2EIJE

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eijE00
2ZXWE 3WG7E 1OCCE 3AG3E 2Y69E 2EILE 2EIKE 3AG4E 5IY5E 2OCCE 3ABKE 2EIME 3AG1E 3AG2E 1V55E 3X2QE 3ABME 5B1BE 1OCZE 2EIJE 2DYSE 1OCOE 3ABLE 3ASNE 2EINE 2DYRE 3ASOE 1OCRE 1V54E 5B1AE 5B3SE
chains in the Genus database with same CATH superfamily
4FLBA 4A1SA 1TNBA 2MHKA 3SFXA 4GZDA 3UPVA 3G2UA 3FUEA 2VYIA 3PEUB 2VSXE 3JUEA 2VGYA 4GTMA 1IYGA 1FVFA 2X3MA 3D9HA 3JCKC 3CK8A 4G23A 3CHMA 2WQ7A 5EIBE 5M72A 5ENRD 2MYOA 5EX3A 4JA9A 1X81A 5BW8C 3ZW3A 5CERB 1H2VC 3TXMA 4U8YD 3LY8A 2R5SA 2WB2A 4JL0A 1MHQA 2IEJA 3ULEG 5ANLA 5KNGA 4WNEA 3PUJA 5T4YA 1UJJA 4YDYA 3Q5MA 4J7WA 1QYMA 5EIDA 3LJ3A 2CG3A 4PDXA 3BUAA 5LFAA 4DX2A 2DVWA 2J9QA 4HBDA 2ETAA 1TNOA 4O1PA 4JA7A 1HXIA 2GRPB 2EIKE 1NA3A 2GRLA 3HDXA 3CVNA 2XPIA 3HXCA 3SFYA 2PQRA 2J07A 1UJKA 4HVBA 4WWOA 1KLXA 1TJCA 3LJNA 3FTSA 1S63A 4OYSA 2KZTA 3AS5A 1FCHA 3QAQA 1OWLA 2NC9A 5BXUA 1DCQA 3PZ1A 4A3VA 3MV2B 3S2AA 4ABNA 1K8KG 4GMRA 2EIJE 3Q7FA 2UY1B 3SD5A 5AJLA 4I6EA 1DVPA 2F0YA 3UKUG 1OWPA 3SY2A 1Z3YA 5FT9A 3ZKJA 2AWIA 4JD2G 1JCRA 3FWVA 4JEUA 2UY1A 1H2UA 2IO2C 4NQ0A 1QZ2A 1E8ZA 1HX8A 1QQEA 4BY6A 4C0MA 3JQ0A 2IQCA 1Z3XA 3VLDA 2EILE 2L0TB 3DRAA 4GA0A 4HOQA 2P9SG 1TNUA 3MKRA 4QFVA 4BX9A 5ANRA 4EPZA 4RSYA 5JHBA 3S7JA 3JYSA 3PZDA 4RG6A 4HXIA 4Y6CA 2CHWA 4GYYA 1O1RA 4EQFA 3R9AB 1IKND 3UIOC 3FP3A 2GRQB 3PDNA 3L82A 2AXVA 3UUXA 4J0UA 3NOGD 5FTPA 2R03A 4J8YA 1TEZA 1BD8A 1ELRA 2RFAA 1S0PA 3D3MA 3UIPC 3D9OA 4TUUA 1DNPA 3TJPA 3ZHEB 2GW1A 4U8VD 4WWPA 5AJDA 3B7SA 2P9KG 2VGXB 5ITZF 4TXQA 1N4SA 3IHVA 1MX6A 3QWWA 2XZTG 4DPRA 1H2TC 3PZ4A 5ENNA 2XHEA 4BWRA 1GW6A 3T5VA 1H6PA 3D9LA 3PZ2A 3TG4A 2NXPA 5CRVA 1XNFA 4GZCA 4DX6D 3V31A 2L6BA 2P9UG 2BTDA 4J8EA 3DPDA 5D66A 2LO6A 4J6IA 2I1JA 4XIFA 1WDYA 2DZOA 3NZSA 3HVEB 4AP2A 3Q9NC 3APDA 4B93B 4NURA 1TN6A 2BKKB 4KZ0A 4F6RD 1K3ZD 5KJKA 3L13A 3MKQB 4RLYA 5B3SE 2XEVA 2HO1A 4GZ3A 3DEPA 4BEPA 5LCWJ 2J09A 1E8WA 1HU3A 3GW4A 3HVEA 3UT7A 2IOLA 4RG9A 4UQXA 4ANUA 3L16A 3ZFWA 2YINA 3HXBA 2OEWA 1BU9A 1U2VG 5BT1A 3Q7AA 3CVLA 4UWHA 1EYHA 3CVVA 3IKOB 3OXLA 4U95D 3O48A 2F8YA 3FU0A 4U04A 1BLXB 1KZPA 4CZ2D 2RG8A 3BU8A 3QK0A 4FJYA 2PQNA 3LY7A 2ZGDA 2XQ0A 4GA2A 3LEWA 2WXHA 3IHYA 5DBKA 3TWUA 3JXJA 4ANWA 4YDWA 1VDYA 4U0SA 3SF4A 3U64A 3O4ZA 4NACA 3R9MA 4BSXA 3IV0A 4TUMA 3HIZA 1BI8B 4TXRA 5KJMA 3TL5A 4OVVA 1X5BA 5BV0A 2R2LA 3V30A 5E76A 2DYRE 4B89A 1SZAA 2QY7A 2HYZA 1Q2ZA 3MEKA 4CT4A 5KWDA 4FHJA 3FEXA 2AVPA 3CQGB 2OVFA 4K5BA 4GCNA 3QJZA 3MGBA 3X2QE 3ABME 5AYWD 4DX5D 4GTRA 4AXHA 2E0IA 3JQ1A 2XGOA 3HXFA 5FINA 1H6KA 4GTSA 4HB5A 1QNFA 4ACLA 4XEIG 4LCTA 4BFRA 2XRYA 4AVXA 2WXMA 4JZYA 5FZSA 4G8LA 4XI0A 1MX2A 4OVUA 3UM1A 5CBNA 3FTXA 2ILRA 3FUDA 3Q79A 2GRMA 4JW1A 3TWSA 1MQSA 2P9LG 5B1BE 2XGSA 4APFA 2NSZA 2YQ8A 2WPVA 2V4HC 2AXZA 3B95A 1N0QA 2LAHA 2Y69E 2B0OE 3QKYA 3CVQA 5KBAA 4ATZD 3CKCA 4NRHB 4ILHB 3KD7A 3FUJA 3PNTB 4O60A 3W9FA 4HOTA 4WWNA 1H6OA 3QDNA 1SA5A 4XZ4A 5EILA 4IYPA 4FADA 1S70B 5HQ8A 1MYOA 4GAAA 1N9AA 5EYLA 5CECB 3TWRA 3OAWA 3Q47B 4PUCA 4XX5A 5CHEE 4I17A 4E6HA 3BG1B 4DLQA 4FA6A 3ONLA 1ELKA 4A1GA 3EDTB 1E90A 3UT4A 1AP7A 4Q94A 2WXNA 2WQ6A 4BETA 3Q49B 4Q96A 4MLPA 5KJLA 2I6HA 3CSFA 3SFZA 3CHSA 3RKVA 4M3OA 3PRZA 4MBGA 3UI2A 4DUIA 2CHZA 3E32A 2GRNB 4ZFHA 3CQCB 2BEDA 4B94A 4ATGA 4JPSA 1N4PA 4O6FA 4I2WA 1SZ9A 3TWVA 3N71A 1HFAA 1SW6A 4DX1A 4ANVA 3UM3A 3S7DA 2WXQA 5CCLA 2F37A 5FZRA 4UQYA 2WXIA 4RVBA 3L9TA 4GZ5A 1TJFA 5CCMA 3HXDA 3UKRG 5FWQA 4JXTA 4HOSA 4ME2A 3ZYKA 3ZIMA 3R7RA 4N3BA 3RO3A 1ELWA 4TV3A 3FUMA 3QOUA 1SQMA 3EUVA 4BERA 3UT8A 3L17A 4KMOA 1OWOA 2JEKA 4N2SA 1OCCE 1QBQA 4EBAA 3GZ1A 4AJWA 3CVYA 2H6GA 2VSNA 3LVRE 5G04C 4AY6A 3PVLA 3FUFA 2JABA 5A6CA 3P1UA 4I43A 3CKBA 2MOWA 3LXUX 4FU3A 4UI9J 5H7PA 1W3BA 3FU5A 5HRYA 4CGVA 4Q69A 5IY5E 4A55A 4YVOA 5E75A 1EF1C 4CYMD 4FP7A 4GYWA 4DI4A 4J8FA 2OVBA 3RRMB 4CDNA 3DSXA 4AEZC 1JCSA 3DSSA 3GZ2A 4P29A 3EHMA 5EX0A 2NYJA 1KPSB 1Y6IA 2KZTB 2UWJG 1EDUA 2E2EA 3FY4A 4I1OB 3SI5A 2RD0A 1OCOE 1HF8A 4L7TA 3T5XA 3MX3A 3ML9A 4GU5A 5ENQD 3BG0B 2LXLA 2WXJA 1V55E 2P58C 3CLJA 4F7AA 4KVOA 1SA4A 2FO7A 3GZSA 2XS1A 3EJNA 3T9KA 1Z5SC 3ESKA 3FTZA 3ISMC 3RAUA 3AJIA 4MKTA 5AIJA 2L9BA 1NFIE 3MV3B 3Q15A 1YMPA 2V0PA 3V2XA 5AARA 2ETCA 1U3CA 5G05J 3ZGQA 2JLBA 1TNYA 1HG5A 4N5QA 1RW2A 3MZLB 4L2LA 2DCPA 2AXUA 2XZDG 1UW4B 2XPYA 1ZB1A 4EZJA 3FUKA 2A4ZA 4PH4B 3SBSA 1K1BA 4BT8A 2Y1LE 5FJYA 4MRUA 4UWKA 1NA0A 3L22A 4YDOA 4IN3B 3KEAA 2WQHA 4CDRA 3NZUA 3C98A 4CCAA 3ZNGA 4EZLA 3ZN3A 3L08A 5HI7A 2KBXA 4M7CA 2PL2A 4GA1A 3TWTA 4C0EA 3AG3E 4H7YA 4JHKA 4EZKA 3B13A 2C0LA 4ZHBA 4XI9A 3PREA 3I3NA 3U4TA 3KS2A 4MS6A 2KCLA 4U8HA 4CT0A 1KT0A 4I6GA 4AM9A 3MA5A 2VSYA 3FH8A 3WG7E 2C0MA 4IULA 1N4QA 3OXGA 3F6QA 1DCEA 4FULA 4JC8A 1Y8MA 3FTYA 1PAQA 5A7DB 2IO3C 3T8MA 3LVQE 2DYSE 3ZVVA 1D9SA 1V54E 3QB2A 2P9PG 2IFUA 2FO1E 2CFUA 1WM5A 2WXRA 2IJGX 3TWXA 3G2WA 1IQUA 1N52A 1MJ0A 2KATA 2AW6A 3DXKG 2IU1A 1JWGA 4BSZB 1E8XA 2QZAA 5T8IA 2A5EA 3EHNA 3KEZA 2WXKA 5JJ6A 3JXIA 2ZISA 3Q9UC 2BF0X 3SNXA 1ZU2A 3FEYA 5J08A 1JCQA 3IXEA 2XENA 3CV0A 2CFZA 4YDEA 3HHMA 3U9WA 4I6JA 2V4LA 3I4RB 3DXMG 4GPKA 3PZ3A 4KXKB 2VTBA 4G2VA 4I9EA 1H0AA 4LUNU 2H6FA 3LY9A 3K9IA 4K03A 4I9CA 1IHGA 3AU4A 4URKA 5LCWC 2WMOA 3TWWA 4YNDA 1E7VA 4G26A 3ZXSA 4W9RA 2WXGA 1OUVA 4HQDA 3FUHA 4R7LA 1H19A 1LF8A 3CGHA 3U66A 3FTVA 2VJ8A 2I9CA 2ZXWE 2FEZA 2Y4TA 2YHCA 4GTPA 2ZGGA 4X8QA 5ARFA 5HS0A 1HZ4A 4XKCA 2EQXA 3CSTA 3SHFA 2DWZA 1UN9A 1JWFA 3TGOA 1ZBPA 2Q7FA 3FU3A 3C3RA 1YCSB 1UG3A 4J8SA 4G11A 4GZ6A 5AQ7A 1LTXA 2X6HA 1BI7B 3UMVA 4DX7D 4U07A 2YNQA 2YHEA 5KCMA 2XS8A 1HO8A 3FTWA 1OWMA 4F3VA 4JEHA 2XGMA 3NAWA 5ENOD 2V5FA 2R17C 1LD8A 4LG6A 5BNWA 3FULA 3R7QA 3CHOA 3B7BA 5BUZA 4FJZA 5JJ7A 1N4RA 3UM0A 5A23A 3UTMA 2QYUA 3ASOE 2LNIA 3DSWA 5CBOA 5DIZA 4DRXE 5KNHD 3ZYQA 4B8CB 3LKUA 4KVMA 5LP0A 2FULA 2B6CA 3C3QA 4G1TA 4EECA 3FH5A 4KT6B 4F1PA 1NL4A 2H6IA 3TG5A 5FQ7A 2FBNA 2LSUA 4XKBA 4CRWA 3FU6A 3E30A 4N39A 3DBSA 1PY1A 1WAO1 2ZIRA 4GTTA 4LEUA 2X6KA 5FZQA 2LSVA 3B7RL 3URZA 4HS2A 4UWFA 1JPLA 5JJTA 1N54A 5FQ6A 1INZA 3ZYMA 3CHQA 2R59A 3QARA 4GCOA 3EHRA 5AQAA 5HKPA 3ZYLA 4LRZA 5BPPA 2Y3AA 4I1MA 1OT8A 3SQVA 4LSZE 1S64A 5FQ4A 2J4DA 3E4BA 1NZNA 4HRMB 3NB2A 3RO2A 1N11A 3AG1E 2VQ2A 4EHMA 1D8EA 3SBTB 2CG2A 4UWLA 4WAFA 4Z68A 2KCKA 4RQIA 1N94A 2FF4A 3FUIA 1O1TA 1TYQG 2XCCA 2XRZA 4L23A 2DZNA 5AN8A 5EKQD 2GROB 1AWCB 2HR2A 1IHBA 3BQOA 5JHAA 4BX8A 3U3WA 2KXPC 3T8KA 3ENEA 3VTYA 4G25A 3ZU7B 3ESLA 2GGFA 2XCBA 4N2QA 2ETBA 2M63A 3OTNA 2QFCA 4I2ZA 3DSTA 4N5CA 1HE8A 1A17A 1SVXA 4KYOB 4DI3A 4HI8A 4C9BB 1KZOA 4NIKA 2FI7A 2OCCE 4UUCA 3AG2E 3ONKA 3CK7A 4HRLA 2VSOE 4DJAA 2PM6A 4UI9C 1XGWA 2I2OA 4AOFA 3S7BA 3I4GA 4LNGA 1O5MA 4XE0A 1YYHA 1Z6TA 4H7XA 3PS6A 4WNGA 2V5QC 4U96D 4DK5A 3ZUVB 2VGEA 4C48B 3VLEA 5J90A 1N0RA 2XEHA 3FTUA 1TN7A 3CR3A 3MJWA 4ILGA 5ARGA 4GTOA 3E34A 5ENPD 3CVUA 3FHEA 5KJNA 1IQRA 1LD7A 3FH7A 3HRAA 4ACKA 5JMND 1IXVA 3Q4AB 3B7TA 4FHKA 3DWLG 2F8XK 1FPPA 4UI9K 3C3OA 2BKGA 2WMNA 4WNFA 1NI1A 3LCAA 3PEVB 4GPMA 4APOA 4J8DA 3APFA 2J08A 2QC9A 2OEVA 2PNNA 4FC8A 2R05A 4GTQA 3PH0C 5FIOA 3FDHA 2WM9A 4GMLA 1P5QA 3RK6A 2EIME 3E37A 3HXEA 4HRNA 3ASHA 1MZCA 3L6AA 4G24A 3LYAA 1G3NB 5G05C 3WXXA 1YA0A 3DSVA 3ML8A 1HH8A 3AS4A 1HS6A 3G2VA 3BEEA 3V79K 1TNZA 3SGHA 3HYMB 5AENA 5CEDB 1OY3D 2A5UA 4HLLA 3GYZA 2WXFA 5AQBA 5CEAA 2C2LA 2WXOA 2R02A 3VTXA 4HLEA 3V2OA 3P2BA 3CEQA 4AY5A 3EU5A 2AJAA 3I5PA 2X6FA 4K5AB 1L5JA 3ZRHA 5LOZA 4LNBA 3ZHEA 3MYVA 4B8AA 2IOSA 3DSUA 2VGXA 3SO8A 2H6HA 4HNAD 1K1AA 4V3IA 4N3AA 4HFGA 3UXGA 3CK9A 2XPZA 5CMYA 3RSEG 3CHPA 4JHRA 4QQIA 2ZU6B 4FLHA 4L9PA 4PS8A 2P9IG 4B0ZA 2LXMA 5AQ9A 2Y0BG 5D0OD 4GB9A 2VTBB 3ASNE 5C1DA 1JUQA 4CDMA 4JB8P 4CEMA 3AS8A 5C2YA 1D8DA 3FUNA 4Y6WA 2HE0A 3ASDA 3TWQA 1A5EA 3MKQA 1PC2A 3NOCD 4AV7A 2ONDA 3ULYA 4OAUC 5JA4D 2OOEA 2V8SE 5ENTD 1UN8A 4YVQC 3CHRA 1MX4A 3IBEA 3QC1A 3FFLA 4L2YA 3UX4A 2CHXA 2RKKA 3DEOA 1WY6A 2BUGA 4JVSA 2P2CP 3E33A 1OWNA 3RJVA 3G2TA 4N3CA 3PE4A 4GMJA 1EPUA 1O1SA 3RRNB 1FVHA 3RIBA 2IONA 4TRQA 3APCA 4I1AA 3C5RA 5T3RA 4D10C 4F1SA 3VLFA 2RFMA 2LAIA 3ULQA 4LERA 1UOHA 4EBAG 5FQ8A 5LX8A 4OAVB 4K0RA 2KM4A 1U3DA 3B7UX 3AU5A 2IY0C 1TN8A 3PUKA 3D9IA 5EN5D 3PNLB 1OCZE 3ASFA 4PS3A 2L0IA 3AAAC 2Y4UA 3OXFA 3HG0D 2J49A 3L54A 3J5QB 3D9KA 2X6IA 4GYOA 3Q75A 4HOUA 4U7EB 1B89A 2XEEA 4E85A 3LS8A 3JUIA 4G8KA 5G55A 1OXJA 3CIAA 3KSQA 2DIWA 1BPOA 4L1BA 3KSLA 1E7UA 4IRUA 3D9JA 3MCXA 4HORA 3Q73A 1HG2A 3RRUA 2MRIA 1E8YA 4GTVA 2J4BA 3W9GA 2LUHA 5AAOA 3Q78A 3TAXA 4U0ZA 3ABLE 3CVWA 2HM8A 3TXNA 2KCVA 3CVXA 3NQPA 3RU0A 4BESA 5D2MC 3ASGA 3EHQA 1NP7A 5EYPF 3S7FA 3AG4E 3LPZA 3UINC 3SZ7A 3QNKA 2KC7A 3CVPA 3QWPA 1E96B 2WXPA 3ZXPA 3NBNB 4BT9A 3EIQC 2OV8A 2EINE 4LNUD 1FT1A 4BTBA 4TXPA 2WVIA 1WG0A 3D9MA 2J8SD 2I1KA 2WXLA 4A63B 2P9NG 3G2SA 4K5CA 4BTAA 3QWVA 4JHJA 1DC2A 3UQ3A 3EIJA 5ENSD 3D9NA 3PE3A 4O1OA 4WNDA 3IEGA 1RZ4A 1N95A 1KT1A 4UQZA 2QYJA 3DPYA 4KZCA 5D0QD 2GRRB 2IF4A 2PM7A 5CRUA 2X38A 3KAEA 3ZPJA 1TR4A 4PS7A 4CGWA 3UM2A 4UWGA 3C72A 4ILIA 1FT2A 4ANXA 3LDZA 3D9PA 2X6JA 2PZIA 3NF1A 5EDSA 5CMWA 4F53A 4KBQA 3ABKE 4U0UA 2L6JA 3ZEFA 2DBAA 5BV1A 4DLOA 4AIFA 5BXOA 5G2NA 4WUYA 5G04J 3EU9A 4U63A 1OCRE 5B1AE 4A3TA 4HI9A 3J5PA
chains in the Genus database with same CATH topology
2ZXWE 3WG7E 1OCCE 3AG3E 2Y69E 2EILE 2EIKE 3AG4E 5IY5E 2OCCE 3ABKE 2EIME 3AG1E 3AG2E 1V55E 3X2QE 3ABME 5B1BE 1OCZE 2EIJE 2DYSE 1OCOE 3ABLE 3ASNE 2EINE 2DYRE 3ASOE 1OCRE 1V54E 5B1AE 5B3SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXW E;  3WG7 E;  1OCC E;  3AG3 E;  2Y69 E;  2EIL E;  2EIK E;  3AG4 E;  5IY5 E;  2OCC E;  3ABK E;  2EIM E;  3AG1 E;  3AG2 E;  1V55 E;  3X2Q E;  3ABM E;  5B1B E;  1OCZ E;  2EIJ E;  2DYS E;  1OCO E;  3ABL E;  3ASN E;  2EIN E;  2DYR E;  3ASO E;  1OCR E;  1V54 E;  5B1A E;  5B3S E; 
#chains in the Genus database with same CATH topology
 4FLB A;  4A1S A;  1TNB A;  2MHK A;  3SFX A;  4GZD A;  3UPV A;  3G2U A;  3FUE A;  2VYI A;  3PEU B;  2VSX E;  3JUE A;  2VGY A;  4GTM A;  1IYG A;  1FVF A;  2X3M A;  3D9H A;  3JCK C;  3CK8 A;  4G23 A;  3CHM A;  2WQ7 A;  5EIB E;  5M72 A;  5ENR D;  2MYO A;  5EX3 A;  4JA9 A;  1X81 A;  5BW8 C;  3ZW3 A;  5CER B;  1H2V C;  3TXM A;  4U8Y D;  3LY8 A;  2R5S A;  2WB2 A;  4JL0 A;  1MHQ A;  2IEJ A;  3ULE G;  5ANL A;  5KNG A;  4WNE A;  3PUJ A;  5T4Y A;  1UJJ A;  4YDY A;  3Q5M A;  4J7W A;  1QYM A;  5EID A;  3LJ3 A;  2CG3 A;  4PDX A;  3BUA A;  5LFA A;  4DX2 A;  2DVW A;  2J9Q A;  4HBD A;  2ETA A;  1TNO A;  4O1P A;  4JA7 A;  1HXI A;  2GRP B;  2EIK E;  1NA3 A;  2GRL A;  3HDX A;  3CVN A;  2XPI A;  3HXC A;  3SFY A;  2PQR A;  2J07 A;  1UJK A;  4HVB A;  4WWO A;  1KLX A;  1TJC A;  3LJN A;  3FTS A;  1S63 A;  4OYS A;  2KZT A;  3AS5 A;  1FCH A;  3QAQ A;  1OWL A;  2NC9 A;  5BXU A;  1DCQ A;  3PZ1 A;  4A3V A;  3MV2 B;  3S2A A;  4ABN A;  1K8K G;  4GMR A;  2EIJ E;  3Q7F A;  2UY1 B;  3SD5 A;  5AJL A;  4I6E A;  1DVP A;  2F0Y A;  3UKU G;  1OWP A;  3SY2 A;  1Z3Y A;  5FT9 A;  3ZKJ A;  2AWI A;  4JD2 G;  1JCR A;  3FWV A;  4JEU A;  2UY1 A;  1H2U A;  2IO2 C;  4NQ0 A;  1QZ2 A;  1E8Z A;  1HX8 A;  1QQE A;  4BY6 A;  4C0M A;  3JQ0 A;  2IQC A;  1Z3X A;  3VLD A;  2EIL E;  2L0T B;  3DRA A;  4GA0 A;  4HOQ A;  2P9S G;  1TNU A;  3MKR A;  4QFV A;  4BX9 A;  5ANR A;  4EPZ A;  4RSY A;  5JHB A;  3S7J A;  3JYS A;  3PZD A;  4RG6 A;  4HXI A;  4Y6C A;  2CHW A;  4GYY A;  1O1R A;  4EQF A;  3R9A B;  1IKN D;  3UIO C;  3FP3 A;  2GRQ B;  3PDN A;  3L82 A;  2AXV A;  3UUX A;  4J0U A;  3NOG D;  5FTP A;  2R03 A;  4J8Y A;  1TEZ A;  1BD8 A;  1ELR A;  2RFA A;  1S0P A;  3D3M A;  3UIP C;  3D9O A;  4TUU A;  1DNP A;  3TJP A;  3ZHE B;  2GW1 A;  4U8V D;  4WWP A;  5AJD A;  3B7S A;  2P9K G;  2VGX B;  5ITZ F;  4TXQ A;  1N4S A;  3IHV A;  1MX6 A;  3QWW A;  2XZT G;  4DPR A;  1H2T C;  3PZ4 A;  5ENN A;  2XHE A;  4BWR A;  1GW6 A;  3T5V A;  1H6P A;  3D9L A;  3PZ2 A;  3TG4 A;  2NXP A;  5CRV A;  1XNF A;  4GZC A;  4DX6 D;  3V31 A;  2L6B A;  2P9U G;  2BTD A;  4J8E A;  3DPD A;  5D66 A;  2LO6 A;  4J6I A;  2I1J A;  4XIF A;  1WDY A;  2DZO A;  3NZS A;  3HVE B;  4AP2 A;  3Q9N C;  3APD A;  4B93 B;  4NUR A;  1TN6 A;  2BKK B;  4KZ0 A;  4F6R D;  1K3Z D;  5KJK A;  3L13 A;  3MKQ B;  4RLY A;  5B3S E;  2XEV A;  2HO1 A;  4GZ3 A;  3DEP A;  4BEP A;  5LCW J;  2J09 A;  1E8W A;  1HU3 A;  3GW4 A;  3HVE A;  3UT7 A;  2IOL A;  4RG9 A;  4UQX A;  4ANU A;  3L16 A;  3ZFW A;  2YIN A;  3HXB A;  2OEW A;  1BU9 A;  1U2V G;  5BT1 A;  3Q7A A;  3CVL A;  4UWH A;  1EYH A;  3CVV A;  3IKO B;  3OXL A;  4U95 D;  3O48 A;  2F8Y A;  3FU0 A;  4U04 A;  1BLX B;  1KZP A;  4CZ2 D;  2RG8 A;  3BU8 A;  3QK0 A;  4FJY A;  2PQN A;  3LY7 A;  2ZGD A;  2XQ0 A;  4GA2 A;  3LEW A;  2WXH A;  3IHY A;  5DBK A;  3TWU A;  3JXJ A;  4ANW A;  4YDW A;  1VDY A;  4U0S A;  3SF4 A;  3U64 A;  3O4Z A;  4NAC A;  3R9M A;  4BSX A;  3IV0 A;  4TUM A;  3HIZ A;  1BI8 B;  4TXR A;  5KJM A;  3TL5 A;  4OVV A;  1X5B A;  5BV0 A;  2R2L A;  3V30 A;  5E76 A;  2DYR E;  4B89 A;  1SZA A;  2QY7 A;  2HYZ A;  1Q2Z A;  3MEK A;  4CT4 A;  5KWD A;  4FHJ A;  3FEX A;  2AVP A;  3CQG B;  2OVF A;  4K5B A;  4GCN A;  3QJZ A;  3MGB A;  3X2Q E;  3ABM E;  5AYW D;  4DX5 D;  4GTR A;  4AXH A;  2E0I A;  3JQ1 A;  2XGO A;  3HXF A;  5FIN A;  1H6K A;  4GTS A;  4HB5 A;  1QNF A;  4ACL A;  4XEI G;  4LCT A;  4BFR A;  2XRY A;  4AVX A;  2WXM A;  4JZY A;  5FZS A;  4G8L A;  4XI0 A;  1MX2 A;  4OVU A;  3UM1 A;  5CBN A;  3FTX A;  2ILR A;  3FUD A;  3Q79 A;  2GRM A;  4JW1 A;  3TWS A;  1MQS A;  2P9L G;  5B1B E;  2XGS A;  4APF A;  2NSZ A;  2YQ8 A;  2WPV A;  2V4H C;  2AXZ A;  3B95 A;  1N0Q A;  2LAH A;  2Y69 E;  2B0O E;  3QKY A;  3CVQ A;  5KBA A;  4ATZ D;  3CKC A;  4NRH B;  4ILH B;  3KD7 A;  3FUJ A;  3PNT B;  4O60 A;  3W9F A;  4HOT A;  4WWN A;  1H6O A;  3QDN A;  1SA5 A;  4XZ4 A;  5EIL A;  4IYP A;  4FAD A;  1S70 B;  5HQ8 A;  1MYO A;  4GAA A;  1N9A A;  5EYL A;  5CEC B;  3TWR A;  3OAW A;  3Q47 B;  4PUC A;  4XX5 A;  5CHE E;  4I17 A;  4E6H A;  3BG1 B;  4DLQ A;  4FA6 A;  3ONL A;  1ELK A;  4A1G A;  3EDT B;  1E90 A;  3UT4 A;  1AP7 A;  4Q94 A;  2WXN A;  2WQ6 A;  4BET A;  3Q49 B;  4Q96 A;  4MLP A;  5KJL A;  2I6H A;  3CSF A;  3SFZ A;  3CHS A;  3RKV A;  4M3O A;  3PRZ A;  4MBG A;  3UI2 A;  4DUI A;  2CHZ A;  3E32 A;  2GRN B;  4ZFH A;  3CQC B;  2BED A;  4B94 A;  4ATG A;  4JPS A;  1N4P A;  4O6F A;  4I2W A;  1SZ9 A;  3TWV A;  3N71 A;  1HFA A;  1SW6 A;  4DX1 A;  4ANV A;  3UM3 A;  3S7D A;  2WXQ A;  5CCL A;  2F37 A;  5FZR A;  4UQY A;  2WXI A;  4RVB A;  3L9T A;  4GZ5 A;  1TJF A;  5CCM A;  3HXD A;  3UKR G;  5FWQ A;  4JXT A;  4HOS A;  4ME2 A;  3ZYK A;  3ZIM A;  3R7R A;  4N3B A;  3RO3 A;  1ELW A;  4TV3 A;  3FUM A;  3QOU A;  1SQM A;  3EUV A;  4BER A;  3UT8 A;  3L17 A;  4KMO A;  1OWO A;  2JEK A;  4N2S A;  1OCC E;  1QBQ A;  4EBA A;  3GZ1 A;  4AJW A;  3CVY A;  2H6G A;  2VSN A;  3LVR E;  5G04 C;  4AY6 A;  3PVL A;  3FUF A;  2JAB A;  5A6C A;  3P1U A;  4I43 A;  3CKB A;  2MOW A;  3LXU X;  4FU3 A;  4UI9 J;  5H7P A;  1W3B A;  3FU5 A;  5HRY A;  4CGV A;  4Q69 A;  5IY5 E;  4A55 A;  4YVO A;  5E75 A;  1EF1 C;  4CYM D;  4FP7 A;  4GYW A;  4DI4 A;  4J8F A;  2OVB A;  3RRM B;  4CDN A;  3DSX A;  4AEZ C;  1JCS A;  3DSS A;  3GZ2 A;  4P29 A;  3EHM A;  5EX0 A;  2NYJ A;  1KPS B;  1Y6I A;  2KZT B;  2UWJ G;  1EDU A;  2E2E A;  3FY4 A;  4I1O B;  3SI5 A;  2RD0 A;  1OCO E;  1HF8 A;  4L7T A;  3T5X A;  3MX3 A;  3ML9 A;  4GU5 A;  5ENQ D;  3BG0 B;  2LXL A;  2WXJ A;  1V55 E;  2P58 C;  3CLJ A;  4F7A A;  4KVO A;  1SA4 A;  2FO7 A;  3GZS A;  2XS1 A;  3EJN A;  3T9K A;  1Z5S C;  3ESK A;  3FTZ A;  3ISM C;  3RAU A;  3AJI A;  4MKT A;  5AIJ A;  2L9B A;  1NFI E;  3MV3 B;  3Q15 A;  1YMP A;  2V0P A;  3V2X A;  5AAR A;  2ETC A;  1U3C A;  5G05 J;  3ZGQ A;  2JLB A;  1TNY A;  1HG5 A;  4N5Q A;  1RW2 A;  3MZL B;  4L2L A;  2DCP A;  2AXU A;  2XZD G;  1UW4 B;  2XPY A;  1ZB1 A;  4EZJ A;  3FUK A;  2A4Z A;  4PH4 B;  3SBS A;  1K1B A;  4BT8 A;  2Y1L E;  5FJY A;  4MRU A;  4UWK A;  1NA0 A;  3L22 A;  4YDO A;  4IN3 B;  3KEA A;  2WQH A;  4CDR A;  3NZU A;  3C98 A;  4CCA A;  3ZNG A;  4EZL A;  3ZN3 A;  3L08 A;  5HI7 A;  2KBX A;  4M7C A;  2PL2 A;  4GA1 A;  3TWT A;  4C0E A;  3AG3 E;  4H7Y A;  4JHK A;  4EZK A;  3B13 A;  2C0L A;  4ZHB A;  4XI9 A;  3PRE A;  3I3N A;  3U4T A;  3KS2 A;  4MS6 A;  2KCL A;  4U8H A;  4CT0 A;  1KT0 A;  4I6G A;  4AM9 A;  3MA5 A;  2VSY A;  3FH8 A;  3WG7 E;  2C0M A;  4IUL A;  1N4Q A;  3OXG A;  3F6Q A;  1DCE A;  4FUL A;  4JC8 A;  1Y8M A;  3FTY A;  1PAQ A;  5A7D B;  2IO3 C;  3T8M A;  3LVQ E;  2DYS E;  3ZVV A;  1D9S A;  1V54 E;  3QB2 A;  2P9P G;  2IFU A;  2FO1 E;  2CFU A;  1WM5 A;  2WXR A;  2IJG X;  3TWX A;  3G2W A;  1IQU A;  1N52 A;  1MJ0 A;  2KAT A;  2AW6 A;  3DXK G;  2IU1 A;  1JWG A;  4BSZ B;  1E8X A;  2QZA A;  5T8I A;  2A5E A;  3EHN A;  3KEZ A;  2WXK A;  5JJ6 A;  3JXI A;  2ZIS A;  3Q9U C;  2BF0 X;  3SNX A;  1ZU2 A;  3FEY A;  5J08 A;  1JCQ A;  3IXE A;  2XEN A;  3CV0 A;  2CFZ A;  4YDE A;  3HHM A;  3U9W A;  4I6J A;  2V4L A;  3I4R B;  3DXM G;  4GPK A;  3PZ3 A;  4KXK B;  2VTB A;  4G2V A;  4I9E A;  1H0A A;  4LUN U;  2H6F A;  3LY9 A;  3K9I A;  4K03 A;  4I9C A;  1IHG A;  3AU4 A;  4URK A;  5LCW C;  2WMO A;  3TWW A;  4YND A;  1E7V A;  4G26 A;  3ZXS A;  4W9R A;  2WXG A;  1OUV A;  4HQD A;  3FUH A;  4R7L A;  1H19 A;  1LF8 A;  3CGH A;  3U66 A;  3FTV A;  2VJ8 A;  2I9C A;  2ZXW E;  2FEZ A;  2Y4T A;  2YHC A;  4GTP A;  2ZGG A;  4X8Q A;  5ARF A;  5HS0 A;  1HZ4 A;  4XKC A;  2EQX A;  3CST A;  3SHF A;  2DWZ A;  1UN9 A;  1JWF A;  3TGO A;  1ZBP A;  2Q7F A;  3FU3 A;  3C3R A;  1YCS B;  1UG3 A;  4J8S A;  4G11 A;  4GZ6 A;  5AQ7 A;  1LTX A;  2X6H A;  1BI7 B;  3UMV A;  4DX7 D;  4U07 A;  2YNQ A;  2YHE A;  5KCM A;  2XS8 A;  1HO8 A;  3FTW A;  1OWM A;  4F3V A;  4JEH A;  2XGM A;  3NAW A;  5ENO D;  2V5F A;  2R17 C;  1LD8 A;  4LG6 A;  5BNW A;  3FUL A;  3R7Q A;  3CHO A;  3B7B A;  5BUZ A;  4FJZ A;  5JJ7 A;  1N4R A;  3UM0 A;  5A23 A;  3UTM A;  2QYU A;  3ASO E;  2LNI A;  3DSW A;  5CBO A;  5DIZ A;  4DRX E;  5KNH D;  3ZYQ A;  4B8C B;  3LKU A;  4KVM A;  5LP0 A;  2FUL A;  2B6C A;  3C3Q A;  4G1T A;  4EEC A;  3FH5 A;  4KT6 B;  4F1P A;  1NL4 A;  2H6I A;  3TG5 A;  5FQ7 A;  2FBN A;  2LSU A;  4XKB A;  4CRW A;  3FU6 A;  3E30 A;  4N39 A;  3DBS A;  1PY1 A;  1WAO 1;  2ZIR A;  4GTT A;  4LEU A;  2X6K A;  5FZQ A;  2LSV A;  3B7R L;  3URZ A;  4HS2 A;  4UWF A;  1JPL A;  5JJT A;  1N54 A;  5FQ6 A;  1INZ A;  3ZYM A;  3CHQ A;  2R59 A;  3QAR A;  4GCO A;  3EHR A;  5AQA A;  5HKP A;  3ZYL A;  4LRZ A;  5BPP A;  2Y3A A;  4I1M A;  1OT8 A;  3SQV A;  4LSZ E;  1S64 A;  5FQ4 A;  2J4D A;  3E4B A;  1NZN A;  4HRM B;  3NB2 A;  3RO2 A;  1N11 A;  3AG1 E;  2VQ2 A;  4EHM A;  1D8E A;  3SBT B;  2CG2 A;  4UWL A;  4WAF A;  4Z68 A;  2KCK A;  4RQI A;  1N94 A;  2FF4 A;  3FUI A;  1O1T A;  1TYQ G;  2XCC A;  2XRZ A;  4L23 A;  2DZN A;  5AN8 A;  5EKQ D;  2GRO B;  1AWC B;  2HR2 A;  1IHB A;  3BQO A;  5JHA A;  4BX8 A;  3U3W A;  2KXP C;  3T8K A;  3ENE A;  3VTY A;  4G25 A;  3ZU7 B;  3ESL A;  2GGF A;  2XCB A;  4N2Q A;  2ETB A;  2M63 A;  3OTN A;  2QFC A;  4I2Z A;  3DST A;  4N5C A;  1HE8 A;  1A17 A;  1SVX A;  4KYO B;  4DI3 A;  4HI8 A;  4C9B B;  1KZO A;  4NIK A;  2FI7 A;  2OCC E;  4UUC A;  3AG2 E;  3ONK A;  3CK7 A;  4HRL A;  2VSO E;  4DJA A;  2PM6 A;  4UI9 C;  1XGW A;  2I2O A;  4AOF A;  3S7B A;  3I4G A;  4LNG A;  1O5M A;  4XE0 A;  1YYH A;  1Z6T A;  4H7X A;  3PS6 A;  4WNG A;  2V5Q C;  4U96 D;  4DK5 A;  3ZUV B;  2VGE A;  4C48 B;  3VLE A;  5J90 A;  1N0R A;  2XEH A;  3FTU A;  1TN7 A;  3CR3 A;  3MJW A;  4ILG A;  5ARG A;  4GTO A;  3E34 A;  5ENP D;  3CVU A;  3FHE A;  5KJN A;  1IQR A;  1LD7 A;  3FH7 A;  3HRA A;  4ACK A;  5JMN D;  1IXV A;  3Q4A B;  3B7T A;  4FHK A;  3DWL G;  2F8X K;  1FPP A;  4UI9 K;  3C3O A;  2BKG A;  2WMN A;  4WNF A;  1NI1 A;  3LCA A;  3PEV B;  4GPM A;  4APO A;  4J8D A;  3APF A;  2J08 A;  2QC9 A;  2OEV A;  2PNN A;  4FC8 A;  2R05 A;  4GTQ A;  3PH0 C;  5FIO A;  3FDH A;  2WM9 A;  4GML A;  1P5Q A;  3RK6 A;  2EIM E;  3E37 A;  3HXE A;  4HRN A;  3ASH A;  1MZC A;  3L6A A;  4G24 A;  3LYA A;  1G3N B;  5G05 C;  3WXX A;  1YA0 A;  3DSV A;  3ML8 A;  1HH8 A;  3AS4 A;  1HS6 A;  3G2V A;  3BEE A;  3V79 K;  1TNZ A;  3SGH A;  3HYM B;  5AEN A;  5CED B;  1OY3 D;  2A5U A;  4HLL A;  3GYZ A;  2WXF A;  5AQB A;  5CEA A;  2C2L A;  2WXO A;  2R02 A;  3VTX A;  4HLE A;  3V2O A;  3P2B A;  3CEQ A;  4AY5 A;  3EU5 A;  2AJA A;  3I5P A;  2X6F A;  4K5A B;  1L5J A;  3ZRH A;  5LOZ A;  4LNB A;  3ZHE A;  3MYV A;  4B8A A;  2IOS A;  3DSU A;  2VGX A;  3SO8 A;  2H6H A;  4HNA D;  1K1A A;  4V3I A;  4N3A A;  4HFG A;  3UXG A;  3CK9 A;  2XPZ A;  5CMY A;  3RSE G;  3CHP A;  4JHR A;  4QQI A;  2ZU6 B;  4FLH A;  4L9P A;  4PS8 A;  2P9I G;  4B0Z A;  2LXM A;  5AQ9 A;  2Y0B G;  5D0O D;  4GB9 A;  2VTB B;  3ASN E;  5C1D A;  1JUQ A;  4CDM A;  4JB8 P;  4CEM A;  3AS8 A;  5C2Y A;  1D8D A;  3FUN A;  4Y6W A;  2HE0 A;  3ASD A;  3TWQ A;  1A5E A;  3MKQ A;  1PC2 A;  3NOC D;  4AV7 A;  2OND A;  3ULY A;  4OAU C;  5JA4 D;  2OOE A;  2V8S E;  5ENT D;  1UN8 A;  4YVQ C;  3CHR A;  1MX4 A;  3IBE A;  3QC1 A;  3FFL A;  4L2Y A;  3UX4 A;  2CHX A;  2RKK A;  3DEO A;  1WY6 A;  2BUG A;  4JVS A;  2P2C P;  3E33 A;  1OWN A;  3RJV A;  3G2T A;  4N3C A;  3PE4 A;  4GMJ A;  1EPU A;  1O1S A;  3RRN B;  1FVH A;  3RIB A;  2ION A;  4TRQ A;  3APC A;  4I1A A;  3C5R A;  5T3R A;  4D10 C;  4F1S A;  3VLF A;  2RFM A;  2LAI A;  3ULQ A;  4LER A;  1UOH A;  4EBA G;  5FQ8 A;  5LX8 A;  4OAV B;  4K0R A;  2KM4 A;  1U3D A;  3B7U X;  3AU5 A;  2IY0 C;  1TN8 A;  3PUK A;  3D9I A;  5EN5 D;  3PNL B;  1OCZ E;  3ASF A;  4PS3 A;  2L0I A;  3AAA C;  2Y4U A;  3OXF A;  3HG0 D;  2J49 A;  3L54 A;  3J5Q B;  3D9K A;  2X6I A;  4GYO A;  3Q75 A;  4HOU A;  4U7E B;  1B89 A;  2XEE A;  4E85 A;  3LS8 A;  3JUI A;  4G8K A;  5G55 A;  1OXJ A;  3CIA A;  3KSQ A;  2DIW A;  1BPO A;  4L1B A;  3KSL A;  1E7U A;  4IRU A;  3D9J A;  3MCX A;  4HOR A;  3Q73 A;  1HG2 A;  3RRU A;  2MRI A;  1E8Y A;  4GTV A;  2J4B A;  3W9G A;  2LUH A;  5AAO A;  3Q78 A;  3TAX A;  4U0Z A;  3ABL E;  3CVW A;  2HM8 A;  3TXN A;  2KCV A;  3CVX A;  3NQP A;  3RU0 A;  4BES A;  5D2M C;  3ASG A;  3EHQ A;  1NP7 A;  5EYP F;  3S7F A;  3AG4 E;  3LPZ A;  3UIN C;  3SZ7 A;  3QNK A;  2KC7 A;  3CVP A;  3QWP A;  1E96 B;  2WXP A;  3ZXP A;  3NBN B;  4BT9 A;  3EIQ C;  2OV8 A;  2EIN E;  4LNU D;  1FT1 A;  4BTB A;  4TXP A;  2WVI A;  1WG0 A;  3D9M A;  2J8S D;  2I1K A;  2WXL A;  4A63 B;  2P9N G;  3G2S A;  4K5C A;  4BTA A;  3QWV A;  4JHJ A;  1DC2 A;  3UQ3 A;  3EIJ A;  5ENS D;  3D9N A;  3PE3 A;  4O1O A;  4WND A;  3IEG A;  1RZ4 A;  1N95 A;  1KT1 A;  4UQZ A;  2QYJ A;  3DPY A;  4KZC A;  5D0Q D;  2GRR B;  2IF4 A;  2PM7 A;  5CRU A;  2X38 A;  3KAE A;  3ZPJ A;  1TR4 A;  4PS7 A;  4CGW A;  3UM2 A;  4UWG A;  3C72 A;  4ILI A;  1FT2 A;  4ANX A;  3LDZ A;  3D9P A;  2X6J A;  2PZI A;  3NF1 A;  5EDS A;  5CMW A;  4F53 A;  4KBQ A;  3ABK E;  4U0U A;  2L6J A;  3ZEF A;  2DBA A;  5BV1 A;  4DLO A;  4AIF A;  5BXO A;  5G2N A;  4WUY A;  5G04 J;  3EU9 A;  4U63 A;  1OCR E;  5B1A E;  4A3T A;  4HI9 A;  3J5P A; 
#chains in the Genus database with same CATH homology
 2ZXW E;  3WG7 E;  1OCC E;  3AG3 E;  2Y69 E;  2EIL E;  2EIK E;  3AG4 E;  5IY5 E;  2OCC E;  3ABK E;  2EIM E;  3AG1 E;  3AG2 E;  1V55 E;  3X2Q E;  3ABM E;  5B1B E;  1OCZ E;  2EIJ E;  2DYS E;  1OCO E;  3ABL E;  3ASN E;  2EIN E;  2DYR E;  3ASO E;  1OCR E;  1V54 E;  5B1A E;  5B3S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...