2EIJE

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eijE00
3AG3E 2EINE 1OCCE 1OCRE 3AG4E 3ABKE 2ZXWE 2EILE 3ABME 1V55E 2DYRE 3ASNE 5B1AE 3WG7E 5B3SE 1V54E 2EIJE 3ABLE 3X2QE 2Y69E 3ASOE 2DYSE 2EIME 2OCCE 3AG2E 2EIKE 1OCOE 5B1BE 5IY5E 3AG1E 1OCZE
chains in the Genus database with same CATH superfamily
3C5RA 5DBKA 4BERA 2QFCA 4ANVA 2ZGGA 3PE3A 4ATZD 3LCAA 2IEJA 3DXMG 4AY6A 2P9UG 3MYVA 3TWQA 2WXJA 2J4BA 3V31A 3SQVA 2IY0C 3S7JA 1TN8A 3CHQA 2DZOA 3TWTA 4F6RD 5JA4D 5JHAA 3ZFWA 1V54E 2HYZA 4J6IA 5AN8A 1NA0A 3CVYA 3CK8A 3P1UA 3UIPC 1YMPA 4HLLA 4JW1A 1YYHA 1N54A 4ABNA 3ZXSA 1TN7A 4LEUA 3L9TA 2P9SG 4U95D 3FU6A 5LOZA 1BI8B 4J8FA 4RG9A 4K0RA 4QFVA 4BX8A 1HO8A 3G2UA 5ENPD 1O1RA 4MS6A 1D9SA 1JCRA 4G11A 4YDOA 3ULYA 1SA5A 3NOCD 4YDWA 5G04J 3IHYA 4DLQA 5A6CA 2VGXB 4KT6B 3FEYA 3MV3B 3AG2E 4KBQA 5BW8C 5EKQD 4TRQA 4MRUA 3QWVA 4L7TA 4IYPA 3KSQA 1OCRE 4KVMA 5EIBE 4U0SA 3UM3A 2OCCE 4DX7D 1K1BA 2OOEA 2XEEA 4ACKA 1KT1A 3PH0C 5J08A 4EHMA 2ETBA 4JHKA 4PDXA 3ABKE 3PEVB 2ZXWE 2KBXA 2AXZA 4RLYA 2WXRA 3DBSA 2IOSA 4GA0A 2R59A 3L17A 5AQBA 5ENQD 2P9LG 3D9KA 5AENA 3RRNB 2BTDA 2BEDA 3JUIA 3CHMA 3L08A 3NZUA 4ATGA 5J90A 1TEZA 4UI9J 4I6EA 1H19A 1IHBA 4O1PA 2CHWA 4QQIA 3GZ1A 4G24A 2M63A 1SVXA 1JCSA 3IHVA 4JB8P 3ZUVB 3Q7FA 1O5MA 4XX5A 1U3CA 2WXKA 5HI7A 3QJZA 1HG5A 1TNUA 2KATA 2WPVA 3B7RL 2XPYA 2QYJA 5T3RA 4I9CA 1U3DA 4EZJA 3ZYMA 4A55A 3SNXA 4BSXA 2LAIA 4APOA 4WWOA 3HXEA 3FUNA 1MHQA 4N2SA 4GCNA 1HXIA 3FTXA 2IO2C 4GYYA 1MQSA 4FJZA 2P9KG 4EBAA 2EIKE 4P29A 2XCCA 3F6QA 3AG1E 1WM5A 3UM1A 1OCZE 1E96B 4U0UA 2FBNA 3G2TA 3HRAA 4L23A 5CBNA 4YVOA 2XRZA 3ZYQA 5A23A 1WY6A 4CGWA 2Y1LE 2AVPA 1DVPA 2YINA 1N94A 3QAQA 3SFXA 3CHPA 2L6BA 2BUGA 4IRUA 3MA5A 1B89A 1WG0A 4FU3A 5CRVA 5G05C 4GZCA 4BT8A 4G25A 3QARA 3PUJA 2P58C 3LY7A 3ZNGA 1H6PA 4DK5A 4WUYA 1NA3A 4I2ZA 4DRXE 4I9EA 2X3MA 2QYUA 2XS1A 5A7DB 2R03A 1HG2A 1JPLA 4GTPA 2C2LA 4AP2A 3T8MA 1UOHA 1Z3YA 2X6KA 1EDUA 2CHZA 4PH4B 2GROB 2CG3A 4Q96A 4HI8A 1PC2A 3K9IA 4K5AB 2LNIA 2XGMA 3NAWA 5FQ6A 4GTOA 3ONLA 3CVLA 1OWLA 3PS6A 2H6HA 1LD8A 3G2WA 3W9GA 2CFUA 3D9OA 2R2LA 3DWLG 3JQ1A 3APFA 3FWVA 3IBEA 4ANXA 3R7RA 3ZN3A 3CK9A 4A3TA 5FIOA 3ZPJA 3FTYA 3VLEA 4AXHA 1TNBA 3Q5MA 4K03A 1QQEA 3ABME 1AWCB 5FTPA 5B3SE 3OXFA 3UT7A 3ML9A 3ZRHA 4CT0A 2X6FA 4GMRA 3MCXA 4G26A 2UWJG 5ENTD 3DEOA 2MRIA 2LSUA 4JL0A 5LP0A 4ANUA 3C3RA 4OAUC 2IF4A 2BKKB 3QOUA 2J07A 1FT1A 2YQ8A 3FY4A 5KNHD 3RU0A 5G2NA 3RRUA 3AAAC 1DNPA 3D9MA 3CQCB 5M72A 3CHRA 5CEAA 1LD7A 4ILHB 5CHEE 2JLBA 2AJAA 4NQ0A 2L9BA 4K5BA 3T8KA 2VSNA 2RKKA 3RJVA 2ONDA 1NZNA 4KVOA 1W3BA 1FCHA 4I43A 4B94A 3PREA 3G2VA 1Y6IA 5DIZA 3TG5A 1E7VA 4GMLA 3Q49B 4JHRA 3LYAA 5LCWC 3S7DA 3NB2A 3LDZA 2I9CA 5ENSD 3GYZA 4F1SA 2F0YA 1ELRA 2EQXA 2YHCA 3FH8A 2DVWA 3R7QA 4UI9K 3EU9A 1ZB1A 4UQYA 2C0LA 3TL5A 3Q4AB 4UWHA 3ZEFA 3QKYA 3LJ3A 4G23A 2KM4A 3O4ZA 3CR3A 3ZXPA 2XPZA 5BXUA 2IJGX 3VTXA 4LNUD 1X5BA 2WVIA 4DUIA 5EX3A 3DSXA 4AV7A 4GTQA 2KCLA 2ZISA 2DIWA 2Y4UA 1EF1C 1HFAA 4EBAG 4XZ4A 2PZIA 3AS8A 3BG1B 3Q9UC 4UI9C 4TUMA 4XIFA 1SQMA 2WQ7A 2L0IA 4HRMB 4U8YD 2GRNB 2I1JA 2GRPB 5CEDB 2RFMA 3TG4A 3BU8A 4Q69A 4U63A 4GTRA 4J8DA 3DSVA 3AJIA 2WXGA 3SO8A 2BF0X 4OVVA 4KMOA 4W9RA 3HIZA 3HVEA 1OUVA 3TJPA 4J7WA 4PS7A 1UJKA 1XNFA 2KCVA 2V5FA 4G8LA 2A5UA 3LJNA 3CVWA 4E6HA 4FC8A 1MZCA 2WXPA 3CQGB 3UX4A 3V2XA 3SY2A 5AIJA 4OYSA 1DC2A 1O1TA 2BKGA 2J08A 4ZFHA 3V30A 1HF8A 3EHQA 3LXUX 2X38A 4UQXA 3WXXA 5KNGA 1BU9A 5ANRA 2VGYA 3C3QA 1MX2A 3AG3E 4BT9A 4L1BA 4N3CA 3KEZA 5G05J 3PUKA 5B1AE 1UN9A 1YA0A 2LAHA 2IU1A 4UWFA 3UKRG 3FH7A 3Q79A 5BXOA 2VTBB 1K3ZD 1DCQA 1OCOE 2VSXE 4GZDA 4WWNA 1OY3D 1FPPA 4XEIG 3E4BA 2NSZA 1OXJA 5EN5D 4X8QA 4I6JA 3FU3A 4OAVB 5JJ7A 2EIME 1N4QA 3ULEG 4D10C 1X81A 3CVXA 3FU5A 1H6OA 4L2YA 1E7UA 2HO1A 1E8ZA 1O1SA 2J4DA 4XE0A 1N0RA 4BY6A 4EECA 2WXNA 4HOSA 2Y4TA 4TXRA 1GW6A 3FHEA 3GZSA 2YNQA 1Z6TA 2MOWA 2B0OE 2XENA 3TXNA 1N9AA 4M7CA 2R5SA 3FUIA 4ANWA 3KD7A 4G8KA 3MJWA 2H6IA 2DYSE 1OWOA 1Y8MA 3ZU7B 4APFA 4GMJA 1ELKA 2AWIA 4U96D 3E37A 3CVVA 2LXMA 2VJ8A 3CEQA 4BETA 3ML8A 4A1GA 3ZKJA 1ZU2A 3SHFA 3Q9NC 1HZ4A 3U66A 1QYMA 2ILRA 4HOTA 4NIKA 3FDHA 2XHEA 3FTWA 1K8KG 3IEGA 4O60A 2LSVA 1KPSB 4GTTA 5T4YA 2QC9A 1RW2A 4I1OB 4JHJA 1NP7A 5FZQA 2ETCA 2CG2A 3L6AA 3ZHEB 3FUEA 5EYLA 4RG6A 2L0TB 4CT4A 3IKOB 4MBGA 1MYOA 1H6KA 2VGEA 4U0ZA 2F8XK 1BD8A 3HXFA 3B7UX 2VSOE 5FJYA 4CDMA 5AJDA 3MKRA 1LF8A 3T9KA 2V0PA 4JA7A 3PZDA 3ASNE 4KZ0A 4GYOA 4EZLA 3FUHA 3LY9A 3TWUA 1NFIE 3SF4A 2R17C 5LCWJ 3UT4A 2J9QA 2I1KA 3MZLB 3T5VA 3E34A 3ASDA 3UXGA 3FTUA 3AG4E 2XPIA 2XGOA 5E75A 1ZBPA 3EIQC 4G1TA 5BT1A 4I6GA 3EUVA 3OXGA 3FH5A 3Q73A 5JHBA 2X6JA 3CIAA 5KCMA 4BTAA 5AJLA 3ENEA 3ULQA 1OWPA 3E32A 5CCLA 2FF4A 4BEPA 2NC9A 4NRHB 3V2OA 4JXTA 4FLHA 3RAUA 3UI2A 4NACA 2V8SE 3Q47B 3LY8A 3DSWA 3FUFA 3ZHEA 3APCA 3HDXA 1SW6A 1N11A 1E8XA 3CVQA 3TWRA 2WXHA 3GZ2A 3NZSA 1TR4A 1FVFA 1A17A 4Z68A 4RSYA 3L16A 1HH8A 4KYOB 1TJFA 5ARFA 4CEMA 4DI3A 5D2MC 3UKUG 3FFLA 3MGBA 5EILA 2XQ0A 4HQDA 4AJWA 4H7XA 1E8WA 1FVHA 4O1OA 5ARGA 3CVPA 2Y69E 3U4TA 5FQ8A 3DSTA 4N5QA 3RKVA 3PDNA 5D66A 1BLXB 3FUMA 5LX8A 2XRYA 3DPYA 2IFUA 3I5PA 4KZCA 2QZAA 3U9WA 4ACLA 2PNNA 2A5EA 3SBSA 2Y0BG 2B6CA 1SZ9A 3KS2A 3MKQA 5BV1A 2JEKA 3OAWA 4LERA 1DCEA 4J8SA 5HQ8A 3KAEA 3SGHA 1SZAA 4A3VA 1XGWA 2WM9A 3QNKA 2R05A 3UIOC 3ISMC 4BX9A 3CSTA 3BG0B 4CYMD 2DWZA 4CCAA 3JQ0A 2F37A 3VLDA 5BNWA 4I1MA 2IONA 4U04A 4WNDA 3FUDA 4HBDA 3C72A 3URZA 2P2CP 4GZ5A 4CZ2D 5H7PA 3ZVVA 3S7BA 4HI9A 2X6IA 3FU0A 4L9PA 5FQ7A 3JCKC 3APDA 4HLEA 5FWQA 4FHJA 4FA6A 3I3NA 4LNGA 4JA9A 1OT8A 2F8YA 4HFGA 4I2WA 3QC1A 3RIBA 3AU5A 3ASFA 4KXKB 3DSUA 3JXIA 1PAQA 3ESLA 3ASHA 1P5QA 2FO1E 4DPRA 4DI4A 4ME2A 5D0OD 1S63A 5ENRD 3ZYLA 4U07A 3PZ4A 3C98A 5FZRA 3DSSA 3EHNA 4B0ZA 1JUQA 4GA2A 5AAOA 4HRLA 3LPZA 4A63B 3SI5A 3GW4A 2GRRB 2GRMA 4M3OA 4YDEA 2X6HA 2XGSA 2WQ6A 3CKBA 3NQPA 5D0QD 4AM9A 4LRZA 3ASGA 3ESKA 3ONKA 4CRWA 5FZSA 3FP3A 3FUJA 2OEVA 3CSFA 5CCMA 4N3BA 1N4RA 4DX6D 2MHKA 4N2QA 1QNFA 3ABLE 4I17A 3UTMA 2A4ZA 3CGHA 3FTZA 3BEEA 3B7BA 3G2SA 3NF1A 3CVNA 2ZU6B 3KEAA 3MV2B 4J0UA 4AIFA 3PRZA 3CK7A 4NURA 5CBOA 2J09A 4BWRA 3BUAA 2V4HC 2FULA 2FI7A 3RRMB 2MYOA 2GGFA 2VTBA 3UPVA 3VTYA 2WMNA 1PY1A 2VQ2A 4URKA 5CMYA 4HOQA 3FUKA 3BQOA 1HE8A 1S70B 4MKTA 2I2OA 2ZIRA 2CHXA 3DEPA 2PL2A 5AQAA 3QK0A 2UY1A 3RO2A 3FTSA 3CLJA 3UM0A 1UG3A 1S0PA 5AARA 3RSEG 2WXQA 4F1PA 2LO6A 4LSZE 5HS0A 4CDNA 2DZNA 2LXLA 2E2EA 2XCBA 4Y6CA 2WXLA 4O6FA 3B7TA 1WAO1 1H2TC 3OXLA 3HHMA 2HR2A 4U7EB 3HXBA 1D8EA 1N4SA 2OV8A 4A1SA 1IKND 1N0QA 1E90A 4OVUA 4V3IA 1VDYA 1N95A 3SD5A 3D3MA 4JD2G 2WXIA 5IY5E 2KZTA 4C9BB 5KJNA 3IXEA 4ILGA 3EIJA 5C2YA 5EX0A 5AYWD 3L13A 1MX4A 4JEUA 2PQRA 3CHOA 4G2VA 1NI1A 3PVLA 4AEZC 3CHSA 4DX1A 1NL4A 4JEHA 2EINE 2HM8A 3RO3A 2H6GA 3LKUA 3SFYA 3Q15A 3D9LA 4BFRA 1A5EA 3EHRA 4DX2A 5EDSA 4JC8A 4JVSA 4B89A 3ZGQA 3P2BA 4C48B 4BESA 3MX3A 2UY1B 3T5XA 1TJCA 3DXKG 4H7YA 4J8EA 4U8HA 2XS8A 1KZPA 4UUCA 4LUNU 2VYIA 4DJAA 3L22A 3B7SA 4N39A 4XI9A 3EJNA 3D9HA 4TXPA 2VSYA 4BTBA 4CDRA 4YVQC 2RFAA 3QDNA 3TWXA 3TXMA 4IN3B 2FEZA 1QZ2A 3WG7E 1KLXA 1KZOA 2EIJE 3LVRE 1LTXA 3Q78A 4FADA 3JYSA 4B8AA 3LEWA 3ZYKA 3UUXA 4FJYA 3LVQE 2IQCA 4B8CB 3UINC 5BUZA 1IQUA 4F7AA 1YCSB 4J8YA 1G3NB 2FO7A 1HX8A 5KWDA 1INZA 4XKCA 2GRQB 2PM7A 3FULA 4PS8A 4LG6A 4BSZB 1OWNA 3TWWA 1HU3A 3C3OA 1TYQG 2RD0A 4R7LA 3N71A 3PNTB 4C0MA 3TGOA 1KT0A 4AY5A 1H2UA 3VLFA 1ELWA 2R02A 1H0AA 3U64A 4B93B 2PQNA 2WMOA 2QY7A 5CECB 1FT2A 3HYMB 3NBNB 3CV0A 1H2VC 1WDYA 5KJMA 3ZW3A 3PZ3A 1MJ0A 4GTSA 1OCCE 4TUUA 3TWVA 5ITZF 2P9NG 3O48A 4YDYA 1JCQA 1BPOA 3SFZA 4WAFA 1BI7B 4IULA 4UQZA 4ZHBA 3QWPA 5E76A 5BV0A 4FP7A 2NXPA 4DX5D 1IHGA 1E8YA 4GZ3A 3KSLA 3SZ7A 2YHEA 4HS2A 3OTNA 4Q94A 3CVUA 4GTVA 4HNAD 5CRUA 5G55A 4FLBA 2OEWA 4HXIA 5G04C 4MLPA 2LUHA 3PE4A 1V55E 2WQHA 4GAAA 4GPMA 1Z3XA 3Q75A 5JMND 3EHMA 2DCPA 4GU5A 3Q7AA 2NYJA 4CGVA 2L6JA 3S7FA 1Q2ZA 3TAXA 2KXPC 3PNLB 4UWLA 3UQ3A 1UN8A 1SA4A 3X2QE 4ILIA 5KBAA 3D9JA 3PZ1A 4L2LA 4WWPA 2XZTG 5CMWA 1TNZA 4HB5A 4PS3A 1TNYA 2XZDG 3JXJA 3U3WA 4K5CA 5FT9A 3SBTB 3B13A 2ETAA 4GB9A 5ENOD 5FINA 5T8IA 3FEXA 4UWKA 3UMVA 3R9AB 5JJ6A 3ZIMA 1IXVA 2P9IG 3QWWA 1N4PA 4GCOA 4HOUA 2WXMA 4AVXA 2P9PG 1TNOA 1JWFA 4TXQA 5EIDA 5FQ4A 2Q7FA 4TV3A 3V79K 1OWMA 2DBAA 1S64A 4RVBA 4E85A 3I4RB 4F3VA 2H6FA 2ZGDA 3AS5A 4N3AA 4RQIA 5B1BE 1U2VG 1QBQA 3AS4A 2OVFA 4HORA 2GRLA 3IV0A 4FHKA 4YNDA 3HG0D 2XEVA 3TWSA 3E30A 3DRAA 2RG8A 2WB2A 2XEHA 5BPPA 5HKPA 3ASOE 4JZYA 5AQ9A 2PM6A 3NOGD 4JPSA 3D9NA 2WXOA 2AXUA 3QB2A 4WNGA 4PUCA 3JUEA 1RZ4A 3MKQB 5EYPF 4LNBA 5JJTA 1IYGA 2EILE 5CERB 1EPUA 3J5PA 4GYWA 1N52A 4DLOA 3PZ2A 3EDTB 4GPKA 1D8DA 3UM2A 3W9FA 4C0EA 1L5JA 3R9MA 4LCTA 4I1AA 4F53A 4AOFA 2KZTB 2C0MA 1JWGA 4Y6WA 3FTVA 3I4GA 1UW4B 1UJJA 4FULA 4UWGA 2E0IA 2IOLA 4HVBA 5HRYA 2GW1A 3D9IA 5KJKA 2I6HA 1TN6A 5KJLA 3L82A 2CFZA 4EQFA 5LFAA 2J8SD 3MEKA 2AXVA 2V5QC 2Y3AA 2DYRE 3UT8A 3L54A 3RK6A 2HE0A 2JABA 1Z5SC 5ENNA 2VGXA 4EPZA 2KCKA 2OVBA 1HS6A 1MX6A 3B95A 3D9PA 1IQRA 4EZKA 4GA1A 5ANLA 2J49A 4HRNA 3J5QB 4N5CA 3DPDA 4GTMA 4GZ6A 1AP7A 4WNFA 3LS8A 2V4LA 4XI0A 3CKCA 3AU4A 3EU5A 1EYHA 3HXCA 3HVEB 4U8VD 4WNEA 3E33A 3PEUB 2WXFA 5C1DA 4XKBA 1K1AA 2IO3C 3HXDA 3S2AA 2KC7A 2AW6A 5AQ7A
chains in the Genus database with same CATH topology
3AG3E 2EINE 1OCCE 1OCRE 3AG4E 3ABKE 2ZXWE 2EILE 3ABME 1V55E 2DYRE 3ASNE 5B1AE 3WG7E 5B3SE 1V54E 2EIJE 3ABLE 3X2QE 2Y69E 3ASOE 2DYSE 2EIME 2OCCE 3AG2E 2EIKE 1OCOE 5B1BE 5IY5E 3AG1E 1OCZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG3 E;  2EIN E;  1OCC E;  1OCR E;  3AG4 E;  3ABK E;  2ZXW E;  2EIL E;  3ABM E;  1V55 E;  2DYR E;  3ASN E;  5B1A E;  3WG7 E;  5B3S E;  1V54 E;  2EIJ E;  3ABL E;  3X2Q E;  2Y69 E;  3ASO E;  2DYS E;  2EIM E;  2OCC E;  3AG2 E;  2EIK E;  1OCO E;  5B1B E;  5IY5 E;  3AG1 E;  1OCZ E; 
#chains in the Genus database with same CATH topology
 3C5R A;  5DBK A;  4BER A;  2QFC A;  4ANV A;  2ZGG A;  3PE3 A;  4ATZ D;  3LCA A;  2IEJ A;  3DXM G;  4AY6 A;  2P9U G;  3MYV A;  3TWQ A;  2WXJ A;  2J4B A;  3V31 A;  3SQV A;  2IY0 C;  3S7J A;  1TN8 A;  3CHQ A;  2DZO A;  3TWT A;  4F6R D;  5JA4 D;  5JHA A;  3ZFW A;  1V54 E;  2HYZ A;  4J6I A;  5AN8 A;  1NA0 A;  3CVY A;  3CK8 A;  3P1U A;  3UIP C;  1YMP A;  4HLL A;  4JW1 A;  1YYH A;  1N54 A;  4ABN A;  3ZXS A;  1TN7 A;  4LEU A;  3L9T A;  2P9S G;  4U95 D;  3FU6 A;  5LOZ A;  1BI8 B;  4J8F A;  4RG9 A;  4K0R A;  4QFV A;  4BX8 A;  1HO8 A;  3G2U A;  5ENP D;  1O1R A;  4MS6 A;  1D9S A;  1JCR A;  4G11 A;  4YDO A;  3ULY A;  1SA5 A;  3NOC D;  4YDW A;  5G04 J;  3IHY A;  4DLQ A;  5A6C A;  2VGX B;  4KT6 B;  3FEY A;  3MV3 B;  3AG2 E;  4KBQ A;  5BW8 C;  5EKQ D;  4TRQ A;  4MRU A;  3QWV A;  4L7T A;  4IYP A;  3KSQ A;  1OCR E;  4KVM A;  5EIB E;  4U0S A;  3UM3 A;  2OCC E;  4DX7 D;  1K1B A;  2OOE A;  2XEE A;  4ACK A;  1KT1 A;  3PH0 C;  5J08 A;  4EHM A;  2ETB A;  4JHK A;  4PDX A;  3ABK E;  3PEV B;  2ZXW E;  2KBX A;  2AXZ A;  4RLY A;  2WXR A;  3DBS A;  2IOS A;  4GA0 A;  2R59 A;  3L17 A;  5AQB A;  5ENQ D;  2P9L G;  3D9K A;  5AEN A;  3RRN B;  2BTD A;  2BED A;  3JUI A;  3CHM A;  3L08 A;  3NZU A;  4ATG A;  5J90 A;  1TEZ A;  4UI9 J;  4I6E A;  1H19 A;  1IHB A;  4O1P A;  2CHW A;  4QQI A;  3GZ1 A;  4G24 A;  2M63 A;  1SVX A;  1JCS A;  3IHV A;  4JB8 P;  3ZUV B;  3Q7F A;  1O5M A;  4XX5 A;  1U3C A;  2WXK A;  5HI7 A;  3QJZ A;  1HG5 A;  1TNU A;  2KAT A;  2WPV A;  3B7R L;  2XPY A;  2QYJ A;  5T3R A;  4I9C A;  1U3D A;  4EZJ A;  3ZYM A;  4A55 A;  3SNX A;  4BSX A;  2LAI A;  4APO A;  4WWO A;  3HXE A;  3FUN A;  1MHQ A;  4N2S A;  4GCN A;  1HXI A;  3FTX A;  2IO2 C;  4GYY A;  1MQS A;  4FJZ A;  2P9K G;  4EBA A;  2EIK E;  4P29 A;  2XCC A;  3F6Q A;  3AG1 E;  1WM5 A;  3UM1 A;  1OCZ E;  1E96 B;  4U0U A;  2FBN A;  3G2T A;  3HRA A;  4L23 A;  5CBN A;  4YVO A;  2XRZ A;  3ZYQ A;  5A23 A;  1WY6 A;  4CGW A;  2Y1L E;  2AVP A;  1DVP A;  2YIN A;  1N94 A;  3QAQ A;  3SFX A;  3CHP A;  2L6B A;  2BUG A;  4IRU A;  3MA5 A;  1B89 A;  1WG0 A;  4FU3 A;  5CRV A;  5G05 C;  4GZC A;  4BT8 A;  4G25 A;  3QAR A;  3PUJ A;  2P58 C;  3LY7 A;  3ZNG A;  1H6P A;  4DK5 A;  4WUY A;  1NA3 A;  4I2Z A;  4DRX E;  4I9E A;  2X3M A;  2QYU A;  2XS1 A;  5A7D B;  2R03 A;  1HG2 A;  1JPL A;  4GTP A;  2C2L A;  4AP2 A;  3T8M A;  1UOH A;  1Z3Y A;  2X6K A;  1EDU A;  2CHZ A;  4PH4 B;  2GRO B;  2CG3 A;  4Q96 A;  4HI8 A;  1PC2 A;  3K9I A;  4K5A B;  2LNI A;  2XGM A;  3NAW A;  5FQ6 A;  4GTO A;  3ONL A;  3CVL A;  1OWL A;  3PS6 A;  2H6H A;  1LD8 A;  3G2W A;  3W9G A;  2CFU A;  3D9O A;  2R2L A;  3DWL G;  3JQ1 A;  3APF A;  3FWV A;  3IBE A;  4ANX A;  3R7R A;  3ZN3 A;  3CK9 A;  4A3T A;  5FIO A;  3ZPJ A;  3FTY A;  3VLE A;  4AXH A;  1TNB A;  3Q5M A;  4K03 A;  1QQE A;  3ABM E;  1AWC B;  5FTP A;  5B3S E;  3OXF A;  3UT7 A;  3ML9 A;  3ZRH A;  4CT0 A;  2X6F A;  4GMR A;  3MCX A;  4G26 A;  2UWJ G;  5ENT D;  3DEO A;  2MRI A;  2LSU A;  4JL0 A;  5LP0 A;  4ANU A;  3C3R A;  4OAU C;  2IF4 A;  2BKK B;  3QOU A;  2J07 A;  1FT1 A;  2YQ8 A;  3FY4 A;  5KNH D;  3RU0 A;  5G2N A;  3RRU A;  3AAA C;  1DNP A;  3D9M A;  3CQC B;  5M72 A;  3CHR A;  5CEA A;  1LD7 A;  4ILH B;  5CHE E;  2JLB A;  2AJA A;  4NQ0 A;  2L9B A;  4K5B A;  3T8K A;  2VSN A;  2RKK A;  3RJV A;  2OND A;  1NZN A;  4KVO A;  1W3B A;  1FCH A;  4I43 A;  4B94 A;  3PRE A;  3G2V A;  1Y6I A;  5DIZ A;  3TG5 A;  1E7V A;  4GML A;  3Q49 B;  4JHR A;  3LYA A;  5LCW C;  3S7D A;  3NB2 A;  3LDZ A;  2I9C A;  5ENS D;  3GYZ A;  4F1S A;  2F0Y A;  1ELR A;  2EQX A;  2YHC A;  3FH8 A;  2DVW A;  3R7Q A;  4UI9 K;  3EU9 A;  1ZB1 A;  4UQY A;  2C0L A;  3TL5 A;  3Q4A B;  4UWH A;  3ZEF A;  3QKY A;  3LJ3 A;  4G23 A;  2KM4 A;  3O4Z A;  3CR3 A;  3ZXP A;  2XPZ A;  5BXU A;  2IJG X;  3VTX A;  4LNU D;  1X5B A;  2WVI A;  4DUI A;  5EX3 A;  3DSX A;  4AV7 A;  4GTQ A;  2KCL A;  2ZIS A;  2DIW A;  2Y4U A;  1EF1 C;  1HFA A;  4EBA G;  4XZ4 A;  2PZI A;  3AS8 A;  3BG1 B;  3Q9U C;  4UI9 C;  4TUM A;  4XIF A;  1SQM A;  2WQ7 A;  2L0I A;  4HRM B;  4U8Y D;  2GRN B;  2I1J A;  2GRP B;  5CED B;  2RFM A;  3TG4 A;  3BU8 A;  4Q69 A;  4U63 A;  4GTR A;  4J8D A;  3DSV A;  3AJI A;  2WXG A;  3SO8 A;  2BF0 X;  4OVV A;  4KMO A;  4W9R A;  3HIZ A;  3HVE A;  1OUV A;  3TJP A;  4J7W A;  4PS7 A;  1UJK A;  1XNF A;  2KCV A;  2V5F A;  4G8L A;  2A5U A;  3LJN A;  3CVW A;  4E6H A;  4FC8 A;  1MZC A;  2WXP A;  3CQG B;  3UX4 A;  3V2X A;  3SY2 A;  5AIJ A;  4OYS A;  1DC2 A;  1O1T A;  2BKG A;  2J08 A;  4ZFH A;  3V30 A;  1HF8 A;  3EHQ A;  3LXU X;  2X38 A;  4UQX A;  3WXX A;  5KNG A;  1BU9 A;  5ANR A;  2VGY A;  3C3Q A;  1MX2 A;  3AG3 E;  4BT9 A;  4L1B A;  4N3C A;  3KEZ A;  5G05 J;  3PUK A;  5B1A E;  1UN9 A;  1YA0 A;  2LAH A;  2IU1 A;  4UWF A;  3UKR G;  3FH7 A;  3Q79 A;  5BXO A;  2VTB B;  1K3Z D;  1DCQ A;  1OCO E;  2VSX E;  4GZD A;  4WWN A;  1OY3 D;  1FPP A;  4XEI G;  3E4B A;  2NSZ A;  1OXJ A;  5EN5 D;  4X8Q A;  4I6J A;  3FU3 A;  4OAV B;  5JJ7 A;  2EIM E;  1N4Q A;  3ULE G;  4D10 C;  1X81 A;  3CVX A;  3FU5 A;  1H6O A;  4L2Y A;  1E7U A;  2HO1 A;  1E8Z A;  1O1S A;  2J4D A;  4XE0 A;  1N0R A;  4BY6 A;  4EEC A;  2WXN A;  4HOS A;  2Y4T A;  4TXR A;  1GW6 A;  3FHE A;  3GZS A;  2YNQ A;  1Z6T A;  2MOW A;  2B0O E;  2XEN A;  3TXN A;  1N9A A;  4M7C A;  2R5S A;  3FUI A;  4ANW A;  3KD7 A;  4G8K A;  3MJW A;  2H6I A;  2DYS E;  1OWO A;  1Y8M A;  3ZU7 B;  4APF A;  4GMJ A;  1ELK A;  2AWI A;  4U96 D;  3E37 A;  3CVV A;  2LXM A;  2VJ8 A;  3CEQ A;  4BET A;  3ML8 A;  4A1G A;  3ZKJ A;  1ZU2 A;  3SHF A;  3Q9N C;  1HZ4 A;  3U66 A;  1QYM A;  2ILR A;  4HOT A;  4NIK A;  3FDH A;  2XHE A;  3FTW A;  1K8K G;  3IEG A;  4O60 A;  2LSV A;  1KPS B;  4GTT A;  5T4Y A;  2QC9 A;  1RW2 A;  4I1O B;  4JHJ A;  1NP7 A;  5FZQ A;  2ETC A;  2CG2 A;  3L6A A;  3ZHE B;  3FUE A;  5EYL A;  4RG6 A;  2L0T B;  4CT4 A;  3IKO B;  4MBG A;  1MYO A;  1H6K A;  2VGE A;  4U0Z A;  2F8X K;  1BD8 A;  3HXF A;  3B7U X;  2VSO E;  5FJY A;  4CDM A;  5AJD A;  3MKR A;  1LF8 A;  3T9K A;  2V0P A;  4JA7 A;  3PZD A;  3ASN E;  4KZ0 A;  4GYO A;  4EZL A;  3FUH A;  3LY9 A;  3TWU A;  1NFI E;  3SF4 A;  2R17 C;  5LCW J;  3UT4 A;  2J9Q A;  2I1K A;  3MZL B;  3T5V A;  3E34 A;  3ASD A;  3UXG A;  3FTU A;  3AG4 E;  2XPI A;  2XGO A;  5E75 A;  1ZBP A;  3EIQ C;  4G1T A;  5BT1 A;  4I6G A;  3EUV A;  3OXG A;  3FH5 A;  3Q73 A;  5JHB A;  2X6J A;  3CIA A;  5KCM A;  4BTA A;  5AJL A;  3ENE A;  3ULQ A;  1OWP A;  3E32 A;  5CCL A;  2FF4 A;  4BEP A;  2NC9 A;  4NRH B;  3V2O A;  4JXT A;  4FLH A;  3RAU A;  3UI2 A;  4NAC A;  2V8S E;  3Q47 B;  3LY8 A;  3DSW A;  3FUF A;  3ZHE A;  3APC A;  3HDX A;  1SW6 A;  1N11 A;  1E8X A;  3CVQ A;  3TWR A;  2WXH A;  3GZ2 A;  3NZS A;  1TR4 A;  1FVF A;  1A17 A;  4Z68 A;  4RSY A;  3L16 A;  1HH8 A;  4KYO B;  1TJF A;  5ARF A;  4CEM A;  4DI3 A;  5D2M C;  3UKU G;  3FFL A;  3MGB A;  5EIL A;  2XQ0 A;  4HQD A;  4AJW A;  4H7X A;  1E8W A;  1FVH A;  4O1O A;  5ARG A;  3CVP A;  2Y69 E;  3U4T A;  5FQ8 A;  3DST A;  4N5Q A;  3RKV A;  3PDN A;  5D66 A;  1BLX B;  3FUM A;  5LX8 A;  2XRY A;  3DPY A;  2IFU A;  3I5P A;  4KZC A;  2QZA A;  3U9W A;  4ACL A;  2PNN A;  2A5E A;  3SBS A;  2Y0B G;  2B6C A;  1SZ9 A;  3KS2 A;  3MKQ A;  5BV1 A;  2JEK A;  3OAW A;  4LER A;  1DCE A;  4J8S A;  5HQ8 A;  3KAE A;  3SGH A;  1SZA A;  4A3V A;  1XGW A;  2WM9 A;  3QNK A;  2R05 A;  3UIO C;  3ISM C;  4BX9 A;  3CST A;  3BG0 B;  4CYM D;  2DWZ A;  4CCA A;  3JQ0 A;  2F37 A;  3VLD A;  5BNW A;  4I1M A;  2ION A;  4U04 A;  4WND A;  3FUD A;  4HBD A;  3C72 A;  3URZ A;  2P2C P;  4GZ5 A;  4CZ2 D;  5H7P A;  3ZVV A;  3S7B A;  4HI9 A;  2X6I A;  3FU0 A;  4L9P A;  5FQ7 A;  3JCK C;  3APD A;  4HLE A;  5FWQ A;  4FHJ A;  4FA6 A;  3I3N A;  4LNG A;  4JA9 A;  1OT8 A;  2F8Y A;  4HFG A;  4I2W A;  3QC1 A;  3RIB A;  3AU5 A;  3ASF A;  4KXK B;  3DSU A;  3JXI A;  1PAQ A;  3ESL A;  3ASH A;  1P5Q A;  2FO1 E;  4DPR A;  4DI4 A;  4ME2 A;  5D0O D;  1S63 A;  5ENR D;  3ZYL A;  4U07 A;  3PZ4 A;  3C98 A;  5FZR A;  3DSS A;  3EHN A;  4B0Z A;  1JUQ A;  4GA2 A;  5AAO A;  4HRL A;  3LPZ A;  4A63 B;  3SI5 A;  3GW4 A;  2GRR B;  2GRM A;  4M3O A;  4YDE A;  2X6H A;  2XGS A;  2WQ6 A;  3CKB A;  3NQP A;  5D0Q D;  4AM9 A;  4LRZ A;  3ASG A;  3ESK A;  3ONK A;  4CRW A;  5FZS A;  3FP3 A;  3FUJ A;  2OEV A;  3CSF A;  5CCM A;  4N3B A;  1N4R A;  4DX6 D;  2MHK A;  4N2Q A;  1QNF A;  3ABL E;  4I17 A;  3UTM A;  2A4Z A;  3CGH A;  3FTZ A;  3BEE A;  3B7B A;  3G2S A;  3NF1 A;  3CVN A;  2ZU6 B;  3KEA A;  3MV2 B;  4J0U A;  4AIF A;  3PRZ A;  3CK7 A;  4NUR A;  5CBO A;  2J09 A;  4BWR A;  3BUA A;  2V4H C;  2FUL A;  2FI7 A;  3RRM B;  2MYO A;  2GGF A;  2VTB A;  3UPV A;  3VTY A;  2WMN A;  1PY1 A;  2VQ2 A;  4URK A;  5CMY A;  4HOQ A;  3FUK A;  3BQO A;  1HE8 A;  1S70 B;  4MKT A;  2I2O A;  2ZIR A;  2CHX A;  3DEP A;  2PL2 A;  5AQA A;  3QK0 A;  2UY1 A;  3RO2 A;  3FTS A;  3CLJ A;  3UM0 A;  1UG3 A;  1S0P A;  5AAR A;  3RSE G;  2WXQ A;  4F1P A;  2LO6 A;  4LSZ E;  5HS0 A;  4CDN A;  2DZN A;  2LXL A;  2E2E A;  2XCB A;  4Y6C A;  2WXL A;  4O6F A;  3B7T A;  1WAO 1;  1H2T C;  3OXL A;  3HHM A;  2HR2 A;  4U7E B;  3HXB A;  1D8E A;  1N4S A;  2OV8 A;  4A1S A;  1IKN D;  1N0Q A;  1E90 A;  4OVU A;  4V3I A;  1VDY A;  1N95 A;  3SD5 A;  3D3M A;  4JD2 G;  2WXI A;  5IY5 E;  2KZT A;  4C9B B;  5KJN A;  3IXE A;  4ILG A;  3EIJ A;  5C2Y A;  5EX0 A;  5AYW D;  3L13 A;  1MX4 A;  4JEU A;  2PQR A;  3CHO A;  4G2V A;  1NI1 A;  3PVL A;  4AEZ C;  3CHS A;  4DX1 A;  1NL4 A;  4JEH A;  2EIN E;  2HM8 A;  3RO3 A;  2H6G A;  3LKU A;  3SFY A;  3Q15 A;  3D9L A;  4BFR A;  1A5E A;  3EHR A;  4DX2 A;  5EDS A;  4JC8 A;  4JVS A;  4B89 A;  3ZGQ A;  3P2B A;  4C48 B;  4BES A;  3MX3 A;  2UY1 B;  3T5X A;  1TJC A;  3DXK G;  4H7Y A;  4J8E A;  4U8H A;  2XS8 A;  1KZP A;  4UUC A;  4LUN U;  2VYI A;  4DJA A;  3L22 A;  3B7S A;  4N39 A;  4XI9 A;  3EJN A;  3D9H A;  4TXP A;  2VSY A;  4BTB A;  4CDR A;  4YVQ C;  2RFA A;  3QDN A;  3TWX A;  3TXM A;  4IN3 B;  2FEZ A;  1QZ2 A;  3WG7 E;  1KLX A;  1KZO A;  2EIJ E;  3LVR E;  1LTX A;  3Q78 A;  4FAD A;  3JYS A;  4B8A A;  3LEW A;  3ZYK A;  3UUX A;  4FJY A;  3LVQ E;  2IQC A;  4B8C B;  3UIN C;  5BUZ A;  1IQU A;  4F7A A;  1YCS B;  4J8Y A;  1G3N B;  2FO7 A;  1HX8 A;  5KWD A;  1INZ A;  4XKC A;  2GRQ B;  2PM7 A;  3FUL A;  4PS8 A;  4LG6 A;  4BSZ B;  1OWN A;  3TWW A;  1HU3 A;  3C3O A;  1TYQ G;  2RD0 A;  4R7L A;  3N71 A;  3PNT B;  4C0M A;  3TGO A;  1KT0 A;  4AY5 A;  1H2U A;  3VLF A;  1ELW A;  2R02 A;  1H0A A;  3U64 A;  4B93 B;  2PQN A;  2WMO A;  2QY7 A;  5CEC B;  1FT2 A;  3HYM B;  3NBN B;  3CV0 A;  1H2V C;  1WDY A;  5KJM A;  3ZW3 A;  3PZ3 A;  1MJ0 A;  4GTS A;  1OCC E;  4TUU A;  3TWV A;  5ITZ F;  2P9N G;  3O48 A;  4YDY A;  1JCQ A;  1BPO A;  3SFZ A;  4WAF A;  1BI7 B;  4IUL A;  4UQZ A;  4ZHB A;  3QWP A;  5E76 A;  5BV0 A;  4FP7 A;  2NXP A;  4DX5 D;  1IHG A;  1E8Y A;  4GZ3 A;  3KSL A;  3SZ7 A;  2YHE A;  4HS2 A;  3OTN A;  4Q94 A;  3CVU A;  4GTV A;  4HNA D;  5CRU A;  5G55 A;  4FLB A;  2OEW A;  4HXI A;  5G04 C;  4MLP A;  2LUH A;  3PE4 A;  1V55 E;  2WQH A;  4GAA A;  4GPM A;  1Z3X A;  3Q75 A;  5JMN D;  3EHM A;  2DCP A;  4GU5 A;  3Q7A A;  2NYJ A;  4CGV A;  2L6J A;  3S7F A;  1Q2Z A;  3TAX A;  2KXP C;  3PNL B;  4UWL A;  3UQ3 A;  1UN8 A;  1SA4 A;  3X2Q E;  4ILI A;  5KBA A;  3D9J A;  3PZ1 A;  4L2L A;  4WWP A;  2XZT G;  5CMW A;  1TNZ A;  4HB5 A;  4PS3 A;  1TNY A;  2XZD G;  3JXJ A;  3U3W A;  4K5C A;  5FT9 A;  3SBT B;  3B13 A;  2ETA A;  4GB9 A;  5ENO D;  5FIN A;  5T8I A;  3FEX A;  4UWK A;  3UMV A;  3R9A B;  5JJ6 A;  3ZIM A;  1IXV A;  2P9I G;  3QWW A;  1N4P A;  4GCO A;  4HOU A;  2WXM A;  4AVX A;  2P9P G;  1TNO A;  1JWF A;  4TXQ A;  5EID A;  5FQ4 A;  2Q7F A;  4TV3 A;  3V79 K;  1OWM A;  2DBA A;  1S64 A;  4RVB A;  4E85 A;  3I4R B;  4F3V A;  2H6F A;  2ZGD A;  3AS5 A;  4N3A A;  4RQI A;  5B1B E;  1U2V G;  1QBQ A;  3AS4 A;  2OVF A;  4HOR A;  2GRL A;  3IV0 A;  4FHK A;  4YND A;  3HG0 D;  2XEV A;  3TWS A;  3E30 A;  3DRA A;  2RG8 A;  2WB2 A;  2XEH A;  5BPP A;  5HKP A;  3ASO E;  4JZY A;  5AQ9 A;  2PM6 A;  3NOG D;  4JPS A;  3D9N A;  2WXO A;  2AXU A;  3QB2 A;  4WNG A;  4PUC A;  3JUE A;  1RZ4 A;  3MKQ B;  5EYP F;  4LNB A;  5JJT A;  1IYG A;  2EIL E;  5CER B;  1EPU A;  3J5P A;  4GYW A;  1N52 A;  4DLO A;  3PZ2 A;  3EDT B;  4GPK A;  1D8D A;  3UM2 A;  3W9F A;  4C0E A;  1L5J A;  3R9M A;  4LCT A;  4I1A A;  4F53 A;  4AOF A;  2KZT B;  2C0M A;  1JWG A;  4Y6W A;  3FTV A;  3I4G A;  1UW4 B;  1UJJ A;  4FUL A;  4UWG A;  2E0I A;  2IOL A;  4HVB A;  5HRY A;  2GW1 A;  3D9I A;  5KJK A;  2I6H A;  1TN6 A;  5KJL A;  3L82 A;  2CFZ A;  4EQF A;  5LFA A;  2J8S D;  3MEK A;  2AXV A;  2V5Q C;  2Y3A A;  2DYR E;  3UT8 A;  3L54 A;  3RK6 A;  2HE0 A;  2JAB A;  1Z5S C;  5ENN A;  2VGX A;  4EPZ A;  2KCK A;  2OVB A;  1HS6 A;  1MX6 A;  3B95 A;  3D9P A;  1IQR A;  4EZK A;  4GA1 A;  5ANL A;  2J49 A;  4HRN A;  3J5Q B;  4N5C A;  3DPD A;  4GTM A;  4GZ6 A;  1AP7 A;  4WNF A;  3LS8 A;  2V4L A;  4XI0 A;  3CKC A;  3AU4 A;  3EU5 A;  1EYH A;  3HXC A;  3HVE B;  4U8V D;  4WNE A;  3E33 A;  3PEU B;  2WXF A;  5C1D A;  4XKB A;  1K1A A;  2IO3 C;  3HXD A;  3S2A A;  2KC7 A;  2AW6 A;  5AQ7 A; 
#chains in the Genus database with same CATH homology
 3AG3 E;  2EIN E;  1OCC E;  1OCR E;  3AG4 E;  3ABK E;  2ZXW E;  2EIL E;  3ABM E;  1V55 E;  2DYR E;  3ASN E;  5B1A E;  3WG7 E;  5B3S E;  1V54 E;  2EIJ E;  3ABL E;  3X2Q E;  2Y69 E;  3ASO E;  2DYS E;  2EIM E;  2OCC E;  3AG2 E;  2EIK E;  1OCO E;  5B1B E;  5IY5 E;  3AG1 E;  1OCZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...