2EIJE

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eijE00
1V54E 5B1AE 5B3SE 3ABLE 3AG2E 1OCCE 1V55E 2EIKE 3AG3E 3ABME 5B1BE 2EINE 3AG1E 2EIJE 3AG4E 2OCCE 3ASNE 2DYRE 2ZXWE 2DYSE 2EIME 1OCZE 3WG7E 2EILE 3ABKE 3ASOE 5IY5E 2Y69E 1OCOE 1OCRE 3X2QE
chains in the Genus database with same CATH superfamily
3IHVA 3CIAA 2ZU6B 2J08A 3RO3A 4UUCA 3PNTB 4AV7A 3HXDA 4BTAA 3QJZA 3TWSA 3QWVA 3UQ3A 3UM3A 3ONKA 5E75A 3B7BA 3JCKC 2ONDA 2LSVA 4RVBA 5ITZF 2P9PG 3KSQA 3FUEA 2GRMA 4NRHB 2ZISA 2HM8A 2BKKB 4IYPA 4I2WA 3VLDA 4J8EA 4ANXA 5CEAA 2KCKA 3FUJA 5ENOD 2E0IA 3ZU7B 2MHKA 4BETA 4I1MA 5A7DB 2WXRA 3UM0A 3LYAA 1GW6A 5HI7A 3P1UA 4ILIA 3ASHA 2IJGX 3HYMB 4GMJA 2ZGGA 4DK5A 5EX3A 5T3RA 2WPVA 4ILGA 1JCRA 1B89A 2WQ6A 5FZSA 4YDWA 3CVQA 1KT0A 4B0ZA 3ZGQA 2Y4TA 1NA3A 2KZTB 5ARGA 1TEZA 2BTDA 4R7LA 2F8XK 3FDHA 4APFA 4GZ3A 5EILA 1X5BA 4HLLA 1H6PA 1N52A 5BNWA 2J4DA 2VGXB 2NXPA 3Q79A 4NQ0A 3ASNE 4HBDA 4JB8P 4JEHA 2WXGA 5KCMA 1HS6A 3Q4AB 4GZ5A 1OCZE 2PM6A 4UQZA 3TJPA 3HG0D 2PQRA 3RIBA 4N5CA 1EPUA 5ARFA 3AS5A 3T5VA 1OCCE 4DLOA 3CQCB 3NF1A 5H7PA 1WDYA 2I9CA 3E32A 3TAXA 4IN3B 3TWUA 4GCNA 3DSUA 4J8YA 4DX1A 2IONA 2Q7FA 5ENSD 2OVFA 4YVOA 5ENNA 4U8HA 3PUKA 4HRLA 4WUYA 4O1OA 4WWOA 2J09A 3O4ZA 4PS8A 4DRXE 2BUGA 3ONLA 4LUNU 3S7JA 1IHBA 2C0MA 4HRMB 2DBAA 4HORA 3HHMA 1HZ4A 3LVRE 1OT8A 4JXTA 2B0OE 3ZYQA 4HNAD 3APDA 3BEEA 3CVWA 2XRZA 3FU3A 4EPZA 4BFRA 2RD0A 4CDNA 2QYUA 3CK7A 3GW4A 4AM9A 3SBSA 3D9HA 3V30A 2AXUA 4EQFA 4ANUA 1L5JA 4DI4A 2I1KA 3G2SA 4GZCA 3FH7A 5AQAA 1N9AA 4U63A 4UWGA 1K8KG 2JEKA 4N2QA 2CG2A 2GRPB 5AAOA 3AU4A 1UW4B 1G3NB 3MA5A 3ZNGA 3W9GA 2DIWA 2EILE 3GZSA 3ZIMA 1DNPA 2LSUA 3CSFA 3PEVB 5B1AE 3UM2A 1QNFA 1OWPA 3EU9A 1HX8A 3EU5A 3PVLA 5FQ7A 3CHQA 4G8LA 4APOA 2M63A 3UX4A 3PZ4A 2XPIA 1SA4A 4G2VA 2EIME 3NOCD 1P5QA 4L23A 4GTMA 3TG5A 4A1SA 1S70B 5LOZA 2I6HA 4ZFHA 5FJYA 1HG5A 4AEZC 4CGVA 3UIOC 5FQ8A 1N4RA 5FINA 3D9NA 3FUKA 2WXKA 1Z5SC 3VTXA 5A6CA 1MJ0A 1SW6A 2L0TB 3CV0A 2IOSA 3FHEA 3CR3A 4BX9A 3FTYA 4TXQA 3QK0A 3EHRA 3D9JA 3S7BA 4RG6A 3LS8A 3PUJA 3R9AB 3FH5A 5FWQA 2YNQA 3GZ1A 3HXFA 4NACA 1ZBPA 4LCTA 4B89A 2H6HA 3APCA 2DYRE 2RFAA 3DEOA 5G55A 3Q9NC 3T8MA 3MCXA 2VSXE 2J49A 3SNXA 5EN5D 3V2OA 4GAAA 5CEDB 3IXEA 2WXPA 3SY2A 5AN8A 3W9FA 3ESKA 4DPRA 2J9QA 1D9SA 3DSTA 4K5CA 3CVLA 2LXMA 3AAAC 4HRNA 5G05C 3UIPC 5KJMA 2QYJA 3Q7FA 4XI9A 3FFLA 4MBGA 4BWRA 2LUHA 2YQ8A 5DIZA 3AJIA 4DX2A 3Q78A 4Q69A 4PH4B 2LXLA 3QWPA 3RSEG 1INZA 3MKQA 3TWTA 3VLEA 2CHXA 5EKQD 3PREA 4P29A 4FULA 2JABA 4J7WA 4BESA 2R02A 1YA0A 3FH8A 1N4SA 4OAVB 2MOWA 4GTSA 4HI9A 3Q73A 2BEDA 2FO7A 5JJ6A 3QWWA 2GRLA 4JPSA 5EX0A 2PQNA 2RG8A 3X2QE 5C1DA 3AU5A 3PZDA 5AQ7A 3FU0A 4AP2A 1HH8A 2P9UG 3FUIA 2XEHA 4I9EA 4TV3A 4WNEA 2DVWA 4HQDA 5M72A 4GB9A 1ZU2A 2DWZA 2WXNA 5BPPA 4I1OB 4TXPA 3S7FA 4EZJA 4ME2A 4G8KA 4U0ZA 3D3MA 1WY6A 3UT4A 3VTYA 3IKOB 3NQPA 2GRQB 3C3QA 3PZ3A 2E2EA 1TJFA 3JXJA 4AY5A 5AIJA 3LPZA 2KZTA 5LCWC 1S0PA 3LVQE 1UN9A 4HI8A 3UTMA 4N3AA 3LY9A 4L2LA 3FTWA 1WAO1 4OAUC 5CBNA 3I5PA 3SBTB 4UI9K 3Q49B 3B7TA 2WMOA 2XS8A 3UI2A 2IF4A 5E76A 3UKUG 2XPZA 4M7CA 3TWVA 4UWHA 2IY0C 2F0YA 3PE4A 3HIZA 4BTBA 3T9KA 4BSXA 3G2UA 1SZ9A 3DXKG 3IV0A 4CGWA 4MRUA 4GA2A 5D66A 5LP0A 3BU8A 2ILRA 1V55E 3KS2A 3ML9A 2EINE 4DUIA 4G25A 3B7SA 5CBOA 2WXJA 4ATZD 4UWKA 1D8EA 4KVMA 4BERA 4ANWA 3MGBA 4E6HA 4DX5D 4LSZE 3IEGA 3UT7A 1QBQA 2WXHA 2XCBA 3AG1E 4G23A 4L1BA 2R05A 5CCLA 4LG6A 4OVVA 2Y4UA 4XX5A 4L7TA 2V5QC 3CVUA 1H2VC 4C9BB 3C72A 4J8DA 3V31A 1D8DA 2F37A 5AJLA 2X6JA 4C0MA 4N3CA 4KMOA 1E90A 5B3SE 4I2ZA 3ABLE 2EIKE 2P9NG 2FO1E 2WVIA 3U4TA 1E7VA 4A3TA 4U04A 3KEZA 2WXMA 1NZNA 1PAQA 4L9PA 3Q75A 3DXMG 3LKUA 2ZGDA 5BV1A 3EUVA 3CGHA 4O1PA 5LX8A 3NZSA 3GZ2A 4OYSA 2PZIA 5G2NA 1NA0A 3Q47B 2P9LG 1BLXB 1TYQG 5HRYA 3CHRA 2R2LA 1LD7A 3E34A 4FA6A 1N54A 1NP7A 5EIDA 1K1BA 1UN8A 2FBNA 1N4QA 3OTNA 5ENQD 4GU5A 4GPMA 4JZYA 3TG4A 4NIKA 1LF8A 3DPYA 2BKGA 3LJ3A 4PS3A 1X81A 1Z6TA 4GYYA 3HVEA 2AXZA 4GTVA 3L22A 5EIBE 4WNGA 2V4HC 3B95A 3CVPA 1OUVA 1H2TC 3UM1A 2WQ7A 3MZLB 1E8WA 3Q5MA 3OXFA 1E96B 4N2SA 4I1AA 3AG3E 3CLJA 5DBKA 3HXEA 2KCVA 2FEZA 4CCAA 4JL0A 4U8YD 4RG9A 4WNDA 2MYOA 4XI0A 4RSYA 4Q94A 4K03A 2IO2C 3FEYA 4A3VA 1WM5A 3PZ1A 2AXVA 2CFZA 4JC8A 1NFIE 4TUMA 4OVUA 4V3IA 2XRYA 2XENA 2KCLA 4BY6A 2HE0A 3PNLB 3JUEA 3SFXA 2X6FA 2WM9A 3D9PA 4PDXA 3LXUX 4H7XA 2IEJA 1UG3A 5JJ7A 3O48A 1UJKA 3R9MA 4XZ4A 5ENPD 3ESLA 4ACKA 3PEUB 4WWNA 4DLQA 3DSSA 1H6OA 2IO3C 2V0PA 1K1AA 2L6JA 1N4PA 2NYJA 3CVVA 4B93B 3RJVA 3SF4A 5J08A 3ABME 4A63B 4FU3A 4MLPA 1TN7A 5BXUA 3FWVA 3S7DA 4U0SA 4DJAA 4GTRA 3J5PA 2XZTG 4LERA 4C0EA 4XKBA 1N11A 3B7RL 3CK9A 3UKRG 4ZHBA 2NC9A 3U64A 3SFYA 2XEEA 3LDZA 2AJAA 5G05J 4ANVA 2VSYA 2UY1A 3LCAA 2XGMA 4J0UA 2L9BA 4HS2A 3Q7AA 4G11A 2VSNA 5KWDA 3UT8A 5KBAA 4FADA 1QQEA 3TWXA 1BI8B 4TXRA 4EZKA 1YCSB 3E30A 3E4BA 2DCPA 1JWGA 1U3CA 2B6CA 2LO6A 3FU5A 3BQOA 5A23A 4Y6CA 5JA4D 1N95A 4I43A 1OCRE 3SQVA 4FLBA 1KZOA 1PC2A 4K5BA 3I4RB 3NOGD 5JMND 2VQ2A 1FT2A 2GGFA 2MRIA 3TWWA 4Z68A 1DCQA 2EIJE 3D9OA 5KNHD 5T8IA 1BU9A 3ULEG 2WXIA 3UMVA 1O1RA 2IOLA 1TNBA 3CKCA 2R5SA 3ZYKA 3HVEB 3L54A 3ML8A 3QARA 4KYOB 3G2WA 2HO1A 4QFVA 5BT1A 4BT8A 4A1GA 2RKKA 1ELWA 3E33A 2XCCA 1OCOE 3ZHEA 2HR2A 3G2VA 1ELRA 2WQHA 2QFCA 4PS7A 3I3NA 3R7QA 3DWLG 1WG0A 3CEQA 1E8ZA 5EYPF 3MEKA 2VYIA 3ZN3A 2XQ0A 1E7UA 4FLHA 2OEVA 4O60A 1FCHA 2J07A 3B7UX 4UWLA 1N0QA 1TR4A 2QC9A 1MZCA 2Y69E 4C48B 3CK8A 5ANLA 3D9KA 3DSVA 4BX8A 2Y3AA 2L0IA 2QY7A 3G2TA 3OXLA 3U3WA 5G04J 2FF4A 2LAHA 2ZIRA 1HF8A 4UQXA 3C98A 4UQYA 1JCQA 1KZPA 3CKBA 3UUXA 1MHQA 4DX7D 4QQIA 3RRMB 3ZEFA 3ZHEB 3RRNB 5B1BE 5FQ6A 4ABNA 1H6KA 3R7RA 1Z3YA 3EJNA 4AVXA 1NI1A 4I6EA 3UINC 3CVYA 5FIOA 4G26A 4YNDA 3MKRA 5D2MC 5LFAA 4U8VD 4GA0A 3EHQA 4J6IA 2KATA 1FVFA 1YMPA 4YDEA 4FP7A 3Q15A 1SQMA 2WXOA 3KAEA 4B94A 1VDYA 3MYVA 4FC8A 5AENA 4JA9A 3TXMA 1H19A 1OWOA 2LAIA 2YHEA 1N94A 2X3MA 1FT1A 3ZFWA 5EDSA 4CYMD 4Y6WA 5G04C 2GW1A 4K0RA 4BSZB 3TXNA 3L9TA 3SO8A 3L17A 5AQBA 3FTSA 3AS4A 3QKYA 1KPSB 2DYSE 4GMRA 4O6FA 3SZ7A 1NL4A 4FHKA 5KJKA 5KJLA 1K3ZD 3FTVA 4CDMA 1BI7B 1BPOA 2LNIA 4IULA 1YYHA 3TGOA 1MQSA 4GPKA 3UPVA 3KEAA 3ASFA 1FVHA 4HVBA 4JW1A 4GMLA 3PDNA 1EDUA 1AP7A 3APFA 3ENEA 2I1JA 2BF0X 4U07A 1Z3XA 5KNGA 5BXOA 1HO8A 1TN6A 5D0QD 1EYHA 3SFZA 3KSLA 1KT1A 2H6IA 3JQ1A 4WWPA 1H2UA 4XEIG 3FUNA 4HOUA 5AJDA 1UOHA 3EDTB 1OWLA 2A4ZA 1O1TA 3CQGB 3L08A 4U0UA 5CMYA 4EECA 1IHGA 4L2YA 1HG2A 5AARA 4U96D 4WAFA 4NURA 3AG4E 4CZ2D 3V2XA 3EIJA 3D9IA 3QOUA 3RKVA 2XEVA 3HDXA 4TUUA 1IYGA 2AVPA 2R59A 3NZUA 1SVXA 2ETCA 3HXBA 2GROB 3ZUVB 5C2YA 3NAWA 1Q2ZA 3RAUA 3QC1A 1MX4A 3OAWA 4XE0A 3SGHA 4CEMA 3FUDA 2R03A 5CCMA 4ACLA 3TWQA 1HE8A 3TL5A 3FUHA 2OOEA 4PUCA 4D10C 3MKQB 1TNUA 4FJYA 3P2BA 1JUQA 1OY3D 3F6QA 2XS1A 5FZQA 2VGXA 3ZXPA 3LJNA 2PL2A 2EQXA 5CRVA 4UI9C 3ULYA 3JUIA 4AIFA 3SD5A 3N71A 5LCWJ 2VGYA 4MS6A 1EF1C 3FU6A 3UXGA 4DI3A 3U9WA 3I4GA 2F8YA 3QAQA 4F1SA 2XHEA 4G24A 2CFUA 3NBNB 3T5XA 2AWIA 1TNZA 4M3OA 4AY6A 3FUFA 3B13A 4JHJA 1DVPA 3MX3A 4RQIA 3EHMA 1V54E 3U66A 2VSOE 3Q9UC 2AW6A 2XGSA 4CT4A 3TWRA 2P9IG 3CHOA 1W3BA 2XGOA 3S2AA 5FTPA 1OWMA 3DPDA 3E37A 3ASOE 3L16A 3CHPA 3NB2A 4YVQC 2C0LA 4XIFA 4Q96A 1RZ4A 3EHNA 5JHBA 4GCOA 4XKCA 3D9LA 1E8YA 4W9RA 3URZA 3ISMC 5HS0A 4AJWA 5BUZA 3PE3A 2X6HA 2X38A 1ELKA 3ZRHA 5FZRA 3ULQA 4HLEA 2CHWA 4KT6B 4IRUA 1TNOA 2WMNA 4GYOA 2PM7A 2Y1LE 3L13A 2OCCE 3QNKA 1Y6IA 3DSXA 5HKPA 2DZOA 1MX6A 3ZPJA 3IBEA 3FUMA 1JWFA 1Y8MA 4I9CA 3PH0C 3ASDA 4EHMA 2UY1B 2YINA 4GA1A 2XZDG 1U3DA 4I17A 2IU1A 3T8KA 1LD8A 2X6IA 4GTTA 3RRUA 4KXKB 5CECB 4HOQA 3MV3B 2A5UA 2PNNA 1KLXA 1A5EA 1IQRA 1H0AA 4JA7A 4BT9A 2DZNA 2H6FA 3L82A 3DBSA 5T4YA 3SI5A 4JHKA 4BEPA 3D9MA 1IXVA 4U7EB 1AWCB 4EBAG 1RW2A 4UWFA 3WG7E 5BV0A 3FP3A 5FT9A 4E85A 2KBXA 5CHEE 4EZLA 4FJZA 2KXPC 3VLFA 4GTQA 4K5AB 3GYZA 3LEWA 5ENRD 4LNUD 4X8QA 4ATGA 4MKTA 4I6GA 1ZB1A 4CT0A 5AQ9A 2P2CP 2VTBB 2V5FA 4KZCA 4CRWA 5EYLA 1IKND 3V79K 1IQUA 3ZW3A 2QZAA 2JLBA 2WXFA 5ENTD 2ETAA 4JEUA 5FQ4A 2NSZA 1JCSA 3QB2A 2P9KG 1OXJA 5JHAA 4YDYA 2V4LA 2ETBA 3JQ0A 2GRNB 3MV2B 3CVXA 3C3OA 5IY5E 5J90A 3OXGA 3FY4A 3BG0B 4JHRA 1HXIA 3CHMA 3RU0A 4GZ6A 4DX6D 4N39A 4A55A 1E8XA 3AS8A 5CRUA 4HB5A 3SHFA 1TJCA 3ZXSA 3HXCA 2FULA 5CERB 3IHYA 4J8FA 1OWNA 3DEPA 4F53A 3KD7A 4GTPA 1LTXA 1JPLA 3K9IA 1DC2A 4LNGA 4HOSA 4GTOA 4F3VA 2OVBA 3ABKE 2V8SE 3HRAA 4I6JA 2P58C 4J8SA 1FPPA 4CDRA 2XPYA 3AG2E 5AYWD 5HQ8A 1A17A 3ASGA 2A5EA 2CHZA 3J5QB 3FTUA 5D0OD 1XNFA 2GRRB 4HFGA 1O5MA 4N5QA 3PZ2A 3WXXA 3RO2A 2RFMA 1O1SA 3MJWA 2UWJG 3FTZA 1TNYA 2VTBA 1U2VG 2I2OA 1N0RA 2IQCA 2FI7A 4KBQA 4TRQA 2H6GA 2WB2A 1UJJA 1SA5A 3RK6A 2WXQA 4EBAA 3BUAA 4F1PA 1TN8A 4JD2G 5BW8C 3DSWA 4N3BA 4F6RD 1S63A 4YDOA 5JJTA 2R17C 4AOFA 1HFAA 4U95D 4KVOA 3BG1B 3PRZA 3JYSA 2CG3A 2ZXWE 4LEUA 1QZ2A 4HOTA 3ZKJA 2P9SG 4URKA 4GZDA 4HXIA 1MYOA 4JVSA 1PY1A 4F7AA 2YHCA 4H7YA 2J4BA 4LNBA 2KM4A 2WXLA 3ZYMA 1DCEA 3ZVVA 1MX2A 3LY8A 4GYWA 4UI9J 5KJNA 4G1TA 1QYMA 3EIQC 5ANRA 1SZAA 3DRAA 4AXHA 1HU3A 4WNFA 1S64A 3CVNA 2VGEA 2KC7A 3FULA 2J8SD 1BD8A 2X6KA 2IFUA 3JXIA 1XGWA 2C2LA 3FTXA 2Y0BG 3C3RA 2OV8A 4ILHB 2OEWA 4B8CB 2VJ8A 3QDNA 5CMWA 3FEXA 4LRZA 3PS6A 3CSTA 2HYZA 4RLYA 2L6BA 4KZ0A 3LY7A 3CHSA 3L6AA 4B8AA 3C5RA 3ZYLA 4FHJA
chains in the Genus database with same CATH topology
1V54E 5B1AE 5B3SE 3ABLE 3AG2E 1OCCE 1V55E 2EIKE 3AG3E 3ABME 5B1BE 2EINE 3AG1E 2EIJE 3AG4E 2OCCE 3ASNE 2DYRE 2ZXWE 2DYSE 2EIME 1OCZE 3WG7E 2EILE 3ABKE 3ASOE 5IY5E 2Y69E 1OCOE 1OCRE 3X2QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 E;  5B1A E;  5B3S E;  3ABL E;  3AG2 E;  1OCC E;  1V55 E;  2EIK E;  3AG3 E;  3ABM E;  5B1B E;  2EIN E;  3AG1 E;  2EIJ E;  3AG4 E;  2OCC E;  3ASN E;  2DYR E;  2ZXW E;  2DYS E;  2EIM E;  1OCZ E;  3WG7 E;  2EIL E;  3ABK E;  3ASO E;  5IY5 E;  2Y69 E;  1OCO E;  1OCR E;  3X2Q E; 
#chains in the Genus database with same CATH topology
 3IHV A;  3CIA A;  2ZU6 B;  2J08 A;  3RO3 A;  4UUC A;  3PNT B;  4AV7 A;  3HXD A;  4BTA A;  3QJZ A;  3TWS A;  3QWV A;  3UQ3 A;  3UM3 A;  3ONK A;  5E75 A;  3B7B A;  3JCK C;  2OND A;  2LSV A;  4RVB A;  5ITZ F;  2P9P G;  3KSQ A;  3FUE A;  2GRM A;  4NRH B;  2ZIS A;  2HM8 A;  2BKK B;  4IYP A;  4I2W A;  3VLD A;  4J8E A;  4ANX A;  5CEA A;  2KCK A;  3FUJ A;  5ENO D;  2E0I A;  3ZU7 B;  2MHK A;  4BET A;  4I1M A;  5A7D B;  2WXR A;  3UM0 A;  3LYA A;  1GW6 A;  5HI7 A;  3P1U A;  4ILI A;  3ASH A;  2IJG X;  3HYM B;  4GMJ A;  2ZGG A;  4DK5 A;  5EX3 A;  5T3R A;  2WPV A;  4ILG A;  1JCR A;  1B89 A;  2WQ6 A;  5FZS A;  4YDW A;  3CVQ A;  1KT0 A;  4B0Z A;  3ZGQ A;  2Y4T A;  1NA3 A;  2KZT B;  5ARG A;  1TEZ A;  2BTD A;  4R7L A;  2F8X K;  3FDH A;  4APF A;  4GZ3 A;  5EIL A;  1X5B A;  4HLL A;  1H6P A;  1N52 A;  5BNW A;  2J4D A;  2VGX B;  2NXP A;  3Q79 A;  4NQ0 A;  3ASN E;  4HBD A;  4JB8 P;  4JEH A;  2WXG A;  5KCM A;  1HS6 A;  3Q4A B;  4GZ5 A;  1OCZ E;  2PM6 A;  4UQZ A;  3TJP A;  3HG0 D;  2PQR A;  3RIB A;  4N5C A;  1EPU A;  5ARF A;  3AS5 A;  3T5V A;  1OCC E;  4DLO A;  3CQC B;  3NF1 A;  5H7P A;  1WDY A;  2I9C A;  3E32 A;  3TAX A;  4IN3 B;  3TWU A;  4GCN A;  3DSU A;  4J8Y A;  4DX1 A;  2ION A;  2Q7F A;  5ENS D;  2OVF A;  4YVO A;  5ENN A;  4U8H A;  3PUK A;  4HRL A;  4WUY A;  4O1O A;  4WWO A;  2J09 A;  3O4Z A;  4PS8 A;  4DRX E;  2BUG A;  3ONL A;  4LUN U;  3S7J A;  1IHB A;  2C0M A;  4HRM B;  2DBA A;  4HOR A;  3HHM A;  1HZ4 A;  3LVR E;  1OT8 A;  4JXT A;  2B0O E;  3ZYQ A;  4HNA D;  3APD A;  3BEE A;  3CVW A;  2XRZ A;  3FU3 A;  4EPZ A;  4BFR A;  2RD0 A;  4CDN A;  2QYU A;  3CK7 A;  3GW4 A;  4AM9 A;  3SBS A;  3D9H A;  3V30 A;  2AXU A;  4EQF A;  4ANU A;  1L5J A;  4DI4 A;  2I1K A;  3G2S A;  4GZC A;  3FH7 A;  5AQA A;  1N9A A;  4U63 A;  4UWG A;  1K8K G;  2JEK A;  4N2Q A;  2CG2 A;  2GRP B;  5AAO A;  3AU4 A;  1UW4 B;  1G3N B;  3MA5 A;  3ZNG A;  3W9G A;  2DIW A;  2EIL E;  3GZS A;  3ZIM A;  1DNP A;  2LSU A;  3CSF A;  3PEV B;  5B1A E;  3UM2 A;  1QNF A;  1OWP A;  3EU9 A;  1HX8 A;  3EU5 A;  3PVL A;  5FQ7 A;  3CHQ A;  4G8L A;  4APO A;  2M63 A;  3UX4 A;  3PZ4 A;  2XPI A;  1SA4 A;  4G2V A;  2EIM E;  3NOC D;  1P5Q A;  4L23 A;  4GTM A;  3TG5 A;  4A1S A;  1S70 B;  5LOZ A;  2I6H A;  4ZFH A;  5FJY A;  1HG5 A;  4AEZ C;  4CGV A;  3UIO C;  5FQ8 A;  1N4R A;  5FIN A;  3D9N A;  3FUK A;  2WXK A;  1Z5S C;  3VTX A;  5A6C A;  1MJ0 A;  1SW6 A;  2L0T B;  3CV0 A;  2IOS A;  3FHE A;  3CR3 A;  4BX9 A;  3FTY A;  4TXQ A;  3QK0 A;  3EHR A;  3D9J A;  3S7B A;  4RG6 A;  3LS8 A;  3PUJ A;  3R9A B;  3FH5 A;  5FWQ A;  2YNQ A;  3GZ1 A;  3HXF A;  4NAC A;  1ZBP A;  4LCT A;  4B89 A;  2H6H A;  3APC A;  2DYR E;  2RFA A;  3DEO A;  5G55 A;  3Q9N C;  3T8M A;  3MCX A;  2VSX E;  2J49 A;  3SNX A;  5EN5 D;  3V2O A;  4GAA A;  5CED B;  3IXE A;  2WXP A;  3SY2 A;  5AN8 A;  3W9F A;  3ESK A;  4DPR A;  2J9Q A;  1D9S A;  3DST A;  4K5C A;  3CVL A;  2LXM A;  3AAA C;  4HRN A;  5G05 C;  3UIP C;  5KJM A;  2QYJ A;  3Q7F A;  4XI9 A;  3FFL A;  4MBG A;  4BWR A;  2LUH A;  2YQ8 A;  5DIZ A;  3AJI A;  4DX2 A;  3Q78 A;  4Q69 A;  4PH4 B;  2LXL A;  3QWP A;  3RSE G;  1INZ A;  3MKQ A;  3TWT A;  3VLE A;  2CHX A;  5EKQ D;  3PRE A;  4P29 A;  4FUL A;  2JAB A;  4J7W A;  4BES A;  2R02 A;  1YA0 A;  3FH8 A;  1N4S A;  4OAV B;  2MOW A;  4GTS A;  4HI9 A;  3Q73 A;  2BED A;  2FO7 A;  5JJ6 A;  3QWW A;  2GRL A;  4JPS A;  5EX0 A;  2PQN A;  2RG8 A;  3X2Q E;  5C1D A;  3AU5 A;  3PZD A;  5AQ7 A;  3FU0 A;  4AP2 A;  1HH8 A;  2P9U G;  3FUI A;  2XEH A;  4I9E A;  4TV3 A;  4WNE A;  2DVW A;  4HQD A;  5M72 A;  4GB9 A;  1ZU2 A;  2DWZ A;  2WXN A;  5BPP A;  4I1O B;  4TXP A;  3S7F A;  4EZJ A;  4ME2 A;  4G8K A;  4U0Z A;  3D3M A;  1WY6 A;  3UT4 A;  3VTY A;  3IKO B;  3NQP A;  2GRQ B;  3C3Q A;  3PZ3 A;  2E2E A;  1TJF A;  3JXJ A;  4AY5 A;  5AIJ A;  3LPZ A;  2KZT A;  5LCW C;  1S0P A;  3LVQ E;  1UN9 A;  4HI8 A;  3UTM A;  4N3A A;  3LY9 A;  4L2L A;  3FTW A;  1WAO 1;  4OAU C;  5CBN A;  3I5P A;  3SBT B;  4UI9 K;  3Q49 B;  3B7T A;  2WMO A;  2XS8 A;  3UI2 A;  2IF4 A;  5E76 A;  3UKU G;  2XPZ A;  4M7C A;  3TWV A;  4UWH A;  2IY0 C;  2F0Y A;  3PE4 A;  3HIZ A;  4BTB A;  3T9K A;  4BSX A;  3G2U A;  1SZ9 A;  3DXK G;  3IV0 A;  4CGW A;  4MRU A;  4GA2 A;  5D66 A;  5LP0 A;  3BU8 A;  2ILR A;  1V55 E;  3KS2 A;  3ML9 A;  2EIN E;  4DUI A;  4G25 A;  3B7S A;  5CBO A;  2WXJ A;  4ATZ D;  4UWK A;  1D8E A;  4KVM A;  4BER A;  4ANW A;  3MGB A;  4E6H A;  4DX5 D;  4LSZ E;  3IEG A;  3UT7 A;  1QBQ A;  2WXH A;  2XCB A;  3AG1 E;  4G23 A;  4L1B A;  2R05 A;  5CCL A;  4LG6 A;  4OVV A;  2Y4U A;  4XX5 A;  4L7T A;  2V5Q C;  3CVU A;  1H2V C;  4C9B B;  3C72 A;  4J8D A;  3V31 A;  1D8D A;  2F37 A;  5AJL A;  2X6J A;  4C0M A;  4N3C A;  4KMO A;  1E90 A;  5B3S E;  4I2Z A;  3ABL E;  2EIK E;  2P9N G;  2FO1 E;  2WVI A;  3U4T A;  1E7V A;  4A3T A;  4U04 A;  3KEZ A;  2WXM A;  1NZN A;  1PAQ A;  4L9P A;  3Q75 A;  3DXM G;  3LKU A;  2ZGD A;  5BV1 A;  3EUV A;  3CGH A;  4O1P A;  5LX8 A;  3NZS A;  3GZ2 A;  4OYS A;  2PZI A;  5G2N A;  1NA0 A;  3Q47 B;  2P9L G;  1BLX B;  1TYQ G;  5HRY A;  3CHR A;  2R2L A;  1LD7 A;  3E34 A;  4FA6 A;  1N54 A;  1NP7 A;  5EID A;  1K1B A;  1UN8 A;  2FBN A;  1N4Q A;  3OTN A;  5ENQ D;  4GU5 A;  4GPM A;  4JZY A;  3TG4 A;  4NIK A;  1LF8 A;  3DPY A;  2BKG A;  3LJ3 A;  4PS3 A;  1X81 A;  1Z6T A;  4GYY A;  3HVE A;  2AXZ A;  4GTV A;  3L22 A;  5EIB E;  4WNG A;  2V4H C;  3B95 A;  3CVP A;  1OUV A;  1H2T C;  3UM1 A;  2WQ7 A;  3MZL B;  1E8W A;  3Q5M A;  3OXF A;  1E96 B;  4N2S A;  4I1A A;  3AG3 E;  3CLJ A;  5DBK A;  3HXE A;  2KCV A;  2FEZ A;  4CCA A;  4JL0 A;  4U8Y D;  4RG9 A;  4WND A;  2MYO A;  4XI0 A;  4RSY A;  4Q94 A;  4K03 A;  2IO2 C;  3FEY A;  4A3V A;  1WM5 A;  3PZ1 A;  2AXV A;  2CFZ A;  4JC8 A;  1NFI E;  4TUM A;  4OVU A;  4V3I A;  2XRY A;  2XEN A;  2KCL A;  4BY6 A;  2HE0 A;  3PNL B;  3JUE A;  3SFX A;  2X6F A;  2WM9 A;  3D9P A;  4PDX A;  3LXU X;  4H7X A;  2IEJ A;  1UG3 A;  5JJ7 A;  3O48 A;  1UJK A;  3R9M A;  4XZ4 A;  5ENP D;  3ESL A;  4ACK A;  3PEU B;  4WWN A;  4DLQ A;  3DSS A;  1H6O A;  2IO3 C;  2V0P A;  1K1A A;  2L6J A;  1N4P A;  2NYJ A;  3CVV A;  4B93 B;  3RJV A;  3SF4 A;  5J08 A;  3ABM E;  4A63 B;  4FU3 A;  4MLP A;  1TN7 A;  5BXU A;  3FWV A;  3S7D A;  4U0S A;  4DJA A;  4GTR A;  3J5P A;  2XZT G;  4LER A;  4C0E A;  4XKB A;  1N11 A;  3B7R L;  3CK9 A;  3UKR G;  4ZHB A;  2NC9 A;  3U64 A;  3SFY A;  2XEE A;  3LDZ A;  2AJA A;  5G05 J;  4ANV A;  2VSY A;  2UY1 A;  3LCA A;  2XGM A;  4J0U A;  2L9B A;  4HS2 A;  3Q7A A;  4G11 A;  2VSN A;  5KWD A;  3UT8 A;  5KBA A;  4FAD A;  1QQE A;  3TWX A;  1BI8 B;  4TXR A;  4EZK A;  1YCS B;  3E30 A;  3E4B A;  2DCP A;  1JWG A;  1U3C A;  2B6C A;  2LO6 A;  3FU5 A;  3BQO A;  5A23 A;  4Y6C A;  5JA4 D;  1N95 A;  4I43 A;  1OCR E;  3SQV A;  4FLB A;  1KZO A;  1PC2 A;  4K5B A;  3I4R B;  3NOG D;  5JMN D;  2VQ2 A;  1FT2 A;  2GGF A;  2MRI A;  3TWW A;  4Z68 A;  1DCQ A;  2EIJ E;  3D9O A;  5KNH D;  5T8I A;  1BU9 A;  3ULE G;  2WXI A;  3UMV A;  1O1R A;  2IOL A;  1TNB A;  3CKC A;  2R5S A;  3ZYK A;  3HVE B;  3L54 A;  3ML8 A;  3QAR A;  4KYO B;  3G2W A;  2HO1 A;  4QFV A;  5BT1 A;  4BT8 A;  4A1G A;  2RKK A;  1ELW A;  3E33 A;  2XCC A;  1OCO E;  3ZHE A;  2HR2 A;  3G2V A;  1ELR A;  2WQH A;  2QFC A;  4PS7 A;  3I3N A;  3R7Q A;  3DWL G;  1WG0 A;  3CEQ A;  1E8Z A;  5EYP F;  3MEK A;  2VYI A;  3ZN3 A;  2XQ0 A;  1E7U A;  4FLH A;  2OEV A;  4O60 A;  1FCH A;  2J07 A;  3B7U X;  4UWL A;  1N0Q A;  1TR4 A;  2QC9 A;  1MZC A;  2Y69 E;  4C48 B;  3CK8 A;  5ANL A;  3D9K A;  3DSV A;  4BX8 A;  2Y3A A;  2L0I A;  2QY7 A;  3G2T A;  3OXL A;  3U3W A;  5G04 J;  2FF4 A;  2LAH A;  2ZIR A;  1HF8 A;  4UQX A;  3C98 A;  4UQY A;  1JCQ A;  1KZP A;  3CKB A;  3UUX A;  1MHQ A;  4DX7 D;  4QQI A;  3RRM B;  3ZEF A;  3ZHE B;  3RRN B;  5B1B E;  5FQ6 A;  4ABN A;  1H6K A;  3R7R A;  1Z3Y A;  3EJN A;  4AVX A;  1NI1 A;  4I6E A;  3UIN C;  3CVY A;  5FIO A;  4G26 A;  4YND A;  3MKR A;  5D2M C;  5LFA A;  4U8V D;  4GA0 A;  3EHQ A;  4J6I A;  2KAT A;  1FVF A;  1YMP A;  4YDE A;  4FP7 A;  3Q15 A;  1SQM A;  2WXO A;  3KAE A;  4B94 A;  1VDY A;  3MYV A;  4FC8 A;  5AEN A;  4JA9 A;  3TXM A;  1H19 A;  1OWO A;  2LAI A;  2YHE A;  1N94 A;  2X3M A;  1FT1 A;  3ZFW A;  5EDS A;  4CYM D;  4Y6W A;  5G04 C;  2GW1 A;  4K0R A;  4BSZ B;  3TXN A;  3L9T A;  3SO8 A;  3L17 A;  5AQB A;  3FTS A;  3AS4 A;  3QKY A;  1KPS B;  2DYS E;  4GMR A;  4O6F A;  3SZ7 A;  1NL4 A;  4FHK A;  5KJK A;  5KJL A;  1K3Z D;  3FTV A;  4CDM A;  1BI7 B;  1BPO A;  2LNI A;  4IUL A;  1YYH A;  3TGO A;  1MQS A;  4GPK A;  3UPV A;  3KEA A;  3ASF A;  1FVH A;  4HVB A;  4JW1 A;  4GML A;  3PDN A;  1EDU A;  1AP7 A;  3APF A;  3ENE A;  2I1J A;  2BF0 X;  4U07 A;  1Z3X A;  5KNG A;  5BXO A;  1HO8 A;  1TN6 A;  5D0Q D;  1EYH A;  3SFZ A;  3KSL A;  1KT1 A;  2H6I A;  3JQ1 A;  4WWP A;  1H2U A;  4XEI G;  3FUN A;  4HOU A;  5AJD A;  1UOH A;  3EDT B;  1OWL A;  2A4Z A;  1O1T A;  3CQG B;  3L08 A;  4U0U A;  5CMY A;  4EEC A;  1IHG A;  4L2Y A;  1HG2 A;  5AAR A;  4U96 D;  4WAF A;  4NUR A;  3AG4 E;  4CZ2 D;  3V2X A;  3EIJ A;  3D9I A;  3QOU A;  3RKV A;  2XEV A;  3HDX A;  4TUU A;  1IYG A;  2AVP A;  2R59 A;  3NZU A;  1SVX A;  2ETC A;  3HXB A;  2GRO B;  3ZUV B;  5C2Y A;  3NAW A;  1Q2Z A;  3RAU A;  3QC1 A;  1MX4 A;  3OAW A;  4XE0 A;  3SGH A;  4CEM A;  3FUD A;  2R03 A;  5CCM A;  4ACL A;  3TWQ A;  1HE8 A;  3TL5 A;  3FUH A;  2OOE A;  4PUC A;  4D10 C;  3MKQ B;  1TNU A;  4FJY A;  3P2B A;  1JUQ A;  1OY3 D;  3F6Q A;  2XS1 A;  5FZQ A;  2VGX A;  3ZXP A;  3LJN A;  2PL2 A;  2EQX A;  5CRV A;  4UI9 C;  3ULY A;  3JUI A;  4AIF A;  3SD5 A;  3N71 A;  5LCW J;  2VGY A;  4MS6 A;  1EF1 C;  3FU6 A;  3UXG A;  4DI3 A;  3U9W A;  3I4G A;  2F8Y A;  3QAQ A;  4F1S A;  2XHE A;  4G24 A;  2CFU A;  3NBN B;  3T5X A;  2AWI A;  1TNZ A;  4M3O A;  4AY6 A;  3FUF A;  3B13 A;  4JHJ A;  1DVP A;  3MX3 A;  4RQI A;  3EHM A;  1V54 E;  3U66 A;  2VSO E;  3Q9U C;  2AW6 A;  2XGS A;  4CT4 A;  3TWR A;  2P9I G;  3CHO A;  1W3B A;  2XGO A;  3S2A A;  5FTP A;  1OWM A;  3DPD A;  3E37 A;  3ASO E;  3L16 A;  3CHP A;  3NB2 A;  4YVQ C;  2C0L A;  4XIF A;  4Q96 A;  1RZ4 A;  3EHN A;  5JHB A;  4GCO A;  4XKC A;  3D9L A;  1E8Y A;  4W9R A;  3URZ A;  3ISM C;  5HS0 A;  4AJW A;  5BUZ A;  3PE3 A;  2X6H A;  2X38 A;  1ELK A;  3ZRH A;  5FZR A;  3ULQ A;  4HLE A;  2CHW A;  4KT6 B;  4IRU A;  1TNO A;  2WMN A;  4GYO A;  2PM7 A;  2Y1L E;  3L13 A;  2OCC E;  3QNK A;  1Y6I A;  3DSX A;  5HKP A;  2DZO A;  1MX6 A;  3ZPJ A;  3IBE A;  3FUM A;  1JWF A;  1Y8M A;  4I9C A;  3PH0 C;  3ASD A;  4EHM A;  2UY1 B;  2YIN A;  4GA1 A;  2XZD G;  1U3D A;  4I17 A;  2IU1 A;  3T8K A;  1LD8 A;  2X6I A;  4GTT A;  3RRU A;  4KXK B;  5CEC B;  4HOQ A;  3MV3 B;  2A5U A;  2PNN A;  1KLX A;  1A5E A;  1IQR A;  1H0A A;  4JA7 A;  4BT9 A;  2DZN A;  2H6F A;  3L82 A;  3DBS A;  5T4Y A;  3SI5 A;  4JHK A;  4BEP A;  3D9M A;  1IXV A;  4U7E B;  1AWC B;  4EBA G;  1RW2 A;  4UWF A;  3WG7 E;  5BV0 A;  3FP3 A;  5FT9 A;  4E85 A;  2KBX A;  5CHE E;  4EZL A;  4FJZ A;  2KXP C;  3VLF A;  4GTQ A;  4K5A B;  3GYZ A;  3LEW A;  5ENR D;  4LNU D;  4X8Q A;  4ATG A;  4MKT A;  4I6G A;  1ZB1 A;  4CT0 A;  5AQ9 A;  2P2C P;  2VTB B;  2V5F A;  4KZC A;  4CRW A;  5EYL A;  1IKN D;  3V79 K;  1IQU A;  3ZW3 A;  2QZA A;  2JLB A;  2WXF A;  5ENT D;  2ETA A;  4JEU A;  5FQ4 A;  2NSZ A;  1JCS A;  3QB2 A;  2P9K G;  1OXJ A;  5JHA A;  4YDY A;  2V4L A;  2ETB A;  3JQ0 A;  2GRN B;  3MV2 B;  3CVX A;  3C3O A;  5IY5 E;  5J90 A;  3OXG A;  3FY4 A;  3BG0 B;  4JHR A;  1HXI A;  3CHM A;  3RU0 A;  4GZ6 A;  4DX6 D;  4N39 A;  4A55 A;  1E8X A;  3AS8 A;  5CRU A;  4HB5 A;  3SHF A;  1TJC A;  3ZXS A;  3HXC A;  2FUL A;  5CER B;  3IHY A;  4J8F A;  1OWN A;  3DEP A;  4F53 A;  3KD7 A;  4GTP A;  1LTX A;  1JPL A;  3K9I A;  1DC2 A;  4LNG A;  4HOS A;  4GTO A;  4F3V A;  2OVB A;  3ABK E;  2V8S E;  3HRA A;  4I6J A;  2P58 C;  4J8S A;  1FPP A;  4CDR A;  2XPY A;  3AG2 E;  5AYW D;  5HQ8 A;  1A17 A;  3ASG A;  2A5E A;  2CHZ A;  3J5Q B;  3FTU A;  5D0O D;  1XNF A;  2GRR B;  4HFG A;  1O5M A;  4N5Q A;  3PZ2 A;  3WXX A;  3RO2 A;  2RFM A;  1O1S A;  3MJW A;  2UWJ G;  3FTZ A;  1TNY A;  2VTB A;  1U2V G;  2I2O A;  1N0R A;  2IQC A;  2FI7 A;  4KBQ A;  4TRQ A;  2H6G A;  2WB2 A;  1UJJ A;  1SA5 A;  3RK6 A;  2WXQ A;  4EBA A;  3BUA A;  4F1P A;  1TN8 A;  4JD2 G;  5BW8 C;  3DSW A;  4N3B A;  4F6R D;  1S63 A;  4YDO A;  5JJT A;  2R17 C;  4AOF A;  1HFA A;  4U95 D;  4KVO A;  3BG1 B;  3PRZ A;  3JYS A;  2CG3 A;  2ZXW E;  4LEU A;  1QZ2 A;  4HOT A;  3ZKJ A;  2P9S G;  4URK A;  4GZD A;  4HXI A;  1MYO A;  4JVS A;  1PY1 A;  4F7A A;  2YHC A;  4H7Y A;  2J4B A;  4LNB A;  2KM4 A;  2WXL A;  3ZYM A;  1DCE A;  3ZVV A;  1MX2 A;  3LY8 A;  4GYW A;  4UI9 J;  5KJN A;  4G1T A;  1QYM A;  3EIQ C;  5ANR A;  1SZA A;  3DRA A;  4AXH A;  1HU3 A;  4WNF A;  1S64 A;  3CVN A;  2VGE A;  2KC7 A;  3FUL A;  2J8S D;  1BD8 A;  2X6K A;  2IFU A;  3JXI A;  1XGW A;  2C2L A;  3FTX A;  2Y0B G;  3C3R A;  2OV8 A;  4ILH B;  2OEW A;  4B8C B;  2VJ8 A;  3QDN A;  5CMW A;  3FEX A;  4LRZ A;  3PS6 A;  3CST A;  2HYZ A;  4RLY A;  2L6B A;  4KZ0 A;  3LY7 A;  3CHS A;  3L6A A;  4B8A A;  3C5R A;  3ZYL A;  4FHJ A; 
#chains in the Genus database with same CATH homology
 1V54 E;  5B1A E;  5B3S E;  3ABL E;  3AG2 E;  1OCC E;  1V55 E;  2EIK E;  3AG3 E;  3ABM E;  5B1B E;  2EIN E;  3AG1 E;  2EIJ E;  3AG4 E;  2OCC E;  3ASN E;  2DYR E;  2ZXW E;  2DYS E;  2EIM E;  1OCZ E;  3WG7 E;  2EIL E;  3ABK E;  3ASO E;  5IY5 E;  2Y69 E;  1OCO E;  1OCR E;  3X2Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...