2EIJE

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eijE00
2EILE 3AG1E 5B1AE 3X2QE 5B3SE 5B1BE 2DYSE 1OCZE 3ABME 3ASOE 2DYRE 3AG2E 2Y69E 2EIJE 3ABKE 2EIME 1V54E 2ZXWE 1V55E 2EINE 2OCCE 2EIKE 3AG3E 3AG4E 3WG7E 1OCOE 1OCCE 3ABLE 5IY5E 1OCRE 3ASNE
chains in the Genus database with same CATH superfamily
2ETBA 4AEZC 3CSTA 1OT8A 2RKKA 2WXRA 4JHKA 3GZSA 4JPSA 3AS4A 2IO3C 3DWLG 4RG9A 2X6IA 5AQAA 1MX2A 4GU5A 4DPRA 5JJ7A 2WB2A 3SY2A 3DSVA 3LY7A 1SW6A 4BTAA 1IXVA 2ZIRA 3MJWA 3O4ZA 1YMPA 4NURA 4UWFA 2UY1A 4XI9A 4YDWA 1JCRA 4JD2G 3PVLA 5AYWD 3CVNA 2DZOA 5CRUA 2E2EA 2J8SD 2FO1E 2MRIA 3SFZA 1N0QA 1MX6A 4X8QA 4WWOA 3CKCA 3JXIA 2CHZA 3ZYKA 3VLDA 1SVXA 3DEPA 2GW1A 4J8YA 2FULA 3HVEA 5BXOA 1HZ4A 1JUQA 3PE3A 3C98A 4RSYA 2ZGDA 4YDOA 5ENRD 4J8EA 3UUXA 3NZUA 3ML8A 4U8YD 5FIOA 3F6QA 5CBOA 2P9KG 2LXLA 5D0OD 3ENEA 5M72A 2OEVA 2LSVA 5ENOD 4C48B 3P2BA 3E33A 4EPZA 1D8DA 2XEHA 1HFAA 4JEUA 4XEIG 1FT1A 1HX8A 1Z5SC 4MKTA 4L2LA 3U66A 3APDA 3IXEA 4GTRA 2XS8A 4K0RA 3PREA 3I3NA 3LVRE 4L7TA 2E0IA 4KYOB 1H2VC 2WPVA 3ISMC 4AXHA 4BFRA 3V79K 3R9MA 4XIFA 4FHKA 4BY6A 1U3DA 2WXNA 5EIBE 2YQ8A 2VGXA 5AQBA 3ZKJA 4NRHB 2WXIA 2ZISA 2XCBA 3UINC 5AJDA 1N4PA 1E8YA 5KJKA 1YA0A 4B8AA 3JQ0A 5JA4D 5KNHD 5KWDA 3RK6A 4GMRA 3FFLA 1SA5A 3EJNA 2RG8A 4OYSA 3MCXA 3R9AB 2QZAA 3B7SA 3ULQA 4O60A 3FU0A 1ZB1A 5G04J 4U8VD 1DNPA 5BV1A 3U3WA 4KMOA 3RO2A 1TNBA 5A7DB 2VYIA 3ZHEB 2X38A 3DXMG 2LUHA 1UJJA 5ENNA 1HF8A 3ZUVB 4PUCA 2FI7A 2VSXE 3OTNA 1PC2A 3MV2B 3G2VA 2KZTB 1HO8A 3ZU7B 2AW6A 3CIAA 5B3SE 2HE0A 1OY3D 4A63B 4CEMA 3FHEA 3OXLA 3N71A 5LOZA 3CK9A 3UXGA 4EHMA 3UKRG 5CHEE 2MYOA 4C0EA 3IKOB 4HORA 1KZPA 2EILE 5D66A 3ASOE 4C0MA 1ZBPA 4LCTA 1X5BA 2Q7FA 4B0ZA 4DX5D 3PUJA 5BT1A 1MZCA 2R17C 2F8YA 4GZ3A 4MBGA 4LEUA 3D9MA 2BUGA 3C3RA 1D8EA 1S0PA 2P9LG 3NQPA 1O5MA 2X3MA 1OXJA 4AY6A 4TRQA 1TN6A 2I2OA 3UT7A 4FA6A 4G8LA 2WQ6A 5G2NA 4GTSA 5FQ7A 5J90A 3DBSA 4GZ6A 5JMND 3ASDA 4WNDA 2AXUA 2F8XK 4BT9A 3KSLA 3QWWA 2YINA 3EHRA 3Q75A 2DBAA 2X6FA 2I9CA 2Y69E 2JEKA 5HI7A 4ANXA 2DIWA 3SQVA 1KT1A 2WXQA 4U0ZA 4ILGA 4LERA 1OWMA 4EZJA 3UT8A 4N2SA 3GZ1A 5T4YA 5LCWC 4TXPA 2Y4TA 1QZ2A 4N3AA 4JHJA 2WXKA 4I9EA 5ANRA 1Z3XA 4DLQA 1WG0A 5C2YA 3CVLA 4JXTA 4DLOA 5ANLA 4TXRA 3VTYA 4BX8A 3ASFA 3ABME 5KBAA 3FUEA 4HI8A 3FUHA 4FP7A 3CV0A 4RQIA 2GROB 3CR3A 1NFIE 3T5VA 2A5EA 4N2QA 3QARA 3E34A 3ZGQA 2RD0A 4DI4A 1OUVA 2A4ZA 4Q94A 3JYSA 5ENSD 4CGWA 3EIJA 4XX5A 5KJMA 1ZU2A 2WXLA 3I5PA 4FLBA 1S70B 1U3CA 4CGVA 1HH8A 4YDEA 2MOWA 3DEOA 4I2WA 3U9WA 2BEDA 3ZFWA 3L13A 2BF0X 3OXGA 4N5CA 5EYLA 3ABKE 3CHQA 3U4TA 3D9OA 3PNTB 2ZU6B 4GYWA 3CHMA 4I6GA 3LDZA 1EF1C 2WM9A 3TWUA 4PS8A 1K3ZD 5A23A 5LP0A 3KS2A 4U07A 3CLJA 3UM1A 3FUDA 2VJ8A 4GZCA 1X81A 2XPIA 4QQIA 1K1AA 3NOCD 4FC8A 2P9PG 4HB5A 3QKYA 1TYQG 5EKQD 3E30A 1TNYA 1N52A 3DSSA 3PEUB 2Y1LE 3I4GA 3LPZA 4OAVB 4DK5A 3D9IA 3MV3B 4FJYA 4KXKB 4JA7A 3B7TA 4N3BA 5BW8C 1XGWA 3KEZA 3LS8A 3W9GA 3ZPJA 4GB9A 3RRMB 3TWTA 5E76A 2I1KA 3FH7A 3U64A 1TNOA 2XZTG 4PH4B 1HG2A 3DSXA 4UI9K 5T3RA 4ATZD 3G2SA 4XKCA 2OCCE 4UWGA 2A5UA 1N4RA 2JABA 4GPMA 4LNBA 3PDNA 4F1SA 4A3TA 3HXCA 4BSXA 4KZ0A 4WUYA 1E96B 3HYMB 2EIJE 3BU8A 3WXXA 1QBQA 2L9BA 5EDSA 1JCSA 3L17A 1H6KA 1MHQA 3TWWA 2VSNA 4UI9C 5AIJA 3L22A 5HQ8A 3JQ1A 3DSUA 4WNFA 3JCKC 2Y4UA 4GPKA 4CT0A 1Y8MA 4U04A 3Q7FA 3SF4A 4FLHA 4CYMD 2R59A 4L9PA 2R05A 5CERB 3PZ1A 4AJWA 4GTOA 4JHRA 5CCLA 5D0QD 3SGHA 2KBXA 4U95D 5B1BE 4I1OB 4JB8P 4KT6B 4U96D 1N94A 2VSYA 4WWPA 3P1UA 4XKBA 4JA9A 1OWNA 2LO6A 2P9SG 1WAO1 3B7UX 2Y3AA 2VTBA 3CSFA 3C3QA 2XENA 2QYJA 3UT4A 4HXIA 4O1OA 1QYMA 5AN8A 4UWHA 5G05C 2HO1A 5ENTD 4F1PA 3BUAA 2XGMA 3RSEG 3E37A 3GW4A 4JVSA 2XZDG 2WMNA 3V2XA 2EIME 3TXNA 3EIQC 2IO2C 1NL4A 4RLYA 3B13A 3T9KA 4HRLA 1H6OA 3G2WA 4CDRA 4DI3A 1A17A 4Q69A 1E8XA 3FUNA 3RU0A 4AM9A 2WXPA 5AQ9A 4BX9A 3UM2A 5CRVA 3MEKA 1UW4B 4YDYA 2PQNA 3Q79A 2J9QA 3QDNA 3ESKA 3FUJA 3Q5MA 2XQ0A 2J09A 4GMJA 2HR2A 5ARGA 1WDYA 4G8KA 5BPPA 4FJZA 3ABLE 3Q78A 1AP7A 1TN7A 2P58C 2LAHA 4QFVA 3UM3A 3PE4A 3MKQB 2GRPB 2WMOA 3PZ3A 3CVWA 5G05J 5FT9A 1GW6A 5KCMA 3WG7E 3ZN3A 4MRUA 3IV0A 3CVXA 4BERA 3FTVA 4ZHBA 1N4SA 4G24A 1O1SA 1MYOA 2R2LA 4GMLA 3NZSA 3VLFA 4B8CB 3D3MA 1U2VG 3I4RB 3C72A 2CG3A 2QYUA 3L08A 2P9UG 3LJNA 3LXUX 3ZVVA 3SFYA 4J7WA 3GZ2A 3ESLA 5B1AE 3CHSA 3RRNB 3EHNA 1K8KG 3DXKG 3HXBA 4L1BA 3LVQE 2OOEA 4O6FA 4J8FA 2B0OE 4A1GA 1LD7A 1INZA 5AQ7A 1OCZE 3LCAA 2P9NG 1S64A 2DZNA 2EINE 3AU4A 3ML9A 4A1SA 3TWQA 5AENA 5EX0A 2JLBA 4HOTA 1ELWA 1IHBA 3L54A 4G23A 5EIDA 3ONLA 3URZA 4GTPA 3CKBA 4G1TA 2XS1A 1E8WA 4GTQA 2CFZA 4EBAG 2LXMA 3BG0B 4CDNA 1IYGA 3IHYA 1MJ0A 2GRMA 1EDUA 4KVOA 3S7FA 3R7QA 2PQRA 1EPUA 3L9TA 5FJYA 2BTDA 1TEZA 4H7YA 2H6IA 3S7BA 3DPDA 3IEGA 1JWFA 3FU6A 2PNNA 5CEAA 2GRRB 3HG0D 1Z6TA 4F3VA 2H6FA 3DRAA 3DSTA 2CG2A 2YHEA 3ONKA 4HFGA 4U8HA 5EYPF 4U0UA 3D9NA 4I2ZA 3RKVA 3AU5A 2CHXA 3TL5A 1XNFA 5KNGA 3Q7AA 2KCKA 2VGYA 4TXQA 2XCCA 3UM0A 3NOGD 3HXDA 2WXFA 4I1MA 4LNUD 1V54E 3RAUA 2PM7A 2OV8A 4ILHB 4FHJA 3FH5A 2F37A 2F0YA 2C0LA 2IQCA 2NYJA 3E32A 3KD7A 3Q9NC 3QOUA 1E90A 4AIFA 1W3BA 3Q15A 4HOSA 3AS8A 3FH8A 2RFAA 3TAXA 2J4DA 2UY1B 5AARA 5HKPA 3L82A 1DC2A 3UI2A 5FTPA 3MZLB 4G11A 4IN3B 3ZHEA 4L23A 1QQEA 3TWSA 2V5QC 4CCAA 2DYRE 2X6HA 2RFMA 2LSUA 4GCNA 3SFXA 3HDXA 2VQ2A 2KZTA 3QC1A 1Y6IA 2MHKA 5CCMA 1BI8B 4GA0A 3QK0A 4OAUC 1VDYA 4L2YA 3JXJA 3FUFA 1UOHA 3HVEB 1A5EA 3UMVA 4EQFA 1KLXA 1KT0A 4UWLA 2QFCA 1Q2ZA 2NXPA 4AY5A 4ANVA 2CFUA 2C2LA 2AWIA 4UQZA 1LD8A 3V2OA 1BD8A 4G2VA 5LCWJ 4WAFA 5C1DA 5FINA 2IJGX 2EQXA 3KAEA 4I9CA 2DYSE 1FVHA 4ANWA 4DX1A 3EHMA 3RO3A 1YCSB 2IOSA 3IHVA 3FDHA 2GRQB 3TG5A 3UKUG 3QWPA 3CHPA 4HRMB 3NF1A 4HBDA 2XHEA 4DX7D 1PAQA 2AJAA 5DIZA 4BEPA 4A3VA 1OWLA 1MQSA 1SA4A 4RVBA 3V31A 4HVBA 2VGEA 4GTVA 4HI9A 3ZW3A 3FP3A 3D9JA 1JCQA 2EIKE 2WXHA 3AG4E 3OAWA 3FUMA 5FZSA 4BT8A 3CVPA 1OCCE 3DSWA 4ZFHA 5BNWA 2ILRA 1ELKA 2KC7A 2OVFA 4Q96A 3TGOA 4GA2A 1UJKA 3HIZA 4CRWA 5JJTA 4K5AB 2PM6A 1BI7B 2QC9A 2VGXB 4UQYA 4J8DA 3MKRA 2KM4A 4CZ2D 4BWRA 3AG1E 3ASHA 4JZYA 2UWJG 2V0PA 5DBKA 3HRAA 2YHCA 4DX2A 4ACKA 4M3OA 4KVMA 3BEEA 3FTWA 3GYZA 3B7RL 5EN5D 2IU1A 3J5QB 2V8SE 2PZIA 1G3NB 4FU3A 4B89A 4OVUA 4WNEA 1KPSB 3PZ2A 2IFUA 3EHQA 1K1BA 4HLLA 4E6HA 3ASNE 1LF8A 2DCPA 2IOLA 2KATA 3UIOC 3J5PA 4B93B 2V4LA 4J0UA 3TWVA 3FTUA 3AAAC 4Z68A 3QAQA 4EZLA 5HS0A 3CHOA 2R02A 3SZ7A 2XEEA 3CEQA 3SHFA 3DPYA 1NZNA 1TJCA 3PUKA 4TV3A 3FULA 1E7UA 4JL0A 3RIBA 4IYPA 4WNGA 3Q47B 3ZXSA 4C9BB 4MS6A 3AG3E 2FF4A 5JHBA 2XGSA 4UQXA 5KJLA 3ULEG 3APCA 3PEVB 3IBEA 1HS6A 1BLXB 3FY4A 4FADA 1BU9A 1V55E 1HXIA 1H19A 2QY7A 3SBSA 5LFAA 4I43A 2XPZA 5T8IA 4ME2A 4DUIA 3ZXPA 5FWQA 3VTXA 3Q73A 4WWNA 4GCOA 2VSOE 2B6CA 4GYYA 2H6HA 4LG6A 3SI5A 3RJVA 3FTZA 2KCLA 3SBTB 4LRZA 3MYVA 1HU3A 4J8SA 3FTYA 3CQCB 4UI9J 1SQMA 3EUVA 4EECA 4LUNU 2XRYA 3D9LA 4FULA 2V5FA 1E7VA 3OXFA 3CVYA 3KSQA 3K9IA 4E85A 4K5CA 3PNLB 4U7EB 4ANUA 5AJLA 2ETAA 5G04C 3R7RA 5ARFA 1DCEA 2ETCA 3APFA 1OWPA 3EU5A 3JUEA 3FTSA 1N4QA 3MGBA 3LEWA 2LNIA 3FU5A 1IQRA 4CT4A 2Y0BG 4BTBA 2AXZA 2L0IA 1H2TC 1L5JA 2FEZA 2IEJA 1RZ4A 3SD5A 3Q4AB 4O1PA 5EILA 5J08A 3QB2A 3HXFA 5CMYA 3PH0C 4GTTA 4XZ4A 1OCOE 3NBNB 3QWVA 4DRXE 1IQUA 2I1JA 4I17A 1P5QA 2AXVA 3KEAA 4JC8A 2ZXWE 1D9SA 3MA5A 3MX3A 5FZRA 2DWZA 5CECB 3UX4A 2GGFA 1TNZA 3UPVA 2KXPC 2IONA 4BETA 3JUIA 4ACLA 1BPOA 2WVIA 5FZQA 4YVQC 2YNQA 4M7CA 2XPYA 2FBNA 1NP7A 4GA1A 4AV7A 2ZGGA 4AP2A 1DVPA 5JJ6A 3TWXA 1O1RA 5CEDB 3BG1B 2X6JA 3T8KA 4CDMA 1WM5A 1SZ9A 1NA0A 5G55A 4AOFA 1UN8A 2FO7A 3C3OA 4EBAA 4N39A 1N54A 2DVWA 3E4BA 4BSZB 1TJFA 3LJ3A 5ENQD 1HE8A 4YVOA 1JPLA 3AJIA 5BUZA 5EX3A 3CVVA 4GTMA 5HRYA 4B94A 2PL2A 3S7DA 2KCVA 4GAAA 4U0SA 1NI1A 3PZDA 3BQOA 4OVVA 3UQ3A 3FUIA 3D9HA 3G2TA 4G26A 2I6HA 4JW1A 3SO8A 1TN8A 4F7AA 3G2UA 3PRZA 4N5QA 1UG3A 3NAWA 3C5RA 5ITZF 5AAOA 1NA3A 3V30A 2L0TB 4APOA 2IY0C 4KZCA 4XI0A 2X6KA 1MX4A 4YNDA 4HS2A 4GZDA 3B95A 4UUCA 5JHAA 3S2AA 4DJAA 4H7XA 4LSZE 4U63A 4TUMA 4HLEA 3ZIMA 5CMWA 1OCRE 5D2MC 3FTXA 2XEVA 3HHMA 1E8ZA 4UWKA 5KJNA 1WY6A 4A55A 3ZNGA 1O1TA 2GRNB 3PZ4A 3EU9A 2WXMA 4EZKA 1FT2A 4F6RD 2WQHA 4P29A 3LKUA 3L16A 3VLEA 2V4HC 2BKGA 1ELRA 1N9AA 2WXJA 4K5BA 3SNXA 3ZRHA 1AWCB 1H0AA 5FQ6A 2XGOA 1PY1A 2L6JA 1QNFA 1H6PA 4GYOA 4PS3A 4RG6A 5CBNA 2NC9A 4GZ5A 2HYZA 5E75A 4IRUA 4ABNA 3MKQA 3FEXA 4NACA 4W9RA 2WXOA 3L6AA 2M63A 5FQ4A 4AVXA 2J49A 1Z3YA 5LX8A 1FCHA 4PDXA 4Y6CA 2J4BA 3S7JA 3LYAA 2BKKB 2NSZA 3Q49B 1TR4A 4HQDA 3T8MA 3CGHA 4TUUA 3X2QE 1FVFA 3CVQA 1UN9A 3QNKA 1H2UA 3PS6A 2P9IG 4N3CA 3EDTB 1OWOA 3W9FA 1N11A 1KZOA 3FU3A 1DCQA 3ZYMA 1HG5A 4DX6D 2C0MA 3UIPC 2R03A 3TJPA 4PS7A 2VTBB 2OVBA 3LY8A 1FPPA 4HOUA 4URKA 3RRUA 2J07A 3O48A 4HNAD 3TXMA 2R5SA 1S63A 1EYHA 3AS5A 4F53A 2LAIA 3QJZA 4XE0A 3ASGA 1JWGA 4JEHA 5BXUA 2WQ7A 3ULYA 4APFA 2H6GA 3CQGB 3NB2A 3B7BA 3HXEA 4MLPA 4LNGA 2ONDA 3CK8A 4J6IA 2J08A 2HM8A 3CK7A 5A6CA 3UTMA 4V3IA 1IHGA 4ILIA 4ATGA 5ENPD 5H7PA 3TWRA 1N0RA 1IKND 4I6JA 3D9PA 3ZYQA 4HOQA 4G25A 2WXGA 2CHWA 2P2CP 3CHRA 5FQ8A 3FEYA 4D10C 4R7LA 1B89A 4NIKA 2IF4A 3T5XA 4IULA 5BV0A 3FUKA 4NQ0A 1RW2A 4K03A 4I1AA 4I6EA 2L6BA 3LY9A 3Q9UC 1SZAA 3ZEFA 1N95A 3CVUA 3AG2E 1TNUA 3FWVA 2AVPA 1YYHA 3TG4A 4BESA 3ZYLA 3D9KA 1LTXA 2OEWA 4Y6WA 4KBQA 2GRLA 2XRZA 5IY5E 4HRNA
chains in the Genus database with same CATH topology
2EILE 3AG1E 5B1AE 3X2QE 5B3SE 5B1BE 2DYSE 1OCZE 3ABME 3ASOE 2DYRE 3AG2E 2Y69E 2EIJE 3ABKE 2EIME 1V54E 2ZXWE 1V55E 2EINE 2OCCE 2EIKE 3AG3E 3AG4E 3WG7E 1OCOE 1OCCE 3ABLE 5IY5E 1OCRE 3ASNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL E;  3AG1 E;  5B1A E;  3X2Q E;  5B3S E;  5B1B E;  2DYS E;  1OCZ E;  3ABM E;  3ASO E;  2DYR E;  3AG2 E;  2Y69 E;  2EIJ E;  3ABK E;  2EIM E;  1V54 E;  2ZXW E;  1V55 E;  2EIN E;  2OCC E;  2EIK E;  3AG3 E;  3AG4 E;  3WG7 E;  1OCO E;  1OCC E;  3ABL E;  5IY5 E;  1OCR E;  3ASN E; 
#chains in the Genus database with same CATH topology
 2ETB A;  4AEZ C;  3CST A;  1OT8 A;  2RKK A;  2WXR A;  4JHK A;  3GZS A;  4JPS A;  3AS4 A;  2IO3 C;  3DWL G;  4RG9 A;  2X6I A;  5AQA A;  1MX2 A;  4GU5 A;  4DPR A;  5JJ7 A;  2WB2 A;  3SY2 A;  3DSV A;  3LY7 A;  1SW6 A;  4BTA A;  1IXV A;  2ZIR A;  3MJW A;  3O4Z A;  1YMP A;  4NUR A;  4UWF A;  2UY1 A;  4XI9 A;  4YDW A;  1JCR A;  4JD2 G;  3PVL A;  5AYW D;  3CVN A;  2DZO A;  5CRU A;  2E2E A;  2J8S D;  2FO1 E;  2MRI A;  3SFZ A;  1N0Q A;  1MX6 A;  4X8Q A;  4WWO A;  3CKC A;  3JXI A;  2CHZ A;  3ZYK A;  3VLD A;  1SVX A;  3DEP A;  2GW1 A;  4J8Y A;  2FUL A;  3HVE A;  5BXO A;  1HZ4 A;  1JUQ A;  3PE3 A;  3C98 A;  4RSY A;  2ZGD A;  4YDO A;  5ENR D;  4J8E A;  3UUX A;  3NZU A;  3ML8 A;  4U8Y D;  5FIO A;  3F6Q A;  5CBO A;  2P9K G;  2LXL A;  5D0O D;  3ENE A;  5M72 A;  2OEV A;  2LSV A;  5ENO D;  4C48 B;  3P2B A;  3E33 A;  4EPZ A;  1D8D A;  2XEH A;  1HFA A;  4JEU A;  4XEI G;  1FT1 A;  1HX8 A;  1Z5S C;  4MKT A;  4L2L A;  3U66 A;  3APD A;  3IXE A;  4GTR A;  2XS8 A;  4K0R A;  3PRE A;  3I3N A;  3LVR E;  4L7T A;  2E0I A;  4KYO B;  1H2V C;  2WPV A;  3ISM C;  4AXH A;  4BFR A;  3V79 K;  3R9M A;  4XIF A;  4FHK A;  4BY6 A;  1U3D A;  2WXN A;  5EIB E;  2YQ8 A;  2VGX A;  5AQB A;  3ZKJ A;  4NRH B;  2WXI A;  2ZIS A;  2XCB A;  3UIN C;  5AJD A;  1N4P A;  1E8Y A;  5KJK A;  1YA0 A;  4B8A A;  3JQ0 A;  5JA4 D;  5KNH D;  5KWD A;  3RK6 A;  4GMR A;  3FFL A;  1SA5 A;  3EJN A;  2RG8 A;  4OYS A;  3MCX A;  3R9A B;  2QZA A;  3B7S A;  3ULQ A;  4O60 A;  3FU0 A;  1ZB1 A;  5G04 J;  4U8V D;  1DNP A;  5BV1 A;  3U3W A;  4KMO A;  3RO2 A;  1TNB A;  5A7D B;  2VYI A;  3ZHE B;  2X38 A;  3DXM G;  2LUH A;  1UJJ A;  5ENN A;  1HF8 A;  3ZUV B;  4PUC A;  2FI7 A;  2VSX E;  3OTN A;  1PC2 A;  3MV2 B;  3G2V A;  2KZT B;  1HO8 A;  3ZU7 B;  2AW6 A;  3CIA A;  5B3S E;  2HE0 A;  1OY3 D;  4A63 B;  4CEM A;  3FHE A;  3OXL A;  3N71 A;  5LOZ A;  3CK9 A;  3UXG A;  4EHM A;  3UKR G;  5CHE E;  2MYO A;  4C0E A;  3IKO B;  4HOR A;  1KZP A;  2EIL E;  5D66 A;  3ASO E;  4C0M A;  1ZBP A;  4LCT A;  1X5B A;  2Q7F A;  4B0Z A;  4DX5 D;  3PUJ A;  5BT1 A;  1MZC A;  2R17 C;  2F8Y A;  4GZ3 A;  4MBG A;  4LEU A;  3D9M A;  2BUG A;  3C3R A;  1D8E A;  1S0P A;  2P9L G;  3NQP A;  1O5M A;  2X3M A;  1OXJ A;  4AY6 A;  4TRQ A;  1TN6 A;  2I2O A;  3UT7 A;  4FA6 A;  4G8L A;  2WQ6 A;  5G2N A;  4GTS A;  5FQ7 A;  5J90 A;  3DBS A;  4GZ6 A;  5JMN D;  3ASD A;  4WND A;  2AXU A;  2F8X K;  4BT9 A;  3KSL A;  3QWW A;  2YIN A;  3EHR A;  3Q75 A;  2DBA A;  2X6F A;  2I9C A;  2Y69 E;  2JEK A;  5HI7 A;  4ANX A;  2DIW A;  3SQV A;  1KT1 A;  2WXQ A;  4U0Z A;  4ILG A;  4LER A;  1OWM A;  4EZJ A;  3UT8 A;  4N2S A;  3GZ1 A;  5T4Y A;  5LCW C;  4TXP A;  2Y4T A;  1QZ2 A;  4N3A A;  4JHJ A;  2WXK A;  4I9E A;  5ANR A;  1Z3X A;  4DLQ A;  1WG0 A;  5C2Y A;  3CVL A;  4JXT A;  4DLO A;  5ANL A;  4TXR A;  3VTY A;  4BX8 A;  3ASF A;  3ABM E;  5KBA A;  3FUE A;  4HI8 A;  3FUH A;  4FP7 A;  3CV0 A;  4RQI A;  2GRO B;  3CR3 A;  1NFI E;  3T5V A;  2A5E A;  4N2Q A;  3QAR A;  3E34 A;  3ZGQ A;  2RD0 A;  4DI4 A;  1OUV A;  2A4Z A;  4Q94 A;  3JYS A;  5ENS D;  4CGW A;  3EIJ A;  4XX5 A;  5KJM A;  1ZU2 A;  2WXL A;  3I5P A;  4FLB A;  1S70 B;  1U3C A;  4CGV A;  1HH8 A;  4YDE A;  2MOW A;  3DEO A;  4I2W A;  3U9W A;  2BED A;  3ZFW A;  3L13 A;  2BF0 X;  3OXG A;  4N5C A;  5EYL A;  3ABK E;  3CHQ A;  3U4T A;  3D9O A;  3PNT B;  2ZU6 B;  4GYW A;  3CHM A;  4I6G A;  3LDZ A;  1EF1 C;  2WM9 A;  3TWU A;  4PS8 A;  1K3Z D;  5A23 A;  5LP0 A;  3KS2 A;  4U07 A;  3CLJ A;  3UM1 A;  3FUD A;  2VJ8 A;  4GZC A;  1X81 A;  2XPI A;  4QQI A;  1K1A A;  3NOC D;  4FC8 A;  2P9P G;  4HB5 A;  3QKY A;  1TYQ G;  5EKQ D;  3E30 A;  1TNY A;  1N52 A;  3DSS A;  3PEU B;  2Y1L E;  3I4G A;  3LPZ A;  4OAV B;  4DK5 A;  3D9I A;  3MV3 B;  4FJY A;  4KXK B;  4JA7 A;  3B7T A;  4N3B A;  5BW8 C;  1XGW A;  3KEZ A;  3LS8 A;  3W9G A;  3ZPJ A;  4GB9 A;  3RRM B;  3TWT A;  5E76 A;  2I1K A;  3FH7 A;  3U64 A;  1TNO A;  2XZT G;  4PH4 B;  1HG2 A;  3DSX A;  4UI9 K;  5T3R A;  4ATZ D;  3G2S A;  4XKC A;  2OCC E;  4UWG A;  2A5U A;  1N4R A;  2JAB A;  4GPM A;  4LNB A;  3PDN A;  4F1S A;  4A3T A;  3HXC A;  4BSX A;  4KZ0 A;  4WUY A;  1E96 B;  3HYM B;  2EIJ E;  3BU8 A;  3WXX A;  1QBQ A;  2L9B A;  5EDS A;  1JCS A;  3L17 A;  1H6K A;  1MHQ A;  3TWW A;  2VSN A;  4UI9 C;  5AIJ A;  3L22 A;  5HQ8 A;  3JQ1 A;  3DSU A;  4WNF A;  3JCK C;  2Y4U A;  4GPK A;  4CT0 A;  1Y8M A;  4U04 A;  3Q7F A;  3SF4 A;  4FLH A;  4CYM D;  2R59 A;  4L9P A;  2R05 A;  5CER B;  3PZ1 A;  4AJW A;  4GTO A;  4JHR A;  5CCL A;  5D0Q D;  3SGH A;  2KBX A;  4U95 D;  5B1B E;  4I1O B;  4JB8 P;  4KT6 B;  4U96 D;  1N94 A;  2VSY A;  4WWP A;  3P1U A;  4XKB A;  4JA9 A;  1OWN A;  2LO6 A;  2P9S G;  1WAO 1;  3B7U X;  2Y3A A;  2VTB A;  3CSF A;  3C3Q A;  2XEN A;  2QYJ A;  3UT4 A;  4HXI A;  4O1O A;  1QYM A;  5AN8 A;  4UWH A;  5G05 C;  2HO1 A;  5ENT D;  4F1P A;  3BUA A;  2XGM A;  3RSE G;  3E37 A;  3GW4 A;  4JVS A;  2XZD G;  2WMN A;  3V2X A;  2EIM E;  3TXN A;  3EIQ C;  2IO2 C;  1NL4 A;  4RLY A;  3B13 A;  3T9K A;  4HRL A;  1H6O A;  3G2W A;  4CDR A;  4DI3 A;  1A17 A;  4Q69 A;  1E8X A;  3FUN A;  3RU0 A;  4AM9 A;  2WXP A;  5AQ9 A;  4BX9 A;  3UM2 A;  5CRV A;  3MEK A;  1UW4 B;  4YDY A;  2PQN A;  3Q79 A;  2J9Q A;  3QDN A;  3ESK A;  3FUJ A;  3Q5M A;  2XQ0 A;  2J09 A;  4GMJ A;  2HR2 A;  5ARG A;  1WDY A;  4G8K A;  5BPP A;  4FJZ A;  3ABL E;  3Q78 A;  1AP7 A;  1TN7 A;  2P58 C;  2LAH A;  4QFV A;  3UM3 A;  3PE4 A;  3MKQ B;  2GRP B;  2WMO A;  3PZ3 A;  3CVW A;  5G05 J;  5FT9 A;  1GW6 A;  5KCM A;  3WG7 E;  3ZN3 A;  4MRU A;  3IV0 A;  3CVX A;  4BER A;  3FTV A;  4ZHB A;  1N4S A;  4G24 A;  1O1S A;  1MYO A;  2R2L A;  4GML A;  3NZS A;  3VLF A;  4B8C B;  3D3M A;  1U2V G;  3I4R B;  3C72 A;  2CG3 A;  2QYU A;  3L08 A;  2P9U G;  3LJN A;  3LXU X;  3ZVV A;  3SFY A;  4J7W A;  3GZ2 A;  3ESL A;  5B1A E;  3CHS A;  3RRN B;  3EHN A;  1K8K G;  3DXK G;  3HXB A;  4L1B A;  3LVQ E;  2OOE A;  4O6F A;  4J8F A;  2B0O E;  4A1G A;  1LD7 A;  1INZ A;  5AQ7 A;  1OCZ E;  3LCA A;  2P9N G;  1S64 A;  2DZN A;  2EIN E;  3AU4 A;  3ML9 A;  4A1S A;  3TWQ A;  5AEN A;  5EX0 A;  2JLB A;  4HOT A;  1ELW A;  1IHB A;  3L54 A;  4G23 A;  5EID A;  3ONL A;  3URZ A;  4GTP A;  3CKB A;  4G1T A;  2XS1 A;  1E8W A;  4GTQ A;  2CFZ A;  4EBA G;  2LXM A;  3BG0 B;  4CDN A;  1IYG A;  3IHY A;  1MJ0 A;  2GRM A;  1EDU A;  4KVO A;  3S7F A;  3R7Q A;  2PQR A;  1EPU A;  3L9T A;  5FJY A;  2BTD A;  1TEZ A;  4H7Y A;  2H6I A;  3S7B A;  3DPD A;  3IEG A;  1JWF A;  3FU6 A;  2PNN A;  5CEA A;  2GRR B;  3HG0 D;  1Z6T A;  4F3V A;  2H6F A;  3DRA A;  3DST A;  2CG2 A;  2YHE A;  3ONK A;  4HFG A;  4U8H A;  5EYP F;  4U0U A;  3D9N A;  4I2Z A;  3RKV A;  3AU5 A;  2CHX A;  3TL5 A;  1XNF A;  5KNG A;  3Q7A A;  2KCK A;  2VGY A;  4TXQ A;  2XCC A;  3UM0 A;  3NOG D;  3HXD A;  2WXF A;  4I1M A;  4LNU D;  1V54 E;  3RAU A;  2PM7 A;  2OV8 A;  4ILH B;  4FHJ A;  3FH5 A;  2F37 A;  2F0Y A;  2C0L A;  2IQC A;  2NYJ A;  3E32 A;  3KD7 A;  3Q9N C;  3QOU A;  1E90 A;  4AIF A;  1W3B A;  3Q15 A;  4HOS A;  3AS8 A;  3FH8 A;  2RFA A;  3TAX A;  2J4D A;  2UY1 B;  5AAR A;  5HKP A;  3L82 A;  1DC2 A;  3UI2 A;  5FTP A;  3MZL B;  4G11 A;  4IN3 B;  3ZHE A;  4L23 A;  1QQE A;  3TWS A;  2V5Q C;  4CCA A;  2DYR E;  2X6H A;  2RFM A;  2LSU A;  4GCN A;  3SFX A;  3HDX A;  2VQ2 A;  2KZT A;  3QC1 A;  1Y6I A;  2MHK A;  5CCM A;  1BI8 B;  4GA0 A;  3QK0 A;  4OAU C;  1VDY A;  4L2Y A;  3JXJ A;  3FUF A;  1UOH A;  3HVE B;  1A5E A;  3UMV A;  4EQF A;  1KLX A;  1KT0 A;  4UWL A;  2QFC A;  1Q2Z A;  2NXP A;  4AY5 A;  4ANV A;  2CFU A;  2C2L A;  2AWI A;  4UQZ A;  1LD8 A;  3V2O A;  1BD8 A;  4G2V A;  5LCW J;  4WAF A;  5C1D A;  5FIN A;  2IJG X;  2EQX A;  3KAE A;  4I9C A;  2DYS E;  1FVH A;  4ANW A;  4DX1 A;  3EHM A;  3RO3 A;  1YCS B;  2IOS A;  3IHV A;  3FDH A;  2GRQ B;  3TG5 A;  3UKU G;  3QWP A;  3CHP A;  4HRM B;  3NF1 A;  4HBD A;  2XHE A;  4DX7 D;  1PAQ A;  2AJA A;  5DIZ A;  4BEP A;  4A3V A;  1OWL A;  1MQS A;  1SA4 A;  4RVB A;  3V31 A;  4HVB A;  2VGE A;  4GTV A;  4HI9 A;  3ZW3 A;  3FP3 A;  3D9J A;  1JCQ A;  2EIK E;  2WXH A;  3AG4 E;  3OAW A;  3FUM A;  5FZS A;  4BT8 A;  3CVP A;  1OCC E;  3DSW A;  4ZFH A;  5BNW A;  2ILR A;  1ELK A;  2KC7 A;  2OVF A;  4Q96 A;  3TGO A;  4GA2 A;  1UJK A;  3HIZ A;  4CRW A;  5JJT A;  4K5A B;  2PM6 A;  1BI7 B;  2QC9 A;  2VGX B;  4UQY A;  4J8D A;  3MKR A;  2KM4 A;  4CZ2 D;  4BWR A;  3AG1 E;  3ASH A;  4JZY A;  2UWJ G;  2V0P A;  5DBK A;  3HRA A;  2YHC A;  4DX2 A;  4ACK A;  4M3O A;  4KVM A;  3BEE A;  3FTW A;  3GYZ A;  3B7R L;  5EN5 D;  2IU1 A;  3J5Q B;  2V8S E;  2PZI A;  1G3N B;  4FU3 A;  4B89 A;  4OVU A;  4WNE A;  1KPS B;  3PZ2 A;  2IFU A;  3EHQ A;  1K1B A;  4HLL A;  4E6H A;  3ASN E;  1LF8 A;  2DCP A;  2IOL A;  2KAT A;  3UIO C;  3J5P A;  4B93 B;  2V4L A;  4J0U A;  3TWV A;  3FTU A;  3AAA C;  4Z68 A;  3QAQ A;  4EZL A;  5HS0 A;  3CHO A;  2R02 A;  3SZ7 A;  2XEE A;  3CEQ A;  3SHF A;  3DPY A;  1NZN A;  1TJC A;  3PUK A;  4TV3 A;  3FUL A;  1E7U A;  4JL0 A;  3RIB A;  4IYP A;  4WNG A;  3Q47 B;  3ZXS A;  4C9B B;  4MS6 A;  3AG3 E;  2FF4 A;  5JHB A;  2XGS A;  4UQX A;  5KJL A;  3ULE G;  3APC A;  3PEV B;  3IBE A;  1HS6 A;  1BLX B;  3FY4 A;  4FAD A;  1BU9 A;  1V55 E;  1HXI A;  1H19 A;  2QY7 A;  3SBS A;  5LFA A;  4I43 A;  2XPZ A;  5T8I A;  4ME2 A;  4DUI A;  3ZXP A;  5FWQ A;  3VTX A;  3Q73 A;  4WWN A;  4GCO A;  2VSO E;  2B6C A;  4GYY A;  2H6H A;  4LG6 A;  3SI5 A;  3RJV A;  3FTZ A;  2KCL A;  3SBT B;  4LRZ A;  3MYV A;  1HU3 A;  4J8S A;  3FTY A;  3CQC B;  4UI9 J;  1SQM A;  3EUV A;  4EEC A;  4LUN U;  2XRY A;  3D9L A;  4FUL A;  2V5F A;  1E7V A;  3OXF A;  3CVY A;  3KSQ A;  3K9I A;  4E85 A;  4K5C A;  3PNL B;  4U7E B;  4ANU A;  5AJL A;  2ETA A;  5G04 C;  3R7R A;  5ARF A;  1DCE A;  2ETC A;  3APF A;  1OWP A;  3EU5 A;  3JUE A;  3FTS A;  1N4Q A;  3MGB A;  3LEW A;  2LNI A;  3FU5 A;  1IQR A;  4CT4 A;  2Y0B G;  4BTB A;  2AXZ A;  2L0I A;  1H2T C;  1L5J A;  2FEZ A;  2IEJ A;  1RZ4 A;  3SD5 A;  3Q4A B;  4O1P A;  5EIL A;  5J08 A;  3QB2 A;  3HXF A;  5CMY A;  3PH0 C;  4GTT A;  4XZ4 A;  1OCO E;  3NBN B;  3QWV A;  4DRX E;  1IQU A;  2I1J A;  4I17 A;  1P5Q A;  2AXV A;  3KEA A;  4JC8 A;  2ZXW E;  1D9S A;  3MA5 A;  3MX3 A;  5FZR A;  2DWZ A;  5CEC B;  3UX4 A;  2GGF A;  1TNZ A;  3UPV A;  2KXP C;  2ION A;  4BET A;  3JUI A;  4ACL A;  1BPO A;  2WVI A;  5FZQ A;  4YVQ C;  2YNQ A;  4M7C A;  2XPY A;  2FBN A;  1NP7 A;  4GA1 A;  4AV7 A;  2ZGG A;  4AP2 A;  1DVP A;  5JJ6 A;  3TWX A;  1O1R A;  5CED B;  3BG1 B;  2X6J A;  3T8K A;  4CDM A;  1WM5 A;  1SZ9 A;  1NA0 A;  5G55 A;  4AOF A;  1UN8 A;  2FO7 A;  3C3O A;  4EBA A;  4N39 A;  1N54 A;  2DVW A;  3E4B A;  4BSZ B;  1TJF A;  3LJ3 A;  5ENQ D;  1HE8 A;  4YVO A;  1JPL A;  3AJI A;  5BUZ A;  5EX3 A;  3CVV A;  4GTM A;  5HRY A;  4B94 A;  2PL2 A;  3S7D A;  2KCV A;  4GAA A;  4U0S A;  1NI1 A;  3PZD A;  3BQO A;  4OVV A;  3UQ3 A;  3FUI A;  3D9H A;  3G2T A;  4G26 A;  2I6H A;  4JW1 A;  3SO8 A;  1TN8 A;  4F7A A;  3G2U A;  3PRZ A;  4N5Q A;  1UG3 A;  3NAW A;  3C5R A;  5ITZ F;  5AAO A;  1NA3 A;  3V30 A;  2L0T B;  4APO A;  2IY0 C;  4KZC A;  4XI0 A;  2X6K A;  1MX4 A;  4YND A;  4HS2 A;  4GZD A;  3B95 A;  4UUC A;  5JHA A;  3S2A A;  4DJA A;  4H7X A;  4LSZ E;  4U63 A;  4TUM A;  4HLE A;  3ZIM A;  5CMW A;  1OCR E;  5D2M C;  3FTX A;  2XEV A;  3HHM A;  1E8Z A;  4UWK A;  5KJN A;  1WY6 A;  4A55 A;  3ZNG A;  1O1T A;  2GRN B;  3PZ4 A;  3EU9 A;  2WXM A;  4EZK A;  1FT2 A;  4F6R D;  2WQH A;  4P29 A;  3LKU A;  3L16 A;  3VLE A;  2V4H C;  2BKG A;  1ELR A;  1N9A A;  2WXJ A;  4K5B A;  3SNX A;  3ZRH A;  1AWC B;  1H0A A;  5FQ6 A;  2XGO A;  1PY1 A;  2L6J A;  1QNF A;  1H6P A;  4GYO A;  4PS3 A;  4RG6 A;  5CBN A;  2NC9 A;  4GZ5 A;  2HYZ A;  5E75 A;  4IRU A;  4ABN A;  3MKQ A;  3FEX A;  4NAC A;  4W9R A;  2WXO A;  3L6A A;  2M63 A;  5FQ4 A;  4AVX A;  2J49 A;  1Z3Y A;  5LX8 A;  1FCH A;  4PDX A;  4Y6C A;  2J4B A;  3S7J A;  3LYA A;  2BKK B;  2NSZ A;  3Q49 B;  1TR4 A;  4HQD A;  3T8M A;  3CGH A;  4TUU A;  3X2Q E;  1FVF A;  3CVQ A;  1UN9 A;  3QNK A;  1H2U A;  3PS6 A;  2P9I G;  4N3C A;  3EDT B;  1OWO A;  3W9F A;  1N11 A;  1KZO A;  3FU3 A;  1DCQ A;  3ZYM A;  1HG5 A;  4DX6 D;  2C0M A;  3UIP C;  2R03 A;  3TJP A;  4PS7 A;  2VTB B;  2OVB A;  3LY8 A;  1FPP A;  4HOU A;  4URK A;  3RRU A;  2J07 A;  3O48 A;  4HNA D;  3TXM A;  2R5S A;  1S63 A;  1EYH A;  3AS5 A;  4F53 A;  2LAI A;  3QJZ A;  4XE0 A;  3ASG A;  1JWG A;  4JEH A;  5BXU A;  2WQ7 A;  3ULY A;  4APF A;  2H6G A;  3CQG B;  3NB2 A;  3B7B A;  3HXE A;  4MLP A;  4LNG A;  2OND A;  3CK8 A;  4J6I A;  2J08 A;  2HM8 A;  3CK7 A;  5A6C A;  3UTM A;  4V3I A;  1IHG A;  4ILI A;  4ATG A;  5ENP D;  5H7P A;  3TWR A;  1N0R A;  1IKN D;  4I6J A;  3D9P A;  3ZYQ A;  4HOQ A;  4G25 A;  2WXG A;  2CHW A;  2P2C P;  3CHR A;  5FQ8 A;  3FEY A;  4D10 C;  4R7L A;  1B89 A;  4NIK A;  2IF4 A;  3T5X A;  4IUL A;  5BV0 A;  3FUK A;  4NQ0 A;  1RW2 A;  4K03 A;  4I1A A;  4I6E A;  2L6B A;  3LY9 A;  3Q9U C;  1SZA A;  3ZEF A;  1N95 A;  3CVU A;  3AG2 E;  1TNU A;  3FWV A;  2AVP A;  1YYH A;  3TG4 A;  4BES A;  3ZYL A;  3D9K A;  1LTX A;  2OEW A;  4Y6W A;  4KBQ A;  2GRL A;  2XRZ A;  5IY5 E;  4HRN A; 
#chains in the Genus database with same CATH homology
 2EIL E;  3AG1 E;  5B1A E;  3X2Q E;  5B3S E;  5B1B E;  2DYS E;  1OCZ E;  3ABM E;  3ASO E;  2DYR E;  3AG2 E;  2Y69 E;  2EIJ E;  3ABK E;  2EIM E;  1V54 E;  2ZXW E;  1V55 E;  2EIN E;  2OCC E;  2EIK E;  3AG3 E;  3AG4 E;  3WG7 E;  1OCO E;  1OCC E;  3ABL E;  5IY5 E;  1OCR E;  3ASN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...