2EIJE

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eijE00
1V54E 3AG3E 1OCZE 2Y69E 3ABLE 2DYRE 1OCCE 3AG4E 1V55E 2EIJE 2EIKE 2DYSE 2EINE 3WG7E 2EILE 3AG1E 5B1AE 3ABKE 3AG2E 1OCRE 1OCOE 3ASNE 3ASOE 3ABME 2ZXWE 2OCCE 5B3SE 3X2QE 5B1BE 5IY5E 2EIME
chains in the Genus database with same CATH superfamily
2XS8A 3Q75A 2QFCA 2LAIA 4EZKA 4GTMA 2RFMA 1OWNA 3QWPA 3NF1A 3CSFA 4U8YD 3G2TA 4AVXA 2EILE 4L1BA 1TR4A 3PZ3A 5JJ6A 1N0RA 5J90A 3MGBA 3RSEG 3Q4AB 2OEVA 3T8MA 3L6AA 4CDRA 4A55A 3LKUA 4F53A 1WDYA 3D9OA 3S7DA 2HM8A 3PEVB 3UM2A 5ENNA 4UI9K 1UJJA 4G25A 4AEZC 4KYOB 4D10C 1K1AA 1HG2A 3AG3E 5E75A 1XGWA 3CVYA 1N4RA 3FWVA 3VTXA 3CV0A 2WXOA 4CGWA 5DBKA 3DPYA 3LYAA 4BFRA 4EQFA 4LCTA 4NRHB 2ILRA 3Q7AA 3FUFA 2UY1A 2CHZA 3TWXA 3R9AB 3SNXA 2QYJA 4FHKA 4I1MA 3U3WA 3HHMA 4XEIG 2Y3AA 3B7RL 2PL2A 3U64A 1AWCB 3IHYA 3C3OA 4PUCA 4TXRA 1KZPA 3D9MA 2LXMA 2ZGDA 5FZQA 4URKA 3GZSA 4JA7A 4UI9J 3FUKA 4APOA 2R05A 3SBSA 2MOWA 2P58C 2X6KA 2M63A 4B8CB 5CEDB 3FTYA 1HG5A 2H6IA 3J5QB 2NSZA 3MYVA 2VGXB 4TXQA 2ZIRA 4O1PA 2AWIA 2XEVA 5B1BE 3C5RA 4JXTA 4DX2A 3ZYQA 4I1AA 4ATZD 5AN8A 4HLEA 2KCVA 3E32A 2WM9A 3GZ2A 3W9FA 2F0YA 1OWPA 4UWHA 2E0IA 3UINC 4A3VA 3NB2A 3G2SA 4BX9A 1OXJA 1N4PA 5H7PA 2X6IA 3BU8A 4B89A 3ZPJA 3O4ZA 3ZIMA 1B89A 2EINE 1E7UA 1FT2A 2KC7A 3FUNA 3FFLA 4L2YA 3DXKG 3SZ7A 3SF4A 5KNGA 3F6QA 3S7FA 4GZDA 4HOQA 4O1OA 5AQAA 5EIBE 2R17C 3HVEA 1TN7A 4MS6A 3ZRHA 4X8QA 3TXMA 4U0ZA 4I9EA 1UN8A 2L9BA 2XRZA 1OWOA 3IXEA 4GCNA 3Q9NC 5CRVA 2OVFA 3D9NA 2EQXA 3E33A 4J6IA 3ZUVB 2QZAA 1H19A 5G05J 2AVPA 1SA5A 1TNBA 4UWFA 3TWQA 4J8FA 3CIAA 4XX5A 3PVLA 2V4HC 4F7AA 5CERB 4JEHA 1OCZE 5AENA 5BT1A 4ME2A 3IV0A 2Y0BG 3UM0A 5ENOD 4GA0A 4MLPA 4HVBA 3SFXA 4CDNA 3LJ3A 4UWKA 2DYRE 5A23A 1PY1A 4U95D 4HNAD 2FO1E 2UWJG 1HFAA 5AIJA 2VJ8A 2KXPC 3FY4A 3FUMA 3SY2A 4YDEA 1E8WA 4FADA 4ATGA 2P9PG 4EPZA 4BX8A 2V8SE 5A6CA 2BKKB 3CGHA 2MRIA 3AS4A 4WAFA 1Z6TA 3FDHA 2FI7A 1E8ZA 2XGOA 5AJDA 2QYUA 3LS8A 4G2VA 5KWDA 3S7JA 4A3TA 3UTMA 3JUEA 4N5QA 2VGYA 3ZVVA 4JHJA 1UOHA 1GW6A 3FUJA 1INZA 2IU1A 2FEZA 4LNBA 3G2VA 4FP7A 4U0SA 1UJKA 3SHFA 5BNWA 4ABNA 1YA0A 4XKCA 4YVOA 5KJMA 4J8DA 4FC8A 2V5QC 4BT8A 4CDMA 3V79K 1V54E 5KJLA 3CHOA 1EDUA 3MJWA 2P9KG 4BT9A 4OAUC 4ZFHA 1IXVA 4HORA 4I1OB 4TXPA 4M7CA 1Z5SC 5CHEE 4CT0A 2I1KA 4WUYA 5ANLA 4N2SA 1Z3XA 2XPIA 4I2ZA 4XIFA 4B0ZA 5HRYA 3DBSA 4U8VD 3R7QA 3I4GA 1H2VC 1K3ZD 3EHNA 3QNKA 5JA4D 4LSZE 3QK0A 2XZDG 2VSNA 4GTVA 3P1UA 4FJZA 3C3RA 1FVFA 4KZCA 2KZTA 3SFYA 1JCQA 5JJ7A 5CBNA 2WMNA 4BTBA 3FH7A 2IO2C 4QQIA 3TXNA 2BEDA 4TUUA 2ZU6B 3ABME 1IKND 3DEOA 2WXGA 1AP7A 4HS2A 2HR2A 3W9GA 5FIOA 2VSYA 2MYOA 2CFUA 4K5BA 4JD2G 4ACKA 5CBOA 4FULA 2J49A 2IOLA 4B93B 1HH8A 2CG3A 4K5CA 4ACLA 4U04A 3BG1B 5ITZF 3L54A 4KBQA 3TG4A 3TWUA 4IN3B 5T3RA 3HXDA 3QWWA 1QBQA 3FUEA 4J0UA 4UWLA 4RG6A 5ENSD 2R2LA 1RW2A 2F37A 3D9KA 2GRRB 3TWTA 2A4ZA 3ESLA 3UUXA 4G24A 5LCWJ 2EIJE 2EIKE 4JW1A 5JHAA 1YMPA 3SQVA 3PS6A 4EZJA 2OV8A 4NURA 4OVUA 5B3SE 1N9AA 4WWNA 1NFIE 4G11A 3ENEA 1ZBPA 4HOUA 3FUIA 5EILA 4U0UA 3TL5A 3DPDA 2GGFA 1P5QA 4O6FA 4E6HA 3UM1A 2HE0A 5D2MC 1H6PA 4AP2A 1SZ9A 3LCAA 1WY6A 3JQ1A 2P9NG 2LAHA 4JPSA 3OTNA 2XPYA 4LNUD 1NA0A 2WXPA 3BQOA 4DI3A 2X6JA 4U96D 1QQEA 2P9SG 3UPVA 2IONA 2EIME 2R03A 3GZ1A 4FJYA 4HOSA 4F1SA 3NOCD 2V5FA 1N94A 3FEYA 4UUCA 4TUMA 3D9HA 3SI5A 2BF0X 3I4RB 2H6HA 1FCHA 5JJTA 4N3CA 2ONDA 2VSXE 4KT6B 2FO7A 3L9TA 3DEPA 4FA6A 4GMRA 4GCOA 3UM3A 3L17A 3AAAC 3U66A 4A1GA 2WQ6A 3PUKA 2CFZA 4C9BB 3HXFA 5FTPA 5LX8A 2ZGGA 1ELRA 2HYZA 1N11A 3E30A 4GMLA 2PZIA 3ZHEA 1NL4A 1BD8A 3KEAA 5AARA 2JEKA 3AJIA 5D0OD 3HG0D 4G8KA 3TWWA 3CVUA 4IRUA 4Q96A 1IHBA 4E85A 3MKQA 3ZKJA 3N71A 3ULEG 4C48B 4UWGA 2WXNA 4ILIA 1W3BA 2RG8A 2FBNA 3CVPA 3Q49B 4I6GA 4AOFA 3UQ3A 1SVXA 1TNZA 4N3BA 3G2WA 4Q94A 1U3DA 2LSVA 3AG1E 4UQYA 4PS7A 1HX8A 3L82A 4CGVA 1ELWA 3DRAA 3SGHA 2E2EA 3FTSA 4F1PA 4BY6A 4APFA 5HQ8A 2KCLA 4FLHA 1SW6A 3LVRE 3PZ1A 2XPZA 3HXBA 1S63A 1NA3A 2H6GA 3FUDA 3D3MA 4DX6D 3KSQA 1S0PA 4C0MA 4XI9A 1D8EA 3B95A 3CKBA 2XQ0A 5T4YA 1Q2ZA 3HXEA 2XGMA 2AXVA 3CVVA 5FJYA 1DVPA 1N4QA 5LFAA 3CVWA 2IO3C 3IHVA 3IBEA 4JHRA 2PQNA 3AS5A 3ASHA 2RD0A 4LRZA 5E76A 1HS6A 4TV3A 2WQ7A 3KSLA 2VTBB 1QZ2A 1TJCA 4MBGA 5FQ6A 4J7WA 3UT7A 3ESKA 3TG5A 4K5AB 1JUQA 2J8SD 4GA2A 4PH4B 1OWMA 2XGSA 3TAXA 4M3OA 1BI7B 2XEHA 1FVHA 3Q73A 4AV7A 1OCCE 2WMOA 3OXFA 4DX7D 4I17A 3CK8A 4V3IA 2QY7A 1ZB1A 3TWVA 4HLLA 2KATA 1HO8A 2VSOE 1SZAA 3EIJA 2GRMA 4GB9A 4B94A 2V0PA 2XENA 2IFUA 1TNUA 4CEMA 3HIZA 2X6FA 2WXRA 3CKCA 2NYJA 1H0AA 1DC2A 4RLYA 1MQSA 2Y69E 1QNFA 4WNFA 3B7SA 5J08A 2XS1A 4EHMA 2J9QA 4KMOA 2VYIA 3ABKE 4JZYA 4MRUA 4HRNA 3ULYA 2I2OA 4GYWA 3ZYLA 3ASDA 2PNNA 1RZ4A 4U07A 4BWRA 1MZCA 2IJGX 2A5EA 4GTOA 2B0OE 4DPRA 3Q15A 3QWVA 3NAWA 4ZHBA 3PZDA 2I6HA 3ZFWA 4WWOA 3QB2A 5ENRD 3OXGA 4N2QA 1TN6A 2ZISA 4FHJA 4HRLA 1E8YA 3U9WA 3R9MA 4W9RA 3DSSA 1A17A 1BLXB 3CQGB 3ZN3A 3CK9A 4ANVA 2MHKA 3LY9A 4JC8A 2AXUA 4WNEA 1KT1A 4NACA 3ZW3A 2UY1B 4XKBA 3T9KA 1HXIA 2LUHA 4HRMB 2DZOA 4CRWA 5DIZA 3QJZA 1OUVA 4RQIA 4RVBA 2GRPB 4CZ2D 3PNLB 4HBDA 5BV1A 4BEPA 3ZXSA 5KCMA 4K03A 5G2NA 5AQ7A 4GAAA 3T5VA 3DSVA 4J8YA 3CHSA 4N5CA 2CG2A 4GYOA 2LNIA 1DCQA 1IYGA 3FHEA 1HE8A 4R7LA 1MX6A 2R5SA 1OCOE 2C0MA 4Z68A 5FZSA 1BU9A 2FF4A 4WWPA 3UI2A 5EX3A 2OVBA 3P2BA 4KXKB 3GYZA 4EZLA 3RIBA 3EIQC 1MHQA 3D9PA 4JL0A 4O60A 3FU0A 1D9SA 3CHQA 1KPSB 4Y6WA 4HB5A 1H6OA 4U7EB 3G2UA 4DLQA 3ZYMA 1U2VG 3B7UX 1XNFA 1JPLA 3I5PA 2P9UG 3MA5A 3UXGA 5CECB 5D66A 3EU9A 2V4LA 4G1TA 3LJNA 3HVEB 3JCKC 1LD8A 2YHEA 3UX4A 4PDXA 1QYMA 1N54A 4NIKA 4YDYA 3L22A 4JVSA 4ANUA 5HS0A 4FU3A 4GZCA 4ILHB 4TRQA 5AAOA 2AXZA 4DRXE 1MJ0A 1LF8A 2KCKA 3PE3A 4Y6CA 1PC2A 4YDOA 1TYQG 5KNHD 3E4BA 5IY5E 3E37A 1K8KG 2JABA 5JHBA 3D9IA 4KVOA 5B1AE 2CHXA 4GTTA 2ETAA 3LXUX 5JMND 5FQ8A 5ENTD 5KBAA 4J8SA 4BETA 3AG4E 1Y6IA 1FPPA 3PZ4A 1Z3YA 5G04J 4L7TA 3QAQA 3V2XA 2VGXA 5CMWA 2GRNB 5G04C 2OEWA 3CHPA 3ONKA 2BKGA 2R59A 5AQBA 3ASFA 5EX0A 2WXQA 3RRNB 3EHMA 1X81A 2J07A 3DXMG 4EBAG 3PH0C 1Y8MA 5KJKA 2AJAA 4G26A 3ABLE 4GZ5A 2J4DA 3CVXA 4GA1A 2WB2A 1KT0A 2ETBA 2Y4UA 1UG3A 3TGOA 4GTPA 3B7BA 2IF4A 2YHCA 4BERA 3APFA 4AJWA 1HZ4A 4GZ6A 3NZSA 1LTXA 4HI8A 1N4SA 5CRUA 3WXXA 2C2LA 2F8YA 3FULA 1OCRE 2PM7A 4GMJA 4AM9A 1H2UA 2L6JA 4YDWA 2FULA 2L0IA 5D0QD 3LPZA 3FTWA 4P29A 2LSUA 4K0RA 4I6JA 3FU6A 2RKKA 1N0QA 3GW4A 5FT9A 4Q69A 3LDZA 2L6BA 4QFVA 4G8LA 1BPOA 1E7VA 5LP0A 2WXLA 4GYYA 1E90A 2YINA 3Q5MA 4I6EA 3CVNA 3MEKA 5AYWD 2WVIA 3CLJA 3UIOC 3T5XA 4HI9A 5CMYA 2F8XK 2BUGA 4JA9A 3CVQA 4WNDA 3K9IA 1N52A 4BESA 1MX4A 3RK6A 5ANRA 3AU4A 3HXCA 3PREA 4U63A 3UIPC 4I2WA 4GZ3A 2J09A 3FUHA 4F6RD 1D8DA 1WG0A 5FQ4A 2DWZA 3C3QA 2KZTB 5FINA 4GPKA 3RRUA 4BTAA 3CR3A 3MX3A 3JQ0A 4LNGA 3LEWA 1HF8A 3U4TA 4FLBA 3UMVA 1JCSA 3E34A 2DZNA 3IEGA 3ZU7B 4YNDA 5FZRA 4JHKA 3AU5A 1WAO1 5BPPA 2GRQB 3OXLA 4WNGA 3HDXA 5AQ9A 2WPVA 1IHGA 1ZU2A 1X5BA 4L23A 3ZGQA 3L16A 3TJPA 4CCAA 3LY7A 1KZOA 1NI1A 4UI9C 1EF1C 2PM6A 4BSXA 2X38A 5ARGA 4EBAA 1JWGA 2A5UA 3KD7A 2Y4TA 3VLEA 2I9CA 3QKYA 5EDSA 3FU3A 3OAWA 1DNPA 4L9PA 4L2LA 3APDA 2WXFA 3JYSA 3MZLB 4EECA 4A1SA 4DI4A 3PZ2A 3D9LA 3ULQA 1H2TC 3MV3B 2HO1A 3B7TA 4YVQC 5LOZA 5EN5D 2ETCA 1O1SA 1L5JA 4N39A 2P9LG 4JB8P 3Q78A 3ASGA 1MX2A 2YNQA 1WM5A 1MYOA 3VTYA 3RO3A 1FT1A 1TN8A 4XZ4A 3NZUA 3X2QE 1DCEA 2XHEA 3FU5A 2IY0C 1O5MA 1SA4A 2WXIA 2LO6A 2WXHA 1O1TA 2I1JA 2XEEA 1TJFA 2GRLA 2OOEA 1BI8B 2RFAA 5T8IA 3RO2A 3Q79A 3V2OA 3ASOE 4XE0A 3EJNA 3B13A 4KVMA 2GW1A 1JWFA 1TNYA 2NC9A 4HFGA 5BXOA 4HOTA 3DSWA 2P2CP 3ZYKA 1O1RA 3BUAA 1U3CA 3KAEA 3UT8A 5AJLA 1YYHA 3UKRG 5G55A 5G05C 2XCBA 4CYMD 4ILGA 3APCA 3RRMB 3CHMA 2Y1LE 2DVWA 4OVVA 4OAVB 4PS3A 5FQ7A 3ZHEB 3V31A 3QDNA 3NBNB 3EUVA 1ELKA 3KEZA 4KZ0A 3FH8A 2J4BA 1EPUA 3MKQB 3V30A 4XI0A 4HQDA 2X3MA 1KLXA 3UKUG 2R02A 3FTXA 4GPMA 3CVLA 4I9CA 3AG2E 2WXMA 3ZNGA 4DJAA 2J08A 4PS8A 3URZA 2WXJA 3PUJA 3PE4A 1E96B 3BG0B 3CQCB 3JXJA 3ISMC 4GTQA 2WXKA 3TWRA 1A5EA 5A7DB 3PDNA 3MKRA 1JCRA 1UN9A 3EHQA 4GTRA 2NXPA 2XRYA 4NQ0A 3VLFA 3ML8A 4DLOA 3JUIA 1SQMA 2YQ8A 3QOUA 3I3NA 4JEUA 3S7BA 2IEJA 4OYSA 2L0TB 3O48A 5HKPA 1YCSB 1N95A 2OCCE 2XCCA 3CHRA 2Q7FA 4G23A 3C98A 3FTVA 3T8KA 3L13A 4LEUA 3QC1A 2BTDA 4IULA 4DUIA 3SBTB 3Q7FA 4ANXA 1TEZA 1UW4B 3NOGD 3VLDA 4DX1A 3BEEA 3FEXA 4RSYA 1OT8A 5BV0A 1IQRA 3SO8A 3SFZA 2X6HA 5BUZA 3FTZA 3Q9UC 3FP3A 3ML9A 4AXHA 3EDTB 5EKQD 4HXIA 3Q47B 4AIFA 2VQ2A 5EYLA 4BSZB 2C0LA 3CEQA 1K1BA 1HU3A 3HRAA 4DK5A 1PAQA 4LERA 1OY3D 2P9IG 5EYPF 3DWLG 5BW8C 2PQRA 4H7XA 3LY8A 3SD5A 3HYMB 4F3VA 3ZXPA 1E8XA 2KM4A 3DSTA 2VGEA 3CK7A 2KBXA 1S64A 2JLBA 3RAUA 5FWQA 3RJVA 2LXLA 1TNOA 5CCLA 4AY6A 2CHWA 4H7YA 3KS2A 3MCXA 4UQXA 1S70B 3ONLA 3S2AA 3EU5A 2DBAA 5CEAA 5ENPD 2XZTG 2WQHA 4GU5A 5CCMA 3QARA 2DCPA 1H6KA 4CT4A 3WG7E 4LG6A 5KJNA 3JXIA 3R7RA 3AS8A 2ZXWE 4U8HA 4J8EA 3TWSA 3UT4A 4RG9A 2DIWA 3LVQE 2VTBA 1LD7A 5EIDA 2DYSE 4B8AA 4N3AA 5LCWC 3FTUA 3ASNE 3RKVA 2GROB 1OWLA 3NQPA 3EHRA 4AY5A 2QC9A 1NP7A 3C72A 2H6FA 3MV2B 4GTSA 3PEUB 3L08A 4MKTA 3PRZA 5C1DA 5C2YA 3ZEFA 1G3NB 1NZNA 3J5PA 4ANWA 4C0EA 2B6CA 4IYPA 4I43A 3DSUA 5HI7A 4UQZA 4A63B 1V55E 2IOSA 5ARFA 5BXUA 1EYHA 3RU0A 5ENQD 2AW6A 3CSTA 5M72A 1VDYA 3D9JA 3FH5A 2IQCA 4LUNU 3DSXA 4DX5D 3IKOB 1IQUA 3PNTB
chains in the Genus database with same CATH topology
1V54E 3AG3E 1OCZE 2Y69E 3ABLE 2DYRE 1OCCE 3AG4E 1V55E 2EIJE 2EIKE 2DYSE 2EINE 3WG7E 2EILE 3AG1E 5B1AE 3ABKE 3AG2E 1OCRE 1OCOE 3ASNE 3ASOE 3ABME 2ZXWE 2OCCE 5B3SE 3X2QE 5B1BE 5IY5E 2EIME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 E;  3AG3 E;  1OCZ E;  2Y69 E;  3ABL E;  2DYR E;  1OCC E;  3AG4 E;  1V55 E;  2EIJ E;  2EIK E;  2DYS E;  2EIN E;  3WG7 E;  2EIL E;  3AG1 E;  5B1A E;  3ABK E;  3AG2 E;  1OCR E;  1OCO E;  3ASN E;  3ASO E;  3ABM E;  2ZXW E;  2OCC E;  5B3S E;  3X2Q E;  5B1B E;  5IY5 E;  2EIM E; 
#chains in the Genus database with same CATH topology
 2XS8 A;  3Q75 A;  2QFC A;  2LAI A;  4EZK A;  4GTM A;  2RFM A;  1OWN A;  3QWP A;  3NF1 A;  3CSF A;  4U8Y D;  3G2T A;  4AVX A;  2EIL E;  4L1B A;  1TR4 A;  3PZ3 A;  5JJ6 A;  1N0R A;  5J90 A;  3MGB A;  3RSE G;  3Q4A B;  2OEV A;  3T8M A;  3L6A A;  4CDR A;  4A55 A;  3LKU A;  4F53 A;  1WDY A;  3D9O A;  3S7D A;  2HM8 A;  3PEV B;  3UM2 A;  5ENN A;  4UI9 K;  1UJJ A;  4G25 A;  4AEZ C;  4KYO B;  4D10 C;  1K1A A;  1HG2 A;  3AG3 E;  5E75 A;  1XGW A;  3CVY A;  1N4R A;  3FWV A;  3VTX A;  3CV0 A;  2WXO A;  4CGW A;  5DBK A;  3DPY A;  3LYA A;  4BFR A;  4EQF A;  4LCT A;  4NRH B;  2ILR A;  3Q7A A;  3FUF A;  2UY1 A;  2CHZ A;  3TWX A;  3R9A B;  3SNX A;  2QYJ A;  4FHK A;  4I1M A;  3U3W A;  3HHM A;  4XEI G;  2Y3A A;  3B7R L;  2PL2 A;  3U64 A;  1AWC B;  3IHY A;  3C3O A;  4PUC A;  4TXR A;  1KZP A;  3D9M A;  2LXM A;  2ZGD A;  5FZQ A;  4URK A;  3GZS A;  4JA7 A;  4UI9 J;  3FUK A;  4APO A;  2R05 A;  3SBS A;  2MOW A;  2P58 C;  2X6K A;  2M63 A;  4B8C B;  5CED B;  3FTY A;  1HG5 A;  2H6I A;  3J5Q B;  2NSZ A;  3MYV A;  2VGX B;  4TXQ A;  2ZIR A;  4O1P A;  2AWI A;  2XEV A;  5B1B E;  3C5R A;  4JXT A;  4DX2 A;  3ZYQ A;  4I1A A;  4ATZ D;  5AN8 A;  4HLE A;  2KCV A;  3E32 A;  2WM9 A;  3GZ2 A;  3W9F A;  2F0Y A;  1OWP A;  4UWH A;  2E0I A;  3UIN C;  4A3V A;  3NB2 A;  3G2S A;  4BX9 A;  1OXJ A;  1N4P A;  5H7P A;  2X6I A;  3BU8 A;  4B89 A;  3ZPJ A;  3O4Z A;  3ZIM A;  1B89 A;  2EIN E;  1E7U A;  1FT2 A;  2KC7 A;  3FUN A;  3FFL A;  4L2Y A;  3DXK G;  3SZ7 A;  3SF4 A;  5KNG A;  3F6Q A;  3S7F A;  4GZD A;  4HOQ A;  4O1O A;  5AQA A;  5EIB E;  2R17 C;  3HVE A;  1TN7 A;  4MS6 A;  3ZRH A;  4X8Q A;  3TXM A;  4U0Z A;  4I9E A;  1UN8 A;  2L9B A;  2XRZ A;  1OWO A;  3IXE A;  4GCN A;  3Q9N C;  5CRV A;  2OVF A;  3D9N A;  2EQX A;  3E33 A;  4J6I A;  3ZUV B;  2QZA A;  1H19 A;  5G05 J;  2AVP A;  1SA5 A;  1TNB A;  4UWF A;  3TWQ A;  4J8F A;  3CIA A;  4XX5 A;  3PVL A;  2V4H C;  4F7A A;  5CER B;  4JEH A;  1OCZ E;  5AEN A;  5BT1 A;  4ME2 A;  3IV0 A;  2Y0B G;  3UM0 A;  5ENO D;  4GA0 A;  4MLP A;  4HVB A;  3SFX A;  4CDN A;  3LJ3 A;  4UWK A;  2DYR E;  5A23 A;  1PY1 A;  4U95 D;  4HNA D;  2FO1 E;  2UWJ G;  1HFA A;  5AIJ A;  2VJ8 A;  2KXP C;  3FY4 A;  3FUM A;  3SY2 A;  4YDE A;  1E8W A;  4FAD A;  4ATG A;  2P9P G;  4EPZ A;  4BX8 A;  2V8S E;  5A6C A;  2BKK B;  3CGH A;  2MRI A;  3AS4 A;  4WAF A;  1Z6T A;  3FDH A;  2FI7 A;  1E8Z A;  2XGO A;  5AJD A;  2QYU A;  3LS8 A;  4G2V A;  5KWD A;  3S7J A;  4A3T A;  3UTM A;  3JUE A;  4N5Q A;  2VGY A;  3ZVV A;  4JHJ A;  1UOH A;  1GW6 A;  3FUJ A;  1INZ A;  2IU1 A;  2FEZ A;  4LNB A;  3G2V A;  4FP7 A;  4U0S A;  1UJK A;  3SHF A;  5BNW A;  4ABN A;  1YA0 A;  4XKC A;  4YVO A;  5KJM A;  4J8D A;  4FC8 A;  2V5Q C;  4BT8 A;  4CDM A;  3V79 K;  1V54 E;  5KJL A;  3CHO A;  1EDU A;  3MJW A;  2P9K G;  4BT9 A;  4OAU C;  4ZFH A;  1IXV A;  4HOR A;  4I1O B;  4TXP A;  4M7C A;  1Z5S C;  5CHE E;  4CT0 A;  2I1K A;  4WUY A;  5ANL A;  4N2S A;  1Z3X A;  2XPI A;  4I2Z A;  4XIF A;  4B0Z A;  5HRY A;  3DBS A;  4U8V D;  3R7Q A;  3I4G A;  1H2V C;  1K3Z D;  3EHN A;  3QNK A;  5JA4 D;  4LSZ E;  3QK0 A;  2XZD G;  2VSN A;  4GTV A;  3P1U A;  4FJZ A;  3C3R A;  1FVF A;  4KZC A;  2KZT A;  3SFY A;  1JCQ A;  5JJ7 A;  5CBN A;  2WMN A;  4BTB A;  3FH7 A;  2IO2 C;  4QQI A;  3TXN A;  2BED A;  4TUU A;  2ZU6 B;  3ABM E;  1IKN D;  3DEO A;  2WXG A;  1AP7 A;  4HS2 A;  2HR2 A;  3W9G A;  5FIO A;  2VSY A;  2MYO A;  2CFU A;  4K5B A;  4JD2 G;  4ACK A;  5CBO A;  4FUL A;  2J49 A;  2IOL A;  4B93 B;  1HH8 A;  2CG3 A;  4K5C A;  4ACL A;  4U04 A;  3BG1 B;  5ITZ F;  3L54 A;  4KBQ A;  3TG4 A;  3TWU A;  4IN3 B;  5T3R A;  3HXD A;  3QWW A;  1QBQ A;  3FUE A;  4J0U A;  4UWL A;  4RG6 A;  5ENS D;  2R2L A;  1RW2 A;  2F37 A;  3D9K A;  2GRR B;  3TWT A;  2A4Z A;  3ESL A;  3UUX A;  4G24 A;  5LCW J;  2EIJ E;  2EIK E;  4JW1 A;  5JHA A;  1YMP A;  3SQV A;  3PS6 A;  4EZJ A;  2OV8 A;  4NUR A;  4OVU A;  5B3S E;  1N9A A;  4WWN A;  1NFI E;  4G11 A;  3ENE A;  1ZBP A;  4HOU A;  3FUI A;  5EIL A;  4U0U A;  3TL5 A;  3DPD A;  2GGF A;  1P5Q A;  4O6F A;  4E6H A;  3UM1 A;  2HE0 A;  5D2M C;  1H6P A;  4AP2 A;  1SZ9 A;  3LCA A;  1WY6 A;  3JQ1 A;  2P9N G;  2LAH A;  4JPS A;  3OTN A;  2XPY A;  4LNU D;  1NA0 A;  2WXP A;  3BQO A;  4DI3 A;  2X6J A;  4U96 D;  1QQE A;  2P9S G;  3UPV A;  2ION A;  2EIM E;  2R03 A;  3GZ1 A;  4FJY A;  4HOS A;  4F1S A;  3NOC D;  2V5F A;  1N94 A;  3FEY A;  4UUC A;  4TUM A;  3D9H A;  3SI5 A;  2BF0 X;  3I4R B;  2H6H A;  1FCH A;  5JJT A;  4N3C A;  2OND A;  2VSX E;  4KT6 B;  2FO7 A;  3L9T A;  3DEP A;  4FA6 A;  4GMR A;  4GCO A;  3UM3 A;  3L17 A;  3AAA C;  3U66 A;  4A1G A;  2WQ6 A;  3PUK A;  2CFZ A;  4C9B B;  3HXF A;  5FTP A;  5LX8 A;  2ZGG A;  1ELR A;  2HYZ A;  1N11 A;  3E30 A;  4GML A;  2PZI A;  3ZHE A;  1NL4 A;  1BD8 A;  3KEA A;  5AAR A;  2JEK A;  3AJI A;  5D0O D;  3HG0 D;  4G8K A;  3TWW A;  3CVU A;  4IRU A;  4Q96 A;  1IHB A;  4E85 A;  3MKQ A;  3ZKJ A;  3N71 A;  3ULE G;  4C48 B;  4UWG A;  2WXN A;  4ILI A;  1W3B A;  2RG8 A;  2FBN A;  3CVP A;  3Q49 B;  4I6G A;  4AOF A;  3UQ3 A;  1SVX A;  1TNZ A;  4N3B A;  3G2W A;  4Q94 A;  1U3D A;  2LSV A;  3AG1 E;  4UQY A;  4PS7 A;  1HX8 A;  3L82 A;  4CGV A;  1ELW A;  3DRA A;  3SGH A;  2E2E A;  3FTS A;  4F1P A;  4BY6 A;  4APF A;  5HQ8 A;  2KCL A;  4FLH A;  1SW6 A;  3LVR E;  3PZ1 A;  2XPZ A;  3HXB A;  1S63 A;  1NA3 A;  2H6G A;  3FUD A;  3D3M A;  4DX6 D;  3KSQ A;  1S0P A;  4C0M A;  4XI9 A;  1D8E A;  3B95 A;  3CKB A;  2XQ0 A;  5T4Y A;  1Q2Z A;  3HXE A;  2XGM A;  2AXV A;  3CVV A;  5FJY A;  1DVP A;  1N4Q A;  5LFA A;  3CVW A;  2IO3 C;  3IHV A;  3IBE A;  4JHR A;  2PQN A;  3AS5 A;  3ASH A;  2RD0 A;  4LRZ A;  5E76 A;  1HS6 A;  4TV3 A;  2WQ7 A;  3KSL A;  2VTB B;  1QZ2 A;  1TJC A;  4MBG A;  5FQ6 A;  4J7W A;  3UT7 A;  3ESK A;  3TG5 A;  4K5A B;  1JUQ A;  2J8S D;  4GA2 A;  4PH4 B;  1OWM A;  2XGS A;  3TAX A;  4M3O A;  1BI7 B;  2XEH A;  1FVH A;  3Q73 A;  4AV7 A;  1OCC E;  2WMO A;  3OXF A;  4DX7 D;  4I17 A;  3CK8 A;  4V3I A;  2QY7 A;  1ZB1 A;  3TWV A;  4HLL A;  2KAT A;  1HO8 A;  2VSO E;  1SZA A;  3EIJ A;  2GRM A;  4GB9 A;  4B94 A;  2V0P A;  2XEN A;  2IFU A;  1TNU A;  4CEM A;  3HIZ A;  2X6F A;  2WXR A;  3CKC A;  2NYJ A;  1H0A A;  1DC2 A;  4RLY A;  1MQS A;  2Y69 E;  1QNF A;  4WNF A;  3B7S A;  5J08 A;  2XS1 A;  4EHM A;  2J9Q A;  4KMO A;  2VYI A;  3ABK E;  4JZY A;  4MRU A;  4HRN A;  3ULY A;  2I2O A;  4GYW A;  3ZYL A;  3ASD A;  2PNN A;  1RZ4 A;  4U07 A;  4BWR A;  1MZC A;  2IJG X;  2A5E A;  4GTO A;  2B0O E;  4DPR A;  3Q15 A;  3QWV A;  3NAW A;  4ZHB A;  3PZD A;  2I6H A;  3ZFW A;  4WWO A;  3QB2 A;  5ENR D;  3OXG A;  4N2Q A;  1TN6 A;  2ZIS A;  4FHJ A;  4HRL A;  1E8Y A;  3U9W A;  3R9M A;  4W9R A;  3DSS A;  1A17 A;  1BLX B;  3CQG B;  3ZN3 A;  3CK9 A;  4ANV A;  2MHK A;  3LY9 A;  4JC8 A;  2AXU A;  4WNE A;  1KT1 A;  4NAC A;  3ZW3 A;  2UY1 B;  4XKB A;  3T9K A;  1HXI A;  2LUH A;  4HRM B;  2DZO A;  4CRW A;  5DIZ A;  3QJZ A;  1OUV A;  4RQI A;  4RVB A;  2GRP B;  4CZ2 D;  3PNL B;  4HBD A;  5BV1 A;  4BEP A;  3ZXS A;  5KCM A;  4K03 A;  5G2N A;  5AQ7 A;  4GAA A;  3T5V A;  3DSV A;  4J8Y A;  3CHS A;  4N5C A;  2CG2 A;  4GYO A;  2LNI A;  1DCQ A;  1IYG A;  3FHE A;  1HE8 A;  4R7L A;  1MX6 A;  2R5S A;  1OCO E;  2C0M A;  4Z68 A;  5FZS A;  1BU9 A;  2FF4 A;  4WWP A;  3UI2 A;  5EX3 A;  2OVB A;  3P2B A;  4KXK B;  3GYZ A;  4EZL A;  3RIB A;  3EIQ C;  1MHQ A;  3D9P A;  4JL0 A;  4O60 A;  3FU0 A;  1D9S A;  3CHQ A;  1KPS B;  4Y6W A;  4HB5 A;  1H6O A;  4U7E B;  3G2U A;  4DLQ A;  3ZYM A;  1U2V G;  3B7U X;  1XNF A;  1JPL A;  3I5P A;  2P9U G;  3MA5 A;  3UXG A;  5CEC B;  5D66 A;  3EU9 A;  2V4L A;  4G1T A;  3LJN A;  3HVE B;  3JCK C;  1LD8 A;  2YHE A;  3UX4 A;  4PDX A;  1QYM A;  1N54 A;  4NIK A;  4YDY A;  3L22 A;  4JVS A;  4ANU A;  5HS0 A;  4FU3 A;  4GZC A;  4ILH B;  4TRQ A;  5AAO A;  2AXZ A;  4DRX E;  1MJ0 A;  1LF8 A;  2KCK A;  3PE3 A;  4Y6C A;  1PC2 A;  4YDO A;  1TYQ G;  5KNH D;  3E4B A;  5IY5 E;  3E37 A;  1K8K G;  2JAB A;  5JHB A;  3D9I A;  4KVO A;  5B1A E;  2CHX A;  4GTT A;  2ETA A;  3LXU X;  5JMN D;  5FQ8 A;  5ENT D;  5KBA A;  4J8S A;  4BET A;  3AG4 E;  1Y6I A;  1FPP A;  3PZ4 A;  1Z3Y A;  5G04 J;  4L7T A;  3QAQ A;  3V2X A;  2VGX A;  5CMW A;  2GRN B;  5G04 C;  2OEW A;  3CHP A;  3ONK A;  2BKG A;  2R59 A;  5AQB A;  3ASF A;  5EX0 A;  2WXQ A;  3RRN B;  3EHM A;  1X81 A;  2J07 A;  3DXM G;  4EBA G;  3PH0 C;  1Y8M A;  5KJK A;  2AJA A;  4G26 A;  3ABL E;  4GZ5 A;  2J4D A;  3CVX A;  4GA1 A;  2WB2 A;  1KT0 A;  2ETB A;  2Y4U A;  1UG3 A;  3TGO A;  4GTP A;  3B7B A;  2IF4 A;  2YHC A;  4BER A;  3APF A;  4AJW A;  1HZ4 A;  4GZ6 A;  3NZS A;  1LTX A;  4HI8 A;  1N4S A;  5CRU A;  3WXX A;  2C2L A;  2F8Y A;  3FUL A;  1OCR E;  2PM7 A;  4GMJ A;  4AM9 A;  1H2U A;  2L6J A;  4YDW A;  2FUL A;  2L0I A;  5D0Q D;  3LPZ A;  3FTW A;  4P29 A;  2LSU A;  4K0R A;  4I6J A;  3FU6 A;  2RKK A;  1N0Q A;  3GW4 A;  5FT9 A;  4Q69 A;  3LDZ A;  2L6B A;  4QFV A;  4G8L A;  1BPO A;  1E7V A;  5LP0 A;  2WXL A;  4GYY A;  1E90 A;  2YIN A;  3Q5M A;  4I6E A;  3CVN A;  3MEK A;  5AYW D;  2WVI A;  3CLJ A;  3UIO C;  3T5X A;  4HI9 A;  5CMY A;  2F8X K;  2BUG A;  4JA9 A;  3CVQ A;  4WND A;  3K9I A;  1N52 A;  4BES A;  1MX4 A;  3RK6 A;  5ANR A;  3AU4 A;  3HXC A;  3PRE A;  4U63 A;  3UIP C;  4I2W A;  4GZ3 A;  2J09 A;  3FUH A;  4F6R D;  1D8D A;  1WG0 A;  5FQ4 A;  2DWZ A;  3C3Q A;  2KZT B;  5FIN A;  4GPK A;  3RRU A;  4BTA A;  3CR3 A;  3MX3 A;  3JQ0 A;  4LNG A;  3LEW A;  1HF8 A;  3U4T A;  4FLB A;  3UMV A;  1JCS A;  3E34 A;  2DZN A;  3IEG A;  3ZU7 B;  4YND A;  5FZR A;  4JHK A;  3AU5 A;  1WAO 1;  5BPP A;  2GRQ B;  3OXL A;  4WNG A;  3HDX A;  5AQ9 A;  2WPV A;  1IHG A;  1ZU2 A;  1X5B A;  4L23 A;  3ZGQ A;  3L16 A;  3TJP A;  4CCA A;  3LY7 A;  1KZO A;  1NI1 A;  4UI9 C;  1EF1 C;  2PM6 A;  4BSX A;  2X38 A;  5ARG A;  4EBA A;  1JWG A;  2A5U A;  3KD7 A;  2Y4T A;  3VLE A;  2I9C A;  3QKY A;  5EDS A;  3FU3 A;  3OAW A;  1DNP A;  4L9P A;  4L2L A;  3APD A;  2WXF A;  3JYS A;  3MZL B;  4EEC A;  4A1S A;  4DI4 A;  3PZ2 A;  3D9L A;  3ULQ A;  1H2T C;  3MV3 B;  2HO1 A;  3B7T A;  4YVQ C;  5LOZ A;  5EN5 D;  2ETC A;  1O1S A;  1L5J A;  4N39 A;  2P9L G;  4JB8 P;  3Q78 A;  3ASG A;  1MX2 A;  2YNQ A;  1WM5 A;  1MYO A;  3VTY A;  3RO3 A;  1FT1 A;  1TN8 A;  4XZ4 A;  3NZU A;  3X2Q E;  1DCE A;  2XHE A;  3FU5 A;  2IY0 C;  1O5M A;  1SA4 A;  2WXI A;  2LO6 A;  2WXH A;  1O1T A;  2I1J A;  2XEE A;  1TJF A;  2GRL A;  2OOE A;  1BI8 B;  2RFA A;  5T8I A;  3RO2 A;  3Q79 A;  3V2O A;  3ASO E;  4XE0 A;  3EJN A;  3B13 A;  4KVM A;  2GW1 A;  1JWF A;  1TNY A;  2NC9 A;  4HFG A;  5BXO A;  4HOT A;  3DSW A;  2P2C P;  3ZYK A;  1O1R A;  3BUA A;  1U3C A;  3KAE A;  3UT8 A;  5AJL A;  1YYH A;  3UKR G;  5G55 A;  5G05 C;  2XCB A;  4CYM D;  4ILG A;  3APC A;  3RRM B;  3CHM A;  2Y1L E;  2DVW A;  4OVV A;  4OAV B;  4PS3 A;  5FQ7 A;  3ZHE B;  3V31 A;  3QDN A;  3NBN B;  3EUV A;  1ELK A;  3KEZ A;  4KZ0 A;  3FH8 A;  2J4B A;  1EPU A;  3MKQ B;  3V30 A;  4XI0 A;  4HQD A;  2X3M A;  1KLX A;  3UKU G;  2R02 A;  3FTX A;  4GPM A;  3CVL A;  4I9C A;  3AG2 E;  2WXM A;  3ZNG A;  4DJA A;  2J08 A;  4PS8 A;  3URZ A;  2WXJ A;  3PUJ A;  3PE4 A;  1E96 B;  3BG0 B;  3CQC B;  3JXJ A;  3ISM C;  4GTQ A;  2WXK A;  3TWR A;  1A5E A;  5A7D B;  3PDN A;  3MKR A;  1JCR A;  1UN9 A;  3EHQ A;  4GTR A;  2NXP A;  2XRY A;  4NQ0 A;  3VLF A;  3ML8 A;  4DLO A;  3JUI A;  1SQM A;  2YQ8 A;  3QOU A;  3I3N A;  4JEU A;  3S7B A;  2IEJ A;  4OYS A;  2L0T B;  3O48 A;  5HKP A;  1YCS B;  1N95 A;  2OCC E;  2XCC A;  3CHR A;  2Q7F A;  4G23 A;  3C98 A;  3FTV A;  3T8K A;  3L13 A;  4LEU A;  3QC1 A;  2BTD A;  4IUL A;  4DUI A;  3SBT B;  3Q7F A;  4ANX A;  1TEZ A;  1UW4 B;  3NOG D;  3VLD A;  4DX1 A;  3BEE A;  3FEX A;  4RSY A;  1OT8 A;  5BV0 A;  1IQR A;  3SO8 A;  3SFZ A;  2X6H A;  5BUZ A;  3FTZ A;  3Q9U C;  3FP3 A;  3ML9 A;  4AXH A;  3EDT B;  5EKQ D;  4HXI A;  3Q47 B;  4AIF A;  2VQ2 A;  5EYL A;  4BSZ B;  2C0L A;  3CEQ A;  1K1B A;  1HU3 A;  3HRA A;  4DK5 A;  1PAQ A;  4LER A;  1OY3 D;  2P9I G;  5EYP F;  3DWL G;  5BW8 C;  2PQR A;  4H7X A;  3LY8 A;  3SD5 A;  3HYM B;  4F3V A;  3ZXP A;  1E8X A;  2KM4 A;  3DST A;  2VGE A;  3CK7 A;  2KBX A;  1S64 A;  2JLB A;  3RAU A;  5FWQ A;  3RJV A;  2LXL A;  1TNO A;  5CCL A;  4AY6 A;  2CHW A;  4H7Y A;  3KS2 A;  3MCX A;  4UQX A;  1S70 B;  3ONL A;  3S2A A;  3EU5 A;  2DBA A;  5CEA A;  5ENP D;  2XZT G;  2WQH A;  4GU5 A;  5CCM A;  3QAR A;  2DCP A;  1H6K A;  4CT4 A;  3WG7 E;  4LG6 A;  5KJN A;  3JXI A;  3R7R A;  3AS8 A;  2ZXW E;  4U8H A;  4J8E A;  3TWS A;  3UT4 A;  4RG9 A;  2DIW A;  3LVQ E;  2VTB A;  1LD7 A;  5EID A;  2DYS E;  4B8A A;  4N3A A;  5LCW C;  3FTU A;  3ASN E;  3RKV A;  2GRO B;  1OWL A;  3NQP A;  3EHR A;  4AY5 A;  2QC9 A;  1NP7 A;  3C72 A;  2H6F A;  3MV2 B;  4GTS A;  3PEU B;  3L08 A;  4MKT A;  3PRZ A;  5C1D A;  5C2Y A;  3ZEF A;  1G3N B;  1NZN A;  3J5P A;  4ANW A;  4C0E A;  2B6C A;  4IYP A;  4I43 A;  3DSU A;  5HI7 A;  4UQZ A;  4A63 B;  1V55 E;  2IOS A;  5ARF A;  5BXU A;  1EYH A;  3RU0 A;  5ENQ D;  2AW6 A;  3CST A;  5M72 A;  1VDY A;  3D9J A;  3FH5 A;  2IQC A;  4LUN U;  3DSX A;  4DX5 D;  3IKO B;  1IQU A;  3PNT B; 
#chains in the Genus database with same CATH homology
 1V54 E;  3AG3 E;  1OCZ E;  2Y69 E;  3ABL E;  2DYR E;  1OCC E;  3AG4 E;  1V55 E;  2EIJ E;  2EIK E;  2DYS E;  2EIN E;  3WG7 E;  2EIL E;  3AG1 E;  5B1A E;  3ABK E;  3AG2 E;  1OCR E;  1OCO E;  3ASN E;  3ASO E;  3ABM E;  2ZXW E;  2OCC E;  5B3S E;  3X2Q E;  5B1B E;  5IY5 E;  2EIM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...