1KLXA

Helicobacter pylori cysteine rich protein b (hcpb)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
133
structure length
133
Chain Sequence
GGGTVKKDLKKAIQYYVKACELNEMFGCLSLVSNSQINKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cysteine Rich Protein B
publication title The crystal structure of Helicobacter pylori cysteine-rich protein B reveals a novel fold for a penicillin-binding protein.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 52
structure length 133
sequence length 133
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08238 Sel1 Sel1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1klxA00
2LSUA 4JA7A 1IHGA 4UI9K 4GZ6A 3Q49B 1KT1A 2WPVA 4B94A 5C1DA 3AS8A 3RU0A 3U3WA 3MEKA 3Q15A 1HXIA 5JJ6A 4BWRA 3EDTB 5KJKA 4XI0A 2PQNA 4H7YA 2FF4A 4GCNA 3UPVA 3URZA 4BTAA 3CEQA 3MA5A 1KLXA 2FI7A 4CDRA 5DIZA 4N3BA 4I9EA 3AS5A 5D0QD 3CK7A 2XPIA 4U07A 4BTBA 3K9IA 3N71A 3ZHEB 3KD7A 3CV0A 4AIFA 4GZ5A 2VYIA 4WNDA 5CCMA 4GA2A 2XGSA 3ASHA 4LEUA 1NZNA 4I9CA 3MKRA 2YHCA 3S7DA 4U04A 5LCWC 5HQ8A 1FCHA 5FTPA 2E2EA 3CKCA 4KBQA 2C2LA 2FBNA 2R5SA 4W9RA 4N2SA 3UQ3A 3CVQA 3S7BA 1HH8A 3R9AB 5DBKA 3RO2A 3CK9A 1PC2A 2QFCA 5BW8C 1WM5A 5FZQA 4U0SA 4HORA 3ASFA 2L6JA 4I17A 5HI7A 4XI9A 2I6HA 3VTXA 5EX3A 3ZGQA 1NA3A 4YVOA 2PQRA 1ZBPA 3S7JA 4J8DA 1QZ2A 3KAEA 4H7XA 4F3VA 2VGYA 1XNFA 5CHEE 4UQYA 3SZ7A 3SF4A 3IEGA 2OOEA 1TJCA 3QWVA 1W3BA 3Q5MA 4ABNA 3AS4A 3ULQA 4A1SA 2P58C 4RG6A 2LNIA 4I2ZA 3LYAA 5FZRA 5FZSA 3QWWA 3TG5A 2IFUA 3OXFA 2BUGA 2J9QA 3PE4A 4HOQA 3RKVA 1A17A 1E96B 3FWVA 4KYOB 3QOUA 3VTYA 1ELWA 2YQ8A 4G23A 2UY1B 1IYGA 3Q4AB 3RJVA 2KCLA 4N5CA 4CGVA 4G2VA 3ASDA 4GYWA 3OXGA 2HR2A 3FFLA 4WNGA 3CK8A 2MHKA 4JA9A 4G1TA 3GZ1A 3ESKA 3KS2A 2HO1A 3ZFWA 5KJLA 3QDNA 2PZIA 3U4TA 4HOSA 1ZU2A 2XGMA 2Y4TA 3GZ2A 2DBAA 2ONDA 4N3AA 4XIFA 5LCWJ 1KT0A 4U0ZA 2JLBA 3ASGA 2PL2A 4YNDA 3QWPA 1HZ4A 3CVPA 4GZ3A 4J8EA 4AY5A 4BT8A 3LY7A 5ARFA 3O48A 2VQ2A 3LY8A 3BEEA 4WNFA 5A7DB 4AM9A 4IN3B 3LCAA 2UY1A 4GYOA 2XCCA 3GW4A 2C0MA 5BT1A 4GYYA 4I2WA 4NRHB 2FO7A 3FP3A 5KJMA 4I1AA 5CCLA 3TGOA 4RG9A 1OUVA 4EQFA 3LPZA 4UQZA 3ZN3A 3LY9A 4U0UA 4KXKB 4NQ0A 2NC9A 2V5FA 5G04C 3HYMB 4BT9A 2AVPA 4G26A 4HOUA 3TG4A 5KJNA 5FT9A 3RIBA 3LKUA 5D0OD 5ARGA 4O6FA 5G04J 4WNEA 5EX0A 5A6CA 3UUXA 5M72A 4GPKA 3WXXA 2KATA 3RO3A 3S7FA 4UQXA 2XCBA 2VGXB 2IF4A 3Q47B 5BNWA 5FJYA 4Y6CA 4APOA 2HYZA 2XGOA 4N3CA 4UI9C 2FEZA 2VSYA 4AY6A 4G25A 4HOTA 4GA1A 3JYSA 4Y6WA 5AYWD 2VSNA 3TAXA 1QQEA 1Y8MA 3MV3B 1YA0A 1P5QA 4J0UA 5JJ7A 4UI9J 1NA0A 3PE3A 4GA0A 2Q7FA 3ZPJA 3CKBA 4WUYA 3OXLA 3E4BA 1ELRA 2GW1A 4YVQC 3CVLA 4JL0A 4J8FA 2UWJG 5G05C 2XEVA 1WAO1 3NF1A 2KCKA 4CGWA 2LSVA 4JHRA 4ME2A 3CVNA 2VGXA 2Y4UA 2KC7A 4G24A 3GYZA 4GCOA 5JJTA 5EKQD 4N2QA 3MV2B 4N39A 1B89A 2C0LA 5G05J 3PDNA 2KCVA 3ZHEA 2WQHA 3QKYA
chains in the Genus database with same CATH superfamily
3BUAA 1N4QA 3NOGD 4U8HA 4B94A 3U3WA 4M3OA 2GGFA 3FTXA 2I9CA 4ILHB 1TR4A 2PQNA 3F6QA 2FF4A 2Y1LE 3UPVA 2GRLA 2L9BA 4BTAA 4F1SA 3FTWA 3HIZA 3HDXA 5G2NA 2FI7A 1SA5A 3EUVA 5AQ7A 3T8KA 4TUMA 2XPIA 4U07A 4R7LA 1O1TA 1UJKA 2XS1A 4O1OA 4FA6A 3UKRG 2MOWA 2ETCA 2NYJA 4GZ5A 3LJNA 2GRQB 5CCMA 3ASHA 4I9CA 3APFA 2CG3A 2YHCA 5AIJA 5LCWC 4L2LA 1FCHA 1HF8A 1JPLA 5FQ4A 5FTPA 3FULA 2C2LA 2J09A 3UM3A 2IQCA 5JHAA 3ENEA 1N0QA 4LSZE 3DPYA 3S7BA 3R9AB 2M63A 4EHMA 4U0SA 4HORA 1RW2A 2L6JA 4I43A 5HI7A 2I6HA 1PY1A 2AJAA 3Q75A 4A63B 2J4DA 3S7JA 3GZSA 3FUMA 2WXNA 3PH0C 2F8XK 1UOHA 2QZAA 4F3VA 1UG3A 5ENRD 2R2LA 3SGHA 2CFUA 2VGYA 1EYHA 5J90A 5EIBE 3EHMA 2RFAA 4UQYA 3SZ7A 3SF4A 3WG7E 1TNUA 3QWVA 3LXUX 1TNOA 3R9MA 3FTZA 2OEVA 4JW1A 1H6OA 3AS4A 5A23A 3ZVVA 4HRNA 1HU3A 2B6CA 4QFVA 3V30A 4GTOA 4I2ZA 2XS8A 3FTYA 4B89A 1E8XA 5ENQD 3QWWA 3DSTA 3TG5A 2EIKE 3C3RA 3OXFA 2BTDA 3PE4A 4DX6D 1DCEA 5LOZA 2KM4A 3RKVA 1E96B 3HXBA 3FWVA 3AU5A 3B7BA 4KYOB 2A5EA 3ZYLA 1ELWA 2F0YA 3RJVA 1H0AA 3ZYMA 1LTXA 1X81A 5E75A 3NZUA 4TXRA 5FQ6A 3OXGA 3PEUB 2WXKA 3CSFA 4WNGA 1KPSB 4U95D 2R03A 3UKUG 4HFGA 4FLHA 1S63A 5BXUA 2LXLA 3ZFWA 4U8YD 4Q69A 3C3QA 3FY4A 3GZ2A 3I4RB 3TL5A 4AVXA 2DBAA 3E37A 4MBGA 5AAOA 3CR3A 4DX1A 2P9KG 4GZ3A 5LX8A 4J8EA 2B0OE 3UM2A 1OXJA 4AEZC 3W9FA 3B7RL 3ZXPA 3V2XA 3LY8A 1L5JA 5HS0A 3UMVA 4BFRA 2VGEA 4IYPA 1YCSB 3RSEG 3UM0A 3FTUA 2C0MA 4GYYA 4I2WA 2FO7A 2DWZA 4GTQA 3FP3A 3MZLB 2PM6A 4LNBA 2A5UA 5KJMA 2FO1E 4DI4A 1G3NB 3B95A 1YMPA 4DRXE 5CECB 2IY0C 3CLJA 1OUVA 4EQFA 4ZHBA 5CMYA 3ZN3A 2E0IA 3RK6A 4NQ0A 3D9PA 2NC9A 4Q96A 3CHMA 3ZIMA 2AVPA 5ANLA 4KZCA 4HOUA 4BSZB 3TG4A 3MKQB 4GTSA 3JXJA 4TXPA 3LKUA 4TUUA 3Q9UC 2ILRA 1N94A 4BX8A 5ARGA 5EIDA 4XKBA 5EX0A 5M72A 1AP7A 1S70B 3S7FA 1K1BA 4UQXA 2WXPA 3D9KA 2IF4A 4WWOA 3AAAC 1E90A 4JC8A 4Q94A 1OCRE 4N3CA 2EIME 2FEZA 1YYHA 3ISMC 4HOTA 1JCQA 2AWIA 2A4ZA 3JYSA 3QARA 3V31A 3FH8A 2VTBA 5T3RA 5B1BE 4CT0A 3ULYA 5JJ7A 3PE3A 4K0RA 2DZOA 4GA0A 3ZPJA 5KWDA 3CKBA 3TJPA 3VLFA 3ABME 1E7UA 4AOFA 3MJWA 2R17C 3IBEA 3E4BA 1ELRA 1JCSA 3D9JA 1EDUA 4YVQC 4RQIA 3CVLA 1DCQA 4J8FA 3TXNA 1N95A 1WAO1 3ABLE 2WXMA 2LSVA 1LD8A 4LG6A 3EIJA 4TV3A 3E34A 3EIQC 2QY7A 3UX4A 3CVNA 2Y4UA 4BX9A 3KSLA 3LS8A 3LVQE 4GTTA 5EILA 5EKQD 3CIAA 3EHRA 1TJFA 2LUHA 4N39A 1O5MA 4JD2G 2P9UG 4LRZA 4HI8A 4HXIA 3PDNA 2KCVA 4URKA 3ZHEA 2WQHA 4IULA 3QKYA 4GZCA 2CG2A 3DSUA 4BETA 2GRMA 4KT6B 3DEPA 1Z5SC 3NOCD 4UI9K 4HQDA 4Z68A 4GZ6A 3Q49B 1KT1A 1MQSA 1OWMA 3DXMG 2F8YA 3Q15A 1WG0A 5JJ6A 2MRIA 1JCRA 3NZSA 3EDTB 2BF0X 4OAUC 5KJKA 4XI0A 5FQ8A 2EIJE 4H7YA 3URZA 5EDSA 3NBNB 2LAIA 4KMOA 4U8VD 3EJNA 3CEQA 4GTRA 4A55A 1HS6A 4J7WA 3D9MA 2DIWA 4CDRA 4DX7D 4ZFHA 1MHQA 2DYSE 1MX6A 3Q7AA 1RZ4A 3LDZA 2IOLA 5LP0A 4I9EA 5KNHD 5D0QD 4RLYA 3ONLA 4DLOA 4EECA 4FJZA 1OWNA 1SZAA 1DC2A 3PZ1A 1TN6A 4KZ0A 4P29A 3B13A 4TRQA 3CV0A 3B7TA 1IHBA 2KXPC 4TXQA 2LXMA 4ACLA 3OAWA 5CEAA 3HXEA 1HO8A 4J6IA 4L23A 4GTVA 3SFZA 4KBQA 4CCAA 5JHBA 2I2OA 1BU9A 4W9RA 3UQ3A 3FDHA 1FT2A 1HH8A 4HLLA 3UTMA 2QFCA 3SD5A 2X6FA 3TWWA 4EZLA 3I5PA 1D9SA 2LAHA 3FUHA 3VTXA 2XQ0A 1BLXB 3ZGQA 3ZEFA 2CHZA 3BU8A 4FADA 2R02A 3E30A 4FLBA 1TNYA 4BEPA 4MKTA 5AQBA 5KNGA 4J8YA 4UWLA 3DRAA 3IEGA 2OOEA 3Q5MA 3QAQA 3ZXSA 3PZ3A 1JUQA 2WMOA 5CMWA 2JEKA 3AG2E 2P9LG 3T9KA 2WXFA 3ULQA 4A1SA 4RG6A 4GMJA 4CRWA 4DI3A 5C2YA 3RRUA 2LNIA 2ETBA 3LYAA 5FZRA 3EU5A 1H2UA 2WQ7A 3W9GA 4JB8P 1LD7A 1O1RA 4ILIA 2IFUA 5AENA 2BUGA 2HM8A 3ZUVB 3HXDA 4EZKA 4L9PA 1TN7A 4I1MA 4LCTA 2L6BA 4G23A 1NP7A 1OWPA 1IYGA 3TWSA 3DXKG 2BKKB 3Q4AB 4JEUA 2XPYA 4FHJA 1TYQG 4G2VA 4XKCA 3ASDA 4GYWA 3AU4A 3CK8A 4D10C 1LF8A 4JA9A 4OYSA 4G1TA 3KS2A 4JHJA 3DSSA 2HO1A 3C72A 2IO2C 3PZ4A 2XGMA 2OEWA 3FUEA 1K3ZD 3JXIA 2ONDA 5HKPA 3Q9NC 5LCWJ 2WXHA 2X38A 3NAWA 5CERB 4U0ZA 2JLBA 1NFIE 2QC9A 4YNDA 3QWPA 2WXOA 3CVPA 1MYOA 4AY5A 4JEHA 4UWFA 2P9NG 3U9WA 1IQUA 3FH7A 3FHEA 3QK0A 5A7DB 4IN3B 3LCAA 1KZPA 2AXVA 1OCCE 3TWVA 4GYOA 2XCCA 3SY2A 1Y6IA 2H6GA 4RSYA 3TGOA 1WDYA 2F37A 3ABKE 3DWLG 4KXKB 5T8IA 2WB2A 2V5FA 2CHXA 4OVUA 1D8DA 5KJNA 3CHSA 3E33A 3AG1E 3PREA 4WNEA 2IOSA 4GPKA 3G2VA 3UT4A 2VGXB 1UN8A 2P9PG 3FEYA 3IHVA 4LUNU 4Y6CA 4APOA 2DYRE 4HVBA 2XZDG 4GMRA 3UM1A 2IJGX 4ANXA 4CT4A 4L2YA 5AYWD 5KBAA 1QQEA 1INZA 1OWLA 4J0UA 1HE8A 2J49A 1NA0A 5CBNA 4F1PA 2Y69E 3UXGA 1N9AA 2Y0BG 4HNAD 4BERA 5AQAA 3UIOC 2H6FA 4C0MA 1E7VA 3CGHA 1H6KA 2YINA 3PNTB 1S64A 3J5QB 2KCKA 4B8CB 2AXUA 3HG0D 3B7UX 3EU9A 3Q78A 2I1JA 2VGXA 2VTBB 3TWXA 1PAQA 1U3CA 5ANRA 2XHEA 2J4BA 2XRZA 1K1AA 1IHGA 2IONA 4GAAA 5AN8A 2WPVA 4O1PA 3AS8A 2EINE 3MEKA 4BESA 3JQ0A 3CSTA 4FJYA 4GCNA 4JHKA 2ZGGA 4WWPA 4GU5A 1XGWA 3DSWA 2XZTG 4HB5A 3Q7FA 2ZISA 3I3NA 3CK7A 1SQMA 3J5PA 3ZU7B 2HE0A 4CEMA 1V54E 3SNXA 3D3MA 3N71A 3ZHEB 5BPPA 4L7TA 3KD7A 4ANWA 3EHQA 3PNLB 5FIOA 3SFXA 4AIFA 4F53A 2H6IA 2VYIA 4NACA 4WNDA 4GA2A 1NZNA 4GTMA 4EBAG 3MKRA 4I6GA 3S7DA 5HQ8A 4K5BA 5LFAA 3CKCA 1OY3D 3JUEA 3MYVA 2YNQA 3FUDA 2BKGA 3APCA 3HXCA 3V79K 2ZIRA 3CK9A 1PC2A 5BW8C 4BY6A 1WM5A 5FZQA 3JUIA 3CVUA 4HRLA 4X8QA 4E85A 3FUFA 1NA3A 4DJAA 1D8EA 4CYMD 3PEVB 5CBOA 1BD8A 1QZ2A 3FU3A 3TWRA 3FUKA 4H7XA 5EYLA 1FT1A 1XNFA 3KSQA 4FC8A 1TJCA 1V55E 1W3BA 4DPRA 3L13A 4ATGA 3TXMA 4ABNA 1S0PA 4N5QA 5G55A 3CHRA 1HX8A 1IQRA 5ENTD 3FUIA 2XEHA 2VSOE 4GB9A 4L1BA 1OCOE 3DBSA 3HVEB 4MLPA 4HOQA 2XEEA 2WXGA 2P9IG 3DSVA 3VTYA 3O4ZA 4U7EB 3PZDA 2UY1B 5J08A 2ZGDA 3VLEA 3PUKA 2WQ6A 2J07A 2MHKA 4HRMB 4LERA 3LJ3A 3QB2A 5EN5D 3GZ1A 1Z3YA 3ESKA 2V8SE 4UWKA 5KJLA 2PZIA 4HOSA 1ZU2A 2ETAA 2QYUA 4PS3A 2V4HC 2VSXE 1UW4B 4N3AA 5FQ7A 3L08A 4XIFA 4FP7A 4JPSA 2P2CP 3PRZA 1HZ4A 1AWCB 2V0PA 4PH4B 4IRUA 2PM7A 5B3SE 3LY7A 5ARFA 3O48A 3HVEA 4EBAA 3G2SA 3BG0B 3ONKA 3BEEA 4WNFA 1H2TC 3SHFA 2UY1A 3PZ2A 3ZRHA 2RG8A 5BT1A 3UINC 2WXIA 4I6JA 4AV7A 4A1GA 4I1AA 2R59A 1JWFA 3QJZA 3SBTB 4PS8A 3LPZA 3QC1A 3CHOA 4NURA 4U0UA 1N52A 4JZYA 3L9TA 4ANVA 5T4YA 1SVXA 5G04C 1QNFA 4DX5D 1UJJA 3HYMB 4BT9A 1OT8A 3CVYA 4K03A 2Y3AA 3L16A 2V5QC 4G26A 3JCKC 5FT9A 3ULEG 5D0OD 5ENSD 4DUIA 4O6FA 3FU5A 5G04J 3KEZA 1OWOA 3IHYA 3SI5A 3WXXA 2XCBA 3L54A 3Q47B 2WVIA 3CHQA 5FJYA 4QQIA 3FU0A 3ASNE 2XGOA 1H2VC 2X6IA 4UI9C 4G25A 3UIPC 4GA1A 4Y6WA 1WY6A 1JWGA 2EQXA 2VSNA 4HBDA 4AP2A 1N11A 3ML9A 5FWQA 1Y8MA 4C9BB 3T5VA 4A3TA 3G2WA 1YA0A 2KBXA 3ASOE 1TNBA 2AXZA 4UI9J 4YDEA 4C48B 2X6JA 4OAVB 4I1OB 4YDYA 4GPMA 2X6KA 4HS2A 3S2AA 2WM9A 4UWHA 4EPZA 2VJ8A 2J08A 3U66A 1U2VG 4K5CA 4WUYA 2ZU6B 4B0ZA 1H19A 3OXLA 2WXJA 4E6HA 1MX2A 2OVBA 4YDWA 1KZOA 4WWNA 4V3IA 4JHRA 5CEDB 3ZNGA 1HFAA 4G24A 3GYZA 2GRRB 5JJTA 3MV2B 5EYPF 1MJ0A 3U64A 1DNPA 2ZXWE 4NIKA 1A5EA 4LNGA 3FTSA 3C3OA 1TEZA 2LSUA 2KZTB 2OVFA 4JA7A 3CQGB 5AARA 2L0IA 4G11A 3RRMB 3AJIA 5C1DA 5D2MC 3RU0A 1QYMA 1HXIA 4PUCA 4BWRA 3EHNA 1IKND 2WXRA 4U63A 2OV8A 4WAFA 4B93B 4J8SA 1UN9A 3MA5A 2NXPA 5ENNA 1KLXA 3NB2A 2IEJA 5DIZA 3OTNA 4XE0A 4N3BA 3NQPA 3AS5A 3D9LA 3G2TA 3PS6A 4BTBA 1DVPA 2LO6A 1NL4A 4APFA 3CQCB 3K9IA 1O1SA 5BUZA 2RFMA 1FPPA 3R7QA 3IV0A 3MGBA 3PVLA 3L82A 3D9OA 1TN8A 2PNNA 2I1KA 2QYJA 2XGSA 2KZTA 4LEUA 3ML8A 3FUJA 1Z6TA 4U04A 3Q73A 2E2EA 4GZDA 2FBNA 2R5SA 5AQ9A 4MS6A 4N2SA 2XPZA 3CHPA 3CVQA 4AXHA 4K5AB 5DBKA 3RO2A 3APDA 3TWQA 5JMND 3D9NA 4MRUA 4DLQA 3ASFA 4I17A 2IU1A 2JABA 4XI9A 1BI8B 3TWTA 5EX3A 4ACKA 2DZNA 5KCMA 4YVOA 4B8AA 3C98A 3V2OA 2PQRA 1TNZA 1ZBPA 4J8DA 3RRNB 3KAEA 1EF1C 3UT7A 1FVHA 5IY5E 4CZ2D 2XRYA 4F6RD 2GROB 1VDYA 3T8MA 2CHWA 1FVFA 3L22A 2NSZA 5CHEE 1E8WA 4ANUA 1HG2A 4KVOA 3DEOA 1N54A 4DX2A 2WXQA 4DK5A 4O60A 3VLDA 4ATZD 3SQVA 5HRYA 2P58C 2P9SG 4FULA 3BG1B 3MX3A 4M7CA 4PS7A 3FU6A 5FZSA 3DPDA 3CVWA 5BV0A 2J9QA 3ZKJA 4LNUD 3DSXA 3Q79A 3UT8A 4A3VA 4FHKA 1A17A 3IKOB 3HXFA 3QOUA 1SW6A 2YQ8A 5BV1A 2FULA 4GTPA 2KCLA 1Z3XA 1ZB1A 4PDXA 4N5CA 3E32A 3LEWA 4CGVA 1BPOA 3HRAA 1GW6A 5ITZF 2HR2A 3FFLA 1MX4A 4C0EA 1U3DA 4I6EA 5FINA 3P2BA 2J8SD 2V4LA 3QDNA 3U4TA 4XZ4A 2Y4TA 3FTVA 5H7PA 4YDOA 2OCCE 3BQOA 4XEIG 1ELKA 4EZJA 1KT0A 1MZCA 4FU3A 3MCXA 4XX5A 5BXOA 3ASGA 2PL2A 3ESLA 4UUCA 3I4GA 2DVWA 4CDMA 3MKQA 4BT8A 4U96D 2IO3C 2L0TB 2VQ2A 1K8KG 4F7AA 4HLEA 4AM9A 3KEAA 1BI7B 2GRPB 3GW4A 4NRHB 3L17A 3D9IA 1E8YA 3C5RA 3FUNA 5CCLA 4RVBA 4RG9A 1QBQA 4UQZA 4ILGA 3LY9A 4KVMA 3L6AA 2WXLA 3ZW3A 3UI2A 3LVRE 4JXTA 5CRVA 3T5XA 3ZYKA 3AG3E 4GMLA 2AW6A 2MYOA 3RIBA 1NI1A 3JQ1A 3ZYQA 2RKKA 3G2UA 5JA4D 5A6CA 2RD0A 4JVSA 3UUXA 2KATA 3RO3A 2YHEA 3AG4E 3SO8A 3X2QE 1SA4A 5BNWA 2HYZA 1N0RA 2VSYA 4AY6A 3D9HA 2EILE 4G8KA 1Q2ZA 3TAXA 2CFZA 2WMNA 1N4SA 4AJWA 3HHMA 3SBSA 3MV3B 1P5QA 2GRNB 3RAUA 5D66A 3FEXA 3TWUA 4OVVA 4CDNA 2Q7FA 4G8LA 2H6HA 2XENA 2R05A 3IXEA 1N4RA 4BSXA 3FH5A 5ENOD 5CRUA 1N4PA 2GW1A 3P1UA 2X6HA 4UWGA 1H6PA 1IXVA 4JL0A 2UWJG 5G05C 1EPUA 2BEDA 2XEVA 3NF1A 3QNKA 4CGWA 3PUJA 3SFYA 4ME2A 1X5BA 5AJDA 2X3MA 5AJLA 1OCZE 3CVVA 1SZ9A 2KC7A 5B1AE 5E76A 4GCOA 4N2QA 1B89A 2C0LA 5G05J 1E8ZA 3B7SA 5ENPD 3R7RA 4HI9A 3CVXA 2DCPA 1HG5A
chains in the Genus database with same CATH topology
2LSUA 2KZTB 2OVFA 2GRMA 4JA7A 3CQGB 4KT6B 1IHGA 2IONA 4UI9K 4U8HA 4GZ6A 3Q49B 4GAAA 1KT1A 2WPVA 2L0IA 4B94A 4G11A 3RRMB 5C1DA 1MQSA 1OWMA 3AS8A 3RU0A 3U3WA 4M3OA 3MEKA 3Q15A 4PUCA 1HXIA 5JJ6A 4BWRA 2MRIA 3EHNA 2GGFA 3NZSA 3EDTB 2BF0X 2WXRA 3JQ0A 3FTXA 5KJKA 3CSTA 2I9CA 4ILHB 4XI0A 5FQ8A 2PQNA 4U63A 2OV8A 2FF4A 4FJYA 4GCNA 4H7YA 4JHKA 3UPVA 3URZA 4WAFA 4WWPA 2GRLA 5EDSA 4GU5A 2LAIA 4KMOA 1XGWA 3EJNA 4J8SA 2L9BA 4BTAA 4F1SA 3CEQA 1UN9A 4A55A 1HS6A 3FTWA 3MA5A 2NXPA 3HIZA 5ENNA 3D9MA 3HDXA 5G2NA 1KLXA 2FI7A 2DIWA 4CDRA 5DIZA 1MHQA 3OTNA 4XE0A 3LDZA 2IOLA 3NQPA 4N3BA 5LP0A 4I9EA 3AS5A 3D9LA 3I3NA 5D0QD 3CK7A 1SQMA 2XPIA 3G2TA 3ONLA 4U07A 3PS6A 4R7LA 1UJKA 4DLOA 4EECA 4FJZA 4CEMA 4BTBA 1OWNA 1DVPA 1SZAA 4FA6A 2LO6A 3SNXA 4APFA 2MOWA 3CQCB 3D3MA 3K9IA 3N71A 3ZHEB 5BPPA 4L7TA 5BUZA 3KD7A 4ANWA 4KZ0A 4P29A 3B13A 4TRQA 3R7QA 3CV0A 3B7TA 3IV0A 3MGBA 3PNLB 4AIFA 4F53A 3PVLA 3D9OA 4GZ5A 4ACLA 2VYIA 4NACA 3OAWA 4WNDA 2I1KA 5CCMA 4GA2A 2XGSA 3ASHA 2KZTA 4LEUA 1NZNA 4I9CA 3ML8A 3FUJA 3APFA 1HO8A 4J6IA 4L23A 1Z6TA 3MKRA 2CG3A 2YHCA 4I6GA 4U04A 3S7DA 4EBAG 4L2LA 5AIJA 1FCHA 5HQ8A 5LCWC 1HF8A 1JPLA 5FQ4A 5FTPA 2E2EA 3FULA 3SFZA 5LFAA 3CKCA 4KBQA 2C2LA 2J09A 2IQCA 5JHAA 3ENEA 4CCAA 4GZDA 5JHBA 3MYVA 2YNQA 2FBNA 2I2OA 3FUDA 2R5SA 4MS6A 4W9RA 4N2SA 3UQ3A 2XPZA 3CHPA 3CVQA 4AXHA 3FDHA 3APCA 3S7BA 1HH8A 3R9AB 5DBKA 2M63A 3RO2A 3APDA 3CK9A 1PC2A 2QFCA 3SD5A 2X6FA 5BW8C 3D9NA 4BY6A 4MRUA 1WM5A 4DLQA 5FZQA 4U0SA 4HORA 3ASFA 2L6JA 4I17A 2IU1A 4EZLA 3I5PA 4I43A 5HI7A 3JUIA 2LAHA 3FUHA 4XI9A 2I6HA 3VTXA 3CVUA 5EX3A 2XQ0A 3ZGQA 1PY1A 3FUFA 1NA3A 2CHZA 5KCMA 3ZEFA 4ACKA 4YVOA 4B8AA 4E85A 3C98A 4DJAA 2PQRA 2J4DA 1ZBPA 3PEVB 3S7JA 3GZSA 4FADA 4J8DA 3FUMA 1QZ2A 3RRNB 2WXNA 3PH0C 3FU3A 3KAEA 1EF1C 4FLBA 3FUKA 4H7XA 4F3VA 1UG3A 3UT7A 1FVHA 4MKTA 3SGHA 2CFUA 2VGYA 2XRYA 1EYHA 1VDYA 5J90A 3T8MA 3EHMA 2CHWA 1FVFA 1XNFA 3L22A 4UWLA 2NSZA 4UQYA 5CHEE 3SZ7A 3SF4A 1E8WA 3IEGA 2OOEA 1TJCA 4FC8A 3QWVA 4ANUA 1W3BA 3Q5MA 1HG2A 3LXUX 4DPRA 4KVOA 3QAQA 3ZXSA 1N54A 3L13A 4ATGA 3FTZA 1JUQA 2WXQA 2WMOA 3TXMA 4DK5A 4ABNA 4JW1A 5CMWA 1HG5A 1S0PA 2JEKA 3AS4A 5A23A 3VLDA 3ULQA 2WXFA 3ZVVA 4A1SA 1HU3A 3CHRA 2P58C 5G55A 4RG6A 4QFVA 4GMJA 1HX8A 1IQRA 4FULA 4CRWA 4DI3A 5C2YA 3RRUA 3FUIA 2LNIA 3BG1B 4I2ZA 3LYAA 3MX3A 5FZRA 4PS7A 1H2UA 3FTYA 2VSOE 3FU6A 2WQ7A 4B89A 1E8XA 5FZSA 3QWWA 4GB9A 3TG5A 3DPDA 3CVWA 5AENA 4L1BA 4ILIA 5BV0A 2IFUA 3OXFA 2BTDA 2BUGA 2J9QA 3DBSA 2HM8A 3PE4A 3HVEB 4MLPA 5LOZA 3UT8A 4HOQA 2KM4A 4A3VA 4FHKA 3RKVA 1A17A 1E96B 2WXGA 3IKOB 3FWVA 3AU5A 4KYOB 4EZKA 3QOUA 3O4ZA 3VTYA 3ZYLA 1ELWA 3PZDA 2YQ8A 4I1MA 4LCTA 4G23A 2UY1B 1NP7A 5BV1A 1OWPA 2FULA 5J08A 1IYGA 3Q4AB 3RJVA 2KCLA 4JEUA 1Z3XA 3VLEA 1H0AA 2XPYA 4N5CA 4PDXA 3ZYMA 4FHJA 3PUKA 3LEWA 4CGVA 4G2VA 1BPOA 4XKCA 5E75A 3NZUA 1GW6A 3ASDA 4GYWA 5FQ6A 2WQ6A 3AU4A 3OXGA 2J07A 3PEUB 2HR2A 3FFLA 2WXKA 3CSFA 4WNGA 3CK8A 2MHKA 4D10C 1LF8A 4JA9A 4LERA 3LJ3A 4G1TA 4OYSA 3QB2A 4C0EA 3GZ1A 1U3DA 1Z3YA 3ESKA 4HFGA 3KS2A 4FLHA 4JHJA 2V8SE 4UWKA 4I6EA 2HO1A 3P2BA 3ZFWA 5KJLA 2V4LA 3QDNA 2PZIA 3U4TA 4HOSA 4Q69A 1ZU2A 2XGMA 4XZ4A 2Y4TA 3FY4A 3FTVA 3GZ2A 3I4RB 3FUEA 3TL5A 4PS3A 4AVXA 2DBAA 2VSXE 2ONDA 1UW4B 4N3AA 1ELKA 3L08A 4XIFA 5FQ7A 5LCWJ 2WXHA 1KT0A 2X38A 4EZJA 4FP7A 4JPSA 4FU3A 4U0ZA 3MCXA 4XX5A 2JLBA 3ASGA 2PL2A 3CR3A 3ESLA 4YNDA 3PRZA 2WXOA 3QWPA 1HZ4A 3CVPA 3I4GA 4GZ3A 2V0PA 4PH4B 4CDMA 3MKQA 4IRUA 5LX8A 4J8EA 4AY5A 2PM7A 4BT8A 4JEHA 3LY7A 5ARFA 4UWFA 2L0TB 3O48A 4AEZC 3B7RL 3HVEA 2VQ2A 3U9WA 4EBAA 3G2SA 3LY8A 1L5JA 3UMVA 1IQUA 4BFRA 3BG0B 4F7AA 3FH7A 4IYPA 3FHEA 3ONKA 4HLEA 3BEEA 3QK0A 4WNFA 5A7DB 1H2TC 4IN3B 4AM9A 3LCAA 3SHFA 2UY1A 2AXVA 3ZRHA 4GYOA 2XCCA 3GW4A 2RG8A 3FTUA 2C0MA 5BT1A 4GYYA 4I2WA 4NRHB 2FO7A 2WXIA 1Y6IA 3L17A 4I6JA 3D9IA 4A1GA 4AV7A 3FP3A 1E8YA 2PM6A 3MZLB 2A5UA 5KJMA 3FUNA 4I1AA 2R59A 4RSYA 4DI4A 5CCLA 4RVBA 3TGOA 1JWFA 4RG9A 3QJZA 3CLJA 1OUVA 3SBTB 4PS8A 3LPZA 4EQFA 3QC1A 5CMYA 3CHOA 4UQZA 4ILGA 3ZN3A 3LY9A 2E0IA 4KVMA 4NURA 3L6AA 4U0UA 1N52A 3RK6A 4KXKB 4NQ0A 5T8IA 2WXLA 3D9PA 4JZYA 4ANVA 5T4YA 2NC9A 3ZW3A 2WB2A 4Q96A 3LVRE 2V5FA 3CHMA 5G04C 1QNFA 2CHXA 4JXTA 3ZIMA 1UJJA 3T5XA 3HYMB 4BT9A 3CVYA 4K03A 2AVPA 2Y3AA 5ANLA 3L16A 3ZYKA 4KZCA 4G26A 4HOUA 4OVUA 3JCKC 4GMLA 3MKQB 3TG4A 2AW6A 5KJNA 5FT9A 3RIBA 3CHSA 3LKUA 4TUUA 3JQ1A 2ILRA 5D0OD 4BX8A 3ZYQA 5ARGA 4O6FA 3FU5A 3PREA 5G04J 3KEZA 1OWOA 3G2UA 4WNEA 4XKBA 5EX0A 5A6CA 2RD0A 3IHYA 4JVSA 3UUXA 5M72A 2IOSA 3SI5A 4GPKA 3WXXA 2KATA 3G2VA 3UT4A 3RO3A 2YHEA 3S7FA 4UQXA 2XCBA 2WXPA 2VGXB 2IF4A 3D9KA 3L54A 1UN8A 3Q47B 4WWOA 2WVIA 3CHQA 5BNWA 3FEYA 3IHVA 4LUNU 3FU0A 4Y6CA 5FJYA 1E90A 4JC8A 4Q94A 2HYZA 4APOA 2XGOA 1H2VC 2X6IA 4N3CA 4UI9C 2FEZA 2VSYA 4HVBA 4AY6A 4G25A 4HOTA 2IJGX 2AWIA 3JYSA 2A4ZA 3QARA 4GA1A 4ANXA 4CT4A 3FH8A 4Y6WA 2VTBA 4L2YA 1WY6A 1JWGA 2EQXA 2VSNA 5AYWD 3TAXA 4AP2A 3ML9A 2CFZA 1QQEA 5FWQA 2WMNA 1Y8MA 5T3RA 1INZA 4C9BB 4AJWA 3T5VA 3HHMA 4CT0A 4A3TA 3SBSA 3MV3B 3G2WA 1YA0A 1P5QA 1OWLA 4J0UA 5JJ7A 2AXZA 4UI9J 3FEXA 1HE8A 2J49A 2X6JA 1NA0A 3PE3A 4K0RA 4GA0A 4I1OB 4OVVA 4CDNA 2Q7FA 3ZPJA 2X6KA 3CKBA 4HS2A 3TJPA 3S2AA 2WM9A 4UWHA 3VLFA 4EPZA 2VJ8A 4C0MA 2J08A 1E7VA 1E7UA 3U66A 4BSXA 3FH5A 4WUYA 2ZU6B 4B0ZA 4AOFA 3MJWA 2R17C 1H19A 3IBEA 3OXLA 3E4BA 1ELRA 2GW1A 2WXJA 3CGHA 4E6HA 3D9JA 3P1UA 1EDUA 4YVQC 2X6HA 1H6KA 4UWGA 3CVLA 2YINA 4JL0A 3PNTB 4J8FA 3TXNA 2UWJG 5G05C 1EPUA 2XEVA 1WAO1 3NF1A 3QNKA 2KCKA 2OVBA 4CGWA 2WXMA 2LSVA 3PUJA 4B8CB 4WWNA 4V3IA 3EIJA 4JHRA 4ME2A 4TV3A 1X5BA 2AXUA 5AJDA 2X3MA 3EIQC 5AJLA 2QY7A 3B7UX 3UX4A 3CVNA 2I1JA 2VGXA 3CVVA 1HFAA 2Y4UA 4BX9A 3LS8A 1SZ9A 3LVQE 2KC7A 2VTBB 4G24A 3GYZA 5E76A 1PAQA 4GCOA 5EKQD 3CIAA 5JJTA 4N2QA 1U3CA 3MV2B 1TJFA 4N39A 1B89A 2C0LA 5G05J 1E8ZA 3B7SA 5ANRA 3U64A 1DNPA 2XHEA 4LRZA 4HXIA 3R7RA 3CVXA 3PDNA 2KCVA 4URKA 3ZHEA 2WQHA 2J4BA 3QKYA 4IULA 2XRZA 4GZCA 2DCPA 2CG2A 3FTSA 1TEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSU A;  4JA7 A;  1IHG A;  4UI9 K;  4GZ6 A;  3Q49 B;  1KT1 A;  2WPV A;  4B94 A;  5C1D A;  3AS8 A;  3RU0 A;  3U3W A;  3MEK A;  3Q15 A;  1HXI A;  5JJ6 A;  4BWR A;  3EDT B;  5KJK A;  4XI0 A;  2PQN A;  4H7Y A;  2FF4 A;  4GCN A;  3UPV A;  3URZ A;  4BTA A;  3CEQ A;  3MA5 A;  1KLX A;  2FI7 A;  4CDR A;  5DIZ A;  4N3B A;  4I9E A;  3AS5 A;  5D0Q D;  3CK7 A;  2XPI A;  4U07 A;  4BTB A;  3K9I A;  3N71 A;  3ZHE B;  3KD7 A;  3CV0 A;  4AIF A;  4GZ5 A;  2VYI A;  4WND A;  5CCM A;  4GA2 A;  2XGS A;  3ASH A;  4LEU A;  1NZN A;  4I9C A;  3MKR A;  2YHC A;  3S7D A;  4U04 A;  5LCW C;  5HQ8 A;  1FCH A;  5FTP A;  2E2E A;  3CKC A;  4KBQ A;  2C2L A;  2FBN A;  2R5S A;  4W9R A;  4N2S A;  3UQ3 A;  3CVQ A;  3S7B A;  1HH8 A;  3R9A B;  5DBK A;  3RO2 A;  3CK9 A;  1PC2 A;  2QFC A;  5BW8 C;  1WM5 A;  5FZQ A;  4U0S A;  4HOR A;  3ASF A;  2L6J A;  4I17 A;  5HI7 A;  4XI9 A;  2I6H A;  3VTX A;  5EX3 A;  3ZGQ A;  1NA3 A;  4YVO A;  2PQR A;  1ZBP A;  3S7J A;  4J8D A;  1QZ2 A;  3KAE A;  4H7X A;  4F3V A;  2VGY A;  1XNF A;  5CHE E;  4UQY A;  3SZ7 A;  3SF4 A;  3IEG A;  2OOE A;  1TJC A;  3QWV A;  1W3B A;  3Q5M A;  4ABN A;  3AS4 A;  3ULQ A;  4A1S A;  2P58 C;  4RG6 A;  2LNI A;  4I2Z A;  3LYA A;  5FZR A;  5FZS A;  3QWW A;  3TG5 A;  2IFU A;  3OXF A;  2BUG A;  2J9Q A;  3PE4 A;  4HOQ A;  3RKV A;  1A17 A;  1E96 B;  3FWV A;  4KYO B;  3QOU A;  3VTY A;  1ELW A;  2YQ8 A;  4G23 A;  2UY1 B;  1IYG A;  3Q4A B;  3RJV A;  2KCL A;  4N5C A;  4CGV A;  4G2V A;  3ASD A;  4GYW A;  3OXG A;  2HR2 A;  3FFL A;  4WNG A;  3CK8 A;  2MHK A;  4JA9 A;  4G1T A;  3GZ1 A;  3ESK A;  3KS2 A;  2HO1 A;  3ZFW A;  5KJL A;  3QDN A;  2PZI A;  3U4T A;  4HOS A;  1ZU2 A;  2XGM A;  2Y4T A;  3GZ2 A;  2DBA A;  2OND A;  4N3A A;  4XIF A;  5LCW J;  1KT0 A;  4U0Z A;  2JLB A;  3ASG A;  2PL2 A;  4YND A;  3QWP A;  1HZ4 A;  3CVP A;  4GZ3 A;  4J8E A;  4AY5 A;  4BT8 A;  3LY7 A;  5ARF A;  3O48 A;  2VQ2 A;  3LY8 A;  3BEE A;  4WNF A;  5A7D B;  4AM9 A;  4IN3 B;  3LCA A;  2UY1 A;  4GYO A;  2XCC A;  3GW4 A;  2C0M A;  5BT1 A;  4GYY A;  4I2W A;  4NRH B;  2FO7 A;  3FP3 A;  5KJM A;  4I1A A;  5CCL A;  3TGO A;  4RG9 A;  1OUV A;  4EQF A;  3LPZ A;  4UQZ A;  3ZN3 A;  3LY9 A;  4U0U A;  4KXK B;  4NQ0 A;  2NC9 A;  2V5F A;  5G04 C;  3HYM B;  4BT9 A;  2AVP A;  4G26 A;  4HOU A;  3TG4 A;  5KJN A;  5FT9 A;  3RIB A;  3LKU A;  5D0O D;  5ARG A;  4O6F A;  5G04 J;  4WNE A;  5EX0 A;  5A6C A;  3UUX A;  5M72 A;  4GPK A;  3WXX A;  2KAT A;  3RO3 A;  3S7F A;  4UQX A;  2XCB A;  2VGX B;  2IF4 A;  3Q47 B;  5BNW A;  5FJY A;  4Y6C A;  4APO A;  2HYZ A;  2XGO A;  4N3C A;  4UI9 C;  2FEZ A;  2VSY A;  4AY6 A;  4G25 A;  4HOT A;  4GA1 A;  3JYS A;  4Y6W A;  5AYW D;  2VSN A;  3TAX A;  1QQE A;  1Y8M A;  3MV3 B;  1YA0 A;  1P5Q A;  4J0U A;  5JJ7 A;  4UI9 J;  1NA0 A;  3PE3 A;  4GA0 A;  2Q7F A;  3ZPJ A;  3CKB A;  4WUY A;  3OXL A;  3E4B A;  1ELR A;  2GW1 A;  4YVQ C;  3CVL A;  4JL0 A;  4J8F A;  2UWJ G;  5G05 C;  2XEV A;  1WAO 1;  3NF1 A;  2KCK A;  4CGW A;  2LSV A;  4JHR A;  4ME2 A;  3CVN A;  2VGX A;  2Y4U A;  2KC7 A;  4G24 A;  3GYZ A;  4GCO A;  5JJT A;  5EKQ D;  4N2Q A;  3MV2 B;  4N39 A;  1B89 A;  2C0L A;  5G05 J;  3PDN A;  2KCV A;  3ZHE A;  2WQH A;  3QKY A; 
#chains in the Genus database with same CATH topology
 3BUA A;  1N4Q A;  3NOG D;  4U8H A;  4B94 A;  3U3W A;  4M3O A;  2GGF A;  3FTX A;  2I9C A;  4ILH B;  1TR4 A;  2PQN A;  3F6Q A;  2FF4 A;  2Y1L E;  3UPV A;  2GRL A;  2L9B A;  4BTA A;  4F1S A;  3FTW A;  3HIZ A;  3HDX A;  5G2N A;  2FI7 A;  1SA5 A;  3EUV A;  5AQ7 A;  3T8K A;  4TUM A;  2XPI A;  4U07 A;  4R7L A;  1O1T A;  1UJK A;  2XS1 A;  4O1O A;  4FA6 A;  3UKR G;  2MOW A;  2ETC A;  2NYJ A;  4GZ5 A;  3LJN A;  2GRQ B;  5CCM A;  3ASH A;  4I9C A;  3APF A;  2CG3 A;  2YHC A;  5AIJ A;  5LCW C;  4L2L A;  1FCH A;  1HF8 A;  1JPL A;  5FQ4 A;  5FTP A;  3FUL A;  2C2L A;  2J09 A;  3UM3 A;  2IQC A;  5JHA A;  3ENE A;  1N0Q A;  4LSZ E;  3DPY A;  3S7B A;  3R9A B;  2M63 A;  4EHM A;  4U0S A;  4HOR A;  1RW2 A;  2L6J A;  4I43 A;  5HI7 A;  2I6H A;  1PY1 A;  2AJA A;  3Q75 A;  4A63 B;  2J4D A;  3S7J A;  3GZS A;  3FUM A;  2WXN A;  3PH0 C;  2F8X K;  1UOH A;  2QZA A;  4F3V A;  1UG3 A;  5ENR D;  2R2L A;  3SGH A;  2CFU A;  2VGY A;  1EYH A;  5J90 A;  5EIB E;  3EHM A;  2RFA A;  4UQY A;  3SZ7 A;  3SF4 A;  3WG7 E;  1TNU A;  3QWV A;  3LXU X;  1TNO A;  3R9M A;  3FTZ A;  2OEV A;  4JW1 A;  1H6O A;  3AS4 A;  5A23 A;  3ZVV A;  4HRN A;  1HU3 A;  2B6C A;  4QFV A;  3V30 A;  4GTO A;  4I2Z A;  2XS8 A;  3FTY A;  4B89 A;  1E8X A;  5ENQ D;  3QWW A;  3DST A;  3TG5 A;  2EIK E;  3C3R A;  3OXF A;  2BTD A;  3PE4 A;  4DX6 D;  1DCE A;  5LOZ A;  2KM4 A;  3RKV A;  1E96 B;  3HXB A;  3FWV A;  3AU5 A;  3B7B A;  4KYO B;  2A5E A;  3ZYL A;  1ELW A;  2F0Y A;  3RJV A;  1H0A A;  3ZYM A;  1LTX A;  1X81 A;  5E75 A;  3NZU A;  4TXR A;  5FQ6 A;  3OXG A;  3PEU B;  2WXK A;  3CSF A;  4WNG A;  1KPS B;  4U95 D;  2R03 A;  3UKU G;  4HFG A;  4FLH A;  1S63 A;  5BXU A;  2LXL A;  3ZFW A;  4U8Y D;  4Q69 A;  3C3Q A;  3FY4 A;  3GZ2 A;  3I4R B;  3TL5 A;  4AVX A;  2DBA A;  3E37 A;  4MBG A;  5AAO A;  3CR3 A;  4DX1 A;  2P9K G;  4GZ3 A;  5LX8 A;  4J8E A;  2B0O E;  3UM2 A;  1OXJ A;  4AEZ C;  3W9F A;  3B7R L;  3ZXP A;  3V2X A;  3LY8 A;  1L5J A;  5HS0 A;  3UMV A;  4BFR A;  2VGE A;  4IYP A;  1YCS B;  3RSE G;  3UM0 A;  3FTU A;  2C0M A;  4GYY A;  4I2W A;  2FO7 A;  2DWZ A;  4GTQ A;  3FP3 A;  3MZL B;  2PM6 A;  4LNB A;  2A5U A;  5KJM A;  2FO1 E;  4DI4 A;  1G3N B;  3B95 A;  1YMP A;  4DRX E;  5CEC B;  2IY0 C;  3CLJ A;  1OUV A;  4EQF A;  4ZHB A;  5CMY A;  3ZN3 A;  2E0I A;  3RK6 A;  4NQ0 A;  3D9P A;  2NC9 A;  4Q96 A;  3CHM A;  3ZIM A;  2AVP A;  5ANL A;  4KZC A;  4HOU A;  4BSZ B;  3TG4 A;  3MKQ B;  4GTS A;  3JXJ A;  4TXP A;  3LKU A;  4TUU A;  3Q9U C;  2ILR A;  1N94 A;  4BX8 A;  5ARG A;  5EID A;  4XKB A;  5EX0 A;  5M72 A;  1AP7 A;  1S70 B;  3S7F A;  1K1B A;  4UQX A;  2WXP A;  3D9K A;  2IF4 A;  4WWO A;  3AAA C;  1E90 A;  4JC8 A;  4Q94 A;  1OCR E;  4N3C A;  2EIM E;  2FEZ A;  1YYH A;  3ISM C;  4HOT A;  1JCQ A;  2AWI A;  2A4Z A;  3JYS A;  3QAR A;  3V31 A;  3FH8 A;  2VTB A;  5T3R A;  5B1B E;  4CT0 A;  3ULY A;  5JJ7 A;  3PE3 A;  4K0R A;  2DZO A;  4GA0 A;  3ZPJ A;  5KWD A;  3CKB A;  3TJP A;  3VLF A;  3ABM E;  1E7U A;  4AOF A;  3MJW A;  2R17 C;  3IBE A;  3E4B A;  1ELR A;  1JCS A;  3D9J A;  1EDU A;  4YVQ C;  4RQI A;  3CVL A;  1DCQ A;  4J8F A;  3TXN A;  1N95 A;  1WAO 1;  3ABL E;  2WXM A;  2LSV A;  1LD8 A;  4LG6 A;  3EIJ A;  4TV3 A;  3E34 A;  3EIQ C;  2QY7 A;  3UX4 A;  3CVN A;  2Y4U A;  4BX9 A;  3KSL A;  3LS8 A;  3LVQ E;  4GTT A;  5EIL A;  5EKQ D;  3CIA A;  3EHR A;  1TJF A;  2LUH A;  4N39 A;  1O5M A;  4JD2 G;  2P9U G;  4LRZ A;  4HI8 A;  4HXI A;  3PDN A;  2KCV A;  4URK A;  3ZHE A;  2WQH A;  4IUL A;  3QKY A;  4GZC A;  2CG2 A;  3DSU A;  4BET A;  2GRM A;  4KT6 B;  3DEP A;  1Z5S C;  3NOC D;  4UI9 K;  4HQD A;  4Z68 A;  4GZ6 A;  3Q49 B;  1KT1 A;  1MQS A;  1OWM A;  3DXM G;  2F8Y A;  3Q15 A;  1WG0 A;  5JJ6 A;  2MRI A;  1JCR A;  3NZS A;  3EDT B;  2BF0 X;  4OAU C;  5KJK A;  4XI0 A;  5FQ8 A;  2EIJ E;  4H7Y A;  3URZ A;  5EDS A;  3NBN B;  2LAI A;  4KMO A;  4U8V D;  3EJN A;  3CEQ A;  4GTR A;  4A55 A;  1HS6 A;  4J7W A;  3D9M A;  2DIW A;  4CDR A;  4DX7 D;  4ZFH A;  1MHQ A;  2DYS E;  1MX6 A;  3Q7A A;  1RZ4 A;  3LDZ A;  2IOL A;  5LP0 A;  4I9E A;  5KNH D;  5D0Q D;  4RLY A;  3ONL A;  4DLO A;  4EEC A;  4FJZ A;  1OWN A;  1SZA A;  1DC2 A;  3PZ1 A;  1TN6 A;  4KZ0 A;  4P29 A;  3B13 A;  4TRQ A;  3CV0 A;  3B7T A;  1IHB A;  2KXP C;  4TXQ A;  2LXM A;  4ACL A;  3OAW A;  5CEA A;  3HXE A;  1HO8 A;  4J6I A;  4L23 A;  4GTV A;  3SFZ A;  4KBQ A;  4CCA A;  5JHB A;  2I2O A;  1BU9 A;  4W9R A;  3UQ3 A;  3FDH A;  1FT2 A;  1HH8 A;  4HLL A;  3UTM A;  2QFC A;  3SD5 A;  2X6F A;  3TWW A;  4EZL A;  3I5P A;  1D9S A;  2LAH A;  3FUH A;  3VTX A;  2XQ0 A;  1BLX B;  3ZGQ A;  3ZEF A;  2CHZ A;  3BU8 A;  4FAD A;  2R02 A;  3E30 A;  4FLB A;  1TNY A;  4BEP A;  4MKT A;  5AQB A;  5KNG A;  4J8Y A;  4UWL A;  3DRA A;  3IEG A;  2OOE A;  3Q5M A;  3QAQ A;  3ZXS A;  3PZ3 A;  1JUQ A;  2WMO A;  5CMW A;  2JEK A;  3AG2 E;  2P9L G;  3T9K A;  2WXF A;  3ULQ A;  4A1S A;  4RG6 A;  4GMJ A;  4CRW A;  4DI3 A;  5C2Y A;  3RRU A;  2LNI A;  2ETB A;  3LYA A;  5FZR A;  3EU5 A;  1H2U A;  2WQ7 A;  3W9G A;  4JB8 P;  1LD7 A;  1O1R A;  4ILI A;  2IFU A;  5AEN A;  2BUG A;  2HM8 A;  3ZUV B;  3HXD A;  4EZK A;  4L9P A;  1TN7 A;  4I1M A;  4LCT A;  2L6B A;  4G23 A;  1NP7 A;  1OWP A;  1IYG A;  3TWS A;  3DXK G;  2BKK B;  3Q4A B;  4JEU A;  2XPY A;  4FHJ A;  1TYQ G;  4G2V A;  4XKC A;  3ASD A;  4GYW A;  3AU4 A;  3CK8 A;  4D10 C;  1LF8 A;  4JA9 A;  4OYS A;  4G1T A;  3KS2 A;  4JHJ A;  3DSS A;  2HO1 A;  3C72 A;  2IO2 C;  3PZ4 A;  2XGM A;  2OEW A;  3FUE A;  1K3Z D;  3JXI A;  2OND A;  5HKP A;  3Q9N C;  5LCW J;  2WXH A;  2X38 A;  3NAW A;  5CER B;  4U0Z A;  2JLB A;  1NFI E;  2QC9 A;  4YND A;  3QWP A;  2WXO A;  3CVP A;  1MYO A;  4AY5 A;  4JEH A;  4UWF A;  2P9N G;  3U9W A;  1IQU A;  3FH7 A;  3FHE A;  3QK0 A;  5A7D B;  4IN3 B;  3LCA A;  1KZP A;  2AXV A;  1OCC E;  3TWV A;  4GYO A;  2XCC A;  3SY2 A;  1Y6I A;  2H6G A;  4RSY A;  3TGO A;  1WDY A;  2F37 A;  3ABK E;  3DWL G;  4KXK B;  5T8I A;  2WB2 A;  2V5F A;  2CHX A;  4OVU A;  1D8D A;  5KJN A;  3CHS A;  3E33 A;  3AG1 E;  3PRE A;  4WNE A;  2IOS A;  4GPK A;  3G2V A;  3UT4 A;  2VGX B;  1UN8 A;  2P9P G;  3FEY A;  3IHV A;  4LUN U;  4Y6C A;  4APO A;  2DYR E;  4HVB A;  2XZD G;  4GMR A;  3UM1 A;  2IJG X;  4ANX A;  4CT4 A;  4L2Y A;  5AYW D;  5KBA A;  1QQE A;  1INZ A;  1OWL A;  4J0U A;  1HE8 A;  2J49 A;  1NA0 A;  5CBN A;  4F1P A;  2Y69 E;  3UXG A;  1N9A A;  2Y0B G;  4HNA D;  4BER A;  5AQA A;  3UIO C;  2H6F A;  4C0M A;  1E7V A;  3CGH A;  1H6K A;  2YIN A;  3PNT B;  1S64 A;  3J5Q B;  2KCK A;  4B8C B;  2AXU A;  3HG0 D;  3B7U X;  3EU9 A;  3Q78 A;  2I1J A;  2VGX A;  2VTB B;  3TWX A;  1PAQ A;  1U3C A;  5ANR A;  2XHE A;  2J4B A;  2XRZ A;  1K1A A;  1IHG A;  2ION A;  4GAA A;  5AN8 A;  2WPV A;  4O1P A;  3AS8 A;  2EIN E;  3MEK A;  4BES A;  3JQ0 A;  3CST A;  4FJY A;  4GCN A;  4JHK A;  2ZGG A;  4WWP A;  4GU5 A;  1XGW A;  3DSW A;  2XZT G;  4HB5 A;  3Q7F A;  2ZIS A;  3I3N A;  3CK7 A;  1SQM A;  3J5P A;  3ZU7 B;  2HE0 A;  4CEM A;  1V54 E;  3SNX A;  3D3M A;  3N71 A;  3ZHE B;  5BPP A;  4L7T A;  3KD7 A;  4ANW A;  3EHQ A;  3PNL B;  5FIO A;  3SFX A;  4AIF A;  4F53 A;  2H6I A;  2VYI A;  4NAC A;  4WND A;  4GA2 A;  1NZN A;  4GTM A;  4EBA G;  3MKR A;  4I6G A;  3S7D A;  5HQ8 A;  4K5B A;  5LFA A;  3CKC A;  1OY3 D;  3JUE A;  3MYV A;  2YNQ A;  3FUD A;  2BKG A;  3APC A;  3HXC A;  3V79 K;  2ZIR A;  3CK9 A;  1PC2 A;  5BW8 C;  4BY6 A;  1WM5 A;  5FZQ A;  3JUI A;  3CVU A;  4HRL A;  4X8Q A;  4E85 A;  3FUF A;  1NA3 A;  4DJA A;  1D8E A;  4CYM D;  3PEV B;  5CBO A;  1BD8 A;  1QZ2 A;  3FU3 A;  3TWR A;  3FUK A;  4H7X A;  5EYL A;  1FT1 A;  1XNF A;  3KSQ A;  4FC8 A;  1TJC A;  1V55 E;  1W3B A;  4DPR A;  3L13 A;  4ATG A;  3TXM A;  4ABN A;  1S0P A;  4N5Q A;  5G55 A;  3CHR A;  1HX8 A;  1IQR A;  5ENT D;  3FUI A;  2XEH A;  2VSO E;  4GB9 A;  4L1B A;  1OCO E;  3DBS A;  3HVE B;  4MLP A;  4HOQ A;  2XEE A;  2WXG A;  2P9I G;  3DSV A;  3VTY A;  3O4Z A;  4U7E B;  3PZD A;  2UY1 B;  5J08 A;  2ZGD A;  3VLE A;  3PUK A;  2WQ6 A;  2J07 A;  2MHK A;  4HRM B;  4LER A;  3LJ3 A;  3QB2 A;  5EN5 D;  3GZ1 A;  1Z3Y A;  3ESK A;  2V8S E;  4UWK A;  5KJL A;  2PZI A;  4HOS A;  1ZU2 A;  2ETA A;  2QYU A;  4PS3 A;  2V4H C;  2VSX E;  1UW4 B;  4N3A A;  5FQ7 A;  3L08 A;  4XIF A;  4FP7 A;  4JPS A;  2P2C P;  3PRZ A;  1HZ4 A;  1AWC B;  2V0P A;  4PH4 B;  4IRU A;  2PM7 A;  5B3S E;  3LY7 A;  5ARF A;  3O48 A;  3HVE A;  4EBA A;  3G2S A;  3BG0 B;  3ONK A;  3BEE A;  4WNF A;  1H2T C;  3SHF A;  2UY1 A;  3PZ2 A;  3ZRH A;  2RG8 A;  5BT1 A;  3UIN C;  2WXI A;  4I6J A;  4AV7 A;  4A1G A;  4I1A A;  2R59 A;  1JWF A;  3QJZ A;  3SBT B;  4PS8 A;  3LPZ A;  3QC1 A;  3CHO A;  4NUR A;  4U0U A;  1N52 A;  4JZY A;  3L9T A;  4ANV A;  5T4Y A;  1SVX A;  5G04 C;  1QNF A;  4DX5 D;  1UJJ A;  3HYM B;  4BT9 A;  1OT8 A;  3CVY A;  4K03 A;  2Y3A A;  3L16 A;  2V5Q C;  4G26 A;  3JCK C;  5FT9 A;  3ULE G;  5D0O D;  5ENS D;  4DUI A;  4O6F A;  3FU5 A;  5G04 J;  3KEZ A;  1OWO A;  3IHY A;  3SI5 A;  3WXX A;  2XCB A;  3L54 A;  3Q47 B;  2WVI A;  3CHQ A;  5FJY A;  4QQI A;  3FU0 A;  3ASN E;  2XGO A;  1H2V C;  2X6I A;  4UI9 C;  4G25 A;  3UIP C;  4GA1 A;  4Y6W A;  1WY6 A;  1JWG A;  2EQX A;  2VSN A;  4HBD A;  4AP2 A;  1N11 A;  3ML9 A;  5FWQ A;  1Y8M A;  4C9B B;  3T5V A;  4A3T A;  3G2W A;  1YA0 A;  2KBX A;  3ASO E;  1TNB A;  2AXZ A;  4UI9 J;  4YDE A;  4C48 B;  2X6J A;  4OAV B;  4I1O B;  4YDY A;  4GPM A;  2X6K A;  4HS2 A;  3S2A A;  2WM9 A;  4UWH A;  4EPZ A;  2VJ8 A;  2J08 A;  3U66 A;  1U2V G;  4K5C A;  4WUY A;  2ZU6 B;  4B0Z A;  1H19 A;  3OXL A;  2WXJ A;  4E6H A;  1MX2 A;  2OVB A;  4YDW A;  1KZO A;  4WWN A;  4V3I A;  4JHR A;  5CED B;  3ZNG A;  1HFA A;  4G24 A;  3GYZ A;  2GRR B;  5JJT A;  3MV2 B;  5EYP F;  1MJ0 A;  3U64 A;  1DNP A;  2ZXW E;  4NIK A;  1A5E A;  4LNG A;  3FTS A;  3C3O A;  1TEZ A;  2LSU A;  2KZT B;  2OVF A;  4JA7 A;  3CQG B;  5AAR A;  2L0I A;  4G11 A;  3RRM B;  3AJI A;  5C1D A;  5D2M C;  3RU0 A;  1QYM A;  1HXI A;  4PUC A;  4BWR A;  3EHN A;  1IKN D;  2WXR A;  4U63 A;  2OV8 A;  4WAF A;  4B93 B;  4J8S A;  1UN9 A;  3MA5 A;  2NXP A;  5ENN A;  1KLX A;  3NB2 A;  2IEJ A;  5DIZ A;  3OTN A;  4XE0 A;  4N3B A;  3NQP A;  3AS5 A;  3D9L A;  3G2T A;  3PS6 A;  4BTB A;  1DVP A;  2LO6 A;  1NL4 A;  4APF A;  3CQC B;  3K9I A;  1O1S A;  5BUZ A;  2RFM A;  1FPP A;  3R7Q A;  3IV0 A;  3MGB A;  3PVL A;  3L82 A;  3D9O A;  1TN8 A;  2PNN A;  2I1K A;  2QYJ A;  2XGS A;  2KZT A;  4LEU A;  3ML8 A;  3FUJ A;  1Z6T A;  4U04 A;  3Q73 A;  2E2E A;  4GZD A;  2FBN A;  2R5S A;  5AQ9 A;  4MS6 A;  4N2S A;  2XPZ A;  3CHP A;  3CVQ A;  4AXH A;  4K5A B;  5DBK A;  3RO2 A;  3APD A;  3TWQ A;  5JMN D;  3D9N A;  4MRU A;  4DLQ A;  3ASF A;  4I17 A;  2IU1 A;  2JAB A;  4XI9 A;  1BI8 B;  3TWT A;  5EX3 A;  4ACK A;  2DZN A;  5KCM A;  4YVO A;  4B8A A;  3C98 A;  3V2O A;  2PQR A;  1TNZ A;  1ZBP A;  4J8D A;  3RRN B;  3KAE A;  1EF1 C;  3UT7 A;  1FVH A;  5IY5 E;  4CZ2 D;  2XRY A;  4F6R D;  2GRO B;  1VDY A;  3T8M A;  2CHW A;  1FVF A;  3L22 A;  2NSZ A;  5CHE E;  1E8W A;  4ANU A;  1HG2 A;  4KVO A;  3DEO A;  1N54 A;  4DX2 A;  2WXQ A;  4DK5 A;  4O60 A;  3VLD A;  4ATZ D;  3SQV A;  5HRY A;  2P58 C;  2P9S G;  4FUL A;  3BG1 B;  3MX3 A;  4M7C A;  4PS7 A;  3FU6 A;  5FZS A;  3DPD A;  3CVW A;  5BV0 A;  2J9Q A;  3ZKJ A;  4LNU D;  3DSX A;  3Q79 A;  3UT8 A;  4A3V A;  4FHK A;  1A17 A;  3IKO B;  3HXF A;  3QOU A;  1SW6 A;  2YQ8 A;  5BV1 A;  2FUL A;  4GTP A;  2KCL A;  1Z3X A;  1ZB1 A;  4PDX A;  4N5C A;  3E32 A;  3LEW A;  4CGV A;  1BPO A;  3HRA A;  1GW6 A;  5ITZ F;  2HR2 A;  3FFL A;  1MX4 A;  4C0E A;  1U3D A;  4I6E A;  5FIN A;  3P2B A;  2J8S D;  2V4L A;  3QDN A;  3U4T A;  4XZ4 A;  2Y4T A;  3FTV A;  5H7P A;  4YDO A;  2OCC E;  3BQO A;  4XEI G;  1ELK A;  4EZJ A;  1KT0 A;  1MZC A;  4FU3 A;  3MCX A;  4XX5 A;  5BXO A;  3ASG A;  2PL2 A;  3ESL A;  4UUC A;  3I4G A;  2DVW A;  4CDM A;  3MKQ A;  4BT8 A;  4U96 D;  2IO3 C;  2L0T B;  2VQ2 A;  1K8K G;  4F7A A;  4HLE A;  4AM9 A;  3KEA A;  1BI7 B;  2GRP B;  3GW4 A;  4NRH B;  3L17 A;  3D9I A;  1E8Y A;  3C5R A;  3FUN A;  5CCL A;  4RVB A;  4RG9 A;  1QBQ A;  4UQZ A;  4ILG A;  3LY9 A;  4KVM A;  3L6A A;  2WXL A;  3ZW3 A;  3UI2 A;  3LVR E;  4JXT A;  5CRV A;  3T5X A;  3ZYK A;  3AG3 E;  4GML A;  2AW6 A;  2MYO A;  3RIB A;  1NI1 A;  3JQ1 A;  3ZYQ A;  2RKK A;  3G2U A;  5JA4 D;  5A6C A;  2RD0 A;  4JVS A;  3UUX A;  2KAT A;  3RO3 A;  2YHE A;  3AG4 E;  3SO8 A;  3X2Q E;  1SA4 A;  5BNW A;  2HYZ A;  1N0R A;  2VSY A;  4AY6 A;  3D9H A;  2EIL E;  4G8K A;  1Q2Z A;  3TAX A;  2CFZ A;  2WMN A;  1N4S A;  4AJW A;  3HHM A;  3SBS A;  3MV3 B;  1P5Q A;  2GRN B;  3RAU A;  5D66 A;  3FEX A;  3TWU A;  4OVV A;  4CDN A;  2Q7F A;  4G8L A;  2H6H A;  2XEN A;  2R05 A;  3IXE A;  1N4R A;  4BSX A;  3FH5 A;  5ENO D;  5CRU A;  1N4P A;  2GW1 A;  3P1U A;  2X6H A;  4UWG A;  1H6P A;  1IXV A;  4JL0 A;  2UWJ G;  5G05 C;  1EPU A;  2BED A;  2XEV A;  3NF1 A;  3QNK A;  4CGW A;  3PUJ A;  3SFY A;  4ME2 A;  1X5B A;  5AJD A;  2X3M A;  5AJL A;  1OCZ E;  3CVV A;  1SZ9 A;  2KC7 A;  5B1A E;  5E76 A;  4GCO A;  4N2Q A;  1B89 A;  2C0L A;  5G05 J;  1E8Z A;  3B7S A;  5ENP D;  3R7R A;  4HI9 A;  3CVX A;  2DCP A;  1HG5 A; 
#chains in the Genus database with same CATH homology
 2LSU A;  2KZT B;  2OVF A;  2GRM A;  4JA7 A;  3CQG B;  4KT6 B;  1IHG A;  2ION A;  4UI9 K;  4U8H A;  4GZ6 A;  3Q49 B;  4GAA A;  1KT1 A;  2WPV A;  2L0I A;  4B94 A;  4G11 A;  3RRM B;  5C1D A;  1MQS A;  1OWM A;  3AS8 A;  3RU0 A;  3U3W A;  4M3O A;  3MEK A;  3Q15 A;  4PUC A;  1HXI A;  5JJ6 A;  4BWR A;  2MRI A;  3EHN A;  2GGF A;  3NZS A;  3EDT B;  2BF0 X;  2WXR A;  3JQ0 A;  3FTX A;  5KJK A;  3CST A;  2I9C A;  4ILH B;  4XI0 A;  5FQ8 A;  2PQN A;  4U63 A;  2OV8 A;  2FF4 A;  4FJY A;  4GCN A;  4H7Y A;  4JHK A;  3UPV A;  3URZ A;  4WAF A;  4WWP A;  2GRL A;  5EDS A;  4GU5 A;  2LAI A;  4KMO A;  1XGW A;  3EJN A;  4J8S A;  2L9B A;  4BTA A;  4F1S A;  3CEQ A;  1UN9 A;  4A55 A;  1HS6 A;  3FTW A;  3MA5 A;  2NXP A;  3HIZ A;  5ENN A;  3D9M A;  3HDX A;  5G2N A;  1KLX A;  2FI7 A;  2DIW A;  4CDR A;  5DIZ A;  1MHQ A;  3OTN A;  4XE0 A;  3LDZ A;  2IOL A;  3NQP A;  4N3B A;  5LP0 A;  4I9E A;  3AS5 A;  3D9L A;  3I3N A;  5D0Q D;  3CK7 A;  1SQM A;  2XPI A;  3G2T A;  3ONL A;  4U07 A;  3PS6 A;  4R7L A;  1UJK A;  4DLO A;  4EEC A;  4FJZ A;  4CEM A;  4BTB A;  1OWN A;  1DVP A;  1SZA A;  4FA6 A;  2LO6 A;  3SNX A;  4APF A;  2MOW A;  3CQC B;  3D3M A;  3K9I A;  3N71 A;  3ZHE B;  5BPP A;  4L7T A;  5BUZ A;  3KD7 A;  4ANW A;  4KZ0 A;  4P29 A;  3B13 A;  4TRQ A;  3R7Q A;  3CV0 A;  3B7T A;  3IV0 A;  3MGB A;  3PNL B;  4AIF A;  4F53 A;  3PVL A;  3D9O A;  4GZ5 A;  4ACL A;  2VYI A;  4NAC A;  3OAW A;  4WND A;  2I1K A;  5CCM A;  4GA2 A;  2XGS A;  3ASH A;  2KZT A;  4LEU A;  1NZN A;  4I9C A;  3ML8 A;  3FUJ A;  3APF A;  1HO8 A;  4J6I A;  4L23 A;  1Z6T A;  3MKR A;  2CG3 A;  2YHC A;  4I6G A;  4U04 A;  3S7D A;  4EBA G;  4L2L A;  5AIJ A;  1FCH A;  5HQ8 A;  5LCW C;  1HF8 A;  1JPL A;  5FQ4 A;  5FTP A;  2E2E A;  3FUL A;  3SFZ A;  5LFA A;  3CKC A;  4KBQ A;  2C2L A;  2J09 A;  2IQC A;  5JHA A;  3ENE A;  4CCA A;  4GZD A;  5JHB A;  3MYV A;  2YNQ A;  2FBN A;  2I2O A;  3FUD A;  2R5S A;  4MS6 A;  4W9R A;  4N2S A;  3UQ3 A;  2XPZ A;  3CHP A;  3CVQ A;  4AXH A;  3FDH A;  3APC A;  3S7B A;  1HH8 A;  3R9A B;  5DBK A;  2M63 A;  3RO2 A;  3APD A;  3CK9 A;  1PC2 A;  2QFC A;  3SD5 A;  2X6F A;  5BW8 C;  3D9N A;  4BY6 A;  4MRU A;  1WM5 A;  4DLQ A;  5FZQ A;  4U0S A;  4HOR A;  3ASF A;  2L6J A;  4I17 A;  2IU1 A;  4EZL A;  3I5P A;  4I43 A;  5HI7 A;  3JUI A;  2LAH A;  3FUH A;  4XI9 A;  2I6H A;  3VTX A;  3CVU A;  5EX3 A;  2XQ0 A;  3ZGQ A;  1PY1 A;  3FUF A;  1NA3 A;  2CHZ A;  5KCM A;  3ZEF A;  4ACK A;  4YVO A;  4B8A A;  4E85 A;  3C98 A;  4DJA A;  2PQR A;  2J4D A;  1ZBP A;  3PEV B;  3S7J A;  3GZS A;  4FAD A;  4J8D A;  3FUM A;  1QZ2 A;  3RRN B;  2WXN A;  3PH0 C;  3FU3 A;  3KAE A;  1EF1 C;  4FLB A;  3FUK A;  4H7X A;  4F3V A;  1UG3 A;  3UT7 A;  1FVH A;  4MKT A;  3SGH A;  2CFU A;  2VGY A;  2XRY A;  1EYH A;  1VDY A;  5J90 A;  3T8M A;  3EHM A;  2CHW A;  1FVF A;  1XNF A;  3L22 A;  4UWL A;  2NSZ A;  4UQY A;  5CHE E;  3SZ7 A;  3SF4 A;  1E8W A;  3IEG A;  2OOE A;  1TJC A;  4FC8 A;  3QWV A;  4ANU A;  1W3B A;  3Q5M A;  1HG2 A;  3LXU X;  4DPR A;  4KVO A;  3QAQ A;  3ZXS A;  1N54 A;  3L13 A;  4ATG A;  3FTZ A;  1JUQ A;  2WXQ A;  2WMO A;  3TXM A;  4DK5 A;  4ABN A;  4JW1 A;  5CMW A;  1HG5 A;  1S0P A;  2JEK A;  3AS4 A;  5A23 A;  3VLD A;  3ULQ A;  2WXF A;  3ZVV A;  4A1S A;  1HU3 A;  3CHR A;  2P58 C;  5G55 A;  4RG6 A;  4QFV A;  4GMJ A;  1HX8 A;  1IQR A;  4FUL A;  4CRW A;  4DI3 A;  5C2Y A;  3RRU A;  3FUI A;  2LNI A;  3BG1 B;  4I2Z A;  3LYA A;  3MX3 A;  5FZR A;  4PS7 A;  1H2U A;  3FTY A;  2VSO E;  3FU6 A;  2WQ7 A;  4B89 A;  1E8X A;  5FZS A;  3QWW A;  4GB9 A;  3TG5 A;  3DPD A;  3CVW A;  5AEN A;  4L1B A;  4ILI A;  5BV0 A;  2IFU A;  3OXF A;  2BTD A;  2BUG A;  2J9Q A;  3DBS A;  2HM8 A;  3PE4 A;  3HVE B;  4MLP A;  5LOZ A;  3UT8 A;  4HOQ A;  2KM4 A;  4A3V A;  4FHK A;  3RKV A;  1A17 A;  1E96 B;  2WXG A;  3IKO B;  3FWV A;  3AU5 A;  4KYO B;  4EZK A;  3QOU A;  3O4Z A;  3VTY A;  3ZYL A;  1ELW A;  3PZD A;  2YQ8 A;  4I1M A;  4LCT A;  4G23 A;  2UY1 B;  1NP7 A;  5BV1 A;  1OWP A;  2FUL A;  5J08 A;  1IYG A;  3Q4A B;  3RJV A;  2KCL A;  4JEU A;  1Z3X A;  3VLE A;  1H0A A;  2XPY A;  4N5C A;  4PDX A;  3ZYM A;  4FHJ A;  3PUK A;  3LEW A;  4CGV A;  4G2V A;  1BPO A;  4XKC A;  5E75 A;  3NZU A;  1GW6 A;  3ASD A;  4GYW A;  5FQ6 A;  2WQ6 A;  3AU4 A;  3OXG A;  2J07 A;  3PEU B;  2HR2 A;  3FFL A;  2WXK A;  3CSF A;  4WNG A;  3CK8 A;  2MHK A;  4D10 C;  1LF8 A;  4JA9 A;  4LER A;  3LJ3 A;  4G1T A;  4OYS A;  3QB2 A;  4C0E A;  3GZ1 A;  1U3D A;  1Z3Y A;  3ESK A;  4HFG A;  3KS2 A;  4FLH A;  4JHJ A;  2V8S E;  4UWK A;  4I6E A;  2HO1 A;  3P2B A;  3ZFW A;  5KJL A;  2V4L A;  3QDN A;  2PZI A;  3U4T A;  4HOS A;  4Q69 A;  1ZU2 A;  2XGM A;  4XZ4 A;  2Y4T A;  3FY4 A;  3FTV A;  3GZ2 A;  3I4R B;  3FUE A;  3TL5 A;  4PS3 A;  4AVX A;  2DBA A;  2VSX E;  2OND A;  1UW4 B;  4N3A A;  1ELK A;  3L08 A;  4XIF A;  5FQ7 A;  5LCW J;  2WXH A;  1KT0 A;  2X38 A;  4EZJ A;  4FP7 A;  4JPS A;  4FU3 A;  4U0Z A;  3MCX A;  4XX5 A;  2JLB A;  3ASG A;  2PL2 A;  3CR3 A;  3ESL A;  4YND A;  3PRZ A;  2WXO A;  3QWP A;  1HZ4 A;  3CVP A;  3I4G A;  4GZ3 A;  2V0P A;  4PH4 B;  4CDM A;  3MKQ A;  4IRU A;  5LX8 A;  4J8E A;  4AY5 A;  2PM7 A;  4BT8 A;  4JEH A;  3LY7 A;  5ARF A;  4UWF A;  2L0T B;  3O48 A;  4AEZ C;  3B7R L;  3HVE A;  2VQ2 A;  3U9W A;  4EBA A;  3G2S A;  3LY8 A;  1L5J A;  3UMV A;  1IQU A;  4BFR A;  3BG0 B;  4F7A A;  3FH7 A;  4IYP A;  3FHE A;  3ONK A;  4HLE A;  3BEE A;  3QK0 A;  4WNF A;  5A7D B;  1H2T C;  4IN3 B;  4AM9 A;  3LCA A;  3SHF A;  2UY1 A;  2AXV A;  3ZRH A;  4GYO A;  2XCC A;  3GW4 A;  2RG8 A;  3FTU A;  2C0M A;  5BT1 A;  4GYY A;  4I2W A;  4NRH B;  2FO7 A;  2WXI A;  1Y6I A;  3L17 A;  4I6J A;  3D9I A;  4A1G A;  4AV7 A;  3FP3 A;  1E8Y A;  2PM6 A;  3MZL B;  2A5U A;  5KJM A;  3FUN A;  4I1A A;  2R59 A;  4RSY A;  4DI4 A;  5CCL A;  4RVB A;  3TGO A;  1JWF A;  4RG9 A;  3QJZ A;  3CLJ A;  1OUV A;  3SBT B;  4PS8 A;  3LPZ A;  4EQF A;  3QC1 A;  5CMY A;  3CHO A;  4UQZ A;  4ILG A;  3ZN3 A;  3LY9 A;  2E0I A;  4KVM A;  4NUR A;  3L6A A;  4U0U A;  1N52 A;  3RK6 A;  4KXK B;  4NQ0 A;  5T8I A;  2WXL A;  3D9P A;  4JZY A;  4ANV A;  5T4Y A;  2NC9 A;  3ZW3 A;  2WB2 A;  4Q96 A;  3LVR E;  2V5F A;  3CHM A;  5G04 C;  1QNF A;  2CHX A;  4JXT A;  3ZIM A;  1UJJ A;  3T5X A;  3HYM B;  4BT9 A;  3CVY A;  4K03 A;  2AVP A;  2Y3A A;  5ANL A;  3L16 A;  3ZYK A;  4KZC A;  4G26 A;  4HOU A;  4OVU A;  3JCK C;  4GML A;  3MKQ B;  3TG4 A;  2AW6 A;  5KJN A;  5FT9 A;  3RIB A;  3CHS A;  3LKU A;  4TUU A;  3JQ1 A;  2ILR A;  5D0O D;  4BX8 A;  3ZYQ A;  5ARG A;  4O6F A;  3FU5 A;  3PRE A;  5G04 J;  3KEZ A;  1OWO A;  3G2U A;  4WNE A;  4XKB A;  5EX0 A;  5A6C A;  2RD0 A;  3IHY A;  4JVS A;  3UUX A;  5M72 A;  2IOS A;  3SI5 A;  4GPK A;  3WXX A;  2KAT A;  3G2V A;  3UT4 A;  3RO3 A;  2YHE A;  3S7F A;  4UQX A;  2XCB A;  2WXP A;  2VGX B;  2IF4 A;  3D9K A;  3L54 A;  1UN8 A;  3Q47 B;  4WWO A;  2WVI A;  3CHQ A;  5BNW A;  3FEY A;  3IHV A;  4LUN U;  3FU0 A;  4Y6C A;  5FJY A;  1E90 A;  4JC8 A;  4Q94 A;  2HYZ A;  4APO A;  2XGO A;  1H2V C;  2X6I A;  4N3C A;  4UI9 C;  2FEZ A;  2VSY A;  4HVB A;  4AY6 A;  4G25 A;  4HOT A;  2IJG X;  2AWI A;  3JYS A;  2A4Z A;  3QAR A;  4GA1 A;  4ANX A;  4CT4 A;  3FH8 A;  4Y6W A;  2VTB A;  4L2Y A;  1WY6 A;  1JWG A;  2EQX A;  2VSN A;  5AYW D;  3TAX A;  4AP2 A;  3ML9 A;  2CFZ A;  1QQE A;  5FWQ A;  2WMN A;  1Y8M A;  5T3R A;  1INZ A;  4C9B B;  4AJW A;  3T5V A;  3HHM A;  4CT0 A;  4A3T A;  3SBS A;  3MV3 B;  3G2W A;  1YA0 A;  1P5Q A;  1OWL A;  4J0U A;  5JJ7 A;  2AXZ A;  4UI9 J;  3FEX A;  1HE8 A;  2J49 A;  2X6J A;  1NA0 A;  3PE3 A;  4K0R A;  4GA0 A;  4I1O B;  4OVV A;  4CDN A;  2Q7F A;  3ZPJ A;  2X6K A;  3CKB A;  4HS2 A;  3TJP A;  3S2A A;  2WM9 A;  4UWH A;  3VLF A;  4EPZ A;  2VJ8 A;  4C0M A;  2J08 A;  1E7V A;  1E7U A;  3U66 A;  4BSX A;  3FH5 A;  4WUY A;  2ZU6 B;  4B0Z A;  4AOF A;  3MJW A;  2R17 C;  1H19 A;  3IBE A;  3OXL A;  3E4B A;  1ELR A;  2GW1 A;  2WXJ A;  3CGH A;  4E6H A;  3D9J A;  3P1U A;  1EDU A;  4YVQ C;  2X6H A;  1H6K A;  4UWG A;  3CVL A;  2YIN A;  4JL0 A;  3PNT B;  4J8F A;  3TXN A;  2UWJ G;  5G05 C;  1EPU A;  2XEV A;  1WAO 1;  3NF1 A;  3QNK A;  2KCK A;  2OVB A;  4CGW A;  2WXM A;  2LSV A;  3PUJ A;  4B8C B;  4WWN A;  4V3I A;  3EIJ A;  4JHR A;  4ME2 A;  4TV3 A;  1X5B A;  2AXU A;  5AJD A;  2X3M A;  3EIQ C;  5AJL A;  2QY7 A;  3B7U X;  3UX4 A;  3CVN A;  2I1J A;  2VGX A;  3CVV A;  1HFA A;  2Y4U A;  4BX9 A;  3LS8 A;  1SZ9 A;  3LVQ E;  2KC7 A;  2VTB B;  4G24 A;  3GYZ A;  5E76 A;  1PAQ A;  4GCO A;  5EKQ D;  3CIA A;  5JJT A;  4N2Q A;  1U3C A;  3MV2 B;  1TJF A;  4N39 A;  1B89 A;  2C0L A;  5G05 J;  1E8Z A;  3B7S A;  5ANR A;  3U64 A;  1DNP A;  2XHE A;  4LRZ A;  4HXI A;  3R7R A;  3CVX A;  3PDN A;  2KCV A;  4URK A;  3ZHE A;  2WQH A;  2J4B A;  3QKY A;  4IUL A;  2XRZ A;  4GZC A;  2DCP A;  2CG2 A;  3FTS A;  1TEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...