1KLXA

Helicobacter pylori cysteine rich protein b (hcpb)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
133
structure length
133
Chain Sequence
GGGTVKKDLKKAIQYYVKACELNEMFGCLSLVSNSQINKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine Rich Protein B
publication title The crystal structure of Helicobacter pylori cysteine-rich protein B reveals a novel fold for a penicillin-binding protein.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 52
structure length 133
sequence length 133
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08238 Sel1 Sel1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1klxA00
3RKVA 3Q5MA 2VGXA 3CVPA 4YNDA 5EX3A 3ESKA 4I17A 5DIZA 4XI9A 2LNIA 2PQRA 5CCLA 4RG9A 3PDNA 3QWPA 4RG6A 2XEVA 3NF1A 5BW8C 2WPVA 3S7FA 4H7YA 2KCVA 4I9CA 4HOQA 3CVQA 3LY9A 5HI7A 5BNWA 4J8FA 3AS8A 5LCWC 4XI0A 2E2EA 3TG5A 4G2VA 4A1SA 4NRHB 4NQ0A 3S7DA 4GPKA 2PL2A 3UQ3A 4U0UA 3QWVA 2C2LA 1OUVA 4GYWA 1B89A 3CV0A 3LYAA 3ASDA 5FT9A 4AM9A 1IHGA 4U04A 3ZGQA 3JYSA 3K9IA 3TG4A 3UPVA 4G1TA 5D0OD 4U0ZA 5JJTA 4KXKB 4HOTA 3QWWA 3AS4A 5C1DA 3ZHEA 4GA2A 3VTYA 1NZNA 3R9AB 3RO2A 4HORA 2WQHA 3MEKA 1QQEA 3N71A 4KYOB 4I2ZA 1WAO1 4J8DA 2XCBA 3CK8A 4IN3B 3ZFWA 1NA3A 4WUYA 3VTXA 5A7DB 2FEZA 4GCOA 2UY1B 5D0QD 3U3WA 2PZIA 3AS5A 2BUGA 3EDTB 4BT9A 2XCCA 4N3CA 3S7BA 4YVOA 4U07A 1A17A 5G05C 3OXFA 2R5SA 5BT1A 4JA9A 5G05J 5HQ8A 3O48A 2PQNA 4JL0A 5FZSA 2XGMA 3GYZA 3ASGA 4GYOA 4F3VA 3CKCA 3KS2A 5A6CA 1NA0A 4U0SA 4UQYA 2YHCA 1HH8A 1KT0A 3PE4A 4I1AA 5KJNA 2Y4UA 2DBAA 4JA7A 3CK9A 2Y4TA 4N3AA 4AY5A 4UI9K 2XPIA 1Y8MA 2XGSA 5JJ6A 5DBKA 2VGXB 3Q49B 3U4TA 3MA5A 5ARGA 4WNDA 1IYGA 3TAXA 3HYMB 3E4BA 5FJYA 5KJKA 5ARFA 4AIFA 3ASHA 4HOUA 4YVQC 4WNFA 4UQZA 5FZRA 4I2WA 2VYIA 2LSVA 3FWVA 2UWJG 1ELWA 4N5CA 3LKUA 2OOEA 1HXIA 1QZ2A 2XGOA 3RIBA 3Q15A 5CHEE 5M72A 2Q7FA 4GZ6A 4Y6CA 4ME2A 2FI7A 3ULQA 4APOA 1KLXA 3ASFA 4I9EA 2UY1A 2FF4A 3FP3A 3WXXA 3URZA 4J8EA 4GA0A 5G04C 3LCAA 3CEQA 3Q47B 3CK7A 4Y6WA 2HYZA 3MV2B 2IF4A 4H7XA 5G04J 4CGWA 1P5QA 1ZBPA 3UUXA 4GCNA 2AVPA 3RJVA 2MHKA 3CKBA 3RU0A 1ELRA 2J9QA 4N2QA 4GA1A 3OXGA 3OXLA 4G24A 4N2SA 5EX0A 2GW1A 2KATA 3ZHEB 4G23A 3FFLA 3KD7A 4CDRA 2C0MA 3SZ7A 4GZ5A 3IEGA 4EQFA 3QOUA 2FO7A 4KBQA 2JLBA 4WNEA 3QKYA 2C0LA 2LSUA 3S7JA 1WM5A 3LY7A 4ABNA 3MKRA 2VSNA 4JHRA 3LY8A 5FTPA 5JJ7A 3TGOA 2ONDA 3GW4A 2L6JA 4G25A 4UQXA 5KJMA 2QFCA 5LCWJ 2KCLA 2I6HA 2HR2A 5EKQD 4W9RA 2V5FA 4N39A 4BTBA 4XIFA 3ZN3A 4J0UA 2YQ8A 4G26A 4LEUA 5FZQA 3CVLA 4UI9C 1YA0A 3Q4AB 5KJLA 1KT1A 1HZ4A 4UI9J 1FCHA 4AY6A 2NC9A 4WNGA 5CCMA 3KAEA 4GYYA 3PE3A 1ZU2A 4BWRA 1PC2A 4O6FA 3GZ1A 4GZ3A 2VSYA 2HO1A 3LPZA 2KC7A 3BEEA 1TJCA 2VGYA 2VQ2A 3RO3A 2IFUA 5AYWD 4CGVA 2FBNA 2KCKA 4BTAA 4B94A 1E96B 3GZ2A 4BT8A 4HOSA 1XNFA 4N3BA 1W3BA 2P58C 3CVNA 3ZPJA 3QDNA 3MV3B 3SF4A
chains in the Genus database with same CATH superfamily
3V2OA 3CVPA 2P9KG 5BV1A 4I17A 2PM6A 4JHKA 4XI9A 2WXMA 3F6QA 3NF1A 3TWSA 3DEPA 3S7FA 3HG0D 3T8MA 2X6KA 3LY9A 5HI7A 2RFMA 4GTTA 5BNWA 4A3TA 4DI3A 4HVBA 2PNNA 1S64A 4G2VA 5AN8A 4NRHB 1RW2A 2LAIA 5CMWA 3ONKA 1TNZA 4AP2A 2EILE 3NB2A 1OWLA 4UWFA 1BU9A 4FADA 4AM9A 4O60A 4UWHA 3ML8A 1UOHA 5CRVA 5ENPD 3K9IA 5CBNA 5D0OD 3FU0A 5JJTA 3FTSA 3FUEA 1N0QA 4HOTA 2IO2C 3R7QA 3HXFA 4I6JA 4DX2A 2A5EA 3VTYA 3P2BA 1NZNA 5HKPA 4V3IA 4IYPA 4LG6A 5B1AE 4U63A 3ZIMA 1IQRA 4HORA 2ZIRA 4HBDA 3MEKA 1QQEA 1N11A 3N71A 5EILA 3PZ3A 1PAQA 2KZTA 4J8DA 5CRUA 1UN8A 2YNQA 1JCSA 3APFA 3SHFA 3ZXPA 3ZFWA 4I43A 2A4ZA 5B1BE 3D9LA 3ULYA 5KCMA 2V4LA 1GW6A 3AS5A 3HIZA 4GTOA 2BUGA 1E8XA 4U8VD 4GB9A 3G2TA 3APDA 5D2MC 5ENNA 1PY1A 3W9FA 3ZYKA 2QYUA 2XEHA 2PQNA 5JMND 5FZSA 1Y6IA 2WXHA 4GYOA 3CKCA 3KS2A 3R7RA 3P1UA 3WG7E 2DIWA 4NURA 4B93B 5KJNA 4JA7A 3CK9A 3FTVA 4LCTA 2BTDA 3QK0A 4UI9K 2XQ0A 5AQAA 2WQ6A 3U4TA 3ASNE 3FH8A 2AJAA 4RLYA 2J49A 2OVFA 4GTQA 4ANWA 2P9UG 3B7RL 1JWGA 3Q9UC 4WNFA 5FZRA 3ZUVB 3SBSA 2VYIA 5T8IA 2B0OE 2ZGGA 4N5CA 2X6JA 2OOEA 4GZ6A 5A23A 4Y6CA 4ME2A 2DVWA 2FULA 2H6FA 5AQ9A 1OCZE 5BXUA 1N94A 2UY1A 2FF4A 1FPPA 2QC9A 4DX5D 1MHQA 5ENRD 4Y6WA 2HE0A 4GCNA 1UW4B 4B8CB 5BXOA 3W9GA 1H6OA 2DWZA 4OVUA 4N2QA 3TXNA 2CG3A 3AAAC 4U8YD 3B7BA 4GTMA 2VSXE 2WQ7A 1OCRE 3PUKA 4LUNU 5FIOA 3EU5A 3EHMA 4I6EA 3KD7A 3AG1E 2C0MA 5HS0A 3L82A 4FHKA 5LFAA 4EQFA 3O4ZA 4A1GA 4EZLA 1DVPA 1NI1A 3TWXA 4I1OB 3DSTA 3FU3A 4ATGA 3S7JA 4ANUA 4HS2A 4OAVB 2WXPA 4ABNA 3MKRA 2BEDA 3PUJA 4JHRA 2VGEA 4GZDA 3EHQA 5AQ7A 2L0TB 4FLBA 3CQCB 5KJMA 4L7TA 5KNGA 4JB8P 1U2VG 4FLHA 5LOZA 2OVBA 4JZYA 3DBSA 4BSXA 4W9RA 1Z3YA 2F8XK 3V31A 1TNYA 1QBQA 5CEAA 3FUHA 5EYLA 3J5PA 2EIME 1OCOE 3DSUA 1HZ4A 1INZA 3ZRHA 3RRMB 5FQ4A 1H0AA 3FTUA 1FVFA 3Q78A 3CR3A 4XX5A 5ENQD 3L22A 1TN6A 4GTSA 4GYYA 3PE3A 4BWRA 1PC2A 3GZ1A 2VSYA 1SZ9A 3LPZA 2WXLA 3HDXA 5AYWD 4CCAA 3EJNA 1KPSB 4B94A 1E96B 1SQMA 3L08A 4HOSA 4N3BA 2WXQA 3PEUB 4L2LA 2P58C 2XZDG 3CVNA 5KWDA 4HQDA 3ZVVA 3QB2A 3SF4A 1OWPA 3RKVA 4U95D 4D10C 2V8SE 3V79K 1WG0A 5B3SE 5G55A 3PDNA 3QWPA 2NYJA 3KSQA 3UINC 2XEVA 5BW8C 2WPVA 1SA4A 2CFZA 3QJZA 3AS8A 4Z68A 2MRIA 2L9BA 4AOFA 5LCWC 3FY4A 3TG5A 3IHYA 2MYOA 2QYJA 3OAWA 3DSSA 3L13A 4HI9A 4Q69A 4QQIA 3DEOA 3KEZA 2PL2A 1OT8A 2XPZA 2C2LA 2J07A 3CV0A 3ASDA 2LUHA 1TYQG 4MS6A 2EQXA 1S0PA 3S2AA 1IHGA 1OXJA 5E75A 3JYSA 4OAUC 3UM2A 3ABKE 3E32A 3SNXA 2HM8A 2RD0A 4R7LA 3ZYLA 2IONA 3CVXA 4GMRA 4KXKB 3CHQA 3G2SA 3PNLB 5EIBE 1K3ZD 2BKKB 3TWUA 4WWOA 3E34A 4EZKA 1H2TC 5BV0A 3RK6A 3MCXA 4PS7A 2E0IA 2ETAA 3D9KA 2F37A 5FINA 2KBXA 5CEDB 3T9KA 3VLDA 4I2ZA 1WAO1 1HX8A 3DXKG 4XKCA 1TN8A 3UIPC 1A5EA 1S63A 4WUYA 5AJLA 1WDYA 4PUCA 3DSXA 2FEZA 4GCOA 4DK5A 2XRZA 2UY1B 2AW6A 3NOGD 1BI8B 3AG3E 4CYMD 4HLLA 4URKA 4N3CA 1TNUA 1YMPA 3Q75A 3OXFA 2GRMA 4GPMA 4G11A 4JA9A 3EU9A 3O48A 3ZKJA 5E76A 3AU4A 4F3VA 4LERA 3RAUA 2VSOE 5A6CA 1NA0A 4U0SA 3LEWA 4B0ZA 3FH7A 4UUCA 3TXMA 3PE4A 3JXJA 4YDWA 2DBAA 2IOLA 3LJNA 4K5AB 3ZXSA 2XGSA 3CLJA 5DBKA 3FEXA 3IV0A 4C0MA 3MA5A 1JPLA 4J7WA 4BERA 1E7VA 4WNDA 3HYMB 2R17C 4KZ0A 3I5PA 4JXTA 5KJKA 2WVIA 2ILRA 2WXJA 4G8LA 1O5MA 1D8DA 3X2QE 4TRQA 2WXKA 2P2CP 4ANXA 3PZ1A 4PS8A 1YCSB 2GRPB 3HXDA 2JEKA 3Q15A 5M72A 2CHWA 2KM4A 2FI7A 2WXRA 2RG8A 3E30A 3DRAA 3QNKA 1LD7A 1X81A 1Z5SC 5FQ8A 4J8EA 4GA0A 4KMOA 5ANRA 2GRLA 4CDMA 3TWQA 2DYSE 2X6IA 4GTRA 5D66A 5EYPF 1P5QA 2AVPA 2GRNB 3RJVA 2MHKA 3CKBA 3PVLA 2P9LG 2J9QA 3CVWA 3UMVA 3CIAA 2CHXA 3DXMG 3RSEG 4G24A 3D9PA 3V30A 5EX0A 2ZGDA 4FA6A 4MLPA 2FO1E 3FFLA 4CDRA 4A63B 1FT1A 4GMLA 1N95A 4GMJA 1K8KG 4GZ5A 2WXFA 1IXVA 3QOUA 4WWPA 3TWTA 4KBQA 3IXEA 1RZ4A 4C9BB 4FU3A 3FUFA 5G2NA 4LNBA 4EBAA 1IKND 2LSUA 4J6IA 2VSNA 3UM1A 1EF1C 3NZUA 3Q79A 1JCQA 3VLEA 4HLEA 3HRAA 2M63A 2R03A 1HO8A 1OWNA 3GW4A 4AVXA 3FUIA 4G25A 5T3RA 3CVVA 3D9OA 3HVEB 4DX6D 1EYHA 4CZ2D 1H19A 2IOSA 1UJKA 1MYOA 1KZPA 3SY2A 2X3MA 5EKQD 2V5FA 4JD2G 4N39A 3B7UX 1E90A 4GAAA 3ZN3A 1HF8A 4DUIA 2H6HA 5H7PA 3C3RA 4IRUA 3ESLA 1O1TA 2XENA 4UI9C 1TR4A 4A55A 2IQCA 1KT1A 4UI9J 1NL4A 4O1PA 3UT7A 2XZTG 3FTWA 3KAEA 5CERB 4O6FA 3TWRA 3ZNGA 2HO1A 4WAFA 1G3NB 1HFAA 3BEEA 4UWKA 2XHEA 4TUUA 3GZSA 3MKQB 2WXNA 1BLXB 2J09A 4ILIA 5LP0A 4HI8A 4ZFHA 2Y1LE 4MKTA 1XNFA 1W3BA 2WMNA 3U66A 3JUIA 3E33A 4GTPA 2X6HA 4BESA 3KEAA 5ANLA 4HRNA 4DLOA 3OTNA 3E37A 4YNDA 5EX3A 2LNIA 5CCLA 4RG9A 1Z3XA 2WXIA 3TWWA 3ONLA 3MJWA 1HS6A 1N4QA 2KCVA 1O1SA 4I9CA 4MBGA 2X38A 3SQVA 2IJGX 4J8FA 1EDUA 2I1JA 1MX4A 4RSYA 3VLFA 1O1RA 3B95A 2QZAA 4XI0A 2E2EA 3LXUX 5AQBA 5BUZA 2EIJE 2LAHA 2NXPA 4A1SA 1K1BA 3UT4A 1TEZA 3QWVA 2GRRB 3FUNA 1OUVA 1TJFA 3SBTB 4P29A 3EHRA 3DPYA 4LNGA 4KT6B 2GROB 1U3CA 4F6RD 4U04A 5J90A 3MX3A 4EBAG 4K0RA 4XE0A 5T4YA 4G1TA 3Q9NC 5EIDA 1Z6TA 2R2LA 1JUQA 3CHSA 1TN7A 5ITZF 3QWWA 4BETA 3UM0A 1EPUA 1DCEA 3L9TA 5JHBA 2IY0C 4U8HA 3RO2A 3ZYMA 4JW1A 5EDSA 2B6CA 3HXBA 2XCBA 5FQ6A 3CK8A 4IN3B 2P9NG 3LVRE 3L17A 2XRYA 1NA3A 3MYVA 3AG2E 4K5BA 2OV8A 4J8YA 3CGHA 1TNBA 3NBNB 4L23A 3Q73A 4APFA 4BSZB 5G05C 2V4HC 4U96D 5LX8A 1SA5A 4EECA 3ULEG 3IBEA 3HVEA 2JABA 2OCCE 4QFVA 2EIKE 5G05J 4OYSA 4DX7D 3GYZA 2LO6A 3G2UA 3D9IA 4TV3A 2YHCA 3JQ1A 3U9WA 4CDNA 1KT0A 1QNFA 2CHZA 3NQPA 2ZXWE 4I1AA 2Y4UA 3IKOB 4KZCA 1UG3A 3CVYA 1D8EA 2Y4TA 4AY5A 1LD8A 3FU6A 3LJ3A 2VGXB 4GTVA 4HFGA 3TWVA 1FVHA 2X6FA 5ARGA 2CFUA 2WB2A 1IYGA 3TAXA 4E6HA 3CHRA 3E4BA 5ARFA 3C98A 4AIFA 3SFXA 1AWCB 1S70B 3UTMA 4UQZA 3ISMC 1LF8A 3FWVA 2ETCA 1ELWA 1H6PA 3MKQA 3LKUA 4HB5A 4I1MA 2L6BA 4JEUA 4CT4A 4YDYA 2Q7FA 2WXGA 3ULQA 3FTXA 3JCKC 4UWGA 4ANVA 4APOA 1KLXA 2J4DA 3ASFA 3CQGB 4I9EA 3UIOC 3HHMA 3TL5A 1MZCA 4Q96A 3URZA 1DNPA 5G04C 3RRNB 3G2WA 2ZISA 3CK7A 3Q47B 2HYZA 2IF4A 4JPSA 5G04J 4CGWA 1ZBPA 4OVVA 2YINA 3FU5A 3B7SA 3LS8A 5IY5E 3OXGA 4U7EB 2XS8A 3SFZA 4ACKA 4N2SA 4ILHB 4AEZC 4BX8A 2BF0X 3NAWA 3ZHEB 4TXPA 3FH5A 3FDHA 1HG2A 3ML9A 3AJIA 3NOCD 2MOWA 2J08A 4HRLA 3CHMA 1V54E 2I9CA 2FO7A 3PZDA 2BKGA 4WNEA 5KNHD 1YYHA 3Q7AA 2OEWA 2NSZA 4KVOA 4YDOA 2R02A 3QKYA 2C0LA 2WXOA 1WM5A 1OY3D 3QAQA 1N52A 2AWIA 3LY8A 3ZEFA 2ONDA 3CSFA 4TXQA 1MX6A 2WM9A 4KVMA 4AXHA 2L6JA 2ETBA 4UQXA 5CECB 4GZCA 2ZU6B 3FTZA 2QFCA 1H2UA 2KCLA 3L16A 4ATZD 2I6HA 2WMOA 1K1AA 2P9PG 4E85A 3LDZA 2Y3AA 1MQSA 1BI7B 4BEPA 3G2VA 3PNTB 4LEUA 1OWMA 3FUDA 1YA0A 3Q4AB 5KJLA 2GGFA 4FHJA 4Q94A 2R59A 2AXZA 4FC8A 3C5RA 3PRZA 4K03A 1MX2A 4AY6A 2L0IA 3AU5A 2NC9A 4F7AA 3DPDA 1E8ZA 4C0EA 4G8KA 5J08A 3UXGA 5C2YA 2KC7A 1TJCA 2VGYA 2VQ2A 5AENA 3RO3A 4GU5A 2IFUA 2KCKA 4BTAA 2VTBB 3GZ2A 4BT8A 4TXRA 1SW6A 3C3QA 2DCPA 2XS1A 3ZPJA 2V5QC 2LXLA 3QDNA 4BY6A 3MV3B 3DSVA 1U3DA 2VGXA 3Q5MA 4FJYA 4DPRA 3EIJA 3UI2A 3ESKA 3U64A 5DIZA 4UWLA 2PQRA 4RG6A 1E7UA 3DWLG 5ENOD 3D9JA 4H7YA 4HOQA 3CVQA 4EPZA 4CEMA 4EHMA 4EZJA 3D3MA 2DYRE 3FULA 4RVBA 1FT2A 1IQUA 4NQ0A 3S7DA 2DZOA 4GPKA 5AAOA 3UQ3A 1JCRA 4U0UA 4XEIG 4GYWA 1OWOA 1B89A 3LYAA 4LNUD 5FT9A 4ACLA 4CT0A 2XEEA 4HNAD 5AARA 4K5CA 3ZGQA 3TG4A 3UPVA 4U0ZA 5ENTD 3CHPA 2P9IG 2PM7A 4WWNA 3C3OA 4F1PA 3AS4A 5C1DA 3ZHEA 1BPOA 3FUKA 3UX4A 4GA2A 2Y0BG 1Q2ZA 4O1OA 2EINE 3PREA 3R9AB 1HU3A 2WQHA 5KBAA 4B89A 4KYOB 3RRUA 5EN5D 3TJPA 2P9SG 4M3OA 4F1SA 3VTXA 1IHBA 3EIQC 4NIKA 2I2OA 3PZ2A 5A7DB 4N5QA 3PZ4A 3SGHA 3UT8A 4XZ4A 3QARA 5D0QD 3U3WA 2PZIA 1JWFA 2IEJA 3C72A 3EDTB 3AG4E 2DZNA 4YDEA 4BFRA 4BT9A 2XCCA 4A3VA 4JC8A 1H6KA 3S7BA 3T5XA 4YVOA 1WY6A 4B8AA 4U07A 4CRWA 5AIJA 1A17A 4PDXA 2R5SA 1N54A 4AV7A 5BT1A 3ABLE 2H6IA 4LSZE 5HQ8A 1L5JA 4JL0A 3HXEA 2XGMA 3Q7FA 3ASGA 3BG0B 1E8YA 4UQYA 5CMYA 4MRUA 1HH8A 4LRZA 5HRYA 1D9SA 3UKUG 1N0RA 3B13A 5FWQA 2F8YA 2RFAA 4N3AA 4IULA 2R05A 1Y8MA 2XPIA 3L54A 3T8KA 5JJ6A 3B7TA 3Q49B 3V2XA 2J4BA 3SI5A 4DLQA 4NACA 2V0PA 5FJYA 1HG5A 1AP7A 3ASHA 4HOUA 4YVQC 1DC2A 4L9PA 4I2WA 2LSVA 2UWJG 3ZU7B 3I4RB 3I3NA 3JQ0A 4JVSA 4C48B 1H2VC 3PS6A 3T5VA 2VTBA 1HXIA 1QZ2A 2XGOA 3BG1B 3ZW3A 3RIBA 5CHEE 1SZAA 3FUJA 2GRQB 4PH4B 2H6GA 3EHNA 1N9AA 2J8SD 3FUMA 3R9MA 1TNOA 1ZB1A 3FP3A 3DSWA 3NZSA 2RKKA 3WXXA 4RQIA 3I4GA 5JHAA 4DRXE 3LCAA 3CEQA 4J8SA 3MV2B 4H7XA 5ENSD 3IHVA 3UUXA 1E8WA 2KXPC 1N4SA 3RU0A 1ELRA 3MZLB 1N4PA 3CHOA 4GA1A 3MGBA 3OXLA 4ILGA 1NFIE 2F0YA 3CSTA 2GW1A 3BUAA 2KATA 1N4RA 3APCA 4I6GA 3JXIA 4BX9A 4G23A 3KSLA 3FHEA 3PEVB 1MJ0A 1UJJA 1DCQA 3SZ7A 3JUEA 4DJAA 3IEGA 4L2YA 2A5UA 2JLBA 1ELKA 2KZTB 2IO3C 4JHJA 4FP7A 1NP7A 3LY7A 3UM3A 1LTXA 2IU1A 3ASOE 3ENEA 1X5BA 5FTPA 5JJ7A 3TGOA 3SFYA 4L1BA 2CG2A 3BQOA 1XGWA 5BPPA 3CVUA 4HRMB 2VJ8A 4M7CA 5LCWJ 2OEVA 4HXIA 3D9NA 4F53A 4DI4A 2HR2A 5AJDA 4DX1A 2I1KA 3D9MA 4BTBA 3ZYQA 4XIFA 3PH0C 1SVXA 4J0UA 2YQ8A 1V55E 4G26A 3D9HA 2LXMA 5FZQA 1HE8A 2AXVA 3CVLA 3FTYA 1BD8A 1QYMA 2AXUA 2Y69E 3SO8A 5CBOA 5FQ7A 5JA4D 4FULA 3EUVA 1FCHA 4WNGA 3L6AA 3FEYA 2XPYA 5CCMA 1VDYA 1ZU2A 4GZ3A 1KZOA 2QY7A 4TUMA 4X8QA 3SD5A 2FBNA 4PS3A 4CGVA 2YHEA 4AJWA 3ABME 3BU8A 4FJZA 1UN9A 4XKBA 4ZHBA 3UKRG 3QC1A 4JEHA 1OCCE 3HXCA 3LVQE 3J5QB
chains in the Genus database with same CATH topology
1OWPA 3RKVA 3Q5MA 1U3DA 2VGXA 3CVPA 4FJYA 4YNDA 3EIJA 4D10C 4DPRA 5BV1A 2V8SE 5EX3A 3ESKA 4I17A 3U64A 2PM6A 4JHKA 4UWLA 4XI9A 5DIZA 2WXMA 2LNIA 5G55A 2PQRA 5CCLA 4RG9A 3PDNA 1Z3XA 3QWPA 4RG6A 2WXIA 1E7UA 3ONLA 2XEVA 3NF1A 3D9JA 3MJWA 1HS6A 5BW8C 2WPVA 3S7FA 4H7YA 2CFZA 2KCVA 4I9CA 3T8MA 2X6KA 3CVQA 3LY9A 2X38A 4HOQA 5HI7A 3QJZA 2IJGX 3AS8A 4J8FA 4EPZA 5BNWA 1EDUA 2MRIA 2I1JA 4CEMA 4RSYA 3VLFA 4A3TA 2L9BA 4AOFA 4EZJA 5LCWC 3FY4A 3D3MA 2E2EA 3LXUX 4XI0A 4DI3A 3TG5A 3IHYA 4HVBA 5BUZA 2LAHA 3OAWA 3FULA 4G2VA 2NXPA 4A1SA 4NRHB 4RVBA 2LAIA 3UT4A 5CMWA 1TEZA 1IQUA 3L13A 4NQ0A 4Q69A 3S7DA 3KEZA 3ONKA 4GPKA 2PL2A 3UQ3A 4AP2A 4U0UA 3QWVA 2XPZA 3FUNA 2C2LA 1OUVA 4GYWA 1TJFA 2J07A 1OWOA 3SBTB 1B89A 1OWLA 4UWFA 4P29A 3CV0A 3LYAA 3ASDA 5FT9A 4FADA 4AM9A 4ACLA 4CT0A 4MS6A 4KT6B 2EQXA 4UWHA 1S0PA 1U3CA 3S2AA 1IHGA 3ML8A 4U04A 5J90A 3MX3A 5E75A 3ZGQA 3JYSA 3K9IA 4EBAG 4K0RA 4XE0A 5T4YA 3SNXA 3TG4A 3UPVA 2HM8A 4G1TA 5D0OD 3FU0A 4U0ZA 5JJTA 2RD0A 4R7LA 3ZYLA 3CHPA 2IONA 2PM7A 3FTSA 3CVXA 4WWNA 1Z6TA 1JUQA 3CHSA 3FUEA 4KXKB 3CHQA 3G2SA 3PNLB 4HOTA 3QWWA 3R7QA 4I6JA 3AS4A 5C1DA 3ZHEA 4WWOA 1BPOA 1EPUA 3FUKA 4GA2A 3UX4A 3VTYA 3P2BA 1NZNA 4EZKA 3PREA 4V3IA 1H2TC 5JHBA 4IYPA 3R9AB 4U8HA 5BV0A 3RK6A 3MCXA 3RO2A 4U63A 3ZYMA 4PS7A 2E0IA 3ZIMA 1IQRA 1HU3A 4JW1A 5EDSA 4HORA 2WQHA 3D9KA 3MEKA 1QQEA 3N71A 3VLDA 1PAQA 4B89A 4KYOB 3RRUA 4I2ZA 1WAO1 2KZTA 1HX8A 4J8DA 4XKCA 2XCBA 5FQ6A 3CK8A 4IN3B 4M3OA 3TJPA 1UN8A 2YNQA 3APFA 3SHFA 3LVRE 3ZFWA 3L17A 2XRYA 1NA3A 3MYVA 4I43A 4WUYA 5AJLA 4F1SA 3VTXA 4PUCA 2OV8A 2A4ZA 3EIQC 2I2OA 5A7DB 2FEZA 3D9LA 4GCOA 3CGHA 3SGHA 3UT8A 4DK5A 2XRZA 5KCMA 4XZ4A 2UY1B 3QARA 5D0QD 3U3WA 2PZIA 2V4LA 1JWFA 2AW6A 1GW6A 3AS5A 3HIZA 2BUGA 3EDTB 1E8XA 4L23A 4BFRA 4BT9A 2XCCA 4A3VA 4JC8A 4URKA 4GB9A 1H6KA 3G2TA 4N3CA 3S7BA 3T5XA 4YVOA 1WY6A 4APFA 4B8AA 4U07A 4CRWA 5AIJA 1A17A 3APDA 5G05C 3OXFA 2GRMA 5LX8A 4PDXA 2R5SA 4EECA 3IBEA 3HVEA 1N54A 5ENNA 1PY1A 4AV7A 4G11A 4QFVA 5BT1A 4JA9A 5G05J 3ZYKA 5HQ8A 3O48A 1L5JA 2PQNA 4JL0A 4OYSA 5FZSA 2XGMA 3GYZA 1Y6IA 2WXHA 3ASGA 2LO6A 3BG0B 4GYOA 5E76A 3AU4A 3G2UA 4F3VA 3CKCA 4LERA 2VSOE 3D9IA 3KS2A 3R7RA 5A6CA 1E8YA 3P1UA 4TV3A 1NA0A 4U0SA 4UQYA 2YHCA 3JQ1A 3LEWA 4MRUA 5CMYA 3FH7A 3U9WA 4B0ZA 1HH8A 2DIWA 4LRZA 4CDNA 1KT0A 3TXMA 1QNFA 3PE4A 2CHZA 4NURA 3NQPA 4I1AA 5KJNA 2Y4UA 2DBAA 3IKOB 2IOLA 3B13A 4JA7A 4KZCA 5FWQA 3CK9A 3FTVA 4LCTA 2BTDA 1UG3A 3QK0A 3CVYA 2Y4TA 4N3AA 4AY5A 4UI9K 4IULA 2XPIA 1Y8MA 3ZXSA 3L54A 2XGSA 2XQ0A 5JJ6A 3FU6A 3B7TA 3CLJA 3LJ3A 5DBKA 2VGXB 3Q49B 4HFGA 3FEXA 1FVHA 3IV0A 3U4TA 2WQ6A 4C0MA 2X6FA 2J4BA 3MA5A 1JPLA 5ARGA 3FH8A 3SI5A 4DLQA 4NACA 2CFUA 2V0PA 2WB2A 1E7VA 4WNDA 1IYGA 2J49A 3TAXA 4E6HA 3CHRA 2OVFA 3HYMB 4ANWA 2R17C 3E4BA 4KZ0A 5FJYA 3I5PA 1HG5A 3B7RL 2WVIA 3C98A 1JWGA 2ILRA 4JXTA 5ARFA 4AIFA 5KJKA 3ASHA 4HOUA 4YVQC 4WNFA 2WXJA 4UQZA 5FZRA 4I2WA 3SBSA 2VYIA 4TRQA 2LSVA 2UWJG 1LF8A 2WXKA 3FWVA 1ELWA 3I3NA 3I4RB 5T8IA 4N5CA 3JQ0A 4ANXA 3MKQA 4PS8A 4JVSA 3LKUA 2X6JA 2OOEA 4I1MA 1H2VC 3PS6A 3T5VA 2VTBA 1HXIA 1QZ2A 2XGOA 2JEKA 3BG1B 4JEUA 3RIBA 3Q15A 5CHEE 3ZW3A 4CT4A 2Q7FA 1SZAA 4GZ6A 5A23A 4Y6CA 2WXGA 5M72A 3FUJA 4ME2A 2CHWA 2KM4A 2FI7A 3ULQA 2FULA 2WXRA 3FTXA 4PH4B 3JCKC 2RG8A 3EHNA 4UWGA 4ANVA 4APOA 1KLXA 3FUMA 2J4DA 3ASFA 3QNKA 3CQGB 4I9EA 2UY1A 2FF4A 3FP3A 3NZSA 3HHMA 3TL5A 3WXXA 5FQ8A 4Q96A 3URZA 1DNPA 3I4GA 4J8EA 4GA0A 5G04C 5JHAA 4KMOA 3RRNB 5ANRA 2GRLA 3G2WA 3LCAA 1MHQA 3CEQA 3Q47B 3CK7A 4CDMA 4J8SA 2HYZA 3MV2B 4Y6WA 2IF4A 2X6IA 4H7XA 4JPSA 5G04J 4CGWA 1P5QA 1ZBPA 3IHVA 3UUXA 4GCNA 4OVVA 1E8WA 2AVPA 3RJVA 2MHKA 3CKBA 1UW4B 3RU0A 1ELRA 2YINA 4B8CB 3MZLB 3PVLA 3FU5A 3B7SA 2J9QA 3LS8A 4OVUA 4N2QA 3CHOA 3TXNA 2CG3A 4GA1A 3MGBA 3CVWA 3OXGA 3UMVA 3CIAA 2CHXA 3OXLA 4ILGA 3SFZA 4G24A 4ACKA 3D9PA 4N2SA 2VSXE 4ILHB 2WQ7A 3CSTA 3PUKA 5EX0A 4AEZC 2GW1A 4BX8A 2KATA 2BF0X 4FA6A 4MLPA 3APCA 4I6GA 3ZHEB 4LUNU 4BX9A 3FH5A 4G23A 3FDHA 3EHMA 3FFLA 1HG2A 3FHEA 3ML9A 3KD7A 1UJJA 3PEVB 4I6EA 4CDRA 4GMLA 2C0MA 3SZ7A 4GMJA 2MOWA 4FHKA 4GZ5A 4DJAA 2J08A 5LFAA 2WXFA 3CHMA 3IEGA 4EQFA 4L2YA 3O4ZA 3QOUA 4WWPA 2I9CA 2FO7A 4A1GA 4KBQA 4EZLA 2A5UA 3PZDA 2JLBA 4C9BB 4FU3A 4WNEA 3FUFA 5G2NA 1DVPA 1ELKA 2KZTB 4EBAA 2NSZA 4KVOA 4JHJA 4I1OB 3FU3A 3QKYA 4FP7A 4ATGA 2C0LA 2LSUA 3S7JA 4ANUA 1NP7A 1WM5A 2WXOA 3LY7A 4HS2A 4J6IA 2WXPA 3QAQA 1N52A 2AWIA 3MKRA 4ABNA 2IU1A 3ENEA 2VSNA 3PUJA 4JHRA 1X5BA 3LY8A 5FTPA 5JJ7A 4GZDA 3TGOA 3ZEFA 2ONDA 1EF1C 3CSFA 3NZUA 4L1BA 2CG2A 3VLEA 2WM9A 4HLEA 2M63A 2L0TB 1XGWA 1HO8A 4KVMA 1OWNA 3GW4A 4AVXA 2L6JA 4AXHA 5BPPA 3FUIA 4FLBA 4G25A 3CQCB 4UQXA 5KJMA 4L7TA 3CVUA 5T3RA 3CVVA 2VJ8A 3D9OA 4GZCA 2ZU6B 3FTZA 3HVEB 2QFCA 5LCWJ 1H2UA 2KCLA 4FLHA 4HXIA 3L16A 3D9NA 4F53A 4DI4A 5LOZA 1EYHA 2I6HA 2HR2A 2OVBA 3DBSA 4JZYA 5AJDA 2WMOA 1H19A 2IOSA 1UJKA 4BSXA 2X3MA 5EKQD 4W9RA 1Z3YA 2I1KA 2V5FA 4N39A 3B7UX 3D9MA 4BTBA 4E85A 3ZYQA 1E90A 4GAAA 3LDZA 4XIFA 3PH0C 3ZN3A 2Y3AA 1MQSA 4J0UA 1HF8A 2YQ8A 4G26A 3G2VA 3PNTB 4LEUA 1OWMA 3FUHA 4IRUA 5FZQA 3ESLA 1HE8A 2AXVA 3CVLA 3FUDA 4UI9C 1YA0A 4A55A 3Q4AB 2IQCA 2GGFA 3FTYA 4FHJA 1KT1A 4Q94A 5KJLA 1HZ4A 2AXUA 1INZA 3ZRHA 3RRMB 2R59A 2AXZA 5FQ4A 4UI9J 4FC8A 1H0AA 3FTUA 5FQ7A 3UT7A 1FVFA 4FULA 3PRZA 3CR3A 4K03A 4XX5A 1FCHA 4AY6A 2L0IA 3AU5A 2NC9A 3L22A 3FTWA 4WNGA 4F7AA 3DPDA 3L6AA 3FEYA 2XPYA 5CCMA 3KAEA 4GYYA 1VDYA 3PE3A 1ZU2A 1E8ZA 4C0EA 4BWRA 1PC2A 4O6FA 3GZ1A 4GZ3A 5J08A 2VSYA 2HO1A 5C2YA 1SZ9A 1HFAA 4WAFA 3LPZA 2KC7A 3BEEA 2QY7A 1TJCA 2VGYA 2VQ2A 5AENA 3RO3A 2WXLA 4UWKA 2XHEA 4GU5A 3HDXA 2IFUA 4TUUA 5AYWD 4CCAA 3GZSA 3MKQB 2WXNA 3EJNA 3SD5A 2FBNA 2KCKA 4PS3A 4BTAA 4CGVA 2VTBB 2J09A 2YHEA 4B94A 1E96B 3GZ2A 4ILIA 5LP0A 1SQMA 3L08A 4AJWA 4FJZA 4BT8A 1UN9A 4HOSA 4MKTA 1XNFA 4XKBA 4N3BA 2WXQA 1W3BA 3PEUB 4L2LA 2P58C 2DCPA 2WMNA 3U66A 3CVNA 3QC1A 4JEHA 3JUIA 3ZPJA 3QDNA 2X6HA 4BY6A 3ZVVA 3LVQE 3MV3B 5ANLA 3QB2A 3SF4A 4DLOA 3OTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKV A;  3Q5M A;  2VGX A;  3CVP A;  4YND A;  5EX3 A;  3ESK A;  4I17 A;  5DIZ A;  4XI9 A;  2LNI A;  2PQR A;  5CCL A;  4RG9 A;  3PDN A;  3QWP A;  4RG6 A;  2XEV A;  3NF1 A;  5BW8 C;  2WPV A;  3S7F A;  4H7Y A;  2KCV A;  4I9C A;  4HOQ A;  3CVQ A;  3LY9 A;  5HI7 A;  5BNW A;  4J8F A;  3AS8 A;  5LCW C;  4XI0 A;  2E2E A;  3TG5 A;  4G2V A;  4A1S A;  4NRH B;  4NQ0 A;  3S7D A;  4GPK A;  2PL2 A;  3UQ3 A;  4U0U A;  3QWV A;  2C2L A;  1OUV A;  4GYW A;  1B89 A;  3CV0 A;  3LYA A;  3ASD A;  5FT9 A;  4AM9 A;  1IHG A;  4U04 A;  3ZGQ A;  3JYS A;  3K9I A;  3TG4 A;  3UPV A;  4G1T A;  5D0O D;  4U0Z A;  5JJT A;  4KXK B;  4HOT A;  3QWW A;  3AS4 A;  5C1D A;  3ZHE A;  4GA2 A;  3VTY A;  1NZN A;  3R9A B;  3RO2 A;  4HOR A;  2WQH A;  3MEK A;  1QQE A;  3N71 A;  4KYO B;  4I2Z A;  1WAO 1;  4J8D A;  2XCB A;  3CK8 A;  4IN3 B;  3ZFW A;  1NA3 A;  4WUY A;  3VTX A;  5A7D B;  2FEZ A;  4GCO A;  2UY1 B;  5D0Q D;  3U3W A;  2PZI A;  3AS5 A;  2BUG A;  3EDT B;  4BT9 A;  2XCC A;  4N3C A;  3S7B A;  4YVO A;  4U07 A;  1A17 A;  5G05 C;  3OXF A;  2R5S A;  5BT1 A;  4JA9 A;  5G05 J;  5HQ8 A;  3O48 A;  2PQN A;  4JL0 A;  5FZS A;  2XGM A;  3GYZ A;  3ASG A;  4GYO A;  4F3V A;  3CKC A;  3KS2 A;  5A6C A;  1NA0 A;  4U0S A;  4UQY A;  2YHC A;  1HH8 A;  1KT0 A;  3PE4 A;  4I1A A;  5KJN A;  2Y4U A;  2DBA A;  4JA7 A;  3CK9 A;  2Y4T A;  4N3A A;  4AY5 A;  4UI9 K;  2XPI A;  1Y8M A;  2XGS A;  5JJ6 A;  5DBK A;  2VGX B;  3Q49 B;  3U4T A;  3MA5 A;  5ARG A;  4WND A;  1IYG A;  3TAX A;  3HYM B;  3E4B A;  5FJY A;  5KJK A;  5ARF A;  4AIF A;  3ASH A;  4HOU A;  4YVQ C;  4WNF A;  4UQZ A;  5FZR A;  4I2W A;  2VYI A;  2LSV A;  3FWV A;  2UWJ G;  1ELW A;  4N5C A;  3LKU A;  2OOE A;  1HXI A;  1QZ2 A;  2XGO A;  3RIB A;  3Q15 A;  5CHE E;  5M72 A;  2Q7F A;  4GZ6 A;  4Y6C A;  4ME2 A;  2FI7 A;  3ULQ A;  4APO A;  1KLX A;  3ASF A;  4I9E A;  2UY1 A;  2FF4 A;  3FP3 A;  3WXX A;  3URZ A;  4J8E A;  4GA0 A;  5G04 C;  3LCA A;  3CEQ A;  3Q47 B;  3CK7 A;  4Y6W A;  2HYZ A;  3MV2 B;  2IF4 A;  4H7X A;  5G04 J;  4CGW A;  1P5Q A;  1ZBP A;  3UUX A;  4GCN A;  2AVP A;  3RJV A;  2MHK A;  3CKB A;  3RU0 A;  1ELR A;  2J9Q A;  4N2Q A;  4GA1 A;  3OXG A;  3OXL A;  4G24 A;  4N2S A;  5EX0 A;  2GW1 A;  2KAT A;  3ZHE B;  4G23 A;  3FFL A;  3KD7 A;  4CDR A;  2C0M A;  3SZ7 A;  4GZ5 A;  3IEG A;  4EQF A;  3QOU A;  2FO7 A;  4KBQ A;  2JLB A;  4WNE A;  3QKY A;  2C0L A;  2LSU A;  3S7J A;  1WM5 A;  3LY7 A;  4ABN A;  3MKR A;  2VSN A;  4JHR A;  3LY8 A;  5FTP A;  5JJ7 A;  3TGO A;  2OND A;  3GW4 A;  2L6J A;  4G25 A;  4UQX A;  5KJM A;  2QFC A;  5LCW J;  2KCL A;  2I6H A;  2HR2 A;  5EKQ D;  4W9R A;  2V5F A;  4N39 A;  4BTB A;  4XIF A;  3ZN3 A;  4J0U A;  2YQ8 A;  4G26 A;  4LEU A;  5FZQ A;  3CVL A;  4UI9 C;  1YA0 A;  3Q4A B;  5KJL A;  1KT1 A;  1HZ4 A;  4UI9 J;  1FCH A;  4AY6 A;  2NC9 A;  4WNG A;  5CCM A;  3KAE A;  4GYY A;  3PE3 A;  1ZU2 A;  4BWR A;  1PC2 A;  4O6F A;  3GZ1 A;  4GZ3 A;  2VSY A;  2HO1 A;  3LPZ A;  2KC7 A;  3BEE A;  1TJC A;  2VGY A;  2VQ2 A;  3RO3 A;  2IFU A;  5AYW D;  4CGV A;  2FBN A;  2KCK A;  4BTA A;  4B94 A;  1E96 B;  3GZ2 A;  4BT8 A;  4HOS A;  1XNF A;  4N3B A;  1W3B A;  2P58 C;  3CVN A;  3ZPJ A;  3QDN A;  3MV3 B;  3SF4 A; 
#chains in the Genus database with same CATH topology
 3V2O A;  3CVP A;  2P9K G;  5BV1 A;  4I17 A;  2PM6 A;  4JHK A;  4XI9 A;  2WXM A;  3F6Q A;  3NF1 A;  3TWS A;  3DEP A;  3S7F A;  3HG0 D;  3T8M A;  2X6K A;  3LY9 A;  5HI7 A;  2RFM A;  4GTT A;  5BNW A;  4A3T A;  4DI3 A;  4HVB A;  2PNN A;  1S64 A;  4G2V A;  5AN8 A;  4NRH B;  1RW2 A;  2LAI A;  5CMW A;  3ONK A;  1TNZ A;  4AP2 A;  2EIL E;  3NB2 A;  1OWL A;  4UWF A;  1BU9 A;  4FAD A;  4AM9 A;  4O60 A;  4UWH A;  3ML8 A;  1UOH A;  5CRV A;  5ENP D;  3K9I A;  5CBN A;  5D0O D;  3FU0 A;  5JJT A;  3FTS A;  3FUE A;  1N0Q A;  4HOT A;  2IO2 C;  3R7Q A;  3HXF A;  4I6J A;  4DX2 A;  2A5E A;  3VTY A;  3P2B A;  1NZN A;  5HKP A;  4V3I A;  4IYP A;  4LG6 A;  5B1A E;  4U63 A;  3ZIM A;  1IQR A;  4HOR A;  2ZIR A;  4HBD A;  3MEK A;  1QQE A;  1N11 A;  3N71 A;  5EIL A;  3PZ3 A;  1PAQ A;  2KZT A;  4J8D A;  5CRU A;  1UN8 A;  2YNQ A;  1JCS A;  3APF A;  3SHF A;  3ZXP A;  3ZFW A;  4I43 A;  2A4Z A;  5B1B E;  3D9L A;  3ULY A;  5KCM A;  2V4L A;  1GW6 A;  3AS5 A;  3HIZ A;  4GTO A;  2BUG A;  1E8X A;  4U8V D;  4GB9 A;  3G2T A;  3APD A;  5D2M C;  5ENN A;  1PY1 A;  3W9F A;  3ZYK A;  2QYU A;  2XEH A;  2PQN A;  5JMN D;  5FZS A;  1Y6I A;  2WXH A;  4GYO A;  3CKC A;  3KS2 A;  3R7R A;  3P1U A;  3WG7 E;  2DIW A;  4NUR A;  4B93 B;  5KJN A;  4JA7 A;  3CK9 A;  3FTV A;  4LCT A;  2BTD A;  3QK0 A;  4UI9 K;  2XQ0 A;  5AQA A;  2WQ6 A;  3U4T A;  3ASN E;  3FH8 A;  2AJA A;  4RLY A;  2J49 A;  2OVF A;  4GTQ A;  4ANW A;  2P9U G;  3B7R L;  1JWG A;  3Q9U C;  4WNF A;  5FZR A;  3ZUV B;  3SBS A;  2VYI A;  5T8I A;  2B0O E;  2ZGG A;  4N5C A;  2X6J A;  2OOE A;  4GZ6 A;  5A23 A;  4Y6C A;  4ME2 A;  2DVW A;  2FUL A;  2H6F A;  5AQ9 A;  1OCZ E;  5BXU A;  1N94 A;  2UY1 A;  2FF4 A;  1FPP A;  2QC9 A;  4DX5 D;  1MHQ A;  5ENR D;  4Y6W A;  2HE0 A;  4GCN A;  1UW4 B;  4B8C B;  5BXO A;  3W9G A;  1H6O A;  2DWZ A;  4OVU A;  4N2Q A;  3TXN A;  2CG3 A;  3AAA C;  4U8Y D;  3B7B A;  4GTM A;  2VSX E;  2WQ7 A;  1OCR E;  3PUK A;  4LUN U;  5FIO A;  3EU5 A;  3EHM A;  4I6E A;  3KD7 A;  3AG1 E;  2C0M A;  5HS0 A;  3L82 A;  4FHK A;  5LFA A;  4EQF A;  3O4Z A;  4A1G A;  4EZL A;  1DVP A;  1NI1 A;  3TWX A;  4I1O B;  3DST A;  3FU3 A;  4ATG A;  3S7J A;  4ANU A;  4HS2 A;  4OAV B;  2WXP A;  4ABN A;  3MKR A;  2BED A;  3PUJ A;  4JHR A;  2VGE A;  4GZD A;  3EHQ A;  5AQ7 A;  2L0T B;  4FLB A;  3CQC B;  5KJM A;  4L7T A;  5KNG A;  4JB8 P;  1U2V G;  4FLH A;  5LOZ A;  2OVB A;  4JZY A;  3DBS A;  4BSX A;  4W9R A;  1Z3Y A;  2F8X K;  3V31 A;  1TNY A;  1QBQ A;  5CEA A;  3FUH A;  5EYL A;  3J5P A;  2EIM E;  1OCO E;  3DSU A;  1HZ4 A;  1INZ A;  3ZRH A;  3RRM B;  5FQ4 A;  1H0A A;  3FTU A;  1FVF A;  3Q78 A;  3CR3 A;  4XX5 A;  5ENQ D;  3L22 A;  1TN6 A;  4GTS A;  4GYY A;  3PE3 A;  4BWR A;  1PC2 A;  3GZ1 A;  2VSY A;  1SZ9 A;  3LPZ A;  2WXL A;  3HDX A;  5AYW D;  4CCA A;  3EJN A;  1KPS B;  4B94 A;  1E96 B;  1SQM A;  3L08 A;  4HOS A;  4N3B A;  2WXQ A;  3PEU B;  4L2L A;  2P58 C;  2XZD G;  3CVN A;  5KWD A;  4HQD A;  3ZVV A;  3QB2 A;  3SF4 A;  1OWP A;  3RKV A;  4U95 D;  4D10 C;  2V8S E;  3V79 K;  1WG0 A;  5B3S E;  5G55 A;  3PDN A;  3QWP A;  2NYJ A;  3KSQ A;  3UIN C;  2XEV A;  5BW8 C;  2WPV A;  1SA4 A;  2CFZ A;  3QJZ A;  3AS8 A;  4Z68 A;  2MRI A;  2L9B A;  4AOF A;  5LCW C;  3FY4 A;  3TG5 A;  3IHY A;  2MYO A;  2QYJ A;  3OAW A;  3DSS A;  3L13 A;  4HI9 A;  4Q69 A;  4QQI A;  3DEO A;  3KEZ A;  2PL2 A;  1OT8 A;  2XPZ A;  2C2L A;  2J07 A;  3CV0 A;  3ASD A;  2LUH A;  1TYQ G;  4MS6 A;  2EQX A;  1S0P A;  3S2A A;  1IHG A;  1OXJ A;  5E75 A;  3JYS A;  4OAU C;  3UM2 A;  3ABK E;  3E32 A;  3SNX A;  2HM8 A;  2RD0 A;  4R7L A;  3ZYL A;  2ION A;  3CVX A;  4GMR A;  4KXK B;  3CHQ A;  3G2S A;  3PNL B;  5EIB E;  1K3Z D;  2BKK B;  3TWU A;  4WWO A;  3E34 A;  4EZK A;  1H2T C;  5BV0 A;  3RK6 A;  3MCX A;  4PS7 A;  2E0I A;  2ETA A;  3D9K A;  2F37 A;  5FIN A;  2KBX A;  5CED B;  3T9K A;  3VLD A;  4I2Z A;  1WAO 1;  1HX8 A;  3DXK G;  4XKC A;  1TN8 A;  3UIP C;  1A5E A;  1S63 A;  4WUY A;  5AJL A;  1WDY A;  4PUC A;  3DSX A;  2FEZ A;  4GCO A;  4DK5 A;  2XRZ A;  2UY1 B;  2AW6 A;  3NOG D;  1BI8 B;  3AG3 E;  4CYM D;  4HLL A;  4URK A;  4N3C A;  1TNU A;  1YMP A;  3Q75 A;  3OXF A;  2GRM A;  4GPM A;  4G11 A;  4JA9 A;  3EU9 A;  3O48 A;  3ZKJ A;  5E76 A;  3AU4 A;  4F3V A;  4LER A;  3RAU A;  2VSO E;  5A6C A;  1NA0 A;  4U0S A;  3LEW A;  4B0Z A;  3FH7 A;  4UUC A;  3TXM A;  3PE4 A;  3JXJ A;  4YDW A;  2DBA A;  2IOL A;  3LJN A;  4K5A B;  3ZXS A;  2XGS A;  3CLJ A;  5DBK A;  3FEX A;  3IV0 A;  4C0M A;  3MA5 A;  1JPL A;  4J7W A;  4BER A;  1E7V A;  4WND A;  3HYM B;  2R17 C;  4KZ0 A;  3I5P A;  4JXT A;  5KJK A;  2WVI A;  2ILR A;  2WXJ A;  4G8L A;  1O5M A;  1D8D A;  3X2Q E;  4TRQ A;  2WXK A;  2P2C P;  4ANX A;  3PZ1 A;  4PS8 A;  1YCS B;  2GRP B;  3HXD A;  2JEK A;  3Q15 A;  5M72 A;  2CHW A;  2KM4 A;  2FI7 A;  2WXR A;  2RG8 A;  3E30 A;  3DRA A;  3QNK A;  1LD7 A;  1X81 A;  1Z5S C;  5FQ8 A;  4J8E A;  4GA0 A;  4KMO A;  5ANR A;  2GRL A;  4CDM A;  3TWQ A;  2DYS E;  2X6I A;  4GTR A;  5D66 A;  5EYP F;  1P5Q A;  2AVP A;  2GRN B;  3RJV A;  2MHK A;  3CKB A;  3PVL A;  2P9L G;  2J9Q A;  3CVW A;  3UMV A;  3CIA A;  2CHX A;  3DXM G;  3RSE G;  4G24 A;  3D9P A;  3V30 A;  5EX0 A;  2ZGD A;  4FA6 A;  4MLP A;  2FO1 E;  3FFL A;  4CDR A;  4A63 B;  1FT1 A;  4GML A;  1N95 A;  4GMJ A;  1K8K G;  4GZ5 A;  2WXF A;  1IXV A;  3QOU A;  4WWP A;  3TWT A;  4KBQ A;  3IXE A;  1RZ4 A;  4C9B B;  4FU3 A;  3FUF A;  5G2N A;  4LNB A;  4EBA A;  1IKN D;  2LSU A;  4J6I A;  2VSN A;  3UM1 A;  1EF1 C;  3NZU A;  3Q79 A;  1JCQ A;  3VLE A;  4HLE A;  3HRA A;  2M63 A;  2R03 A;  1HO8 A;  1OWN A;  3GW4 A;  4AVX A;  3FUI A;  4G25 A;  5T3R A;  3CVV A;  3D9O A;  3HVE B;  4DX6 D;  1EYH A;  4CZ2 D;  1H19 A;  2IOS A;  1UJK A;  1MYO A;  1KZP A;  3SY2 A;  2X3M A;  5EKQ D;  2V5F A;  4JD2 G;  4N39 A;  3B7U X;  1E90 A;  4GAA A;  3ZN3 A;  1HF8 A;  4DUI A;  2H6H A;  5H7P A;  3C3R A;  4IRU A;  3ESL A;  1O1T A;  2XEN A;  4UI9 C;  1TR4 A;  4A55 A;  2IQC A;  1KT1 A;  4UI9 J;  1NL4 A;  4O1P A;  3UT7 A;  2XZT G;  3FTW A;  3KAE A;  5CER B;  4O6F A;  3TWR A;  3ZNG A;  2HO1 A;  4WAF A;  1G3N B;  1HFA A;  3BEE A;  4UWK A;  2XHE A;  4TUU A;  3GZS A;  3MKQ B;  2WXN A;  1BLX B;  2J09 A;  4ILI A;  5LP0 A;  4HI8 A;  4ZFH A;  2Y1L E;  4MKT A;  1XNF A;  1W3B A;  2WMN A;  3U66 A;  3JUI A;  3E33 A;  4GTP A;  2X6H A;  4BES A;  3KEA A;  5ANL A;  4HRN A;  4DLO A;  3OTN A;  3E37 A;  4YND A;  5EX3 A;  2LNI A;  5CCL A;  4RG9 A;  1Z3X A;  2WXI A;  3TWW A;  3ONL A;  3MJW A;  1HS6 A;  1N4Q A;  2KCV A;  1O1S A;  4I9C A;  4MBG A;  2X38 A;  3SQV A;  2IJG X;  4J8F A;  1EDU A;  2I1J A;  1MX4 A;  4RSY A;  3VLF A;  1O1R A;  3B95 A;  2QZA A;  4XI0 A;  2E2E A;  3LXU X;  5AQB A;  5BUZ A;  2EIJ E;  2LAH A;  2NXP A;  4A1S A;  1K1B A;  3UT4 A;  1TEZ A;  3QWV A;  2GRR B;  3FUN A;  1OUV A;  1TJF A;  3SBT B;  4P29 A;  3EHR A;  3DPY A;  4LNG A;  4KT6 B;  2GRO B;  1U3C A;  4F6R D;  4U04 A;  5J90 A;  3MX3 A;  4EBA G;  4K0R A;  4XE0 A;  5T4Y A;  4G1T A;  3Q9N C;  5EID A;  1Z6T A;  2R2L A;  1JUQ A;  3CHS A;  1TN7 A;  5ITZ F;  3QWW A;  4BET A;  3UM0 A;  1EPU A;  1DCE A;  3L9T A;  5JHB A;  2IY0 C;  4U8H A;  3RO2 A;  3ZYM A;  4JW1 A;  5EDS A;  2B6C A;  3HXB A;  2XCB A;  5FQ6 A;  3CK8 A;  4IN3 B;  2P9N G;  3LVR E;  3L17 A;  2XRY A;  1NA3 A;  3MYV A;  3AG2 E;  4K5B A;  2OV8 A;  4J8Y A;  3CGH A;  1TNB A;  3NBN B;  4L23 A;  3Q73 A;  4APF A;  4BSZ B;  5G05 C;  2V4H C;  4U96 D;  5LX8 A;  1SA5 A;  4EEC A;  3ULE G;  3IBE A;  3HVE A;  2JAB A;  2OCC E;  4QFV A;  2EIK E;  5G05 J;  4OYS A;  4DX7 D;  3GYZ A;  2LO6 A;  3G2U A;  3D9I A;  4TV3 A;  2YHC A;  3JQ1 A;  3U9W A;  4CDN A;  1KT0 A;  1QNF A;  2CHZ A;  3NQP A;  2ZXW E;  4I1A A;  2Y4U A;  3IKO B;  4KZC A;  1UG3 A;  3CVY A;  1D8E A;  2Y4T A;  4AY5 A;  1LD8 A;  3FU6 A;  3LJ3 A;  2VGX B;  4GTV A;  4HFG A;  3TWV A;  1FVH A;  2X6F A;  5ARG A;  2CFU A;  2WB2 A;  1IYG A;  3TAX A;  4E6H A;  3CHR A;  3E4B A;  5ARF A;  3C98 A;  4AIF A;  3SFX A;  1AWC B;  1S70 B;  3UTM A;  4UQZ A;  3ISM C;  1LF8 A;  3FWV A;  2ETC A;  1ELW A;  1H6P A;  3MKQ A;  3LKU A;  4HB5 A;  4I1M A;  2L6B A;  4JEU A;  4CT4 A;  4YDY A;  2Q7F A;  2WXG A;  3ULQ A;  3FTX A;  3JCK C;  4UWG A;  4ANV A;  4APO A;  1KLX A;  2J4D A;  3ASF A;  3CQG B;  4I9E A;  3UIO C;  3HHM A;  3TL5 A;  1MZC A;  4Q96 A;  3URZ A;  1DNP A;  5G04 C;  3RRN B;  3G2W A;  2ZIS A;  3CK7 A;  3Q47 B;  2HYZ A;  2IF4 A;  4JPS A;  5G04 J;  4CGW A;  1ZBP A;  4OVV A;  2YIN A;  3FU5 A;  3B7S A;  3LS8 A;  5IY5 E;  3OXG A;  4U7E B;  2XS8 A;  3SFZ A;  4ACK A;  4N2S A;  4ILH B;  4AEZ C;  4BX8 A;  2BF0 X;  3NAW A;  3ZHE B;  4TXP A;  3FH5 A;  3FDH A;  1HG2 A;  3ML9 A;  3AJI A;  3NOC D;  2MOW A;  2J08 A;  4HRL A;  3CHM A;  1V54 E;  2I9C A;  2FO7 A;  3PZD A;  2BKG A;  4WNE A;  5KNH D;  1YYH A;  3Q7A A;  2OEW A;  2NSZ A;  4KVO A;  4YDO A;  2R02 A;  3QKY A;  2C0L A;  2WXO A;  1WM5 A;  1OY3 D;  3QAQ A;  1N52 A;  2AWI A;  3LY8 A;  3ZEF A;  2OND A;  3CSF A;  4TXQ A;  1MX6 A;  2WM9 A;  4KVM A;  4AXH A;  2L6J A;  2ETB A;  4UQX A;  5CEC B;  4GZC A;  2ZU6 B;  3FTZ A;  2QFC A;  1H2U A;  2KCL A;  3L16 A;  4ATZ D;  2I6H A;  2WMO A;  1K1A A;  2P9P G;  4E85 A;  3LDZ A;  2Y3A A;  1MQS A;  1BI7 B;  4BEP A;  3G2V A;  3PNT B;  4LEU A;  1OWM A;  3FUD A;  1YA0 A;  3Q4A B;  5KJL A;  2GGF A;  4FHJ A;  4Q94 A;  2R59 A;  2AXZ A;  4FC8 A;  3C5R A;  3PRZ A;  4K03 A;  1MX2 A;  4AY6 A;  2L0I A;  3AU5 A;  2NC9 A;  4F7A A;  3DPD A;  1E8Z A;  4C0E A;  4G8K A;  5J08 A;  3UXG A;  5C2Y A;  2KC7 A;  1TJC A;  2VGY A;  2VQ2 A;  5AEN A;  3RO3 A;  4GU5 A;  2IFU A;  2KCK A;  4BTA A;  2VTB B;  3GZ2 A;  4BT8 A;  4TXR A;  1SW6 A;  3C3Q A;  2DCP A;  2XS1 A;  3ZPJ A;  2V5Q C;  2LXL A;  3QDN A;  4BY6 A;  3MV3 B;  3DSV A;  1U3D A;  2VGX A;  3Q5M A;  4FJY A;  4DPR A;  3EIJ A;  3UI2 A;  3ESK A;  3U64 A;  5DIZ A;  4UWL A;  2PQR A;  4RG6 A;  1E7U A;  3DWL G;  5ENO D;  3D9J A;  4H7Y A;  4HOQ A;  3CVQ A;  4EPZ A;  4CEM A;  4EHM A;  4EZJ A;  3D3M A;  2DYR E;  3FUL A;  4RVB A;  1FT2 A;  1IQU A;  4NQ0 A;  3S7D A;  2DZO A;  4GPK A;  5AAO A;  3UQ3 A;  1JCR A;  4U0U A;  4XEI G;  4GYW A;  1OWO A;  1B89 A;  3LYA A;  4LNU D;  5FT9 A;  4ACL A;  4CT0 A;  2XEE A;  4HNA D;  5AAR A;  4K5C A;  3ZGQ A;  3TG4 A;  3UPV A;  4U0Z A;  5ENT D;  3CHP A;  2P9I G;  2PM7 A;  4WWN A;  3C3O A;  4F1P A;  3AS4 A;  5C1D A;  3ZHE A;  1BPO A;  3FUK A;  3UX4 A;  4GA2 A;  2Y0B G;  1Q2Z A;  4O1O A;  2EIN E;  3PRE A;  3R9A B;  1HU3 A;  2WQH A;  5KBA A;  4B89 A;  4KYO B;  3RRU A;  5EN5 D;  3TJP A;  2P9S G;  4M3O A;  4F1S A;  3VTX A;  1IHB A;  3EIQ C;  4NIK A;  2I2O A;  3PZ2 A;  5A7D B;  4N5Q A;  3PZ4 A;  3SGH A;  3UT8 A;  4XZ4 A;  3QAR A;  5D0Q D;  3U3W A;  2PZI A;  1JWF A;  2IEJ A;  3C72 A;  3EDT B;  3AG4 E;  2DZN A;  4YDE A;  4BFR A;  4BT9 A;  2XCC A;  4A3V A;  4JC8 A;  1H6K A;  3S7B A;  3T5X A;  4YVO A;  1WY6 A;  4B8A A;  4U07 A;  4CRW A;  5AIJ A;  1A17 A;  4PDX A;  2R5S A;  1N54 A;  4AV7 A;  5BT1 A;  3ABL E;  2H6I A;  4LSZ E;  5HQ8 A;  1L5J A;  4JL0 A;  3HXE A;  2XGM A;  3Q7F A;  3ASG A;  3BG0 B;  1E8Y A;  4UQY A;  5CMY A;  4MRU A;  1HH8 A;  4LRZ A;  5HRY A;  1D9S A;  3UKU G;  1N0R A;  3B13 A;  5FWQ A;  2F8Y A;  2RFA A;  4N3A A;  4IUL A;  2R05 A;  1Y8M A;  2XPI A;  3L54 A;  3T8K A;  5JJ6 A;  3B7T A;  3Q49 B;  3V2X A;  2J4B A;  3SI5 A;  4DLQ A;  4NAC A;  2V0P A;  5FJY A;  1HG5 A;  1AP7 A;  3ASH A;  4HOU A;  4YVQ C;  1DC2 A;  4L9P A;  4I2W A;  2LSV A;  2UWJ G;  3ZU7 B;  3I4R B;  3I3N A;  3JQ0 A;  4JVS A;  4C48 B;  1H2V C;  3PS6 A;  3T5V A;  2VTB A;  1HXI A;  1QZ2 A;  2XGO A;  3BG1 B;  3ZW3 A;  3RIB A;  5CHE E;  1SZA A;  3FUJ A;  2GRQ B;  4PH4 B;  2H6G A;  3EHN A;  1N9A A;  2J8S D;  3FUM A;  3R9M A;  1TNO A;  1ZB1 A;  3FP3 A;  3DSW A;  3NZS A;  2RKK A;  3WXX A;  4RQI A;  3I4G A;  5JHA A;  4DRX E;  3LCA A;  3CEQ A;  4J8S A;  3MV2 B;  4H7X A;  5ENS D;  3IHV A;  3UUX A;  1E8W A;  2KXP C;  1N4S A;  3RU0 A;  1ELR A;  3MZL B;  1N4P A;  3CHO A;  4GA1 A;  3MGB A;  3OXL A;  4ILG A;  1NFI E;  2F0Y A;  3CST A;  2GW1 A;  3BUA A;  2KAT A;  1N4R A;  3APC A;  4I6G A;  3JXI A;  4BX9 A;  4G23 A;  3KSL A;  3FHE A;  3PEV B;  1MJ0 A;  1UJJ A;  1DCQ A;  3SZ7 A;  3JUE A;  4DJA A;  3IEG A;  4L2Y A;  2A5U A;  2JLB A;  1ELK A;  2KZT B;  2IO3 C;  4JHJ A;  4FP7 A;  1NP7 A;  3LY7 A;  3UM3 A;  1LTX A;  2IU1 A;  3ASO E;  3ENE A;  1X5B A;  5FTP A;  5JJ7 A;  3TGO A;  3SFY A;  4L1B A;  2CG2 A;  3BQO A;  1XGW A;  5BPP A;  3CVU A;  4HRM B;  2VJ8 A;  4M7C A;  5LCW J;  2OEV A;  4HXI A;  3D9N A;  4F53 A;  4DI4 A;  2HR2 A;  5AJD A;  4DX1 A;  2I1K A;  3D9M A;  4BTB A;  3ZYQ A;  4XIF A;  3PH0 C;  1SVX A;  4J0U A;  2YQ8 A;  1V55 E;  4G26 A;  3D9H A;  2LXM A;  5FZQ A;  1HE8 A;  2AXV A;  3CVL A;  3FTY A;  1BD8 A;  1QYM A;  2AXU A;  2Y69 E;  3SO8 A;  5CBO A;  5FQ7 A;  5JA4 D;  4FUL A;  3EUV A;  1FCH A;  4WNG A;  3L6A A;  3FEY A;  2XPY A;  5CCM A;  1VDY A;  1ZU2 A;  4GZ3 A;  1KZO A;  2QY7 A;  4TUM A;  4X8Q A;  3SD5 A;  2FBN A;  4PS3 A;  4CGV A;  2YHE A;  4AJW A;  3ABM E;  3BU8 A;  4FJZ A;  1UN9 A;  4XKB A;  4ZHB A;  3UKR G;  3QC1 A;  4JEH A;  1OCC E;  3HXC A;  3LVQ E;  3J5Q B; 
#chains in the Genus database with same CATH homology
 1OWP A;  3RKV A;  3Q5M A;  1U3D A;  2VGX A;  3CVP A;  4FJY A;  4YND A;  3EIJ A;  4D10 C;  4DPR A;  5BV1 A;  2V8S E;  5EX3 A;  3ESK A;  4I17 A;  3U64 A;  2PM6 A;  4JHK A;  4UWL A;  4XI9 A;  5DIZ A;  2WXM A;  2LNI A;  5G55 A;  2PQR A;  5CCL A;  4RG9 A;  3PDN A;  1Z3X A;  3QWP A;  4RG6 A;  2WXI A;  1E7U A;  3ONL A;  2XEV A;  3NF1 A;  3D9J A;  3MJW A;  1HS6 A;  5BW8 C;  2WPV A;  3S7F A;  4H7Y A;  2CFZ A;  2KCV A;  4I9C A;  3T8M A;  2X6K A;  3CVQ A;  3LY9 A;  2X38 A;  4HOQ A;  5HI7 A;  3QJZ A;  2IJG X;  3AS8 A;  4J8F A;  4EPZ A;  5BNW A;  1EDU A;  2MRI A;  2I1J A;  4CEM A;  4RSY A;  3VLF A;  4A3T A;  2L9B A;  4AOF A;  4EZJ A;  5LCW C;  3FY4 A;  3D3M A;  2E2E A;  3LXU X;  4XI0 A;  4DI3 A;  3TG5 A;  3IHY A;  4HVB A;  5BUZ A;  2LAH A;  3OAW A;  3FUL A;  4G2V A;  2NXP A;  4A1S A;  4NRH B;  4RVB A;  2LAI A;  3UT4 A;  5CMW A;  1TEZ A;  1IQU A;  3L13 A;  4NQ0 A;  4Q69 A;  3S7D A;  3KEZ A;  3ONK A;  4GPK A;  2PL2 A;  3UQ3 A;  4AP2 A;  4U0U A;  3QWV A;  2XPZ A;  3FUN A;  2C2L A;  1OUV A;  4GYW A;  1TJF A;  2J07 A;  1OWO A;  3SBT B;  1B89 A;  1OWL A;  4UWF A;  4P29 A;  3CV0 A;  3LYA A;  3ASD A;  5FT9 A;  4FAD A;  4AM9 A;  4ACL A;  4CT0 A;  4MS6 A;  4KT6 B;  2EQX A;  4UWH A;  1S0P A;  1U3C A;  3S2A A;  1IHG A;  3ML8 A;  4U04 A;  5J90 A;  3MX3 A;  5E75 A;  3ZGQ A;  3JYS A;  3K9I A;  4EBA G;  4K0R A;  4XE0 A;  5T4Y A;  3SNX A;  3TG4 A;  3UPV A;  2HM8 A;  4G1T A;  5D0O D;  3FU0 A;  4U0Z A;  5JJT A;  2RD0 A;  4R7L A;  3ZYL A;  3CHP A;  2ION A;  2PM7 A;  3FTS A;  3CVX A;  4WWN A;  1Z6T A;  1JUQ A;  3CHS A;  3FUE A;  4KXK B;  3CHQ A;  3G2S A;  3PNL B;  4HOT A;  3QWW A;  3R7Q A;  4I6J A;  3AS4 A;  5C1D A;  3ZHE A;  4WWO A;  1BPO A;  1EPU A;  3FUK A;  4GA2 A;  3UX4 A;  3VTY A;  3P2B A;  1NZN A;  4EZK A;  3PRE A;  4V3I A;  1H2T C;  5JHB A;  4IYP A;  3R9A B;  4U8H A;  5BV0 A;  3RK6 A;  3MCX A;  3RO2 A;  4U63 A;  3ZYM A;  4PS7 A;  2E0I A;  3ZIM A;  1IQR A;  1HU3 A;  4JW1 A;  5EDS A;  4HOR A;  2WQH A;  3D9K A;  3MEK A;  1QQE A;  3N71 A;  3VLD A;  1PAQ A;  4B89 A;  4KYO B;  3RRU A;  4I2Z A;  1WAO 1;  2KZT A;  1HX8 A;  4J8D A;  4XKC A;  2XCB A;  5FQ6 A;  3CK8 A;  4IN3 B;  4M3O A;  3TJP A;  1UN8 A;  2YNQ A;  3APF A;  3SHF A;  3LVR E;  3ZFW A;  3L17 A;  2XRY A;  1NA3 A;  3MYV A;  4I43 A;  4WUY A;  5AJL A;  4F1S A;  3VTX A;  4PUC A;  2OV8 A;  2A4Z A;  3EIQ C;  2I2O A;  5A7D B;  2FEZ A;  3D9L A;  4GCO A;  3CGH A;  3SGH A;  3UT8 A;  4DK5 A;  2XRZ A;  5KCM A;  4XZ4 A;  2UY1 B;  3QAR A;  5D0Q D;  3U3W A;  2PZI A;  2V4L A;  1JWF A;  2AW6 A;  1GW6 A;  3AS5 A;  3HIZ A;  2BUG A;  3EDT B;  1E8X A;  4L23 A;  4BFR A;  4BT9 A;  2XCC A;  4A3V A;  4JC8 A;  4URK A;  4GB9 A;  1H6K A;  3G2T A;  4N3C A;  3S7B A;  3T5X A;  4YVO A;  1WY6 A;  4APF A;  4B8A A;  4U07 A;  4CRW A;  5AIJ A;  1A17 A;  3APD A;  5G05 C;  3OXF A;  2GRM A;  5LX8 A;  4PDX A;  2R5S A;  4EEC A;  3IBE A;  3HVE A;  1N54 A;  5ENN A;  1PY1 A;  4AV7 A;  4G11 A;  4QFV A;  5BT1 A;  4JA9 A;  5G05 J;  3ZYK A;  5HQ8 A;  3O48 A;  1L5J A;  2PQN A;  4JL0 A;  4OYS A;  5FZS A;  2XGM A;  3GYZ A;  1Y6I A;  2WXH A;  3ASG A;  2LO6 A;  3BG0 B;  4GYO A;  5E76 A;  3AU4 A;  3G2U A;  4F3V A;  3CKC A;  4LER A;  2VSO E;  3D9I A;  3KS2 A;  3R7R A;  5A6C A;  1E8Y A;  3P1U A;  4TV3 A;  1NA0 A;  4U0S A;  4UQY A;  2YHC A;  3JQ1 A;  3LEW A;  4MRU A;  5CMY A;  3FH7 A;  3U9W A;  4B0Z A;  1HH8 A;  2DIW A;  4LRZ A;  4CDN A;  1KT0 A;  3TXM A;  1QNF A;  3PE4 A;  2CHZ A;  4NUR A;  3NQP A;  4I1A A;  5KJN A;  2Y4U A;  2DBA A;  3IKO B;  2IOL A;  3B13 A;  4JA7 A;  4KZC A;  5FWQ A;  3CK9 A;  3FTV A;  4LCT A;  2BTD A;  1UG3 A;  3QK0 A;  3CVY A;  2Y4T A;  4N3A A;  4AY5 A;  4UI9 K;  4IUL A;  2XPI A;  1Y8M A;  3ZXS A;  3L54 A;  2XGS A;  2XQ0 A;  5JJ6 A;  3FU6 A;  3B7T A;  3CLJ A;  3LJ3 A;  5DBK A;  2VGX B;  3Q49 B;  4HFG A;  3FEX A;  1FVH A;  3IV0 A;  3U4T A;  2WQ6 A;  4C0M A;  2X6F A;  2J4B A;  3MA5 A;  1JPL A;  5ARG A;  3FH8 A;  3SI5 A;  4DLQ A;  4NAC A;  2CFU A;  2V0P A;  2WB2 A;  1E7V A;  4WND A;  1IYG A;  2J49 A;  3TAX A;  4E6H A;  3CHR A;  2OVF A;  3HYM B;  4ANW A;  2R17 C;  3E4B A;  4KZ0 A;  5FJY A;  3I5P A;  1HG5 A;  3B7R L;  2WVI A;  3C98 A;  1JWG A;  2ILR A;  4JXT A;  5ARF A;  4AIF A;  5KJK A;  3ASH A;  4HOU A;  4YVQ C;  4WNF A;  2WXJ A;  4UQZ A;  5FZR A;  4I2W A;  3SBS A;  2VYI A;  4TRQ A;  2LSV A;  2UWJ G;  1LF8 A;  2WXK A;  3FWV A;  1ELW A;  3I3N A;  3I4R B;  5T8I A;  4N5C A;  3JQ0 A;  4ANX A;  3MKQ A;  4PS8 A;  4JVS A;  3LKU A;  2X6J A;  2OOE A;  4I1M A;  1H2V C;  3PS6 A;  3T5V A;  2VTB A;  1HXI A;  1QZ2 A;  2XGO A;  2JEK A;  3BG1 B;  4JEU A;  3RIB A;  3Q15 A;  5CHE E;  3ZW3 A;  4CT4 A;  2Q7F A;  1SZA A;  4GZ6 A;  5A23 A;  4Y6C A;  2WXG A;  5M72 A;  3FUJ A;  4ME2 A;  2CHW A;  2KM4 A;  2FI7 A;  3ULQ A;  2FUL A;  2WXR A;  3FTX A;  4PH4 B;  3JCK C;  2RG8 A;  3EHN A;  4UWG A;  4ANV A;  4APO A;  1KLX A;  3FUM A;  2J4D A;  3ASF A;  3QNK A;  3CQG B;  4I9E A;  2UY1 A;  2FF4 A;  3FP3 A;  3NZS A;  3HHM A;  3TL5 A;  3WXX A;  5FQ8 A;  4Q96 A;  3URZ A;  1DNP A;  3I4G A;  4J8E A;  4GA0 A;  5G04 C;  5JHA A;  4KMO A;  3RRN B;  5ANR A;  2GRL A;  3G2W A;  3LCA A;  1MHQ A;  3CEQ A;  3Q47 B;  3CK7 A;  4CDM A;  4J8S A;  2HYZ A;  3MV2 B;  4Y6W A;  2IF4 A;  2X6I A;  4H7X A;  4JPS A;  5G04 J;  4CGW A;  1P5Q A;  1ZBP A;  3IHV A;  3UUX A;  4GCN A;  4OVV A;  1E8W A;  2AVP A;  3RJV A;  2MHK A;  3CKB A;  1UW4 B;  3RU0 A;  1ELR A;  2YIN A;  4B8C B;  3MZL B;  3PVL A;  3FU5 A;  3B7S A;  2J9Q A;  3LS8 A;  4OVU A;  4N2Q A;  3CHO A;  3TXN A;  2CG3 A;  4GA1 A;  3MGB A;  3CVW A;  3OXG A;  3UMV A;  3CIA A;  2CHX A;  3OXL A;  4ILG A;  3SFZ A;  4G24 A;  4ACK A;  3D9P A;  4N2S A;  2VSX E;  4ILH B;  2WQ7 A;  3CST A;  3PUK A;  5EX0 A;  4AEZ C;  2GW1 A;  4BX8 A;  2KAT A;  2BF0 X;  4FA6 A;  4MLP A;  3APC A;  4I6G A;  3ZHE B;  4LUN U;  4BX9 A;  3FH5 A;  4G23 A;  3FDH A;  3EHM A;  3FFL A;  1HG2 A;  3FHE A;  3ML9 A;  3KD7 A;  1UJJ A;  3PEV B;  4I6E A;  4CDR A;  4GML A;  2C0M A;  3SZ7 A;  4GMJ A;  2MOW A;  4FHK A;  4GZ5 A;  4DJA A;  2J08 A;  5LFA A;  2WXF A;  3CHM A;  3IEG A;  4EQF A;  4L2Y A;  3O4Z A;  3QOU A;  4WWP A;  2I9C A;  2FO7 A;  4A1G A;  4KBQ A;  4EZL A;  2A5U A;  3PZD A;  2JLB A;  4C9B B;  4FU3 A;  4WNE A;  3FUF A;  5G2N A;  1DVP A;  1ELK A;  2KZT B;  4EBA A;  2NSZ A;  4KVO A;  4JHJ A;  4I1O B;  3FU3 A;  3QKY A;  4FP7 A;  4ATG A;  2C0L A;  2LSU A;  3S7J A;  4ANU A;  1NP7 A;  1WM5 A;  2WXO A;  3LY7 A;  4HS2 A;  4J6I A;  2WXP A;  3QAQ A;  1N52 A;  2AWI A;  3MKR A;  4ABN A;  2IU1 A;  3ENE A;  2VSN A;  3PUJ A;  4JHR A;  1X5B A;  3LY8 A;  5FTP A;  5JJ7 A;  4GZD A;  3TGO A;  3ZEF A;  2OND A;  1EF1 C;  3CSF A;  3NZU A;  4L1B A;  2CG2 A;  3VLE A;  2WM9 A;  4HLE A;  2M63 A;  2L0T B;  1XGW A;  1HO8 A;  4KVM A;  1OWN A;  3GW4 A;  4AVX A;  2L6J A;  4AXH A;  5BPP A;  3FUI A;  4FLB A;  4G25 A;  3CQC B;  4UQX A;  5KJM A;  4L7T A;  3CVU A;  5T3R A;  3CVV A;  2VJ8 A;  3D9O A;  4GZC A;  2ZU6 B;  3FTZ A;  3HVE B;  2QFC A;  5LCW J;  1H2U A;  2KCL A;  4FLH A;  4HXI A;  3L16 A;  3D9N A;  4F53 A;  4DI4 A;  5LOZ A;  1EYH A;  2I6H A;  2HR2 A;  2OVB A;  3DBS A;  4JZY A;  5AJD A;  2WMO A;  1H19 A;  2IOS A;  1UJK A;  4BSX A;  2X3M A;  5EKQ D;  4W9R A;  1Z3Y A;  2I1K A;  2V5F A;  4N39 A;  3B7U X;  3D9M A;  4BTB A;  4E85 A;  3ZYQ A;  1E90 A;  4GAA A;  3LDZ A;  4XIF A;  3PH0 C;  3ZN3 A;  2Y3A A;  1MQS A;  4J0U A;  1HF8 A;  2YQ8 A;  4G26 A;  3G2V A;  3PNT B;  4LEU A;  1OWM A;  3FUH A;  4IRU A;  5FZQ A;  3ESL A;  1HE8 A;  2AXV A;  3CVL A;  3FUD A;  4UI9 C;  1YA0 A;  4A55 A;  3Q4A B;  2IQC A;  2GGF A;  3FTY A;  4FHJ A;  1KT1 A;  4Q94 A;  5KJL A;  1HZ4 A;  2AXU A;  1INZ A;  3ZRH A;  3RRM B;  2R59 A;  2AXZ A;  5FQ4 A;  4UI9 J;  4FC8 A;  1H0A A;  3FTU A;  5FQ7 A;  3UT7 A;  1FVF A;  4FUL A;  3PRZ A;  3CR3 A;  4K03 A;  4XX5 A;  1FCH A;  4AY6 A;  2L0I A;  3AU5 A;  2NC9 A;  3L22 A;  3FTW A;  4WNG A;  4F7A A;  3DPD A;  3L6A A;  3FEY A;  2XPY A;  5CCM A;  3KAE A;  4GYY A;  1VDY A;  3PE3 A;  1ZU2 A;  1E8Z A;  4C0E A;  4BWR A;  1PC2 A;  4O6F A;  3GZ1 A;  4GZ3 A;  5J08 A;  2VSY A;  2HO1 A;  5C2Y A;  1SZ9 A;  1HFA A;  4WAF A;  3LPZ A;  2KC7 A;  3BEE A;  2QY7 A;  1TJC A;  2VGY A;  2VQ2 A;  5AEN A;  3RO3 A;  2WXL A;  4UWK A;  2XHE A;  4GU5 A;  3HDX A;  2IFU A;  4TUU A;  5AYW D;  4CCA A;  3GZS A;  3MKQ B;  2WXN A;  3EJN A;  3SD5 A;  2FBN A;  2KCK A;  4PS3 A;  4BTA A;  4CGV A;  2VTB B;  2J09 A;  2YHE A;  4B94 A;  1E96 B;  3GZ2 A;  4ILI A;  5LP0 A;  1SQM A;  3L08 A;  4AJW A;  4FJZ A;  4BT8 A;  1UN9 A;  4HOS A;  4MKT A;  1XNF A;  4XKB A;  4N3B A;  2WXQ A;  1W3B A;  3PEU B;  4L2L A;  2P58 C;  2DCP A;  2WMN A;  3U66 A;  3CVN A;  3QC1 A;  4JEH A;  3JUI A;  3ZPJ A;  3QDN A;  2X6H A;  4BY6 A;  3ZVV A;  3LVQ E;  3MV3 B;  5ANL A;  3QB2 A;  3SF4 A;  4DLO A;  3OTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...