1XGWA

The crystal structure of human enthoprotin n-terminal domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
VVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin 4
publication title The crystal structure of human enthoprotin N-terminal domain
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 51
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1xgwA00
4HFGA 1EDUA 1JWFA 1H0AA 2L0IA 1HX8A 2DCPA 1UJJA 3G2WA 3ONLA 2LO6A 2V8SE 3CLJA 3RRUA 2BF0X 3D9OA 1SZAA 3G2VA 3ZYMA 1EYHA 5LOZA 3ZYKA 5LP0A 3D9PA 3G2UA 1ELKA 2KM4A 3D9IA 2QY7A 4Q94A 1VDYA 1JWGA 1HF8A 3G2TA 3ZYLA 4NACA 1HFAA 5J08A 1LF8A 1SZ9A 3D9MA 4JXTA 4AVXA 3ONKA 1DVPA 4GZCA 4Q96A 4FLBA 1JUQA 3D9KA 3D9LA 3D9NA 4FU3A 1HG2A 1X5BA 1JPLA 1PY1A 5CMYA 1HG5A 2L0TB 3ZYQA 1XGWA 3G2SA 2DIWA 3D9JA 5CMWA 1UJKA 1MHQA 2MOWA 1INZA 4GZDA 3LDZA
chains in the Genus database with same CATH superfamily
2B6CA 3G2WA 4DUIA 2V8SE 4KZ0A 4URKA 5DBKA 3PRZA 4GU5A 5KJNA 4FLBA 2HO1A 4L2YA 2E0IA 5CEDB 2IF4A 4GB9A 3W9FA 1TN6A 2R05A 3Q49B 2WQ6A 3D9OA 3BG1B 3EU5A 3ZNGA 2R17C 3AG4E 1TYQG 3UI2A 4BX9A 5AARA 4UWKA 1H6OA 5ARGA 1NI1A 2LNIA 4G8LA 2XRZA 4ILHB 2PM6A 4XZ4A 2F8YA 4I2WA 1WM5A 1UN9A 4CRWA 3I3NA 2KBXA 3ABKE 3B7SA 4EBAG 3UM3A 3ESLA 1HU3A 2IQCA 1ZU2A 2XS8A 1N0RA 2WB2A 2VSOE 4FP7A 3TXMA 1LD7A 3CVWA 1BLXB 4GCOA 3CHQA 4JHRA 5BW8C 4XKCA 3KS2A 3GZSA 1BI8B 3PS6A 4RVBA 1RZ4A 1P5QA 4ANVA 2PNNA 3C72A 4GTRA 2PQRA 4GTOA 1OXJA 3CVLA 4I1MA 2LSVA 3QARA 2WQHA 4O6FA 2H6FA 3ASFA 4GCNA 4CDNA 1D8DA 2GROB 4JHKA 5FT9A 5JJTA 3JYSA 5DIZA 3AG3E 4I6EA 1PY1A 2I2OA 5CRUA 1NA3A 1WY6A 3LVRE 2QYJA 3FH5A 4GYOA 1WG0A 3HVEA 2LSUA 4ILGA 2QFCA 3VTYA 4J8FA 5BXUA 4GA2A 3HIZA 3RO2A 3EDTB 4L7TA 3UINC 3FH8A 2VYIA 2VSXE 2BUGA 2M63A 3ONLA 2R59A 3SY2A 2WXMA 3ZW3A 3LPZA 3PDNA 3B7UX 4NIKA 2RFAA 2J4BA 3FDHA 2IONA 1IQUA 1O1TA 3RO3A 1ELWA 3IBEA 3MV3B 4GZCA 4PS7A 3RK6A 1OWNA 4GPKA 3L22A 3QWVA 4K5AB 2UY1A 5AQAA 1D9SA 3BEEA 3GW4A 4BY6A 4ATGA 1N95A 3E33A 1EF1C 4HS2A 2VGXB 3ASOE 4L1BA 3ZYLA 4I9EA 1TN7A 1K1AA 3PZ2A 3FFLA 4GYWA 1NP7A 1WDYA 4Y6WA 3DWLG 4ATZD 4FHKA 2WXIA 5LFAA 3I5PA 3QC1A 3RJVA 4WAFA 4DRXE 4F1SA 2H6HA 2KM4A 3CQCB 1AP7A 3JUEA 3RSEG 5AQ9A 4NQ0A 3FUHA 3HXDA 5HS0A 2XEHA 4ME2A 3FUNA 1N4RA 3GYZA 1TJCA 1KT1A 3MV2B 3PE4A 3CQGB 1KZPA 4WWPA 4GPMA 3U4TA 4DJAA 1PAQA 3KSQA 5JHAA 2OEVA 4K5CA 4PS3A 3UM2A 3CR3A 3Q73A 1D8EA 2KATA 2DZNA 2BTDA 2H6IA 2VGYA 4J0UA 5B1BE 4LNBA 2RKKA 3UQ3A 3LCAA 3QNKA 1UW4B 4LEUA 3FU0A 3L13A 3FU5A 2KXPC 2DCPA 2R5SA 4N3AA 4CGVA 1PC2A 3G2UA 3DEPA 5EDSA 2VTBB 3IXEA 2A5EA 4HXIA 5D0OD 1Z3XA 4MS6A 4AOFA 1XGWA 5HQ8A 3PUKA 2QYUA 5FZQA 2F8XK 4I43A 3Q7FA 4BESA 2Y69E 3R7RA 4EBAA 5FIOA 5JHBA 3U64A 2IOLA 3TAXA 2KCKA 1FPPA 2DYRE 3DSVA 4JA9A 4G25A 2Y4UA 4LCTA 4UWGA 4N3BA 4U96D 2KZTA 4ANWA 1KPSB 3D3MA 5KWDA 3D9KA 3ASHA 5EILA 4WNFA 3KEAA 4P29A 4A3VA 1MX6A 1L5JA 4HVBA 1KLXA 3QAQA 1OWOA 3V30A 2X3MA 4WWNA 4OVUA 4ANXA 2VSNA 3DRAA 4KBQA 2EIKE 4G24A 2OOEA 3ZRHA 1DNPA 2PQNA 2CHWA 3TWQA 4LUNU 2F0YA 4ZFHA 2YHCA 4JA7A 3CVUA 1HXIA 5A7DB 1YA0A 2WQ7A 3E34A 5T3RA 2OEWA 1Z3YA 1H6PA 2XZDG 4M7CA 5HRYA 3S7JA 4B8CB 3LXUX 1S64A 4YDOA 2B0OE 3CLJA 4ACLA 2IO2C 3D9PA 1S63A 1DCEA 2L6JA 3NZSA 2FF4A 4AVXA 1A5EA 4BT8A 3ZPJA 3JXIA 3SO8A 4WNEA 2P9NG 2ZIRA 4HORA 3CVPA 5B3SE 2WXGA 3ZIMA 2I1KA 3OXGA 4F6RD 3FTXA 3NOGD 3ASNE 2E2EA 5CECB 1N4SA 4MBGA 1JPLA 3AS5A 3TWRA 3JXJA 1TR4A 3R7QA 3RU0A 5KCMA 1U2VG 1B89A 1NZNA 4L2LA 5D0QD 5ITZF 2J9QA 4HI8A 3HHMA 2YINA 4CT0A 5EX0A 4C9BB 1Q2ZA 1N11A 4BTBA 3DSTA 5FQ6A 3Q15A 5ARFA 3UXGA 2L0TB 3QWPA 1FT1A 2CHXA 4XKBA 2WXOA 1IKND 3FWVA 2FO7A 4Q94A 3CHRA 3AU4A 4OAVB 3ONKA 2C2LA 2I1JA 3IHYA 3U66A 4GZ3A 3FUMA 3X2QE 1QNFA 4APOA 3BG0B 4UI9C 4A1SA 3J5PA 1SA5A 1V55E 3F6QA 1FVHA 2X6KA 3HXFA 1EPUA 1X5BA 2KCVA 3E37A 1BPOA 1Y6IA 3LYAA 5ENTD 2BKKB 3ML8A 2I9CA 4GA0A 4K03A 5JA4D 2QC9A 1IQRA 4H7YA 3UIOC 3UTMA 5BXOA 3NOCD 2CFZA 2X6JA 4U95D 4JB8P 4MLPA 4HLLA 4MKTA 4RSYA 4LERA 4XX5A 3UKUG 2V4HC 3Q5MA 4HRNA 2L0IA 3ZHEB 5ENPD 2IJGX 2R03A 3GZ2A 5CBNA 3U3WA 3LS8A 5EX3A 3ZN3A 3LVQE 1IHGA 1LF8A 4XIFA 4U63A 3AS8A 3RRMB 3PZ4A 2BKGA 3DBSA 3SHFA 3AJIA 5EKQD 1W3BA 1E8WA 3GZ1A 2V5QC 4FHJA 1INZA 1WAO1 2LXLA 1SZAA 1N9AA 4JC8A 4I6JA 2P58C 2WM9A 3T8KA 4CEMA 3UT7A 3FUIA 4GTPA 5H7PA 3FUEA 5CERB 3PUJA 3PZ1A 2WVIA 4JHJA 2WPVA 3PH0C 2XPYA 3FTSA 3TWTA 1OCCE 2J4DA 2JABA 4U8YD 2XPIA 4F1PA 5JMND 3IKOB 4F7AA 4NACA 3EIJA 4AIFA 4UI9J 3ABME 5ENOD 4GTMA 2FBNA 2WXJA 3AU5A 3ZYMA 3FUKA 4HB5A 3ENEA 2VGXA 3DXKG 3PEVB 4HQDA 3JCKC 2I6HA 2X6HA 4HOTA 3L08A 3K9IA 4QQIA 4AY6A 2LAIA 2XGOA 3FUFA 1N54A 4Q69A 3APCA 2F37A 4APFA 2WXKA 4ACKA 1O1SA 3L9TA 3Q4AB 1U3CA 1QBQA 3EHQA 1OCRE 5ANLA 3FH7A 5KJMA 4JPSA 4Z68A 3S7FA 1E96B 2QZAA 3QDNA 3T5VA 3D9IA 3NBNB 3AS4A 2WXRA 4AV7A 4O1PA 4CDMA 1ELRA 3RAUA 4UWHA 3SI5A 3SD5A 4ILIA 3LJNA 3KAEA 3CV0A 3ML9A 1ZBPA 2WXLA 4DI3A 2JLBA 2IU1A 2MRIA 2J07A 4B0ZA 3UT8A 4CGWA 3E30A 1AWCB 3ZGQA 2VTBA 3ZXPA 3C3QA 4AJWA 3LEWA 2P9KG 4GMRA 2EIJE 2XEVA 2MOWA 2XS1A 3KD7A 4GYYA 4JW1A 4TUMA 4HOQA 2CFUA 1S0PA 5FQ7A 5CCMA 2L9BA 4QFVA 1H19A 3PE3A 4RG6A 4JEUA 5EIBE 1MZCA 3Q7AA 1BI7B 5JJ7A 2DYSE 2P9LG 2GRQB 4OVVA 1H2UA 4N5CA 5KJLA 3PZ3A 1OWMA 4V3IA 3QJZA 4I1AA 4DI4A 4L23A 2WXQA 4LRZA 3SZ7A 3EHMA 3LJ3A 3NAWA 1FCHA 3VLDA 4G8KA 3V31A 3DPYA 2WMNA 4TV3A 3CK7A 2VSYA 4BETA 5AIJA 4JVSA 3FTZA 4PDXA 1HX8A 2Y4TA 4E6HA 5FINA 5J90A 3MCXA 5AJLA 2RD0A 3EIQC 3MX3A 1OWPA 4J8EA 4RLYA 1K1BA 2RFMA 3FHEA 4L9PA 4WNGA 2OCCE 4N5QA 1OWLA 5AAOA 4B93B 4IYPA 4UUCA 4U04A 3MJWA 2KC7A 2XEEA 3DPDA 4HNAD 4AY5A 1IYGA 1XNFA 3O4ZA 2ETAA 2OV8A 3L82A 3B7TA 2R2LA 5KNGA 2NXPA 4GAAA 2X38A 3S7BA 2CHZA 3D9MA 2PM7A 5EYPF 3FU3A 2AXUA 2HM8A 5CMWA 2VGEA 1SW6A 4U0SA 1U3DA 2IO3C 2NC9A 3DSUA 1OT8A 2NYJA 5FTPA 2KCLA 3OAWA 2YHEA 1V54E 3HDXA 4F3VA 3APFA 3W9GA 4BT9A 4KVMA 3L16A 4FULA 3TXNA 4FLHA 3TWWA 1JCQA 5BV0A 3B7BA 4GMJA 1E7UA 5C2YA 2GGFA 2GRPB 3B7RL 2MYOA 3SF4A 5LCWC 1O5MA 2WXNA 2NSZA 4CT4A 2ZXWE 4I1OB 3TJPA 5FQ8A 3DSWA 3RKVA 4EPZA 4RG9A 4DLQA 4Q96A 3CVYA 2AJAA 4U7EB 3UMVA 3EU9A 2HE0A 4DK5A 4HRMB 3MKQB 1UJJA 4TXPA 4R7LA 5IY5E 4EECA 2EQXA 4GTTA 4U07A 4OYSA 2C0MA 1HFAA 4EQFA 2LAHA 4FU3A 2J08A 2WXPA 2XHEA 1N52A 1BU9A 3TGOA 5JJ6A 2LUHA 1A17A 3RRNB 3AAAC 3CKCA 3P2BA 4YVOA 3S2AA 2UWJG 4N3CA 2AW6A 3SBSA 5G04C 3SFXA 4A55A 4WNDA 5KBAA 4J8YA 1SVXA 3UM1A 1TNYA 2XPZA 2ONDA 3FU6A 3FEXA 3NB2A 3ULQA 2Y0BG 1UJKA 3NF1A 1K8KG 4C0MA 4W9RA 3ZHEA 5A23A 2BF0X 3NQPA 3OXLA 2DVWA 1NL4A 3D9HA 4AM9A 4G11A 5ENRD 4LNGA 5FZSA 5LCWJ 2XRYA 2XZTG 2DZOA 3L6AA 5G2NA 3ZEFA 1LD8A 3EHNA 4DX5D 3FTWA 3CK8A 1HH8A 1QYMA 4BSXA 3Q47B 4GZ5A 1VDYA 4BTAA 2OVFA 2XGMA 3ESKA 3KEZA 4F53A 4GTSA 1OUVA 4G2VA 2P9PG 4UQXA 5CHEE 4TXRA 4MRUA 1K3ZD 4UWFA 1N4QA 3ZXSA 3DSSA 3FUJA 4OAUC 3EJNA 4HBDA 5J08A 4BX8A 1OY3D 4EZKA 2L6BA 3LDZA 3CHOA 3TWUA 1HZ4A 5LOZA 4GZ6A 5AQ7A 4LSZE 5G04J 4WWOA 2ILRA 3CEQA 1YYHA 2ETCA 3CHMA 3ZYQA 4N2SA 2ZISA 4C0EA 3CSTA 4U8VD 3JQ1A 1SA4A 1TN8A 4U8HA 1H2TC 2AXZA 4NRHB 4J8SA 3BUAA 1HS6A 3I4GA 1NFIE 2J09A 1H2VC 4M3OA 3MKRA 3P1UA 3PNTB 3FULA 4G23A 2BEDA 3G2TA 1HE8A 1HO8A 2AVPA 4B94A 4PH4B 4Y6CA 1IHBA 3ZU7B 4HI9A 4G26A 4J7WA 3EUVA 3FTUA 5AYWD 1QQEA 2RG8A 3TWSA 2EIME 2X6FA 2FI7A 2H6GA 3ABLE 3C3OA 4WUYA 2WXHA 1FVFA 4LNUD 3L17A 2ZGDA 1TNOA 2XCBA 3ZVVA 3ZUVB 4I6GA 1MYOA 4JXTA 3R9AB 3CK9A 3C5RA 4FJZA 3V2XA 3C3RA 5CMYA 4A63B 3D9JA 4KVOA 2LO6A 1EDUA 4EZJA 5HKPA 5FWQA 3UUXA 4YVQC 3PNLB 2CG2A 1DVPA 1KT0A 4HOUA 2PL2A 5BUZA 1DCQA 3VLFA 5FZRA 1JWFA 2FEZA 3SFZA 3Q78A 3Q9NC 1SQMA 4AEZC 5AQBA 5LP0A 3IEGA 1NA0A 2C0LA 1G3NB 4U0ZA 4B8AA 2VQ2A 4XI0A 4DX7D 4A1GA 2XENA 3U9WA 5ENSD 4IN3B 4BFRA 4KYOB 5FQ4A 4U0UA 3IHVA 3CIAA 1EYHA 3HG0D 4FC8A 1UN8A 2QY7A 4LG6A 2ETBA 1TNZA 3CGHA 4KMOA 3HXCA 2AXVA 5CCLA 1E8XA 1BD8A 1YCSB 5AENA 4PS8A 3QB2A 3KSLA 4TXQA 2XQ0A 2HYZA 3E32A 3ZYKA 1E8YA 4ZHBA 5EIDA 3ASGA 4KXKB 3TWXA 4YDWA 1N4PA 5G55A 3C98A 4IULA 4YDYA 3RIBA 4GTVA 3UT4A 4EHMA 3UKRG 2MHKA 3SGHA 3WXXA 3R9MA 3G2VA 3CHPA 4TRQA 4BWRA 3UX4A 3QWWA 3Q9UC 4FJYA 1Z6TA 3FEYA 3O48A 2VJ8A 3JQ0A 3PZDA 2LXMA 4B89A 3SQVA 3G2SA 3FP3A 4GZDA 1ZB1A 2CG3A 3HVEB 5G05C 3ULEG 3MZLB 4DX6D 4N39A 4YDEA 2FULA 4KZCA 2YQ8A 1JUQA 5M72A 1H6KA 4XE0A 1HG2A 1GW6A 2V4LA 2P2CP 3PVLA 3L54A 1QZ2A 3CVVA 3MKQA 4D10C 3LY9A 4O1OA 1TEZA 3EHRA 4UQZA 3MEKA 2JEKA 5EN5D 3FUDA 3DEOA 3SBTB 2YNQA 1JCRA 3T9KA 5T4YA 3PEUB 1N94A 4I2ZA 3UPVA 2WMOA 1E7VA 4H7XA 4JEHA 1MX4A 1H0AA 5ENNA 4E85A 3URZA 5BV1A 4CCAA 3CKBA 2X6IA 3JUIA 5AJDA 2A4ZA 1MX2A 4GTQA 2ZU6B 4UI9K 3SNXA 5AN8A 2ZGGA 2UY1B 4RQIA 2HR2A 1OCOE 3LKUA 4PUCA 4C48B 3UM0A 3TL5A 2GW1A 1FT2A 2IY0C 5D66A 3OTNA 2J49A 4O60A 2GRMA 3CVXA 3ULYA 3PREA 2R02A 1UG3A 4DX2A 1LTXA 3LY8A 4NURA 1TNBA 4CZ2D 3VTXA 3CVNA 4JD2G 3ISMC 3T5XA 1RW2A 5A6CA 4GMLA 2DWZA 4FA6A 4TUUA 3QK0A 3V2OA 4HLEA 4CYMD 3VLEA 3BQOA 2XCCA 3DSXA 1MHQA 2V5FA 5G05J 3Q79A 1MJ0A 1ELKA 2OVBA 4JZYA 2A5UA 4BEPA 3B13A 4EZLA 4UWLA 1YMPA 4KT6B 1S70B 3CVQA 4AXHA 4HFGA 2IOSA 3I4RB 5BPPA 2Y1LE 5ENQD 1N0QA 2AWIA 3FTVA 2EILE 3D9LA 3IV0A 4YNDA 1DC2A 3QKYA 3HXEA 3UIPC 5C1DA 1OCZE 5FJYA 3TG5A 2IEJA 3MYVA 3J5QB 1HF8A 3TWVA 4AP2A 2IFUA 4UQYA 1TNUA 5BNWA 3D9NA 2V0PA 3B95A 3HXBA 5KJKA 4HRLA 1Y8MA 4BERA 2Y3AA 3AG2E 3APDA 3MA5A 1UOHA 5KNHD 2KZTB 3OXFA 4A3TA 1KZOA 2J8SD 3Q75A 2WXFA 1E8ZA 2P9IG 5CRVA 3CSFA 5CBOA 3E4BA 4ABNA 4K0RA 5HI7A 3CHSA 3AG1E 3ZKJA 3FTYA 1JCSA 1MQSA 3RRUA 4J6IA 3N71A 2DBAA 2P9SG 4GA1A 5D2MC 5T8IA 3QOUA 5CEAA 4XEIG 4K5BA 2GRRB 5ANRA 1O1RA 1TJFA 4BSZB 3SFYA 4DX1A 4HOSA 3DXMG 4I9CA 5EYLA 4DPRA 4DLOA 2DIWA 1Z5SC 4I17A 5B1AE 2GRLA 4J8DA 4XI9A 1X81A 1IXVA 3FY4A 4X8QA 5BT1A 4ANUA 2FO1E 4JL0A 3V79K 2GRNB 4N2QA 2Q7FA 1E90A 3WG7E 3LY7A 2PZIA 4G1TA 4IRUA 3BU8A 5E75A 4CDRA 3NZUA 3S7DA 2EINE 3HYMB 2XGSA 3T8MA 5E76A 1JWGA 3HRAA 2P9UG 1SZ9A 3MGBA 3ASDA 1HG5A 4FADA 5LX8A 3ZFWA 3TG4A
chains in the Genus database with same CATH topology
3LXUX 5FZRA 4AY5A 1IYGA 1XNFA 3O4ZA 1JWFA 2FEZA 3G2WA 3SFZA 2OV8A 2V8SE 1SQMA 3CLJA 4AEZC 4ACLA 3B7TA 5LP0A 3D9PA 4KZ0A 4URKA 3IEGA 1NA0A 2C0LA 5DBKA 2NXPA 2L6JA 4GAAA 2X38A 3S7BA 3PRZA 3NZSA 4GU5A 2CHZA 4U0ZA 4B8AA 3D9MA 2FF4A 2VQ2A 4XI0A 4AVXA 4BT8A 5KJNA 3ZPJA 2PM7A 4FLBA 2HO1A 4L2YA 2E0IA 4A1GA 3FU3A 3U9WA 2IF4A 2AXUA 4GB9A 2HM8A 5CMWA 4BFRA 4IN3B 4U0SA 4WNEA 1U3DA 4KYOB 5FQ4A 4HORA 3CVPA 3Q49B 4U0UA 3IHVA 2WXGA 2NC9A 2WQ6A 3ZIMA 2I1KA 3OXGA 3D9OA 3CIAA 1EYHA 3BG1B 5FTPA 4FC8A 1UN8A 2KCLA 3OAWA 2QY7A 2YHEA 2R17C 3HDXA 4F3VA 3CGHA 3FTXA 4KMOA 3APFA 2AXVA 2E2EA 5CCLA 1E8XA 4BX9A 4BT9A 4KVMA 4UWKA 1JPLA 3AS5A 3L16A 5AJLA 4FULA 5ARGA 3TXNA 5AENA 4FLHA 3R7QA 2LNIA 5DIZA 2XRZA 5BV0A 4PS8A 3RU0A 3QB2A 5KCMA 4ILHB 2XQ0A 1B89A 2HYZA 1NZNA 2PM6A 4L2LA 4GMJA 4XZ4A 1E7UA 5C2YA 4I2WA 2GGFA 1WM5A 1UN9A 3ZYKA 4CRWA 1E8YA 3B7RL 5D0QD 3I3NA 2J9QA 3ASGA 3HHMA 2YINA 4CT0A 4KXKB 5EX0A 4C9BB 3B7SA 4EBAG 3SF4A 4BTBA 5LCWC 3ESLA 5G55A 1HU3A 2IQCA 1ZU2A 3C98A 3Q15A 5FQ6A 5ARFA 2WB2A 4IULA 2VSOE 4FP7A 2L0TB 3RIBA 3TXMA 3UT4A 2WXNA 2NSZA 3CVWA 4GCOA 3QWPA 3CHQA 4CT4A 2CHXA 2MHKA 5M72A 4JHRA 3SGHA 4I1OB 5BW8C 4XKBA 4XKCA 3WXXA 3TJPA 3KS2A 5FQ8A 2WXOA 3GZSA 3G2VA 3CHPA 3FWVA 3PS6A 4TRQA 4BWRA 2FO7A 4RVBA 3UX4A 3QWWA 4Q94A 3RKVA 3CHRA 4FJYA 1Z6TA 4EPZA 4RG9A 1P5QA 3AU4A 3FEYA 4ANVA 3ONKA 4DLQA 2C2LA 4Q96A 3O48A 3CVYA 2PQRA 2VJ8A 3JQ0A 3PZDA 4B89A 2I1JA 3CVLA 3UMVA 4I1MA 2LSVA 3G2SA 3IHYA 3U66A 3FP3A 3QARA 4GZDA 4GZ3A 4DK5A 2WQHA 2CG3A 3FUMA 3MKQB 1UJJA 3HVEB 4O6FA 5G05C 1QNFA 4APOA 4R7LA 3BG0B 3MZLB 4UI9C 3ASFA 4A1SA 4GCNA 4EECA 4CDNA 2EQXA 1FVHA 2X6KA 4U07A 4OYSA 2C0MA 1HFAA 4EQFA 4N39A 4JHKA 5FT9A 2FULA 5JJTA 4KZCA 2YQ8A 1JUQA 1EPUA 2LAHA 3JYSA 4FU3A 1H6KA 2J08A 4XE0A 1HG2A 1GW6A 1X5BA 2V4LA 2KCVA 2WXPA 1PY1A 1N52A 2XHEA 4I6EA 2I2OA 3PVLA 3L54A 1NA3A 1QZ2A 1WY6A 1BPOA 3LVRE 1Y6IA 3LYAA 3TGOA 3CVVA 3FH5A 3MKQA 4GYOA 5JJ6A 4D10C 1A17A 3HVEA 2LSUA 3LY9A 3RRNB 1TEZA 3CKCA 4UQZA 3ML8A 3MEKA 2JEKA 2I9CA 4GA0A 4ILGA 3P2BA 4YVOA 2QFCA 4K03A 3S2AA 1IQRA 3FUDA 2UWJG 4H7YA 3SBTB 3VTYA 2YNQA 4N3CA 2AW6A 4J8FA 3SBSA 5G04C 4GA2A 3HIZA 3RO2A 5T4YA 3EDTB 2CFZA 4L7TA 3PEUB 2X6JA 4MLPA 4A55A 4I2ZA 4MKTA 3FH8A 4RSYA 4LERA 2WMOA 4WNDA 4XX5A 3UPVA 2VYIA 2VSXE 1E7VA 3Q5MA 4H7XA 4JEHA 2BUGA 2L0IA 1H0AA 2M63A 3ZHEB 5ENNA 3ONLA 2IJGX 2R59A 4E85A 3GZ2A 2WXMA 3ZW3A 3URZA 5BV1A 3U3WA 3LS8A 4CCAA 3CKBA 5EX3A 2X6IA 3JUIA 3LPZA 3PDNA 3ZN3A 5AJDA 3LVQE 1IHGA 2XPZA 2A4ZA 1LF8A 4XIFA 4U63A 2ZU6B 4UI9K 3AS8A 3SNXA 3B7UX 3RRMB 2ONDA 3DBSA 3FU6A 3FEXA 3SHFA 2UY1B 3ULQA 5EKQD 1W3BA 2HR2A 2J4BA 1UJKA 1E8WA 3GZ1A 3NF1A 4FHJA 1INZA 3LKUA 3FDHA 4C0MA 1WAO1 4PUCA 4W9RA 3ZHEA 5A23A 2IONA 2BF0X 3NQPA 3OXLA 1SZAA 3TL5A 2GW1A 1IQUA 4AM9A 4JC8A 4G11A 4I6JA 3OTNA 3RO3A 5FZSA 1ELWA 2P58C 2J49A 2WM9A 3IBEA 2XRYA 3VLFA 5LCWJ 2GRMA 3MV3B 3CVXA 4GZCA 4PS7A 3PREA 3L6AA 5G2NA 3RK6A 4CEMA 1OWNA 3ZEFA 4GPKA 3L22A 3UT7A 3QWVA 1UG3A 3FUIA 2UY1A 3EHNA 3FUEA 3LY8A 4NURA 3BEEA 3FTWA 3GW4A 3CK8A 1HH8A 3VTXA 3PUJA 4BY6A 4BSXA 3CVNA 2WVIA 4ATGA 4JHJA 3Q47B 2WPVA 3PH0C 3T5XA 2XPYA 4GZ5A 1EF1C 4HS2A 1VDYA 5A6CA 3FTSA 4GMLA 2VGXB 4L1BA 3ZYLA 4BTAA 4FA6A 4I9EA 2J4DA 4TUUA 2OVFA 3QK0A 3FFLA 4GYWA 1NP7A 4HLEA 2XGMA 2XPIA 3ESKA 3KEZA 4F53A 3VLEA 4Y6WA 1OUVA 2XCCA 3IKOB 4G2VA 4F7AA 1MHQA 2V5FA 4NACA 5G05J 3EIJA 4UQXA 4AIFA 5CHEE 4UI9J 4FHKA 2WXIA 5LFAA 4MRUA 3I5PA 3QC1A 3RJVA 2FBNA 2WXJA 4WAFA 3AU5A 4UWFA 3ZYMA 3FUKA 4F1SA 1ELKA 2KM4A 3ZXSA 3CQCB 3FUJA 3ENEA 2OVBA 3EJNA 2VGXA 3PEVB 5J08A 4NQ0A 3FUHA 4JZYA 2A5UA 3JCKC 4ME2A 4BX8A 3FUNA 3GYZA 1TJCA 3B13A 1KT1A 3MV2B 4EZLA 2I6HA 2X6HA 4UWLA 4HOTA 4EZKA 3L08A 3PE4A 3CQGB 3K9IA 4WWPA 4AY6A 3LDZA 4KT6B 3CVQA 4AXHA 4HFGA 3U4TA 4DJAA 1PAQA 2LAIA 3CHOA 1HZ4A 2XGOA 3FUFA 5JHAA 4PS3A 3CR3A 1N54A 5LOZA 2IOSA 3I4RB 5BPPA 4GZ6A 4Q69A 2KATA 2AWIA 2BTDA 3APCA 2VGYA 4J0UA 3FTVA 5G04J 4APFA 4WWOA 2WXKA 2ILRA 4ACKA 3CEQA 3Q4AB 3UQ3A 3LCAA 3D9LA 3IV0A 4YNDA 3QNKA 1UW4B 4LEUA 3FU0A 3S7DA 3L13A 3CHMA 1U3CA 3QKYA 3ZYQA 4N2SA 3FU5A 4C0EA 3CSTA 5ANLA 5C1DA 3FH7A 2DCPA 3JQ1A 5KJMA 2R5SA 4JPSA 4U8HA 3S7FA 1H2TC 5FJYA 2AXZA 4N3AA 3TG5A 4CGVA 1PC2A 1E96B 3G2UA 3QDNA 3MYVA 3T5VA 3D9IA 4NRHB 4J8SA 5EDSA 2VTBB 1HF8A 3AS4A 2WXRA 4HXIA 4AP2A 4AV7A 2IFUA 4UQYA 5D0OD 4CDMA 1ELRA 3SI5A 4UWHA 5BNWA 1HS6A 3D9NA 1Z3XA 3SD5A 2V0PA 3I4GA 4ILIA 4MS6A 4AOFA 3KAEA 1XGWA 3CV0A 2J09A 1ZBPA 2WXLA 1H2VC 3ML9A 4DI3A 5KJKA 2JLBA 2IU1A 4M3OA 2MRIA 1Y8MA 3MKRA 2Y3AA 3P1UA 2J07A 3PNTB 3MA5A 3APDA 3UT8A 3PUKA 4B0ZA 3FULA 5HQ8A 4CGWA 2KZTB 3ZGQA 4G23A 3OXFA 5FZQA 4A3TA 4I43A 2VTBA 3G2TA 2WXFA 1HE8A 1HO8A 3R7RA 4AJWA 1E8ZA 2AVPA 4EBAA 5JHBA 3LEWA 3U64A 4B94A 2IOLA 3CSFA 3TAXA 2KCKA 4PH4B 4Y6CA 2XEVA 3E4BA 4JA9A 2MOWA 4ABNA 4K0RA 3KD7A 4G25A 5HI7A 4GYYA 4JW1A 2Y4UA 4G26A 4LCTA 3CHSA 4HOQA 3FTYA 2CFUA 4UWGA 4N3BA 1MQSA 3RRUA 4J6IA 1S0PA 3N71A 4ANWA 2DBAA 2KZTA 5FQ7A 5CCMA 3CVUA 2L9BA 4GA1A 5T8IA 4QFVA 3QOUA 1H19A 3PE3A 4RG6A 3FTUA 4JEUA 5AYWD 3D3MA 5ANRA 5JJ7A 1QQEA 1TJFA 4OVVA 3D9KA 1H2UA 2RG8A 3ASHA 4N5CA 5KJLA 4HOSA 2X6FA 4I9CA 4DPRA 4DLOA 1OWMA 2DIWA 4WNFA 4V3IA 4I17A 3QJZA 4P29A 4I1AA 4A3VA 2FI7A 4DI4A 4L23A 2GRLA 2WXQA 4LRZA 3SZ7A 3EHMA 4J8DA 4XI9A 4WUYA 3FY4A 2WXHA 1FVFA 1L5JA 5BT1A 4HVBA 3LJ3A 1KLXA 3VLDA 1FCHA 3QAQA 1OWOA 3L17A 4ANUA 2XCBA 3ZVVA 4JL0A 4I6GA 2X3MA 4JXTA 3R9AB 4WWNA 4OVUA 4ANXA 3CK9A 4N2QA 2WMNA 2VSNA 4TV3A 3CK7A 2VSYA 4FJZA 2Q7FA 4KBQA 5CMYA 4G24A 2OOEA 5AIJA 1E90A 3D9JA 4JVSA 3LY7A 2LO6A 4KVOA 2PZIA 3FTZA 3ZRHA 4G1TA 1DNPA 1EDUA 4IRUA 4PDXA 4EZJA 1HX8A 5E75A 2PQNA 2Y4TA 5FWQA 2CHWA 3UUXA 4CDRA 4E6HA 5J90A 4LUNU 4YVQC 3MCXA 2YHCA 3NZUA 2RD0A 3EIQC 3HYMB 3MX3A 1OWPA 4JA7A 1HXIA 2XGSA 4J8EA 3PNLB 5A7DB 1YA0A 3T8MA 5E76A 1JWGA 2WQ7A 3FHEA 1SZ9A 2CG2A 4WNGA 5T3RA 1DVPA 1OWLA 1Z3YA 1KT0A 4IYPA 4HOUA 3MGBA 3ASDA 2PL2A 4U04A 5BUZA 3MJWA 1HG5A 2KC7A 4FADA 5LX8A 3ZFWA 3S7JA 3DPDA 4B8CB 3TG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFG A;  1EDU A;  1JWF A;  1H0A A;  2L0I A;  1HX8 A;  2DCP A;  1UJJ A;  3G2W A;  3ONL A;  2LO6 A;  2V8S E;  3CLJ A;  3RRU A;  2BF0 X;  3D9O A;  1SZA A;  3G2V A;  3ZYM A;  1EYH A;  5LOZ A;  3ZYK A;  5LP0 A;  3D9P A;  3G2U A;  1ELK A;  2KM4 A;  3D9I A;  2QY7 A;  4Q94 A;  1VDY A;  1JWG A;  1HF8 A;  3G2T A;  3ZYL A;  4NAC A;  1HFA A;  5J08 A;  1LF8 A;  1SZ9 A;  3D9M A;  4JXT A;  4AVX A;  3ONK A;  1DVP A;  4GZC A;  4Q96 A;  4FLB A;  1JUQ A;  3D9K A;  3D9L A;  3D9N A;  4FU3 A;  1HG2 A;  1X5B A;  1JPL A;  1PY1 A;  5CMY A;  1HG5 A;  2L0T B;  3ZYQ A;  1XGW A;  3G2S A;  2DIW A;  3D9J A;  5CMW A;  1UJK A;  1MHQ A;  2MOW A;  1INZ A;  4GZD A;  3LDZ A; 
#chains in the Genus database with same CATH topology
 2B6C A;  3G2W A;  4DUI A;  2V8S E;  4KZ0 A;  4URK A;  5DBK A;  3PRZ A;  4GU5 A;  5KJN A;  4FLB A;  2HO1 A;  4L2Y A;  2E0I A;  5CED B;  2IF4 A;  4GB9 A;  3W9F A;  1TN6 A;  2R05 A;  3Q49 B;  2WQ6 A;  3D9O A;  3BG1 B;  3EU5 A;  3ZNG A;  2R17 C;  3AG4 E;  1TYQ G;  3UI2 A;  4BX9 A;  5AAR A;  4UWK A;  1H6O A;  5ARG A;  1NI1 A;  2LNI A;  4G8L A;  2XRZ A;  4ILH B;  2PM6 A;  4XZ4 A;  2F8Y A;  4I2W A;  1WM5 A;  1UN9 A;  4CRW A;  3I3N A;  2KBX A;  3ABK E;  3B7S A;  4EBA G;  3UM3 A;  3ESL A;  1HU3 A;  2IQC A;  1ZU2 A;  2XS8 A;  1N0R A;  2WB2 A;  2VSO E;  4FP7 A;  3TXM A;  1LD7 A;  3CVW A;  1BLX B;  4GCO A;  3CHQ A;  4JHR A;  5BW8 C;  4XKC A;  3KS2 A;  3GZS A;  1BI8 B;  3PS6 A;  4RVB A;  1RZ4 A;  1P5Q A;  4ANV A;  2PNN A;  3C72 A;  4GTR A;  2PQR A;  4GTO A;  1OXJ A;  3CVL A;  4I1M A;  2LSV A;  3QAR A;  2WQH A;  4O6F A;  2H6F A;  3ASF A;  4GCN A;  4CDN A;  1D8D A;  2GRO B;  4JHK A;  5FT9 A;  5JJT A;  3JYS A;  5DIZ A;  3AG3 E;  4I6E A;  1PY1 A;  2I2O A;  5CRU A;  1NA3 A;  1WY6 A;  3LVR E;  2QYJ A;  3FH5 A;  4GYO A;  1WG0 A;  3HVE A;  2LSU A;  4ILG A;  2QFC A;  3VTY A;  4J8F A;  5BXU A;  4GA2 A;  3HIZ A;  3RO2 A;  3EDT B;  4L7T A;  3UIN C;  3FH8 A;  2VYI A;  2VSX E;  2BUG A;  2M63 A;  3ONL A;  2R59 A;  3SY2 A;  2WXM A;  3ZW3 A;  3LPZ A;  3PDN A;  3B7U X;  4NIK A;  2RFA A;  2J4B A;  3FDH A;  2ION A;  1IQU A;  1O1T A;  3RO3 A;  1ELW A;  3IBE A;  3MV3 B;  4GZC A;  4PS7 A;  3RK6 A;  1OWN A;  4GPK A;  3L22 A;  3QWV A;  4K5A B;  2UY1 A;  5AQA A;  1D9S A;  3BEE A;  3GW4 A;  4BY6 A;  4ATG A;  1N95 A;  3E33 A;  1EF1 C;  4HS2 A;  2VGX B;  3ASO E;  4L1B A;  3ZYL A;  4I9E A;  1TN7 A;  1K1A A;  3PZ2 A;  3FFL A;  4GYW A;  1NP7 A;  1WDY A;  4Y6W A;  3DWL G;  4ATZ D;  4FHK A;  2WXI A;  5LFA A;  3I5P A;  3QC1 A;  3RJV A;  4WAF A;  4DRX E;  4F1S A;  2H6H A;  2KM4 A;  3CQC B;  1AP7 A;  3JUE A;  3RSE G;  5AQ9 A;  4NQ0 A;  3FUH A;  3HXD A;  5HS0 A;  2XEH A;  4ME2 A;  3FUN A;  1N4R A;  3GYZ A;  1TJC A;  1KT1 A;  3MV2 B;  3PE4 A;  3CQG B;  1KZP A;  4WWP A;  4GPM A;  3U4T A;  4DJA A;  1PAQ A;  3KSQ A;  5JHA A;  2OEV A;  4K5C A;  4PS3 A;  3UM2 A;  3CR3 A;  3Q73 A;  1D8E A;  2KAT A;  2DZN A;  2BTD A;  2H6I A;  2VGY A;  4J0U A;  5B1B E;  4LNB A;  2RKK A;  3UQ3 A;  3LCA A;  3QNK A;  1UW4 B;  4LEU A;  3FU0 A;  3L13 A;  3FU5 A;  2KXP C;  2DCP A;  2R5S A;  4N3A A;  4CGV A;  1PC2 A;  3G2U A;  3DEP A;  5EDS A;  2VTB B;  3IXE A;  2A5E A;  4HXI A;  5D0O D;  1Z3X A;  4MS6 A;  4AOF A;  1XGW A;  5HQ8 A;  3PUK A;  2QYU A;  5FZQ A;  2F8X K;  4I43 A;  3Q7F A;  4BES A;  2Y69 E;  3R7R A;  4EBA A;  5FIO A;  5JHB A;  3U64 A;  2IOL A;  3TAX A;  2KCK A;  1FPP A;  2DYR E;  3DSV A;  4JA9 A;  4G25 A;  2Y4U A;  4LCT A;  4UWG A;  4N3B A;  4U96 D;  2KZT A;  4ANW A;  1KPS B;  3D3M A;  5KWD A;  3D9K A;  3ASH A;  5EIL A;  4WNF A;  3KEA A;  4P29 A;  4A3V A;  1MX6 A;  1L5J A;  4HVB A;  1KLX A;  3QAQ A;  1OWO A;  3V30 A;  2X3M A;  4WWN A;  4OVU A;  4ANX A;  2VSN A;  3DRA A;  4KBQ A;  2EIK E;  4G24 A;  2OOE A;  3ZRH A;  1DNP A;  2PQN A;  2CHW A;  3TWQ A;  4LUN U;  2F0Y A;  4ZFH A;  2YHC A;  4JA7 A;  3CVU A;  1HXI A;  5A7D B;  1YA0 A;  2WQ7 A;  3E34 A;  5T3R A;  2OEW A;  1Z3Y A;  1H6P A;  2XZD G;  4M7C A;  5HRY A;  3S7J A;  4B8C B;  3LXU X;  1S64 A;  4YDO A;  2B0O E;  3CLJ A;  4ACL A;  2IO2 C;  3D9P A;  1S63 A;  1DCE A;  2L6J A;  3NZS A;  2FF4 A;  4AVX A;  1A5E A;  4BT8 A;  3ZPJ A;  3JXI A;  3SO8 A;  4WNE A;  2P9N G;  2ZIR A;  4HOR A;  3CVP A;  5B3S E;  2WXG A;  3ZIM A;  2I1K A;  3OXG A;  4F6R D;  3FTX A;  3NOG D;  3ASN E;  2E2E A;  5CEC B;  1N4S A;  4MBG A;  1JPL A;  3AS5 A;  3TWR A;  3JXJ A;  1TR4 A;  3R7Q A;  3RU0 A;  5KCM A;  1U2V G;  1B89 A;  1NZN A;  4L2L A;  5D0Q D;  5ITZ F;  2J9Q A;  4HI8 A;  3HHM A;  2YIN A;  4CT0 A;  5EX0 A;  4C9B B;  1Q2Z A;  1N11 A;  4BTB A;  3DST A;  5FQ6 A;  3Q15 A;  5ARF A;  3UXG A;  2L0T B;  3QWP A;  1FT1 A;  2CHX A;  4XKB A;  2WXO A;  1IKN D;  3FWV A;  2FO7 A;  4Q94 A;  3CHR A;  3AU4 A;  4OAV B;  3ONK A;  2C2L A;  2I1J A;  3IHY A;  3U66 A;  4GZ3 A;  3FUM A;  3X2Q E;  1QNF A;  4APO A;  3BG0 B;  4UI9 C;  4A1S A;  3J5P A;  1SA5 A;  1V55 E;  3F6Q A;  1FVH A;  2X6K A;  3HXF A;  1EPU A;  1X5B A;  2KCV A;  3E37 A;  1BPO A;  1Y6I A;  3LYA A;  5ENT D;  2BKK B;  3ML8 A;  2I9C A;  4GA0 A;  4K03 A;  5JA4 D;  2QC9 A;  1IQR A;  4H7Y A;  3UIO C;  3UTM A;  5BXO A;  3NOC D;  2CFZ A;  2X6J A;  4U95 D;  4JB8 P;  4MLP A;  4HLL A;  4MKT A;  4RSY A;  4LER A;  4XX5 A;  3UKU G;  2V4H C;  3Q5M A;  4HRN A;  2L0I A;  3ZHE B;  5ENP D;  2IJG X;  2R03 A;  3GZ2 A;  5CBN A;  3U3W A;  3LS8 A;  5EX3 A;  3ZN3 A;  3LVQ E;  1IHG A;  1LF8 A;  4XIF A;  4U63 A;  3AS8 A;  3RRM B;  3PZ4 A;  2BKG A;  3DBS A;  3SHF A;  3AJI A;  5EKQ D;  1W3B A;  1E8W A;  3GZ1 A;  2V5Q C;  4FHJ A;  1INZ A;  1WAO 1;  2LXL A;  1SZA A;  1N9A A;  4JC8 A;  4I6J A;  2P58 C;  2WM9 A;  3T8K A;  4CEM A;  3UT7 A;  3FUI A;  4GTP A;  5H7P A;  3FUE A;  5CER B;  3PUJ A;  3PZ1 A;  2WVI A;  4JHJ A;  2WPV A;  3PH0 C;  2XPY A;  3FTS A;  3TWT A;  1OCC E;  2J4D A;  2JAB A;  4U8Y D;  2XPI A;  4F1P A;  5JMN D;  3IKO B;  4F7A A;  4NAC A;  3EIJ A;  4AIF A;  4UI9 J;  3ABM E;  5ENO D;  4GTM A;  2FBN A;  2WXJ A;  3AU5 A;  3ZYM A;  3FUK A;  4HB5 A;  3ENE A;  2VGX A;  3DXK G;  3PEV B;  4HQD A;  3JCK C;  2I6H A;  2X6H A;  4HOT A;  3L08 A;  3K9I A;  4QQI A;  4AY6 A;  2LAI A;  2XGO A;  3FUF A;  1N54 A;  4Q69 A;  3APC A;  2F37 A;  4APF A;  2WXK A;  4ACK A;  1O1S A;  3L9T A;  3Q4A B;  1U3C A;  1QBQ A;  3EHQ A;  1OCR E;  5ANL A;  3FH7 A;  5KJM A;  4JPS A;  4Z68 A;  3S7F A;  1E96 B;  2QZA A;  3QDN A;  3T5V A;  3D9I A;  3NBN B;  3AS4 A;  2WXR A;  4AV7 A;  4O1P A;  4CDM A;  1ELR A;  3RAU A;  4UWH A;  3SI5 A;  3SD5 A;  4ILI A;  3LJN A;  3KAE A;  3CV0 A;  3ML9 A;  1ZBP A;  2WXL A;  4DI3 A;  2JLB A;  2IU1 A;  2MRI A;  2J07 A;  4B0Z A;  3UT8 A;  4CGW A;  3E30 A;  1AWC B;  3ZGQ A;  2VTB A;  3ZXP A;  3C3Q A;  4AJW A;  3LEW A;  2P9K G;  4GMR A;  2EIJ E;  2XEV A;  2MOW A;  2XS1 A;  3KD7 A;  4GYY A;  4JW1 A;  4TUM A;  4HOQ A;  2CFU A;  1S0P A;  5FQ7 A;  5CCM A;  2L9B A;  4QFV A;  1H19 A;  3PE3 A;  4RG6 A;  4JEU A;  5EIB E;  1MZC A;  3Q7A A;  1BI7 B;  5JJ7 A;  2DYS E;  2P9L G;  2GRQ B;  4OVV A;  1H2U A;  4N5C A;  5KJL A;  3PZ3 A;  1OWM A;  4V3I A;  3QJZ A;  4I1A A;  4DI4 A;  4L23 A;  2WXQ A;  4LRZ A;  3SZ7 A;  3EHM A;  3LJ3 A;  3NAW A;  1FCH A;  3VLD A;  4G8K A;  3V31 A;  3DPY A;  2WMN A;  4TV3 A;  3CK7 A;  2VSY A;  4BET A;  5AIJ A;  4JVS A;  3FTZ A;  4PDX A;  1HX8 A;  2Y4T A;  4E6H A;  5FIN A;  5J90 A;  3MCX A;  5AJL A;  2RD0 A;  3EIQ C;  3MX3 A;  1OWP A;  4J8E A;  4RLY A;  1K1B A;  2RFM A;  3FHE A;  4L9P A;  4WNG A;  2OCC E;  4N5Q A;  1OWL A;  5AAO A;  4B93 B;  4IYP A;  4UUC A;  4U04 A;  3MJW A;  2KC7 A;  2XEE A;  3DPD A;  4HNA D;  4AY5 A;  1IYG A;  1XNF A;  3O4Z A;  2ETA A;  2OV8 A;  3L82 A;  3B7T A;  2R2L A;  5KNG A;  2NXP A;  4GAA A;  2X38 A;  3S7B A;  2CHZ A;  3D9M A;  2PM7 A;  5EYP F;  3FU3 A;  2AXU A;  2HM8 A;  5CMW A;  2VGE A;  1SW6 A;  4U0S A;  1U3D A;  2IO3 C;  2NC9 A;  3DSU A;  1OT8 A;  2NYJ A;  5FTP A;  2KCL A;  3OAW A;  2YHE A;  1V54 E;  3HDX A;  4F3V A;  3APF A;  3W9G A;  4BT9 A;  4KVM A;  3L16 A;  4FUL A;  3TXN A;  4FLH A;  3TWW A;  1JCQ A;  5BV0 A;  3B7B A;  4GMJ A;  1E7U A;  5C2Y A;  2GGF A;  2GRP B;  3B7R L;  2MYO A;  3SF4 A;  5LCW C;  1O5M A;  2WXN A;  2NSZ A;  4CT4 A;  2ZXW E;  4I1O B;  3TJP A;  5FQ8 A;  3DSW A;  3RKV A;  4EPZ A;  4RG9 A;  4DLQ A;  4Q96 A;  3CVY A;  2AJA A;  4U7E B;  3UMV A;  3EU9 A;  2HE0 A;  4DK5 A;  4HRM B;  3MKQ B;  1UJJ A;  4TXP A;  4R7L A;  5IY5 E;  4EEC A;  2EQX A;  4GTT A;  4U07 A;  4OYS A;  2C0M A;  1HFA A;  4EQF A;  2LAH A;  4FU3 A;  2J08 A;  2WXP A;  2XHE A;  1N52 A;  1BU9 A;  3TGO A;  5JJ6 A;  2LUH A;  1A17 A;  3RRN B;  3AAA C;  3CKC A;  3P2B A;  4YVO A;  3S2A A;  2UWJ G;  4N3C A;  2AW6 A;  3SBS A;  5G04 C;  3SFX A;  4A55 A;  4WND A;  5KBA A;  4J8Y A;  1SVX A;  3UM1 A;  1TNY A;  2XPZ A;  2OND A;  3FU6 A;  3FEX A;  3NB2 A;  3ULQ A;  2Y0B G;  1UJK A;  3NF1 A;  1K8K G;  4C0M A;  4W9R A;  3ZHE A;  5A23 A;  2BF0 X;  3NQP A;  3OXL A;  2DVW A;  1NL4 A;  3D9H A;  4AM9 A;  4G11 A;  5ENR D;  4LNG A;  5FZS A;  5LCW J;  2XRY A;  2XZT G;  2DZO A;  3L6A A;  5G2N A;  3ZEF A;  1LD8 A;  3EHN A;  4DX5 D;  3FTW A;  3CK8 A;  1HH8 A;  1QYM A;  4BSX A;  3Q47 B;  4GZ5 A;  1VDY A;  4BTA A;  2OVF A;  2XGM A;  3ESK A;  3KEZ A;  4F53 A;  4GTS A;  1OUV A;  4G2V A;  2P9P G;  4UQX A;  5CHE E;  4TXR A;  4MRU A;  1K3Z D;  4UWF A;  1N4Q A;  3ZXS A;  3DSS A;  3FUJ A;  4OAU C;  3EJN A;  4HBD A;  5J08 A;  4BX8 A;  1OY3 D;  4EZK A;  2L6B A;  3LDZ A;  3CHO A;  3TWU A;  1HZ4 A;  5LOZ A;  4GZ6 A;  5AQ7 A;  4LSZ E;  5G04 J;  4WWO A;  2ILR A;  3CEQ A;  1YYH A;  2ETC A;  3CHM A;  3ZYQ A;  4N2S A;  2ZIS A;  4C0E A;  3CST A;  4U8V D;  3JQ1 A;  1SA4 A;  1TN8 A;  4U8H A;  1H2T C;  2AXZ A;  4NRH B;  4J8S A;  3BUA A;  1HS6 A;  3I4G A;  1NFI E;  2J09 A;  1H2V C;  4M3O A;  3MKR A;  3P1U A;  3PNT B;  3FUL A;  4G23 A;  2BED A;  3G2T A;  1HE8 A;  1HO8 A;  2AVP A;  4B94 A;  4PH4 B;  4Y6C A;  1IHB A;  3ZU7 B;  4HI9 A;  4G26 A;  4J7W A;  3EUV A;  3FTU A;  5AYW D;  1QQE A;  2RG8 A;  3TWS A;  2EIM E;  2X6F A;  2FI7 A;  2H6G A;  3ABL E;  3C3O A;  4WUY A;  2WXH A;  1FVF A;  4LNU D;  3L17 A;  2ZGD A;  1TNO A;  2XCB A;  3ZVV A;  3ZUV B;  4I6G A;  1MYO A;  4JXT A;  3R9A B;  3CK9 A;  3C5R A;  4FJZ A;  3V2X A;  3C3R A;  5CMY A;  4A63 B;  3D9J A;  4KVO A;  2LO6 A;  1EDU A;  4EZJ A;  5HKP A;  5FWQ A;  3UUX A;  4YVQ C;  3PNL B;  2CG2 A;  1DVP A;  1KT0 A;  4HOU A;  2PL2 A;  5BUZ A;  1DCQ A;  3VLF A;  5FZR A;  1JWF A;  2FEZ A;  3SFZ A;  3Q78 A;  3Q9N C;  1SQM A;  4AEZ C;  5AQB A;  5LP0 A;  3IEG A;  1NA0 A;  2C0L A;  1G3N B;  4U0Z A;  4B8A A;  2VQ2 A;  4XI0 A;  4DX7 D;  4A1G A;  2XEN A;  3U9W A;  5ENS D;  4IN3 B;  4BFR A;  4KYO B;  5FQ4 A;  4U0U A;  3IHV A;  3CIA A;  1EYH A;  3HG0 D;  4FC8 A;  1UN8 A;  2QY7 A;  4LG6 A;  2ETB A;  1TNZ A;  3CGH A;  4KMO A;  3HXC A;  2AXV A;  5CCL A;  1E8X A;  1BD8 A;  1YCS B;  5AEN A;  4PS8 A;  3QB2 A;  3KSL A;  4TXQ A;  2XQ0 A;  2HYZ A;  3E32 A;  3ZYK A;  1E8Y A;  4ZHB A;  5EID A;  3ASG A;  4KXK B;  3TWX A;  4YDW A;  1N4P A;  5G55 A;  3C98 A;  4IUL A;  4YDY A;  3RIB A;  4GTV A;  3UT4 A;  4EHM A;  3UKR G;  2MHK A;  3SGH A;  3WXX A;  3R9M A;  3G2V A;  3CHP A;  4TRQ A;  4BWR A;  3UX4 A;  3QWW A;  3Q9U C;  4FJY A;  1Z6T A;  3FEY A;  3O48 A;  2VJ8 A;  3JQ0 A;  3PZD A;  2LXM A;  4B89 A;  3SQV A;  3G2S A;  3FP3 A;  4GZD A;  1ZB1 A;  2CG3 A;  3HVE B;  5G05 C;  3ULE G;  3MZL B;  4DX6 D;  4N39 A;  4YDE A;  2FUL A;  4KZC A;  2YQ8 A;  1JUQ A;  5M72 A;  1H6K A;  4XE0 A;  1HG2 A;  1GW6 A;  2V4L A;  2P2C P;  3PVL A;  3L54 A;  1QZ2 A;  3CVV A;  3MKQ A;  4D10 C;  3LY9 A;  4O1O A;  1TEZ A;  3EHR A;  4UQZ A;  3MEK A;  2JEK A;  5EN5 D;  3FUD A;  3DEO A;  3SBT B;  2YNQ A;  1JCR A;  3T9K A;  5T4Y A;  3PEU B;  1N94 A;  4I2Z A;  3UPV A;  2WMO A;  1E7V A;  4H7X A;  4JEH A;  1MX4 A;  1H0A A;  5ENN A;  4E85 A;  3URZ A;  5BV1 A;  4CCA A;  3CKB A;  2X6I A;  3JUI A;  5AJD A;  2A4Z A;  1MX2 A;  4GTQ A;  2ZU6 B;  4UI9 K;  3SNX A;  5AN8 A;  2ZGG A;  2UY1 B;  4RQI A;  2HR2 A;  1OCO E;  3LKU A;  4PUC A;  4C48 B;  3UM0 A;  3TL5 A;  2GW1 A;  1FT2 A;  2IY0 C;  5D66 A;  3OTN A;  2J49 A;  4O60 A;  2GRM A;  3CVX A;  3ULY A;  3PRE A;  2R02 A;  1UG3 A;  4DX2 A;  1LTX A;  3LY8 A;  4NUR A;  1TNB A;  4CZ2 D;  3VTX A;  3CVN A;  4JD2 G;  3ISM C;  3T5X A;  1RW2 A;  5A6C A;  4GML A;  2DWZ A;  4FA6 A;  4TUU A;  3QK0 A;  3V2O A;  4HLE A;  4CYM D;  3VLE A;  3BQO A;  2XCC A;  3DSX A;  1MHQ A;  2V5F A;  5G05 J;  3Q79 A;  1MJ0 A;  1ELK A;  2OVB A;  4JZY A;  2A5U A;  4BEP A;  3B13 A;  4EZL A;  4UWL A;  1YMP A;  4KT6 B;  1S70 B;  3CVQ A;  4AXH A;  4HFG A;  2IOS A;  3I4R B;  5BPP A;  2Y1L E;  5ENQ D;  1N0Q A;  2AWI A;  3FTV A;  2EIL E;  3D9L A;  3IV0 A;  4YND A;  1DC2 A;  3QKY A;  3HXE A;  3UIP C;  5C1D A;  1OCZ E;  5FJY A;  3TG5 A;  2IEJ A;  3MYV A;  3J5Q B;  1HF8 A;  3TWV A;  4AP2 A;  2IFU A;  4UQY A;  1TNU A;  5BNW A;  3D9N A;  2V0P A;  3B95 A;  3HXB A;  5KJK A;  4HRL A;  1Y8M A;  4BER A;  2Y3A A;  3AG2 E;  3APD A;  3MA5 A;  1UOH A;  5KNH D;  2KZT B;  3OXF A;  4A3T A;  1KZO A;  2J8S D;  3Q75 A;  2WXF A;  1E8Z A;  2P9I G;  5CRV A;  3CSF A;  5CBO A;  3E4B A;  4ABN A;  4K0R A;  5HI7 A;  3CHS A;  3AG1 E;  3ZKJ A;  3FTY A;  1JCS A;  1MQS A;  3RRU A;  4J6I A;  3N71 A;  2DBA A;  2P9S G;  4GA1 A;  5D2M C;  5T8I A;  3QOU A;  5CEA A;  4XEI G;  4K5B A;  2GRR B;  5ANR A;  1O1R A;  1TJF A;  4BSZ B;  3SFY A;  4DX1 A;  4HOS A;  3DXM G;  4I9C A;  5EYL A;  4DPR A;  4DLO A;  2DIW A;  1Z5S C;  4I17 A;  5B1A E;  2GRL A;  4J8D A;  4XI9 A;  1X81 A;  1IXV A;  3FY4 A;  4X8Q A;  5BT1 A;  4ANU A;  2FO1 E;  4JL0 A;  3V79 K;  2GRN B;  4N2Q A;  2Q7F A;  1E90 A;  3WG7 E;  3LY7 A;  2PZI A;  4G1T A;  4IRU A;  3BU8 A;  5E75 A;  4CDR A;  3NZU A;  3S7D A;  2EIN E;  3HYM B;  2XGS A;  3T8M A;  5E76 A;  1JWG A;  3HRA A;  2P9U G;  1SZ9 A;  3MGB A;  3ASD A;  1HG5 A;  4FAD A;  5LX8 A;  3ZFW A;  3TG4 A; 
#chains in the Genus database with same CATH homology
 3LXU X;  5FZR A;  4AY5 A;  1IYG A;  1XNF A;  3O4Z A;  1JWF A;  2FEZ A;  3G2W A;  3SFZ A;  2OV8 A;  2V8S E;  1SQM A;  3CLJ A;  4AEZ C;  4ACL A;  3B7T A;  5LP0 A;  3D9P A;  4KZ0 A;  4URK A;  3IEG A;  1NA0 A;  2C0L A;  5DBK A;  2NXP A;  2L6J A;  4GAA A;  2X38 A;  3S7B A;  3PRZ A;  3NZS A;  4GU5 A;  2CHZ A;  4U0Z A;  4B8A A;  3D9M A;  2FF4 A;  2VQ2 A;  4XI0 A;  4AVX A;  4BT8 A;  5KJN A;  3ZPJ A;  2PM7 A;  4FLB A;  2HO1 A;  4L2Y A;  2E0I A;  4A1G A;  3FU3 A;  3U9W A;  2IF4 A;  2AXU A;  4GB9 A;  2HM8 A;  5CMW A;  4BFR A;  4IN3 B;  4U0S A;  4WNE A;  1U3D A;  4KYO B;  5FQ4 A;  4HOR A;  3CVP A;  3Q49 B;  4U0U A;  3IHV A;  2WXG A;  2NC9 A;  2WQ6 A;  3ZIM A;  2I1K A;  3OXG A;  3D9O A;  3CIA A;  1EYH A;  3BG1 B;  5FTP A;  4FC8 A;  1UN8 A;  2KCL A;  3OAW A;  2QY7 A;  2YHE A;  2R17 C;  3HDX A;  4F3V A;  3CGH A;  3FTX A;  4KMO A;  3APF A;  2AXV A;  2E2E A;  5CCL A;  1E8X A;  4BX9 A;  4BT9 A;  4KVM A;  4UWK A;  1JPL A;  3AS5 A;  3L16 A;  5AJL A;  4FUL A;  5ARG A;  3TXN A;  5AEN A;  4FLH A;  3R7Q A;  2LNI A;  5DIZ A;  2XRZ A;  5BV0 A;  4PS8 A;  3RU0 A;  3QB2 A;  5KCM A;  4ILH B;  2XQ0 A;  1B89 A;  2HYZ A;  1NZN A;  2PM6 A;  4L2L A;  4GMJ A;  4XZ4 A;  1E7U A;  5C2Y A;  4I2W A;  2GGF A;  1WM5 A;  1UN9 A;  3ZYK A;  4CRW A;  1E8Y A;  3B7R L;  5D0Q D;  3I3N A;  2J9Q A;  3ASG A;  3HHM A;  2YIN A;  4CT0 A;  4KXK B;  5EX0 A;  4C9B B;  3B7S A;  4EBA G;  3SF4 A;  4BTB A;  5LCW C;  3ESL A;  5G55 A;  1HU3 A;  2IQC A;  1ZU2 A;  3C98 A;  3Q15 A;  5FQ6 A;  5ARF A;  2WB2 A;  4IUL A;  2VSO E;  4FP7 A;  2L0T B;  3RIB A;  3TXM A;  3UT4 A;  2WXN A;  2NSZ A;  3CVW A;  4GCO A;  3QWP A;  3CHQ A;  4CT4 A;  2CHX A;  2MHK A;  5M72 A;  4JHR A;  3SGH A;  4I1O B;  5BW8 C;  4XKB A;  4XKC A;  3WXX A;  3TJP A;  3KS2 A;  5FQ8 A;  2WXO A;  3GZS A;  3G2V A;  3CHP A;  3FWV A;  3PS6 A;  4TRQ A;  4BWR A;  2FO7 A;  4RVB A;  3UX4 A;  3QWW A;  4Q94 A;  3RKV A;  3CHR A;  4FJY A;  1Z6T A;  4EPZ A;  4RG9 A;  1P5Q A;  3AU4 A;  3FEY A;  4ANV A;  3ONK A;  4DLQ A;  2C2L A;  4Q96 A;  3O48 A;  3CVY A;  2PQR A;  2VJ8 A;  3JQ0 A;  3PZD A;  4B89 A;  2I1J A;  3CVL A;  3UMV A;  4I1M A;  2LSV A;  3G2S A;  3IHY A;  3U66 A;  3FP3 A;  3QAR A;  4GZD A;  4GZ3 A;  4DK5 A;  2WQH A;  2CG3 A;  3FUM A;  3MKQ B;  1UJJ A;  3HVE B;  4O6F A;  5G05 C;  1QNF A;  4APO A;  4R7L A;  3BG0 B;  3MZL B;  4UI9 C;  3ASF A;  4A1S A;  4GCN A;  4EEC A;  4CDN A;  2EQX A;  1FVH A;  2X6K A;  4U07 A;  4OYS A;  2C0M A;  1HFA A;  4EQF A;  4N39 A;  4JHK A;  5FT9 A;  2FUL A;  5JJT A;  4KZC A;  2YQ8 A;  1JUQ A;  1EPU A;  2LAH A;  3JYS A;  4FU3 A;  1H6K A;  2J08 A;  4XE0 A;  1HG2 A;  1GW6 A;  1X5B A;  2V4L A;  2KCV A;  2WXP A;  1PY1 A;  1N52 A;  2XHE A;  4I6E A;  2I2O A;  3PVL A;  3L54 A;  1NA3 A;  1QZ2 A;  1WY6 A;  1BPO A;  3LVR E;  1Y6I A;  3LYA A;  3TGO A;  3CVV A;  3FH5 A;  3MKQ A;  4GYO A;  5JJ6 A;  4D10 C;  1A17 A;  3HVE A;  2LSU A;  3LY9 A;  3RRN B;  1TEZ A;  3CKC A;  4UQZ A;  3ML8 A;  3MEK A;  2JEK A;  2I9C A;  4GA0 A;  4ILG A;  3P2B A;  4YVO A;  2QFC A;  4K03 A;  3S2A A;  1IQR A;  3FUD A;  2UWJ G;  4H7Y A;  3SBT B;  3VTY A;  2YNQ A;  4N3C A;  2AW6 A;  4J8F A;  3SBS A;  5G04 C;  4GA2 A;  3HIZ A;  3RO2 A;  5T4Y A;  3EDT B;  2CFZ A;  4L7T A;  3PEU B;  2X6J A;  4MLP A;  4A55 A;  4I2Z A;  4MKT A;  3FH8 A;  4RSY A;  4LER A;  2WMO A;  4WND A;  4XX5 A;  3UPV A;  2VYI A;  2VSX E;  1E7V A;  3Q5M A;  4H7X A;  4JEH A;  2BUG A;  2L0I A;  1H0A A;  2M63 A;  3ZHE B;  5ENN A;  3ONL A;  2IJG X;  2R59 A;  4E85 A;  3GZ2 A;  2WXM A;  3ZW3 A;  3URZ A;  5BV1 A;  3U3W A;  3LS8 A;  4CCA A;  3CKB A;  5EX3 A;  2X6I A;  3JUI A;  3LPZ A;  3PDN A;  3ZN3 A;  5AJD A;  3LVQ E;  1IHG A;  2XPZ A;  2A4Z A;  1LF8 A;  4XIF A;  4U63 A;  2ZU6 B;  4UI9 K;  3AS8 A;  3SNX A;  3B7U X;  3RRM B;  2OND A;  3DBS A;  3FU6 A;  3FEX A;  3SHF A;  2UY1 B;  3ULQ A;  5EKQ D;  1W3B A;  2HR2 A;  2J4B A;  1UJK A;  1E8W A;  3GZ1 A;  3NF1 A;  4FHJ A;  1INZ A;  3LKU A;  3FDH A;  4C0M A;  1WAO 1;  4PUC A;  4W9R A;  3ZHE A;  5A23 A;  2ION A;  2BF0 X;  3NQP A;  3OXL A;  1SZA A;  3TL5 A;  2GW1 A;  1IQU A;  4AM9 A;  4JC8 A;  4G11 A;  4I6J A;  3OTN A;  3RO3 A;  5FZS A;  1ELW A;  2P58 C;  2J49 A;  2WM9 A;  3IBE A;  2XRY A;  3VLF A;  5LCW J;  2GRM A;  3MV3 B;  3CVX A;  4GZC A;  4PS7 A;  3PRE A;  3L6A A;  5G2N A;  3RK6 A;  4CEM A;  1OWN A;  3ZEF A;  4GPK A;  3L22 A;  3UT7 A;  3QWV A;  1UG3 A;  3FUI A;  2UY1 A;  3EHN A;  3FUE A;  3LY8 A;  4NUR A;  3BEE A;  3FTW A;  3GW4 A;  3CK8 A;  1HH8 A;  3VTX A;  3PUJ A;  4BY6 A;  4BSX A;  3CVN A;  2WVI A;  4ATG A;  4JHJ A;  3Q47 B;  2WPV A;  3PH0 C;  3T5X A;  2XPY A;  4GZ5 A;  1EF1 C;  4HS2 A;  1VDY A;  5A6C A;  3FTS A;  4GML A;  2VGX B;  4L1B A;  3ZYL A;  4BTA A;  4FA6 A;  4I9E A;  2J4D A;  4TUU A;  2OVF A;  3QK0 A;  3FFL A;  4GYW A;  1NP7 A;  4HLE A;  2XGM A;  2XPI A;  3ESK A;  3KEZ A;  4F53 A;  3VLE A;  4Y6W A;  1OUV A;  2XCC A;  3IKO B;  4G2V A;  4F7A A;  1MHQ A;  2V5F A;  4NAC A;  5G05 J;  3EIJ A;  4UQX A;  4AIF A;  5CHE E;  4UI9 J;  4FHK A;  2WXI A;  5LFA A;  4MRU A;  3I5P A;  3QC1 A;  3RJV A;  2FBN A;  2WXJ A;  4WAF A;  3AU5 A;  4UWF A;  3ZYM A;  3FUK A;  4F1S A;  1ELK A;  2KM4 A;  3ZXS A;  3CQC B;  3FUJ A;  3ENE A;  2OVB A;  3EJN A;  2VGX A;  3PEV B;  5J08 A;  4NQ0 A;  3FUH A;  4JZY A;  2A5U A;  3JCK C;  4ME2 A;  4BX8 A;  3FUN A;  3GYZ A;  1TJC A;  3B13 A;  1KT1 A;  3MV2 B;  4EZL A;  2I6H A;  2X6H A;  4UWL A;  4HOT A;  4EZK A;  3L08 A;  3PE4 A;  3CQG B;  3K9I A;  4WWP A;  4AY6 A;  3LDZ A;  4KT6 B;  3CVQ A;  4AXH A;  4HFG A;  3U4T A;  4DJA A;  1PAQ A;  2LAI A;  3CHO A;  1HZ4 A;  2XGO A;  3FUF A;  5JHA A;  4PS3 A;  3CR3 A;  1N54 A;  5LOZ A;  2IOS A;  3I4R B;  5BPP A;  4GZ6 A;  4Q69 A;  2KAT A;  2AWI A;  2BTD A;  3APC A;  2VGY A;  4J0U A;  3FTV A;  5G04 J;  4APF A;  4WWO A;  2WXK A;  2ILR A;  4ACK A;  3CEQ A;  3Q4A B;  3UQ3 A;  3LCA A;  3D9L A;  3IV0 A;  4YND A;  3QNK A;  1UW4 B;  4LEU A;  3FU0 A;  3S7D A;  3L13 A;  3CHM A;  1U3C A;  3QKY A;  3ZYQ A;  4N2S A;  3FU5 A;  4C0E A;  3CST A;  5ANL A;  5C1D A;  3FH7 A;  2DCP A;  3JQ1 A;  5KJM A;  2R5S A;  4JPS A;  4U8H A;  3S7F A;  1H2T C;  5FJY A;  2AXZ A;  4N3A A;  3TG5 A;  4CGV A;  1PC2 A;  1E96 B;  3G2U A;  3QDN A;  3MYV A;  3T5V A;  3D9I A;  4NRH B;  4J8S A;  5EDS A;  2VTB B;  1HF8 A;  3AS4 A;  2WXR A;  4HXI A;  4AP2 A;  4AV7 A;  2IFU A;  4UQY A;  5D0O D;  4CDM A;  1ELR A;  3SI5 A;  4UWH A;  5BNW A;  1HS6 A;  3D9N A;  1Z3X A;  3SD5 A;  2V0P A;  3I4G A;  4ILI A;  4MS6 A;  4AOF A;  3KAE A;  1XGW A;  3CV0 A;  2J09 A;  1ZBP A;  2WXL A;  1H2V C;  3ML9 A;  4DI3 A;  5KJK A;  2JLB A;  2IU1 A;  4M3O A;  2MRI A;  1Y8M A;  3MKR A;  2Y3A A;  3P1U A;  2J07 A;  3PNT B;  3MA5 A;  3APD A;  3UT8 A;  3PUK A;  4B0Z A;  3FUL A;  5HQ8 A;  4CGW A;  2KZT B;  3ZGQ A;  4G23 A;  3OXF A;  5FZQ A;  4A3T A;  4I43 A;  2VTB A;  3G2T A;  2WXF A;  1HE8 A;  1HO8 A;  3R7R A;  4AJW A;  1E8Z A;  2AVP A;  4EBA A;  5JHB A;  3LEW A;  3U64 A;  4B94 A;  2IOL A;  3CSF A;  3TAX A;  2KCK A;  4PH4 B;  4Y6C A;  2XEV A;  3E4B A;  4JA9 A;  2MOW A;  4ABN A;  4K0R A;  3KD7 A;  4G25 A;  5HI7 A;  4GYY A;  4JW1 A;  2Y4U A;  4G26 A;  4LCT A;  3CHS A;  4HOQ A;  3FTY A;  2CFU A;  4UWG A;  4N3B A;  1MQS A;  3RRU A;  4J6I A;  1S0P A;  3N71 A;  4ANW A;  2DBA A;  2KZT A;  5FQ7 A;  5CCM A;  3CVU A;  2L9B A;  4GA1 A;  5T8I A;  4QFV A;  3QOU A;  1H19 A;  3PE3 A;  4RG6 A;  3FTU A;  4JEU A;  5AYW D;  3D3M A;  5ANR A;  5JJ7 A;  1QQE A;  1TJF A;  4OVV A;  3D9K A;  1H2U A;  2RG8 A;  3ASH A;  4N5C A;  5KJL A;  4HOS A;  2X6F A;  4I9C A;  4DPR A;  4DLO A;  1OWM A;  2DIW A;  4WNF A;  4V3I A;  4I17 A;  3QJZ A;  4P29 A;  4I1A A;  4A3V A;  2FI7 A;  4DI4 A;  4L23 A;  2GRL A;  2WXQ A;  4LRZ A;  3SZ7 A;  3EHM A;  4J8D A;  4XI9 A;  4WUY A;  3FY4 A;  2WXH A;  1FVF A;  1L5J A;  5BT1 A;  4HVB A;  3LJ3 A;  1KLX A;  3VLD A;  1FCH A;  3QAQ A;  1OWO A;  3L17 A;  4ANU A;  2XCB A;  3ZVV A;  4JL0 A;  4I6G A;  2X3M A;  4JXT A;  3R9A B;  4WWN A;  4OVU A;  4ANX A;  3CK9 A;  4N2Q A;  2WMN A;  2VSN A;  4TV3 A;  3CK7 A;  2VSY A;  4FJZ A;  2Q7F A;  4KBQ A;  5CMY A;  4G24 A;  2OOE A;  5AIJ A;  1E90 A;  3D9J A;  4JVS A;  3LY7 A;  2LO6 A;  4KVO A;  2PZI A;  3FTZ A;  3ZRH A;  4G1T A;  1DNP A;  1EDU A;  4IRU A;  4PDX A;  4EZJ A;  1HX8 A;  5E75 A;  2PQN A;  2Y4T A;  5FWQ A;  2CHW A;  3UUX A;  4CDR A;  4E6H A;  5J90 A;  4LUN U;  4YVQ C;  3MCX A;  2YHC A;  3NZU A;  2RD0 A;  3EIQ C;  3HYM B;  3MX3 A;  1OWP A;  4JA7 A;  1HXI A;  2XGS A;  4J8E A;  3PNL B;  5A7D B;  1YA0 A;  3T8M A;  5E76 A;  1JWG A;  2WQ7 A;  3FHE A;  1SZ9 A;  2CG2 A;  4WNG A;  5T3R A;  1DVP A;  1OWL A;  1Z3Y A;  1KT0 A;  4IYP A;  4HOU A;  3MGB A;  3ASD A;  2PL2 A;  4U04 A;  5BUZ A;  3MJW A;  1HG5 A;  2KC7 A;  4FAD A;  5LX8 A;  3ZFW A;  3S7J A;  3DPD A;  4B8C B;  3TG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...