1XGWA

The crystal structure of human enthoprotin n-terminal domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
VVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin 4
publication title The crystal structure of human enthoprotin N-terminal domain
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 51
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1xgwA00
1HFAA 1JUQA 3D9JA 3D9LA 1HX8A 1SZ9A 2DIWA 3ONLA 2L0IA 1UJJA 5J08A 3D9OA 3ZYQA 3CLJA 3D9IA 3D9PA 3G2UA 1UJKA 4GZCA 3ZYKA 2BF0X 2L0TB 4NACA 5LP0A 5CMYA 4FU3A 1EDUA 1HF8A 4HFGA 3RRUA 1INZA 1ELKA 1JWGA 2KM4A 1SZAA 1HG5A 4JXTA 3ZYMA 5CMWA 3LDZA 4GZDA 3ONKA 4Q94A 1JPLA 1XGWA 3G2SA 1EYHA 1JWFA 3G2WA 3G2TA 1DVPA 1LF8A 2DCPA 2MOWA 2LO6A 2V8SE 4AVXA 3D9KA 3D9NA 1X5BA 4FLBA 1H0AA 1MHQA 3ZYLA 3D9MA 4Q96A 1PY1A 3G2VA 1HG2A 1VDYA 2QY7A 5LOZA
chains in the Genus database with same CATH superfamily
3VLDA 4KZCA 2NSZA 4WNFA 1TNYA 4PDXA 2LXMA 3ZYMA 4KBQA 3C3QA 2P58C 5EILA 1N0RA 2ZIRA 3FH8A 3GZ1A 2AVPA 2R02A 1NI1A 2IY0C 4XI9A 3UM1A 3AS5A 3ZGQA 5CMYA 3LEWA 2WXOA 4I2ZA 4GMRA 4EZJA 3QJZA 2CFZA 4L2YA 5EKQD 2JLBA 2VJ8A 2BEDA 1LF8A 3B7BA 4XKBA 3S7JA 5FTPA 4ANXA 4JA7A 4C48B 5AAOA 2XHEA 4BEPA 5T3RA 3SD5A 3Q7FA 4XEIG 1OCRE 1OY3D 3OXLA 3V2XA 4FLHA 3ZRHA 1TR4A 5CBOA 3G2TA 3DXKG 2B0OE 4AY6A 4NRHB 3UUXA 3J5PA 3NAWA 3UM2A 2I1JA 2VGYA 3FH7A 2VTBA 1IQUA 2YHCA 3ZHEB 2X6FA 4XE0A 5JJ7A 2YQ8A 3CHQA 3NOCD 3VLEA 4CGWA 1FT1A 1KT0A 2VQ2A 2OV8A 2JEKA 4TRQA 4UUCA 4GTTA 3Q7AA 4YVOA 3ZYKA 4N3CA 5FQ6A 2GRPB 3R7QA 1D9SA 4I1MA 5EYLA 3FHEA 5KJMA 1MHQA 3T8KA 3C5RA 2A5EA 3FTZA 5KBAA 4K0RA 3P2BA 1TEZA 4BY6A 4C9BB 3E30A 3UMVA 2XGMA 4J0UA 1A5EA 4GYOA 1IHBA 3G2WA 5CHEE 3CQGB 4M3OA 3MJWA 1Z6TA 4DX5D 4KYOB 4GTSA 2ILRA 3HXDA 4HRNA 2OVFA 4U8HA 2WM9A 3CHOA 3JUIA 2V8SE 3L82A 1MX4A 1Y8MA 3L9TA 4U96D 3HXCA 2DIWA 2PL2A 4OVUA 4WWPA 5H7PA 2H6HA 3FDHA 1TN6A 4L1BA 4L7TA 3CVVA 3U9WA 2IO3C 2PZIA 3JQ1A 3E34A 1AP7A 2ZISA 2FULA 4B93B 1UN9A 3MV2B 4E6HA 2WXKA 4F6RD 4HRMB 3DSXA 3FUIA 1N4SA 1NFIE 2GGFA 4KVOA 4AOFA 1TJCA 3C98A 4N3BA 4N39A 1ZU2A 1KPSB 4BX8A 2F8XK 2I9CA 1Z3XA 1K1BA 5ITZF 5HRYA 3O4ZA 1QQEA 4I2WA 4KMOA 3EHMA 3SFZA 3DPDA 3URZA 3HXFA 3TWRA 4P29A 4UWKA 2HM8A 2RFMA 1E90A 5JA4D 1UOHA 3RK6A 2I6HA 3PNLB 4URKA 1Y6IA 1UW4B 3FH5A 4I43A 5T4YA 3ZFWA 2KXPC 3E4BA 3RKVA 3V30A 3GZ2A 2B6CA 3HVEA 1KZOA 1MX6A 4JL0A 1U3CA 3DRAA 4EECA 4ATZD 1Q2ZA 3OTNA 1XNFA 5ENRD 4N5QA 2C2LA 2R5SA 2WXPA 1OCZE 4QQIA 5E75A 4F1SA 3CVLA 3L6AA 1PAQA 1JWGA 3N71A 5BXUA 3B7UX 2DBAA 5FWQA 2MOWA 4DI3A 4UWHA 1W3BA 4ZHBA 4G11A 4UWFA 5C1DA 3MEKA 1TNUA 4GZ3A 2WXLA 1FCHA 2PM6A 4PS7A 4BESA 3ONKA 4I17A 5CEDB 3CV0A 2KZTA 3EJNA 4Q69A 5ANRA 2HYZA 3SY2A 3RRMB 4BERA 3FUFA 3ONLA 2J07A 5FINA 3OXGA 1HH8A 5AN8A 5CCLA 3ASDA 3MKRA 3IBEA 4F1PA 1FVHA 3LY7A 4OVVA 3TL5A 4UQYA 5AENA 1N11A 4EZLA 2P9SG 4DPRA 2R59A 3RSEG 3ZPJA 1U3DA 4I9CA 4DLOA 4B8CB 3G2UA 1MYOA 2GRRB 3DSSA 2L6JA 1JPLA 1DVPA 3TAXA 3Q15A 1FPPA 2V4HC 5CEAA 5JHBA 5D0QD 4HFGA 4EZKA 4JXTA 5ENSD 3CK8A 3PUKA 3RO2A 3L17A 3FUKA 1H2TC 3ASGA 5KNHD 3FY4A 1X81A 3CGHA 2XPYA 2WXMA 4AY5A 4CGVA 3BQOA 3MZLB 4LSZE 4BTAA 3GW4A 4J7WA 2X6IA 4NQ0A 1RZ4A 3O48A 4G25A 4EQFA 3DPYA 5EDSA 2I2OA 5LCWC 3FU5A 2PQNA 3UT8A 2EIKE 1QNFA 1JCQA 5ENNA 4HOUA 3R9AB 1IHGA 3DXMG 1WY6A 3D9IA 2CHWA 3HRAA 4ANWA 3FWVA 3Q47B 3BG0B 3V2OA 4DK5A 4N3AA 3L54A 3JXIA 3UQ3A 2KC7A 3Q9UC 3S7BA 1IKND 1SZ9A 4TXRA 3PE3A 5LX8A 4RQIA 2XRYA 3FUMA 4GB9A 2X6HA 4JD2G 5CMWA 2J9QA 3CSFA 4JC8A 4OYSA 4Q94A 2QYUA 3KSLA 4JB8P 3KSQA 1ZB1A 4TUMA 2FO1E 3HXEA 3EU9A 3AS8A 4ILGA 2I1KA 2IOSA 4MLPA 1BI7B 3SQVA 4IULA 1EF1C 3G2SA 4Z68A 3CIAA 1SA4A 4FADA 2DVWA 1TNOA 4N2SA 1PC2A 3DEPA 4UQXA 4A1SA 5JHAA 4ACKA 3V31A 3ULEG 3PEVB 5LP0A 3CQCB 2RKKA 2LNIA 3BUAA 3SFYA 5J90A 3CHPA 5ENPD 4KT6B 2XS8A 1H2VC 2AWIA 2KATA 2J8SD 1E8WA 3S7DA 4A55A 2IU1A 4YVQC 3UKUG 5BW8C 2C0LA 3ZXPA 1OT8A 3D9HA 4YNDA 5KNGA 3UPVA 4TUUA 4GMLA 5FT9A 4B94A 2P9KG 5T8IA 2GW1A 1QBQA 2GRNB 4ACLA 5AARA 4AV7A 2YINA 4B8AA 5BNWA 2WMNA 4MS6A 4JHRA 3TWVA 4HBDA 2IOLA 2WXQA 4IYPA 3CVYA 5CECB 3QB2A 4I9EA 2YHEA 4N2QA 4G24A 3CSTA 4BETA 4U7EB 1E7UA 5CERB 2LSUA 4J8EA 2BF0X 2YNQA 1OUVA 4U8VD 3V79K 4MRUA 4RG6A 3NZSA 5LFAA 1N94A 4GAAA 3EHRA 3BEEA 3IKOB 4PH4B 4DUIA 2X38A 5G05J 4GMJA 3CKCA 4DRXE 1E8YA 3UKRG 1HO8A 4YDYA 3AS4A 3CLJA 2MHKA 3FU0A 1OWMA 3TG4A 2XEEA 3ZKJA 3EIQC 2FI7A 2XZTG 1D8DA 4GA1A 2XRZA 1YMPA 4J8SA 1BLXB 3MGBA 1HX8A 4FA6A 3IXEA 4GPMA 5EN5D 1DCQA 3FTXA 3TWTA 2P2CP 3TXNA 2XPIA 1LTXA 2CHXA 4GTRA 4G23A 4C0EA 3L13A 2R17C 4I6GA 3U64A 4EBAG 3EUVA 5A7DB 4LNGA 2WMOA 3ZYLA 3EIJA 2Y1LE 3B7TA 3HG0D 1O1RA 3FU6A 3LY9A 4DI4A 3FU3A 4HS2A 3BU8A 2AXZA 3APDA 4WNGA 5AYWD 3PEUB 2XGSA 3ZXSA 3AG1E 2VGXB 4GZDA 4CYMD 2KBXA 1YCSB 2XCBA 4D10C 2QZAA 4GTQA 3LVRE 3LS8A 4GZCA 3CHMA 5G04J 2XPZA 2XENA 3PZ4A 3TWQA 3MKQA 5BV0A 3FULA 2RG8A 3E33A 3FTWA 4AJWA 3B95A 3QC1A 1JUQA 3MX3A 3L22A 4G2VA 3PE4A 3TG5A 3ENEA 2CG2A 3UM0A 3MCXA 3MYVA 4BT9A 1Z3YA 1D8EA 3VTXA 1K1AA 3FUNA 5J08A 3WXXA 4U63A 2XQ0A 4HB5A 1G3NB 3ZU7B 3FTSA 3IHVA 3AJIA 4CDRA 2Y4TA 4WUYA 3PDNA 3I3NA 4GYYA 3ML8A 2P9LG 3DSTA 3D9LA 1H6PA 3ESLA 4OAUC 1O1SA 4UWLA 4LNUD 3B13A 2XGOA 4UWGA 3X2QE 4I1AA 1OWNA 4J6IA 1DC2A 5M72A 3U4TA 2WXRA 2ZXWE 3C3RA 5KJKA 3ASNE 1JCRA 2QY7A 3D9JA 3FUDA 3FFLA 4G8KA 3UT7A 4NIKA 3CVWA 4KXKB 1OWLA 1KT1A 3ZIMA 4CZ2D 3J5QB 3AG2E 3LKUA 2VTBB 1LD7A 3NF1A 4GTPA 3DSUA 3CHSA 3Q73A 3E37A 4PS8A 2J49A 3B7RL 3EHQA 4DX1A 5EIBE 4O6FA 5EX3A 4O1PA 2UWJG 3QNKA 5D66A 1V54E 2EINE 3PZDA 5AQAA 5B1AE 4JHJA 1S63A 2F0YA 3CVQA 3TXMA 3QWPA 3RRUA 4ANUA 2ZU6B 3CK9A 2R05A 3QWWA 4DX6D 1PY1A 1X5BA 3MV3B 3PRZA 5BT1A 3KD7A 3P1UA 4WNEA 5HI7A 4HQDA 3OAWA 4DLQA 5D0OD 4R7LA 3TWUA 2GRQB 2ETAA 2DYRE 3G2VA 4M7CA 1HZ4A 5LOZA 4EBAA 4L9PA 2XS1A 3ZHEA 4HOQA 1H6OA 1OCCE 1BPOA 2WXGA 2WB2A 3C3OA 1N9AA 4FU3A 3LPZA 4FJZA 5ENQD 4AEZC 4LERA 4WAFA 2Y3AA 2EIJE 3ABKE 3DBSA 4AM9A 4OAVB 3UTMA 4NURA 1MX2A 1WG0A 2EQXA 1NA0A 4K5CA 4CEMA 4BTBA 1SVXA 5FQ8A 2OVBA 4CDNA 2XEVA 3OXFA 1SA5A 2A5UA 2XEHA 5G05C 2IO2C 3SHFA 4CT0A 4GYWA 3IEGA 1OWPA 3PZ1A 4U95D 4JHKA 2BTDA 1Z5SC 5ARFA 2F37A 2EIME 5BPPA 4HORA 3BG1B 3QKYA 3KEZA 1N4QA 2CHZA 2P9PG 3ULYA 2BKGA 2V5FA 3PNTB 2R2LA 4UI9J 3SI5A 1JCSA 1UJKA 3HDXA 3UIOC 1MJ0A 5B3SE 4H7YA 2J4BA 1N4RA 3PS6A 5FZRA 4WWOA 1KLXA 2UY1B 3LCAA 4FLBA 3T8MA 4HOTA 3QARA 5G55A 2OOEA 4U04A 3RO3A 1YA0A 2IEJA 2VGXA 2LUHA 4V3IA 4WWNA 1N95A 2LXLA 1IQRA 1N54A 4GZ5A 3PVLA 3R9MA 2GRLA 4BX9A 2QFCA 2ZGGA 2BKKB 1QYMA 4HLLA 4AXHA 2PNNA 1V55E 4X8QA 5G04C 4B89A 2L0TB 3GYZA 4U0ZA 2WXFA 1TN7A 4RVBA 3ML9A 5AQ7A 2J08A 5CCMA 4O60A 2WXNA 3SGHA 4I6JA 1VDYA 2HE0A 5FZQA 4APFA 3ASFA 1GW6A 3LVQE 4K5BA 4ZFHA 3SBSA 3I4RB 3EU5A 1OCOE 5A6CA 3D9MA 3PH0C 3SO8A 3FTVA 2DWZA 2EILE 3Q49B 4U8YD 2NXPA 3JCKC 4LG6A 2ETCA 2HR2A 5DBKA 1U2VG 1E7VA 4Y6CA 5C2YA 3D9NA 1E8XA 1NZNA 3LY8A 3D3MA 3Q79A 4RSYA 2KZTB 5FQ7A 5FIOA 3R7RA 2VSOE 2L9BA 3ASHA 5ENTD 3DWLG 3FTUA 1LD8A 4FP7A 5HKPA 5BV1A 4U07A 3QAQA 4CCAA 3HYMB 4Y6WA 2ONDA 1ZBPA 2HO1A 3Q4AB 2IJGX 4O1OA 3S2AA 3E32A 3W9GA 1HFAA 5DIZA 4RG9A 4IRUA 2RFAA 2H6IA 5EYPF 4JVSA 3T5XA 4YDOA 4TXQA 1S0PA 3CHRA 1NL4A 5KJNA 4HNAD 3JYSA 3PZ2A 1NA3A 3QDNA 1TYQG 2DCPA 4DX2A 3U66A 4B0ZA 4HVBA 3DEOA 4I1OB 3D9OA 4LNBA 1IYGA 1EDUA 3AU4A 4K03A 3S7FA 4ME2A 1E96B 4LUNU 4BFRA 2KCVA 3AG3E 4FULA 4Q96A 4KZ0A 3APFA 2ETBA 3ABME 4LRZA 4JW1A 3ABLE 1K8KG 2DZNA 2AJAA 3APCA 3FUEA 4TXPA 4JEUA 4E85A 1KZPA 1SZAA 4WNDA 3WG7E 3AU5A 2FEZA 5LCWJ 2CG3A 1EYHA 3CVUA 1H6KA 1QZ2A 4GTVA 4C0MA 3VTYA 4GTOA 4CT4A 4I6EA 1O1TA 2V0PA 4ILHB 1TN8A 4YDEA 1ELWA 3ASOE 4GU5A 4U0SA 3TWSA 4ANVA 5ANLA 3RU0A 3FUHA 4J8YA 5E76A 1ELRA 4BSXA 4FJYA 4XX5A 4YDWA 3ISMC 4G8LA 3UINC 3NBNB 4HRLA 3B7SA 3CK7A 3EHNA 3UXGA 1L5JA 5ARGA 1ELKA 2R03A 2H6FA 4L2LA 4KVMA 2X6JA 4J8FA 3GZSA 2IFUA 2QYJA 3F6QA 3ZUVB 3Q5MA 2KCLA 5B1BE 2MRIA 3SFXA 2ZGDA 3T9KA 1N52A 4RLYA 5A23A 2F8YA 2X6KA 1BI8B 2WVIA 3JQ0A 3LJ3A 3NOGD 5AIJA 5IY5E 2M63A 3UIPC 1BD8A 3NZUA 1HG2A 2BUGA 2WPVA 5KWDA 3W9FA 3ZEFA 1YYHA 2E2EA 3ESKA 1INZA 2GROB 5KCMA 1UG3A 3NQPA 3IV0A 4GPKA 3DSVA 5EX0A 2PQRA 4AIFA 2LSVA 1WAO1 4L23A 4UI9C 3QOUA 5JJ6A 4A3VA 1O5MA 2IQCA 1TNBA 3EDTB 1UJJA 1HE8A 4EHMA 4K5AB 4HLEA 3VLFA 4FHJA 2UY1A 1K3ZD 1TJFA 4F53A 4IN3B 5CRVA 4FHKA 5AQBA 2MYOA 2WQHA 4LEUA 2LAIA 3Q75A 2V4LA 3D9KA 2GRMA 2IF4A 3LXUX 2VYIA 4G26A 5FZSA 2J09A 5JJTA 3CVNA 3JUEA 4HXIA 1UN8A 2KCKA 5AJDA 1S70B 3JXJA 2AXVA 4PS3A 3PREA 2FF4A 3FEXA 1H19A 4TV3A 5FQ4A 3TJPA 4XI0A 1N4PA 1TNZA 4CRWA 4XIFA 1JWFA 4AVXA 1B89A 4ABNA 2Y0BG 4DX7D 3CVXA 3L08A 4H7XA 3L16A 3FUJA 3KS2A 2J4DA 4GA2A 4JZYA 3HXBA 5G2NA 3CEQA 3FTYA 1OXJA 2WXHA 2LAHA 2OCCE 5KJLA 4W9RA 1AWCB 5AJLA 3TGOA 2V5QC 3RIBA 4ATGA 4FC8A 3TWWA 3K9IA 5FJYA 2WQ6A 3ULQA 1FT2A 4PUCA 4CDMA 2WQ7A 5HQ8A 2NC9A 3PZ3A 3LJNA 3Q78A 2LO6A 2DYSE 5AQ9A 2A4ZA 1N0QA 3LYAA 1OWOA 3U3WA 2AW6A 1EPUA 2AXUA 4JEHA 1HS6A 4EPZA 3FEYA 4MBGA 1WM5A 3UT4A 3CVPA 1MZCA 4GZ6A 4QFVA 3AG4E 2XZDG 4HI9A 5JMND 2OEWA 4BSZB 2Q7FA 1HU3A 3UX4A 5BUZA 4JA9A 2IONA 3QK0A 3SZ7A 2JABA 4HI8A 5D2MC 2Y69E 4XKCA 3SF4A 5HS0A 3I4GA 3DSWA 3ZN3A 1WDYA 4U0UA 2L0IA 3ZNGA 3UM3A 4JPSA 1HF8A 2H6GA 2VSXE 4A1GA 2QC9A 3TWXA 4F7AA 4UQZA 3MKQB 2XCCA 3HIZA 3PUJA 2WXIA 1HXIA 1IXVA 4ILIA 3SNXA 2DZOA 4LCTA 1A17A 2PM7A 2OEVA 1P5QA 3LDZA 1FVFA 3KEAA 3FP3A 2E0IA 4N5CA 3C72A 4AP2A 4J8DA 3T5VA 5BXOA 4GTMA 5CBNA 1DCEA 3ZYQA 3D9PA 3RAUA 2VSNA 3AAAC 4G1TA 1HG5A 1SQMA 1BU9A 2WXJA 4XZ4A 3UI2A 4GA0A 3KAEA 4HOSA 1MQSA 5ENOD 4GCOA 2X3MA 4A63B 3CKBA 4A3TA 4APOA 4F3VA 4GCNA 3QWVA 3SBTB 3HHMA 3MA5A 2FO7A 2VSYA 4NACA 3NB2A 2KM4A 2L6BA 3RRNB 1S64A 2CFUA 2FBNA 1NP7A 2C0MA 4DJAA 1H2UA 1RW2A 2P9UG 1SW6A 3ZW3A 5EIDA 2Y4UA 2NYJA 3RJVA 1E8ZA 2P9IG 4BT8A 4BWRA 3I5PA 3ZVVA 1DNPA 2P9NG 3IHYA 4MKTA 3CR3A 3HVEB 1XGWA 2RD0A 4UI9K 1H0AA 3Q9NC 5CRUA 2VGEA
chains in the Genus database with same CATH topology
3APFA 3D9LA 4LRZA 4JW1A 4I9CA 4DLOA 3VLDA 4KZCA 3ESLA 4B8CB 3G2UA 2NSZA 4WNFA 4UWLA 4PDXA 3B13A 2XGOA 3APCA 4UWGA 3FUEA 4JEUA 4E85A 3ZYMA 4KBQA 1SZAA 4WNDA 2L6JA 2P58C 4I1AA 1OWNA 4J6IA 3AU5A 2FEZA 1JPLA 3U4TA 2CG3A 1EYHA 2WXRA 5LCWJ 5M72A 3FH8A 1DVPA 1H6KA 1QZ2A 4C0MA 3CVUA 3VTYA 5KJKA 3GZ1A 4CT4A 2AVPA 3TAXA 4I6EA 2QY7A 2V0PA 3Q15A 4ILHB 4XI9A 3D9JA 3FUDA 3FFLA 5JHBA 1ELWA 3AS5A 3UT7A 3ZGQA 5CMYA 3LEWA 2WXOA 4GU5A 4KXKB 5D0QD 3CVWA 4HFGA 4I2ZA 4EZKA 4EZJA 3QJZA 4U0SA 1OWLA 1KT1A 2CFZA 4L2YA 4JXTA 5EKQD 2JLBA 3ZIMA 2VJ8A 3CK8A 3PUKA 5ANLA 3RO2A 4ANVA 3LKUA 3L17A 3RU0A 2VTBB 3NF1A 3FUKA 1H2TC 3ASGA 3FUHA 1LF8A 3CHSA 4XKBA 3FY4A 3S7JA 5E76A 5FTPA 3CGHA 2XPYA 2WXMA 4AY5A 1ELRA 4CGVA 4BSXA 4ANXA 4FJYA 4JA7A 4XX5A 2XHEA 3MZLB 4PS8A 4BTAA 3GW4A 2J49A 5T3RA 3SD5A 3B7RL 2X6IA 3B7SA 4NQ0A 3CK7A 3EHNA 3OXLA 3O48A 1L5JA 4O6FA 5ARGA 4G25A 1ELKA 4EQFA 5EX3A 5EDSA 4FLHA 2I2OA 5LCWC 3ZRHA 2UWJG 4L2LA 4KVMA 3FU5A 3QNKA 3G2TA 2X6JA 4J8FA 3GZSA 2IFUA 2PQNA 3UT8A 4AY6A 3PZDA 4NRHB 1QNFA 3Q5MA 3UUXA 2KCLA 5ENNA 4HOUA 3R9AB 1IHGA 2MRIA 2I1JA 1WY6A 2VGYA 4JHJA 3D9IA 2CHWA 3FH7A 3CVQA 3TXMA 2VTBA 3QWPA 1N52A 3FWVA 1IQUA 2YHCA 3ZHEB 3Q47B 3RRUA 4ANUA 2X6FA 3BG0B 5A23A 2ZU6B 4XE0A 5JJ7A 4DK5A 3CK9A 2X6KA 4N3AA 3L54A 2YQ8A 3QWWA 3CHQA 3VLEA 4CGWA 3UQ3A 2WVIA 2KC7A 3JQ0A 3LJ3A 5AIJA 3S7BA 2M63A 1PY1A 1KT0A 2VQ2A 3NZUA 1X5BA 1HG2A 2OV8A 2JEKA 3MV3B 3PRZA 4TRQA 1SZ9A 2BUGA 2WPVA 3PE3A 3ZEFA 5LX8A 4YVOA 3ZYKA 5BT1A 3KD7A 2E2EA 3ESKA 3P1UA 2XRYA 4WNEA 4N3CA 5HI7A 3FUMA 1INZA 4GB9A 5FQ6A 3R7QA 2X6HA 5KCMA 5CMWA 1UG3A 4I1MA 2J9QA 3NQPA 3CSFA 3IV0A 4JC8A 4OYSA 4Q94A 4GPKA 3OAWA 4DLQA 5EX0A 2PQRA 5D0OD 4R7LA 4AIFA 3FHEA 2LSVA 5KJMA 1WAO1 4L23A 1MHQA 3G2VA 3FTZA 4UI9C 3QOUA 1TEZA 4K0RA 3P2BA 1HZ4A 2IQCA 5JJ6A 5LOZA 3ZHEA 4A3VA 4BY6A 4HOQA 4C9BB 4EBAA 3EDTB 1UJJA 3AS8A 1BPOA 1HE8A 2WXGA 3UMVA 2WB2A 4HLEA 4FU3A 2XGMA 3LPZA 3VLFA 4FHJA 2UY1A 4ILGA 1TJFA 4FJZA 2I1KA 4F53A 4IN3B 4J0UA 2IOSA 4FHKA 4MLPA 4LERA 4AEZC 4WAFA 4IULA 2Y3AA 1EF1C 4GYOA 3G2SA 3DBSA 3G2WA 2WQHA 3CIAA 3CQGB 4LEUA 5CHEE 4AM9A 2LAIA 4M3OA 4FADA 3MJWA 2V4LA 3D9KA 2GRMA 4N2SA 1PC2A 2IF4A 3LXUX 2VYIA 4UQXA 4G26A 5FZSA 2J09A 1Z6TA 5JJTA 4NURA 3CVNA 4A1SA 2EQXA 4KYOB 5JHAA 4ACKA 1NA0A 4HXIA 1UN8A 2KCKA 5AJDA 3PEVB 4CEMA 4BTBA 2AXVA 4PS3A 5LP0A 3CQCB 2LNIA 3PREA 2ILRA 2FF4A 5J90A 2OVFA 3CHPA 3FEXA 4U8HA 1H19A 5FQ8A 4KT6B 2OVBA 1H2VC 4TV3A 4CDNA 5FQ4A 3TJPA 4XI0A 2WM9A 4CRWA 2AWIA 2KATA 3CHOA 4XIFA 1JWFA 3JUIA 2XEVA 3OXFA 2V8SE 2A5UA 4AVXA 1E8WA 3S7DA 1B89A 5G05C 4ABNA 4A55A 2IU1A 4YVQC 3SHFA 5BW8C 2C0LA 4CT0A 1Y8MA 4GYWA 4YNDA 3IEGA 3CVXA 1OWPA 2DIWA 3UPVA 4TUUA 3L08A 4GMLA 2PL2A 4H7XA 4JHKA 5FT9A 4B94A 4OVUA 2BTDA 4WWPA 3L16A 3FUJA 5T8IA 5ARFA 3KS2A 5BPPA 4HORA 2GW1A 3BG1B 4ACLA 2J4DA 3FDHA 4GA2A 4JZYA 3QKYA 5G2NA 3KEZA 3CEQA 4L1BA 2CHZA 4L7TA 3CVVA 3U9WA 3FTYA 2V5FA 4AV7A 2YINA 4B8AA 3PNTB 2WXHA 2PZIA 5BNWA 3JQ1A 2WMNA 4UI9J 4MS6A 3SI5A 2LAHA 5KJLA 1UJKA 4W9RA 4JHRA 5AJLA 3TGOA 2IOLA 3RIBA 4ATGA 4FC8A 3HDXA 2WXQA 3K9IA 5FJYA 2WQ6A 2FULA 4IYPA 3ULQA 3CVYA 4CDMA 4H7YA 4PUCA 2J4BA 2WQ7A 3PS6A 2NC9A 5HQ8A 1UN9A 3MV2B 3QB2A 5FZRA 4E6HA 4WWOA 1KLXA 2UY1B 2LO6A 2WXKA 4I9EA 2YHEA 3LCAA 2A4ZA 4FLBA 3T8MA 4N2QA 4HOTA 3QARA 4G24A 3FUIA 3CSTA 3LYAA 1OWOA 5G55A 2OOEA 4U04A 3U3WA 2AW6A 1EPUA 1E7UA 2AXUA 3RO3A 1YA0A 2LSUA 4J8EA 4JEHA 2VGXA 1HS6A 4ANWA 2BF0X 4EPZA 2YNQA 2GGFA 3FEYA 1OUVA 1WM5A 4KVOA 3UT4A 3CVPA 4AOFA 1TJCA 4V3IA 4GZ6A 4WWNA 4QFVA 3C98A 4MRUA 4N3BA 1IQRA 1N54A 4GZ5A 4RG6A 3PVLA 2Q7FA 3NZSA 1HU3A 4N39A 3UX4A 5LFAA 4GAAA 1ZU2A 5BUZA 2GRLA 3BEEA 3IKOB 4BX9A 4JA9A 4PH4B 2QFCA 2X38A 2IONA 5G05J 4GMJA 3CKCA 4AXHA 1E8YA 4BX8A 1HO8A 3AS4A 3CLJA 3QK0A 2MHKA 2I9CA 3SZ7A 5G04C 3FU0A 4B89A 1OWMA 2L0TB 3GYZA 4U0ZA 3TG4A 2WXFA 1Z3XA 4XKCA 4RVBA 3EIQC 3O4ZA 1QQEA 2FI7A 3SF4A 3ML9A 3I4GA 2J08A 4I2WA 4KMOA 3EHMA 3SFZA 5CCMA 3DPDA 4GA1A 3URZA 2XRZA 3ZN3A 2WXNA 3SGHA 4P29A 4I6JA 4J8SA 1VDYA 4U0UA 4UWKA 3MGBA 1HX8A 2HM8A 2L0IA 5FZQA 4FA6A 1E90A 4APFA 3ASFA 3FTXA 1GW6A 4JPSA 1HF8A 3RK6A 3TXNA 2XPIA 3LVQE 2I6HA 3PNLB 2CHXA 2VSXE 4URKA 1Y6IA 3SBSA 4G23A 4C0EA 3L13A 1UW4B 2R17C 3FH5A 3I4RB 4I43A 4I6GA 3U64A 4A1GA 4EBAG 4F7AA 5A7DB 5A6CA 2WMOA 4UQZA 3EIJA 3B7TA 3D9MA 3MKQB 5T4YA 3ZFWA 3ZYLA 3FU6A 3LY9A 3PH0C 2XCCA 3FU3A 3E4BA 3RKVA 4DI4A 4HS2A 3FTVA 3HIZA 3PUJA 2WXIA 1HXIA 3GZ2A 4ILIA 3HVEA 3Q49B 2AXZA 3APDA 3SNXA 2NXPA 4WNGA 5AYWD 3PEUB 4LCTA 2XGSA 1A17A 3JCKC 3ZXSA 2PM7A 1P5QA 1U3CA 4JL0A 3LDZA 4EECA 1FVFA 2VGXB 2HR2A 4GZDA 5DBKA 3OTNA 3FP3A 1XNFA 2E0IA 2XCBA 4N5CA 4D10C 2C2LA 4AP2A 4J8DA 3T5VA 1E7VA 4Y6CA 5C2YA 3D9NA 1E8XA 1NZNA 3LVRE 3LY8A 3LS8A 3D3MA 2R5SA 2WXPA 4RSYA 2KZTB 5E75A 5FQ7A 4F1SA 3ZYQA 3R7RA 3D9PA 4GZCA 2VSOE 3CVLA 3CHMA 2L9BA 2VSNA 3ASHA 4G1TA 3FTUA 3L6AA 5G04J 2XPZA 1PAQA 4FP7A 1JWGA 4U07A 3QAQA 1HG5A 1SQMA 5BV1A 2WXJA 3N71A 3MKQA 4XZ4A 4CCAA 3HYMB 4GA0A 3B7UX 2DBAA 3KAEA 4Y6WA 4HOSA 2ONDA 1ZBPA 2HO1A 5FWQA 2MOWA 3FULA 5BV0A 3Q4AB 4DI3A 1MQSA 2IJGX 4UWHA 4GCOA 3S2AA 1W3BA 2X3MA 2RG8A 3CKBA 4A3TA 4G11A 3FTWA 4APOA 4UWFA 4F3VA 4GCNA 3QWVA 5C1DA 3SBTB 1HFAA 4AJWA 3QC1A 1JUQA 3MEKA 4GZ3A 2WXLA 3HHMA 3MX3A 4RG9A 3MA5A 4IRUA 2FO7A 5DIZA 3L22A 4JVSA 4G2VA 3T5XA 3PE4A 2VSYA 4NACA 1S0PA 3CHRA 1FCHA 3TG5A 5KJNA 3ENEA 2KM4A 2PM6A 4PS7A 2CG2A 3RRNB 2CFUA 2FBNA 1NP7A 2C0MA 3JYSA 3ONKA 4DJAA 4I17A 3MCXA 3CV0A 2KZTA 1NA3A 3EJNA 3QDNA 2DCPA 4Q69A 1H2UA 3MYVA 4BT9A 5ANRA 1Z3YA 2HYZA 3RRMB 3ZW3A 3U66A 3FUFA 3ONLA 4B0ZA 3VTXA 2Y4UA 3FUNA 3RJVA 1E8ZA 2J07A 4BT8A 3OXGA 1HH8A 4BWRA 4HVBA 5CCLA 3I5PA 3ASDA 4I1OB 5J08A 3MKRA 1DNPA 3D9OA 3WXXA 3ZVVA 4U63A 3IBEA 2XQ0A 1IYGA 1EDUA 1FVHA 3AU4A 3LY7A 4OVVA 4K03A 3IHYA 4MKTA 3S7FA 3TL5A 4UQYA 4ME2A 1E96B 3CR3A 3FTSA 3HVEB 4LUNU 4BFRA 3IHVA 1XGWA 2KCVA 5AENA 4EZLA 4CDRA 2Y4TA 2RD0A 4WUYA 3PDNA 4DPRA 4UI9K 3I3NA 1H0AA 4FULA 4Q96A 2R59A 4GYYA 3ML8A 3ZPJA 1U3DA 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFA A;  1JUQ A;  3D9J A;  3D9L A;  1HX8 A;  1SZ9 A;  2DIW A;  3ONL A;  2L0I A;  1UJJ A;  5J08 A;  3D9O A;  3ZYQ A;  3CLJ A;  3D9I A;  3D9P A;  3G2U A;  1UJK A;  4GZC A;  3ZYK A;  2BF0 X;  2L0T B;  4NAC A;  5LP0 A;  5CMY A;  4FU3 A;  1EDU A;  1HF8 A;  4HFG A;  3RRU A;  1INZ A;  1ELK A;  1JWG A;  2KM4 A;  1SZA A;  1HG5 A;  4JXT A;  3ZYM A;  5CMW A;  3LDZ A;  4GZD A;  3ONK A;  4Q94 A;  1JPL A;  1XGW A;  3G2S A;  1EYH A;  1JWF A;  3G2W A;  3G2T A;  1DVP A;  1LF8 A;  2DCP A;  2MOW A;  2LO6 A;  2V8S E;  4AVX A;  3D9K A;  3D9N A;  1X5B A;  4FLB A;  1H0A A;  1MHQ A;  3ZYL A;  3D9M A;  4Q96 A;  1PY1 A;  3G2V A;  1HG2 A;  1VDY A;  2QY7 A;  5LOZ A; 
#chains in the Genus database with same CATH topology
 3VLD A;  4KZC A;  2NSZ A;  4WNF A;  1TNY A;  4PDX A;  2LXM A;  3ZYM A;  4KBQ A;  3C3Q A;  2P58 C;  5EIL A;  1N0R A;  2ZIR A;  3FH8 A;  3GZ1 A;  2AVP A;  2R02 A;  1NI1 A;  2IY0 C;  4XI9 A;  3UM1 A;  3AS5 A;  3ZGQ A;  5CMY A;  3LEW A;  2WXO A;  4I2Z A;  4GMR A;  4EZJ A;  3QJZ A;  2CFZ A;  4L2Y A;  5EKQ D;  2JLB A;  2VJ8 A;  2BED A;  1LF8 A;  3B7B A;  4XKB A;  3S7J A;  5FTP A;  4ANX A;  4JA7 A;  4C48 B;  5AAO A;  2XHE A;  4BEP A;  5T3R A;  3SD5 A;  3Q7F A;  4XEI G;  1OCR E;  1OY3 D;  3OXL A;  3V2X A;  4FLH A;  3ZRH A;  1TR4 A;  5CBO A;  3G2T A;  3DXK G;  2B0O E;  4AY6 A;  4NRH B;  3UUX A;  3J5P A;  3NAW A;  3UM2 A;  2I1J A;  2VGY A;  3FH7 A;  2VTB A;  1IQU A;  2YHC A;  3ZHE B;  2X6F A;  4XE0 A;  5JJ7 A;  2YQ8 A;  3CHQ A;  3NOC D;  3VLE A;  4CGW A;  1FT1 A;  1KT0 A;  2VQ2 A;  2OV8 A;  2JEK A;  4TRQ A;  4UUC A;  4GTT A;  3Q7A A;  4YVO A;  3ZYK A;  4N3C A;  5FQ6 A;  2GRP B;  3R7Q A;  1D9S A;  4I1M A;  5EYL A;  3FHE A;  5KJM A;  1MHQ A;  3T8K A;  3C5R A;  2A5E A;  3FTZ A;  5KBA A;  4K0R A;  3P2B A;  1TEZ A;  4BY6 A;  4C9B B;  3E30 A;  3UMV A;  2XGM A;  4J0U A;  1A5E A;  4GYO A;  1IHB A;  3G2W A;  5CHE E;  3CQG B;  4M3O A;  3MJW A;  1Z6T A;  4DX5 D;  4KYO B;  4GTS A;  2ILR A;  3HXD A;  4HRN A;  2OVF A;  4U8H A;  2WM9 A;  3CHO A;  3JUI A;  2V8S E;  3L82 A;  1MX4 A;  1Y8M A;  3L9T A;  4U96 D;  3HXC A;  2DIW A;  2PL2 A;  4OVU A;  4WWP A;  5H7P A;  2H6H A;  3FDH A;  1TN6 A;  4L1B A;  4L7T A;  3CVV A;  3U9W A;  2IO3 C;  2PZI A;  3JQ1 A;  3E34 A;  1AP7 A;  2ZIS A;  2FUL A;  4B93 B;  1UN9 A;  3MV2 B;  4E6H A;  2WXK A;  4F6R D;  4HRM B;  3DSX A;  3FUI A;  1N4S A;  1NFI E;  2GGF A;  4KVO A;  4AOF A;  1TJC A;  3C98 A;  4N3B A;  4N39 A;  1ZU2 A;  1KPS B;  4BX8 A;  2F8X K;  2I9C A;  1Z3X A;  1K1B A;  5ITZ F;  5HRY A;  3O4Z A;  1QQE A;  4I2W A;  4KMO A;  3EHM A;  3SFZ A;  3DPD A;  3URZ A;  3HXF A;  3TWR A;  4P29 A;  4UWK A;  2HM8 A;  2RFM A;  1E90 A;  5JA4 D;  1UOH A;  3RK6 A;  2I6H A;  3PNL B;  4URK A;  1Y6I A;  1UW4 B;  3FH5 A;  4I43 A;  5T4Y A;  3ZFW A;  2KXP C;  3E4B A;  3RKV A;  3V30 A;  3GZ2 A;  2B6C A;  3HVE A;  1KZO A;  1MX6 A;  4JL0 A;  1U3C A;  3DRA A;  4EEC A;  4ATZ D;  1Q2Z A;  3OTN A;  1XNF A;  5ENR D;  4N5Q A;  2C2L A;  2R5S A;  2WXP A;  1OCZ E;  4QQI A;  5E75 A;  4F1S A;  3CVL A;  3L6A A;  1PAQ A;  1JWG A;  3N71 A;  5BXU A;  3B7U X;  2DBA A;  5FWQ A;  2MOW A;  4DI3 A;  4UWH A;  1W3B A;  4ZHB A;  4G11 A;  4UWF A;  5C1D A;  3MEK A;  1TNU A;  4GZ3 A;  2WXL A;  1FCH A;  2PM6 A;  4PS7 A;  4BES A;  3ONK A;  4I17 A;  5CED B;  3CV0 A;  2KZT A;  3EJN A;  4Q69 A;  5ANR A;  2HYZ A;  3SY2 A;  3RRM B;  4BER A;  3FUF A;  3ONL A;  2J07 A;  5FIN A;  3OXG A;  1HH8 A;  5AN8 A;  5CCL A;  3ASD A;  3MKR A;  3IBE A;  4F1P A;  1FVH A;  3LY7 A;  4OVV A;  3TL5 A;  4UQY A;  5AEN A;  1N11 A;  4EZL A;  2P9S G;  4DPR A;  2R59 A;  3RSE G;  3ZPJ A;  1U3D A;  4I9C A;  4DLO A;  4B8C B;  3G2U A;  1MYO A;  2GRR B;  3DSS A;  2L6J A;  1JPL A;  1DVP A;  3TAX A;  3Q15 A;  1FPP A;  2V4H C;  5CEA A;  5JHB A;  5D0Q D;  4HFG A;  4EZK A;  4JXT A;  5ENS D;  3CK8 A;  3PUK A;  3RO2 A;  3L17 A;  3FUK A;  1H2T C;  3ASG A;  5KNH D;  3FY4 A;  1X81 A;  3CGH A;  2XPY A;  2WXM A;  4AY5 A;  4CGV A;  3BQO A;  3MZL B;  4LSZ E;  4BTA A;  3GW4 A;  4J7W A;  2X6I A;  4NQ0 A;  1RZ4 A;  3O48 A;  4G25 A;  4EQF A;  3DPY A;  5EDS A;  2I2O A;  5LCW C;  3FU5 A;  2PQN A;  3UT8 A;  2EIK E;  1QNF A;  1JCQ A;  5ENN A;  4HOU A;  3R9A B;  1IHG A;  3DXM G;  1WY6 A;  3D9I A;  2CHW A;  3HRA A;  4ANW A;  3FWV A;  3Q47 B;  3BG0 B;  3V2O A;  4DK5 A;  4N3A A;  3L54 A;  3JXI A;  3UQ3 A;  2KC7 A;  3Q9U C;  3S7B A;  1IKN D;  1SZ9 A;  4TXR A;  3PE3 A;  5LX8 A;  4RQI A;  2XRY A;  3FUM A;  4GB9 A;  2X6H A;  4JD2 G;  5CMW A;  2J9Q A;  3CSF A;  4JC8 A;  4OYS A;  4Q94 A;  2QYU A;  3KSL A;  4JB8 P;  3KSQ A;  1ZB1 A;  4TUM A;  2FO1 E;  3HXE A;  3EU9 A;  3AS8 A;  4ILG A;  2I1K A;  2IOS A;  4MLP A;  1BI7 B;  3SQV A;  4IUL A;  1EF1 C;  3G2S A;  4Z68 A;  3CIA A;  1SA4 A;  4FAD A;  2DVW A;  1TNO A;  4N2S A;  1PC2 A;  3DEP A;  4UQX A;  4A1S A;  5JHA A;  4ACK A;  3V31 A;  3ULE G;  3PEV B;  5LP0 A;  3CQC B;  2RKK A;  2LNI A;  3BUA A;  3SFY A;  5J90 A;  3CHP A;  5ENP D;  4KT6 B;  2XS8 A;  1H2V C;  2AWI A;  2KAT A;  2J8S D;  1E8W A;  3S7D A;  4A55 A;  2IU1 A;  4YVQ C;  3UKU G;  5BW8 C;  2C0L A;  3ZXP A;  1OT8 A;  3D9H A;  4YND A;  5KNG A;  3UPV A;  4TUU A;  4GML A;  5FT9 A;  4B94 A;  2P9K G;  5T8I A;  2GW1 A;  1QBQ A;  2GRN B;  4ACL A;  5AAR A;  4AV7 A;  2YIN A;  4B8A A;  5BNW A;  2WMN A;  4MS6 A;  4JHR A;  3TWV A;  4HBD A;  2IOL A;  2WXQ A;  4IYP A;  3CVY A;  5CEC B;  3QB2 A;  4I9E A;  2YHE A;  4N2Q A;  4G24 A;  3CST A;  4BET A;  4U7E B;  1E7U A;  5CER B;  2LSU A;  4J8E A;  2BF0 X;  2YNQ A;  1OUV A;  4U8V D;  3V79 K;  4MRU A;  4RG6 A;  3NZS A;  5LFA A;  1N94 A;  4GAA A;  3EHR A;  3BEE A;  3IKO B;  4PH4 B;  4DUI A;  2X38 A;  5G05 J;  4GMJ A;  3CKC A;  4DRX E;  1E8Y A;  3UKR G;  1HO8 A;  4YDY A;  3AS4 A;  3CLJ A;  2MHK A;  3FU0 A;  1OWM A;  3TG4 A;  2XEE A;  3ZKJ A;  3EIQ C;  2FI7 A;  2XZT G;  1D8D A;  4GA1 A;  2XRZ A;  1YMP A;  4J8S A;  1BLX B;  3MGB A;  1HX8 A;  4FA6 A;  3IXE A;  4GPM A;  5EN5 D;  1DCQ A;  3FTX A;  3TWT A;  2P2C P;  3TXN A;  2XPI A;  1LTX A;  2CHX A;  4GTR A;  4G23 A;  4C0E A;  3L13 A;  2R17 C;  4I6G A;  3U64 A;  4EBA G;  3EUV A;  5A7D B;  4LNG A;  2WMO A;  3ZYL A;  3EIJ A;  2Y1L E;  3B7T A;  3HG0 D;  1O1R A;  3FU6 A;  3LY9 A;  4DI4 A;  3FU3 A;  4HS2 A;  3BU8 A;  2AXZ A;  3APD A;  4WNG A;  5AYW D;  3PEU B;  2XGS A;  3ZXS A;  3AG1 E;  2VGX B;  4GZD A;  4CYM D;  2KBX A;  1YCS B;  2XCB A;  4D10 C;  2QZA A;  4GTQ A;  3LVR E;  3LS8 A;  4GZC A;  3CHM A;  5G04 J;  2XPZ A;  2XEN A;  3PZ4 A;  3TWQ A;  3MKQ A;  5BV0 A;  3FUL A;  2RG8 A;  3E33 A;  3FTW A;  4AJW A;  3B95 A;  3QC1 A;  1JUQ A;  3MX3 A;  3L22 A;  4G2V A;  3PE4 A;  3TG5 A;  3ENE A;  2CG2 A;  3UM0 A;  3MCX A;  3MYV A;  4BT9 A;  1Z3Y A;  1D8E A;  3VTX A;  1K1A A;  3FUN A;  5J08 A;  3WXX A;  4U63 A;  2XQ0 A;  4HB5 A;  1G3N B;  3ZU7 B;  3FTS A;  3IHV A;  3AJI A;  4CDR A;  2Y4T A;  4WUY A;  3PDN A;  3I3N A;  4GYY A;  3ML8 A;  2P9L G;  3DST A;  3D9L A;  1H6P A;  3ESL A;  4OAU C;  1O1S A;  4UWL A;  4LNU D;  3B13 A;  2XGO A;  4UWG A;  3X2Q E;  4I1A A;  1OWN A;  4J6I A;  1DC2 A;  5M72 A;  3U4T A;  2WXR A;  2ZXW E;  3C3R A;  5KJK A;  3ASN E;  1JCR A;  2QY7 A;  3D9J A;  3FUD A;  3FFL A;  4G8K A;  3UT7 A;  4NIK A;  3CVW A;  4KXK B;  1OWL A;  1KT1 A;  3ZIM A;  4CZ2 D;  3J5Q B;  3AG2 E;  3LKU A;  2VTB B;  1LD7 A;  3NF1 A;  4GTP A;  3DSU A;  3CHS A;  3Q73 A;  3E37 A;  4PS8 A;  2J49 A;  3B7R L;  3EHQ A;  4DX1 A;  5EIB E;  4O6F A;  5EX3 A;  4O1P A;  2UWJ G;  3QNK A;  5D66 A;  1V54 E;  2EIN E;  3PZD A;  5AQA A;  5B1A E;  4JHJ A;  1S63 A;  2F0Y A;  3CVQ A;  3TXM A;  3QWP A;  3RRU A;  4ANU A;  2ZU6 B;  3CK9 A;  2R05 A;  3QWW A;  4DX6 D;  1PY1 A;  1X5B A;  3MV3 B;  3PRZ A;  5BT1 A;  3KD7 A;  3P1U A;  4WNE A;  5HI7 A;  4HQD A;  3OAW A;  4DLQ A;  5D0O D;  4R7L A;  3TWU A;  2GRQ B;  2ETA A;  2DYR E;  3G2V A;  4M7C A;  1HZ4 A;  5LOZ A;  4EBA A;  4L9P A;  2XS1 A;  3ZHE A;  4HOQ A;  1H6O A;  1OCC E;  1BPO A;  2WXG A;  2WB2 A;  3C3O A;  1N9A A;  4FU3 A;  3LPZ A;  4FJZ A;  5ENQ D;  4AEZ C;  4LER A;  4WAF A;  2Y3A A;  2EIJ E;  3ABK E;  3DBS A;  4AM9 A;  4OAV B;  3UTM A;  4NUR A;  1MX2 A;  1WG0 A;  2EQX A;  1NA0 A;  4K5C A;  4CEM A;  4BTB A;  1SVX A;  5FQ8 A;  2OVB A;  4CDN A;  2XEV A;  3OXF A;  1SA5 A;  2A5U A;  2XEH A;  5G05 C;  2IO2 C;  3SHF A;  4CT0 A;  4GYW A;  3IEG A;  1OWP A;  3PZ1 A;  4U95 D;  4JHK A;  2BTD A;  1Z5S C;  5ARF A;  2F37 A;  2EIM E;  5BPP A;  4HOR A;  3BG1 B;  3QKY A;  3KEZ A;  1N4Q A;  2CHZ A;  2P9P G;  3ULY A;  2BKG A;  2V5F A;  3PNT B;  2R2L A;  4UI9 J;  3SI5 A;  1JCS A;  1UJK A;  3HDX A;  3UIO C;  1MJ0 A;  5B3S E;  4H7Y A;  2J4B A;  1N4R A;  3PS6 A;  5FZR A;  4WWO A;  1KLX A;  2UY1 B;  3LCA A;  4FLB A;  3T8M A;  4HOT A;  3QAR A;  5G55 A;  2OOE A;  4U04 A;  3RO3 A;  1YA0 A;  2IEJ A;  2VGX A;  2LUH A;  4V3I A;  4WWN A;  1N95 A;  2LXL A;  1IQR A;  1N54 A;  4GZ5 A;  3PVL A;  3R9M A;  2GRL A;  4BX9 A;  2QFC A;  2ZGG A;  2BKK B;  1QYM A;  4HLL A;  4AXH A;  2PNN A;  1V55 E;  4X8Q A;  5G04 C;  4B89 A;  2L0T B;  3GYZ A;  4U0Z A;  2WXF A;  1TN7 A;  4RVB A;  3ML9 A;  5AQ7 A;  2J08 A;  5CCM A;  4O60 A;  2WXN A;  3SGH A;  4I6J A;  1VDY A;  2HE0 A;  5FZQ A;  4APF A;  3ASF A;  1GW6 A;  3LVQ E;  4K5B A;  4ZFH A;  3SBS A;  3I4R B;  3EU5 A;  1OCO E;  5A6C A;  3D9M A;  3PH0 C;  3SO8 A;  3FTV A;  2DWZ A;  2EIL E;  3Q49 B;  4U8Y D;  2NXP A;  3JCK C;  4LG6 A;  2ETC A;  2HR2 A;  5DBK A;  1U2V G;  1E7V A;  4Y6C A;  5C2Y A;  3D9N A;  1E8X A;  1NZN A;  3LY8 A;  3D3M A;  3Q79 A;  4RSY A;  2KZT B;  5FQ7 A;  5FIO A;  3R7R A;  2VSO E;  2L9B A;  3ASH A;  5ENT D;  3DWL G;  3FTU A;  1LD8 A;  4FP7 A;  5HKP A;  5BV1 A;  4U07 A;  3QAQ A;  4CCA A;  3HYM B;  4Y6W A;  2OND A;  1ZBP A;  2HO1 A;  3Q4A B;  2IJG X;  4O1O A;  3S2A A;  3E32 A;  3W9G A;  1HFA A;  5DIZ A;  4RG9 A;  4IRU A;  2RFA A;  2H6I A;  5EYP F;  4JVS A;  3T5X A;  4YDO A;  4TXQ A;  1S0P A;  3CHR A;  1NL4 A;  5KJN A;  4HNA D;  3JYS A;  3PZ2 A;  1NA3 A;  3QDN A;  1TYQ G;  2DCP A;  4DX2 A;  3U66 A;  4B0Z A;  4HVB A;  3DEO A;  4I1O B;  3D9O A;  4LNB A;  1IYG A;  1EDU A;  3AU4 A;  4K03 A;  3S7F A;  4ME2 A;  1E96 B;  4LUN U;  4BFR A;  2KCV A;  3AG3 E;  4FUL A;  4Q96 A;  4KZ0 A;  3APF A;  2ETB A;  3ABM E;  4LRZ A;  4JW1 A;  3ABL E;  1K8K G;  2DZN A;  2AJA A;  3APC A;  3FUE A;  4TXP A;  4JEU A;  4E85 A;  1KZP A;  1SZA A;  4WND A;  3WG7 E;  3AU5 A;  2FEZ A;  5LCW J;  2CG3 A;  1EYH A;  3CVU A;  1H6K A;  1QZ2 A;  4GTV A;  4C0M A;  3VTY A;  4GTO A;  4CT4 A;  4I6E A;  1O1T A;  2V0P A;  4ILH B;  1TN8 A;  4YDE A;  1ELW A;  3ASO E;  4GU5 A;  4U0S A;  3TWS A;  4ANV A;  5ANL A;  3RU0 A;  3FUH A;  4J8Y A;  5E76 A;  1ELR A;  4BSX A;  4FJY A;  4XX5 A;  4YDW A;  3ISM C;  4G8L A;  3UIN C;  3NBN B;  4HRL A;  3B7S A;  3CK7 A;  3EHN A;  3UXG A;  1L5J A;  5ARG A;  1ELK A;  2R03 A;  2H6F A;  4L2L A;  4KVM A;  2X6J A;  4J8F A;  3GZS A;  2IFU A;  2QYJ A;  3F6Q A;  3ZUV B;  3Q5M A;  2KCL A;  5B1B E;  2MRI A;  3SFX A;  2ZGD A;  3T9K A;  1N52 A;  4RLY A;  5A23 A;  2F8Y A;  2X6K A;  1BI8 B;  2WVI A;  3JQ0 A;  3LJ3 A;  3NOG D;  5AIJ A;  5IY5 E;  2M63 A;  3UIP C;  1BD8 A;  3NZU A;  1HG2 A;  2BUG A;  2WPV A;  5KWD A;  3W9F A;  3ZEF A;  1YYH A;  2E2E A;  3ESK A;  1INZ A;  2GRO B;  5KCM A;  1UG3 A;  3NQP A;  3IV0 A;  4GPK A;  3DSV A;  5EX0 A;  2PQR A;  4AIF A;  2LSV A;  1WAO 1;  4L23 A;  4UI9 C;  3QOU A;  5JJ6 A;  4A3V A;  1O5M A;  2IQC A;  1TNB A;  3EDT B;  1UJJ A;  1HE8 A;  4EHM A;  4K5A B;  4HLE A;  3VLF A;  4FHJ A;  2UY1 A;  1K3Z D;  1TJF A;  4F53 A;  4IN3 B;  5CRV A;  4FHK A;  5AQB A;  2MYO A;  2WQH A;  4LEU A;  2LAI A;  3Q75 A;  2V4L A;  3D9K A;  2GRM A;  2IF4 A;  3LXU X;  2VYI A;  4G26 A;  5FZS A;  2J09 A;  5JJT A;  3CVN A;  3JUE A;  4HXI A;  1UN8 A;  2KCK A;  5AJD A;  1S70 B;  3JXJ A;  2AXV A;  4PS3 A;  3PRE A;  2FF4 A;  3FEX A;  1H19 A;  4TV3 A;  5FQ4 A;  3TJP A;  4XI0 A;  1N4P A;  1TNZ A;  4CRW A;  4XIF A;  1JWF A;  4AVX A;  1B89 A;  4ABN A;  2Y0B G;  4DX7 D;  3CVX A;  3L08 A;  4H7X A;  3L16 A;  3FUJ A;  3KS2 A;  2J4D A;  4GA2 A;  4JZY A;  3HXB A;  5G2N A;  3CEQ A;  3FTY A;  1OXJ A;  2WXH A;  2LAH A;  2OCC E;  5KJL A;  4W9R A;  1AWC B;  5AJL A;  3TGO A;  2V5Q C;  3RIB A;  4ATG A;  4FC8 A;  3TWW A;  3K9I A;  5FJY A;  2WQ6 A;  3ULQ A;  1FT2 A;  4PUC A;  4CDM A;  2WQ7 A;  5HQ8 A;  2NC9 A;  3PZ3 A;  3LJN A;  3Q78 A;  2LO6 A;  2DYS E;  5AQ9 A;  2A4Z A;  1N0Q A;  3LYA A;  1OWO A;  3U3W A;  2AW6 A;  1EPU A;  2AXU A;  4JEH A;  1HS6 A;  4EPZ A;  3FEY A;  4MBG A;  1WM5 A;  3UT4 A;  3CVP A;  1MZC A;  4GZ6 A;  4QFV A;  3AG4 E;  2XZD G;  4HI9 A;  5JMN D;  2OEW A;  4BSZ B;  2Q7F A;  1HU3 A;  3UX4 A;  5BUZ A;  4JA9 A;  2ION A;  3QK0 A;  3SZ7 A;  2JAB A;  4HI8 A;  5D2M C;  2Y69 E;  4XKC A;  3SF4 A;  5HS0 A;  3I4G A;  3DSW A;  3ZN3 A;  1WDY A;  4U0U A;  2L0I A;  3ZNG A;  3UM3 A;  4JPS A;  1HF8 A;  2H6G A;  2VSX E;  4A1G A;  2QC9 A;  3TWX A;  4F7A A;  4UQZ A;  3MKQ B;  2XCC A;  3HIZ A;  3PUJ A;  2WXI A;  1HXI A;  1IXV A;  4ILI A;  3SNX A;  2DZO A;  4LCT A;  1A17 A;  2PM7 A;  2OEV A;  1P5Q A;  3LDZ A;  1FVF A;  3KEA A;  3FP3 A;  2E0I A;  4N5C A;  3C72 A;  4AP2 A;  4J8D A;  3T5V A;  5BXO A;  4GTM A;  5CBN A;  1DCE A;  3ZYQ A;  3D9P A;  3RAU A;  2VSN A;  3AAA C;  4G1T A;  1HG5 A;  1SQM A;  1BU9 A;  2WXJ A;  4XZ4 A;  3UI2 A;  4GA0 A;  3KAE A;  4HOS A;  1MQS A;  5ENO D;  4GCO A;  2X3M A;  4A63 B;  3CKB A;  4A3T A;  4APO A;  4F3V A;  4GCN A;  3QWV A;  3SBT B;  3HHM A;  3MA5 A;  2FO7 A;  2VSY A;  4NAC A;  3NB2 A;  2KM4 A;  2L6B A;  3RRN B;  1S64 A;  2CFU A;  2FBN A;  1NP7 A;  2C0M A;  4DJA A;  1H2U A;  1RW2 A;  2P9U G;  1SW6 A;  3ZW3 A;  5EID A;  2Y4U A;  2NYJ A;  3RJV A;  1E8Z A;  2P9I G;  4BT8 A;  4BWR A;  3I5P A;  3ZVV A;  1DNP A;  2P9N G;  3IHY A;  4MKT A;  3CR3 A;  3HVE B;  1XGW A;  2RD0 A;  4UI9 K;  1H0A A;  3Q9N C;  5CRU A;  2VGE A; 
#chains in the Genus database with same CATH homology
 3APF A;  3D9L A;  4LRZ A;  4JW1 A;  4I9C A;  4DLO A;  3VLD A;  4KZC A;  3ESL A;  4B8C B;  3G2U A;  2NSZ A;  4WNF A;  4UWL A;  4PDX A;  3B13 A;  2XGO A;  3APC A;  4UWG A;  3FUE A;  4JEU A;  4E85 A;  3ZYM A;  4KBQ A;  1SZA A;  4WND A;  2L6J A;  2P58 C;  4I1A A;  1OWN A;  4J6I A;  3AU5 A;  2FEZ A;  1JPL A;  3U4T A;  2CG3 A;  1EYH A;  2WXR A;  5LCW J;  5M72 A;  3FH8 A;  1DVP A;  1H6K A;  1QZ2 A;  4C0M A;  3CVU A;  3VTY A;  5KJK A;  3GZ1 A;  4CT4 A;  2AVP A;  3TAX A;  4I6E A;  2QY7 A;  2V0P A;  3Q15 A;  4ILH B;  4XI9 A;  3D9J A;  3FUD A;  3FFL A;  5JHB A;  1ELW A;  3AS5 A;  3UT7 A;  3ZGQ A;  5CMY A;  3LEW A;  2WXO A;  4GU5 A;  4KXK B;  5D0Q D;  3CVW A;  4HFG A;  4I2Z A;  4EZK A;  4EZJ A;  3QJZ A;  4U0S A;  1OWL A;  1KT1 A;  2CFZ A;  4L2Y A;  4JXT A;  5EKQ D;  2JLB A;  3ZIM A;  2VJ8 A;  3CK8 A;  3PUK A;  5ANL A;  3RO2 A;  4ANV A;  3LKU A;  3L17 A;  3RU0 A;  2VTB B;  3NF1 A;  3FUK A;  1H2T C;  3ASG A;  3FUH A;  1LF8 A;  3CHS A;  4XKB A;  3FY4 A;  3S7J A;  5E76 A;  5FTP A;  3CGH A;  2XPY A;  2WXM A;  4AY5 A;  1ELR A;  4CGV A;  4BSX A;  4ANX A;  4FJY A;  4JA7 A;  4XX5 A;  2XHE A;  3MZL B;  4PS8 A;  4BTA A;  3GW4 A;  2J49 A;  5T3R A;  3SD5 A;  3B7R L;  2X6I A;  3B7S A;  4NQ0 A;  3CK7 A;  3EHN A;  3OXL A;  3O48 A;  1L5J A;  4O6F A;  5ARG A;  4G25 A;  1ELK A;  4EQF A;  5EX3 A;  5EDS A;  4FLH A;  2I2O A;  5LCW C;  3ZRH A;  2UWJ G;  4L2L A;  4KVM A;  3FU5 A;  3QNK A;  3G2T A;  2X6J A;  4J8F A;  3GZS A;  2IFU A;  2PQN A;  3UT8 A;  4AY6 A;  3PZD A;  4NRH B;  1QNF A;  3Q5M A;  3UUX A;  2KCL A;  5ENN A;  4HOU A;  3R9A B;  1IHG A;  2MRI A;  2I1J A;  1WY6 A;  2VGY A;  4JHJ A;  3D9I A;  2CHW A;  3FH7 A;  3CVQ A;  3TXM A;  2VTB A;  3QWP A;  1N52 A;  3FWV A;  1IQU A;  2YHC A;  3ZHE B;  3Q47 B;  3RRU A;  4ANU A;  2X6F A;  3BG0 B;  5A23 A;  2ZU6 B;  4XE0 A;  5JJ7 A;  4DK5 A;  3CK9 A;  2X6K A;  4N3A A;  3L54 A;  2YQ8 A;  3QWW A;  3CHQ A;  3VLE A;  4CGW A;  3UQ3 A;  2WVI A;  2KC7 A;  3JQ0 A;  3LJ3 A;  5AIJ A;  3S7B A;  2M63 A;  1PY1 A;  1KT0 A;  2VQ2 A;  3NZU A;  1X5B A;  1HG2 A;  2OV8 A;  2JEK A;  3MV3 B;  3PRZ A;  4TRQ A;  1SZ9 A;  2BUG A;  2WPV A;  3PE3 A;  3ZEF A;  5LX8 A;  4YVO A;  3ZYK A;  5BT1 A;  3KD7 A;  2E2E A;  3ESK A;  3P1U A;  2XRY A;  4WNE A;  4N3C A;  5HI7 A;  3FUM A;  1INZ A;  4GB9 A;  5FQ6 A;  3R7Q A;  2X6H A;  5KCM A;  5CMW A;  1UG3 A;  4I1M A;  2J9Q A;  3NQP A;  3CSF A;  3IV0 A;  4JC8 A;  4OYS A;  4Q94 A;  4GPK A;  3OAW A;  4DLQ A;  5EX0 A;  2PQR A;  5D0O D;  4R7L A;  4AIF A;  3FHE A;  2LSV A;  5KJM A;  1WAO 1;  4L23 A;  1MHQ A;  3G2V A;  3FTZ A;  4UI9 C;  3QOU A;  1TEZ A;  4K0R A;  3P2B A;  1HZ4 A;  2IQC A;  5JJ6 A;  5LOZ A;  3ZHE A;  4A3V A;  4BY6 A;  4HOQ A;  4C9B B;  4EBA A;  3EDT B;  1UJJ A;  3AS8 A;  1BPO A;  1HE8 A;  2WXG A;  3UMV A;  2WB2 A;  4HLE A;  4FU3 A;  2XGM A;  3LPZ A;  3VLF A;  4FHJ A;  2UY1 A;  4ILG A;  1TJF A;  4FJZ A;  2I1K A;  4F53 A;  4IN3 B;  4J0U A;  2IOS A;  4FHK A;  4MLP A;  4LER A;  4AEZ C;  4WAF A;  4IUL A;  2Y3A A;  1EF1 C;  4GYO A;  3G2S A;  3DBS A;  3G2W A;  2WQH A;  3CIA A;  3CQG B;  4LEU A;  5CHE E;  4AM9 A;  2LAI A;  4M3O A;  4FAD A;  3MJW A;  2V4L A;  3D9K A;  2GRM A;  4N2S A;  1PC2 A;  2IF4 A;  3LXU X;  2VYI A;  4UQX A;  4G26 A;  5FZS A;  2J09 A;  1Z6T A;  5JJT A;  4NUR A;  3CVN A;  4A1S A;  2EQX A;  4KYO B;  5JHA A;  4ACK A;  1NA0 A;  4HXI A;  1UN8 A;  2KCK A;  5AJD A;  3PEV B;  4CEM A;  4BTB A;  2AXV A;  4PS3 A;  5LP0 A;  3CQC B;  2LNI A;  3PRE A;  2ILR A;  2FF4 A;  5J90 A;  2OVF A;  3CHP A;  3FEX A;  4U8H A;  1H19 A;  5FQ8 A;  4KT6 B;  2OVB A;  1H2V C;  4TV3 A;  4CDN A;  5FQ4 A;  3TJP A;  4XI0 A;  2WM9 A;  4CRW A;  2AWI A;  2KAT A;  3CHO A;  4XIF A;  1JWF A;  3JUI A;  2XEV A;  3OXF A;  2V8S E;  2A5U A;  4AVX A;  1E8W A;  3S7D A;  1B89 A;  5G05 C;  4ABN A;  4A55 A;  2IU1 A;  4YVQ C;  3SHF A;  5BW8 C;  2C0L A;  4CT0 A;  1Y8M A;  4GYW A;  4YND A;  3IEG A;  3CVX A;  1OWP A;  2DIW A;  3UPV A;  4TUU A;  3L08 A;  4GML A;  2PL2 A;  4H7X A;  4JHK A;  5FT9 A;  4B94 A;  4OVU A;  2BTD A;  4WWP A;  3L16 A;  3FUJ A;  5T8I A;  5ARF A;  3KS2 A;  5BPP A;  4HOR A;  2GW1 A;  3BG1 B;  4ACL A;  2J4D A;  3FDH A;  4GA2 A;  4JZY A;  3QKY A;  5G2N A;  3KEZ A;  3CEQ A;  4L1B A;  2CHZ A;  4L7T A;  3CVV A;  3U9W A;  3FTY A;  2V5F A;  4AV7 A;  2YIN A;  4B8A A;  3PNT B;  2WXH A;  2PZI A;  5BNW A;  3JQ1 A;  2WMN A;  4UI9 J;  4MS6 A;  3SI5 A;  2LAH A;  5KJL A;  1UJK A;  4W9R A;  4JHR A;  5AJL A;  3TGO A;  2IOL A;  3RIB A;  4ATG A;  4FC8 A;  3HDX A;  2WXQ A;  3K9I A;  5FJY A;  2WQ6 A;  2FUL A;  4IYP A;  3ULQ A;  3CVY A;  4CDM A;  4H7Y A;  4PUC A;  2J4B A;  2WQ7 A;  3PS6 A;  2NC9 A;  5HQ8 A;  1UN9 A;  3MV2 B;  3QB2 A;  5FZR A;  4E6H A;  4WWO A;  1KLX A;  2UY1 B;  2LO6 A;  2WXK A;  4I9E A;  2YHE A;  3LCA A;  2A4Z A;  4FLB A;  3T8M A;  4N2Q A;  4HOT A;  3QAR A;  4G24 A;  3FUI A;  3CST A;  3LYA A;  1OWO A;  5G55 A;  2OOE A;  4U04 A;  3U3W A;  2AW6 A;  1EPU A;  1E7U A;  2AXU A;  3RO3 A;  1YA0 A;  2LSU A;  4J8E A;  4JEH A;  2VGX A;  1HS6 A;  4ANW A;  2BF0 X;  4EPZ A;  2YNQ A;  2GGF A;  3FEY A;  1OUV A;  1WM5 A;  4KVO A;  3UT4 A;  3CVP A;  4AOF A;  1TJC A;  4V3I A;  4GZ6 A;  4WWN A;  4QFV A;  3C98 A;  4MRU A;  4N3B A;  1IQR A;  1N54 A;  4GZ5 A;  4RG6 A;  3PVL A;  2Q7F A;  3NZS A;  1HU3 A;  4N39 A;  3UX4 A;  5LFA A;  4GAA A;  1ZU2 A;  5BUZ A;  2GRL A;  3BEE A;  3IKO B;  4BX9 A;  4JA9 A;  4PH4 B;  2QFC A;  2X38 A;  2ION A;  5G05 J;  4GMJ A;  3CKC A;  4AXH A;  1E8Y A;  4BX8 A;  1HO8 A;  3AS4 A;  3CLJ A;  3QK0 A;  2MHK A;  2I9C A;  3SZ7 A;  5G04 C;  3FU0 A;  4B89 A;  1OWM A;  2L0T B;  3GYZ A;  4U0Z A;  3TG4 A;  2WXF A;  1Z3X A;  4XKC A;  4RVB A;  3EIQ C;  3O4Z A;  1QQE A;  2FI7 A;  3SF4 A;  3ML9 A;  3I4G A;  2J08 A;  4I2W A;  4KMO A;  3EHM A;  3SFZ A;  5CCM A;  3DPD A;  4GA1 A;  3URZ A;  2XRZ A;  3ZN3 A;  2WXN A;  3SGH A;  4P29 A;  4I6J A;  4J8S A;  1VDY A;  4U0U A;  4UWK A;  3MGB A;  1HX8 A;  2HM8 A;  2L0I A;  5FZQ A;  4FA6 A;  1E90 A;  4APF A;  3ASF A;  3FTX A;  1GW6 A;  4JPS A;  1HF8 A;  3RK6 A;  3TXN A;  2XPI A;  3LVQ E;  2I6H A;  3PNL B;  2CHX A;  2VSX E;  4URK A;  1Y6I A;  3SBS A;  4G23 A;  4C0E A;  3L13 A;  1UW4 B;  2R17 C;  3FH5 A;  3I4R B;  4I43 A;  4I6G A;  3U64 A;  4A1G A;  4EBA G;  4F7A A;  5A7D B;  5A6C A;  2WMO A;  4UQZ A;  3EIJ A;  3B7T A;  3D9M A;  3MKQ B;  5T4Y A;  3ZFW A;  3ZYL A;  3FU6 A;  3LY9 A;  3PH0 C;  2XCC A;  3FU3 A;  3E4B A;  3RKV A;  4DI4 A;  4HS2 A;  3FTV A;  3HIZ A;  3PUJ A;  2WXI A;  1HXI A;  3GZ2 A;  4ILI A;  3HVE A;  3Q49 B;  2AXZ A;  3APD A;  3SNX A;  2NXP A;  4WNG A;  5AYW D;  3PEU B;  4LCT A;  2XGS A;  1A17 A;  3JCK C;  3ZXS A;  2PM7 A;  1P5Q A;  1U3C A;  4JL0 A;  3LDZ A;  4EEC A;  1FVF A;  2VGX B;  2HR2 A;  4GZD A;  5DBK A;  3OTN A;  3FP3 A;  1XNF A;  2E0I A;  2XCB A;  4N5C A;  4D10 C;  2C2L A;  4AP2 A;  4J8D A;  3T5V A;  1E7V A;  4Y6C A;  5C2Y A;  3D9N A;  1E8X A;  1NZN A;  3LVR E;  3LY8 A;  3LS8 A;  3D3M A;  2R5S A;  2WXP A;  4RSY A;  2KZT B;  5E75 A;  5FQ7 A;  4F1S A;  3ZYQ A;  3R7R A;  3D9P A;  4GZC A;  2VSO E;  3CVL A;  3CHM A;  2L9B A;  2VSN A;  3ASH A;  4G1T A;  3FTU A;  3L6A A;  5G04 J;  2XPZ A;  1PAQ A;  4FP7 A;  1JWG A;  4U07 A;  3QAQ A;  1HG5 A;  1SQM A;  5BV1 A;  2WXJ A;  3N71 A;  3MKQ A;  4XZ4 A;  4CCA A;  3HYM B;  4GA0 A;  3B7U X;  2DBA A;  3KAE A;  4Y6W A;  4HOS A;  2OND A;  1ZBP A;  2HO1 A;  5FWQ A;  2MOW A;  3FUL A;  5BV0 A;  3Q4A B;  4DI3 A;  1MQS A;  2IJG X;  4UWH A;  4GCO A;  3S2A A;  1W3B A;  2X3M A;  2RG8 A;  3CKB A;  4A3T A;  4G11 A;  3FTW A;  4APO A;  4UWF A;  4F3V A;  4GCN A;  3QWV A;  5C1D A;  3SBT B;  1HFA A;  4AJW A;  3QC1 A;  1JUQ A;  3MEK A;  4GZ3 A;  2WXL A;  3HHM A;  3MX3 A;  4RG9 A;  3MA5 A;  4IRU A;  2FO7 A;  5DIZ A;  3L22 A;  4JVS A;  4G2V A;  3T5X A;  3PE4 A;  2VSY A;  4NAC A;  1S0P A;  3CHR A;  1FCH A;  3TG5 A;  5KJN A;  3ENE A;  2KM4 A;  2PM6 A;  4PS7 A;  2CG2 A;  3RRN B;  2CFU A;  2FBN A;  1NP7 A;  2C0M A;  3JYS A;  3ONK A;  4DJA A;  4I17 A;  3MCX A;  3CV0 A;  2KZT A;  1NA3 A;  3EJN A;  3QDN A;  2DCP A;  4Q69 A;  1H2U A;  3MYV A;  4BT9 A;  5ANR A;  1Z3Y A;  2HYZ A;  3RRM B;  3ZW3 A;  3U66 A;  3FUF A;  3ONL A;  4B0Z A;  3VTX A;  2Y4U A;  3FUN A;  3RJV A;  1E8Z A;  2J07 A;  4BT8 A;  3OXG A;  1HH8 A;  4BWR A;  4HVB A;  5CCL A;  3I5P A;  3ASD A;  4I1O B;  5J08 A;  3MKR A;  1DNP A;  3D9O A;  3WXX A;  3ZVV A;  4U63 A;  3IBE A;  2XQ0 A;  1IYG A;  1EDU A;  1FVH A;  3AU4 A;  3LY7 A;  4OVV A;  4K03 A;  3IHY A;  4MKT A;  3S7F A;  3TL5 A;  4UQY A;  4ME2 A;  1E96 B;  3CR3 A;  3FTS A;  3HVE B;  4LUN U;  4BFR A;  3IHV A;  1XGW A;  2KCV A;  5AEN A;  4EZL A;  4CDR A;  2Y4T A;  2RD0 A;  4WUY A;  3PDN A;  4DPR A;  4UI9 K;  3I3N A;  1H0A A;  4FUL A;  4Q96 A;  2R59 A;  4GYY A;  3ML8 A;  3ZPJ A;  1U3D A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...