1XGWA

The crystal structure of human enthoprotin n-terminal domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
VVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Epsin 4
publication title The crystal structure of human enthoprotin N-terminal domain
rcsb
source organism Homo sapiens
total genus 51
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1xgwA00
3G2WA 1UJKA 1HX8A 1H0AA 3D9LA 2DCPA 3G2VA 4FU3A 3LDZA 2MOWA 3G2SA 1XGWA 3D9MA 1JWFA 3RRUA 1HG2A 3G2TA 1VDYA 1SZ9A 1UJJA 4FLBA 1ELKA 1SZAA 2V8SE 3D9IA 1JPLA 4GZDA 3ZYQA 5LP0A 3D9KA 3ONKA 3D9PA 1HF8A 1JUQA 4Q96A 4JXTA 2L0IA 3ZYKA 4AVXA 2QY7A 3D9OA 3ONLA 5J08A 3D9NA 3ZYMA 2KM4A 2LO6A 1INZA 2L0TB 3CLJA 4GZCA 1HFAA 2BF0X 4HFGA 3ZYLA 2DIWA 1PY1A 3G2UA 4NACA 1LF8A 5LOZA 1DVPA 4Q94A 1X5BA 3D9JA 5CMYA 1JWGA 1EYHA 5CMWA 1HG5A 1MHQA 1EDUA
chains in the Genus database with same CATH superfamily
3ZPJA 3OAWA 1S0PA 3RRUA 2VGXB 5BT1A 4GCOA 5ENOD 3ZRHA 3TWQA 5ARFA 3DEPA 4HB5A 2P9NG 4DK5A 4XEIG 3S2AA 4ANWA 2IOSA 3L6AA 3Q75A 3FU5A 3IEGA 4X8QA 3D9JA 5CMWA 1HG5A 1EDUA 4K5CA 4NURA 2AXZA 1HO8A 3SBSA 3I4RB 3CQCB 5LP0A 2KZTB 3ULEG 3HVEA 3CK8A 3CK9A 4LG6A 3DBSA 5BW8C 3QWWA 5LOZA 4B8CB 1OUVA 4GTPA 4DLOA 5KJMA 1E7VA 1SZ9A 2EIME 3HYMB 3BUAA 3TG5A 5JJ7A 3DSVA 1TYQG 3IKOB 3VTYA 3O48A 1V55E 1LTXA 4ILHB 3LS8A 2VQ2A 4J8FA 2J07A 3HG0D 2WXMA 4PDXA 3JXIA 3KEAA 3JXJA 5BUZA 3CVUA 3LYAA 2HE0A 2CHZA 4WNFA 4I6EA 3RJVA 3GZSA 1W3BA 3MYVA 3D9HA 1DNPA 4AEZC 2J08A 2I6HA 4BERA 2XCBA 3B13A 2ZXWE 3QC1A 5BNWA 2IO2C 3SI5A 3GW4A 1TR4A 3CV0A 4K5BA 4I2WA 1E8WA 1UOHA 5D66A 5J90A 4GMJA 1ELRA 3QOUA 4L1BA 3PE3A 2OVFA 3SO8A 4BSZB 3T5XA 1TN8A 1BLXB 3UI2A 3CGHA 2KCVA 3TL5A 3SZ7A 3D9MA 2XEVA 4EZJA 4L9PA 1RZ4A 3HXFA 5FZQA 1YMPA 2F8YA 3ZUVB 5A7DB 4HOUA 1N11A 2YINA 4ME2A 3UINC 1AWCB 4O1PA 4IULA 3FULA 4GTMA 3CHMA 5KJKA 4C9BB 1JCQA 1X81A 4LNUD 3MA5A 3VLEA 3Q5MA 4J7WA 3G2TA 4J0UA 3CVQA 1Z6TA 2DYSE 4APFA 4BESA 4YDEA 3HRAA 4HRLA 4PS3A 2JLBA 4H7YA 2NYJA 4FA6A 1Q2ZA 2RFMA 4YNDA 4U0SA 4IN3B 2XQ0A 3CVNA 2LXMA 2V0PA 1FVFA 4L7TA 2J49A 4JHRA 5G55A 1Z3XA 2GROB 3IXEA 3QB2A 1U3DA 3D9PA 4PH4B 3L9TA 3ASGA 3WG7E 3OXFA 3ASOE 2WXIA 2AXUA 3R9AB 4GZCA 4L2LA 5FQ4A 3PNLB 5LFAA 1MHQA 2V4HC 3ESLA 5G05J 1KT1A 3PVLA 3APFA 2CHXA 4G8KA 3UM0A 2H6IA 3FUFA 4B0ZA 3MCXA 5DBKA 4A3VA 4DRXE 4G25A 4CT4A 4HOQA 1EYHA 3Q15A 4M7CA 3OTNA 4AY5A 1H6KA 3FUHA 4JB8P 1YCSB 2WB2A 1DCQA 5ENRD 2WXLA 1JUQA 2R59A 3TJPA 2UY1B 3X2QE 3FHEA 3FU0A 3G2UA 3MJWA 4B94A 4KBQA 3EHRA 3ZEFA 3U9WA 2I1JA 5FQ8A 3QWPA 4WWOA 2KC7A 3G2SA 4XI9A 2AWIA 4U04A 1EF1C 3AG3E 4JW1A 4O1OA 3IHVA 4EHMA 3TAXA 3DRAA 3LVQE 2GRRB 4N3CA 3SNXA 3FTWA 5CCMA 4WWPA 1QBQA 2QFCA 4I1AA 2Q7FA 4MKTA 2LXLA 1WG0A 4E85A 1S70B 1OT8A 3S7DA 1N9AA 4GA2A 3SF4A 4ANVA 3RAUA 2WMOA 2DBAA 1SZAA 4DJAA 3B7TA 3PREA 4KVOA 5BV0A 3UT4A 1NP7A 4W9RA 3AU4A 3R9MA 3N71A 5EN5D 2YHCA 1WM5A 4FLHA 3B7UX 3CIAA 2WXQA 4JD2G 3PS6A 3NBNB 3FUIA 4BWRA 5AQAA 3J5QB 5HI7A 3LPZA 2BUGA 2M63A 4GA1A 1JWFA 1A5EA 1OWOA 3V2XA 5HS0A 3P2BA 2ONDA 1ELWA 3PUKA 4J8EA 1FT2A 3ZW3A 3FTYA 3ESKA 4XKCA 4JL0A 4ATGA 1KPSB 2XPYA 4J8DA 1TNZA 3LXUX 4ILGA 4UQXA 2HO1A 4UWKA 1SQMA 3R7QA 5KJNA 5JA4D 4RQIA 3BG0B 5G05C 4GA0A 3ZXPA 3MV2B 4FP7A 2RD0A 4TXRA 3EDTB 2P9PG 1H2UA 3UXGA 4XX5A 2AXVA 2JABA 4NRHB 1O1TA 2L0TB 2P58C 5CRVA 3CSFA 2VSXE 1HH8A 2PQRA 2AVPA 3EIQC 5CEDB 4HQDA 4U0UA 1IKND 4DLQA 5CEAA 4EPZA 3MX3A 2C0MA 1NI1A 2JEKA 1Z3YA 3ZKJA 3PH0C 2IF4A 1N95A 3UX4A 2CFZA 4F53A 5FWQA 2QZAA 4BETA 1QYMA 4N5CA 4GTOA 2UWJG 3KAEA 5C1DA 3SD5A 4XIFA 2WPVA 2V5QC 3CVWA 5ENPD 3URZA 1QZ2A 1H0AA 1OWLA 5FIOA 3FUNA 3GZ2A 3CHOA 3IHYA 4U07A 3GYZA 5JJTA 5FQ7A 4AV7A 5LCWJ 1IQUA 5KBAA 3QKYA 4HI8A 3T5VA 3C3OA 1Y8MA 3PZ3A 4H7XA 5AARA 2QYJA 3ULQA 3DXKG 3FP3A 4GU5A 2BKGA 3ZYQA 4HNAD 4DPRA 3AS8A 1QQEA 2OEVA 2XRYA 3L16A 3ABME 2Y4TA 4ZFHA 1EPUA 5IY5E 1JCRA 2GRNB 2XRZA 1K1BA 4CEMA 2LUHA 4B89A 4I2ZA 3CHRA 2WM9A 4GZ5A 3KEZA 4G23A 2X6FA 5FINA 5FT9A 4MBGA 3ML9A 3ZHEB 3O4ZA 1LD8A 2OVBA 2WXFA 3IBEA 3U4TA 2WQ6A 4NQ0A 1JPLA 3CVLA 2GW1A 3ZIMA 4JEUA 3C3QA 1TNYA 3MKQB 1E96B 3FUEA 4Q69A 2VTBA 2P9UG 4GTSA 1N94A 3L13A 5FTPA 3ZVVA 3S7BA 4XE0A 4HLEA 4ABNA 2PM7A 4EZKA 2L6BA 4AJWA 5EX0A 3D3MA 2BKKB 3DSUA 1H2VC 3NOGD 4KMOA 1V54E 1ZB1A 2NXPA 3B95A 2Y3AA 5G04C 3WXXA 1H6PA 4MS6A 4BX8A 4JHKA 3VLDA 5AQ7A 4NACA 3GZ1A 2NSZA 2VSNA 4AVXA 3TWSA 1HZ4A 3TGOA 1OXJA 3Q47B 1NA3A 3V31A 2OV8A 3ZFWA 3Q49B 4Q94A 3PZDA 1HXIA 2Y4UA 5LCWC 4F7AA 4DUIA 4RG6A 4FU3A 3LJNA 4BTAA 3C72A 1XNFA 3AS5A 5ITZF 3Q9NC 2P9KG 3LVRE 5FJYA 5CCLA 2WXOA 3V2OA 2KM4A 4BTBA 3NZSA 2X38A 2BF0X 3FFLA 4TUMA 4YDYA 4A63B 4YDOA 3NZUA 5CMYA 4YDWA 5BV1A 2L6JA 4OVUA 3ZNGA 3PEVB 3K9IA 4UI9J 4LEUA 2DZNA 3CVVA 2DWZA 2X6HA 3HIZA 1P5QA 4U0ZA 4HRNA 4GYYA 5AJLA 1OWNA 3TG4A 4GCNA 3B7RL 3L17A 3UM3A 1UJKA 1TNUA 3DXMG 4J6IA 4TRQA 4EBAG 3DEOA 3C98A 4YVOA 2LO6A 4U63A 3E4BA 1LD7A 4U8YD 2VSOE 1AP7A 2VJ8A 1NZNA 1N0QA 4DX5D 4I43A 2PQNA 3SFZA 4EBAA 1IHBA 4CZ2D 5D0OD 3BG1B 4LSZE 3S7JA 3B7BA 1E7UA 1N4SA 5ENTD 3NAWA 3AG2E 2X3MA 3AAAC 2WMNA 5KNGA 3CHSA 2OCCE 4YVQC 2BTDA 4Y6CA 4CYMD 1JCSA 4AP2A 2PL2A 3T8MA 2XZDG 3I3NA 1U3CA 3D9IA 4RLYA 1K1AA 2OEWA 3LY7A 3RRNB 3AG1E 3HVEB 2J09A 1WAO1 1H2TC 4LNBA 4GTVA 1DVPA 4OAUC 2DCPA 4N2SA 1K8KG 1OY3D 5JHAA 2EILE 5B1AE 4HOSA 4V3IA 4ANUA 3PE4A 5T8IA 5G2NA 4KYOB 3KSLA 3DSXA 3DSWA 3E37A 2DIWA 4HVBA 1K3ZD 2EQXA 4FHJA 3SHFA 1KZOA 4J8SA 3JQ0A 2GRPB 3DPYA 5ENNA 3ASFA 4DI4A 2IOLA 4I1MA 3ZYLA 1DCEA 5BPPA 5ENQD 2R2LA 3FEYA 2VGXA 1WY6A 3ABKE 4JC8A 2DVWA 3TWWA 4HOTA 4LERA 3UM1A 3E32A 1VDYA 3UIPC 2QYUA 2ZISA 5KJLA 3ONKA 2J4BA 3LY9A 4IYPA 2KXPC 3FTUA 3BU8A 3UQ3A 3IV0A 4OYSA 3HXBA 3CHPA 3KD7A 3AJIA 1SW6A 2I2OA 1G3NB 1E8ZA 3SFXA 4BX9A 4JA9A 1A17A 2KZTA 4KT6B 2X6KA 2V8SE 1SA4A 5FZRA 3SBTB 2DYRE 1INZA 3SQVA 1KLXA 5LX8A 3I5PA 3UM2A 2H6HA 3FU3A 1FCHA 4WWNA 1NFIE 1HG2A 3ASDA 4EECA 2VGEA 2C2LA 3E30A 1D8DA 1S63A 1MJ0A 2CFUA 2GRMA 4QFVA 2LAHA 4JEHA 1FT1A 3MZLB 4DX7D 4HI9A 2A5UA 3LKUA 4FJYA 2CG2A 2LAIA 4GYOA 4HLLA 4FULA 3AG4E 5KNHD 3UKUG 1ZBPA 5EYLA 4C48B 3ENEA 3EIJA 1FVHA 2OOEA 2YHEA 3U66A 4FJZA 1HF8A 3AU5A 3TWVA 3RK6A 4G26A 4ACKA 2IY0C 3UT8A 3RU0A 5C2YA 4JA7A 4HRMB 2DZOA 3PZ2A 4O6FA 3EJNA 4BEPA 4Y6WA 2XEEA 1MX6A 2FEZA 2V4LA 4AXHA 4K0RA 2GGFA 4MRUA 2EIKE 3LCAA 2LNIA 1NA0A 2LSVA 3FTZA 2XZTG 1PY1A 2ETBA 4K5AB 3OXGA 3HDXA 4I17A 3HXEA 3TWXA 3JUIA 4XKBA 4GTRA 3TWUA 3L08A 4G1TA 5AYWD 3KS2A 4CCAA 4I9CA 3RRMB 2FO7A 4L23A 1BI8B 4I6JA 2A4ZA 2BEDA 3C5RA 2IQCA 4WNDA 4UQZA 3Q73A 5HKPA 3UUXA 1GW6A 3FTXA 5EYPF 3EHQA 1IQRA 4JVSA 3F6QA 5CECB 1N4PA 4J8YA 2R02A 3TWTA 3MGBA 2E2EA 2CHWA 4ATZD 2MHKA 3QDNA 1TN6A 4F1PA 3E33A 4CRWA 3DPDA 3CKBA 4JHJA 3JQ1A 4HBDA 4UI9K 3BEEA 2F0YA 2EINE 1YYHA 4TXQA 4WNEA 3W9GA 4ACLA 3U3WA 2HM8A 2X6JA 5CERB 1UJJA 5KCMA 2QC9A 3V30A 3ML8A 4GZ3A 5A23A 3EHNA 1ZU2A 2E0IA 5D2MC 4EZLA 4AIFA 4GPMA 2FO1E 3ZXSA 3FU6A 4D10C 4FC8A 5JMND 4N5QA 5EX3A 2WXPA 3CKCA 4UUCA 3QK0A 1H6OA 4G11A 4GAAA 2XPZA 1YA0A 3V79K 4MLPA 4FLBA 3SGHA 1B89A 2XGOA 2ZGDA 5AQ9A 4RVBA 5M72A 2IONA 3FUDA 3NQPA 4JPSA 1D8EA 4LUNU 3CR3A 1UG3A 4KXKB 3S7FA 3E34A 2MRIA 1L5JA 3MKRA 1N0RA 2L0IA 5HRYA 4LCTA 3NOCD 2PM6A 3PRZA 3UKRG 5AJDA 4IRUA 4BFRA 3T9KA 2RG8A 2WXNA 3Q7FA 4C0EA 5EILA 4F1SA 5BXUA 4G8LA 4AOFA 3ABLE 5T4YA 2F37A 3EHMA 4TUUA 2IU1A 4GZDA 2ILRA 2UY1A 4OAVB 3MEKA 3PDNA 2EIJE 4EQFA 3ZYMA 4CDMA 3UTMA 3QAQA 5BXOA 4PUCA 4DX1A 3FTSA 2XS1A 4GYWA 3LDZA 1HE8A 2H6GA 5AAOA 3FUMA 4A1GA 1N52A 2KCLA 2MYOA 3FUJA 4WAFA 2WXJA 4GTTA 4UWLA 1MQSA 4FHKA 1O1RA 1LF8A 1E90A 2PNNA 4R7LA 3D9LA 3ASHA 1IHGA 3LY8A 1UN8A 3DSTA 3AS4A 3UT7A 2IFUA 3ZU7B 4TXPA 4I6GA 4FADA 3L82A 1Y6IA 3RKVA 3PZ4A 2ETCA 4N3BA 3L54A 4WUYA 4N2QA 3UPVA 4HXIA 2CG3A 1KZPA 5E75A 2VSYA 4BT9A 4A55A 1TJCA 3FEXA 3JUEA 4GZ6A 1BPOA 2WXKA 5ANRA 3CLJA 4ANXA 4CT0A 2XCCA 2Y69E 4URKA 5FZSA 3C3RA 4NIKA 3JCKC 2H6FA 1N4QA 4WNGA 3EU9A 2IJGX 2YNQA 2P9IG 2HYZA 2R03A 5FQ6A 1E8YA 2FI7A 4KVMA 2ZIRA 3PNTB 3VLFA 2WXHA 3QNKA 3ZYKA 1RW2A 1OWPA 5AN8A 4B93B 1TNBA 2J4DA 4PS8A 3HHMA 3BQOA 2XEHA 1H19A 5AQBA 3I4GA 3Q78A 3JYSA 4GMLA 4BY6A 5ANLA 5D0QD 2ETAA 4M3OA 3UIOC 2KBXA 3FH7A 4KZCA 2ZGGA 3CHQA 3TWRA 1U2VG 3APCA 1KT0A 1TN7A 3DWLG 1MX2A 2RFAA 4Q96A 1OCOE 2WXGA 3D9OA 2HR2A 2RKKA 2WXRA 2IO3C 3RO3A 1TJFA 4RG9A 1ELKA 2V5FA 4UWHA 2F8XK 2AJAA 4PS7A 3Q79A 1BU9A 1OCZE 2P9LG 4BT8A 4XZ4A 1N4RA 5EDSA 4UWFA 2AW6A 1S64A 3PUJA 2XGMA 2VTBB 4U95D 1OCCE 4LNGA 4HORA 3FH5A 3NB2A 4Z68A 2WQHA 4TV3A 2J9QA 5CBNA 3Q4AB 5ARGA 1PC2A 2YQ8A 5B1BE 3ZN3A 4DI3A 4AM9A 4N39A 1MYOA 2I1KA 3D9NA 4P29A 2FF4A 1WDYA 1D9SA 4UI9C 3L22A 4GPKA 5CHEE 3APDA 1JWGA 4OVVA 3OXLA 3FDHA 1E8XA 3FUKA 1OWMA 3D9KA 2IEJA 3P1UA 4L2YA 5ENSD 2GRQB 1IYGA 1PAQA 4O60A 2PZIA 3RO2A 2XS8A 4GMRA 3ZHEA 3FTVA 4KZ0A 3ISMC 2KATA 5B3SE 3T8KA 4HS2A 2P9SG 3MKQA 1BI7B 2XENA 4CDNA 5JJ6A 3ULYA 3FH8A 4DX6D 4APOA 1TNOA 3CK7A 3PZ1A 4C0MA 4B8AA 3CVPA 3SY2A 2J8SD 1OCRE 4GB9A 4CDRA 4JXTA 3MV3B 4G2VA 2ZU6B 4I1OB 2XGSA 5EIDA 3RIBA 4CGVA 3KSQA 1XGWA 2FULA 3QJZA 3ASNE 2VYIA 4CGWA 3R7RA 4N3AA 3LJ3A 1N54A 4F3VA 3NF1A 2NC9A 2Y0BG 3ZGQA 1IXVA 2B0OE 5E76A 2C0LA 5JHBA 2XPIA 1FPPA 2I9CA 3CQGB 4RSYA 1TEZA 3QWVA 3Q9UC 5AIJA 1QNFA 3ONLA 2LSUA 4K03A 4ILIA 3W9FA 5AENA 5EKQD 5DIZA 1Z5SC 5CBOA 4G24A 1X5BA 1HU3A 1O5MA 2MOWA 4XI0A 1UN9A 4GTQA 3CSTA 3J5PA 3DSSA 3HXCA 4BSXA 4UWGA 5J08A 3TXNA 4AY6A 3VTXA 4HFGA 4A3TA 3TXMA 4ZHBA 3CVYA 3LEWA 5EIBE 1MX4A 2A5EA 2VGYA 2WVIA 2L9BA 5G04J 4UQYA 3G2VA 5CRUA 2XHEA 3FWVA 4I9EA 4U8HA 4JZYA 3FY4A 4U7EB 5A6CA 4LRZA 2R17C 2B6CA 2GRLA 3CEQA 5T3RA 5H7PA 1SVXA 2X6IA 3QARA 2P2CP 3RSEG 1HS6A 5KWDA 3B7SA 4A1SA 5HQ8A 2Y1LE 1DC2A 3G2WA 2R5SA 1HX8A 3SFYA 4DX2A 3PEUB 3HXDA 3UMVA 4QQIA 3U64A 1SA5A 3EUVA 2QY7A 3Q7AA 2WQ7A 1MZCA 3EU5A 1NL4A 2FBNA 4F6RD 2KCKA 3CVXA 4E6HA 4U8VD 1UW4B 1BD8A 2R05A 1HFAA 1O1SA 4U96D
chains in the Genus database with same CATH topology
3ZPJA 3OAWA 4N3BA 3L54A 2DCPA 4N2SA 4WUYA 4N2QA 3LXUX 1S0PA 4HXIA 4ILGA 4UQXA 3UPVA 3RRUA 2CG3A 2HO1A 4UWKA 2VGXB 5BT1A 4GCOA 5E75A 1SQMA 3ZRHA 2VSYA 4BT9A 3R7QA 4A55A 5KJNA 1TJCA 3FEXA 5ARFA 5JHAA 4GZ6A 4DK5A 3BG0B 1BPOA 4HOSA 5G05C 2WXKA 4V3IA 4ANUA 3S2AA 3PE4A 4ANWA 5T8IA 2IOSA 3L6AA 5ANRA 3CLJA 5G2NA 4GA0A 4KYOB 3MV2B 4FP7A 4ANXA 4CT0A 2RD0A 3FU5A 3IEGA 2XCCA 3D9JA 5CMWA 1HG5A 2DIWA 4HVBA 1EDUA 4URKA 4NURA 5FZSA 2AXZA 3JCKC 2EQXA 4FHJA 1HO8A 3SBSA 3SHFA 3I4RB 3EDTB 4J8SA 1H2UA 4WNGA 3CQCB 5LP0A 3JQ0A 4XX5A 2KZTB 3HVEA 3CK8A 2IJGX 3CK9A 5ENNA 2AXVA 3ASFA 4DI4A 2IOLA 2YNQA 4NRHB 3DBSA 4I1MA 2L0TB 2P58C 2HYZA 5BW8C 3ZYLA 3CSFA 3QWWA 5BPPA 5FQ6A 5LOZA 1E8YA 2FI7A 2VSXE 4KVMA 3FEYA 1HH8A 2PQRA 2VGXA 4B8CB 1WY6A 2AVPA 3EIQC 1OUVA 4JC8A 3PNTB 3VLFA 4LERA 4DLOA 4HOTA 5KJMA 2WXHA 1E7VA 1VDYA 1SZ9A 4U0UA 3HYMB 3QNKA 5KJLA 3ONKA 4DLQA 2J4BA 3ZYKA 1OWPA 3LY9A 4EPZA 4IYPA 3FTUA 3TG5A 3UQ3A 5JJ7A 3MX3A 3IV0A 2C0MA 2J4DA 4OYSA 4PS8A 2JEKA 1Z3YA 3IKOB 3CHPA 3HHMA 3KD7A 3VTYA 3O48A 3PH0C 1H19A 2IF4A 2I2OA 3UX4A 1E8ZA 2CFZA 4BX9A 3I4GA 4JA9A 4ILHB 3LS8A 1A17A 3JYSA 2KZTA 4F53A 4KT6B 2X6KA 4GMLA 2VQ2A 4J8FA 5FWQA 4BY6A 5ANLA 5D0QD 4N5CA 2V8SE 2J07A 2WXMA 5FZRA 3SBTB 2UWJG 3KAEA 4M3OA 4PDXA 5C1DA 3SD5A 4XIFA 2WPVA 1INZA 1KLXA 5LX8A 3I5PA 3CVWA 3FH7A 4KZCA 5BUZA 3FU3A 3CHQA 3URZA 3CVUA 1FCHA 4WWNA 1QZ2A 1H0AA 3LYAA 1OWLA 2CHZA 3APCA 1KT0A 4WNFA 1HG2A 3FUNA 3ASDA 3GZ2A 4EECA 4I6EA 3CHOA 3IHYA 3RJVA 4U07A 4Q96A 3GYZA 5JJTA 3D9OA 2WXGA 3GZSA 5FQ7A 2C2LA 4AV7A 2HR2A 5LCWJ 1IQUA 1W3BA 3MYVA 1DNPA 2WXRA 4AEZC 2J08A 2I6HA 2XCBA 3B13A 3QKYA 3QC1A 2CFUA 5BNWA 3T5VA 3RO3A 1Y8MA 2GRMA 4H7XA 4QFVA 3ULQA 1TJFA 3SI5A 2LAHA 4RG9A 3GW4A 4JEHA 3FP3A 4GU5A 1ELKA 3ZYQA 3MZLB 4DPRA 4I2WA 3CV0A 1E8WA 3AS8A 1QQEA 5J90A 2XRYA 3L16A 2V5FA 4UWHA 4GMJA 4PS7A 2A5UA 3LKUA 2Y4TA 1ELRA 3QOUA 4FJYA 2CG2A 1EPUA 2LAIA 4L1BA 3PE3A 2OVFA 4GYOA 4BT8A 4XZ4A 4FULA 5EDSA 3T5XA 4UWFA 1ZBPA 2XRZA 2AW6A 3CGHA 2KCVA 3PUJA 3TL5A 2XGMA 2VTBB 3ENEA 3D9MA 3EIJA 3SZ7A 2XEVA 4EZJA 1FVHA 2OOEA 2YHEA 3U66A 4FJZA 4HORA 1HF8A 4CEMA 3FH5A 3AU5A 4B89A 4I2ZA 5FZQA 3CHRA 4G26A 2WM9A 2WQHA 4GZ5A 4TV3A 2J9QA 3KEZA 4G23A 3RK6A 4ACKA 2X6FA 3UT8A 5FT9A 3RU0A 5C2YA 3Q4AB 4JA7A 3ML9A 5ARGA 5A7DB 1PC2A 4HOUA 3ZHEB 2YQ8A 3O4ZA 4O6FA 3EJNA 2YINA 4ME2A 2OVBA 2WXFA 3IBEA 3ZN3A 3U4TA 4DI3A 4AM9A 4Y6WA 2WQ6A 4NQ0A 4IULA 4N39A 2FEZA 1JPLA 2V4LA 3FULA 4AXHA 4K0RA 2GGFA 4MRUA 2I1KA 3CVLA 3D9NA 4P29A 2GW1A 3ZIMA 3CHMA 3LCAA 4JEUA 2FF4A 2LNIA 1NA0A 2LSVA 3MKQB 3FTZA 1E96B 4UI9C 5KJKA 1PY1A 3L22A 4C9BB 4GPKA 3OXGA 3FUEA 3APDA 3HDXA 3MA5A 5CHEE 4Q69A 2VTBA 1JWGA 4OVVA 3VLEA 4I17A 3OXLA 3Q5MA 3JUIA 4XKBA 3FDHA 3L13A 5FTPA 3ZVVA 3G2TA 1E8XA 3S7BA 3L08A 4G1TA 3FUKA 4J0UA 1OWMA 1Z6TA 3CVQA 3KS2A 4XE0A 5AYWD 3D9KA 4HLEA 4APFA 4CCAA 4I9CA 4PS3A 3RRMB 2PM7A 2FO7A 3P1UA 4L2YA 4L23A 4ABNA 4EZKA 2JLBA 2A4ZA 4H7YA 4I6JA 1IYGA 1PAQA 2IQCA 2PZIA 4WNDA 4FA6A 3RO2A 4UQZA 4AJWA 3ZHEA 5EX0A 3FTVA 3D3MA 4YNDA 1GW6A 3UUXA 4U0SA 4KZ0A 4IN3B 2XQ0A 3CVNA 3FTXA 2V0PA 1H2VC 1FVFA 4L7TA 1IQRA 4JVSA 2J49A 4JHRA 2KATA 5G55A 1Z3XA 3QB2A 4KMOA 1U3DA 3MGBA 4HS2A 2E2EA 2NXPA 2CHWA 3D9PA 4PH4B 2MHKA 3ASGA 2Y3AA 3MKQA 3QDNA 5G04C 3WXXA 4MS6A 4BX8A 3OXFA 4CDNA 2WXIA 2AXUA 4CRWA 5JJ6A 4JHKA 3R9AB 3DPDA 3CKBA 4GZCA 4JHJA 3VLDA 4L2LA 3JQ1A 3FH8A 4NACA 5FQ4A 4UI9K 4APOA 3PNLB 3BEEA 5LFAA 1MHQA 3GZ1A 3CK7A 4C0MA 4B8AA 2NSZA 3CVPA 4WNEA 3ESLA 5G05J 4ACLA 3U3WA 1KT1A 2HM8A 2X6JA 3APFA 3PVLA 2CHXA 2VSNA 1UJJA 5KCMA 4GB9A 3FUFA 4AVXA 3ML8A 4GZ3A 4JXTA 4B0ZA 4CDRA 1HZ4A 3MCXA 3TGOA 3MV3B 3Q47B 5DBKA 4A3VA 5A23A 3EHNA 1ZU2A 1NA3A 2E0IA 4G25A 4G2VA 2ZU6B 4EZLA 4AIFA 4CT4A 2OV8A 3ZFWA 3ZXSA 3FU6A 3Q49B 4I1OB 4Q94A 3PZDA 4D10C 4FC8A 4HOQA 1HXIA 2Y4UA 1EYHA 3Q15A 5LCWC 5EX3A 2XGSA 2WXPA 4F7AA 3CKCA 4RG6A 3OTNA 3QK0A 4FU3A 3RIBA 4CGVA 4AY5A 1H6KA 4G11A 4GAAA 1XGWA 4BTAA 2XPZA 1YA0A 3FUHA 2FULA 4MLPA 2WB2A 1XNFA 4FLBA 3AS5A 3QJZA 3SGHA 2WXLA 1B89A 1JUQA 2XGOA 2R59A 2VYIA 3LVRE 3TJPA 5FJYA 4CGWA 2WXOA 4RVBA 5CCLA 2KM4A 3R7RA 2UY1B 3NZSA 4BTBA 2IONA 4N3AA 5M72A 3FHEA 3LJ3A 1N54A 2X38A 3FU0A 2BF0X 3FFLA 3FUDA 3G2UA 3MJWA 4F3VA 3NQPA 3NF1A 2NC9A 4JPSA 4LUNU 3CR3A 4B94A 3NZUA 4KBQA 5CMYA 3ZEFA 3ZGQA 1UG3A 4KXKB 5E76A 3U9WA 2I1JA 2C0LA 2L6JA 5FQ8A 5BV1A 5JHBA 3QWPA 3S7FA 4WWOA 2XPIA 2I9CA 2KC7A 3G2SA 4XI9A 2MRIA 2AWIA 3CQGB 4RSYA 4OVUA 1TEZA 3PEVB 4U04A 1EF1C 1L5JA 3K9IA 4UI9J 4LEUA 3QWVA 4JW1A 3CVVA 3IHVA 3MKRA 3TAXA 3LVQE 2X6HA 5AIJA 1QNFA 2L0IA 3ONLA 2LSUA 3HIZA 4K03A 4N3CA 1P5QA 3SNXA 3FTWA 4ILIA 4U0ZA 5CCMA 5AENA 5EKQD 4WWPA 4LCTA 4GYYA 5DIZA 5AJLA 2PM6A 3PRZA 2QFCA 4I1AA 2Q7FA 1OWNA 4MKTA 4G24A 3TG4A 4GCNA 4E85A 1X5BA 1HU3A 5AJDA 3B7RL 3L17A 4IRUA 4BFRA 1UJKA 2RG8A 2WXNA 3S7DA 2MOWA 4GA2A 4C0EA 3SF4A 4ANVA 4F1SA 4AOFA 2WMOA 4XI0A 1UN9A 5T4YA 3EHMA 3CSTA 2DBAA 4TUUA 1SZAA 2IU1A 4GZDA 2ILRA 2UY1A 4DJAA 3MEKA 3PDNA 3B7TA 3PREA 4J6IA 4UWGA 4TRQA 4BSXA 4KVOA 4EBAG 3C98A 4EQFA 5J08A 4YVOA 3TXNA 3ZYMA 4AY6A 2LO6A 4CDMA 5BV0A 3UT4A 1NP7A 4U63A 4W9RA 3AU4A 3VTXA 4HFGA 3QAQA 3E4BA 3TXMA 4A3TA 3CVYA 3N71A 3LEWA 2VSOE 2VGYA 4PUCA 2VJ8A 2WVIA 1NZNA 2L9BA 4I43A 3FTSA 5G04J 2PQNA 4UQYA 3G2VA 3SFZA 4GYWA 2XHEA 3LDZA 4EBAA 3FWVA 4I9EA 1HE8A 4U8HA 3FUMA 4A1GA 1N52A 5D0OD 2KCLA 2YHCA 3BG1B 3FUJA 4JZYA 3FY4A 4WAFA 3S7JA 1E7UA 1WM5A 2WXJA 5A6CA 4FLHA 4LRZA 3B7UX 3CIAA 2WXQA 2R17C 3PS6A 3FUIA 4BWRA 2X3MA 2GRLA 4UWLA 2WMNA 3CEQA 5T3RA 1MQSA 2X6IA 3QARA 4FHKA 3CHSA 1LF8A 1HS6A 4YVQC 3B7SA 4A1SA 2BTDA 1E90A 4Y6CA 5HI7A 5HQ8A 3LPZA 2BUGA 3G2WA 2R5SA 1HX8A 4R7LA 3D9LA 3ASHA 1IHGA 2M63A 4GA1A 3LY8A 1JWFA 4AP2A 2PL2A 3PEUB 1UN8A 3T8MA 3AS4A 1OWOA 3I3NA 1U3CA 3UT7A 3D9IA 3UMVA 2IFUA 3U64A 3LY7A 3P2BA 2ONDA 1ELWA 3PUKA 4J8EA 2QY7A 3RRNB 2WQ7A 3ZW3A 3FTYA 3ESKA 4XKCA 3HVEB 4JL0A 4I6GA 2J09A 1WAO1 4ATGA 4FADA 2KCKA 3CVXA 1H2TC 4E6HA 1Y6IA 1DVPA 3RKVA 2XPYA 1UW4B 4J8DA 2FBNA 1HFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2W A;  1UJK A;  1HX8 A;  1H0A A;  3D9L A;  2DCP A;  3G2V A;  4FU3 A;  3LDZ A;  2MOW A;  3G2S A;  1XGW A;  3D9M A;  1JWF A;  3RRU A;  1HG2 A;  3G2T A;  1VDY A;  1SZ9 A;  1UJJ A;  4FLB A;  1ELK A;  1SZA A;  2V8S E;  3D9I A;  1JPL A;  4GZD A;  3ZYQ A;  5LP0 A;  3D9K A;  3ONK A;  3D9P A;  1HF8 A;  1JUQ A;  4Q96 A;  4JXT A;  2L0I A;  3ZYK A;  4AVX A;  2QY7 A;  3D9O A;  3ONL A;  5J08 A;  3D9N A;  3ZYM A;  2KM4 A;  2LO6 A;  1INZ A;  2L0T B;  3CLJ A;  4GZC A;  1HFA A;  2BF0 X;  4HFG A;  3ZYL A;  2DIW A;  1PY1 A;  3G2U A;  4NAC A;  1LF8 A;  5LOZ A;  1DVP A;  4Q94 A;  1X5B A;  3D9J A;  5CMY A;  1JWG A;  1EYH A;  5CMW A;  1HG5 A;  1MHQ A;  1EDU A; 
#chains in the Genus database with same CATH topology
 3ZPJ A;  3OAW A;  1S0P A;  3RRU A;  2VGX B;  5BT1 A;  4GCO A;  5ENO D;  3ZRH A;  3TWQ A;  5ARF A;  3DEP A;  4HB5 A;  2P9N G;  4DK5 A;  4XEI G;  3S2A A;  4ANW A;  2IOS A;  3L6A A;  3Q75 A;  3FU5 A;  3IEG A;  4X8Q A;  3D9J A;  5CMW A;  1HG5 A;  1EDU A;  4K5C A;  4NUR A;  2AXZ A;  1HO8 A;  3SBS A;  3I4R B;  3CQC B;  5LP0 A;  2KZT B;  3ULE G;  3HVE A;  3CK8 A;  3CK9 A;  4LG6 A;  3DBS A;  5BW8 C;  3QWW A;  5LOZ A;  4B8C B;  1OUV A;  4GTP A;  4DLO A;  5KJM A;  1E7V A;  1SZ9 A;  2EIM E;  3HYM B;  3BUA A;  3TG5 A;  5JJ7 A;  3DSV A;  1TYQ G;  3IKO B;  3VTY A;  3O48 A;  1V55 E;  1LTX A;  4ILH B;  3LS8 A;  2VQ2 A;  4J8F A;  2J07 A;  3HG0 D;  2WXM A;  4PDX A;  3JXI A;  3KEA A;  3JXJ A;  5BUZ A;  3CVU A;  3LYA A;  2HE0 A;  2CHZ A;  4WNF A;  4I6E A;  3RJV A;  3GZS A;  1W3B A;  3MYV A;  3D9H A;  1DNP A;  4AEZ C;  2J08 A;  2I6H A;  4BER A;  2XCB A;  3B13 A;  2ZXW E;  3QC1 A;  5BNW A;  2IO2 C;  3SI5 A;  3GW4 A;  1TR4 A;  3CV0 A;  4K5B A;  4I2W A;  1E8W A;  1UOH A;  5D66 A;  5J90 A;  4GMJ A;  1ELR A;  3QOU A;  4L1B A;  3PE3 A;  2OVF A;  3SO8 A;  4BSZ B;  3T5X A;  1TN8 A;  1BLX B;  3UI2 A;  3CGH A;  2KCV A;  3TL5 A;  3SZ7 A;  3D9M A;  2XEV A;  4EZJ A;  4L9P A;  1RZ4 A;  3HXF A;  5FZQ A;  1YMP A;  2F8Y A;  3ZUV B;  5A7D B;  4HOU A;  1N11 A;  2YIN A;  4ME2 A;  3UIN C;  1AWC B;  4O1P A;  4IUL A;  3FUL A;  4GTM A;  3CHM A;  5KJK A;  4C9B B;  1JCQ A;  1X81 A;  4LNU D;  3MA5 A;  3VLE A;  3Q5M A;  4J7W A;  3G2T A;  4J0U A;  3CVQ A;  1Z6T A;  2DYS E;  4APF A;  4BES A;  4YDE A;  3HRA A;  4HRL A;  4PS3 A;  2JLB A;  4H7Y A;  2NYJ A;  4FA6 A;  1Q2Z A;  2RFM A;  4YND A;  4U0S A;  4IN3 B;  2XQ0 A;  3CVN A;  2LXM A;  2V0P A;  1FVF A;  4L7T A;  2J49 A;  4JHR A;  5G55 A;  1Z3X A;  2GRO B;  3IXE A;  3QB2 A;  1U3D A;  3D9P A;  4PH4 B;  3L9T A;  3ASG A;  3WG7 E;  3OXF A;  3ASO E;  2WXI A;  2AXU A;  3R9A B;  4GZC A;  4L2L A;  5FQ4 A;  3PNL B;  5LFA A;  1MHQ A;  2V4H C;  3ESL A;  5G05 J;  1KT1 A;  3PVL A;  3APF A;  2CHX A;  4G8K A;  3UM0 A;  2H6I A;  3FUF A;  4B0Z A;  3MCX A;  5DBK A;  4A3V A;  4DRX E;  4G25 A;  4CT4 A;  4HOQ A;  1EYH A;  3Q15 A;  4M7C A;  3OTN A;  4AY5 A;  1H6K A;  3FUH A;  4JB8 P;  1YCS B;  2WB2 A;  1DCQ A;  5ENR D;  2WXL A;  1JUQ A;  2R59 A;  3TJP A;  2UY1 B;  3X2Q E;  3FHE A;  3FU0 A;  3G2U A;  3MJW A;  4B94 A;  4KBQ A;  3EHR A;  3ZEF A;  3U9W A;  2I1J A;  5FQ8 A;  3QWP A;  4WWO A;  2KC7 A;  3G2S A;  4XI9 A;  2AWI A;  4U04 A;  1EF1 C;  3AG3 E;  4JW1 A;  4O1O A;  3IHV A;  4EHM A;  3TAX A;  3DRA A;  3LVQ E;  2GRR B;  4N3C A;  3SNX A;  3FTW A;  5CCM A;  4WWP A;  1QBQ A;  2QFC A;  4I1A A;  2Q7F A;  4MKT A;  2LXL A;  1WG0 A;  4E85 A;  1S70 B;  1OT8 A;  3S7D A;  1N9A A;  4GA2 A;  3SF4 A;  4ANV A;  3RAU A;  2WMO A;  2DBA A;  1SZA A;  4DJA A;  3B7T A;  3PRE A;  4KVO A;  5BV0 A;  3UT4 A;  1NP7 A;  4W9R A;  3AU4 A;  3R9M A;  3N71 A;  5EN5 D;  2YHC A;  1WM5 A;  4FLH A;  3B7U X;  3CIA A;  2WXQ A;  4JD2 G;  3PS6 A;  3NBN B;  3FUI A;  4BWR A;  5AQA A;  3J5Q B;  5HI7 A;  3LPZ A;  2BUG A;  2M63 A;  4GA1 A;  1JWF A;  1A5E A;  1OWO A;  3V2X A;  5HS0 A;  3P2B A;  2OND A;  1ELW A;  3PUK A;  4J8E A;  1FT2 A;  3ZW3 A;  3FTY A;  3ESK A;  4XKC A;  4JL0 A;  4ATG A;  1KPS B;  2XPY A;  4J8D A;  1TNZ A;  3LXU X;  4ILG A;  4UQX A;  2HO1 A;  4UWK A;  1SQM A;  3R7Q A;  5KJN A;  5JA4 D;  4RQI A;  3BG0 B;  5G05 C;  4GA0 A;  3ZXP A;  3MV2 B;  4FP7 A;  2RD0 A;  4TXR A;  3EDT B;  2P9P G;  1H2U A;  3UXG A;  4XX5 A;  2AXV A;  2JAB A;  4NRH B;  1O1T A;  2L0T B;  2P58 C;  5CRV A;  3CSF A;  2VSX E;  1HH8 A;  2PQR A;  2AVP A;  3EIQ C;  5CED B;  4HQD A;  4U0U A;  1IKN D;  4DLQ A;  5CEA A;  4EPZ A;  3MX3 A;  2C0M A;  1NI1 A;  2JEK A;  1Z3Y A;  3ZKJ A;  3PH0 C;  2IF4 A;  1N95 A;  3UX4 A;  2CFZ A;  4F53 A;  5FWQ A;  2QZA A;  4BET A;  1QYM A;  4N5C A;  4GTO A;  2UWJ G;  3KAE A;  5C1D A;  3SD5 A;  4XIF A;  2WPV A;  2V5Q C;  3CVW A;  5ENP D;  3URZ A;  1QZ2 A;  1H0A A;  1OWL A;  5FIO A;  3FUN A;  3GZ2 A;  3CHO A;  3IHY A;  4U07 A;  3GYZ A;  5JJT A;  5FQ7 A;  4AV7 A;  5LCW J;  1IQU A;  5KBA A;  3QKY A;  4HI8 A;  3T5V A;  3C3O A;  1Y8M A;  3PZ3 A;  4H7X A;  5AAR A;  2QYJ A;  3ULQ A;  3DXK G;  3FP3 A;  4GU5 A;  2BKG A;  3ZYQ A;  4HNA D;  4DPR A;  3AS8 A;  1QQE A;  2OEV A;  2XRY A;  3L16 A;  3ABM E;  2Y4T A;  4ZFH A;  1EPU A;  5IY5 E;  1JCR A;  2GRN B;  2XRZ A;  1K1B A;  4CEM A;  2LUH A;  4B89 A;  4I2Z A;  3CHR A;  2WM9 A;  4GZ5 A;  3KEZ A;  4G23 A;  2X6F A;  5FIN A;  5FT9 A;  4MBG A;  3ML9 A;  3ZHE B;  3O4Z A;  1LD8 A;  2OVB A;  2WXF A;  3IBE A;  3U4T A;  2WQ6 A;  4NQ0 A;  1JPL A;  3CVL A;  2GW1 A;  3ZIM A;  4JEU A;  3C3Q A;  1TNY A;  3MKQ B;  1E96 B;  3FUE A;  4Q69 A;  2VTB A;  2P9U G;  4GTS A;  1N94 A;  3L13 A;  5FTP A;  3ZVV A;  3S7B A;  4XE0 A;  4HLE A;  4ABN A;  2PM7 A;  4EZK A;  2L6B A;  4AJW A;  5EX0 A;  3D3M A;  2BKK B;  3DSU A;  1H2V C;  3NOG D;  4KMO A;  1V54 E;  1ZB1 A;  2NXP A;  3B95 A;  2Y3A A;  5G04 C;  3WXX A;  1H6P A;  4MS6 A;  4BX8 A;  4JHK A;  3VLD A;  5AQ7 A;  4NAC A;  3GZ1 A;  2NSZ A;  2VSN A;  4AVX A;  3TWS A;  1HZ4 A;  3TGO A;  1OXJ A;  3Q47 B;  1NA3 A;  3V31 A;  2OV8 A;  3ZFW A;  3Q49 B;  4Q94 A;  3PZD A;  1HXI A;  2Y4U A;  5LCW C;  4F7A A;  4DUI A;  4RG6 A;  4FU3 A;  3LJN A;  4BTA A;  3C72 A;  1XNF A;  3AS5 A;  5ITZ F;  3Q9N C;  2P9K G;  3LVR E;  5FJY A;  5CCL A;  2WXO A;  3V2O A;  2KM4 A;  4BTB A;  3NZS A;  2X38 A;  2BF0 X;  3FFL A;  4TUM A;  4YDY A;  4A63 B;  4YDO A;  3NZU A;  5CMY A;  4YDW A;  5BV1 A;  2L6J A;  4OVU A;  3ZNG A;  3PEV B;  3K9I A;  4UI9 J;  4LEU A;  2DZN A;  3CVV A;  2DWZ A;  2X6H A;  3HIZ A;  1P5Q A;  4U0Z A;  4HRN A;  4GYY A;  5AJL A;  1OWN A;  3TG4 A;  4GCN A;  3B7R L;  3L17 A;  3UM3 A;  1UJK A;  1TNU A;  3DXM G;  4J6I A;  4TRQ A;  4EBA G;  3DEO A;  3C98 A;  4YVO A;  2LO6 A;  4U63 A;  3E4B A;  1LD7 A;  4U8Y D;  2VSO E;  1AP7 A;  2VJ8 A;  1NZN A;  1N0Q A;  4DX5 D;  4I43 A;  2PQN A;  3SFZ A;  4EBA A;  1IHB A;  4CZ2 D;  5D0O D;  3BG1 B;  4LSZ E;  3S7J A;  3B7B A;  1E7U A;  1N4S A;  5ENT D;  3NAW A;  3AG2 E;  2X3M A;  3AAA C;  2WMN A;  5KNG A;  3CHS A;  2OCC E;  4YVQ C;  2BTD A;  4Y6C A;  4CYM D;  1JCS A;  4AP2 A;  2PL2 A;  3T8M A;  2XZD G;  3I3N A;  1U3C A;  3D9I A;  4RLY A;  1K1A A;  2OEW A;  3LY7 A;  3RRN B;  3AG1 E;  3HVE B;  2J09 A;  1WAO 1;  1H2T C;  4LNB A;  4GTV A;  1DVP A;  4OAU C;  2DCP A;  4N2S A;  1K8K G;  1OY3 D;  5JHA A;  2EIL E;  5B1A E;  4HOS A;  4V3I A;  4ANU A;  3PE4 A;  5T8I A;  5G2N A;  4KYO B;  3KSL A;  3DSX A;  3DSW A;  3E37 A;  2DIW A;  4HVB A;  1K3Z D;  2EQX A;  4FHJ A;  3SHF A;  1KZO A;  4J8S A;  3JQ0 A;  2GRP B;  3DPY A;  5ENN A;  3ASF A;  4DI4 A;  2IOL A;  4I1M A;  3ZYL A;  1DCE A;  5BPP A;  5ENQ D;  2R2L A;  3FEY A;  2VGX A;  1WY6 A;  3ABK E;  4JC8 A;  2DVW A;  3TWW A;  4HOT A;  4LER A;  3UM1 A;  3E32 A;  1VDY A;  3UIP C;  2QYU A;  2ZIS A;  5KJL A;  3ONK A;  2J4B A;  3LY9 A;  4IYP A;  2KXP C;  3FTU A;  3BU8 A;  3UQ3 A;  3IV0 A;  4OYS A;  3HXB A;  3CHP A;  3KD7 A;  3AJI A;  1SW6 A;  2I2O A;  1G3N B;  1E8Z A;  3SFX A;  4BX9 A;  4JA9 A;  1A17 A;  2KZT A;  4KT6 B;  2X6K A;  2V8S E;  1SA4 A;  5FZR A;  3SBT B;  2DYR E;  1INZ A;  3SQV A;  1KLX A;  5LX8 A;  3I5P A;  3UM2 A;  2H6H A;  3FU3 A;  1FCH A;  4WWN A;  1NFI E;  1HG2 A;  3ASD A;  4EEC A;  2VGE A;  2C2L A;  3E30 A;  1D8D A;  1S63 A;  1MJ0 A;  2CFU A;  2GRM A;  4QFV A;  2LAH A;  4JEH A;  1FT1 A;  3MZL B;  4DX7 D;  4HI9 A;  2A5U A;  3LKU A;  4FJY A;  2CG2 A;  2LAI A;  4GYO A;  4HLL A;  4FUL A;  3AG4 E;  5KNH D;  3UKU G;  1ZBP A;  5EYL A;  4C48 B;  3ENE A;  3EIJ A;  1FVH A;  2OOE A;  2YHE A;  3U66 A;  4FJZ A;  1HF8 A;  3AU5 A;  3TWV A;  3RK6 A;  4G26 A;  4ACK A;  2IY0 C;  3UT8 A;  3RU0 A;  5C2Y A;  4JA7 A;  4HRM B;  2DZO A;  3PZ2 A;  4O6F A;  3EJN A;  4BEP A;  4Y6W A;  2XEE A;  1MX6 A;  2FEZ A;  2V4L A;  4AXH A;  4K0R A;  2GGF A;  4MRU A;  2EIK E;  3LCA A;  2LNI A;  1NA0 A;  2LSV A;  3FTZ A;  2XZT G;  1PY1 A;  2ETB A;  4K5A B;  3OXG A;  3HDX A;  4I17 A;  3HXE A;  3TWX A;  3JUI A;  4XKB A;  4GTR A;  3TWU A;  3L08 A;  4G1T A;  5AYW D;  3KS2 A;  4CCA A;  4I9C A;  3RRM B;  2FO7 A;  4L23 A;  1BI8 B;  4I6J A;  2A4Z A;  2BED A;  3C5R A;  2IQC A;  4WND A;  4UQZ A;  3Q73 A;  5HKP A;  3UUX A;  1GW6 A;  3FTX A;  5EYP F;  3EHQ A;  1IQR A;  4JVS A;  3F6Q A;  5CEC B;  1N4P A;  4J8Y A;  2R02 A;  3TWT A;  3MGB A;  2E2E A;  2CHW A;  4ATZ D;  2MHK A;  3QDN A;  1TN6 A;  4F1P A;  3E33 A;  4CRW A;  3DPD A;  3CKB A;  4JHJ A;  3JQ1 A;  4HBD A;  4UI9 K;  3BEE A;  2F0Y A;  2EIN E;  1YYH A;  4TXQ A;  4WNE A;  3W9G A;  4ACL A;  3U3W A;  2HM8 A;  2X6J A;  5CER B;  1UJJ A;  5KCM A;  2QC9 A;  3V30 A;  3ML8 A;  4GZ3 A;  5A23 A;  3EHN A;  1ZU2 A;  2E0I A;  5D2M C;  4EZL A;  4AIF A;  4GPM A;  2FO1 E;  3ZXS A;  3FU6 A;  4D10 C;  4FC8 A;  5JMN D;  4N5Q A;  5EX3 A;  2WXP A;  3CKC A;  4UUC A;  3QK0 A;  1H6O A;  4G11 A;  4GAA A;  2XPZ A;  1YA0 A;  3V79 K;  4MLP A;  4FLB A;  3SGH A;  1B89 A;  2XGO A;  2ZGD A;  5AQ9 A;  4RVB A;  5M72 A;  2ION A;  3FUD A;  3NQP A;  4JPS A;  1D8E A;  4LUN U;  3CR3 A;  1UG3 A;  4KXK B;  3S7F A;  3E34 A;  2MRI A;  1L5J A;  3MKR A;  1N0R A;  2L0I A;  5HRY A;  4LCT A;  3NOC D;  2PM6 A;  3PRZ A;  3UKR G;  5AJD A;  4IRU A;  4BFR A;  3T9K A;  2RG8 A;  2WXN A;  3Q7F A;  4C0E A;  5EIL A;  4F1S A;  5BXU A;  4G8L A;  4AOF A;  3ABL E;  5T4Y A;  2F37 A;  3EHM A;  4TUU A;  2IU1 A;  4GZD A;  2ILR A;  2UY1 A;  4OAV B;  3MEK A;  3PDN A;  2EIJ E;  4EQF A;  3ZYM A;  4CDM A;  3UTM A;  3QAQ A;  5BXO A;  4PUC A;  4DX1 A;  3FTS A;  2XS1 A;  4GYW A;  3LDZ A;  1HE8 A;  2H6G A;  5AAO A;  3FUM A;  4A1G A;  1N52 A;  2KCL A;  2MYO A;  3FUJ A;  4WAF A;  2WXJ A;  4GTT A;  4UWL A;  1MQS A;  4FHK A;  1O1R A;  1LF8 A;  1E90 A;  2PNN A;  4R7L A;  3D9L A;  3ASH A;  1IHG A;  3LY8 A;  1UN8 A;  3DST A;  3AS4 A;  3UT7 A;  2IFU A;  3ZU7 B;  4TXP A;  4I6G A;  4FAD A;  3L82 A;  1Y6I A;  3RKV A;  3PZ4 A;  2ETC A;  4N3B A;  3L54 A;  4WUY A;  4N2Q A;  3UPV A;  4HXI A;  2CG3 A;  1KZP A;  5E75 A;  2VSY A;  4BT9 A;  4A55 A;  1TJC A;  3FEX A;  3JUE A;  4GZ6 A;  1BPO A;  2WXK A;  5ANR A;  3CLJ A;  4ANX A;  4CT0 A;  2XCC A;  2Y69 E;  4URK A;  5FZS A;  3C3R A;  4NIK A;  3JCK C;  2H6F A;  1N4Q A;  4WNG A;  3EU9 A;  2IJG X;  2YNQ A;  2P9I G;  2HYZ A;  2R03 A;  5FQ6 A;  1E8Y A;  2FI7 A;  4KVM A;  2ZIR A;  3PNT B;  3VLF A;  2WXH A;  3QNK A;  3ZYK A;  1RW2 A;  1OWP A;  5AN8 A;  4B93 B;  1TNB A;  2J4D A;  4PS8 A;  3HHM A;  3BQO A;  2XEH A;  1H19 A;  5AQB A;  3I4G A;  3Q78 A;  3JYS A;  4GML A;  4BY6 A;  5ANL A;  5D0Q D;  2ETA A;  4M3O A;  3UIO C;  2KBX A;  3FH7 A;  4KZC A;  2ZGG A;  3CHQ A;  3TWR A;  1U2V G;  3APC A;  1KT0 A;  1TN7 A;  3DWL G;  1MX2 A;  2RFA A;  4Q96 A;  1OCO E;  2WXG A;  3D9O A;  2HR2 A;  2RKK A;  2WXR A;  2IO3 C;  3RO3 A;  1TJF A;  4RG9 A;  1ELK A;  2V5F A;  4UWH A;  2F8X K;  2AJA A;  4PS7 A;  3Q79 A;  1BU9 A;  1OCZ E;  2P9L G;  4BT8 A;  4XZ4 A;  1N4R A;  5EDS A;  4UWF A;  2AW6 A;  1S64 A;  3PUJ A;  2XGM A;  2VTB B;  4U95 D;  1OCC E;  4LNG A;  4HOR A;  3FH5 A;  3NB2 A;  4Z68 A;  2WQH A;  4TV3 A;  2J9Q A;  5CBN A;  3Q4A B;  5ARG A;  1PC2 A;  2YQ8 A;  5B1B E;  3ZN3 A;  4DI3 A;  4AM9 A;  4N39 A;  1MYO A;  2I1K A;  3D9N A;  4P29 A;  2FF4 A;  1WDY A;  1D9S A;  4UI9 C;  3L22 A;  4GPK A;  5CHE E;  3APD A;  1JWG A;  4OVV A;  3OXL A;  3FDH A;  1E8X A;  3FUK A;  1OWM A;  3D9K A;  2IEJ A;  3P1U A;  4L2Y A;  5ENS D;  2GRQ B;  1IYG A;  1PAQ A;  4O60 A;  2PZI A;  3RO2 A;  2XS8 A;  4GMR A;  3ZHE A;  3FTV A;  4KZ0 A;  3ISM C;  2KAT A;  5B3S E;  3T8K A;  4HS2 A;  2P9S G;  3MKQ A;  1BI7 B;  2XEN A;  4CDN A;  5JJ6 A;  3ULY A;  3FH8 A;  4DX6 D;  4APO A;  1TNO A;  3CK7 A;  3PZ1 A;  4C0M A;  4B8A A;  3CVP A;  3SY2 A;  2J8S D;  1OCR E;  4GB9 A;  4CDR A;  4JXT A;  3MV3 B;  4G2V A;  2ZU6 B;  4I1O B;  2XGS A;  5EID A;  3RIB A;  4CGV A;  3KSQ A;  1XGW A;  2FUL A;  3QJZ A;  3ASN E;  2VYI A;  4CGW A;  3R7R A;  4N3A A;  3LJ3 A;  1N54 A;  4F3V A;  3NF1 A;  2NC9 A;  2Y0B G;  3ZGQ A;  1IXV A;  2B0O E;  5E76 A;  2C0L A;  5JHB A;  2XPI A;  1FPP A;  2I9C A;  3CQG B;  4RSY A;  1TEZ A;  3QWV A;  3Q9U C;  5AIJ A;  1QNF A;  3ONL A;  2LSU A;  4K03 A;  4ILI A;  3W9F A;  5AEN A;  5EKQ D;  5DIZ A;  1Z5S C;  5CBO A;  4G24 A;  1X5B A;  1HU3 A;  1O5M A;  2MOW A;  4XI0 A;  1UN9 A;  4GTQ A;  3CST A;  3J5P A;  3DSS A;  3HXC A;  4BSX A;  4UWG A;  5J08 A;  3TXN A;  4AY6 A;  3VTX A;  4HFG A;  4A3T A;  3TXM A;  4ZHB A;  3CVY A;  3LEW A;  5EIB E;  1MX4 A;  2A5E A;  2VGY A;  2WVI A;  2L9B A;  5G04 J;  4UQY A;  3G2V A;  5CRU A;  2XHE A;  3FWV A;  4I9E A;  4U8H A;  4JZY A;  3FY4 A;  4U7E B;  5A6C A;  4LRZ A;  2R17 C;  2B6C A;  2GRL A;  3CEQ A;  5T3R A;  5H7P A;  1SVX A;  2X6I A;  3QAR A;  2P2C P;  3RSE G;  1HS6 A;  5KWD A;  3B7S A;  4A1S A;  5HQ8 A;  2Y1L E;  1DC2 A;  3G2W A;  2R5S A;  1HX8 A;  3SFY A;  4DX2 A;  3PEU B;  3HXD A;  3UMV A;  4QQI A;  3U64 A;  1SA5 A;  3EUV A;  2QY7 A;  3Q7A A;  2WQ7 A;  1MZC A;  3EU5 A;  1NL4 A;  2FBN A;  4F6R D;  2KCK A;  3CVX A;  4E6H A;  4U8V D;  1UW4 B;  1BD8 A;  2R05 A;  1HFA A;  1O1S A;  4U96 D; 
#chains in the Genus database with same CATH homology
 3ZPJ A;  3OAW A;  4N3B A;  3L54 A;  2DCP A;  4N2S A;  4WUY A;  4N2Q A;  3LXU X;  1S0P A;  4HXI A;  4ILG A;  4UQX A;  3UPV A;  3RRU A;  2CG3 A;  2HO1 A;  4UWK A;  2VGX B;  5BT1 A;  4GCO A;  5E75 A;  1SQM A;  3ZRH A;  2VSY A;  4BT9 A;  3R7Q A;  4A55 A;  5KJN A;  1TJC A;  3FEX A;  5ARF A;  5JHA A;  4GZ6 A;  4DK5 A;  3BG0 B;  1BPO A;  4HOS A;  5G05 C;  2WXK A;  4V3I A;  4ANU A;  3S2A A;  3PE4 A;  4ANW A;  5T8I A;  2IOS A;  3L6A A;  5ANR A;  3CLJ A;  5G2N A;  4GA0 A;  4KYO B;  3MV2 B;  4FP7 A;  4ANX A;  4CT0 A;  2RD0 A;  3FU5 A;  3IEG A;  2XCC A;  3D9J A;  5CMW A;  1HG5 A;  2DIW A;  4HVB A;  1EDU A;  4URK A;  4NUR A;  5FZS A;  2AXZ A;  3JCK C;  2EQX A;  4FHJ A;  1HO8 A;  3SBS A;  3SHF A;  3I4R B;  3EDT B;  4J8S A;  1H2U A;  4WNG A;  3CQC B;  5LP0 A;  3JQ0 A;  4XX5 A;  2KZT B;  3HVE A;  3CK8 A;  2IJG X;  3CK9 A;  5ENN A;  2AXV A;  3ASF A;  4DI4 A;  2IOL A;  2YNQ A;  4NRH B;  3DBS A;  4I1M A;  2L0T B;  2P58 C;  2HYZ A;  5BW8 C;  3ZYL A;  3CSF A;  3QWW A;  5BPP A;  5FQ6 A;  5LOZ A;  1E8Y A;  2FI7 A;  2VSX E;  4KVM A;  3FEY A;  1HH8 A;  2PQR A;  2VGX A;  4B8C B;  1WY6 A;  2AVP A;  3EIQ C;  1OUV A;  4JC8 A;  3PNT B;  3VLF A;  4LER A;  4DLO A;  4HOT A;  5KJM A;  2WXH A;  1E7V A;  1VDY A;  1SZ9 A;  4U0U A;  3HYM B;  3QNK A;  5KJL A;  3ONK A;  4DLQ A;  2J4B A;  3ZYK A;  1OWP A;  3LY9 A;  4EPZ A;  4IYP A;  3FTU A;  3TG5 A;  3UQ3 A;  5JJ7 A;  3MX3 A;  3IV0 A;  2C0M A;  2J4D A;  4OYS A;  4PS8 A;  2JEK A;  1Z3Y A;  3IKO B;  3CHP A;  3HHM A;  3KD7 A;  3VTY A;  3O48 A;  3PH0 C;  1H19 A;  2IF4 A;  2I2O A;  3UX4 A;  1E8Z A;  2CFZ A;  4BX9 A;  3I4G A;  4JA9 A;  4ILH B;  3LS8 A;  1A17 A;  3JYS A;  2KZT A;  4F53 A;  4KT6 B;  2X6K A;  4GML A;  2VQ2 A;  4J8F A;  5FWQ A;  4BY6 A;  5ANL A;  5D0Q D;  4N5C A;  2V8S E;  2J07 A;  2WXM A;  5FZR A;  3SBT B;  2UWJ G;  3KAE A;  4M3O A;  4PDX A;  5C1D A;  3SD5 A;  4XIF A;  2WPV A;  1INZ A;  1KLX A;  5LX8 A;  3I5P A;  3CVW A;  3FH7 A;  4KZC A;  5BUZ A;  3FU3 A;  3CHQ A;  3URZ A;  3CVU A;  1FCH A;  4WWN A;  1QZ2 A;  1H0A A;  3LYA A;  1OWL A;  2CHZ A;  3APC A;  1KT0 A;  4WNF A;  1HG2 A;  3FUN A;  3ASD A;  3GZ2 A;  4EEC A;  4I6E A;  3CHO A;  3IHY A;  3RJV A;  4U07 A;  4Q96 A;  3GYZ A;  5JJT A;  3D9O A;  2WXG A;  3GZS A;  5FQ7 A;  2C2L A;  4AV7 A;  2HR2 A;  5LCW J;  1IQU A;  1W3B A;  3MYV A;  1DNP A;  2WXR A;  4AEZ C;  2J08 A;  2I6H A;  2XCB A;  3B13 A;  3QKY A;  3QC1 A;  2CFU A;  5BNW A;  3T5V A;  3RO3 A;  1Y8M A;  2GRM A;  4H7X A;  4QFV A;  3ULQ A;  1TJF A;  3SI5 A;  2LAH A;  4RG9 A;  3GW4 A;  4JEH A;  3FP3 A;  4GU5 A;  1ELK A;  3ZYQ A;  3MZL B;  4DPR A;  4I2W A;  3CV0 A;  1E8W A;  3AS8 A;  1QQE A;  5J90 A;  2XRY A;  3L16 A;  2V5F A;  4UWH A;  4GMJ A;  4PS7 A;  2A5U A;  3LKU A;  2Y4T A;  1ELR A;  3QOU A;  4FJY A;  2CG2 A;  1EPU A;  2LAI A;  4L1B A;  3PE3 A;  2OVF A;  4GYO A;  4BT8 A;  4XZ4 A;  4FUL A;  5EDS A;  3T5X A;  4UWF A;  1ZBP A;  2XRZ A;  2AW6 A;  3CGH A;  2KCV A;  3PUJ A;  3TL5 A;  2XGM A;  2VTB B;  3ENE A;  3D9M A;  3EIJ A;  3SZ7 A;  2XEV A;  4EZJ A;  1FVH A;  2OOE A;  2YHE A;  3U66 A;  4FJZ A;  4HOR A;  1HF8 A;  4CEM A;  3FH5 A;  3AU5 A;  4B89 A;  4I2Z A;  5FZQ A;  3CHR A;  4G26 A;  2WM9 A;  2WQH A;  4GZ5 A;  4TV3 A;  2J9Q A;  3KEZ A;  4G23 A;  3RK6 A;  4ACK A;  2X6F A;  3UT8 A;  5FT9 A;  3RU0 A;  5C2Y A;  3Q4A B;  4JA7 A;  3ML9 A;  5ARG A;  5A7D B;  1PC2 A;  4HOU A;  3ZHE B;  2YQ8 A;  3O4Z A;  4O6F A;  3EJN A;  2YIN A;  4ME2 A;  2OVB A;  2WXF A;  3IBE A;  3ZN3 A;  3U4T A;  4DI3 A;  4AM9 A;  4Y6W A;  2WQ6 A;  4NQ0 A;  4IUL A;  4N39 A;  2FEZ A;  1JPL A;  2V4L A;  3FUL A;  4AXH A;  4K0R A;  2GGF A;  4MRU A;  2I1K A;  3CVL A;  3D9N A;  4P29 A;  2GW1 A;  3ZIM A;  3CHM A;  3LCA A;  4JEU A;  2FF4 A;  2LNI A;  1NA0 A;  2LSV A;  3MKQ B;  3FTZ A;  1E96 B;  4UI9 C;  5KJK A;  1PY1 A;  3L22 A;  4C9B B;  4GPK A;  3OXG A;  3FUE A;  3APD A;  3HDX A;  3MA5 A;  5CHE E;  4Q69 A;  2VTB A;  1JWG A;  4OVV A;  3VLE A;  4I17 A;  3OXL A;  3Q5M A;  3JUI A;  4XKB A;  3FDH A;  3L13 A;  5FTP A;  3ZVV A;  3G2T A;  1E8X A;  3S7B A;  3L08 A;  4G1T A;  3FUK A;  4J0U A;  1OWM A;  1Z6T A;  3CVQ A;  3KS2 A;  4XE0 A;  5AYW D;  3D9K A;  4HLE A;  4APF A;  4CCA A;  4I9C A;  4PS3 A;  3RRM B;  2PM7 A;  2FO7 A;  3P1U A;  4L2Y A;  4L23 A;  4ABN A;  4EZK A;  2JLB A;  2A4Z A;  4H7Y A;  4I6J A;  1IYG A;  1PAQ A;  2IQC A;  2PZI A;  4WND A;  4FA6 A;  3RO2 A;  4UQZ A;  4AJW A;  3ZHE A;  5EX0 A;  3FTV A;  3D3M A;  4YND A;  1GW6 A;  3UUX A;  4U0S A;  4KZ0 A;  4IN3 B;  2XQ0 A;  3CVN A;  3FTX A;  2V0P A;  1H2V C;  1FVF A;  4L7T A;  1IQR A;  4JVS A;  2J49 A;  4JHR A;  2KAT A;  5G55 A;  1Z3X A;  3QB2 A;  4KMO A;  1U3D A;  3MGB A;  4HS2 A;  2E2E A;  2NXP A;  2CHW A;  3D9P A;  4PH4 B;  2MHK A;  3ASG A;  2Y3A A;  3MKQ A;  3QDN A;  5G04 C;  3WXX A;  4MS6 A;  4BX8 A;  3OXF A;  4CDN A;  2WXI A;  2AXU A;  4CRW A;  5JJ6 A;  4JHK A;  3R9A B;  3DPD A;  3CKB A;  4GZC A;  4JHJ A;  3VLD A;  4L2L A;  3JQ1 A;  3FH8 A;  4NAC A;  5FQ4 A;  4UI9 K;  4APO A;  3PNL B;  3BEE A;  5LFA A;  1MHQ A;  3GZ1 A;  3CK7 A;  4C0M A;  4B8A A;  2NSZ A;  3CVP A;  4WNE A;  3ESL A;  5G05 J;  4ACL A;  3U3W A;  1KT1 A;  2HM8 A;  2X6J A;  3APF A;  3PVL A;  2CHX A;  2VSN A;  1UJJ A;  5KCM A;  4GB9 A;  3FUF A;  4AVX A;  3ML8 A;  4GZ3 A;  4JXT A;  4B0Z A;  4CDR A;  1HZ4 A;  3MCX A;  3TGO A;  3MV3 B;  3Q47 B;  5DBK A;  4A3V A;  5A23 A;  3EHN A;  1ZU2 A;  1NA3 A;  2E0I A;  4G25 A;  4G2V A;  2ZU6 B;  4EZL A;  4AIF A;  4CT4 A;  2OV8 A;  3ZFW A;  3ZXS A;  3FU6 A;  3Q49 B;  4I1O B;  4Q94 A;  3PZD A;  4D10 C;  4FC8 A;  4HOQ A;  1HXI A;  2Y4U A;  1EYH A;  3Q15 A;  5LCW C;  5EX3 A;  2XGS A;  2WXP A;  4F7A A;  3CKC A;  4RG6 A;  3OTN A;  3QK0 A;  4FU3 A;  3RIB A;  4CGV A;  4AY5 A;  1H6K A;  4G11 A;  4GAA A;  1XGW A;  4BTA A;  2XPZ A;  1YA0 A;  3FUH A;  2FUL A;  4MLP A;  2WB2 A;  1XNF A;  4FLB A;  3AS5 A;  3QJZ A;  3SGH A;  2WXL A;  1B89 A;  1JUQ A;  2XGO A;  2R59 A;  2VYI A;  3LVR E;  3TJP A;  5FJY A;  4CGW A;  2WXO A;  4RVB A;  5CCL A;  2KM4 A;  3R7R A;  2UY1 B;  3NZS A;  4BTB A;  2ION A;  4N3A A;  5M72 A;  3FHE A;  3LJ3 A;  1N54 A;  2X38 A;  3FU0 A;  2BF0 X;  3FFL A;  3FUD A;  3G2U A;  3MJW A;  4F3V A;  3NQP A;  3NF1 A;  2NC9 A;  4JPS A;  4LUN U;  3CR3 A;  4B94 A;  3NZU A;  4KBQ A;  5CMY A;  3ZEF A;  3ZGQ A;  1UG3 A;  4KXK B;  5E76 A;  3U9W A;  2I1J A;  2C0L A;  2L6J A;  5FQ8 A;  5BV1 A;  5JHB A;  3QWP A;  3S7F A;  4WWO A;  2XPI A;  2I9C A;  2KC7 A;  3G2S A;  4XI9 A;  2MRI A;  2AWI A;  3CQG B;  4RSY A;  4OVU A;  1TEZ A;  3PEV B;  4U04 A;  1EF1 C;  1L5J A;  3K9I A;  4UI9 J;  4LEU A;  3QWV A;  4JW1 A;  3CVV A;  3IHV A;  3MKR A;  3TAX A;  3LVQ E;  2X6H A;  5AIJ A;  1QNF A;  2L0I A;  3ONL A;  2LSU A;  3HIZ A;  4K03 A;  4N3C A;  1P5Q A;  3SNX A;  3FTW A;  4ILI A;  4U0Z A;  5CCM A;  5AEN A;  5EKQ D;  4WWP A;  4LCT A;  4GYY A;  5DIZ A;  5AJL A;  2PM6 A;  3PRZ A;  2QFC A;  4I1A A;  2Q7F A;  1OWN A;  4MKT A;  4G24 A;  3TG4 A;  4GCN A;  4E85 A;  1X5B A;  1HU3 A;  5AJD A;  3B7R L;  3L17 A;  4IRU A;  4BFR A;  1UJK A;  2RG8 A;  2WXN A;  3S7D A;  2MOW A;  4GA2 A;  4C0E A;  3SF4 A;  4ANV A;  4F1S A;  4AOF A;  2WMO A;  4XI0 A;  1UN9 A;  5T4Y A;  3EHM A;  3CST A;  2DBA A;  4TUU A;  1SZA A;  2IU1 A;  4GZD A;  2ILR A;  2UY1 A;  4DJA A;  3MEK A;  3PDN A;  3B7T A;  3PRE A;  4J6I A;  4UWG A;  4TRQ A;  4BSX A;  4KVO A;  4EBA G;  3C98 A;  4EQF A;  5J08 A;  4YVO A;  3TXN A;  3ZYM A;  4AY6 A;  2LO6 A;  4CDM A;  5BV0 A;  3UT4 A;  1NP7 A;  4U63 A;  4W9R A;  3AU4 A;  3VTX A;  4HFG A;  3QAQ A;  3E4B A;  3TXM A;  4A3T A;  3CVY A;  3N71 A;  3LEW A;  2VSO E;  2VGY A;  4PUC A;  2VJ8 A;  2WVI A;  1NZN A;  2L9B A;  4I43 A;  3FTS A;  5G04 J;  2PQN A;  4UQY A;  3G2V A;  3SFZ A;  4GYW A;  2XHE A;  3LDZ A;  4EBA A;  3FWV A;  4I9E A;  1HE8 A;  4U8H A;  3FUM A;  4A1G A;  1N52 A;  5D0O D;  2KCL A;  2YHC A;  3BG1 B;  3FUJ A;  4JZY A;  3FY4 A;  4WAF A;  3S7J A;  1E7U A;  1WM5 A;  2WXJ A;  5A6C A;  4FLH A;  4LRZ A;  3B7U X;  3CIA A;  2WXQ A;  2R17 C;  3PS6 A;  3FUI A;  4BWR A;  2X3M A;  2GRL A;  4UWL A;  2WMN A;  3CEQ A;  5T3R A;  1MQS A;  2X6I A;  3QAR A;  4FHK A;  3CHS A;  1LF8 A;  1HS6 A;  4YVQ C;  3B7S A;  4A1S A;  2BTD A;  1E90 A;  4Y6C A;  5HI7 A;  5HQ8 A;  3LPZ A;  2BUG A;  3G2W A;  2R5S A;  1HX8 A;  4R7L A;  3D9L A;  3ASH A;  1IHG A;  2M63 A;  4GA1 A;  3LY8 A;  1JWF A;  4AP2 A;  2PL2 A;  3PEU B;  1UN8 A;  3T8M A;  3AS4 A;  1OWO A;  3I3N A;  1U3C A;  3UT7 A;  3D9I A;  3UMV A;  2IFU A;  3U64 A;  3LY7 A;  3P2B A;  2OND A;  1ELW A;  3PUK A;  4J8E A;  2QY7 A;  3RRN B;  2WQ7 A;  3ZW3 A;  3FTY A;  3ESK A;  4XKC A;  3HVE B;  4JL0 A;  4I6G A;  2J09 A;  1WAO 1;  4ATG A;  4FAD A;  2KCK A;  3CVX A;  1H2T C;  4E6H A;  1Y6I A;  1DVP A;  3RKV A;  2XPY A;  1UW4 B;  4J8D A;  2FBN A;  1HFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...