1XGWA

The crystal structure of human enthoprotin n-terminal domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
VVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human enthoprotin N-terminal domain
rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords Epsin 4
total genus 51
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1xgwA00
1JUQA 3G2TA 2L0IA 2DIWA 3ONKA 1SZAA 3CLJA 3D9KA 3ZYKA 1X5BA 4FLBA 3D9LA 2DCPA 3ZYMA 2V8SE 2LO6A 4HFGA 3G2WA 1HG2A 1HX8A 3D9PA 5CMYA 5LOZA 1HFAA 2L0TB 3D9MA 3G2VA 3LDZA 1JPLA 4NACA 4Q94A 1DVPA 1LF8A 5CMWA 4GZCA 4GZDA 5J08A 1JWFA 1JWGA 3ONLA 3D9IA 1EYHA 3RRUA 1HG5A 1VDYA 4Q96A 4FU3A 3D9OA 2BF0X 1INZA 5LP0A 1SZ9A 2KM4A 3D9NA 3G2UA 1UJKA 1ELKA 1UJJA 3ZYQA 1PY1A 4AVXA 3G2SA 3D9JA 4JXTA 2MOWA 1XGWA 1H0AA 2QY7A 1EDUA 3ZYLA 1HF8A 1MHQA
chains in the Genus database with same CATH superfamily
3FFLA 1QQEA 3B7TA 3MCXA 4CGWA 1QNFA 3T5VA 3U66A 2IOSA 4A55A 3HXFA 4U0UA 3ASHA 3CVXA 2ZGDA 3FULA 3HXEA 3TG5A 3S2AA 2OVFA 1QZ2A 1OCZE 5G55A 4AY6A 3Q49B 1JPLA 3IKOB 4PS7A 1LF8A 4TXQA 2NSZA 4B94A 3ZUVB 3UT7A 2R03A 2IF4A 4W9RA 4FLHA 5LP0A 5D0OD 3C72A 4JHKA 3CHRA 1SA5A 5BPPA 2ETCA 3BG0B 3S7FA 5A6CA 2QYJA 3PNTB 4UQZA 1K8KG 3IHVA 3P2BA 3TWRA 2BF0X 2Y69E 3FUJA 1N0RA 2UY1B 3Q7AA 3LY9A 4FULA 4M3OA 3MX3A 1YYHA 2WXQA 3UQ3A 4G2VA 3TWQA 2HE0A 3IXEA 5G04C 4I6GA 4BEPA 1JWGA 3HXCA 3FUNA 4E6HA 3AU5A 5EX3A 2B6CA 3FTVA 3PEUB 3U4TA 3D9HA 1D9SA 3D3MA 1BPOA 4A63B 1JUQA 2P9SG 1SA4A 3QOUA 2WMOA 5D0QD 1FCHA 2XEVA 2GRMA 3EHMA 1KPSB 3IBEA 4OVVA 1Z3XA 3CVQA 4G8KA 5ENSD 3D9JA 4TXPA 4MS6A 4EBAA 3AS5A 3TWXA 5H7PA 3SZ7A 5FQ6A 3ENEA 3MV3B 3LXUX 4GTTA 4NIKA 1SW6A 1TYQG 2KATA 3ZIMA 3UX4A 2IJGX 1HS6A 4IN3B 4N3CA 2XZTG 5IY5E 4PUCA 3MEKA 4HLEA 1MZCA 3Q78A 1H6OA 4MLPA 1ELWA 3ABLE 3EIQC 2CG3A 4BT8A 2C2LA 2LAIA 1WY6A 3EIJA 4PS3A 1L5JA 3ZPJA 2Y0BG 3CV0A 1Y8MA 4B8CB 3FP3A 5ENQD 3T8KA 2EIJE 4HRLA 4HFGA 1UN9A 3TAXA 3FEXA 3IV0A 2Y1LE 2OEWA 4J8FA 3V2XA 4I1AA 3RRUA 4P29A 4GCNA 2GROB 1IKND 4QQIA 1NI1A 4GU5A 1LD7A 3UIOC 3BG1B 1X5BA 4Y6CA 4R7LA 4GTPA 4TUUA 1P5QA 2LXMA 4L1BA 1WM5A 5B3SE 3PDNA 4Y6WA 1DVPA 3ABKE 1D8DA 2VSNA 3TXNA 4GZDA 2YQ8A 1N9AA 2DYSE 3G2UA 4CZ2D 2VQ2A 4G24A 2EINE 3ZEFA 2EQXA 2IY0C 3QWWA 5EYPF 1HX8A 4GAAA 4ILGA 5AN8A 3DRAA 3DPDA 2FO1E 3I4GA 1U3CA 1INZA 2KM4A 3QARA 3NB2A 3SBSA 3G2TA 3Q47B 2PL2A 4XKCA 3LS8A 4XI9A 5G04J 3G2VA 4K5CA 3SQVA 1N11A 4HOSA 3NZUA 3SFXA 1NZNA 5BT1A 4GTOA 3VLDA 4CYMD 3I3NA 4GB9A 4LCTA 2XS1A 3MKQA 1A5EA 4GMLA 4L2YA 4JXTA 2R17C 3UM2A 3B7UX 3MZLB 3GZSA 3RKVA 4N2QA 4N5CA 3TWTA 4I1MA 3GZ1A 4CDNA 3UPVA 1JCSA 2YHEA 4B93B 3N71A 1IHBA 2F8YA 3ML9A 3DXKG 1MX6A 3UKRG 3PS6A 2X6IA 2J4DA 4A1GA 1W3BA 3TG4A 2FBNA 3LDZA 3CEQA 4H7YA 4XI0A 3TWWA 4L2LA 4TV3A 3ML8A 1O5MA 3R9AB 3CK7A 2X6FA 2ZISA 3G2SA 2WXRA 3APDA 3EU5A 2DZOA 3ZHEA 4UWKA 3UT8A 1UN8A 1E7VA 3RU0A 3R9MA 1WAO1 3E30A 3APFA 4I17A 1IQRA 4FC8A 5KJMA 4BESA 5JMND 2HO1A 1Z5SC 4GTQA 2WXHA 4CGVA 3K9IA 2DIWA 2I2OA 2WXKA 5ANLA 2GGFA 1MQSA 2ZGGA 3CHSA 4BFRA 3EHRA 3NOCD 3UI2A 5EDSA 4J7WA 4EZKA 5KJNA 1H0AA 2C0MA 4TUMA 3PRZA 1IXVA 3CHPA 3RK6A 5AJLA 1JCQA 3AG2E 2KC7A 4DX7D 4RLYA 3FUEA 3TWVA 4I6EA 3I5PA 4EPZA 4GA2A 2R5SA 4EHMA 3V79K 4UQYA 4GPMA 2E0IA 3C98A 3FTYA 4FHJA 2NC9A 5ARGA 1HXIA 2Y4UA 3PNLB 3U9WA 5FWQA 2XQ0A 3Q7FA 5FQ8A 5ENRD 2KXPC 2KCLA 5KWDA 5ENTD 4G1TA 3RSEG 3D9OA 5BXOA 2FI7A 5B1AE 2MOWA 4RSYA 3Q73A 5HS0A 4B89A 3VTXA 3ABME 3HDXA 5BW8C 4BSXA 3MV2B 4JL0A 3ZVVA 2BKKB 5HI7A 1FT2A 1AP7A 4JPSA 1NA0A 3FUFA 4H7XA 4E85A 1OCOE 4N3AA 4JEHA 2DCPA 1S63A 1MX4A 4F3VA 3CHQA 5ENPD 4ACKA 1JWFA 3PEVB 1UOHA 3D9IA 3I4RB 3Q79A 2GRQB 2NXPA 4GTVA 3V2OA 2AVPA 3SFZA 1H2UA 2J8SD 3QC1A 3QB2A 1O1RA 1SZAA 3ZFWA 5CEDB 4ANWA 1YMPA 5G05C 1TNYA 2BTDA 3R7QA 4I2WA 4Q69A 3KSQA 3PZ2A 3ASNE 4Q96A 5CHEE 4GPKA 2ZXWE 4ZFHA 4BWRA 4GYWA 4AEZC 5BUZA 3HVEA 1FT1A 4ATZD 4M7CA 5CBOA 4U0ZA 3UUXA 3BEEA 3ZYQA 4I2ZA 1YCSB 3LJ3A 4N39A 4U63A 4QFVA 1YA0A 4YDYA 1N94A 2CFZA 1BI8B 2IO2C 5ANRA 3Q9UC 4JHRA 4K0RA 3EHNA 2R2LA 1KZPA 4HORA 5KCMA 4ANVA 1IQUA 1BU9A 3MJWA 1Y6IA 4DX1A 1XGWA 3KEAA 3ULQA 2LNIA 4J8DA 3APCA 3ZN3A 5EN5D 3MA5A 5FZSA 4HI9A 2L9BA 3GW4A 1EF1C 4AP2A 2VSXE 3S7JA 2AXUA 2WXIA 3JQ1A 2XCBA 3JXJA 3HXDA 4JC8A 1O1SA 3EUVA 3WG7E 4UI9C 1N52A 2QFCA 1E96B 4FJYA 4AIFA 4U8YD 4G26A 5HKPA 2J49A 4D10C 3UXGA 3E33A 3SI5A 4AOFA 1OWPA 3AG3E 4URKA 3NF1A 4UI9J 5B1BE 1FVHA 5CECB 2CG2A 5KNHD 2I1KA 3DSWA 4CDMA 4YVQC 1K3ZD 3FTXA 2LO6A 2OOEA 2XRYA 2GW1A 1TJFA 1QYMA 3DBSA 3PE3A 4HRNA 2LXLA 4YDOA 3S7DA 3NAWA 5J90A 1NA3A 4CT0A 3OXFA 5AENA 5T3RA 5LCWC 4BX8A 4A3TA 3CHMA 4JW1A 3OAWA 2HM8A 3AJIA 2DWZA 1HFAA 5JA4D 1RW2A 3R7RA 4GMRA 5CMWA 4HB5A 3FU5A 1UJJA 2WXNA 5BNWA 4ZHBA 1KZOA 3UM1A 2J08A 1TJCA 4DUIA 4DRXE 1S70B 1DCQA 1N0QA 3CVNA 3J5QB 1MYOA 1HE8A 2X6HA 3FTUA 4LNBA 4LEUA 2QZAA 4OYSA 3NOGD 4I9EA 4YNDA 2L6BA 2C0LA 3J5PA 3UIPC 4B0ZA 2Y3AA 4IULA 3FH7A 4AJWA 3D9LA 3TWUA 2OV8A 3ZXSA 3TXMA 3CVUA 1S0PA 3NQPA 2X6JA 4U0SA 2JEKA 5AYWD 2I9CA 3L08A 1N54A 1TN7A 3DWLG 3FY4A 3SFYA 2FO7A 3Q15A 1GW6A 3KEZA 5E76A 4GZ5A 2XEEA 4GTMA 1OXJA 2GRPB 2WXGA 4EQFA 1LTXA 5JJTA 4GCOA 2KBXA 3GZ2A 1Z3YA 2VGYA 3L17A 4DLQA 2V0PA 5ENNA 3E37A 3HG0D 3FUIA 3RIBA 4ILHB 2L0TB 3B7BA 5BV0A 4LRZA 3CK9A 3HHMA 4WAFA 1N95A 2P58C 2RD0A 3DSUA 1SQMA 4U8HA 4WWNA 5CRUA 2LUHA 1TEZA 3SHFA 5FZQA 3CQCB 5AQ7A 1N4RA 4Q94A 2YHCA 5FTPA 3PZ3A 1NFIE 4KVMA 3SY2A 2VYIA 4U8VD 3P1UA 2E2EA 3DEOA 5KNGA 1ZB1A 3ASDA 4YDWA 2ETBA 3ESLA 3CVPA 5E75A 3CLJA 3ZXPA 2V8SE 4HS2A 5EX0A 3NBNB 4RG6A 5AQ9A 4CDRA 1LD8A 5EKQD 5J08A 1OY3D 1EYHA 4UWGA 4J8YA 3KS2A 2XGOA 2ZIRA 4EZJA 2RFAA 3EU9A 4HOQA 4PDXA 2XENA 2RG8A 2V4HC 2J09A 5ENOD 4JD2G 3B13A 4ACLA 4HRMB 1QBQA 2Y4TA 2PQNA 4UUCA 1E7UA 2IEJA 3D9NA 4HLLA 5CCLA 4RG9A 2IU1A 4JEUA 3DPYA 3VTYA 4ATGA 4GYYA 3C3RA 2KZTA 5EIBE 2CHZA 4J8SA 4AV7A 1N4PA 3MYVA 3ZYMA 2AJAA 1HG2A 2WM9A 3PZDA 4GA0A 4LG6A 5KJLA 1X81A 4KBQA 3TGOA 2H6IA 2AXVA 2EILE 5FZRA 3WXXA 4CEMA 2ETAA 4HXIA 4MRUA 4KZ0A 4LERA 3JQ0A 4I6JA 2BKGA 3V31A 4L7TA 4XX5A 4G23A 2HR2A 4LNGA 3CQGB 3UM0A 1OCCE 3AS4A 4A1SA 5M72A 1KT1A 2PNNA 4AXHA 3W9FA 2WQHA 2VGEA 5AJDA 2WB2A 2H6FA 1E8XA 5AQAA 3AG4E 1TN6A 2WXJA 5DIZA 5D2MC 5AQBA 3CHOA 1TNZA 1JCRA 3T8MA 4EECA 5DBKA 1B89A 3PUJA 4V3IA 3LYAA 1EDUA 3PZ4A 3DXMG 4I43A 1N4QA 5FJYA 2F0YA 2V5QC 2WXPA 1SVXA 1OWNA 1WDYA 5CEAA 3X2QE 2YNQA 1E8YA 4AY5A 3ZNGA 2L6JA 4U7EB 3NZSA 4JA9A 3UINC 3ZYKA 2GRLA 2A4ZA 1HO8A 4XIFA 2VSYA 4CCAA 2PM6A 2XZDG 4DJAA 3QK0A 3Q5MA 3V30A 4GZ6A 1IHGA 1Q2ZA 3QNKA 3FWVA 2WQ6A 5JJ6A 4BETA 4F1PA 3DSTA 4GTSA 3FH5A 3DSVA 5HQ8A 2X38A 3FEYA 3PVLA 1E90A 4F53A 5D66A 5FINA 3HVEB 4G25A 3AG1E 4L9PA 1HF8A 2L0IA 4F1SA 2KCKA 1ZU2A 2UY1A 3LVRE 4U04A 3ASOE 4WNFA 1H19A 2KZTB 2P9PG 1SZ9A 3L6AA 2H6HA 5C1DA 3UM3A 3B95A 3QWPA 3CGHA 3SF4A 3B7SA 4ANXA 1OWMA 2Q7FA 2JABA 4U07A 3SO8A 5HRYA 4GMJA 2IONA 3CVYA 4KT6B 3LPZA 5CERB 4JVSA 3KSLA 5KJKA 5LCWJ 1TNBA 3JXIA 1TNOA 3EDTB 1K1AA 1DC2A 2LSUA 4K5AB 3URZA 2DZNA 4FA6A 2RFMA 1E8WA 3EHQA 3DSSA 5CRVA 4MKTA 3L16A 2P9IG 4L23A 2WXFA 3ONLA 2PM7A 3ESKA 2WPVA 5G2NA 3FUMA 5T8IA 2MHKA 2DBAA 3RO2A 2WXLA 2BEDA 1PAQA 2AW6A 2KCVA 2R02A 4YVOA 2OEVA 4J0UA 3BU8A 2F37A 2LSVA 3ZKJA 4UWLA 3SBTB 1BD8A 3CVLA 1H6PA 4EZLA 2EIKE 1Z6TA 1DCEA 4ME2A 3OTNA 4PS8A 3ZYLA 3FUDA 5BXUA 1TR4A 4KVOA 2P9LG 4X8QA 3JUEA 3L82A 2CHWA 3B7RL 2IOLA 3ZU7B 3C5RA 2XPIA 2VGXB 3UT4A 2AXZA 2XPZA 4RVBA 1BLXB 3CSTA 4NQ0A 1MX2A 4O1PA 4KXKB 5FT9A 1HG5A 3O4ZA 4K5BA 1WG0A 4TXRA 5JHAA 3RO3A 3JYSA 2BUGA 2IQCA 1NL4A 2P9NG 3E32A 2WVIA 4BSZB 3UKUG 2HYZA 1FPPA 2P9UG 4F7AA 3CVWA 5A23A 4FU3A 1N4SA 4EBAG 3FTSA 3LVQE 2XGSA 4J8EA 3D9PA 5EYLA 4HI8A 1HU3A 1HH8A 2MYOA 3FDHA 2P2CP 3L22A 4UWFA 4I9CA 3MKRA 3DSXA 4O6FA 3VLFA 2IFUA 3ISMC 3EJNA 4HBDA 3PZ1A 1TN8A 4ABNA 4OAUC 3ULEG 4GTRA 1ELKA 4AM9A 3CK8A 3T9KA 3RAUA 3RRMB 2JLBA 1RZ4A 4BX9A 2GRNB 3ONKA 4HVBA 2XPYA 2F8XK 2QC9A 4LNUD 2ONDA 5FIOA 4BT9A 3Q9NC 4XZ4A 2A5EA 2LAHA 4GZCA 1V54E 1NP7A 4JB8P 4JZYA 4G8LA 4IRUA 3BQOA 1OT8A 2QYUA 3HYMB 4FJZA 2X3MA 4RQIA 2OCCE 3ULYA 3CR3A 5AIJA 2MRIA 4KYOB 2H6GA 5FQ4A 2YINA 4NRHB 3L54A 4A3VA 4GZ3A 4IYPA 2QY7A 1H6KA 3KD7A 3QDNA 2PQRA 4FLBA 4LUNU 5CMYA 4O1OA 4GA1A 2ILRA 3FU6A 1G3NB 2RKKA 2DVWA 4G11A 2A5UA 1OWLA 3KAEA 3T5XA 2J07A 2R59A 4DI3A 4DI4A 3QWVA 3G2WA 1PC2A 4KMOA 1BI7B 3O48A 2IO3C 2V5FA 3CIAA 3L13A 1AWCB 1A17A 3QJZA 3RRNB 3LCAA 4YDEA 5EIDA 4APOA 3D9MA 4NACA 1H2VC 3UMVA 3U3WA 2DYRE 2OVBA 2J4BA 3SGHA 5LX8A 4PH4B 5CCMA 1HZ4A 2VGXA 4JHJA 4OVUA 3OXLA 3IHYA 4GYOA 5T4YA 3MKQB 3HRAA 4Z68A 4FP7A 4WWPA 3JUIA 3FTWA 4HQDA 3QKYA 4UWHA 4N2SA 2GRRB 4BERA 3FH8A 2M63A 1PY1A 2WXOA 4WUYA 2XGMA 3MGBA 2WXMA 3ASGA 3HIZA 1OUVA 4CRWA 4B8AA 3PREA 2XRZA 4BY6A 3JCKC 3L9TA 3DEPA 3AAAC 4WNGA 1KLXA 2FULA 4WNDA 4TRQA 4U95D 4APFA 1H2TC 4FADA 2AWIA 1UW4B 3Q75A 3D9KA 3PUKA 3W9GA 1KT0A 2VTBB 2XS8A 2FF4A 4HOUA 2WMNA 5A7DB 5BV1A 3AS8A 4C48B 2X6KA 4C0EA 3CKBA 2NYJA 2V4LA 1DNPA 1EPUA 3QAQA 3SNXA 5KBAA 3Q4AB 3C3QA 2EIME 3LEWA 4K03A 4WNEA 4MBGA 5ITZF 3ZW3A 1ELRA 3VLEA 5G05J 4C0MA 4CT4A 2VTBA 4UQXA 2XCCA 3ASFA 3FUKA 3FUHA 4I1OB 1FVFA 5EILA 4J6IA 3CSFA 4DPRA 4UI9K 1U2VG 4WWOA 2XHEA 2UWJG 2XEHA 5JHBA 4JA7A 4BTAA 1UG3A 1O1TA 3FHEA 5AARA 3F6QA 1UJKA 4N5QA 4DK5A 3U64A 3E4BA 1MHQA 3CKCA 3TWSA 3ZHEB 5C2YA 2VSOE 3UTMA 4DX6D 1VDYA 1V55E 3LY8A 4O60A 5JJ7A 4DX2A 3ZGQA 1MJ0A 2I1JA 3BUAA 3TJPA 2P9KG 5CBNA 2PZIA 4ILIA 4XE0A 3IEGA 1D8EA 2VJ8A 4C9BB 4N3BA 5AAOA 4XKBA 5ARFA 3HXBA 5LFAA 3CVVA 1IYGA 2J9QA 2CHXA 4ANUA 4NURA 3RJVA 3OXGA 5FQ7A 2FEZA 3E34A 3PE4A 3LJNA 2ZU6B 5LOZA 3FU0A 2WQ7A 3LKUA 4KZCA 3FTZA 1OWOA 3SD5A 1K1BA 2R05A 4U96D 2I6HA 1ZBPA 3C3OA 4DX5D 3LY7A 3FU3A 4DLOA 4LSZE 4BTBA 2B0OE 3S7BA 1E8ZA 2CFUA 4FHKA 3ZRHA 1OCRE 4HOTA 4OAVB 1TNUA 3PH0C 1XNFA 4XEIG 3TL5A 4HNAD 4AVXA 4F6RD 1U3DA 3AU4A 1S64A 3GYZA
chains in the Genus database with same CATH topology
3LVQE 5ARGA 1HXIA 1QQEA 3FFLA 2Y4UA 3PNLB 2XGSA 3B7TA 3CLJA 5FWQA 3U9WA 4J8EA 3MCXA 2XQ0A 2V8SE 4HS2A 1QNFA 3D9PA 5EX0A 5FQ8A 4CGWA 1HU3A 4RG6A 1HH8A 3T5VA 4CDRA 3U66A 2KCLA 2IOSA 5EKQD 4A55A 4U0UA 5J08A 4G1TA 3FDHA 3L22A 4UWFA 3ASHA 1EYHA 3D9OA 4UWGA 4I9CA 3CVXA 2FI7A 3KS2A 2XGOA 3FULA 3MKRA 3TG5A 4EZJA 2MOWA 4HOQA 4O6FA 4RSYA 4PDXA 3S2AA 2OVFA 2RG8A 3VLFA 1QZ2A 2IFUA 4B89A 3EJNA 3VTXA 5G55A 3HDXA 5BW8C 4BSXA 2J09A 3MV2B 4JL0A 3ZVVA 4AY6A 3Q49B 5HI7A 4ABNA 1JPLA 3IKOB 4PS7A 1LF8A 4JPSA 2NSZA 1NA0A 4B94A 3UT7A 2IF4A 3B13A 4ACLA 4W9RA 2Y4TA 2PQNA 1E7UA 4FLHA 5LP0A 3D9NA 5D0OD 1ELKA 4AM9A 5CCLA 3CK8A 4RG9A 4JHKA 3RRMB 3CHRA 2IU1A 3FUFA 4H7XA 2JLBA 4JEUA 4E85A 4N3AA 4BX9A 4JEHA 3ONKA 4HVBA 2XPYA 5BPPA 2DCPA 3BG0B 2ONDA 4BT9A 3S7FA 4F3VA 3VTYA 5A6CA 4ATGA 3PNTB 4XZ4A 4UQZA 3IHVA 2LAHA 3CHQA 4GZCA 4GYYA 2KZTA 1JWFA 4ACKA 1NP7A 3PEVB 3D9IA 3P2BA 2BF0X 4JZYA 3FUJA 3I4RB 2NXPA 2CHZA 2UY1B 2AVPA 4IRUA 4J8SA 4AV7A 3SFZA 1H2UA 3LY9A 4FULA 3QC1A 3QB2A 1SZAA 4M3OA 3ZFWA 4ANWA 3HYMB 4FJZA 2X3MA 3MYVA 3ZYMA 1HG2A 2WM9A 3PZDA 3CR3A 3MX3A 4GA0A 5AIJA 5G05C 2WXQA 3UQ3A 2BTDA 3R7QA 4I2WA 4G2VA 4Q69A 5KJLA 5G04C 2MRIA 4KYOB 4I6GA 4KBQA 5FQ4A 3TGOA 1JWGA 3FUNA 2AXVA 2YINA 4NRHB 4Q96A 5CHEE 5FZRA 3AU5A 3WXXA 4E6HA 4GPKA 3L54A 4A3VA 5EX3A 4CEMA 3FTVA 4HXIA 3PEUB 4MRUA 4BWRA 4GZ3A 3U4TA 4KZ0A 4LERA 3D3MA 1BPOA 3JQ0A 4GYWA 2QY7A 4I6JA 1H6KA 3KD7A 4IYPA 1JUQA 3QDNA 4L7TA 3QOUA 4G23A 4XX5A 4AEZC 2PQRA 2WMOA 5BUZA 4FLBA 2HR2A 5D0QD 4LUNU 1FCHA 2XEVA 3HVEA 5CMYA 3CQGB 2GRMA 3EHMA 3AS4A 4A1SA 4GA1A 5M72A 2ILRA 3FU6A 1KT1A 4U0ZA 3IBEA 4G11A 2A5UA 4OVVA 1OWLA 1Z3XA 3UUXA 3CVQA 3KAEA 3BEEA 3ZYQA 4I2ZA 4AXHA 3D9JA 3T5XA 2WQHA 5AJDA 2WB2A 2J07A 2R59A 3LJ3A 4N39A 4U63A 4QFVA 1YA0A 4MS6A 1E8XA 4DI3A 4EBAA 3AS5A 3SZ7A 2CFZA 4DI4A 5FQ6A 3QWVA 3G2WA 1PC2A 3ENEA 4KMOA 5ANRA 3MV3B 4JHRA 2WXJA 4K0RA 5DIZA 3EHNA 3LXUX 3O48A 4HORA 5KCMA 4ANVA 1IQUA 2KATA 2V5FA 3CHOA 3ZIMA 3CIAA 3UX4A 2IJGX 1HS6A 3MJWA 3L13A 4IN3B 1Y6IA 4N3CA 3T8MA 4EECA 5DBKA 1A17A 1B89A 1XGWA 3PUJA 3LYAA 1EDUA 3MEKA 3QJZA 4PUCA 4V3IA 3ULQA 4HLEA 3RRNB 3LCAA 2LNIA 4MLPA 1ELWA 3EIQC 4I43A 4J8DA 3APCA 5FJYA 3D9MA 4NACA 4APOA 1H2VC 2CG3A 3ZN3A 4BT8A 2WXPA 3UMVA 2C2LA 3MA5A 2LAIA 3U3WA 1OWNA 5FZSA 1WY6A 2L9BA 3EIJA 2YNQA 3GW4A 4PS3A 2OVBA 1EF1C 1E8YA 4AY5A 1L5JA 4AP2A 2VSXE 3ZPJA 2L6JA 2J4BA 1Y8MA 3CV0A 3S7JA 3SGHA 4B8CB 5LX8A 4PH4B 3FP3A 5CCMA 2AXUA 3NZSA 4JA9A 1HZ4A 2VGXA 3ZYKA 4JHJA 2GRLA 2WXIA 2A4ZA 3JQ1A 4OVUA 1HO8A 2XCBA 3IHYA 3OXLA 4GYOA 4XIFA 5T4YA 2VSYA 4HFGA 4CCAA 2PM6A 4JC8A 3MKQB 4DJAA 1UN9A 4FP7A 3TAXA 4WWPA 3JUIA 3FEXA 3QK0A 4UI9C 3IV0A 3FTWA 3Q5MA 4J8FA 3QKYA 1N52A 2QFCA 4GZ6A 4I1AA 3RRUA 4P29A 4UWHA 4N2SA 1IHGA 1E96B 4FJYA 3QNKA 4GCNA 4AIFA 3FH8A 3FWVA 2M63A 1PY1A 2WXOA 4WUYA 2XGMA 3MGBA 4GU5A 2WXMA 3ASGA 3HIZA 3BG1B 1OUVA 1X5BA 4Y6CA 4CRWA 4G26A 5JJ6A 2J49A 2WQ6A 4R7LA 4D10C 4TUUA 1P5QA 4L1BA 3SI5A 4AOFA 1OWPA 4B8AA 3PREA 1WM5A 4URKA 3NF1A 2XRZA 4FHJA 4UI9J 3FH5A 3PDNA 4Y6WA 4BY6A 1DVPA 3JCKC 1FVHA 2VSNA 2CG2A 3TXNA 5HQ8A 2X38A 4GZDA 3FEYA 4WNGA 1KLXA 2FULA 2YQ8A 3PVLA 1E90A 2I1KA 3G2UA 4CDMA 2VQ2A 4F53A 4G24A 4WNDA 4TRQA 3HVEB 4G25A 4APFA 1H2TC 3ZEFA 1HF8A 2EQXA 4YVQC 4FADA 2AWIA 1UW4B 2L0IA 3D9KA 3PUKA 1KT0A 3QWWA 4F1SA 2VTBB 3FTXA 2LO6A 1HX8A 2FF4A 4GAAA 2OOEA 4HOUA 2WMNA 5A7DB 5BV1A 2XRYA 4ILGA 2KCKA 1ZU2A 2UY1A 3LVRE 4U04A 2GW1A 3AS8A 1TJFA 4WNFA 3DBSA 1H19A 3PE3A 2X6KA 3DPDA 2KZTB 3CKBA 3S7DA 4C0EA 2V4LA 3I4GA 1U3CA 1INZA 1SZ9A 2KM4A 1DNPA 1EPUA 3L6AA 3QAQA 3SNXA 5J90A 1NA3A 4CT0A 3OXFA 5C1DA 3Q4AB 3QARA 5AENA 5T3RA 5LCWC 3SBSA 3G2TA 4BX8A 3LEWA 4K03A 3QWPA 4WNEA 4A3TA 3CHMA 3CGHA 2PL2A 3B7SA 3Q47B 4JW1A 3SF4A 3ZW3A 4ANXA 3OAWA 1OWMA 1ELRA 2Q7FA 4U07A 5G05J 2HM8A 3VLEA 4C0MA 4CT4A 4XKCA 3LS8A 2VTBA 4GMJA 4XI9A 4UQXA 2IONA 2XCCA 1HFAA 3G2VA 5G04J 3CVYA 4KT6B 3LPZA 3ASFA 3FUKA 4HOSA 3FUHA 3R7RA 4JVSA 3NZUA 5CMWA 5BT1A 1NZNA 5KJKA 5LCWJ 4I1OB 1FVFA 3VLDA 4J6IA 3I3NA 3CSFA 4GB9A 4LCTA 3FU5A 3EDTB 1UJJA 3MKQA 4DPRA 4GMLA 2WXNA 4L2YA 4UI9K 4JXTA 5BNWA 2R17C 2LSUA 2XHEA 3B7UX 4WWOA 3MZLB 2UWJG 2J08A 1TJCA 3GZSA 3RKVA 3URZA 4N2QA 4N5CA 4FA6A 1E8WA 5JHBA 4I1MA 3CVNA 4MKTA 3L16A 3GZ1A 4CDNA 2X6HA 1HE8A 3FTUA 4LEUA 4JA7A 4BTAA 3UPVA 4L23A 1UG3A 4OYSA 2YHEA 3FHEA 2WXFA 3ONLA 2PM7A 3N71A 4I9EA 3ESKA 2WPVA 3ML9A 5G2NA 4YNDA 1UJKA 2C0LA 3PS6A 2X6IA 4DK5A 3FUMA 2J4DA 5T8IA 3U64A 2MHKA 3E4BA 2DBAA 1W3BA 4A1GA 4B0ZA 1MHQA 2Y3AA 4IULA 3CKCA 3RO2A 2WXLA 3TG4A 3FH7A 4AJWA 1PAQA 3D9LA 2AW6A 2FBNA 2KCVA 3ZHEB 3LDZA 2OV8A 4YVOA 5C2YA 3ZXSA 3TXMA 2VSOE 3CEQA 4H7YA 4J0UA 3CVUA 1S0PA 4XI0A 2LSVA 3NQPA 2X6JA 4L2LA 1VDYA 4U0SA 2JEKA 4TV3A 3ML8A 4UWLA 3CVLA 3R9AB 3SBTB 5AYWD 4EZLA 2I9CA 1Z6TA 3CK7A 2X6FA 3LY8A 3L08A 3G2SA 2WXRA 4ME2A 5JJ7A 1N54A 3APDA 3ZGQA 3FY4A 2I1JA 3TJPA 3OTNA 4PS8A 3ZYLA 2PZIA 4ILIA 3FUDA 3ZHEA 4KVOA 4UWKA 3UT8A 1UN8A 4XE0A 2FO7A 3Q15A 1GW6A 3KEZA 1E7VA 5E76A 3RU0A 3IEGA 4GZ5A 2VJ8A 4C9BB 1WAO1 2CHWA 2WXGA 4EQFA 4N3BA 3APFA 5JJTA 3B7RL 4XKBA 2IOLA 5ARFA 5LFAA 4GCOA 3CVVA 4I17A 1IYGA 3GZ2A 1IQRA 2J9QA 2CHXA 4ANUA 4FC8A 5KJMA 2XPIA 2HO1A 4NURA 3RJVA 2VGXB 1Z3YA 2WXHA 2VGYA 3OXGA 4CGVA 3K9IA 5FQ7A 3L17A 4DLQA 3UT4A 2AXZA 2FEZA 2V0PA 2XPZA 5ENNA 2DIWA 3PE4A 4RVBA 2I2OA 3CSTA 2ZU6B 3FUIA 4ILHB 3RIBA 5LOZA 2L0TB 4NQ0A 5BV0A 3FU0A 2WQ7A 2WXKA 3LKUA 4KZCA 4LRZA 3FTZA 1OWOA 3SD5A 3CK9A 5ANLA 2GGFA 1MQSA 3CHSA 4KXKB 3HHMA 4WAFA 2I6HA 5FT9A 1HG5A 3O4ZA 4BFRA 1ZBPA 2P58C 2RD0A 5EDSA 5JHAA 3RO3A 3JYSA 4EZKA 1SQMA 4U8HA 4WWNA 3LY7A 5KJNA 1H0AA 2C0MA 2BUGA 3FU3A 4DLOA 2IQCA 3PRZA 1TEZA 3CHPA 4BTBA 3SHFA 5FZQA 3S7BA 3RK6A 1E8ZA 5AJLA 3CQCB 2WVIA 2KC7A 4Q94A 2HYZA 2YHCA 5FTPA 2CFUA 3FUEA 4I6EA 4FHKA 3ZRHA 3I5PA 4GA2A 4EPZA 2R5SA 4KVMA 4HOTA 4UQYA 2VYIA 4F7AA 3CVWA 3PH0C 3P1UA 5A23A 1XNFA 4FU3A 2E2EA 3TL5A 4EBAG 3ASDA 4AVXA 2E0IA 1U3DA 3FTSA 3AU4A 3C98A 3CVPA 3ESLA 5E75A 3FTYA 2NC9A 3GYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUQ A;  3G2T A;  2L0I A;  2DIW A;  3ONK A;  1SZA A;  3CLJ A;  3D9K A;  3ZYK A;  1X5B A;  4FLB A;  3D9L A;  2DCP A;  3ZYM A;  2V8S E;  2LO6 A;  4HFG A;  3G2W A;  1HG2 A;  1HX8 A;  3D9P A;  5CMY A;  5LOZ A;  1HFA A;  2L0T B;  3D9M A;  3G2V A;  3LDZ A;  1JPL A;  4NAC A;  4Q94 A;  1DVP A;  1LF8 A;  5CMW A;  4GZC A;  4GZD A;  5J08 A;  1JWF A;  1JWG A;  3ONL A;  3D9I A;  1EYH A;  3RRU A;  1HG5 A;  1VDY A;  4Q96 A;  4FU3 A;  3D9O A;  2BF0 X;  1INZ A;  5LP0 A;  1SZ9 A;  2KM4 A;  3D9N A;  3G2U A;  1UJK A;  1ELK A;  1UJJ A;  3ZYQ A;  1PY1 A;  4AVX A;  3G2S A;  3D9J A;  4JXT A;  2MOW A;  1XGW A;  1H0A A;  2QY7 A;  1EDU A;  3ZYL A;  1HF8 A;  1MHQ A; 
#chains in the Genus database with same CATH topology
 3FFL A;  1QQE A;  3B7T A;  3MCX A;  4CGW A;  1QNF A;  3T5V A;  3U66 A;  2IOS A;  4A55 A;  3HXF A;  4U0U A;  3ASH A;  3CVX A;  2ZGD A;  3FUL A;  3HXE A;  3TG5 A;  3S2A A;  2OVF A;  1QZ2 A;  1OCZ E;  5G55 A;  4AY6 A;  3Q49 B;  1JPL A;  3IKO B;  4PS7 A;  1LF8 A;  4TXQ A;  2NSZ A;  4B94 A;  3ZUV B;  3UT7 A;  2R03 A;  2IF4 A;  4W9R A;  4FLH A;  5LP0 A;  5D0O D;  3C72 A;  4JHK A;  3CHR A;  1SA5 A;  5BPP A;  2ETC A;  3BG0 B;  3S7F A;  5A6C A;  2QYJ A;  3PNT B;  4UQZ A;  1K8K G;  3IHV A;  3P2B A;  3TWR A;  2BF0 X;  2Y69 E;  3FUJ A;  1N0R A;  2UY1 B;  3Q7A A;  3LY9 A;  4FUL A;  4M3O A;  3MX3 A;  1YYH A;  2WXQ A;  3UQ3 A;  4G2V A;  3TWQ A;  2HE0 A;  3IXE A;  5G04 C;  4I6G A;  4BEP A;  1JWG A;  3HXC A;  3FUN A;  4E6H A;  3AU5 A;  5EX3 A;  2B6C A;  3FTV A;  3PEU B;  3U4T A;  3D9H A;  1D9S A;  3D3M A;  1BPO A;  4A63 B;  1JUQ A;  2P9S G;  1SA4 A;  3QOU A;  2WMO A;  5D0Q D;  1FCH A;  2XEV A;  2GRM A;  3EHM A;  1KPS B;  3IBE A;  4OVV A;  1Z3X A;  3CVQ A;  4G8K A;  5ENS D;  3D9J A;  4TXP A;  4MS6 A;  4EBA A;  3AS5 A;  3TWX A;  5H7P A;  3SZ7 A;  5FQ6 A;  3ENE A;  3MV3 B;  3LXU X;  4GTT A;  4NIK A;  1SW6 A;  1TYQ G;  2KAT A;  3ZIM A;  3UX4 A;  2IJG X;  1HS6 A;  4IN3 B;  4N3C A;  2XZT G;  5IY5 E;  4PUC A;  3MEK A;  4HLE A;  1MZC A;  3Q78 A;  1H6O A;  4MLP A;  1ELW A;  3ABL E;  3EIQ C;  2CG3 A;  4BT8 A;  2C2L A;  2LAI A;  1WY6 A;  3EIJ A;  4PS3 A;  1L5J A;  3ZPJ A;  2Y0B G;  3CV0 A;  1Y8M A;  4B8C B;  3FP3 A;  5ENQ D;  3T8K A;  2EIJ E;  4HRL A;  4HFG A;  1UN9 A;  3TAX A;  3FEX A;  3IV0 A;  2Y1L E;  2OEW A;  4J8F A;  3V2X A;  4I1A A;  3RRU A;  4P29 A;  4GCN A;  2GRO B;  1IKN D;  4QQI A;  1NI1 A;  4GU5 A;  1LD7 A;  3UIO C;  3BG1 B;  1X5B A;  4Y6C A;  4R7L A;  4GTP A;  4TUU A;  1P5Q A;  2LXM A;  4L1B A;  1WM5 A;  5B3S E;  3PDN A;  4Y6W A;  1DVP A;  3ABK E;  1D8D A;  2VSN A;  3TXN A;  4GZD A;  2YQ8 A;  1N9A A;  2DYS E;  3G2U A;  4CZ2 D;  2VQ2 A;  4G24 A;  2EIN E;  3ZEF A;  2EQX A;  2IY0 C;  3QWW A;  5EYP F;  1HX8 A;  4GAA A;  4ILG A;  5AN8 A;  3DRA A;  3DPD A;  2FO1 E;  3I4G A;  1U3C A;  1INZ A;  2KM4 A;  3QAR A;  3NB2 A;  3SBS A;  3G2T A;  3Q47 B;  2PL2 A;  4XKC A;  3LS8 A;  4XI9 A;  5G04 J;  3G2V A;  4K5C A;  3SQV A;  1N11 A;  4HOS A;  3NZU A;  3SFX A;  1NZN A;  5BT1 A;  4GTO A;  3VLD A;  4CYM D;  3I3N A;  4GB9 A;  4LCT A;  2XS1 A;  3MKQ A;  1A5E A;  4GML A;  4L2Y A;  4JXT A;  2R17 C;  3UM2 A;  3B7U X;  3MZL B;  3GZS A;  3RKV A;  4N2Q A;  4N5C A;  3TWT A;  4I1M A;  3GZ1 A;  4CDN A;  3UPV A;  1JCS A;  2YHE A;  4B93 B;  3N71 A;  1IHB A;  2F8Y A;  3ML9 A;  3DXK G;  1MX6 A;  3UKR G;  3PS6 A;  2X6I A;  2J4D A;  4A1G A;  1W3B A;  3TG4 A;  2FBN A;  3LDZ A;  3CEQ A;  4H7Y A;  4XI0 A;  3TWW A;  4L2L A;  4TV3 A;  3ML8 A;  1O5M A;  3R9A B;  3CK7 A;  2X6F A;  2ZIS A;  3G2S A;  2WXR A;  3APD A;  3EU5 A;  2DZO A;  3ZHE A;  4UWK A;  3UT8 A;  1UN8 A;  1E7V A;  3RU0 A;  3R9M A;  1WAO 1;  3E30 A;  3APF A;  4I17 A;  1IQR A;  4FC8 A;  5KJM A;  4BES A;  5JMN D;  2HO1 A;  1Z5S C;  4GTQ A;  2WXH A;  4CGV A;  3K9I A;  2DIW A;  2I2O A;  2WXK A;  5ANL A;  2GGF A;  1MQS A;  2ZGG A;  3CHS A;  4BFR A;  3EHR A;  3NOC D;  3UI2 A;  5EDS A;  4J7W A;  4EZK A;  5KJN A;  1H0A A;  2C0M A;  4TUM A;  3PRZ A;  1IXV A;  3CHP A;  3RK6 A;  5AJL A;  1JCQ A;  3AG2 E;  2KC7 A;  4DX7 D;  4RLY A;  3FUE A;  3TWV A;  4I6E A;  3I5P A;  4EPZ A;  4GA2 A;  2R5S A;  4EHM A;  3V79 K;  4UQY A;  4GPM A;  2E0I A;  3C98 A;  3FTY A;  4FHJ A;  2NC9 A;  5ARG A;  1HXI A;  2Y4U A;  3PNL B;  3U9W A;  5FWQ A;  2XQ0 A;  3Q7F A;  5FQ8 A;  5ENR D;  2KXP C;  2KCL A;  5KWD A;  5ENT D;  4G1T A;  3RSE G;  3D9O A;  5BXO A;  2FI7 A;  5B1A E;  2MOW A;  4RSY A;  3Q73 A;  5HS0 A;  4B89 A;  3VTX A;  3ABM E;  3HDX A;  5BW8 C;  4BSX A;  3MV2 B;  4JL0 A;  3ZVV A;  2BKK B;  5HI7 A;  1FT2 A;  1AP7 A;  4JPS A;  1NA0 A;  3FUF A;  4H7X A;  4E85 A;  1OCO E;  4N3A A;  4JEH A;  2DCP A;  1S63 A;  1MX4 A;  4F3V A;  3CHQ A;  5ENP D;  4ACK A;  1JWF A;  3PEV B;  1UOH A;  3D9I A;  3I4R B;  3Q79 A;  2GRQ B;  2NXP A;  4GTV A;  3V2O A;  2AVP A;  3SFZ A;  1H2U A;  2J8S D;  3QC1 A;  3QB2 A;  1O1R A;  1SZA A;  3ZFW A;  5CED B;  4ANW A;  1YMP A;  5G05 C;  1TNY A;  2BTD A;  3R7Q A;  4I2W A;  4Q69 A;  3KSQ A;  3PZ2 A;  3ASN E;  4Q96 A;  5CHE E;  4GPK A;  2ZXW E;  4ZFH A;  4BWR A;  4GYW A;  4AEZ C;  5BUZ A;  3HVE A;  1FT1 A;  4ATZ D;  4M7C A;  5CBO A;  4U0Z A;  3UUX A;  3BEE A;  3ZYQ A;  4I2Z A;  1YCS B;  3LJ3 A;  4N39 A;  4U63 A;  4QFV A;  1YA0 A;  4YDY A;  1N94 A;  2CFZ A;  1BI8 B;  2IO2 C;  5ANR A;  3Q9U C;  4JHR A;  4K0R A;  3EHN A;  2R2L A;  1KZP A;  4HOR A;  5KCM A;  4ANV A;  1IQU A;  1BU9 A;  3MJW A;  1Y6I A;  4DX1 A;  1XGW A;  3KEA A;  3ULQ A;  2LNI A;  4J8D A;  3APC A;  3ZN3 A;  5EN5 D;  3MA5 A;  5FZS A;  4HI9 A;  2L9B A;  3GW4 A;  1EF1 C;  4AP2 A;  2VSX E;  3S7J A;  2AXU A;  2WXI A;  3JQ1 A;  2XCB A;  3JXJ A;  3HXD A;  4JC8 A;  1O1S A;  3EUV A;  3WG7 E;  4UI9 C;  1N52 A;  2QFC A;  1E96 B;  4FJY A;  4AIF A;  4U8Y D;  4G26 A;  5HKP A;  2J49 A;  4D10 C;  3UXG A;  3E33 A;  3SI5 A;  4AOF A;  1OWP A;  3AG3 E;  4URK A;  3NF1 A;  4UI9 J;  5B1B E;  1FVH A;  5CEC B;  2CG2 A;  5KNH D;  2I1K A;  3DSW A;  4CDM A;  4YVQ C;  1K3Z D;  3FTX A;  2LO6 A;  2OOE A;  2XRY A;  2GW1 A;  1TJF A;  1QYM A;  3DBS A;  3PE3 A;  4HRN A;  2LXL A;  4YDO A;  3S7D A;  3NAW A;  5J90 A;  1NA3 A;  4CT0 A;  3OXF A;  5AEN A;  5T3R A;  5LCW C;  4BX8 A;  4A3T A;  3CHM A;  4JW1 A;  3OAW A;  2HM8 A;  3AJI A;  2DWZ A;  1HFA A;  5JA4 D;  1RW2 A;  3R7R A;  4GMR A;  5CMW A;  4HB5 A;  3FU5 A;  1UJJ A;  2WXN A;  5BNW A;  4ZHB A;  1KZO A;  3UM1 A;  2J08 A;  1TJC A;  4DUI A;  4DRX E;  1S70 B;  1DCQ A;  1N0Q A;  3CVN A;  3J5Q B;  1MYO A;  1HE8 A;  2X6H A;  3FTU A;  4LNB A;  4LEU A;  2QZA A;  4OYS A;  3NOG D;  4I9E A;  4YND A;  2L6B A;  2C0L A;  3J5P A;  3UIP C;  4B0Z A;  2Y3A A;  4IUL A;  3FH7 A;  4AJW A;  3D9L A;  3TWU A;  2OV8 A;  3ZXS A;  3TXM A;  3CVU A;  1S0P A;  3NQP A;  2X6J A;  4U0S A;  2JEK A;  5AYW D;  2I9C A;  3L08 A;  1N54 A;  1TN7 A;  3DWL G;  3FY4 A;  3SFY A;  2FO7 A;  3Q15 A;  1GW6 A;  3KEZ A;  5E76 A;  4GZ5 A;  2XEE A;  4GTM A;  1OXJ A;  2GRP B;  2WXG A;  4EQF A;  1LTX A;  5JJT A;  4GCO A;  2KBX A;  3GZ2 A;  1Z3Y A;  2VGY A;  3L17 A;  4DLQ A;  2V0P A;  5ENN A;  3E37 A;  3HG0 D;  3FUI A;  3RIB A;  4ILH B;  2L0T B;  3B7B A;  5BV0 A;  4LRZ A;  3CK9 A;  3HHM A;  4WAF A;  1N95 A;  2P58 C;  2RD0 A;  3DSU A;  1SQM A;  4U8H A;  4WWN A;  5CRU A;  2LUH A;  1TEZ A;  3SHF A;  5FZQ A;  3CQC B;  5AQ7 A;  1N4R A;  4Q94 A;  2YHC A;  5FTP A;  3PZ3 A;  1NFI E;  4KVM A;  3SY2 A;  2VYI A;  4U8V D;  3P1U A;  2E2E A;  3DEO A;  5KNG A;  1ZB1 A;  3ASD A;  4YDW A;  2ETB A;  3ESL A;  3CVP A;  5E75 A;  3CLJ A;  3ZXP A;  2V8S E;  4HS2 A;  5EX0 A;  3NBN B;  4RG6 A;  5AQ9 A;  4CDR A;  1LD8 A;  5EKQ D;  5J08 A;  1OY3 D;  1EYH A;  4UWG A;  4J8Y A;  3KS2 A;  2XGO A;  2ZIR A;  4EZJ A;  2RFA A;  3EU9 A;  4HOQ A;  4PDX A;  2XEN A;  2RG8 A;  2V4H C;  2J09 A;  5ENO D;  4JD2 G;  3B13 A;  4ACL A;  4HRM B;  1QBQ A;  2Y4T A;  2PQN A;  4UUC A;  1E7U A;  2IEJ A;  3D9N A;  4HLL A;  5CCL A;  4RG9 A;  2IU1 A;  4JEU A;  3DPY A;  3VTY A;  4ATG A;  4GYY A;  3C3R A;  2KZT A;  5EIB E;  2CHZ A;  4J8S A;  4AV7 A;  1N4P A;  3MYV A;  3ZYM A;  2AJA A;  1HG2 A;  2WM9 A;  3PZD A;  4GA0 A;  4LG6 A;  5KJL A;  1X81 A;  4KBQ A;  3TGO A;  2H6I A;  2AXV A;  2EIL E;  5FZR A;  3WXX A;  4CEM A;  2ETA A;  4HXI A;  4MRU A;  4KZ0 A;  4LER A;  3JQ0 A;  4I6J A;  2BKG A;  3V31 A;  4L7T A;  4XX5 A;  4G23 A;  2HR2 A;  4LNG A;  3CQG B;  3UM0 A;  1OCC E;  3AS4 A;  4A1S A;  5M72 A;  1KT1 A;  2PNN A;  4AXH A;  3W9F A;  2WQH A;  2VGE A;  5AJD A;  2WB2 A;  2H6F A;  1E8X A;  5AQA A;  3AG4 E;  1TN6 A;  2WXJ A;  5DIZ A;  5D2M C;  5AQB A;  3CHO A;  1TNZ A;  1JCR A;  3T8M A;  4EEC A;  5DBK A;  1B89 A;  3PUJ A;  4V3I A;  3LYA A;  1EDU A;  3PZ4 A;  3DXM G;  4I43 A;  1N4Q A;  5FJY A;  2F0Y A;  2V5Q C;  2WXP A;  1SVX A;  1OWN A;  1WDY A;  5CEA A;  3X2Q E;  2YNQ A;  1E8Y A;  4AY5 A;  3ZNG A;  2L6J A;  4U7E B;  3NZS A;  4JA9 A;  3UIN C;  3ZYK A;  2GRL A;  2A4Z A;  1HO8 A;  4XIF A;  2VSY A;  4CCA A;  2PM6 A;  2XZD G;  4DJA A;  3QK0 A;  3Q5M A;  3V30 A;  4GZ6 A;  1IHG A;  1Q2Z A;  3QNK A;  3FWV A;  2WQ6 A;  5JJ6 A;  4BET A;  4F1P A;  3DST A;  4GTS A;  3FH5 A;  3DSV A;  5HQ8 A;  2X38 A;  3FEY A;  3PVL A;  1E90 A;  4F53 A;  5D66 A;  5FIN A;  3HVE B;  4G25 A;  3AG1 E;  4L9P A;  1HF8 A;  2L0I A;  4F1S A;  2KCK A;  1ZU2 A;  2UY1 A;  3LVR E;  4U04 A;  3ASO E;  4WNF A;  1H19 A;  2KZT B;  2P9P G;  1SZ9 A;  3L6A A;  2H6H A;  5C1D A;  3UM3 A;  3B95 A;  3QWP A;  3CGH A;  3SF4 A;  3B7S A;  4ANX A;  1OWM A;  2Q7F A;  2JAB A;  4U07 A;  3SO8 A;  5HRY A;  4GMJ A;  2ION A;  3CVY A;  4KT6 B;  3LPZ A;  5CER B;  4JVS A;  3KSL A;  5KJK A;  5LCW J;  1TNB A;  3JXI A;  1TNO A;  3EDT B;  1K1A A;  1DC2 A;  2LSU A;  4K5A B;  3URZ A;  2DZN A;  4FA6 A;  2RFM A;  1E8W A;  3EHQ A;  3DSS A;  5CRV A;  4MKT A;  3L16 A;  2P9I G;  4L23 A;  2WXF A;  3ONL A;  2PM7 A;  3ESK A;  2WPV A;  5G2N A;  3FUM A;  5T8I A;  2MHK A;  2DBA A;  3RO2 A;  2WXL A;  2BED A;  1PAQ A;  2AW6 A;  2KCV A;  2R02 A;  4YVO A;  2OEV A;  4J0U A;  3BU8 A;  2F37 A;  2LSV A;  3ZKJ A;  4UWL A;  3SBT B;  1BD8 A;  3CVL A;  1H6P A;  4EZL A;  2EIK E;  1Z6T A;  1DCE A;  4ME2 A;  3OTN A;  4PS8 A;  3ZYL A;  3FUD A;  5BXU A;  1TR4 A;  4KVO A;  2P9L G;  4X8Q A;  3JUE A;  3L82 A;  2CHW A;  3B7R L;  2IOL A;  3ZU7 B;  3C5R A;  2XPI A;  2VGX B;  3UT4 A;  2AXZ A;  2XPZ A;  4RVB A;  1BLX B;  3CST A;  4NQ0 A;  1MX2 A;  4O1P A;  4KXK B;  5FT9 A;  1HG5 A;  3O4Z A;  4K5B A;  1WG0 A;  4TXR A;  5JHA A;  3RO3 A;  3JYS A;  2BUG A;  2IQC A;  1NL4 A;  2P9N G;  3E32 A;  2WVI A;  4BSZ B;  3UKU G;  2HYZ A;  1FPP A;  2P9U G;  4F7A A;  3CVW A;  5A23 A;  4FU3 A;  1N4S A;  4EBA G;  3FTS A;  3LVQ E;  2XGS A;  4J8E A;  3D9P A;  5EYL A;  4HI8 A;  1HU3 A;  1HH8 A;  2MYO A;  3FDH A;  2P2C P;  3L22 A;  4UWF A;  4I9C A;  3MKR A;  3DSX A;  4O6F A;  3VLF A;  2IFU A;  3ISM C;  3EJN A;  4HBD A;  3PZ1 A;  1TN8 A;  4ABN A;  4OAU C;  3ULE G;  4GTR A;  1ELK A;  4AM9 A;  3CK8 A;  3T9K A;  3RAU A;  3RRM B;  2JLB A;  1RZ4 A;  4BX9 A;  2GRN B;  3ONK A;  4HVB A;  2XPY A;  2F8X K;  2QC9 A;  4LNU D;  2OND A;  5FIO A;  4BT9 A;  3Q9N C;  4XZ4 A;  2A5E A;  2LAH A;  4GZC A;  1V54 E;  1NP7 A;  4JB8 P;  4JZY A;  4G8L A;  4IRU A;  3BQO A;  1OT8 A;  2QYU A;  3HYM B;  4FJZ A;  2X3M A;  4RQI A;  2OCC E;  3ULY A;  3CR3 A;  5AIJ A;  2MRI A;  4KYO B;  2H6G A;  5FQ4 A;  2YIN A;  4NRH B;  3L54 A;  4A3V A;  4GZ3 A;  4IYP A;  2QY7 A;  1H6K A;  3KD7 A;  3QDN A;  2PQR A;  4FLB A;  4LUN U;  5CMY A;  4O1O A;  4GA1 A;  2ILR A;  3FU6 A;  1G3N B;  2RKK A;  2DVW A;  4G11 A;  2A5U A;  1OWL A;  3KAE A;  3T5X A;  2J07 A;  2R59 A;  4DI3 A;  4DI4 A;  3QWV A;  3G2W A;  1PC2 A;  4KMO A;  1BI7 B;  3O48 A;  2IO3 C;  2V5F A;  3CIA A;  3L13 A;  1AWC B;  1A17 A;  3QJZ A;  3RRN B;  3LCA A;  4YDE A;  5EID A;  4APO A;  3D9M A;  4NAC A;  1H2V C;  3UMV A;  3U3W A;  2DYR E;  2OVB A;  2J4B A;  3SGH A;  5LX8 A;  4PH4 B;  5CCM A;  1HZ4 A;  2VGX A;  4JHJ A;  4OVU A;  3OXL A;  3IHY A;  4GYO A;  5T4Y A;  3MKQ B;  3HRA A;  4Z68 A;  4FP7 A;  4WWP A;  3JUI A;  3FTW A;  4HQD A;  3QKY A;  4UWH A;  4N2S A;  2GRR B;  4BER A;  3FH8 A;  2M63 A;  1PY1 A;  2WXO A;  4WUY A;  2XGM A;  3MGB A;  2WXM A;  3ASG A;  3HIZ A;  1OUV A;  4CRW A;  4B8A A;  3PRE A;  2XRZ A;  4BY6 A;  3JCK C;  3L9T A;  3DEP A;  3AAA C;  4WNG A;  1KLX A;  2FUL A;  4WND A;  4TRQ A;  4U95 D;  4APF A;  1H2T C;  4FAD A;  2AWI A;  1UW4 B;  3Q75 A;  3D9K A;  3PUK A;  3W9G A;  1KT0 A;  2VTB B;  2XS8 A;  2FF4 A;  4HOU A;  2WMN A;  5A7D B;  5BV1 A;  3AS8 A;  4C48 B;  2X6K A;  4C0E A;  3CKB A;  2NYJ A;  2V4L A;  1DNP A;  1EPU A;  3QAQ A;  3SNX A;  5KBA A;  3Q4A B;  3C3Q A;  2EIM E;  3LEW A;  4K03 A;  4WNE A;  4MBG A;  5ITZ F;  3ZW3 A;  1ELR A;  3VLE A;  5G05 J;  4C0M A;  4CT4 A;  2VTB A;  4UQX A;  2XCC A;  3ASF A;  3FUK A;  3FUH A;  4I1O B;  1FVF A;  5EIL A;  4J6I A;  3CSF A;  4DPR A;  4UI9 K;  1U2V G;  4WWO A;  2XHE A;  2UWJ G;  2XEH A;  5JHB A;  4JA7 A;  4BTA A;  1UG3 A;  1O1T A;  3FHE A;  5AAR A;  3F6Q A;  1UJK A;  4N5Q A;  4DK5 A;  3U64 A;  3E4B A;  1MHQ A;  3CKC A;  3TWS A;  3ZHE B;  5C2Y A;  2VSO E;  3UTM A;  4DX6 D;  1VDY A;  1V55 E;  3LY8 A;  4O60 A;  5JJ7 A;  4DX2 A;  3ZGQ A;  1MJ0 A;  2I1J A;  3BUA A;  3TJP A;  2P9K G;  5CBN A;  2PZI A;  4ILI A;  4XE0 A;  3IEG A;  1D8E A;  2VJ8 A;  4C9B B;  4N3B A;  5AAO A;  4XKB A;  5ARF A;  3HXB A;  5LFA A;  3CVV A;  1IYG A;  2J9Q A;  2CHX A;  4ANU A;  4NUR A;  3RJV A;  3OXG A;  5FQ7 A;  2FEZ A;  3E34 A;  3PE4 A;  3LJN A;  2ZU6 B;  5LOZ A;  3FU0 A;  2WQ7 A;  3LKU A;  4KZC A;  3FTZ A;  1OWO A;  3SD5 A;  1K1B A;  2R05 A;  4U96 D;  2I6H A;  1ZBP A;  3C3O A;  4DX5 D;  3LY7 A;  3FU3 A;  4DLO A;  4LSZ E;  4BTB A;  2B0O E;  3S7B A;  1E8Z A;  2CFU A;  4FHK A;  3ZRH A;  1OCR E;  4HOT A;  4OAV B;  1TNU A;  3PH0 C;  1XNF A;  4XEI G;  3TL5 A;  4HNA D;  4AVX A;  4F6R D;  1U3D A;  3AU4 A;  1S64 A;  3GYZ A; 
#chains in the Genus database with same CATH homology
 3LVQ E;  5ARG A;  1HXI A;  1QQE A;  3FFL A;  2Y4U A;  3PNL B;  2XGS A;  3B7T A;  3CLJ A;  5FWQ A;  3U9W A;  4J8E A;  3MCX A;  2XQ0 A;  2V8S E;  4HS2 A;  1QNF A;  3D9P A;  5EX0 A;  5FQ8 A;  4CGW A;  1HU3 A;  4RG6 A;  1HH8 A;  3T5V A;  4CDR A;  3U66 A;  2KCL A;  2IOS A;  5EKQ D;  4A55 A;  4U0U A;  5J08 A;  4G1T A;  3FDH A;  3L22 A;  4UWF A;  3ASH A;  1EYH A;  3D9O A;  4UWG A;  4I9C A;  3CVX A;  2FI7 A;  3KS2 A;  2XGO A;  3FUL A;  3MKR A;  3TG5 A;  4EZJ A;  2MOW A;  4HOQ A;  4O6F A;  4RSY A;  4PDX A;  3S2A A;  2OVF A;  2RG8 A;  3VLF A;  1QZ2 A;  2IFU A;  4B89 A;  3EJN A;  3VTX A;  5G55 A;  3HDX A;  5BW8 C;  4BSX A;  2J09 A;  3MV2 B;  4JL0 A;  3ZVV A;  4AY6 A;  3Q49 B;  5HI7 A;  4ABN A;  1JPL A;  3IKO B;  4PS7 A;  1LF8 A;  4JPS A;  2NSZ A;  1NA0 A;  4B94 A;  3UT7 A;  2IF4 A;  3B13 A;  4ACL A;  4W9R A;  2Y4T A;  2PQN A;  1E7U A;  4FLH A;  5LP0 A;  3D9N A;  5D0O D;  1ELK A;  4AM9 A;  5CCL A;  3CK8 A;  4RG9 A;  4JHK A;  3RRM B;  3CHR A;  2IU1 A;  3FUF A;  4H7X A;  2JLB A;  4JEU A;  4E85 A;  4N3A A;  4BX9 A;  4JEH A;  3ONK A;  4HVB A;  2XPY A;  5BPP A;  2DCP A;  3BG0 B;  2OND A;  4BT9 A;  3S7F A;  4F3V A;  3VTY A;  5A6C A;  4ATG A;  3PNT B;  4XZ4 A;  4UQZ A;  3IHV A;  2LAH A;  3CHQ A;  4GZC A;  4GYY A;  2KZT A;  1JWF A;  4ACK A;  1NP7 A;  3PEV B;  3D9I A;  3P2B A;  2BF0 X;  4JZY A;  3FUJ A;  3I4R B;  2NXP A;  2CHZ A;  2UY1 B;  2AVP A;  4IRU A;  4J8S A;  4AV7 A;  3SFZ A;  1H2U A;  3LY9 A;  4FUL A;  3QC1 A;  3QB2 A;  1SZA A;  4M3O A;  3ZFW A;  4ANW A;  3HYM B;  4FJZ A;  2X3M A;  3MYV A;  3ZYM A;  1HG2 A;  2WM9 A;  3PZD A;  3CR3 A;  3MX3 A;  4GA0 A;  5AIJ A;  5G05 C;  2WXQ A;  3UQ3 A;  2BTD A;  3R7Q A;  4I2W A;  4G2V A;  4Q69 A;  5KJL A;  5G04 C;  2MRI A;  4KYO B;  4I6G A;  4KBQ A;  5FQ4 A;  3TGO A;  1JWG A;  3FUN A;  2AXV A;  2YIN A;  4NRH B;  4Q96 A;  5CHE E;  5FZR A;  3AU5 A;  3WXX A;  4E6H A;  4GPK A;  3L54 A;  4A3V A;  5EX3 A;  4CEM A;  3FTV A;  4HXI A;  3PEU B;  4MRU A;  4BWR A;  4GZ3 A;  3U4T A;  4KZ0 A;  4LER A;  3D3M A;  1BPO A;  3JQ0 A;  4GYW A;  2QY7 A;  4I6J A;  1H6K A;  3KD7 A;  4IYP A;  1JUQ A;  3QDN A;  4L7T A;  3QOU A;  4G23 A;  4XX5 A;  4AEZ C;  2PQR A;  2WMO A;  5BUZ A;  4FLB A;  2HR2 A;  5D0Q D;  4LUN U;  1FCH A;  2XEV A;  3HVE A;  5CMY A;  3CQG B;  2GRM A;  3EHM A;  3AS4 A;  4A1S A;  4GA1 A;  5M72 A;  2ILR A;  3FU6 A;  1KT1 A;  4U0Z A;  3IBE A;  4G11 A;  2A5U A;  4OVV A;  1OWL A;  1Z3X A;  3UUX A;  3CVQ A;  3KAE A;  3BEE A;  3ZYQ A;  4I2Z A;  4AXH A;  3D9J A;  3T5X A;  2WQH A;  5AJD A;  2WB2 A;  2J07 A;  2R59 A;  3LJ3 A;  4N39 A;  4U63 A;  4QFV A;  1YA0 A;  4MS6 A;  1E8X A;  4DI3 A;  4EBA A;  3AS5 A;  3SZ7 A;  2CFZ A;  4DI4 A;  5FQ6 A;  3QWV A;  3G2W A;  1PC2 A;  3ENE A;  4KMO A;  5ANR A;  3MV3 B;  4JHR A;  2WXJ A;  4K0R A;  5DIZ A;  3EHN A;  3LXU X;  3O48 A;  4HOR A;  5KCM A;  4ANV A;  1IQU A;  2KAT A;  2V5F A;  3CHO A;  3ZIM A;  3CIA A;  3UX4 A;  2IJG X;  1HS6 A;  3MJW A;  3L13 A;  4IN3 B;  1Y6I A;  4N3C A;  3T8M A;  4EEC A;  5DBK A;  1A17 A;  1B89 A;  1XGW A;  3PUJ A;  3LYA A;  1EDU A;  3MEK A;  3QJZ A;  4PUC A;  4V3I A;  3ULQ A;  4HLE A;  3RRN B;  3LCA A;  2LNI A;  4MLP A;  1ELW A;  3EIQ C;  4I43 A;  4J8D A;  3APC A;  5FJY A;  3D9M A;  4NAC A;  4APO A;  1H2V C;  2CG3 A;  3ZN3 A;  4BT8 A;  2WXP A;  3UMV A;  2C2L A;  3MA5 A;  2LAI A;  3U3W A;  1OWN A;  5FZS A;  1WY6 A;  2L9B A;  3EIJ A;  2YNQ A;  3GW4 A;  4PS3 A;  2OVB A;  1EF1 C;  1E8Y A;  4AY5 A;  1L5J A;  4AP2 A;  2VSX E;  3ZPJ A;  2L6J A;  2J4B A;  1Y8M A;  3CV0 A;  3S7J A;  3SGH A;  4B8C B;  5LX8 A;  4PH4 B;  3FP3 A;  5CCM A;  2AXU A;  3NZS A;  4JA9 A;  1HZ4 A;  2VGX A;  3ZYK A;  4JHJ A;  2GRL A;  2WXI A;  2A4Z A;  3JQ1 A;  4OVU A;  1HO8 A;  2XCB A;  3IHY A;  3OXL A;  4GYO A;  4XIF A;  5T4Y A;  2VSY A;  4HFG A;  4CCA A;  2PM6 A;  4JC8 A;  3MKQ B;  4DJA A;  1UN9 A;  4FP7 A;  3TAX A;  4WWP A;  3JUI A;  3FEX A;  3QK0 A;  4UI9 C;  3IV0 A;  3FTW A;  3Q5M A;  4J8F A;  3QKY A;  1N52 A;  2QFC A;  4GZ6 A;  4I1A A;  3RRU A;  4P29 A;  4UWH A;  4N2S A;  1IHG A;  1E96 B;  4FJY A;  3QNK A;  4GCN A;  4AIF A;  3FH8 A;  3FWV A;  2M63 A;  1PY1 A;  2WXO A;  4WUY A;  2XGM A;  3MGB A;  4GU5 A;  2WXM A;  3ASG A;  3HIZ A;  3BG1 B;  1OUV A;  1X5B A;  4Y6C A;  4CRW A;  4G26 A;  5JJ6 A;  2J49 A;  2WQ6 A;  4R7L A;  4D10 C;  4TUU A;  1P5Q A;  4L1B A;  3SI5 A;  4AOF A;  1OWP A;  4B8A A;  3PRE A;  1WM5 A;  4URK A;  3NF1 A;  2XRZ A;  4FHJ A;  4UI9 J;  3FH5 A;  3PDN A;  4Y6W A;  4BY6 A;  1DVP A;  3JCK C;  1FVH A;  2VSN A;  2CG2 A;  3TXN A;  5HQ8 A;  2X38 A;  4GZD A;  3FEY A;  4WNG A;  1KLX A;  2FUL A;  2YQ8 A;  3PVL A;  1E90 A;  2I1K A;  3G2U A;  4CDM A;  2VQ2 A;  4F53 A;  4G24 A;  4WND A;  4TRQ A;  3HVE B;  4G25 A;  4APF A;  1H2T C;  3ZEF A;  1HF8 A;  2EQX A;  4YVQ C;  4FAD A;  2AWI A;  1UW4 B;  2L0I A;  3D9K A;  3PUK A;  1KT0 A;  3QWW A;  4F1S A;  2VTB B;  3FTX A;  2LO6 A;  1HX8 A;  2FF4 A;  4GAA A;  2OOE A;  4HOU A;  2WMN A;  5A7D B;  5BV1 A;  2XRY A;  4ILG A;  2KCK A;  1ZU2 A;  2UY1 A;  3LVR E;  4U04 A;  2GW1 A;  3AS8 A;  1TJF A;  4WNF A;  3DBS A;  1H19 A;  3PE3 A;  2X6K A;  3DPD A;  2KZT B;  3CKB A;  3S7D A;  4C0E A;  2V4L A;  3I4G A;  1U3C A;  1INZ A;  1SZ9 A;  2KM4 A;  1DNP A;  1EPU A;  3L6A A;  3QAQ A;  3SNX A;  5J90 A;  1NA3 A;  4CT0 A;  3OXF A;  5C1D A;  3Q4A B;  3QAR A;  5AEN A;  5T3R A;  5LCW C;  3SBS A;  3G2T A;  4BX8 A;  3LEW A;  4K03 A;  3QWP A;  4WNE A;  4A3T A;  3CHM A;  3CGH A;  2PL2 A;  3B7S A;  3Q47 B;  4JW1 A;  3SF4 A;  3ZW3 A;  4ANX A;  3OAW A;  1OWM A;  1ELR A;  2Q7F A;  4U07 A;  5G05 J;  2HM8 A;  3VLE A;  4C0M A;  4CT4 A;  4XKC A;  3LS8 A;  2VTB A;  4GMJ A;  4XI9 A;  4UQX A;  2ION A;  2XCC A;  1HFA A;  3G2V A;  5G04 J;  3CVY A;  4KT6 B;  3LPZ A;  3ASF A;  3FUK A;  4HOS A;  3FUH A;  3R7R A;  4JVS A;  3NZU A;  5CMW A;  5BT1 A;  1NZN A;  5KJK A;  5LCW J;  4I1O B;  1FVF A;  3VLD A;  4J6I A;  3I3N A;  3CSF A;  4GB9 A;  4LCT A;  3FU5 A;  3EDT B;  1UJJ A;  3MKQ A;  4DPR A;  4GML A;  2WXN A;  4L2Y A;  4UI9 K;  4JXT A;  5BNW A;  2R17 C;  2LSU A;  2XHE A;  3B7U X;  4WWO A;  3MZL B;  2UWJ G;  2J08 A;  1TJC A;  3GZS A;  3RKV A;  3URZ A;  4N2Q A;  4N5C A;  4FA6 A;  1E8W A;  5JHB A;  4I1M A;  3CVN A;  4MKT A;  3L16 A;  3GZ1 A;  4CDN A;  2X6H A;  1HE8 A;  3FTU A;  4LEU A;  4JA7 A;  4BTA A;  3UPV A;  4L23 A;  1UG3 A;  4OYS A;  2YHE A;  3FHE A;  2WXF A;  3ONL A;  2PM7 A;  3N71 A;  4I9E A;  3ESK A;  2WPV A;  3ML9 A;  5G2N A;  4YND A;  1UJK A;  2C0L A;  3PS6 A;  2X6I A;  4DK5 A;  3FUM A;  2J4D A;  5T8I A;  3U64 A;  2MHK A;  3E4B A;  2DBA A;  1W3B A;  4A1G A;  4B0Z A;  1MHQ A;  2Y3A A;  4IUL A;  3CKC A;  3RO2 A;  2WXL A;  3TG4 A;  3FH7 A;  4AJW A;  1PAQ A;  3D9L A;  2AW6 A;  2FBN A;  2KCV A;  3ZHE B;  3LDZ A;  2OV8 A;  4YVO A;  5C2Y A;  3ZXS A;  3TXM A;  2VSO E;  3CEQ A;  4H7Y A;  4J0U A;  3CVU A;  1S0P A;  4XI0 A;  2LSV A;  3NQP A;  2X6J A;  4L2L A;  1VDY A;  4U0S A;  2JEK A;  4TV3 A;  3ML8 A;  4UWL A;  3CVL A;  3R9A B;  3SBT B;  5AYW D;  4EZL A;  2I9C A;  1Z6T A;  3CK7 A;  2X6F A;  3LY8 A;  3L08 A;  3G2S A;  2WXR A;  4ME2 A;  5JJ7 A;  1N54 A;  3APD A;  3ZGQ A;  3FY4 A;  2I1J A;  3TJP A;  3OTN A;  4PS8 A;  3ZYL A;  2PZI A;  4ILI A;  3FUD A;  3ZHE A;  4KVO A;  4UWK A;  3UT8 A;  1UN8 A;  4XE0 A;  2FO7 A;  3Q15 A;  1GW6 A;  3KEZ A;  1E7V A;  5E76 A;  3RU0 A;  3IEG A;  4GZ5 A;  2VJ8 A;  4C9B B;  1WAO 1;  2CHW A;  2WXG A;  4EQF A;  4N3B A;  3APF A;  5JJT A;  3B7R L;  4XKB A;  2IOL A;  5ARF A;  5LFA A;  4GCO A;  3CVV A;  4I17 A;  1IYG A;  3GZ2 A;  1IQR A;  2J9Q A;  2CHX A;  4ANU A;  4FC8 A;  5KJM A;  2XPI A;  2HO1 A;  4NUR A;  3RJV A;  2VGX B;  1Z3Y A;  2WXH A;  2VGY A;  3OXG A;  4CGV A;  3K9I A;  5FQ7 A;  3L17 A;  4DLQ A;  3UT4 A;  2AXZ A;  2FEZ A;  2V0P A;  2XPZ A;  5ENN A;  2DIW A;  3PE4 A;  4RVB A;  2I2O A;  3CST A;  2ZU6 B;  3FUI A;  4ILH B;  3RIB A;  5LOZ A;  2L0T B;  4NQ0 A;  5BV0 A;  3FU0 A;  2WQ7 A;  2WXK A;  3LKU A;  4KZC A;  4LRZ A;  3FTZ A;  1OWO A;  3SD5 A;  3CK9 A;  5ANL A;  2GGF A;  1MQS A;  3CHS A;  4KXK B;  3HHM A;  4WAF A;  2I6H A;  5FT9 A;  1HG5 A;  3O4Z A;  4BFR A;  1ZBP A;  2P58 C;  2RD0 A;  5EDS A;  5JHA A;  3RO3 A;  3JYS A;  4EZK A;  1SQM A;  4U8H A;  4WWN A;  3LY7 A;  5KJN A;  1H0A A;  2C0M A;  2BUG A;  3FU3 A;  4DLO A;  2IQC A;  3PRZ A;  1TEZ A;  3CHP A;  4BTB A;  3SHF A;  5FZQ A;  3S7B A;  3RK6 A;  1E8Z A;  5AJL A;  3CQC B;  2WVI A;  2KC7 A;  4Q94 A;  2HYZ A;  2YHC A;  5FTP A;  2CFU A;  3FUE A;  4I6E A;  4FHK A;  3ZRH A;  3I5P A;  4GA2 A;  4EPZ A;  2R5S A;  4KVM A;  4HOT A;  4UQY A;  2VYI A;  4F7A A;  3CVW A;  3PH0 C;  3P1U A;  5A23 A;  1XNF A;  4FU3 A;  2E2E A;  3TL5 A;  4EBA G;  3ASD A;  4AVX A;  2E0I A;  1U3D A;  3FTS A;  3AU4 A;  3C98 A;  3CVP A;  3ESL A;  5E75 A;  3FTY A;  2NC9 A;  3GYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...