3SNXA

Crystal structure of a putative susd-like carbohydrate binding protein (bt_1439) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
455
structure length
455
Chain Sequence
QVAVAGNAERLFNGAWYNLFEYGTTYANIGYRALQCQDDMMASDVVSRPKYGFNSSYQFNDVAIPSDGRTSFAWYLIYKTIDNCNTAISIKGDSEELRQAQGQALALRAFCYLHLVQHYQFTYLKDKDAPCVPIYTEPTTSGTKPKGKSTVAQVYQQIFDDLNLAQDYLTNYVRKGDGQKFKPNTDVVNGLMARAYLLTGQWGEAAKAAEAARKGYSLMTTTAEYEGFNNISNKEWIWGSPQTLSQSDASYNFYYLDATYVGAYSSFMADPHLMDTFVKGDIRLPLFQWMREGYLGYKKFHMRSDDTADLVLMRSAEMYLIEAEAKVRDGVALDQAVAPLNTLRTARGVGNYDVTGKTKEQVIDEILMERRRELWGEGFGITDVLRNQKAVERMALSEDMQKTEVDCWQEGGSFAKRNPLGHWFLNFPDGKAFSANSSYYLYAIPEKEINANPNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN (BT_1439) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.88 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN
total genus 165
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3snxA00
4PUCA 3OTNA 3I4GA 4Q69A 3CK7A 5T3RA 5E75A 3JQ1A 3L22A 5T4YA 3JYSA 4L7TA 3HDXA 3FDHA 3CGHA 4LERA 5FQ7A 5FQ6A 5J90A 3LEWA 3KEZA 3GZSA 5FQ4A 3CK9A 3MX3A 5LX8A 3NQPA 3CKCA 3P1UA 5E76A 3MYVA 3IV0A 3SGHA 4MRUA 3EJNA 4F53A 3EHNA 3JQ0A 5FQ8A 3MCXA 3CK8A 4F7AA 3EHMA 3CKBA 3SNXA 3QNKA
chains in the Genus database with same CATH superfamily
3D9JA 4ATZD 2WQ6A 4GZ3A 4L7TA 4HFGA 3RRUA 2RKKA 2P9SG 2WXKA 2PQRA 1N9AA 3G2TA 4IN3B 1QYMA 1OWMA 4QQIA 5BNWA 1BU9A 3HHMA 3EHMA 3SNXA 2P9PG 4BT9A 1LD7A 3B7SA 3CK7A 4FULA 1SA4A 3DSUA 2R17C 3DPYA 1EF1C 4WWOA 2XQ0A 3VLDA 3OXGA 1OUVA 3E30A 4G2VA 1O5MA 1SQMA 1UW4B 1AP7A 3G2UA 5CRVA 4WAFA 3UT8A 3TWVA 4TRQA 4C0MA 3HXEA 3IXEA 4K5CA 4BSZB 3ZFWA 5BW8C 3TWWA 3Q79A 3U9WA 5BV0A 2IO3C 4EBAA 3HXFA 3ZVVA 3FFLA 2EIJE 2EIME 5G05C 3BUAA 1IQRA 3W9FA 5AQBA 1IKND 3ZN3A 4GMJA 2XCBA 3DXKG 3QJZA 3MZLB 3CEQA 1B89A 3ASOE 1V54E 3C5RA 3CVUA 2ZISA 3AJIA 4A63B 3FUMA 2FF4A 2IJGX 3E32A 1JPLA 4CRWA 5ENQD 3ZYMA 3LPZA 3T5VA 2LXMA 5FQ4A 3RSEG 2MRIA 4I6JA 3V2XA 4DLQA 3AS8A 2H6FA 4E85A 3T8KA 3D9OA 3LVRE 4KZ0A 5E75A 3O48A 3LJ3A 2ZGDA 2VSOE 3SO8A 5KNGA 4DX5D 1ZU2A 3CHMA 3JCKC 5LOZA 2AVPA 1N52A 3BQOA 3KAEA 4L2LA 1K1AA 1TN8A 2QC9A 4O6FA 3DEOA 3GZSA 2KZTB 2LUHA 4ANWA 3EUVA 2WXLA 2WVIA 4DX1A 1PY1A 3Q9UC 3ZU7B 3U66A 3QK0A 4U96D 3UMVA 3AG1E 2IEJA 3ML8A 3RO2A 4BETA 3CVNA 5AQ9A 3F6QA 4EPZA 4WWPA 2V4LA 1S70B 4GPMA 4GZDA 5LFAA 4LCTA 2WB2A 3HXBA 1N4PA 4Y6WA 5AJDA 3R7QA 4URKA 3Q49B 3FTZA 2GRMA 3FUHA 4XI0A 3CHSA 1N94A 3B7BA 2Y69E 3CSTA 3LEWA 1TNOA 1FVHA 3SFXA 3S7FA 2VTBB 1BLXB 3S2AA 2I6HA 3EDTB 5EYLA 1RW2A 2HE0A 1NI1A 3D9NA 4A55A 3UM3A 5CMWA 3V2OA 2GRPB 1MJ0A 3SD5A 2UY1A 1E8ZA 3WG7E 4N5CA 3ISMC 4Q96A 2DYRE 3TWTA 3LJNA 3UUXA 3PDNA 2BUGA 4PS8A 2J08A 4U07A 4Y6CA 3B95A 2VGEA 2HYZA 3ZRHA 1JCQA 2RG8A 3ONKA 3NB2A 1OCOE 2J09A 1JUQA 3MCXA 2HR2A 4U0SA 3D9HA 3QWVA 3UXGA 3U3WA 3AS5A 3NBNB 2IONA 3RKVA 1FCHA 3CV0A 4U0UA 2IY0C 2R03A 4I6EA 1MZCA 4IULA 3UM0A 4PDXA 3TL5A 2WXJA 1UJJA 4ACKA 5AYWD 2GROB 3FDHA 4LERA 1H2TC 3KEZA 3AG2E 2LAIA 3KEAA 1O1RA 5KNHD 3JUEA 2X6KA 2C2LA 4PUCA 4HBDA 3IHVA 5AARA 5BUZA 4TXRA 4J7WA 4JVSA 4CZ2D 1SW6A 4B0ZA 3DSTA 4KVOA 4A1SA 2XHEA 1A17A 4JA9A 4BT8A 2ZGGA 3T5XA 1L5JA 3FUFA 3L54A 3PEVB 4BTAA 3AG3E 3HG0D 2F8XK 5ARGA 4AM9A 1HO8A 4MKTA 5CECB 4ANXA 4OAVB 2VGYA 4UUCA 3OAWA 5BXUA 1NP7A 1N11A 3J5PA 3I3NA 3ZYKA 3CHOA 3IKOB 2YHEA 1Z5SC 2GGFA 4GA0A 1UG3A 3MGBA 4EZJA 5EKQD 4ANUA 2F0YA 3MX3A 3FEYA 2WXHA 3L82A 3NOCD 1JCSA 1KLXA 2RD0A 4MLPA 4MS6A 4B89A 1SZ9A 5ANLA 3JQ1A 1HU3A 2IOSA 2PM6A 3DBSA 4LNGA 3URZA 4PS3A 4WWNA 3ZXPA 5AIJA 4KXKB 1X81A 4BY6A 2KATA 1GW6A 1N0QA 4FADA 2VTBA 1NL4A 2P58C 4GB9A 1Y8MA 2QYJA 5AENA 5EIDA 3DXMG 3MEKA 4CYMD 3RO3A 3MYVA 4YVQC 2J8SD 4I43A 5G55A 2LO6A 3MKRA 5CBNA 4HLEA 5HKPA 2XZDG 1OXJA 1HF8A 5BT1A 1G3NB 1JWGA 3PNTB 4GMRA 4A1GA 4GTSA 5LX8A 5E76A 4ATGA 3Q75A 1IHGA 5KWDA 4TXPA 4AVXA 2GRRB 3L6AA 3KSLA 5D2MC 5T3RA 2XCCA 2R2LA 5EILA 1OCZE 2AXVA 4UQZA 3P2BA 3NQPA 2GW1A 1WM5A 3D9KA 3CHPA 3N71A 3ASGA 1OWOA 4G25A 2V0PA 1U3CA 2ONDA 5G05J 2XENA 5CHEE 4N5QA 5T8IA 1TNUA 5C1DA 4YNDA 3PE3A 3T9KA 1TJFA 3CR3A 3DSVA 4JL0A 4IYPA 2VGXA 5A7DB 1ELRA 4I2WA 4ILGA 4I9CA 4F6RD 3X2QE 3NF1A 3QARA 4BERA 5IY5E 3FTUA 4I17A 5T4YA 4DJAA 4GZCA 3UM2A 4B93B 1S0PA 2KM4A 4UQYA 3QWWA 4O1PA 4W9RA 3ZIMA 4JEHA 4MRUA 4FC8A 3ABME 4IRUA 4TUMA 5CRUA 2XGSA 2J07A 3EIQC 3V31A 4A3TA 3LY7A 1D9SA 2KXPC 2I2OA 2J4DA 3ULQA 5G2NA 3TG4A 1SA5A 3RJVA 2EQXA 2IOLA 1DCQA 1E8YA 3Q15A 2CFZA 5AJLA 2EIKE 3G2VA 1INZA 1N4SA 3UT7A 3E4BA 4L1BA 2AJAA 4HOTA 4WNGA 4YDEA 2OEWA 1TN6A 5HS0A 5B1BE 3FH5A 1VDYA 3D9MA 2VSYA 4GTVA 1ZB1A 3HVEA 4BFRA 4I1OB 2ETAA 2E0IA 1O1TA 2XPZA 3ZNGA 3FP3A 4FJZA 5KBAA 4NACA 4DX6D 2EINE 3FULA 3LS8A 3KD7A 4BX9A 5H7PA 4ZFHA 5A23A 3TGOA 4HXIA 1PC2A 2NYJA 2NC9A 4I6GA 1SVXA 1EDUA 3J5QB 3ZPJA 4WNDA 3TG5A 5CERB 2CHXA 2IF4A 2JLBA 1H6KA 3C72A 4J8FA 5FWQA 4H7YA 5A6CA 2P9NG 2XEVA 3QDNA 5HQ8A 3E34A 4FU3A 5B3SE 5ENNA 2V4HC 2WMNA 4YDOA 5CMYA 3G2WA 3MKQA 1BD8A 3HVEB 1K8KG 3OTNA 4BWRA 4U04A 1N4RA 3E37A 3S7JA 4NURA 4GTRA 2FI7A 3TXMA 2VSNA 3ML9A 4L2YA 1HG5A 3CSFA 5JJ7A 4K5AB 3AU5A 3P1UA 2VYIA 2YHCA 3FTWA 4C48B 2AWIA 5EYPF 4HB5A 3ZUVB 2J4BA 4Q69A 3FTSA 3FWVA 2GRQB 4GTTA 4GZ5A 2FEZA 4C0EA 4U0ZA 4JPSA 5AQ7A 2ETBA 5B1AE 2Y4UA 5BV1A 3SFYA 4UQXA 3CHQA 3Q4AB 4A3VA 1JWFA 2DVWA 1OCCE 1BI8B 2A5EA 1E96B 3CGHA 1H6PA 4HLLA 4LNBA 3TXNA 1WAO1 2DBAA 4RLYA 3AS4A 2XGOA 5CCMA 3CLJA 2YQ8A 2XRZA 2A5UA 2JABA 3RIBA 2XZTG 4LG6A 3ZW3A 2WQHA 4RG6A 4TUUA 4WNFA 4AJWA 3Q78A 4AOFA 1PAQA 4RSYA 4GPKA 2R02A 4HOSA 1MHQA 1N54A 2X38A 1QQEA 1OWPA 2XS8A 3FUIA 3FTVA 2XGMA 5DIZA 1KZOA 1KT1A 1JCRA 1OY3D 1HXIA 2IO2C 4O1OA 1XNFA 5BXOA 2HM8A 3MA5A 2WXPA 4FLHA 3DSXA 3UM1A 3U4TA 4DI4A 1A5EA 3FU6A 3TWXA 2C0MA 3GW4A 1QZ2A 4XKBA 4ME2A 4AY5A 5FINA 1WY6A 4UWKA 2X3MA 2FULA 1HE8A 4DK5A 5G04C 2LSUA 3CIAA 2X6HA 2WMOA 3SY2A 4XKCA 4FLBA 1U3DA 4MBGA 5KJMA 3LDZA 3HDXA 2Y0BG 3V79K 2PZIA 4BX8A 3RAUA 2VSXE 4M7CA 1OWNA 3VLEA 3IBEA 1YYHA 3FTYA 5CCLA 1D8DA 1BPOA 4LRZA 4BSXA 4CEMA 5HI7A 5EX3A 3UINC 3LKUA 3GZ1A 3UIPC 4X8QA 2CFUA 4GAAA 4I2ZA 1TYQG 4APFA 4TV3A 2RFAA 3L9TA 3ENEA 3BG1B 3FUKA 1W3BA 3BU8A 3T8MA 3SBTB 1H2VC 1KPSB 3CVXA 3IHYA 2ZU6B 4NRHB 1TN7A 4FP7A 4C9BB 1N95A 4UWGA 2L6JA 2OEVA 3Q47B 1DNPA 5AN8A 4HS2A 4G1TA 3NAWA 4GYOA 3ULYA 2X6IA 3DEPA 3I5PA 1HFAA 3ABLE 3SZ7A 2YINA 1Z6TA 4CCAA 3TWSA 3PVLA 4QFVA 3C98A 2DYSE 4GTMA 4G26A 4NQ0A 2LSVA 1WDYA 4AY6A 1MX4A 4LEUA 4GA2A 4J8EA 4ACLA 4L23A 4ILIA 1Y6IA 4UWFA 5CBOA 3CQCB 4ABNA 1ELKA 1OT8A 5DBKA 5ENSD 1OCRE 2DCPA 4LNUD 4EZKA 2YNQA 4GA1A 1UOHA 2UWJG 4Q94A 4J8YA 2P9UG 4CGWA 3ZHEA 4JHKA 4HI9A 2OVBA 3E33A 3L22A 2V5QC 2KC7A 3PZ2A 5FQ7A 5J90A 2WXOA 3MV3B 4B8AA 4FA6A 3MKQB 4HRLA 3ZKJA 3KSQA 1DVPA 4G24A 3FUDA 5FT9A 1S64A 4LUNU 1FT2A 3RK6A 1YMPA 2L0IA 3FU3A 4OVUA 4UWHA 4U95D 3LYAA 4U63A 1TNZA 2WXNA 4GMLA 2VGXB 3I4GA 3FUEA 5CEAA 4EBAG 1LF8A 2Y4TA 2ILRA 3CVVA 1Q2ZA 1KZPA 3OXFA 3Q7FA 1N4QA 4UI9J 4RVBA 3EJNA 2BKGA 2GRNB 3TWUA 3FH8A 2BKKB 4U8YD 2BTDA 3Q7AA 3S7BA 3PNLB 3UQ3A 5ITZF 1X5BA 4YVOA 3Q5MA 4JC8A 1AWCB 3L13A 1EYHA 5FZSA 5D66A 1MX2A 1UJKA 2XPIA 1TEZA 1KT0A 2XS1A 1N0RA 3QWPA 4J8DA 4ZHBA 3FHEA 1IXVA 4JA7A 3LVQE 4J0UA 2A4ZA 3D9LA 2DWZA 3CKCA 3PEUB 2FBNA 3I4RB 2IFUA 3HIZA 2DIWA 4TXQA 2B6CA 3FUJA 4HVBA 2ETCA 2CG3A 4HRMB 4E6HA 4G23A 3RRMB 2WXMA 3TAXA 2P9LG 2PQNA 3APFA 2LAHA 4GU5A 4BEPA 3QNKA 1UN8A 3NZSA 3DPDA 2IQCA 4CDRA 3QKYA 4DPRA 3C3QA 4AV7A 2XEEA 5FTPA 3PH0C 5JHBA 1U2VG 2QFCA 3AAAC 1NA3A 1YA0A 2DZNA 2X6FA 1NA0A 4N2SA 3TWRA 4N39A 1RZ4A 3PS6A 4G8LA 2XEHA 3UPVA 3HRAA 2XPYA 2DZOA 4B8CB 5C2YA 1MX6A 1H2UA 4V3IA 1IHBA 3NOGD 3CK8A 5D0QD 3APCA 4PS7A 2KCLA 4EHMA 5J08A 2L9BA 2QY7A 3R7RA 4EZLA 3GYZA 3PZ1A 4DLOA 2WXFA 2ZXWE 4XEIG 4GYYA 3CVQA 3QB2A 1OWLA 4L9PA 1K1BA 1D8EA 4KBQA 4OVVA 3KS2A 1BI7B 3C3RA 3ASFA 5JJTA 3OXLA 3D3MA 3D9PA 5ENRD 4N3AA 3APDA 5FJYA 4U8HA 3UKUG 2MOWA 1HH8A 3PUJA 4K5BA 4FHKA 4F7AA 4WNEA 3EU5A 3ASNE 4HI8A 1TR4A 4DI3A 5ARFA 3B7RL 4N2QA 2OCCE 3SGHA 3K9IA 3B7TA 4J6IA 5D0OD 3ZGQA 2CHWA 2P9IG 3PZ4A 2H6HA 4YDYA 1HG2A 4KT6B 4UI9K 3ESLA 2HO1A 3CVYA 5KCMA 4B94A 4APOA 5FZQA 3B13A 2J9QA 3DSWA 2P2CP 3ZYQA 5KJLA 3S7DA 3CVLA 5G04J 1TNYA 3NZUA 2M63A 4HRNA 2OOEA 2WM9A 3DRAA 2VJ8A 2WPVA 1TNBA 3ASDA 4EECA 1NZNA 2MYOA 4G11A 4D10C 4HQDA 3UT4A 3JQ0A 4JZYA 1H0AA 1H6OA 4GTOA 3Q73A 2Q7FA 4HORA 3HXCA 2GRLA 4O60A 3FU0A 4BTBA 1LD8A 4ILHB 4U8VD 3MV2B 3PZ3A 2LNIA 4UWLA 4AXHA 4DX2A 1E7UA 3FY4A 4KVMA 3ZHEB 3LY9A 1ZBPA 2PNNA 1DCEA 4HOUA 3PZDA 3CHRA 2OV8A 4GYWA 3ESKA 1LTXA 1DC2A 2WXQA 5EDSA 3HXDA 1ELWA 2KCVA 2QZAA 3R9MA 3WXXA 3PREA 3SHFA 2PL2A 3CQGB 4I1MA 5JJ6A 4CT4A 3UKRG 4AP2A 4CT0A 3FEXA 2I1JA 2WXIA 4R7LA 4BESA 3EHQA 4RG9A 3SBSA 4AEZC 3GZ2A 2NSZA 3CVWA 1E7VA 2WQ7A 3RU0A 4XZ4A 3VLFA 3AG4E 2NXPA 1FPPA 5LCWC 2J49A 3JXJA 4KYOB 3EU9A 1FVFA 2BEDA 3SQVA 4N3BA 3BG0B 4XE0A 3VTYA 4AIFA 4K0RA 4PH4B 2WXRA 4GTPA 2I1KA 3D9IA 1P5QA 5EX0A 2FO7A 3JUIA 3SFZA 1Z3XA 3FUNA 2H6GA 4U7EB 4XI9A 2QYUA 3ZXSA 2EILE 3QAQA 1UN9A 3TWQA 4I9EA 2PM7A 4H7XA 3AU4A 2L0TB 3V30A 2B0OE 4XIFA 2FO1E 2XRYA 2F8YA 2OVFA 3EIJA 2I9CA 4RQIA 3ULEG 4F1SA 4KMOA 4OAUC 1TJCA 5KJKA 5FQ6A 3MJWA 2H6IA 2CG2A 4KZCA 3QC1A 3JXIA 4JD2G 4LSZE 1YCSB 3CKBA 4XX5A 3ABKE 2KZTA 4M3OA 3L17A 3HYMB 1E90A 4N3CA 1FT1A 3RRNB 3DSSA 4F53A 4GZ6A 5EN5D 4CDMA 5KJNA 4UI9C 2RFMA 4P29A 3L16A 5AAOA 4CDNA 3FU5A 3EHRA 3ZYLA 1Z3YA 2JEKA 4I1AA 4ANVA 4JXTA 4JB8P 3LXUX 4EQFA 2P9KG 4GTQA 3UX4A 1IYGA 5ENPD 4FJYA 4J8SA 2L6BA 5JHAA 1NFIE 4JHJA 4G8KA 1S63A 5AQAA 2MHKA 3TJPA 1K3ZD 5JMND 3L08A 5BPPA 2UY1B 4NIKA 2R05A 3R9AB 3CVPA 1E8XA 2LXLA 4OYSA 3G2SA 3UTMA 4HNAD 1O1SA 2F37A 2R59A 3UIOC 2WXGA 3W9GA 1XGWA 3B7UX 3BEEA 5M72A 4JW1A 2VQ2A 2KCKA 3EHNA 3Q9NC 2ZIRA 4YDWA 1WG0A 3LCAA 5LCWJ 2E2EA 3JYSA 5HRYA 3VTXA 2AXZA 3PE4A 3C3OA 2Y3AA 2IU1A 2AXUA 4DUIA 3PRZA 5CEDB 2C0LA 5FQ8A 4WUYA 3SF4A 1HX8A 3DWLG 1QBQA 3ONLA 4JHRA 4CGVA 4K03A 5LP0A 5FZRA 1H19A 5ENOD 4Z68A 1QNFA 4FHJA 3SI5A 5JA4D 3O4ZA 3CK9A 3ASHA 4JEUA 5EIBE 1MQSA 3IV0A 4GCNA 1SZAA 4DX7D 3FTXA 1HS6A 2V5FA 2AW6A 3UI2A 2X6JA 4DRXE 2BF0X 1EPUA 3U64A 3LY8A 2CHZA 2V8SE 4GCOA 1MYOA 3QOUA 4F1PA 2R5SA 1IQUA 3FH7A 2Y1LE 1E8WA 3IEGA 1V55E 5FIOA 4HOQA 1HZ4A 5ANRA 5ENTD 2KBXA 3PUKA 3ZEFA 4F3VA
chains in the Genus database with same CATH topology
3D9JA 3FU6A 5ANLA 2C0MA 2WQ6A 3GW4A 1QZ2A 3JQ1A 4GZ3A 4XKBA 4ME2A 1HU3A 2IOSA 4DI3A 5ARFA 4L7TA 4HFGA 4AY5A 3B7RL 1WY6A 3RRUA 4UWKA 2PM6A 3DBSA 2X3MA 3URZA 2WXKA 2FULA 4PS3A 2PQRA 4N2QA 1HE8A 4WWNA 3G2TA 5AIJA 4IN3B 4KXKB 3SGHA 4DK5A 5G04C 1OWMA 5BNWA 2LSUA 4BY6A 2KATA 3HHMA 1GW6A 3B7TA 3K9IA 4J6IA 3EHMA 3CIAA 5D0OD 3SNXA 3ZGQA 2X6HA 4BT9A 2WMOA 4FADA 2CHWA 2VTBA 3B7SA 3CK7A 1HG2A 4KT6B 4FULA 2P58C 4GB9A 1Y8MA 4FLBA 4UI9K 2R17C 3ESLA 1U3DA 4XKCA 5KJMA 1EF1C 2HO1A 3LDZA 3CVYA 3HDXA 4WWOA 2XQ0A 5KCMA 2PZIA 5AENA 4BX8A 2VSXE 3VLDA 4B94A 3MEKA 3OXGA 1OUVA 1OWNA 4G2VA 3RO3A 3MYVA 4YVQC 4APOA 5FZQA 1SQMA 3B13A 2J9QA 3VLEA 3IBEA 3FTYA 1UW4B 3ZYQA 5CCLA 3S7DA 5KJLA 3G2UA 4I43A 3CVLA 5G04J 5G55A 2LO6A 4WAFA 3UT8A 3MKRA 3NZUA 1BPOA 4LRZA 4TRQA 4BSXA 4C0MA 2M63A 4CEMA 2OOEA 2WM9A 5HI7A 4HLEA 5EX3A 3ZFWA 5BW8C 2VJ8A 1HF8A 3LKUA 2WPVA 3GZ1A 3ASDA 3U9WA 2CFUA 5BT1A 5BV0A 4GAAA 1JWGA 3PNTB 4I2ZA 4EECA 4APFA 4EBAA 1NZNA 4TV3A 4G11A 4A1GA 3ZVVA 4D10C 5LX8A 3ENEA 3BG1B 3FFLA 5E76A 3UT4A 4ATGA 3FUKA 1W3BA 3JQ0A 4JZYA 1IHGA 1H0AA 3T8MA 4AVXA 5G05C 3SBTB 1IQRA 1H2VC 3CVXA 4HORA 2Q7FA 3IHYA 2ZU6B 4NRHB 3L6AA 4FP7A 2GRLA 4C9BB 3FU0A 4BTBA 5T3RA 2XCCA 4UWGA 4ILHB 3ZN3A 2L6JA 3MV2B 4AXHA 2LNIA 4UWLA 2AXVA 4GMJA 3Q47B 1E7UA 3FY4A 2XCBA 3QJZA 1DNPA 4KVMA 4UQZA 3P2BA 3ZHEB 3LY9A 3NQPA 2GW1A 3MZLB 1WM5A 1ZBPA 4HS2A 3D9KA 4G1TA 4HOUA 3CHPA 3PZDA 3CHRA 3N71A 2OV8A 3CEQA 3ASGA 1B89A 4GYOA 3CVUA 4GYWA 3ESKA 1OWOA 4G25A 2X6IA 2V0PA 2WXQA 3I5PA 1U3CA 5EDSA 1ELWA 2ONDA 3FUMA 1HFAA 2KCVA 5G05J 3WXXA 2FF4A 2IJGX 3PREA 3SZ7A 5CHEE 2YINA 5T8IA 3SHFA 2PL2A 5C1DA 1Z6TA 1JPLA 4YNDA 3CQGB 4CRWA 4CCAA 3PE3A 3ZYMA 3PVLA 1TJFA 3CR3A 3LPZA 4I1MA 3C98A 4QFVA 5JJ6A 3T5VA 4JL0A 5FQ4A 4CT4A 2MRIA 4AP2A 4IYPA 2VGXA 4G26A 4NQ0A 2LSVA 4AY6A 4I6JA 5A7DB 4CT0A 3FEXA 1ELRA 4ACLA 4DLQA 4I2WA 2I1JA 4ILGA 3AS8A 4LEUA 4E85A 2WXIA 3D9OA 4R7LA 4GA2A 4RG9A 3SBSA 4I9CA 4J8EA 4L23A 3NF1A 1Y6IA 3LVRE 3QARA 4ILIA 4KZ0A 4UWFA 5E75A 3GZ2A 2NSZA 4AEZC 3O48A 3CVWA 3FTUA 1E7VA 3LJ3A 4I17A 5T4YA 4DJAA 3CQCB 4GZCA 2VSOE 2WQ7A 4ABNA 3RU0A 1ELKA 1S0PA 2KM4A 4UQYA 5DBKA 3QWWA 4W9RA 4XZ4A 3ZIMA 3VLFA 2DCPA 4EZKA 4JEHA 1ZU2A 2NXPA 4MRUA 5LCWC 2YNQA 3CHMA 4FC8A 4GA1A 2J49A 3JCKC 4IRUA 2UWJG 4KYOB 4Q94A 1FVFA 5LOZA 4CGWA 2AVPA 1N52A 3KAEA 4L2LA 3ZHEA 2XGSA 4JHKA 2J07A 3EIQC 4N3BA 3BG0B 2OVBA 4XE0A 3VTYA 4AIFA 3L22A 4A3TA 4K0RA 3LY7A 4PH4B 4O6FA 2WXRA 2KC7A 2I1KA 3D9IA 5FQ7A 2I2OA 2J4DA 3ULQA 5J90A 3GZSA 1P5QA 2WXOA 2KZTB 3MV3B 5G2NA 3TG4A 5EX0A 4B8AA 3RJVA 2FO7A 4ANWA 4FA6A 3JUIA 2EQXA 2WXLA 3SFZA 2IOLA 2WVIA 1Z3XA 1PY1A 1E8YA 3MKQB 3FUNA 3Q15A 2CFZA 1DVPA 5AJLA 3U66A 3QK0A 4G24A 3G2VA 3UMVA 4XI9A 1INZA 3FUDA 5FT9A 3ZXSA 4LUNU 3ML8A 3RO2A 3UT7A 3QAQA 3E4BA 4L1BA 3CVNA 3RK6A 1UN9A 2L0IA 3FU3A 4HOTA 4OVUA 4WNGA 4I9EA 2PM7A 4UWHA 4H7XA 4EPZA 3AU4A 4WWPA 3LYAA 4U63A 2V4LA 2L0TB 4GZDA 4XIFA 3FH5A 2XRYA 5LFAA 2WXNA 2OVFA 4LCTA 4GMLA 3EIJA 2WB2A 1VDYA 3D9MA 2VGXB 4Y6WA 2VSYA 3I4GA 5AJDA 3FUEA 3Q49B 3FTZA 3R7QA 4URKA 2GRMA 2I9CA 3FUHA 4F1SA 4XI0A 3HVEA 4KMOA 3CHSA 4BFRA 1TJCA 4I1OB 4EBAG 1LF8A 2E0IA 2Y4TA 5KJKA 2ILRA 5FQ6A 2XPZA 3CSTA 3LEWA 3CVVA 3MJWA 1FVHA 3FP3A 4FJZA 3OXFA 3S7FA 2VTBB 4NACA 4UI9J 2CG2A 4KZCA 3S2AA 3QC1A 4RVBA 3EJNA 3FULA 2I6HA 3EDTB 3LS8A 3CKBA 4XX5A 3KD7A 3FH8A 4BX9A 3D9NA 2BTDA 4A55A 5A23A 2KZTA 3S7BA 3PNLB 4M3OA 3L17A 3HYMB 3UQ3A 5CMWA 1E90A 4N3CA 1X5BA 4YVOA 3Q5MA 4JC8A 3SD5A 3RRNB 3TGOA 4HXIA 2UY1A 1E8ZA 1PC2A 2NC9A 3L13A 4I6GA 4N5CA 1EYHA 5FZSA 1EDUA 4Q96A 3ZPJA 4F53A 4WNDA 4GZ6A 3TG5A 3UUXA 4CDMA 5KJNA 2CHXA 3PDNA 2IF4A 4UI9C 2JLBA 1UJKA 1H6KA 2BUGA 4J8FA 4PS8A 2XPIA 2J08A 4U07A 4P29A 4Y6CA 1TEZA 5FWQA 1KT0A 3L16A 2HYZA 4H7YA 5A6CA 3QWPA 4J8DA 2XEVA 3FHEA 3QDNA 3ZRHA 4CDNA 4JA7A 5HQ8A 3LVQE 3FU5A 2RG8A 4FU3A 4J0UA 3ONKA 5ENNA 2A4ZA 3D9LA 3ZYLA 2WMNA 1Z3YA 5CMYA 3G2WA 2JEKA 3CKCA 4I1AA 2J09A 4ANVA 3PEUB 4JXTA 3MKQA 1JUQA 3MCXA 2FBNA 3LXUX 4EQFA 3I4RB 2HR2A 4U0SA 3HVEB 2IFUA 3HIZA 2DIWA 3UX4A 1IYGA 4FJYA 3QWVA 4J8SA 3OTNA 4BWRA 4U04A 5JHAA 3U3WA 3AS5A 3FUJA 4HVBA 3S7JA 2CG3A 4NURA 2FI7A 4JHJA 3TXMA 4G23A 2VSNA 4E6HA 3RRMB 2WXMA 3ML9A 4L2YA 2IONA 3RKVA 1FCHA 2MHKA 3CV0A 1HG5A 3TAXA 3CSFA 3TJPA 4U0UA 2PQNA 3L08A 5JJ7A 3AU5A 3P1UA 4I6EA 2VYIA 2YHCA 3APFA 3FTWA 5BPPA 2LAHA 2UY1B 4IULA 4GU5A 2AWIA 4PDXA 3QNKA 3R9AB 2J4BA 3TL5A 1UN8A 3NZSA 3DPDA 4Q69A 2IQCA 3FTSA 3FWVA 2WXJA 3CVPA 4CDRA 3QKYA 1E8XA 1UJJA 4DPRA 4OYSA 3G2SA 4ACKA 5AYWD 4AV7A 4GZ5A 2FEZA 2R59A 2WXGA 3FDHA 4C0EA 4LERA 4U0ZA 1H2TC 3KEZA 5FTPA 1XGWA 2LAIA 4JPSA 3B7UX 3BEEA 3PH0C 2QFCA 5JHBA 5M72A 1NA3A 2VQ2A 2KCKA 4JW1A 3EHNA 1YA0A 2Y4UA 5BV1A 2X6FA 4UQXA 1NA0A 2X6KA 2C2LA 3LCAA 3CHQA 4PUCA 4N2SA 3Q4AB 4A3VA 1JWFA 3IHVA 5LCWJ 4N39A 2E2EA 5BUZA 3JYSA 3PS6A 3VTXA 1E96B 2AXZA 3CGHA 3UPVA 3PE4A 4JVSA 2Y3AA 3TXNA 1WAO1 2IU1A 2DBAA 2XPYA 2AXUA 4B8CB 5C2YA 3PRZA 1H2UA 4V3IA 2C0LA 4B0ZA 3AS4A 2XGOA 5FQ8A 5CCMA 3CK8A 5D0QD 3CLJA 4KVOA 3APCA 4WUYA 2YQ8A 3SF4A 2XHEA 4A1SA 1HX8A 1A17A 2A5UA 3ONLA 4JA9A 4PS7A 4BT8A 2XRZA 2KCLA 4JHRA 4CGVA 3T5XA 4K03A 3RIBA 1L5JA 3FUFA 3L54A 5J08A 3ZW3A 2L9BA 2QY7A 2WQHA 3PEVB 4RG6A 3R7RA 5FZRA 5LP0A 1H19A 4TUUA 4WNFA 4EZLA 4AJWA 3GYZA 4BTAA 4AOFA 5ARGA 4DLOA 1QNFA 4FHJA 1PAQA 3SI5A 4AM9A 1HO8A 4MKTA 2WXFA 4RSYA 3O4ZA 4GPKA 3CK9A 3ASHA 4JEUA 4ANXA 4HOSA 4GYYA 2VGYA 1MQSA 3IV0A 1MHQA 1N54A 1SZAA 3CVQA 3OAWA 4GCNA 3QB2A 2X38A 1NP7A 1OWLA 3FTXA 1QQEA 3I3NA 1OWPA 1HS6A 3ZYKA 2V5FA 4KBQA 2AW6A 4OVVA 2X6JA 3CHOA 3KS2A 3FUIA 3FTVA 3IKOB 2YHEA 2BF0X 2XGMA 1EPUA 2GGFA 5DIZA 3U64A 3ASFA 5JJTA 3OXLA 3LY8A 1KT1A 3D3MA 2CHZA 3D9PA 2V8SE 4GA0A 4GCOA 1HXIA 1UG3A 3MGBA 4EZJA 3QOUA 1XNFA 2R5SA 1IQUA 3FH7A 4N3AA 5EKQD 3APDA 4ANUA 1E8WA 5FJYA 4U8HA 2MOWA 3FEYA 3MX3A 3IEGA 1HH8A 2HM8A 2WXHA 4HOQA 1HZ4A 3MA5A 2WXPA 3PUJA 4FLHA 5ANRA 4FHKA 4F7AA 1KLXA 2RD0A 4MLPA 4WNEA 3U4TA 3PUKA 4DI4A 3ZEFA 4MS6A 4B89A 4F3VA 1SZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUC A;  3OTN A;  3I4G A;  4Q69 A;  3CK7 A;  5T3R A;  5E75 A;  3JQ1 A;  3L22 A;  5T4Y A;  3JYS A;  4L7T A;  3HDX A;  3FDH A;  3CGH A;  4LER A;  5FQ7 A;  5FQ6 A;  5J90 A;  3LEW A;  3KEZ A;  3GZS A;  5FQ4 A;  3CK9 A;  3MX3 A;  5LX8 A;  3NQP A;  3CKC A;  3P1U A;  5E76 A;  3MYV A;  3IV0 A;  3SGH A;  4MRU A;  3EJN A;  4F53 A;  3EHN A;  3JQ0 A;  5FQ8 A;  3MCX A;  3CK8 A;  4F7A A;  3EHM A;  3CKB A;  3SNX A;  3QNK A; 
#chains in the Genus database with same CATH topology
 3D9J A;  4ATZ D;  2WQ6 A;  4GZ3 A;  4L7T A;  4HFG A;  3RRU A;  2RKK A;  2P9S G;  2WXK A;  2PQR A;  1N9A A;  3G2T A;  4IN3 B;  1QYM A;  1OWM A;  4QQI A;  5BNW A;  1BU9 A;  3HHM A;  3EHM A;  3SNX A;  2P9P G;  4BT9 A;  1LD7 A;  3B7S A;  3CK7 A;  4FUL A;  1SA4 A;  3DSU A;  2R17 C;  3DPY A;  1EF1 C;  4WWO A;  2XQ0 A;  3VLD A;  3OXG A;  1OUV A;  3E30 A;  4G2V A;  1O5M A;  1SQM A;  1UW4 B;  1AP7 A;  3G2U A;  5CRV A;  4WAF A;  3UT8 A;  3TWV A;  4TRQ A;  4C0M A;  3HXE A;  3IXE A;  4K5C A;  4BSZ B;  3ZFW A;  5BW8 C;  3TWW A;  3Q79 A;  3U9W A;  5BV0 A;  2IO3 C;  4EBA A;  3HXF A;  3ZVV A;  3FFL A;  2EIJ E;  2EIM E;  5G05 C;  3BUA A;  1IQR A;  3W9F A;  5AQB A;  1IKN D;  3ZN3 A;  4GMJ A;  2XCB A;  3DXK G;  3QJZ A;  3MZL B;  3CEQ A;  1B89 A;  3ASO E;  1V54 E;  3C5R A;  3CVU A;  2ZIS A;  3AJI A;  4A63 B;  3FUM A;  2FF4 A;  2IJG X;  3E32 A;  1JPL A;  4CRW A;  5ENQ D;  3ZYM A;  3LPZ A;  3T5V A;  2LXM A;  5FQ4 A;  3RSE G;  2MRI A;  4I6J A;  3V2X A;  4DLQ A;  3AS8 A;  2H6F A;  4E85 A;  3T8K A;  3D9O A;  3LVR E;  4KZ0 A;  5E75 A;  3O48 A;  3LJ3 A;  2ZGD A;  2VSO E;  3SO8 A;  5KNG A;  4DX5 D;  1ZU2 A;  3CHM A;  3JCK C;  5LOZ A;  2AVP A;  1N52 A;  3BQO A;  3KAE A;  4L2L A;  1K1A A;  1TN8 A;  2QC9 A;  4O6F A;  3DEO A;  3GZS A;  2KZT B;  2LUH A;  4ANW A;  3EUV A;  2WXL A;  2WVI A;  4DX1 A;  1PY1 A;  3Q9U C;  3ZU7 B;  3U66 A;  3QK0 A;  4U96 D;  3UMV A;  3AG1 E;  2IEJ A;  3ML8 A;  3RO2 A;  4BET A;  3CVN A;  5AQ9 A;  3F6Q A;  4EPZ A;  4WWP A;  2V4L A;  1S70 B;  4GPM A;  4GZD A;  5LFA A;  4LCT A;  2WB2 A;  3HXB A;  1N4P A;  4Y6W A;  5AJD A;  3R7Q A;  4URK A;  3Q49 B;  3FTZ A;  2GRM A;  3FUH A;  4XI0 A;  3CHS A;  1N94 A;  3B7B A;  2Y69 E;  3CST A;  3LEW A;  1TNO A;  1FVH A;  3SFX A;  3S7F A;  2VTB B;  1BLX B;  3S2A A;  2I6H A;  3EDT B;  5EYL A;  1RW2 A;  2HE0 A;  1NI1 A;  3D9N A;  4A55 A;  3UM3 A;  5CMW A;  3V2O A;  2GRP B;  1MJ0 A;  3SD5 A;  2UY1 A;  1E8Z A;  3WG7 E;  4N5C A;  3ISM C;  4Q96 A;  2DYR E;  3TWT A;  3LJN A;  3UUX A;  3PDN A;  2BUG A;  4PS8 A;  2J08 A;  4U07 A;  4Y6C A;  3B95 A;  2VGE A;  2HYZ A;  3ZRH A;  1JCQ A;  2RG8 A;  3ONK A;  3NB2 A;  1OCO E;  2J09 A;  1JUQ A;  3MCX A;  2HR2 A;  4U0S A;  3D9H A;  3QWV A;  3UXG A;  3U3W A;  3AS5 A;  3NBN B;  2ION A;  3RKV A;  1FCH A;  3CV0 A;  4U0U A;  2IY0 C;  2R03 A;  4I6E A;  1MZC A;  4IUL A;  3UM0 A;  4PDX A;  3TL5 A;  2WXJ A;  1UJJ A;  4ACK A;  5AYW D;  2GRO B;  3FDH A;  4LER A;  1H2T C;  3KEZ A;  3AG2 E;  2LAI A;  3KEA A;  1O1R A;  5KNH D;  3JUE A;  2X6K A;  2C2L A;  4PUC A;  4HBD A;  3IHV A;  5AAR A;  5BUZ A;  4TXR A;  4J7W A;  4JVS A;  4CZ2 D;  1SW6 A;  4B0Z A;  3DST A;  4KVO A;  4A1S A;  2XHE A;  1A17 A;  4JA9 A;  4BT8 A;  2ZGG A;  3T5X A;  1L5J A;  3FUF A;  3L54 A;  3PEV B;  4BTA A;  3AG3 E;  3HG0 D;  2F8X K;  5ARG A;  4AM9 A;  1HO8 A;  4MKT A;  5CEC B;  4ANX A;  4OAV B;  2VGY A;  4UUC A;  3OAW A;  5BXU A;  1NP7 A;  1N11 A;  3J5P A;  3I3N A;  3ZYK A;  3CHO A;  3IKO B;  2YHE A;  1Z5S C;  2GGF A;  4GA0 A;  1UG3 A;  3MGB A;  4EZJ A;  5EKQ D;  4ANU A;  2F0Y A;  3MX3 A;  3FEY A;  2WXH A;  3L82 A;  3NOC D;  1JCS A;  1KLX A;  2RD0 A;  4MLP A;  4MS6 A;  4B89 A;  1SZ9 A;  5ANL A;  3JQ1 A;  1HU3 A;  2IOS A;  2PM6 A;  3DBS A;  4LNG A;  3URZ A;  4PS3 A;  4WWN A;  3ZXP A;  5AIJ A;  4KXK B;  1X81 A;  4BY6 A;  2KAT A;  1GW6 A;  1N0Q A;  4FAD A;  2VTB A;  1NL4 A;  2P58 C;  4GB9 A;  1Y8M A;  2QYJ A;  5AEN A;  5EID A;  3DXM G;  3MEK A;  4CYM D;  3RO3 A;  3MYV A;  4YVQ C;  2J8S D;  4I43 A;  5G55 A;  2LO6 A;  3MKR A;  5CBN A;  4HLE A;  5HKP A;  2XZD G;  1OXJ A;  1HF8 A;  5BT1 A;  1G3N B;  1JWG A;  3PNT B;  4GMR A;  4A1G A;  4GTS A;  5LX8 A;  5E76 A;  4ATG A;  3Q75 A;  1IHG A;  5KWD A;  4TXP A;  4AVX A;  2GRR B;  3L6A A;  3KSL A;  5D2M C;  5T3R A;  2XCC A;  2R2L A;  5EIL A;  1OCZ E;  2AXV A;  4UQZ A;  3P2B A;  3NQP A;  2GW1 A;  1WM5 A;  3D9K A;  3CHP A;  3N71 A;  3ASG A;  1OWO A;  4G25 A;  2V0P A;  1U3C A;  2OND A;  5G05 J;  2XEN A;  5CHE E;  4N5Q A;  5T8I A;  1TNU A;  5C1D A;  4YND A;  3PE3 A;  3T9K A;  1TJF A;  3CR3 A;  3DSV A;  4JL0 A;  4IYP A;  2VGX A;  5A7D B;  1ELR A;  4I2W A;  4ILG A;  4I9C A;  4F6R D;  3X2Q E;  3NF1 A;  3QAR A;  4BER A;  5IY5 E;  3FTU A;  4I17 A;  5T4Y A;  4DJA A;  4GZC A;  3UM2 A;  4B93 B;  1S0P A;  2KM4 A;  4UQY A;  3QWW A;  4O1P A;  4W9R A;  3ZIM A;  4JEH A;  4MRU A;  4FC8 A;  3ABM E;  4IRU A;  4TUM A;  5CRU A;  2XGS A;  2J07 A;  3EIQ C;  3V31 A;  4A3T A;  3LY7 A;  1D9S A;  2KXP C;  2I2O A;  2J4D A;  3ULQ A;  5G2N A;  3TG4 A;  1SA5 A;  3RJV A;  2EQX A;  2IOL A;  1DCQ A;  1E8Y A;  3Q15 A;  2CFZ A;  5AJL A;  2EIK E;  3G2V A;  1INZ A;  1N4S A;  3UT7 A;  3E4B A;  4L1B A;  2AJA A;  4HOT A;  4WNG A;  4YDE A;  2OEW A;  1TN6 A;  5HS0 A;  5B1B E;  3FH5 A;  1VDY A;  3D9M A;  2VSY A;  4GTV A;  1ZB1 A;  3HVE A;  4BFR A;  4I1O B;  2ETA A;  2E0I A;  1O1T A;  2XPZ A;  3ZNG A;  3FP3 A;  4FJZ A;  5KBA A;  4NAC A;  4DX6 D;  2EIN E;  3FUL A;  3LS8 A;  3KD7 A;  4BX9 A;  5H7P A;  4ZFH A;  5A23 A;  3TGO A;  4HXI A;  1PC2 A;  2NYJ A;  2NC9 A;  4I6G A;  1SVX A;  1EDU A;  3J5Q B;  3ZPJ A;  4WND A;  3TG5 A;  5CER B;  2CHX A;  2IF4 A;  2JLB A;  1H6K A;  3C72 A;  4J8F A;  5FWQ A;  4H7Y A;  5A6C A;  2P9N G;  2XEV A;  3QDN A;  5HQ8 A;  3E34 A;  4FU3 A;  5B3S E;  5ENN A;  2V4H C;  2WMN A;  4YDO A;  5CMY A;  3G2W A;  3MKQ A;  1BD8 A;  3HVE B;  1K8K G;  3OTN A;  4BWR A;  4U04 A;  1N4R A;  3E37 A;  3S7J A;  4NUR A;  4GTR A;  2FI7 A;  3TXM A;  2VSN A;  3ML9 A;  4L2Y A;  1HG5 A;  3CSF A;  5JJ7 A;  4K5A B;  3AU5 A;  3P1U A;  2VYI A;  2YHC A;  3FTW A;  4C48 B;  2AWI A;  5EYP F;  4HB5 A;  3ZUV B;  2J4B A;  4Q69 A;  3FTS A;  3FWV A;  2GRQ B;  4GTT A;  4GZ5 A;  2FEZ A;  4C0E A;  4U0Z A;  4JPS A;  5AQ7 A;  2ETB A;  5B1A E;  2Y4U A;  5BV1 A;  3SFY A;  4UQX A;  3CHQ A;  3Q4A B;  4A3V A;  1JWF A;  2DVW A;  1OCC E;  1BI8 B;  2A5E A;  1E96 B;  3CGH A;  1H6P A;  4HLL A;  4LNB A;  3TXN A;  1WAO 1;  2DBA A;  4RLY A;  3AS4 A;  2XGO A;  5CCM A;  3CLJ A;  2YQ8 A;  2XRZ A;  2A5U A;  2JAB A;  3RIB A;  2XZT G;  4LG6 A;  3ZW3 A;  2WQH A;  4RG6 A;  4TUU A;  4WNF A;  4AJW A;  3Q78 A;  4AOF A;  1PAQ A;  4RSY A;  4GPK A;  2R02 A;  4HOS A;  1MHQ A;  1N54 A;  2X38 A;  1QQE A;  1OWP A;  2XS8 A;  3FUI A;  3FTV A;  2XGM A;  5DIZ A;  1KZO A;  1KT1 A;  1JCR A;  1OY3 D;  1HXI A;  2IO2 C;  4O1O A;  1XNF A;  5BXO A;  2HM8 A;  3MA5 A;  2WXP A;  4FLH A;  3DSX A;  3UM1 A;  3U4T A;  4DI4 A;  1A5E A;  3FU6 A;  3TWX A;  2C0M A;  3GW4 A;  1QZ2 A;  4XKB A;  4ME2 A;  4AY5 A;  5FIN A;  1WY6 A;  4UWK A;  2X3M A;  2FUL A;  1HE8 A;  4DK5 A;  5G04 C;  2LSU A;  3CIA A;  2X6H A;  2WMO A;  3SY2 A;  4XKC A;  4FLB A;  1U3D A;  4MBG A;  5KJM A;  3LDZ A;  3HDX A;  2Y0B G;  3V79 K;  2PZI A;  4BX8 A;  3RAU A;  2VSX E;  4M7C A;  1OWN A;  3VLE A;  3IBE A;  1YYH A;  3FTY A;  5CCL A;  1D8D A;  1BPO A;  4LRZ A;  4BSX A;  4CEM A;  5HI7 A;  5EX3 A;  3UIN C;  3LKU A;  3GZ1 A;  3UIP C;  4X8Q A;  2CFU A;  4GAA A;  4I2Z A;  1TYQ G;  4APF A;  4TV3 A;  2RFA A;  3L9T A;  3ENE A;  3BG1 B;  3FUK A;  1W3B A;  3BU8 A;  3T8M A;  3SBT B;  1H2V C;  1KPS B;  3CVX A;  3IHY A;  2ZU6 B;  4NRH B;  1TN7 A;  4FP7 A;  4C9B B;  1N95 A;  4UWG A;  2L6J A;  2OEV A;  3Q47 B;  1DNP A;  5AN8 A;  4HS2 A;  4G1T A;  3NAW A;  4GYO A;  3ULY A;  2X6I A;  3DEP A;  3I5P A;  1HFA A;  3ABL E;  3SZ7 A;  2YIN A;  1Z6T A;  4CCA A;  3TWS A;  3PVL A;  4QFV A;  3C98 A;  2DYS E;  4GTM A;  4G26 A;  4NQ0 A;  2LSV A;  1WDY A;  4AY6 A;  1MX4 A;  4LEU A;  4GA2 A;  4J8E A;  4ACL A;  4L23 A;  4ILI A;  1Y6I A;  4UWF A;  5CBO A;  3CQC B;  4ABN A;  1ELK A;  1OT8 A;  5DBK A;  5ENS D;  1OCR E;  2DCP A;  4LNU D;  4EZK A;  2YNQ A;  4GA1 A;  1UOH A;  2UWJ G;  4Q94 A;  4J8Y A;  2P9U G;  4CGW A;  3ZHE A;  4JHK A;  4HI9 A;  2OVB A;  3E33 A;  3L22 A;  2V5Q C;  2KC7 A;  3PZ2 A;  5FQ7 A;  5J90 A;  2WXO A;  3MV3 B;  4B8A A;  4FA6 A;  3MKQ B;  4HRL A;  3ZKJ A;  3KSQ A;  1DVP A;  4G24 A;  3FUD A;  5FT9 A;  1S64 A;  4LUN U;  1FT2 A;  3RK6 A;  1YMP A;  2L0I A;  3FU3 A;  4OVU A;  4UWH A;  4U95 D;  3LYA A;  4U63 A;  1TNZ A;  2WXN A;  4GML A;  2VGX B;  3I4G A;  3FUE A;  5CEA A;  4EBA G;  1LF8 A;  2Y4T A;  2ILR A;  3CVV A;  1Q2Z A;  1KZP A;  3OXF A;  3Q7F A;  1N4Q A;  4UI9 J;  4RVB A;  3EJN A;  2BKG A;  2GRN B;  3TWU A;  3FH8 A;  2BKK B;  4U8Y D;  2BTD A;  3Q7A A;  3S7B A;  3PNL B;  3UQ3 A;  5ITZ F;  1X5B A;  4YVO A;  3Q5M A;  4JC8 A;  1AWC B;  3L13 A;  1EYH A;  5FZS A;  5D66 A;  1MX2 A;  1UJK A;  2XPI A;  1TEZ A;  1KT0 A;  2XS1 A;  1N0R A;  3QWP A;  4J8D A;  4ZHB A;  3FHE A;  1IXV A;  4JA7 A;  3LVQ E;  4J0U A;  2A4Z A;  3D9L A;  2DWZ A;  3CKC A;  3PEU B;  2FBN A;  3I4R B;  2IFU A;  3HIZ A;  2DIW A;  4TXQ A;  2B6C A;  3FUJ A;  4HVB A;  2ETC A;  2CG3 A;  4HRM B;  4E6H A;  4G23 A;  3RRM B;  2WXM A;  3TAX A;  2P9L G;  2PQN A;  3APF A;  2LAH A;  4GU5 A;  4BEP A;  3QNK A;  1UN8 A;  3NZS A;  3DPD A;  2IQC A;  4CDR A;  3QKY A;  4DPR A;  3C3Q A;  4AV7 A;  2XEE A;  5FTP A;  3PH0 C;  5JHB A;  1U2V G;  2QFC A;  3AAA C;  1NA3 A;  1YA0 A;  2DZN A;  2X6F A;  1NA0 A;  4N2S A;  3TWR A;  4N39 A;  1RZ4 A;  3PS6 A;  4G8L A;  2XEH A;  3UPV A;  3HRA A;  2XPY A;  2DZO A;  4B8C B;  5C2Y A;  1MX6 A;  1H2U A;  4V3I A;  1IHB A;  3NOG D;  3CK8 A;  5D0Q D;  3APC A;  4PS7 A;  2KCL A;  4EHM A;  5J08 A;  2L9B A;  2QY7 A;  3R7R A;  4EZL A;  3GYZ A;  3PZ1 A;  4DLO A;  2WXF A;  2ZXW E;  4XEI G;  4GYY A;  3CVQ A;  3QB2 A;  1OWL A;  4L9P A;  1K1B A;  1D8E A;  4KBQ A;  4OVV A;  3KS2 A;  1BI7 B;  3C3R A;  3ASF A;  5JJT A;  3OXL A;  3D3M A;  3D9P A;  5ENR D;  4N3A A;  3APD A;  5FJY A;  4U8H A;  3UKU G;  2MOW A;  1HH8 A;  3PUJ A;  4K5B A;  4FHK A;  4F7A A;  4WNE A;  3EU5 A;  3ASN E;  4HI8 A;  1TR4 A;  4DI3 A;  5ARF A;  3B7R L;  4N2Q A;  2OCC E;  3SGH A;  3K9I A;  3B7T A;  4J6I A;  5D0O D;  3ZGQ A;  2CHW A;  2P9I G;  3PZ4 A;  2H6H A;  4YDY A;  1HG2 A;  4KT6 B;  4UI9 K;  3ESL A;  2HO1 A;  3CVY A;  5KCM A;  4B94 A;  4APO A;  5FZQ A;  3B13 A;  2J9Q A;  3DSW A;  2P2C P;  3ZYQ A;  5KJL A;  3S7D A;  3CVL A;  5G04 J;  1TNY A;  3NZU A;  2M63 A;  4HRN A;  2OOE A;  2WM9 A;  3DRA A;  2VJ8 A;  2WPV A;  1TNB A;  3ASD A;  4EEC A;  1NZN A;  2MYO A;  4G11 A;  4D10 C;  4HQD A;  3UT4 A;  3JQ0 A;  4JZY A;  1H0A A;  1H6O A;  4GTO A;  3Q73 A;  2Q7F A;  4HOR A;  3HXC A;  2GRL A;  4O60 A;  3FU0 A;  4BTB A;  1LD8 A;  4ILH B;  4U8V D;  3MV2 B;  3PZ3 A;  2LNI A;  4UWL A;  4AXH A;  4DX2 A;  1E7U A;  3FY4 A;  4KVM A;  3ZHE B;  3LY9 A;  1ZBP A;  2PNN A;  1DCE A;  4HOU A;  3PZD A;  3CHR A;  2OV8 A;  4GYW A;  3ESK A;  1LTX A;  1DC2 A;  2WXQ A;  5EDS A;  3HXD A;  1ELW A;  2KCV A;  2QZA A;  3R9M A;  3WXX A;  3PRE A;  3SHF A;  2PL2 A;  3CQG B;  4I1M A;  5JJ6 A;  4CT4 A;  3UKR G;  4AP2 A;  4CT0 A;  3FEX A;  2I1J A;  2WXI A;  4R7L A;  4BES A;  3EHQ A;  4RG9 A;  3SBS A;  4AEZ C;  3GZ2 A;  2NSZ A;  3CVW A;  1E7V A;  2WQ7 A;  3RU0 A;  4XZ4 A;  3VLF A;  3AG4 E;  2NXP A;  1FPP A;  5LCW C;  2J49 A;  3JXJ A;  4KYO B;  3EU9 A;  1FVF A;  2BED A;  3SQV A;  4N3B A;  3BG0 B;  4XE0 A;  3VTY A;  4AIF A;  4K0R A;  4PH4 B;  2WXR A;  4GTP A;  2I1K A;  3D9I A;  1P5Q A;  5EX0 A;  2FO7 A;  3JUI A;  3SFZ A;  1Z3X A;  3FUN A;  2H6G A;  4U7E B;  4XI9 A;  2QYU A;  3ZXS A;  2EIL E;  3QAQ A;  1UN9 A;  3TWQ A;  4I9E A;  2PM7 A;  4H7X A;  3AU4 A;  2L0T B;  3V30 A;  2B0O E;  4XIF A;  2FO1 E;  2XRY A;  2F8Y A;  2OVF A;  3EIJ A;  2I9C A;  4RQI A;  3ULE G;  4F1S A;  4KMO A;  4OAU C;  1TJC A;  5KJK A;  5FQ6 A;  3MJW A;  2H6I A;  2CG2 A;  4KZC A;  3QC1 A;  3JXI A;  4JD2 G;  4LSZ E;  1YCS B;  3CKB A;  4XX5 A;  3ABK E;  2KZT A;  4M3O A;  3L17 A;  3HYM B;  1E90 A;  4N3C A;  1FT1 A;  3RRN B;  3DSS A;  4F53 A;  4GZ6 A;  5EN5 D;  4CDM A;  5KJN A;  4UI9 C;  2RFM A;  4P29 A;  3L16 A;  5AAO A;  4CDN A;  3FU5 A;  3EHR A;  3ZYL A;  1Z3Y A;  2JEK A;  4I1A A;  4ANV A;  4JXT A;  4JB8 P;  3LXU X;  4EQF A;  2P9K G;  4GTQ A;  3UX4 A;  1IYG A;  5ENP D;  4FJY A;  4J8S A;  2L6B A;  5JHA A;  1NFI E;  4JHJ A;  4G8K A;  1S63 A;  5AQA A;  2MHK A;  3TJP A;  1K3Z D;  5JMN D;  3L08 A;  5BPP A;  2UY1 B;  4NIK A;  2R05 A;  3R9A B;  3CVP A;  1E8X A;  2LXL A;  4OYS A;  3G2S A;  3UTM A;  4HNA D;  1O1S A;  2F37 A;  2R59 A;  3UIO C;  2WXG A;  3W9G A;  1XGW A;  3B7U X;  3BEE A;  5M72 A;  4JW1 A;  2VQ2 A;  2KCK A;  3EHN A;  3Q9N C;  2ZIR A;  4YDW A;  1WG0 A;  3LCA A;  5LCW J;  2E2E A;  3JYS A;  5HRY A;  3VTX A;  2AXZ A;  3PE4 A;  3C3O A;  2Y3A A;  2IU1 A;  2AXU A;  4DUI A;  3PRZ A;  5CED B;  2C0L A;  5FQ8 A;  4WUY A;  3SF4 A;  1HX8 A;  3DWL G;  1QBQ A;  3ONL A;  4JHR A;  4CGV A;  4K03 A;  5LP0 A;  5FZR A;  1H19 A;  5ENO D;  4Z68 A;  1QNF A;  4FHJ A;  3SI5 A;  5JA4 D;  3O4Z A;  3CK9 A;  3ASH A;  4JEU A;  5EIB E;  1MQS A;  3IV0 A;  4GCN A;  1SZA A;  4DX7 D;  3FTX A;  1HS6 A;  2V5F A;  2AW6 A;  3UI2 A;  2X6J A;  4DRX E;  2BF0 X;  1EPU A;  3U64 A;  3LY8 A;  2CHZ A;  2V8S E;  4GCO A;  1MYO A;  3QOU A;  4F1P A;  2R5S A;  1IQU A;  3FH7 A;  2Y1L E;  1E8W A;  3IEG A;  1V55 E;  5FIO A;  4HOQ A;  1HZ4 A;  5ANR A;  5ENT D;  2KBX A;  3PUK A;  3ZEF A;  4F3V A; 
#chains in the Genus database with same CATH homology
 3D9J A;  3FU6 A;  5ANL A;  2C0M A;  2WQ6 A;  3GW4 A;  1QZ2 A;  3JQ1 A;  4GZ3 A;  4XKB A;  4ME2 A;  1HU3 A;  2IOS A;  4DI3 A;  5ARF A;  4L7T A;  4HFG A;  4AY5 A;  3B7R L;  1WY6 A;  3RRU A;  4UWK A;  2PM6 A;  3DBS A;  2X3M A;  3URZ A;  2WXK A;  2FUL A;  4PS3 A;  2PQR A;  4N2Q A;  1HE8 A;  4WWN A;  3G2T A;  5AIJ A;  4IN3 B;  4KXK B;  3SGH A;  4DK5 A;  5G04 C;  1OWM A;  5BNW A;  2LSU A;  4BY6 A;  2KAT A;  3HHM A;  1GW6 A;  3B7T A;  3K9I A;  4J6I A;  3EHM A;  3CIA A;  5D0O D;  3SNX A;  3ZGQ A;  2X6H A;  4BT9 A;  2WMO A;  4FAD A;  2CHW A;  2VTB A;  3B7S A;  3CK7 A;  1HG2 A;  4KT6 B;  4FUL A;  2P58 C;  4GB9 A;  1Y8M A;  4FLB A;  4UI9 K;  2R17 C;  3ESL A;  1U3D A;  4XKC A;  5KJM A;  1EF1 C;  2HO1 A;  3LDZ A;  3CVY A;  3HDX A;  4WWO A;  2XQ0 A;  5KCM A;  2PZI A;  5AEN A;  4BX8 A;  2VSX E;  3VLD A;  4B94 A;  3MEK A;  3OXG A;  1OUV A;  1OWN A;  4G2V A;  3RO3 A;  3MYV A;  4YVQ C;  4APO A;  5FZQ A;  1SQM A;  3B13 A;  2J9Q A;  3VLE A;  3IBE A;  3FTY A;  1UW4 B;  3ZYQ A;  5CCL A;  3S7D A;  5KJL A;  3G2U A;  4I43 A;  3CVL A;  5G04 J;  5G55 A;  2LO6 A;  4WAF A;  3UT8 A;  3MKR A;  3NZU A;  1BPO A;  4LRZ A;  4TRQ A;  4BSX A;  4C0M A;  2M63 A;  4CEM A;  2OOE A;  2WM9 A;  5HI7 A;  4HLE A;  5EX3 A;  3ZFW A;  5BW8 C;  2VJ8 A;  1HF8 A;  3LKU A;  2WPV A;  3GZ1 A;  3ASD A;  3U9W A;  2CFU A;  5BT1 A;  5BV0 A;  4GAA A;  1JWG A;  3PNT B;  4I2Z A;  4EEC A;  4APF A;  4EBA A;  1NZN A;  4TV3 A;  4G11 A;  4A1G A;  3ZVV A;  4D10 C;  5LX8 A;  3ENE A;  3BG1 B;  3FFL A;  5E76 A;  3UT4 A;  4ATG A;  3FUK A;  1W3B A;  3JQ0 A;  4JZY A;  1IHG A;  1H0A A;  3T8M A;  4AVX A;  5G05 C;  3SBT B;  1IQR A;  1H2V C;  3CVX A;  4HOR A;  2Q7F A;  3IHY A;  2ZU6 B;  4NRH B;  3L6A A;  4FP7 A;  2GRL A;  4C9B B;  3FU0 A;  4BTB A;  5T3R A;  2XCC A;  4UWG A;  4ILH B;  3ZN3 A;  2L6J A;  3MV2 B;  4AXH A;  2LNI A;  4UWL A;  2AXV A;  4GMJ A;  3Q47 B;  1E7U A;  3FY4 A;  2XCB A;  3QJZ A;  1DNP A;  4KVM A;  4UQZ A;  3P2B A;  3ZHE B;  3LY9 A;  3NQP A;  2GW1 A;  3MZL B;  1WM5 A;  1ZBP A;  4HS2 A;  3D9K A;  4G1T A;  4HOU A;  3CHP A;  3PZD A;  3CHR A;  3N71 A;  2OV8 A;  3CEQ A;  3ASG A;  1B89 A;  4GYO A;  3CVU A;  4GYW A;  3ESK A;  1OWO A;  4G25 A;  2X6I A;  2V0P A;  2WXQ A;  3I5P A;  1U3C A;  5EDS A;  1ELW A;  2OND A;  3FUM A;  1HFA A;  2KCV A;  5G05 J;  3WXX A;  2FF4 A;  2IJG X;  3PRE A;  3SZ7 A;  5CHE E;  2YIN A;  5T8I A;  3SHF A;  2PL2 A;  5C1D A;  1Z6T A;  1JPL A;  4YND A;  3CQG B;  4CRW A;  4CCA A;  3PE3 A;  3ZYM A;  3PVL A;  1TJF A;  3CR3 A;  3LPZ A;  4I1M A;  3C98 A;  4QFV A;  5JJ6 A;  3T5V A;  4JL0 A;  5FQ4 A;  4CT4 A;  2MRI A;  4AP2 A;  4IYP A;  2VGX A;  4G26 A;  4NQ0 A;  2LSV A;  4AY6 A;  4I6J A;  5A7D B;  4CT0 A;  3FEX A;  1ELR A;  4ACL A;  4DLQ A;  4I2W A;  2I1J A;  4ILG A;  3AS8 A;  4LEU A;  4E85 A;  2WXI A;  3D9O A;  4R7L A;  4GA2 A;  4RG9 A;  3SBS A;  4I9C A;  4J8E A;  4L23 A;  3NF1 A;  1Y6I A;  3LVR E;  3QAR A;  4ILI A;  4KZ0 A;  4UWF A;  5E75 A;  3GZ2 A;  2NSZ A;  4AEZ C;  3O48 A;  3CVW A;  3FTU A;  1E7V A;  3LJ3 A;  4I17 A;  5T4Y A;  4DJA A;  3CQC B;  4GZC A;  2VSO E;  2WQ7 A;  4ABN A;  3RU0 A;  1ELK A;  1S0P A;  2KM4 A;  4UQY A;  5DBK A;  3QWW A;  4W9R A;  4XZ4 A;  3ZIM A;  3VLF A;  2DCP A;  4EZK A;  4JEH A;  1ZU2 A;  2NXP A;  4MRU A;  5LCW C;  2YNQ A;  3CHM A;  4FC8 A;  4GA1 A;  2J49 A;  3JCK C;  4IRU A;  2UWJ G;  4KYO B;  4Q94 A;  1FVF A;  5LOZ A;  4CGW A;  2AVP A;  1N52 A;  3KAE A;  4L2L A;  3ZHE A;  2XGS A;  4JHK A;  2J07 A;  3EIQ C;  4N3B A;  3BG0 B;  2OVB A;  4XE0 A;  3VTY A;  4AIF A;  3L22 A;  4A3T A;  4K0R A;  3LY7 A;  4PH4 B;  4O6F A;  2WXR A;  2KC7 A;  2I1K A;  3D9I A;  5FQ7 A;  2I2O A;  2J4D A;  3ULQ A;  5J90 A;  3GZS A;  1P5Q A;  2WXO A;  2KZT B;  3MV3 B;  5G2N A;  3TG4 A;  5EX0 A;  4B8A A;  3RJV A;  2FO7 A;  4ANW A;  4FA6 A;  3JUI A;  2EQX A;  2WXL A;  3SFZ A;  2IOL A;  2WVI A;  1Z3X A;  1PY1 A;  1E8Y A;  3MKQ B;  3FUN A;  3Q15 A;  2CFZ A;  1DVP A;  5AJL A;  3U66 A;  3QK0 A;  4G24 A;  3G2V A;  3UMV A;  4XI9 A;  1INZ A;  3FUD A;  5FT9 A;  3ZXS A;  4LUN U;  3ML8 A;  3RO2 A;  3UT7 A;  3QAQ A;  3E4B A;  4L1B A;  3CVN A;  3RK6 A;  1UN9 A;  2L0I A;  3FU3 A;  4HOT A;  4OVU A;  4WNG A;  4I9E A;  2PM7 A;  4UWH A;  4H7X A;  4EPZ A;  3AU4 A;  4WWP A;  3LYA A;  4U63 A;  2V4L A;  2L0T B;  4GZD A;  4XIF A;  3FH5 A;  2XRY A;  5LFA A;  2WXN A;  2OVF A;  4LCT A;  4GML A;  3EIJ A;  2WB2 A;  1VDY A;  3D9M A;  2VGX B;  4Y6W A;  2VSY A;  3I4G A;  5AJD A;  3FUE A;  3Q49 B;  3FTZ A;  3R7Q A;  4URK A;  2GRM A;  2I9C A;  3FUH A;  4F1S A;  4XI0 A;  3HVE A;  4KMO A;  3CHS A;  4BFR A;  1TJC A;  4I1O B;  4EBA G;  1LF8 A;  2E0I A;  2Y4T A;  5KJK A;  2ILR A;  5FQ6 A;  2XPZ A;  3CST A;  3LEW A;  3CVV A;  3MJW A;  1FVH A;  3FP3 A;  4FJZ A;  3OXF A;  3S7F A;  2VTB B;  4NAC A;  4UI9 J;  2CG2 A;  4KZC A;  3S2A A;  3QC1 A;  4RVB A;  3EJN A;  3FUL A;  2I6H A;  3EDT B;  3LS8 A;  3CKB A;  4XX5 A;  3KD7 A;  3FH8 A;  4BX9 A;  3D9N A;  2BTD A;  4A55 A;  5A23 A;  2KZT A;  3S7B A;  3PNL B;  4M3O A;  3L17 A;  3HYM B;  3UQ3 A;  5CMW A;  1E90 A;  4N3C A;  1X5B A;  4YVO A;  3Q5M A;  4JC8 A;  3SD5 A;  3RRN B;  3TGO A;  4HXI A;  2UY1 A;  1E8Z A;  1PC2 A;  2NC9 A;  3L13 A;  4I6G A;  4N5C A;  1EYH A;  5FZS A;  1EDU A;  4Q96 A;  3ZPJ A;  4F53 A;  4WND A;  4GZ6 A;  3TG5 A;  3UUX A;  4CDM A;  5KJN A;  2CHX A;  3PDN A;  2IF4 A;  4UI9 C;  2JLB A;  1UJK A;  1H6K A;  2BUG A;  4J8F A;  4PS8 A;  2XPI A;  2J08 A;  4U07 A;  4P29 A;  4Y6C A;  1TEZ A;  5FWQ A;  1KT0 A;  3L16 A;  2HYZ A;  4H7Y A;  5A6C A;  3QWP A;  4J8D A;  2XEV A;  3FHE A;  3QDN A;  3ZRH A;  4CDN A;  4JA7 A;  5HQ8 A;  3LVQ E;  3FU5 A;  2RG8 A;  4FU3 A;  4J0U A;  3ONK A;  5ENN A;  2A4Z A;  3D9L A;  3ZYL A;  2WMN A;  1Z3Y A;  5CMY A;  3G2W A;  2JEK A;  3CKC A;  4I1A A;  2J09 A;  4ANV A;  3PEU B;  4JXT A;  3MKQ A;  1JUQ A;  3MCX A;  2FBN A;  3LXU X;  4EQF A;  3I4R B;  2HR2 A;  4U0S A;  3HVE B;  2IFU A;  3HIZ A;  2DIW A;  3UX4 A;  1IYG A;  4FJY A;  3QWV A;  4J8S A;  3OTN A;  4BWR A;  4U04 A;  5JHA A;  3U3W A;  3AS5 A;  3FUJ A;  4HVB A;  3S7J A;  2CG3 A;  4NUR A;  2FI7 A;  4JHJ A;  3TXM A;  4G23 A;  2VSN A;  4E6H A;  3RRM B;  2WXM A;  3ML9 A;  4L2Y A;  2ION A;  3RKV A;  1FCH A;  2MHK A;  3CV0 A;  1HG5 A;  3TAX A;  3CSF A;  3TJP A;  4U0U A;  2PQN A;  3L08 A;  5JJ7 A;  3AU5 A;  3P1U A;  4I6E A;  2VYI A;  2YHC A;  3APF A;  3FTW A;  5BPP A;  2LAH A;  2UY1 B;  4IUL A;  4GU5 A;  2AWI A;  4PDX A;  3QNK A;  3R9A B;  2J4B A;  3TL5 A;  1UN8 A;  3NZS A;  3DPD A;  4Q69 A;  2IQC A;  3FTS A;  3FWV A;  2WXJ A;  3CVP A;  4CDR A;  3QKY A;  1E8X A;  1UJJ A;  4DPR A;  4OYS A;  3G2S A;  4ACK A;  5AYW D;  4AV7 A;  4GZ5 A;  2FEZ A;  2R59 A;  2WXG A;  3FDH A;  4C0E A;  4LER A;  4U0Z A;  1H2T C;  3KEZ A;  5FTP A;  1XGW A;  2LAI A;  4JPS A;  3B7U X;  3BEE A;  3PH0 C;  2QFC A;  5JHB A;  5M72 A;  1NA3 A;  2VQ2 A;  2KCK A;  4JW1 A;  3EHN A;  1YA0 A;  2Y4U A;  5BV1 A;  2X6F A;  4UQX A;  1NA0 A;  2X6K A;  2C2L A;  3LCA A;  3CHQ A;  4PUC A;  4N2S A;  3Q4A B;  4A3V A;  1JWF A;  3IHV A;  5LCW J;  4N39 A;  2E2E A;  5BUZ A;  3JYS A;  3PS6 A;  3VTX A;  1E96 B;  2AXZ A;  3CGH A;  3UPV A;  3PE4 A;  4JVS A;  2Y3A A;  3TXN A;  1WAO 1;  2IU1 A;  2DBA A;  2XPY A;  2AXU A;  4B8C B;  5C2Y A;  3PRZ A;  1H2U A;  4V3I A;  2C0L A;  4B0Z A;  3AS4 A;  2XGO A;  5FQ8 A;  5CCM A;  3CK8 A;  5D0Q D;  3CLJ A;  4KVO A;  3APC A;  4WUY A;  2YQ8 A;  3SF4 A;  2XHE A;  4A1S A;  1HX8 A;  1A17 A;  2A5U A;  3ONL A;  4JA9 A;  4PS7 A;  4BT8 A;  2XRZ A;  2KCL A;  4JHR A;  4CGV A;  3T5X A;  4K03 A;  3RIB A;  1L5J A;  3FUF A;  3L54 A;  5J08 A;  3ZW3 A;  2L9B A;  2QY7 A;  2WQH A;  3PEV B;  4RG6 A;  3R7R A;  5FZR A;  5LP0 A;  1H19 A;  4TUU A;  4WNF A;  4EZL A;  4AJW A;  3GYZ A;  4BTA A;  4AOF A;  5ARG A;  4DLO A;  1QNF A;  4FHJ A;  1PAQ A;  3SI5 A;  4AM9 A;  1HO8 A;  4MKT A;  2WXF A;  4RSY A;  3O4Z A;  4GPK A;  3CK9 A;  3ASH A;  4JEU A;  4ANX A;  4HOS A;  4GYY A;  2VGY A;  1MQS A;  3IV0 A;  1MHQ A;  1N54 A;  1SZA A;  3CVQ A;  3OAW A;  4GCN A;  3QB2 A;  2X38 A;  1NP7 A;  1OWL A;  3FTX A;  1QQE A;  3I3N A;  1OWP A;  1HS6 A;  3ZYK A;  2V5F A;  4KBQ A;  2AW6 A;  4OVV A;  2X6J A;  3CHO A;  3KS2 A;  3FUI A;  3FTV A;  3IKO B;  2YHE A;  2BF0 X;  2XGM A;  1EPU A;  2GGF A;  5DIZ A;  3U64 A;  3ASF A;  5JJT A;  3OXL A;  3LY8 A;  1KT1 A;  3D3M A;  2CHZ A;  3D9P A;  2V8S E;  4GA0 A;  4GCO A;  1HXI A;  1UG3 A;  3MGB A;  4EZJ A;  3QOU A;  1XNF A;  2R5S A;  1IQU A;  3FH7 A;  4N3A A;  5EKQ D;  3APD A;  4ANU A;  1E8W A;  5FJY A;  4U8H A;  2MOW A;  3FEY A;  3MX3 A;  3IEG A;  1HH8 A;  2HM8 A;  2WXH A;  4HOQ A;  1HZ4 A;  3MA5 A;  2WXP A;  3PUJ A;  4FLH A;  5ANR A;  4FHK A;  4F7A A;  1KLX A;  2RD0 A;  4MLP A;  4WNE A;  3U4T A;  3PUK A;  4DI4 A;  3ZEF A;  4MS6 A;  4B89 A;  4F3V A;  1SZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...