3SNXA

Crystal structure of a putative susd-like carbohydrate binding protein (bt_1439) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
455
structure length
455
Chain Sequence
b'QVAVAGNAERLFNGAWYNLFEYGTTYANIGYRALQCQDDMMASDVVSRPKYGFNSSYQFNDVAIPSDGRTSFAWYLIYKTIDNCNTAISIKGDSEELRQAQGQALALRAFCYLHLVQHYQFTYLKDKDAPCVPIYTEPTTSGTKPKGKSTVAQVYQQIFDDLNLAQDYLTNYVRKGDGQKFKPNTDVVNGLMARAYLLTGQWGEAAKAAEAARKGYSLMTTTAEYEGFNNISNKEWIWGSPQTLSQSDASYNFYYLDATYVGAYSSFMADPHLMDTFVKGDIRLPLFQWMREGYLGYKKFHMRSDDTADLVLMRSAEMYLIEAEAKVRDGVALDQAVAPLNTLRTARGVGNYDVTGKTKEQVIDEILMERRRELWGEGFGITDVLRNQKAVERMALSEDMQKTEVDCWQEGGSFAKRNPLGHWFLNFPDGKAFSANSSYYLYAIPEKEINANPNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN
publication title Crystal structure of a PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN (BT_1439) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.88 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 165
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3snxA00
3SNXA 5FQ6A 3CK7A 3FDHA 3SGHA 5FQ4A 3I4GA 3JQ0A 3CKBA 3NQPA 5J90A 3L22A 3IV0A 3EHNA 3OTNA 5FQ7A 3GZSA 3KEZA 5T3RA 3P1UA 4Q69A 5E76A 3CK8A 5LX8A 3EHMA 3CK9A 3JYSA 3HDXA 5FQ8A 3CGHA 3MCXA 4LERA 5T4YA 3QNKA 3MYVA 4MRUA 4F7AA 3MX3A 4PUCA 4F53A 3LEWA 5E75A 4L7TA 3EJNA 3JQ1A 3CKCA
chains in the Genus database with same CATH superfamily
4EQFA 4PS3A 4N2SA 2R02A 3QC1A 2BTDA 1E8WA 1BLXB 4RQIA 4U0SA 2L6JA 5HS0A 4H7XA 2PQNA 2WXNA 4AM9A 3O4ZA 3G2TA 1IXVA 4M3OA 3AS4A 3LXUX 2CHWA 3UM0A 3X2QE 4C48B 5HI7A 2KCLA 5ENSD 2GRPB 1HO8A 4YNDA 3UPVA 3KEZA 4L23A 2LNIA 3HXBA 2VTBB 5KNGA 3CGHA 3CVPA 3TXMA 2L9BA 5JHAA 5J08A 1EPUA 2CFZA 4ILGA 4XEIG 4J8EA 4FULA 3G2UA 3DSWA 5E76A 1U3DA 2BF0X 4I17A 2KM4A 5AN8A 3UT8A 1JWGA 4WNFA 3C3OA 4F1SA 4NRHB 4O6FA 3L13A 3ZRHA 3APCA 3SO8A 3MEKA 4J8DA 4ZFHA 4JEUA 4W9RA 2GW1A 4JZYA 1INZA 3PZ3A 1S64A 3PNLB 4C9BB 3E30A 5CERB 4GMJA 2NC9A 1N0RA 3FUHA 2XEHA 2P9KG 1ZU2A 3ASNE 4TV3A 3B7BA 4Y6CA 1N95A 3I3NA 2CFUA 5CBOA 4I2ZA 4F6RD 3F6QA 3NF1A 5AQAA 3ZXSA 1QBQA 4DX1A 4YDWA 3ZYMA 4WNDA 2LSUA 4CDMA 1NP7A 5G04C 5JJ6A 3K9IA 4XZ4A 3CHQA 3SZ7A 3LVQE 5FQ6A 1NFIE 1TJFA 3C3RA 5G04J 2LAHA 4FLHA 4BERA 2AW6A 2IONA 3CV0A 3L16A 5CRVA 3PS6A 4B8CB 4F1PA 1TR4A 4GA2A 3MGBA 3TWSA 2IU1A 5KJNA 5B1BE 3S7JA 4PDXA 3L08A 4U63A 1BD8A 4GZ5A 4GPKA 4OAUC 4AIFA 1KZPA 2VJ8A 1OXJA 5HQ8A 3D9HA 3CHPA 4U0UA 2UY1B 5JA4D 1IKND 1YMPA 3FTVA 3V2XA 4UQZA 1N4PA 4U8VD 2OV8A 3FTYA 4APOA 3ASHA 4G1TA 3ASFA 4J8SA 1ELWA 4ANWA 3ASDA 2LSVA 2L0IA 5FWQA 3LKUA 3MYVA 2GROB 5ENOD 2LXLA 4I1OB 1N11A 2X6IA 3SQVA 1GW6A 4R7LA 5C2YA 3TWXA 2DIWA 5KBAA 3Q9NC 1EDUA 4GPMA 3LPZA 3D3MA 3HDXA 2WXHA 3SBSA 1N4SA 4NACA 4APFA 1N0QA 3P2BA 1K1AA 4EHMA 4GA1A 5JJ7A 3KS2A 4GTPA 1YA0A 1QNFA 4I6EA 3TWRA 2R59A 1OUVA 3FH8A 3FUFA 2VTBA 1UW4B 1ZB1A 4HBDA 3JQ0A 1O1TA 4ACLA 2V5FA 4NIKA 5D66A 2WB2A 4G11A 3UI2A 1OWPA 1JWFA 2L0TB 4GMRA 4L9PA 2WM9A 4N2QA 3DPYA 3UQ3A 2HYZA 3CEQA 1H6OA 4JA9A 3HG0D 4A55A 3FEXA 4CGWA 2B6CA 4JVSA 5EKQD 3ABLE 3UINC 3FUNA 2BEDA 3B7UX 2A5EA 3HYMB 3NAWA 4HVBA 4RSYA 3Q15A 2P9UG 4CRWA 5KCMA 4J0UA 3G2WA 3EHNA 4J6IA 1QZ2A 3ZYKA 2DYSE 1NA0A 3L82A 4B8AA 3UM2A 4QQIA 1MHQA 3IEGA 3ML9A 4XI0A 1DCEA 2WXKA 3BU8A 3OXGA 3V31A 1O1SA 5AARA 4FU3A 3FU5A 5BV0A 4KVOA 1OCOE 1Z6TA 3TGOA 2NYJA 4HRMB 2KC7A 4G24A 4TXPA 5ARFA 4UI9C 5B3SE 4LG6A 3E33A 3JQ1A 5HKPA 3T5VA 4GCOA 4GYOA 4UQXA 2DCPA 2H6HA 3OXLA 3ULQA 2ZIRA 5BXOA 1S63A 5CEDB 1WAO1 4UI9J 2RFAA 1JPLA 1K1BA 1IQUA 2UWJG 3CVVA 2ZXWE 4MBGA 3HXEA 3LS8A 3EU9A 5CMWA 2V0PA 1H6PA 2DVWA 4G23A 3SNXA 2C0LA 3E32A 4MLPA 4PS7A 3SBTB 3PE3A 4KYOB 1Z3XA 3B7RL 3EHMA 1FCHA 5C1DA 3C98A 4U04A 1OCZE 3NZSA 5ANLA 4YDEA 1B89A 4IULA 3CLJA 3QOUA 3NQPA 1E7VA 4KBQA 1A5EA 2OEWA 3DWLG 3CVYA 2XENA 2ONDA 2LAIA 3UKRG 1N9AA 3HIZA 3URZA 2YHEA 1OCRE 3CVNA 3V2OA 1SA5A 3DXMG 3V30A 2AJAA 1UN9A 2ZU6B 5JJTA 3PEUB 1Y6IA 4KMOA 3FTZA 1HX8A 2A5UA 4J8YA 4AVXA 5CMYA 4AV7A 4KT6B 2ZISA 3B13A 3AS5A 4OVVA 4JHKA 4F3VA 2VSXE 3LYAA 4CYMD 1HU3A 4GMLA 3ONLA 3U4TA 1Q2ZA 2FF4A 3FULA 1BPOA 3LCAA 1DCQA 2GRRB 4XKBA 1A17A 1SZAA 1FT2A 4GYYA 2Y4TA 5AJDA 2ZGDA 4BT9A 4QFVA 2XCBA 3E37A 4EPZA 2QFCA 1D9SA 4CT4A 3VTXA 2ETCA 3QKYA 5D0OD 4HI9A 3PZ4A 3ABKE 4AEZC 1KLXA 3U9WA 3ESLA 2CHZA 4LRZA 5A23A 4N3CA 3PDNA 4JHJA 4NURA 3HRAA 2J9QA 5EX3A 4F7AA 3PVLA 2WMNA 4HXIA 4BSZB 3Q49B 2P58C 1G3NB 1H19A 5J90A 3U64A 3OTNA 4GZ3A 2MOWA 2B0OE 1Y8MA 2AXUA 1L5JA 4WNGA 2XEEA 2WXRA 3APDA 4BTBA 3PUJA 3AG3E 2ETBA 3LY7A 4WWOA 4BEPA 1X5BA 2R17C 2OVFA 4UUCA 2DWZA 4DX5D 3FTSA 2L6BA 5LP0A 3D9NA 2J8SD 4RLYA 1WG0A 4PH4B 4HOSA 5EN5D 2H6IA 3Q9UC 2J4BA 2PL2A 3FU0A 3ZYLA 3QWPA 4U0ZA 3PNTB 3DRAA 3HXCA 2GRQB 5LX8A 4GB9A 5AJLA 2BKGA 2AXVA 2VYIA 2I1JA 2PM6A 2J09A 1XNFA 2X6KA 1OY3D 3ULEG 1PY1A 2ZGGA 3JCKC 2I6HA 2WPVA 4L2LA 2A4ZA 3W9FA 1OWOA 4G8KA 3C3QA 2DYRE 3ISMC 5BPPA 4ILIA 1TEZA 4A63B 2WQHA 3CHMA 4KZCA 1YCSB 3VTYA 2AXZA 4EBAG 5FJYA 4CDNA 4WNEA 1IQRA 3TWWA 4AOFA 3GZ1A 4HLEA 2JEKA 2GRNB 4JEHA 5KJLA 1NL4A 3ZFWA 3SF4A 3BQOA 3B7SA 3FUJA 3Q75A 4OYSA 5E75A 2EQXA 3T8KA 3J5QB 2WXPA 4B93B 3J5PA 4O60A 4O1OA 3BG1B 3RAUA 3D9OA 4GAAA 4U8YD 4GTVA 2P2CP 1LD7A 1KZOA 3DPDA 3EDTB 4JW1A 4B0ZA 2F0YA 3EJNA 4KVMA 1AWCB 3PH0C 4N5QA 2DBAA 3AU5A 2I9CA 4LSZE 3UT4A 3CQCB 3DSSA 5AQ9A 4U7EB 3PRZA 1D8EA 2YINA 3MJWA 3TG4A 1LF8A 4XE0A 4N3AA 2Y0BG 3IHVA 1QQEA 2PM7A 3B95A 3ML8A 4UWHA 3AG1E 1Z3YA 3Q79A 4JB8P 3S7BA 2Y3AA 4CDRA 3CIAA 3MX3A 5BUZA 3DSTA 1U3CA 3HXFA 3SI5A 2JABA 2VGXB 2EIJE 3QAQA 3JUEA 3NB2A 4HI8A 2BKKB 5BT1A 2WQ6A 1S0PA 2X6FA 1HZ4A 1RZ4A 3ESKA 3FTUA 2E0IA 5FQ8A 1HE8A 3EHQA 3E34A 3UT7A 4HOTA 3ZVVA 2AVPA 5KJMA 4Q69A 3TL5A 1XGWA 2WVIA 1PC2A 3Q73A 3FY4A 1UG3A 1TN8A 2XCCA 2I1KA 5KJKA 2IFUA 5CCLA 3ABME 2P9PG 2WMOA 2HE0A 4LNUD 4J8FA 1TNBA 3SY2A 2HM8A 1TNOA 5A7DB 2XZTG 2GGFA 4DK5A 2VQ2A 3ZUVB 3APFA 4LERA 4TXQA 1H2TC 1V54E 5AQ7A 3ZIMA 2VSNA 3SFZA 3KAEA 3UKUG 4HQDA 4ME2A 3HXDA 1UJKA 2OCCE 4DUIA 4ATZD 2WXGA 3RJVA 4GZCA 3HHMA 5LCWC 3DXKG 3UIPC 3CK8A 2DZNA 3D9LA 3NOCD 2AWIA 1V55E 2KATA 3Q5MA 3CVXA 1EYHA 2BUGA 4K03A 3VLEA 3FHEA 3SFYA 1LTXA 4N5CA 5G2NA 3Q7AA 3JXJA 4TRQA 1NZNA 2JLBA 2Q7FA 3DEPA 2WXQA 3LJ3A 1OWNA 3LJNA 3TXNA 2RKKA 5IY5E 3L22A 5ARGA 2XS8A 4TXRA 2X6JA 3G2SA 2XS1A 4I6GA 3MV3B 4I9CA 1NI1A 2GRLA 1JCSA 4HB5A 2KZTB 4RG6A 1DVPA 2I2OA 4Y6WA 2V4HC 2MYOA 3RRUA 4GTOA 3EIJA 4IN3B 4HOUA 5H7PA 4G2VA 5ENQD 3UTMA 5HRYA 1TNZA 2VSYA 2DZOA 5FINA 3S7FA 3FUDA 2V8SE 4WUYA 4L7TA 5ENNA 2M63A 1TN6A 3RRNB 4OVUA 4DX6D 4V3IA 2YHCA 5BXUA 1WM5A 3CSTA 2KCVA 1N52A 4BSXA 2LUHA 3QARA 3VLFA 5ENRD 3SGHA 1H6KA 3EUVA 4I43A 4GU5A 1QYMA 2VGEA 1H2VC 4HOQA 4C0MA 2EIKE 2QY7A 4WWNA 3KD7A 1IHBA 2VGXA 1HG5A 4GTSA 3TJPA 3Q47B 3UXGA 2FO1E 5D0QD 3FU3A 2EILE 3QB2A 2IF4A 4JPSA 4WWPA 1JCQA 4A3TA 5EYPF 2XPIA 3PEVB 4A1SA 4Z68A 2XGSA 1WY6A 4AXHA 5BNWA 3IXEA 1MX4A 3B7TA 3R7RA 5CCMA 5KNHD 1P5QA 2R05A 1MJ0A 3JYSA 5B1AE 2XQ0A 4GZDA 2CG2A 3HVEA 3Q78A 3FUKA 3L6AA 3ZHEA 2VSOE 2X38A 2FI7A 2Y4UA 2F8XK 2IQCA 3LY9A 2EINE 3MKQB 4IRUA 3CK9A 5BW8C 4LEUA 1TNUA 3CHRA 2IO2C 2F37A 5T8IA 4D10C 2IJGX 3R7QA 2PQRA 3O48A 3AJIA 3CVUA 5FZRA 3CVQA 2V5QC 4BX9A 3IBEA 4YDYA 4LNBA 2FO7A 3PREA 4DX2A 4HFGA 3S7DA 4ANVA 3BG0B 2J08A 5ENPD 4H7YA 3PZ2A 3C72A 3UIOC 2WXFA 3MCXA 4URKA 4MKTA 2YQ8A 3RIBA 3ZPJA 3NZUA 4MS6A 1ZBPA 4E6HA 2QYJA 4ATGA 2KZTA 3ZN3A 2MHKA 3FU6A 3P1UA 3RU0A 3ENEA 4HNAD 3ZU7B 3D9IA 3WG7E 3L54A 4G26A 4B94A 4BTAA 4JD2G 2GRMA 3TWUA 2XGMA 2C0MA 4IYPA 4G25A 5BV1A 4ABNA 2H6FA 5EIBE 3AU4A 4ILHB 5G05C 1OT8A 5ANRA 1HG2A 2LXMA 3IHYA 3DSVA 4GCNA 1JCRA 5G05J 5FQ4A 1EF1C 3PZ1A 3GYZA 4JL0A 5AAOA 1X81A 1VDYA 2P9IG 3S2AA 3QWVA 5JMND 3UUXA 1FVHA 3JUIA 2P9NG 5AYWD 3CR3A 1FPPA 2EIME 3I4RB 4UQYA 3UM1A 1MX2A 4GTTA 3CHOA 3FEYA 3LY8A 2KBXA 1UOHA 3ZXPA 1OCCE 2J49A 2R2LA 3KSLA 2KXPC 1SQMA 2J07A 2Y1LE 1Z5SC 4EZLA 4UWGA 4LCTA 4P29A 1H2UA 3L9TA 4UI9K 3DSXA 3RRMB 1SA4A 2F8YA 1BI8B 3CVWA 3CSFA 3QJZA 4ACKA 3FDHA 4XKCA 4TUMA 3FWVA 4U8HA 4Q94A 4HLLA 3D9JA 3ZYQA 3FUEA 1ELRA 2IOSA 3JXIA 5JHBA 5CRUA 1JUQA 1E8ZA 3CQGB 1AP7A 3Q4AB 2IY0C 3MKQA 4BFRA 4F53A 2R5SA 3RSEG 2LO6A 3KEAA 4K0RA 4DLQA 2VGYA 3D9MA 1N54A 2NXPA 5KWDA 3U3WA 1DC2A 4K5CA 3E4BA 1N94A 4TUUA 1MQSA 1E7UA 3TG5A 3AS8A 1SW6A 1O5MA 1LD8A 4FHJA 1E96B 5CEAA 5FZQA 4I1MA 3AAAC 2OVBA 3FH5A 4AY5A 5EX0A 2QZAA 4U95D 2IO3C 3TAXA 2WXJA 4FP7A 4HRLA 2E2EA 3FUIA 2ETAA 3LVRE 3SFXA 4DI4A 2CHXA 5EYLA 4A1GA 2J4DA 5FTPA 4GTQA 3T9KA 3FP3A 3GZSA 4DJAA 3TWTA 1OWMA 2X6HA 5T4YA 3AG4E 2P9LG 2IEJA 4JXTA 1NA3A 4N3BA 3QWWA 3BUAA 3C5RA 4XI9A 3ZEFA 3W9GA 4BETA 2FBNA 3HVEB 1HS6A 3ZHEB 1K3ZD 4O1PA 4FLBA 3I5PA 1HF8A 2P9SG 4FHKA 2XEVA 2WXIA 1TNYA 4U96D 2FULA 5LOZA 3UM3A 3PUKA 4I6JA 4DLOA 1FVFA 3ZNGA 5M72A 1WDYA 2IOLA 1N4QA 1DNPA 3ULYA 3DBSA 3UX4A 1UJJA 3EHRA 1YYHA 1MX6A 5LCWJ 5DBKA 4GTRA 4EECA 4JC8A 3CKCA 5EDSA 2XHEA 2CG3A 4G8LA 3CKBA 4EZJA 1PAQA 2OEVA 4Q96A 5A6CA 1OWLA 4BESA 3MZLB 1TYQG 3DSUA 4AP2A 2PZIA 2MRIA 3CHSA 3SD5A 1IYGA 3WXXA 3RO3A 4UWKA 5D2MC 2WXOA 3ASOE 2HR2A 3MV2B 3GW4A 4FJZA 4LNGA 4I9EA 4L2YA 3UMVA 3U66A 1KT0A 2XPZA 3NOGD 4A3VA 3R9AB 4FJYA 4BWRA 1IHGA 3RKVA 5G55A 4YDOA 3DEOA 4DRXE 4OAVB 2KCKA 2Y69E 5ITZF 2RG8A 4HS2A 3FTWA 1HFAA 2XPYA 2PNNA 2QC9A 3ZKJA 2FEZA 4E85A 4RG9A 5FZSA 3QK0A 5AIJA 3OAWA 4EZKA 5CBNA 3NBNB 4LUNU 3TWQA 3ASGA 3D9PA 4WAFA 2C2LA 4KXKB 4MRUA 3D9KA 1SVXA 3AG2E 4PS8A 4CGVA 3IKOB 4N39A 4L1BA 3PZDA 3CVLA 4KZ0A 4RVBA 3I4GA 5EILA 4X8QA 3FFLA 1HH8A 5DIZA 4BX8A 4DI3A 1N4RA 3OXFA 4YVOA 3RK6A 1U2VG 2RFMA 3EIQC 3MKRA 4YVQC 3T8MA 4CEMA 5CECB 2WXLA 5AQBA 1E8XA 3LEWA 2RD0A 1S70B 2H6GA 2UY1A 3IV0A 4DX7D 3QDNA 1ELKA 5CHEE 4J7WA 1D8DA 3ZW3A 3RO2A 4CZ2D 1MZCA 4C0EA 3L17A 2ILRA 4GA0A 3GZ2A 4GYWA 1O1RA 3FH7A 1E8YA 3QNKA 4PUCA 1KT1A 1BU9A 1UN8A 4FADA 3CK7A 4AJWA 4GTMA 1RW2A 4XIFA 4JA7A 4I1AA 2NSZA 3LDZA 5EIDA 4UWFA 4CCAA 3Q7FA 3FTXA 4ZHBA 1W3BA 1TN7A 4UWLA 4FA6A 3ZGQA 5LFAA 4U07A 4HORA 4BY6A 4BT8A 5FQ7A 2XZDG 3TWVA 3G2VA 3EU5A 4CT0A 3R9MA 4NQ0A 2OOEA 2YNQA 2R03A 3KSQA 3N71A 2V4LA 4GZ6A 3SHFA 4JHRA 2XGOA 4M7CA 1K8KG 1BI7B 4EBAA 1SZ9A 2XRZA 2QYUA 1KPSB 2X3MA 4K5BA 2XRYA 4AY6A 4DPRA 1HXIA 3FUMA 2WXMA 5ENTD 3VLDA 2WQ7A 2HO1A 3PE4A 4XX5A 1E90A 5FT9A 5FIOA 3T5XA 1TJCA 1H0AA 4ANXA 3V79K 1MYOA 4HRNA 5T3RA 4B89A 1FT1A 3MA5A 4K5AB 5AENA 4ANUA 3BEEA 4FC8A 4I2WA 3ONKA
chains in the Genus database with same CATH topology
3CSFA 3NZSA 3QJZA 4ME2A 5ANLA 4PS3A 4EQFA 4ACKA 4N2SA 1UJKA 3FDHA 1B89A 3QC1A 4XKCA 2BTDA 4IULA 2WXGA 3CLJA 3QOUA 1E8WA 1E7VA 3FWVA 3NQPA 4GZCA 3HHMA 4KBQA 4U8HA 3RJVA 5LCWC 4Q94A 4U0SA 3CVYA 3D9JA 2L6JA 2ONDA 3CK8A 4H7XA 3ZYQA 2LAIA 1ELRA 2IOSA 3D9LA 3FUEA 2PQNA 2WXNA 4AM9A 5JHBA 3HIZA 2AWIA 3O4ZA 2YHEA 3URZA 3G2TA 1JUQA 4M3OA 1E8ZA 3AS4A 3CQGB 3LXUX 2CHWA 3CVNA 3Q4AB 4BFRA 3MKQA 4F53A 5HI7A 2KATA 2KCLA 2R5SA 1UN9A 2LO6A 4K0RA 2ZU6B 2VGYA 3D9MA 3Q5MA 4DLQA 5JJTA 1HO8A 1N54A 3CVXA 1EYHA 2NXPA 4YNDA 2BUGA 3U3WA 4K03A 3UPVA 3KEZA 3PEUB 1Y6IA 3E4BA 3FTZA 4KMOA 3VLEA 4L23A 2LNIA 4TUUA 3FHEA 1MQSA 1E7UA 2VTBB 3CGHA 3TG5A 1HX8A 2A5UA 3AS8A 3CVPA 4N5CA 3TXMA 2L9BA 5JHAA 5G2NA 5J08A 1EPUA 2CFZA 4TRQA 4AVXA 4FHJA 5CMYA 1NZNA 2JLBA 1E96B 2Q7FA 2WXQA 4ILGA 3LJ3A 4J8EA 5FZQA 4FULA 4I1MA 1OWNA 3TXNA 2OVBA 4AV7A 3L22A 3FH5A 4KT6B 4AY5A 3G2UA 5EX0A 3B13A 5ARGA 3AS5A 5E76A 1U3DA 2BF0X 2X6JA 4OVVA 3TAXA 3G2SA 4I17A 2KM4A 2WXJA 4FP7A 4I6GA 4JHKA 4F3VA 3MV3B 4I9CA 2E2EA 3UT8A 3FUIA 2VSXE 2GRLA 3LYAA 1HU3A 1JWGA 3LVRE 3ONLA 4GMLA 3U4TA 2KZTB 4DI4A 2CHXA 4WNFA 4F1SA 2FF4A 3FULA 1BPOA 1DVPA 4NRHB 4O6FA 4RG6A 3LCAA 2I2OA 3L13A 4Y6WA 2J4DA 5FTPA 3ZRHA 4A1GA 4XKBA 3RRUA 3APCA 3MEKA 1A17A 4J8DA 3EIJA 1SZAA 4IN3B 4JEUA 4GYYA 4W9RA 4HOUA 2Y4TA 3FP3A 3GZSA 5AJDA 4G2VA 4DJAA 2GW1A 4JZYA 1INZA 4BT9A 1OWMA 4QFVA 3PNLB 2XCBA 4C9BB 4CDMA 2VSYA 2X6HA 4GMJA 4EPZA 2QFCA 2NC9A 5T4YA 3FUHA 3S7FA 4CT4A 1ZU2A 3VTXA 4TV3A 3FUDA 4Y6CA 4JXTA 1NA3A 2V8SE 3QKYA 4WUYA 4L7TA 5D0OD 4N3BA 5ENNA 3I3NA 2M63A 3QWWA 2CFUA 4I2ZA 4XI9A 3NF1A 4AEZC 1KLXA 3ZXSA 3RRNB 3U9WA 3ZEFA 3ESLA 2CHZA 4LRZA 2FBNA 3HVEB 4OVUA 1HS6A 3ZHEB 5A23A 4N3CA 3ZYMA 4WNDA 2LSUA 4FLBA 4V3IA 2YHCA 3I5PA 3PDNA 4JHJA 1HF8A 1NP7A 4NURA 1WM5A 4FHKA 2XEVA 2J9QA 2WXIA 3K9IA 5G04C 5JJ6A 5EX3A 4XZ4A 3CHQA 3CSTA 4F7AA 2FULA 2KCVA 3SZ7A 5LOZA 1N52A 4BSXA 3PUKA 4I6JA 3QARA 3PVLA 2WMNA 3VLFA 3LVQE 5FQ6A 4HXIA 3Q49B 1TJFA 3SGHA 2P58C 1H6KA 4I43A 1H19A 1FVFA 4DLOA 4GU5A 5G04J 5J90A 3U64A 3OTNA 4GZ3A 2LAHA 2MOWA 4FLHA 5M72A 2AW6A 2IOLA 1H2VC 1Y8MA 1DNPA 4HOQA 2AXUA 3DBSA 3UX4A 1L5JA 1UJJA 2IONA 4C0MA 2QY7A 3CV0A 3L16A 3PS6A 4WNGA 4WWNA 4B8CB 3KD7A 4GA2A 2WXRA 2VGXA 3MGBA 3APDA 1HG5A 2IU1A 5KJNA 5LCWJ 5DBKA 4EECA 4JC8A 4BTBA 3CKCA 3PUJA 5EDSA 2XHEA 3S7JA 3LY7A 4WWOA 1X5BA 4PDXA 2CG3A 2R17C 2OVFA 3L08A 3CKBA 3TJPA 4U63A 4EZJA 1PAQA 4GZ5A 4GPKA 4Q96A 3Q47B 1OWLA 5A6CA 3FTSA 5LP0A 3MZLB 4AIFA 3D9NA 4AP2A 5D0QD 4PH4B 2PZIA 3FU3A 4HOSA 2VJ8A 5HQ8A 3CHPA 4U0UA 2UY1B 3QB2A 2IF4A 4JPSA 4WWPA 5CCMA 2MRIA 3CHSA 3FTVA 3SD5A 3WXXA 4A3TA 3RO3A 1IYGA 2J4BA 4UWKA 2XPIA 2WXOA 4UQZA 3MV2B 2HR2A 3PEVB 2PL2A 2OV8A 3GW4A 2XGSA 3FU0A 3FTYA 4A1SA 4FJZA 3ZYLA 4APOA 4L2YA 4I9EA 3ASHA 3UMVA 3U66A 3QWPA 1WY6A 4G1TA 3ASFA 4U0ZA 1KT0A 4J8SA 3PNTB 2XPZA 1ELWA 4ANWA 4AXHA 5BNWA 4A3VA 5LX8A 4GB9A 3B7TA 3ASDA 5AJLA 3R9AB 4FJYA 3R7RA 2VYIA 2AXVA 1P5QA 2LSVA 1IHGA 4BWRA 3JYSA 2I1JA 2PM6A 5G55A 3RKVA 2L0IA 2XQ0A 4GZDA 5FWQA 2J09A 3LKUA 3MYVA 1XNFA 2X6KA 2CG2A 2KCKA 3HVEA 3FUKA 3L6AA 3ZHEA 2VSOE 2X38A 1PY1A 2RG8A 2X6IA 3FTWA 4HS2A 3JCKC 4I1OB 1HFAA 2I6HA 2XPYA 2WPVA 4L2LA 2FI7A 2A4ZA 2FEZA 1GW6A 4R7LA 2Y4UA 4E85A 5C2YA 1OWOA 4RG9A 5FZSA 2IQCA 3QK0A 2DIWA 5AIJA 3OAWA 3LY9A 1EDUA 3MKQB 4EZKA 4LUNU 4IRUA 3CK9A 3LPZA 3D3MA 5BW8C 4LEUA 3HDXA 4ILIA 3CHRA 3ASGA 3D9PA 5BPPA 2WQHA 4WAFA 2WXHA 1TEZA 3CHMA 4KZCA 5T8IA 3SBSA 4D10C 2C2LA 4KXKB 3VTYA 4NACA 2AXZA 4MRUA 2IJGX 3D9KA 4APFA 3R7QA 4EBAG 2PQRA 4PS8A 3O48A 4CGVA 3IKOB 4N39A 5FJYA 3P2BA 4CDNA 4L1BA 4WNEA 1IQRA 3PZDA 3CVUA 3CVLA 4KZ0A 4AOFA 4RVBA 3GZ1A 4HLEA 3I4GA 4GA1A 2JEKA 5FZRA 5JJ7A 3FFLA 1HH8A 5DIZA 4JEHA 3KS2A 3CVQA 4BX8A 5KJLA 4DI3A 4BX9A 3OXFA 4YVOA 3ZFWA 3RK6A 3EIQC 3MKRA 1YA0A 4YVQC 3T8MA 3SF4A 1QNFA 4CEMA 3IBEA 4I6EA 2R59A 1OUVA 2WXLA 3B7SA 3FUJA 1E8XA 4OYSA 3LEWA 2FO7A 5E75A 2RD0A 3PREA 3FH8A 4HFGA 2EQXA 3FUFA 2VTBA 1UW4B 3S7DA 2UY1A 4ANVA 2WXPA 3JQ0A 3BG0B 2J08A 3IV0A 4H7YA 3BG1B 3D9OA 3QDNA 1ELKA 4GAAA 2V5FA 4ACLA 2WXFA 2WB2A 3MCXA 4URKA 3DPDA 4MKTA 5CHEE 4G11A 3EDTB 1OWPA 1JWFA 4JW1A 2YQ8A 2L0TB 4B0ZA 3RIBA 3ZPJA 2WM9A 3EJNA 3ZW3A 4N2QA 4KVMA 3NZUA 3UQ3A 4MS6A 2HYZA 3CEQA 3PH0C 3RO2A 1ZBPA 4E6HA 2DBAA 3AU5A 4JA9A 4C0EA 4ATGA 2KZTA 3ZN3A 2MHKA 3L17A 2ILRA 3FU6A 4A55A 3P1UA 3FEXA 2I9CA 3RU0A 3ENEA 3UT4A 4CGWA 3CQCB 4GA0A 3GZ2A 4GYWA 3D9IA 3PRZA 3L54A 3FH7A 4G26A 4JVSA 5EKQD 1E8YA 3QNKA 4B94A 2YINA 4BTAA 3MJWA 3TG4A 1LF8A 3FUNA 2GRMA 4PUCA 3B7UX 1KT1A 4XE0A 3HYMB 2XGMA 4N3AA 4HVBA 4RSYA 2C0MA 3Q15A 1UN8A 4FADA 4CRWA 4IYPA 5KCMA 3CK7A 4G25A 4AJWA 5BV1A 4ABNA 4J0UA 3IHVA 3G2WA 3EHNA 4J6IA 1QQEA 1QZ2A 3ZYKA 1NA0A 3AU4A 2PM7A 4ILHB 5G05C 5ANRA 1HG2A 3IHYA 3ML8A 4XIFA 4B8AA 4UWHA 1Z3YA 4JA7A 4I1AA 2NSZA 3LDZA 4GCNA 4UWFA 3S7BA 2Y3AA 1MHQA 3IEGA 4CDRA 4CCAA 3FTXA 3CIAA 3MX3A 1W3BA 5BUZA 5G05J 1U3CA 4UWLA 4FA6A 3ML9A 4XI0A 3ZGQA 3SI5A 5LFAA 4U07A 4HORA 4BY6A 2WXKA 4BT8A 5FQ4A 1EF1C 3OXGA 3GYZA 4JL0A 5FQ7A 2VGXB 4FU3A 3FU5A 5BV0A 3QAQA 1VDYA 3G2VA 3S2AA 4KVOA 4CT0A 1Z6TA 3QWVA 3TGOA 3UUXA 4NQ0A 2KC7A 4G24A 5ARFA 2OOEA 2YNQA 1S0PA 1FVHA 2X6FA 1HZ4A 4UI9C 3JUIA 2WQ6A 3ESKA 3FTUA 3N71A 2E0IA 5AYWD 5FQ8A 1HE8A 2V4LA 3JQ1A 4GZ6A 3T5VA 4GCOA 4GYOA 4UQXA 3SHFA 2DCPA 4JHRA 3CR3A 3OXLA 3UT7A 4HOTA 2XGOA 3ULQA 3ZVVA 2AVPA 3I4RB 1WAO1 4UI9J 5KJMA 4Q69A 4EBAA 1SZ9A 1JPLA 2XRZA 3TL5A 1XGWA 4UQYA 1IQUA 2WVIA 2X3MA 2UWJG 3CVVA 2XRYA 4AY6A 4DPRA 1PC2A 3CHOA 1HXIA 3FY4A 3FEYA 2WXMA 1UG3A 3FUMA 2XCCA 3LY8A 3VLDA 3LS8A 2I1KA 5KJKA 2IFUA 5CCLA 2HO1A 2WQ7A 3PE4A 5CMWA 4XX5A 2J49A 2WMOA 2V0PA 1E90A 4G23A 1SQMA 5FT9A 4J8FA 3SNXA 2C0LA 2J07A 1TJCA 4MLPA 4PS7A 2HM8A 1H0AA 3T5XA 5A7DB 3SBTB 4ANXA 4EZLA 4UWGA 5T3RA 4LCTA 3PE3A 4P29A 4B89A 1H2UA 2GGFA 4KYOB 4DK5A 1Z3XA 3B7RL 3EHMA 4UI9K 3MA5A 2VQ2A 3APFA 1FCHA 3RRMB 5AENA 4LERA 4ANUA 5BT1A 1H2TC 5C1DA 3BEEA 3ZIMA 2VSNA 3C98A 4FC8A 3KAEA 4I2WA 4U04A 3SFZA 3CVWA 3ONKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNX A;  5FQ6 A;  3CK7 A;  3FDH A;  3SGH A;  5FQ4 A;  3I4G A;  3JQ0 A;  3CKB A;  3NQP A;  5J90 A;  3L22 A;  3IV0 A;  3EHN A;  3OTN A;  5FQ7 A;  3GZS A;  3KEZ A;  5T3R A;  3P1U A;  4Q69 A;  5E76 A;  3CK8 A;  5LX8 A;  3EHM A;  3CK9 A;  3JYS A;  3HDX A;  5FQ8 A;  3CGH A;  3MCX A;  4LER A;  5T4Y A;  3QNK A;  3MYV A;  4MRU A;  4F7A A;  3MX3 A;  4PUC A;  4F53 A;  3LEW A;  5E75 A;  4L7T A;  3EJN A;  3JQ1 A;  3CKC A; 
#chains in the Genus database with same CATH topology
 4EQF A;  4PS3 A;  4N2S A;  2R02 A;  3QC1 A;  2BTD A;  1E8W A;  1BLX B;  4RQI A;  4U0S A;  2L6J A;  5HS0 A;  4H7X A;  2PQN A;  2WXN A;  4AM9 A;  3O4Z A;  3G2T A;  1IXV A;  4M3O A;  3AS4 A;  3LXU X;  2CHW A;  3UM0 A;  3X2Q E;  4C48 B;  5HI7 A;  2KCL A;  5ENS D;  2GRP B;  1HO8 A;  4YND A;  3UPV A;  3KEZ A;  4L23 A;  2LNI A;  3HXB A;  2VTB B;  5KNG A;  3CGH A;  3CVP A;  3TXM A;  2L9B A;  5JHA A;  5J08 A;  1EPU A;  2CFZ A;  4ILG A;  4XEI G;  4J8E A;  4FUL A;  3G2U A;  3DSW A;  5E76 A;  1U3D A;  2BF0 X;  4I17 A;  2KM4 A;  5AN8 A;  3UT8 A;  1JWG A;  4WNF A;  3C3O A;  4F1S A;  4NRH B;  4O6F A;  3L13 A;  3ZRH A;  3APC A;  3SO8 A;  3MEK A;  4J8D A;  4ZFH A;  4JEU A;  4W9R A;  2GW1 A;  4JZY A;  1INZ A;  3PZ3 A;  1S64 A;  3PNL B;  4C9B B;  3E30 A;  5CER B;  4GMJ A;  2NC9 A;  1N0R A;  3FUH A;  2XEH A;  2P9K G;  1ZU2 A;  3ASN E;  4TV3 A;  3B7B A;  4Y6C A;  1N95 A;  3I3N A;  2CFU A;  5CBO A;  4I2Z A;  4F6R D;  3F6Q A;  3NF1 A;  5AQA A;  3ZXS A;  1QBQ A;  4DX1 A;  4YDW A;  3ZYM A;  4WND A;  2LSU A;  4CDM A;  1NP7 A;  5G04 C;  5JJ6 A;  3K9I A;  4XZ4 A;  3CHQ A;  3SZ7 A;  3LVQ E;  5FQ6 A;  1NFI E;  1TJF A;  3C3R A;  5G04 J;  2LAH A;  4FLH A;  4BER A;  2AW6 A;  2ION A;  3CV0 A;  3L16 A;  5CRV A;  3PS6 A;  4B8C B;  4F1P A;  1TR4 A;  4GA2 A;  3MGB A;  3TWS A;  2IU1 A;  5KJN A;  5B1B E;  3S7J A;  4PDX A;  3L08 A;  4U63 A;  1BD8 A;  4GZ5 A;  4GPK A;  4OAU C;  4AIF A;  1KZP A;  2VJ8 A;  1OXJ A;  5HQ8 A;  3D9H A;  3CHP A;  4U0U A;  2UY1 B;  5JA4 D;  1IKN D;  1YMP A;  3FTV A;  3V2X A;  4UQZ A;  1N4P A;  4U8V D;  2OV8 A;  3FTY A;  4APO A;  3ASH A;  4G1T A;  3ASF A;  4J8S A;  1ELW A;  4ANW A;  3ASD A;  2LSV A;  2L0I A;  5FWQ A;  3LKU A;  3MYV A;  2GRO B;  5ENO D;  2LXL A;  4I1O B;  1N11 A;  2X6I A;  3SQV A;  1GW6 A;  4R7L A;  5C2Y A;  3TWX A;  2DIW A;  5KBA A;  3Q9N C;  1EDU A;  4GPM A;  3LPZ A;  3D3M A;  3HDX A;  2WXH A;  3SBS A;  1N4S A;  4NAC A;  4APF A;  1N0Q A;  3P2B A;  1K1A A;  4EHM A;  4GA1 A;  5JJ7 A;  3KS2 A;  4GTP A;  1YA0 A;  1QNF A;  4I6E A;  3TWR A;  2R59 A;  1OUV A;  3FH8 A;  3FUF A;  2VTB A;  1UW4 B;  1ZB1 A;  4HBD A;  3JQ0 A;  1O1T A;  4ACL A;  2V5F A;  4NIK A;  5D66 A;  2WB2 A;  4G11 A;  3UI2 A;  1OWP A;  1JWF A;  2L0T B;  4GMR A;  4L9P A;  2WM9 A;  4N2Q A;  3DPY A;  3UQ3 A;  2HYZ A;  3CEQ A;  1H6O A;  4JA9 A;  3HG0 D;  4A55 A;  3FEX A;  4CGW A;  2B6C A;  4JVS A;  5EKQ D;  3ABL E;  3UIN C;  3FUN A;  2BED A;  3B7U X;  2A5E A;  3HYM B;  3NAW A;  4HVB A;  4RSY A;  3Q15 A;  2P9U G;  4CRW A;  5KCM A;  4J0U A;  3G2W A;  3EHN A;  4J6I A;  1QZ2 A;  3ZYK A;  2DYS E;  1NA0 A;  3L82 A;  4B8A A;  3UM2 A;  4QQI A;  1MHQ A;  3IEG A;  3ML9 A;  4XI0 A;  1DCE A;  2WXK A;  3BU8 A;  3OXG A;  3V31 A;  1O1S A;  5AAR A;  4FU3 A;  3FU5 A;  5BV0 A;  4KVO A;  1OCO E;  1Z6T A;  3TGO A;  2NYJ A;  4HRM B;  2KC7 A;  4G24 A;  4TXP A;  5ARF A;  4UI9 C;  5B3S E;  4LG6 A;  3E33 A;  3JQ1 A;  5HKP A;  3T5V A;  4GCO A;  4GYO A;  4UQX A;  2DCP A;  2H6H A;  3OXL A;  3ULQ A;  2ZIR A;  5BXO A;  1S63 A;  5CED B;  1WAO 1;  4UI9 J;  2RFA A;  1JPL A;  1K1B A;  1IQU A;  2UWJ G;  3CVV A;  2ZXW E;  4MBG A;  3HXE A;  3LS8 A;  3EU9 A;  5CMW A;  2V0P A;  1H6P A;  2DVW A;  4G23 A;  3SNX A;  2C0L A;  3E32 A;  4MLP A;  4PS7 A;  3SBT B;  3PE3 A;  4KYO B;  1Z3X A;  3B7R L;  3EHM A;  1FCH A;  5C1D A;  3C98 A;  4U04 A;  1OCZ E;  3NZS A;  5ANL A;  4YDE A;  1B89 A;  4IUL A;  3CLJ A;  3QOU A;  3NQP A;  1E7V A;  4KBQ A;  1A5E A;  2OEW A;  3DWL G;  3CVY A;  2XEN A;  2OND A;  2LAI A;  3UKR G;  1N9A A;  3HIZ A;  3URZ A;  2YHE A;  1OCR E;  3CVN A;  3V2O A;  1SA5 A;  3DXM G;  3V30 A;  2AJA A;  1UN9 A;  2ZU6 B;  5JJT A;  3PEU B;  1Y6I A;  4KMO A;  3FTZ A;  1HX8 A;  2A5U A;  4J8Y A;  4AVX A;  5CMY A;  4AV7 A;  4KT6 B;  2ZIS A;  3B13 A;  3AS5 A;  4OVV A;  4JHK A;  4F3V A;  2VSX E;  3LYA A;  4CYM D;  1HU3 A;  4GML A;  3ONL A;  3U4T A;  1Q2Z A;  2FF4 A;  3FUL A;  1BPO A;  3LCA A;  1DCQ A;  2GRR B;  4XKB A;  1A17 A;  1SZA A;  1FT2 A;  4GYY A;  2Y4T A;  5AJD A;  2ZGD A;  4BT9 A;  4QFV A;  2XCB A;  3E37 A;  4EPZ A;  2QFC A;  1D9S A;  4CT4 A;  3VTX A;  2ETC A;  3QKY A;  5D0O D;  4HI9 A;  3PZ4 A;  3ABK E;  4AEZ C;  1KLX A;  3U9W A;  3ESL A;  2CHZ A;  4LRZ A;  5A23 A;  4N3C A;  3PDN A;  4JHJ A;  4NUR A;  3HRA A;  2J9Q A;  5EX3 A;  4F7A A;  3PVL A;  2WMN A;  4HXI A;  4BSZ B;  3Q49 B;  2P58 C;  1G3N B;  1H19 A;  5J90 A;  3U64 A;  3OTN A;  4GZ3 A;  2MOW A;  2B0O E;  1Y8M A;  2AXU A;  1L5J A;  4WNG A;  2XEE A;  2WXR A;  3APD A;  4BTB A;  3PUJ A;  3AG3 E;  2ETB A;  3LY7 A;  4WWO A;  4BEP A;  1X5B A;  2R17 C;  2OVF A;  4UUC A;  2DWZ A;  4DX5 D;  3FTS A;  2L6B A;  5LP0 A;  3D9N A;  2J8S D;  4RLY A;  1WG0 A;  4PH4 B;  4HOS A;  5EN5 D;  2H6I A;  3Q9U C;  2J4B A;  2PL2 A;  3FU0 A;  3ZYL A;  3QWP A;  4U0Z A;  3PNT B;  3DRA A;  3HXC A;  2GRQ B;  5LX8 A;  4GB9 A;  5AJL A;  2BKG A;  2AXV A;  2VYI A;  2I1J A;  2PM6 A;  2J09 A;  1XNF A;  2X6K A;  1OY3 D;  3ULE G;  1PY1 A;  2ZGG A;  3JCK C;  2I6H A;  2WPV A;  4L2L A;  2A4Z A;  3W9F A;  1OWO A;  4G8K A;  3C3Q A;  2DYR E;  3ISM C;  5BPP A;  4ILI A;  1TEZ A;  4A63 B;  2WQH A;  3CHM A;  4KZC A;  1YCS B;  3VTY A;  2AXZ A;  4EBA G;  5FJY A;  4CDN A;  4WNE A;  1IQR A;  3TWW A;  4AOF A;  3GZ1 A;  4HLE A;  2JEK A;  2GRN B;  4JEH A;  5KJL A;  1NL4 A;  3ZFW A;  3SF4 A;  3BQO A;  3B7S A;  3FUJ A;  3Q75 A;  4OYS A;  5E75 A;  2EQX A;  3T8K A;  3J5Q B;  2WXP A;  4B93 B;  3J5P A;  4O60 A;  4O1O A;  3BG1 B;  3RAU A;  3D9O A;  4GAA A;  4U8Y D;  4GTV A;  2P2C P;  1LD7 A;  1KZO A;  3DPD A;  3EDT B;  4JW1 A;  4B0Z A;  2F0Y A;  3EJN A;  4KVM A;  1AWC B;  3PH0 C;  4N5Q A;  2DBA A;  3AU5 A;  2I9C A;  4LSZ E;  3UT4 A;  3CQC B;  3DSS A;  5AQ9 A;  4U7E B;  3PRZ A;  1D8E A;  2YIN A;  3MJW A;  3TG4 A;  1LF8 A;  4XE0 A;  4N3A A;  2Y0B G;  3IHV A;  1QQE A;  2PM7 A;  3B95 A;  3ML8 A;  4UWH A;  3AG1 E;  1Z3Y A;  3Q79 A;  4JB8 P;  3S7B A;  2Y3A A;  4CDR A;  3CIA A;  3MX3 A;  5BUZ A;  3DST A;  1U3C A;  3HXF A;  3SI5 A;  2JAB A;  2VGX B;  2EIJ E;  3QAQ A;  3JUE A;  3NB2 A;  4HI8 A;  2BKK B;  5BT1 A;  2WQ6 A;  1S0P A;  2X6F A;  1HZ4 A;  1RZ4 A;  3ESK A;  3FTU A;  2E0I A;  5FQ8 A;  1HE8 A;  3EHQ A;  3E34 A;  3UT7 A;  4HOT A;  3ZVV A;  2AVP A;  5KJM A;  4Q69 A;  3TL5 A;  1XGW A;  2WVI A;  1PC2 A;  3Q73 A;  3FY4 A;  1UG3 A;  1TN8 A;  2XCC A;  2I1K A;  5KJK A;  2IFU A;  5CCL A;  3ABM E;  2P9P G;  2WMO A;  2HE0 A;  4LNU D;  4J8F A;  1TNB A;  3SY2 A;  2HM8 A;  1TNO A;  5A7D B;  2XZT G;  2GGF A;  4DK5 A;  2VQ2 A;  3ZUV B;  3APF A;  4LER A;  4TXQ A;  1H2T C;  1V54 E;  5AQ7 A;  3ZIM A;  2VSN A;  3SFZ A;  3KAE A;  3UKU G;  4HQD A;  4ME2 A;  3HXD A;  1UJK A;  2OCC E;  4DUI A;  4ATZ D;  2WXG A;  3RJV A;  4GZC A;  3HHM A;  5LCW C;  3DXK G;  3UIP C;  3CK8 A;  2DZN A;  3D9L A;  3NOC D;  2AWI A;  1V55 E;  2KAT A;  3Q5M A;  3CVX A;  1EYH A;  2BUG A;  4K03 A;  3VLE A;  3FHE A;  3SFY A;  1LTX A;  4N5C A;  5G2N A;  3Q7A A;  3JXJ A;  4TRQ A;  1NZN A;  2JLB A;  2Q7F A;  3DEP A;  2WXQ A;  3LJ3 A;  1OWN A;  3LJN A;  3TXN A;  2RKK A;  5IY5 E;  3L22 A;  5ARG A;  2XS8 A;  4TXR A;  2X6J A;  3G2S A;  2XS1 A;  4I6G A;  3MV3 B;  4I9C A;  1NI1 A;  2GRL A;  1JCS A;  4HB5 A;  2KZT B;  4RG6 A;  1DVP A;  2I2O A;  4Y6W A;  2V4H C;  2MYO A;  3RRU A;  4GTO A;  3EIJ A;  4IN3 B;  4HOU A;  5H7P A;  4G2V A;  5ENQ D;  3UTM A;  5HRY A;  1TNZ A;  2VSY A;  2DZO A;  5FIN A;  3S7F A;  3FUD A;  2V8S E;  4WUY A;  4L7T A;  5ENN A;  2M63 A;  1TN6 A;  3RRN B;  4OVU A;  4DX6 D;  4V3I A;  2YHC A;  5BXU A;  1WM5 A;  3CST A;  2KCV A;  1N52 A;  4BSX A;  2LUH A;  3QAR A;  3VLF A;  5ENR D;  3SGH A;  1H6K A;  3EUV A;  4I43 A;  4GU5 A;  1QYM A;  2VGE A;  1H2V C;  4HOQ A;  4C0M A;  2EIK E;  2QY7 A;  4WWN A;  3KD7 A;  1IHB A;  2VGX A;  1HG5 A;  4GTS A;  3TJP A;  3Q47 B;  3UXG A;  2FO1 E;  5D0Q D;  3FU3 A;  2EIL E;  3QB2 A;  2IF4 A;  4JPS A;  4WWP A;  1JCQ A;  4A3T A;  5EYP F;  2XPI A;  3PEV B;  4A1S A;  4Z68 A;  2XGS A;  1WY6 A;  4AXH A;  5BNW A;  3IXE A;  1MX4 A;  3B7T A;  3R7R A;  5CCM A;  5KNH D;  1P5Q A;  2R05 A;  1MJ0 A;  3JYS A;  5B1A E;  2XQ0 A;  4GZD A;  2CG2 A;  3HVE A;  3Q78 A;  3FUK A;  3L6A A;  3ZHE A;  2VSO E;  2X38 A;  2FI7 A;  2Y4U A;  2F8X K;  2IQC A;  3LY9 A;  2EIN E;  3MKQ B;  4IRU A;  3CK9 A;  5BW8 C;  4LEU A;  1TNU A;  3CHR A;  2IO2 C;  2F37 A;  5T8I A;  4D10 C;  2IJG X;  3R7Q A;  2PQR A;  3O48 A;  3AJI A;  3CVU A;  5FZR A;  3CVQ A;  2V5Q C;  4BX9 A;  3IBE A;  4YDY A;  4LNB A;  2FO7 A;  3PRE A;  4DX2 A;  4HFG A;  3S7D A;  4ANV A;  3BG0 B;  2J08 A;  5ENP D;  4H7Y A;  3PZ2 A;  3C72 A;  3UIO C;  2WXF A;  3MCX A;  4URK A;  4MKT A;  2YQ8 A;  3RIB A;  3ZPJ A;  3NZU A;  4MS6 A;  1ZBP A;  4E6H A;  2QYJ A;  4ATG A;  2KZT A;  3ZN3 A;  2MHK A;  3FU6 A;  3P1U A;  3RU0 A;  3ENE A;  4HNA D;  3ZU7 B;  3D9I A;  3WG7 E;  3L54 A;  4G26 A;  4B94 A;  4BTA A;  4JD2 G;  2GRM A;  3TWU A;  2XGM A;  2C0M A;  4IYP A;  4G25 A;  5BV1 A;  4ABN A;  2H6F A;  5EIB E;  3AU4 A;  4ILH B;  5G05 C;  1OT8 A;  5ANR A;  1HG2 A;  2LXM A;  3IHY A;  3DSV A;  4GCN A;  1JCR A;  5G05 J;  5FQ4 A;  1EF1 C;  3PZ1 A;  3GYZ A;  4JL0 A;  5AAO A;  1X81 A;  1VDY A;  2P9I G;  3S2A A;  3QWV A;  5JMN D;  3UUX A;  1FVH A;  3JUI A;  2P9N G;  5AYW D;  3CR3 A;  1FPP A;  2EIM E;  3I4R B;  4UQY A;  3UM1 A;  1MX2 A;  4GTT A;  3CHO A;  3FEY A;  3LY8 A;  2KBX A;  1UOH A;  3ZXP A;  1OCC E;  2J49 A;  2R2L A;  3KSL A;  2KXP C;  1SQM A;  2J07 A;  2Y1L E;  1Z5S C;  4EZL A;  4UWG A;  4LCT A;  4P29 A;  1H2U A;  3L9T A;  4UI9 K;  3DSX A;  3RRM B;  1SA4 A;  2F8Y A;  1BI8 B;  3CVW A;  3CSF A;  3QJZ A;  4ACK A;  3FDH A;  4XKC A;  4TUM A;  3FWV A;  4U8H A;  4Q94 A;  4HLL A;  3D9J A;  3ZYQ A;  3FUE A;  1ELR A;  2IOS A;  3JXI A;  5JHB A;  5CRU A;  1JUQ A;  1E8Z A;  3CQG B;  1AP7 A;  3Q4A B;  2IY0 C;  3MKQ A;  4BFR A;  4F53 A;  2R5S A;  3RSE G;  2LO6 A;  3KEA A;  4K0R A;  4DLQ A;  2VGY A;  3D9M A;  1N54 A;  2NXP A;  5KWD A;  3U3W A;  1DC2 A;  4K5C A;  3E4B A;  1N94 A;  4TUU A;  1MQS A;  1E7U A;  3TG5 A;  3AS8 A;  1SW6 A;  1O5M A;  1LD8 A;  4FHJ A;  1E96 B;  5CEA A;  5FZQ A;  4I1M A;  3AAA C;  2OVB A;  3FH5 A;  4AY5 A;  5EX0 A;  2QZA A;  4U95 D;  2IO3 C;  3TAX A;  2WXJ A;  4FP7 A;  4HRL A;  2E2E A;  3FUI A;  2ETA A;  3LVR E;  3SFX A;  4DI4 A;  2CHX A;  5EYL A;  4A1G A;  2J4D A;  5FTP A;  4GTQ A;  3T9K A;  3FP3 A;  3GZS A;  4DJA A;  3TWT A;  1OWM A;  2X6H A;  5T4Y A;  3AG4 E;  2P9L G;  2IEJ A;  4JXT A;  1NA3 A;  4N3B A;  3QWW A;  3BUA A;  3C5R A;  4XI9 A;  3ZEF A;  3W9G A;  4BET A;  2FBN A;  3HVE B;  1HS6 A;  3ZHE B;  1K3Z D;  4O1P A;  4FLB A;  3I5P A;  1HF8 A;  2P9S G;  4FHK A;  2XEV A;  2WXI A;  1TNY A;  4U96 D;  2FUL A;  5LOZ A;  3UM3 A;  3PUK A;  4I6J A;  4DLO A;  1FVF A;  3ZNG A;  5M72 A;  1WDY A;  2IOL A;  1N4Q A;  1DNP A;  3ULY A;  3DBS A;  3UX4 A;  1UJJ A;  3EHR A;  1YYH A;  1MX6 A;  5LCW J;  5DBK A;  4GTR A;  4EEC A;  4JC8 A;  3CKC A;  5EDS A;  2XHE A;  2CG3 A;  4G8L A;  3CKB A;  4EZJ A;  1PAQ A;  2OEV A;  4Q96 A;  5A6C A;  1OWL A;  4BES A;  3MZL B;  1TYQ G;  3DSU A;  4AP2 A;  2PZI A;  2MRI A;  3CHS A;  3SD5 A;  1IYG A;  3WXX A;  3RO3 A;  4UWK A;  5D2M C;  2WXO A;  3ASO E;  2HR2 A;  3MV2 B;  3GW4 A;  4FJZ A;  4LNG A;  4I9E A;  4L2Y A;  3UMV A;  3U66 A;  1KT0 A;  2XPZ A;  3NOG D;  4A3V A;  3R9A B;  4FJY A;  4BWR A;  1IHG A;  3RKV A;  5G55 A;  4YDO A;  3DEO A;  4DRX E;  4OAV B;  2KCK A;  2Y69 E;  5ITZ F;  2RG8 A;  4HS2 A;  3FTW A;  1HFA A;  2XPY A;  2PNN A;  2QC9 A;  3ZKJ A;  2FEZ A;  4E85 A;  4RG9 A;  5FZS A;  3QK0 A;  5AIJ A;  3OAW A;  4EZK A;  5CBN A;  3NBN B;  4LUN U;  3TWQ A;  3ASG A;  3D9P A;  4WAF A;  2C2L A;  4KXK B;  4MRU A;  3D9K A;  1SVX A;  3AG2 E;  4PS8 A;  4CGV A;  3IKO B;  4N39 A;  4L1B A;  3PZD A;  3CVL A;  4KZ0 A;  4RVB A;  3I4G A;  5EIL A;  4X8Q A;  3FFL A;  1HH8 A;  5DIZ A;  4BX8 A;  4DI3 A;  1N4R A;  3OXF A;  4YVO A;  3RK6 A;  1U2V G;  2RFM A;  3EIQ C;  3MKR A;  4YVQ C;  3T8M A;  4CEM A;  5CEC B;  2WXL A;  5AQB A;  1E8X A;  3LEW A;  2RD0 A;  1S70 B;  2H6G A;  2UY1 A;  3IV0 A;  4DX7 D;  3QDN A;  1ELK A;  5CHE E;  4J7W A;  1D8D A;  3ZW3 A;  3RO2 A;  4CZ2 D;  1MZC A;  4C0E A;  3L17 A;  2ILR A;  4GA0 A;  3GZ2 A;  4GYW A;  1O1R A;  3FH7 A;  1E8Y A;  3QNK A;  4PUC A;  1KT1 A;  1BU9 A;  1UN8 A;  4FAD A;  3CK7 A;  4AJW A;  4GTM A;  1RW2 A;  4XIF A;  4JA7 A;  4I1A A;  2NSZ A;  3LDZ A;  5EID A;  4UWF A;  4CCA A;  3Q7F A;  3FTX A;  4ZHB A;  1W3B A;  1TN7 A;  4UWL A;  4FA6 A;  3ZGQ A;  5LFA A;  4U07 A;  4HOR A;  4BY6 A;  4BT8 A;  5FQ7 A;  2XZD G;  3TWV A;  3G2V A;  3EU5 A;  4CT0 A;  3R9M A;  4NQ0 A;  2OOE A;  2YNQ A;  2R03 A;  3KSQ A;  3N71 A;  2V4L A;  4GZ6 A;  3SHF A;  4JHR A;  2XGO A;  4M7C A;  1K8K G;  1BI7 B;  4EBA A;  1SZ9 A;  2XRZ A;  2QYU A;  1KPS B;  2X3M A;  4K5B A;  2XRY A;  4AY6 A;  4DPR A;  1HXI A;  3FUM A;  2WXM A;  5ENT D;  3VLD A;  2WQ7 A;  2HO1 A;  3PE4 A;  4XX5 A;  1E90 A;  5FT9 A;  5FIO A;  3T5X A;  1TJC A;  1H0A A;  4ANX A;  3V79 K;  1MYO A;  4HRN A;  5T3R A;  4B89 A;  1FT1 A;  3MA5 A;  4K5A B;  5AEN A;  4ANU A;  3BEE A;  4FC8 A;  4I2W A;  3ONK A; 
#chains in the Genus database with same CATH homology
 3CSF A;  3NZS A;  3QJZ A;  4ME2 A;  5ANL A;  4PS3 A;  4EQF A;  4ACK A;  4N2S A;  1UJK A;  3FDH A;  1B89 A;  3QC1 A;  4XKC A;  2BTD A;  4IUL A;  2WXG A;  3CLJ A;  3QOU A;  1E8W A;  1E7V A;  3FWV A;  3NQP A;  4GZC A;  3HHM A;  4KBQ A;  4U8H A;  3RJV A;  5LCW C;  4Q94 A;  4U0S A;  3CVY A;  3D9J A;  2L6J A;  2OND A;  3CK8 A;  4H7X A;  3ZYQ A;  2LAI A;  1ELR A;  2IOS A;  3D9L A;  3FUE A;  2PQN A;  2WXN A;  4AM9 A;  5JHB A;  3HIZ A;  2AWI A;  3O4Z A;  2YHE A;  3URZ A;  3G2T A;  1JUQ A;  4M3O A;  1E8Z A;  3AS4 A;  3CQG B;  3LXU X;  2CHW A;  3CVN A;  3Q4A B;  4BFR A;  3MKQ A;  4F53 A;  5HI7 A;  2KAT A;  2KCL A;  2R5S A;  1UN9 A;  2LO6 A;  4K0R A;  2ZU6 B;  2VGY A;  3D9M A;  3Q5M A;  4DLQ A;  5JJT A;  1HO8 A;  1N54 A;  3CVX A;  1EYH A;  2NXP A;  4YND A;  2BUG A;  3U3W A;  4K03 A;  3UPV A;  3KEZ A;  3PEU B;  1Y6I A;  3E4B A;  3FTZ A;  4KMO A;  3VLE A;  4L23 A;  2LNI A;  4TUU A;  3FHE A;  1MQS A;  1E7U A;  2VTB B;  3CGH A;  3TG5 A;  1HX8 A;  2A5U A;  3AS8 A;  3CVP A;  4N5C A;  3TXM A;  2L9B A;  5JHA A;  5G2N A;  5J08 A;  1EPU A;  2CFZ A;  4TRQ A;  4AVX A;  4FHJ A;  5CMY A;  1NZN A;  2JLB A;  1E96 B;  2Q7F A;  2WXQ A;  4ILG A;  3LJ3 A;  4J8E A;  5FZQ A;  4FUL A;  4I1M A;  1OWN A;  3TXN A;  2OVB A;  4AV7 A;  3L22 A;  3FH5 A;  4KT6 B;  4AY5 A;  3G2U A;  5EX0 A;  3B13 A;  5ARG A;  3AS5 A;  5E76 A;  1U3D A;  2BF0 X;  2X6J A;  4OVV A;  3TAX A;  3G2S A;  4I17 A;  2KM4 A;  2WXJ A;  4FP7 A;  4I6G A;  4JHK A;  4F3V A;  3MV3 B;  4I9C A;  2E2E A;  3UT8 A;  3FUI A;  2VSX E;  2GRL A;  3LYA A;  1HU3 A;  1JWG A;  3LVR E;  3ONL A;  4GML A;  3U4T A;  2KZT B;  4DI4 A;  2CHX A;  4WNF A;  4F1S A;  2FF4 A;  3FUL A;  1BPO A;  1DVP A;  4NRH B;  4O6F A;  4RG6 A;  3LCA A;  2I2O A;  3L13 A;  4Y6W A;  2J4D A;  5FTP A;  3ZRH A;  4A1G A;  4XKB A;  3RRU A;  3APC A;  3MEK A;  1A17 A;  4J8D A;  3EIJ A;  1SZA A;  4IN3 B;  4JEU A;  4GYY A;  4W9R A;  4HOU A;  2Y4T A;  3FP3 A;  3GZS A;  5AJD A;  4G2V A;  4DJA A;  2GW1 A;  4JZY A;  1INZ A;  4BT9 A;  1OWM A;  4QFV A;  3PNL B;  2XCB A;  4C9B B;  4CDM A;  2VSY A;  2X6H A;  4GMJ A;  4EPZ A;  2QFC A;  2NC9 A;  5T4Y A;  3FUH A;  3S7F A;  4CT4 A;  1ZU2 A;  3VTX A;  4TV3 A;  3FUD A;  4Y6C A;  4JXT A;  1NA3 A;  2V8S E;  3QKY A;  4WUY A;  4L7T A;  5D0O D;  4N3B A;  5ENN A;  3I3N A;  2M63 A;  3QWW A;  2CFU A;  4I2Z A;  4XI9 A;  3NF1 A;  4AEZ C;  1KLX A;  3ZXS A;  3RRN B;  3U9W A;  3ZEF A;  3ESL A;  2CHZ A;  4LRZ A;  2FBN A;  3HVE B;  4OVU A;  1HS6 A;  3ZHE B;  5A23 A;  4N3C A;  3ZYM A;  4WND A;  2LSU A;  4FLB A;  4V3I A;  2YHC A;  3I5P A;  3PDN A;  4JHJ A;  1HF8 A;  1NP7 A;  4NUR A;  1WM5 A;  4FHK A;  2XEV A;  2J9Q A;  2WXI A;  3K9I A;  5G04 C;  5JJ6 A;  5EX3 A;  4XZ4 A;  3CHQ A;  3CST A;  4F7A A;  2FUL A;  2KCV A;  3SZ7 A;  5LOZ A;  1N52 A;  4BSX A;  3PUK A;  4I6J A;  3QAR A;  3PVL A;  2WMN A;  3VLF A;  3LVQ E;  5FQ6 A;  4HXI A;  3Q49 B;  1TJF A;  3SGH A;  2P58 C;  1H6K A;  4I43 A;  1H19 A;  1FVF A;  4DLO A;  4GU5 A;  5G04 J;  5J90 A;  3U64 A;  3OTN A;  4GZ3 A;  2LAH A;  2MOW A;  4FLH A;  5M72 A;  2AW6 A;  2IOL A;  1H2V C;  1Y8M A;  1DNP A;  4HOQ A;  2AXU A;  3DBS A;  3UX4 A;  1L5J A;  1UJJ A;  2ION A;  4C0M A;  2QY7 A;  3CV0 A;  3L16 A;  3PS6 A;  4WNG A;  4WWN A;  4B8C B;  3KD7 A;  4GA2 A;  2WXR A;  2VGX A;  3MGB A;  3APD A;  1HG5 A;  2IU1 A;  5KJN A;  5LCW J;  5DBK A;  4EEC A;  4JC8 A;  4BTB A;  3CKC A;  3PUJ A;  5EDS A;  2XHE A;  3S7J A;  3LY7 A;  4WWO A;  1X5B A;  4PDX A;  2CG3 A;  2R17 C;  2OVF A;  3L08 A;  3CKB A;  3TJP A;  4U63 A;  4EZJ A;  1PAQ A;  4GZ5 A;  4GPK A;  4Q96 A;  3Q47 B;  1OWL A;  5A6C A;  3FTS A;  5LP0 A;  3MZL B;  4AIF A;  3D9N A;  4AP2 A;  5D0Q D;  4PH4 B;  2PZI A;  3FU3 A;  4HOS A;  2VJ8 A;  5HQ8 A;  3CHP A;  4U0U A;  2UY1 B;  3QB2 A;  2IF4 A;  4JPS A;  4WWP A;  5CCM A;  2MRI A;  3CHS A;  3FTV A;  3SD5 A;  3WXX A;  4A3T A;  3RO3 A;  1IYG A;  2J4B A;  4UWK A;  2XPI A;  2WXO A;  4UQZ A;  3MV2 B;  2HR2 A;  3PEV B;  2PL2 A;  2OV8 A;  3GW4 A;  2XGS A;  3FU0 A;  3FTY A;  4A1S A;  4FJZ A;  3ZYL A;  4APO A;  4L2Y A;  4I9E A;  3ASH A;  3UMV A;  3U66 A;  3QWP A;  1WY6 A;  4G1T A;  3ASF A;  4U0Z A;  1KT0 A;  4J8S A;  3PNT B;  2XPZ A;  1ELW A;  4ANW A;  4AXH A;  5BNW A;  4A3V A;  5LX8 A;  4GB9 A;  3B7T A;  3ASD A;  5AJL A;  3R9A B;  4FJY A;  3R7R A;  2VYI A;  2AXV A;  1P5Q A;  2LSV A;  1IHG A;  4BWR A;  3JYS A;  2I1J A;  2PM6 A;  5G55 A;  3RKV A;  2L0I A;  2XQ0 A;  4GZD A;  5FWQ A;  2J09 A;  3LKU A;  3MYV A;  1XNF A;  2X6K A;  2CG2 A;  2KCK A;  3HVE A;  3FUK A;  3L6A A;  3ZHE A;  2VSO E;  2X38 A;  1PY1 A;  2RG8 A;  2X6I A;  3FTW A;  4HS2 A;  3JCK C;  4I1O B;  1HFA A;  2I6H A;  2XPY A;  2WPV A;  4L2L A;  2FI7 A;  2A4Z A;  2FEZ A;  1GW6 A;  4R7L A;  2Y4U A;  4E85 A;  5C2Y A;  1OWO A;  4RG9 A;  5FZS A;  2IQC A;  3QK0 A;  2DIW A;  5AIJ A;  3OAW A;  3LY9 A;  1EDU A;  3MKQ B;  4EZK A;  4LUN U;  4IRU A;  3CK9 A;  3LPZ A;  3D3M A;  5BW8 C;  4LEU A;  3HDX A;  4ILI A;  3CHR A;  3ASG A;  3D9P A;  5BPP A;  2WQH A;  4WAF A;  2WXH A;  1TEZ A;  3CHM A;  4KZC A;  5T8I A;  3SBS A;  4D10 C;  2C2L A;  4KXK B;  3VTY A;  4NAC A;  2AXZ A;  4MRU A;  2IJG X;  3D9K A;  4APF A;  3R7Q A;  4EBA G;  2PQR A;  4PS8 A;  3O48 A;  4CGV A;  3IKO B;  4N39 A;  5FJY A;  3P2B A;  4CDN A;  4L1B A;  4WNE A;  1IQR A;  3PZD A;  3CVU A;  3CVL A;  4KZ0 A;  4AOF A;  4RVB A;  3GZ1 A;  4HLE A;  3I4G A;  4GA1 A;  2JEK A;  5FZR A;  5JJ7 A;  3FFL A;  1HH8 A;  5DIZ A;  4JEH A;  3KS2 A;  3CVQ A;  4BX8 A;  5KJL A;  4DI3 A;  4BX9 A;  3OXF A;  4YVO A;  3ZFW A;  3RK6 A;  3EIQ C;  3MKR A;  1YA0 A;  4YVQ C;  3T8M A;  3SF4 A;  1QNF A;  4CEM A;  3IBE A;  4I6E A;  2R59 A;  1OUV A;  2WXL A;  3B7S A;  3FUJ A;  1E8X A;  4OYS A;  3LEW A;  2FO7 A;  5E75 A;  2RD0 A;  3PRE A;  3FH8 A;  4HFG A;  2EQX A;  3FUF A;  2VTB A;  1UW4 B;  3S7D A;  2UY1 A;  4ANV A;  2WXP A;  3JQ0 A;  3BG0 B;  2J08 A;  3IV0 A;  4H7Y A;  3BG1 B;  3D9O A;  3QDN A;  1ELK A;  4GAA A;  2V5F A;  4ACL A;  2WXF A;  2WB2 A;  3MCX A;  4URK A;  3DPD A;  4MKT A;  5CHE E;  4G11 A;  3EDT B;  1OWP A;  1JWF A;  4JW1 A;  2YQ8 A;  2L0T B;  4B0Z A;  3RIB A;  3ZPJ A;  2WM9 A;  3EJN A;  3ZW3 A;  4N2Q A;  4KVM A;  3NZU A;  3UQ3 A;  4MS6 A;  2HYZ A;  3CEQ A;  3PH0 C;  3RO2 A;  1ZBP A;  4E6H A;  2DBA A;  3AU5 A;  4JA9 A;  4C0E A;  4ATG A;  2KZT A;  3ZN3 A;  2MHK A;  3L17 A;  2ILR A;  3FU6 A;  4A55 A;  3P1U A;  3FEX A;  2I9C A;  3RU0 A;  3ENE A;  3UT4 A;  4CGW A;  3CQC B;  4GA0 A;  3GZ2 A;  4GYW A;  3D9I A;  3PRZ A;  3L54 A;  3FH7 A;  4G26 A;  4JVS A;  5EKQ D;  1E8Y A;  3QNK A;  4B94 A;  2YIN A;  4BTA A;  3MJW A;  3TG4 A;  1LF8 A;  3FUN A;  2GRM A;  4PUC A;  3B7U X;  1KT1 A;  4XE0 A;  3HYM B;  2XGM A;  4N3A A;  4HVB A;  4RSY A;  2C0M A;  3Q15 A;  1UN8 A;  4FAD A;  4CRW A;  4IYP A;  5KCM A;  3CK7 A;  4G25 A;  4AJW A;  5BV1 A;  4ABN A;  4J0U A;  3IHV A;  3G2W A;  3EHN A;  4J6I A;  1QQE A;  1QZ2 A;  3ZYK A;  1NA0 A;  3AU4 A;  2PM7 A;  4ILH B;  5G05 C;  5ANR A;  1HG2 A;  3IHY A;  3ML8 A;  4XIF A;  4B8A A;  4UWH A;  1Z3Y A;  4JA7 A;  4I1A A;  2NSZ A;  3LDZ A;  4GCN A;  4UWF A;  3S7B A;  2Y3A A;  1MHQ A;  3IEG A;  4CDR A;  4CCA A;  3FTX A;  3CIA A;  3MX3 A;  1W3B A;  5BUZ A;  5G05 J;  1U3C A;  4UWL A;  4FA6 A;  3ML9 A;  4XI0 A;  3ZGQ A;  3SI5 A;  5LFA A;  4U07 A;  4HOR A;  4BY6 A;  2WXK A;  4BT8 A;  5FQ4 A;  1EF1 C;  3OXG A;  3GYZ A;  4JL0 A;  5FQ7 A;  2VGX B;  4FU3 A;  3FU5 A;  5BV0 A;  3QAQ A;  1VDY A;  3G2V A;  3S2A A;  4KVO A;  4CT0 A;  1Z6T A;  3QWV A;  3TGO A;  3UUX A;  4NQ0 A;  2KC7 A;  4G24 A;  5ARF A;  2OOE A;  2YNQ A;  1S0P A;  1FVH A;  2X6F A;  1HZ4 A;  4UI9 C;  3JUI A;  2WQ6 A;  3ESK A;  3FTU A;  3N71 A;  2E0I A;  5AYW D;  5FQ8 A;  1HE8 A;  2V4L A;  3JQ1 A;  4GZ6 A;  3T5V A;  4GCO A;  4GYO A;  4UQX A;  3SHF A;  2DCP A;  4JHR A;  3CR3 A;  3OXL A;  3UT7 A;  4HOT A;  2XGO A;  3ULQ A;  3ZVV A;  2AVP A;  3I4R B;  1WAO 1;  4UI9 J;  5KJM A;  4Q69 A;  4EBA A;  1SZ9 A;  1JPL A;  2XRZ A;  3TL5 A;  1XGW A;  4UQY A;  1IQU A;  2WVI A;  2X3M A;  2UWJ G;  3CVV A;  2XRY A;  4AY6 A;  4DPR A;  1PC2 A;  3CHO A;  1HXI A;  3FY4 A;  3FEY A;  2WXM A;  1UG3 A;  3FUM A;  2XCC A;  3LY8 A;  3VLD A;  3LS8 A;  2I1K A;  5KJK A;  2IFU A;  5CCL A;  2HO1 A;  2WQ7 A;  3PE4 A;  5CMW A;  4XX5 A;  2J49 A;  2WMO A;  2V0P A;  1E90 A;  4G23 A;  1SQM A;  5FT9 A;  4J8F A;  3SNX A;  2C0L A;  2J07 A;  1TJC A;  4MLP A;  4PS7 A;  2HM8 A;  1H0A A;  3T5X A;  5A7D B;  3SBT B;  4ANX A;  4EZL A;  4UWG A;  5T3R A;  4LCT A;  3PE3 A;  4P29 A;  4B89 A;  1H2U A;  2GGF A;  4KYO B;  4DK5 A;  1Z3X A;  3B7R L;  3EHM A;  4UI9 K;  3MA5 A;  2VQ2 A;  3APF A;  1FCH A;  3RRM B;  5AEN A;  4LER A;  4ANU A;  5BT1 A;  1H2T C;  5C1D A;  3BEE A;  3ZIM A;  2VSN A;  3C98 A;  4FC8 A;  3KAE A;  4I2W A;  4U04 A;  3SFZ A;  3CVW A;  3ONK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...