3SNXA

Crystal structure of a putative susd-like carbohydrate binding protein (bt_1439) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
455
structure length
455
Chain Sequence
QVAVAGNAERLFNGAWYNLFEYGTTYANIGYRALQCQDDMMASDVVSRPKYGFNSSYQFNDVAIPSDGRTSFAWYLIYKTIDNCNTAISIKGDSEELRQAQGQALALRAFCYLHLVQHYQFTYLKDKDAPCVPIYTEPTTSGTKPKGKSTVAQVYQQIFDDLNLAQDYLTNYVRKGDGQKFKPNTDVVNGLMARAYLLTGQWGEAAKAAEAARKGYSLMTTTAEYEGFNNISNKEWIWGSPQTLSQSDASYNFYYLDATYVGAYSSFMADPHLMDTFVKGDIRLPLFQWMREGYLGYKKFHMRSDDTADLVLMRSAEMYLIEAEAKVRDGVALDQAVAPLNTLRTARGVGNYDVTGKTKEQVIDEILMERRRELWGEGFGITDVLRNQKAVERMALSEDMQKTEVDCWQEGGSFAKRNPLGHWFLNFPDGKAFSANSSYYLYAIPEKEINANPNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN (BT_1439) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.88 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN
total genus 165
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3snxA00
5FQ8A 4Q69A 3OTNA 5E76A 4F7AA 3EHMA 3MYVA 3JQ0A 3CGHA 5T4YA 3SGHA 3MX3A 5T3RA 4F53A 3CKCA 4L7TA 3EJNA 3EHNA 3GZSA 5FQ7A 3SNXA 3IV0A 4PUCA 3FDHA 3QNKA 5LX8A 3CKBA 5FQ6A 3NQPA 3I4GA 3KEZA 3MCXA 4LERA 3LEWA 4MRUA 5FQ4A 3JYSA 3CK8A 3CK9A 3P1UA 3HDXA 3L22A 3JQ1A 5E75A 5J90A 3CK7A
chains in the Genus database with same CATH superfamily
3PZ1A 2RFMA 4E85A 3MYVA 4DX7D 3ULYA 3BUAA 4UQYA 3ASFA 4H7XA 4GTRA 2L6BA 4ILGA 5B3SE 4WWOA 4FA6A 2B0OE 3FUIA 3KS2A 1G3NB 1OXJA 3APDA 4K5CA 1NP7A 2VSYA 3D9HA 5FINA 2VJ8A 4AJWA 5G2NA 1NA3A 5KNGA 1UN8A 5AAOA 3HDXA 4DX5D 5EX0A 1BD8A 1TN6A 3GYZA 4OAUC 2ONDA 1DCEA 4G2VA 5T4YA 2XGSA 1QQEA 5JJTA 3FUHA 3CV0A 3Q7AA 4BT9A 1HE8A 4L23A 4GTQA 3TXMA 2LUHA 1E7UA 2RG8A 2Y1LE 3ZHEA 2WXPA 1N95A 3FTUA 3Q47B 4XI9A 1QZ2A 2OCCE 1HFAA 4EZKA 1TR4A 1BU9A 3MV2B 4APFA 5LFAA 1MX6A 5LOZA 3SNXA 4ZHBA 3CVQA 2RD0A 4BESA 3K9IA 3C72A 1OWPA 4ILIA 3DRAA 3ZUVB 3AAAC 2AXVA 2DYSE 2YNQA 5BV1A 4N3CA 4A1SA 2J4DA 5IY5E 2QZAA 5EN5D 2ZGGA 3IV0A 3VTYA 4EZJA 2H6IA 4JHJA 3EIQC 3CVWA 4G11A 1N4PA 3FU6A 4UWKA 1MHQA 3Q5MA 3IBEA 3IEGA 3PUKA 4I6JA 3I4RB 3D9OA 3CHOA 3RU0A 2J8SD 2DVWA 3DWLG 4J8FA 4UI9C 4UUCA 2WB2A 2R2LA 4XIFA 1MYOA 1D9SA 3UIOC 5LCWJ 5G55A 4HI9A 5FQ8A 4TV3A 1OCZE 2XGOA 3CKCA 3G2VA 4QQIA 2Y4UA 4FC8A 1FVHA 4EBAG 3GW4A 2UWJG 1IYGA 3CK9A 4XEIG 4DPRA 1K8KG 2J09A 4E6HA 3Q49B 1OUVA 4WAFA 1INZA 3E4BA 3FUFA 3GZ2A 3CGHA 1NL4A 3FU3A 3L17A 1JCRA 4YNDA 4L2YA 1OWOA 3CHPA 1AWCB 2DYRE 3W9GA 1FT2A 1HH8A 4MBGA 4RSYA 1BI7B 5E75A 3L22A 3AG4E 2WM9A 3ZVVA 4Q94A 3KEAA 2WMOA 5CRVA 1H6OA 1BI8B 4TXPA 2NXPA 4P29A 3TWSA 4GZ3A 1ZU2A 2H6HA 2B6CA 3HG0D 2HO1A 1JUQA 2FO7A 5EYLA 1D8DA 2BEDA 2I1JA 4LNGA 3C3OA 4BSZB 4CDRA 2OVBA 2AJAA 3L08A 1D8EA 3CVXA 1WDYA 2LSUA 3ABME 3MZLB 1EPUA 5FQ4A 1XGWA 1SZAA 2H6GA 4ACKA 3BQOA 1K3ZD 3FWVA 2KATA 2WXJA 3TL5A 4JC8A 5BNWA 5ANLA 4GMLA 3LKUA 2DZOA 3NOCD 4JL0A 3FTXA 1KPSB 3DSSA 5G04C 3PRZA 5ENRD 1N4QA 2CFUA 1EDUA 4PDXA 3MKQA 2J49A 1H0AA 1Z6TA 3RK6A 4OAVB 1S70B 4B89A 3JXIA 4I6EA 4BSXA 2E2EA 3FTVA 1UJJA 2R05A 1E96B 3PE4A 3ZRHA 1V55E 2Q7FA 1X81A 3RO2A 2KZTA 3R7QA 1MX2A 3V79K 2V4LA 1GW6A 5HQ8A 4NACA 3PZ3A 3Q73A 5B1AE 2P9LG 3G2SA 3D9JA 1SA5A 2EQXA 3ZYQA 5CMWA 1IHBA 3B7UX 4KMOA 3MJWA 3UTMA 2IU1A 2AWIA 3CSTA 5G04J 2J08A 4A63B 4IRUA 3HXFA 1PAQA 3AU5A 2E0IA 4CDNA 5EILA 3ASDA 2LXLA 1K1AA 2IO3C 1IXVA 3HVEA 1LTXA 3O48A 2XQ0A 1FVFA 4A3TA 2XHEA 3UI2A 4G8KA 3RRMB 2I6HA 4UWGA 3PEVB 2XEHA 3KEZA 1YMPA 2X6FA 3Q9UC 3ABLE 2GRNB 3QWVA 3DSUA 4HOQA 4ANWA 3R9MA 1BLXB 3V31A 4FLBA 2IFUA 4HNAD 3FH7A 2WMNA 5HRYA 5KNHD 1PY1A 4UQZA 3FUNA 1ELKA 4NRHB 2XCCA 3SFZA 2Y0BG 3B7SA 3CVPA 4C48B 4XZ4A 3ZEFA 4GYYA 3CHQA 1E8YA 3G2UA 3U3WA 1U2VG 2WXRA 2XPZA 4GZDA 3FUKA 3J5PA 3C3RA 2DCPA 4ATZD 4GU5A 1HG5A 4LEUA 3MX3A 3TG4A 1N11A 5CEAA 4FU3A 2XEEA 3UT8A 2VTBB 2YQ8A 4I2ZA 4ABNA 5CERB 4GA0A 3CEQA 4JPSA 3QAQA 1KT0A 3LY8A 1IQUA 4I9CA 3CK8A 2IOSA 2AW6A 1HS6A 3MKQB 2PQRA 2JABA 2F8YA 4GTOA 3LY7A 3S2AA 1E7VA 4IULA 3FTSA 3PH0C 3VLFA 3CVLA 3KSQA 4MS6A 3LJNA 4PS3A 1V54E 1AP7A 4I1MA 4EECA 2R02A 5D0OD 4XE0A 2WXLA 5DIZA 3RAUA 4NURA 4HORA 4Q96A 3FDHA 2EILE 2WXIA 2VSNA 3QNKA 1N0QA 2MOWA 3FTWA 2BKKB 4HFGA 3CHRA 3JQ1A 4YDWA 5AQ7A 3SD5A 5E76A 4HB5A 2VYIA 3UT4A 4GMRA 2YHEA 4Y6CA 3PEUB 1NZNA 3B7RL 3AS5A 4BX8A 1TN8A 4MLPA 4FHJA 5BW8C 5ENNA 2IJGX 2KCVA 4BTAA 2XRYA 5AJDA 3MEKA 4JB8P 3IHVA 5FZSA 5D66A 4KYOB 4G25A 4AP2A 4UWLA 4WNGA 3FUMA 5A23A 4J6IA 1YYHA 3E33A 2XGMA 4GA2A 5FTPA 2OEVA 4YDOA 1KLXA 3CQGB 4JW1A 3Q79A 3B7TA 3JUEA 3QWPA 1NI1A 2A5EA 1YA0A 4GTTA 3HXDA 1P5QA 2P9NG 3EDTB 3P2BA 4N5CA 3ZN3A 4XX5A 3MGBA 5HKPA 3BU8A 3OXGA 2GRLA 5B1BE 3DSVA 2PM6A 3NF1A 3U4TA 3URZA 3UM2A 4F1SA 2GROB 3E32A 4O6FA 4RLYA 3B95A 4U0SA 2I9CA 1HF8A 1UW4B 2XRZA 3LDZA 3Q78A 2L0IA 2V8SE 4KT6B 3DEOA 4D10C 4FLHA 4BERA 1OCOE 2IONA 4AV7A 5KJLA 2MYOA 4B93B 4N39A 1TYQG 4U8VD 4GZ5A 2NSZA 4XI0A 3TGOA 2P9UG 1TEZA 2KCKA 2QY7A 1E8ZA 4BTBA 3NOGD 3NAWA 2RFAA 4J8SA 2KCLA 1A17A 3LY9A 3ZYLA 2V4HC 3ONLA 4DRXE 2A5UA 4DLQA 2XCBA 2UY1B 4AY5A 3L54A 3PNTB 1N9AA 2VSXE 4A3VA 4BX9A 1EF1C 5CBOA 4C9BB 3SBTB 1HO8A 2WXQA 3CVVA 1KZPA 3DXMG 3ESKA 4HXIA 1S0PA 1O1RA 2R17C 3CVYA 5BPPA 1Z3XA 2GRPB 3V2OA 3JYSA 3ESLA 3RRUA 4J8DA 3UINC 4ME2A 4URKA 1OT8A 3C98A 1LD7A 1S63A 4U96D 3VTXA 4DLOA 1TNYA 3WXXA 3FP3A 5KJKA 2C2LA 2WPVA 3T8KA 1O1SA 5FT9A 2ZISA 4JEHA 4G24A 3ZKJA 2IOLA 3CHMA 2UY1A 3TG5A 5KWDA 4F7AA 3L16A 1DC2A 3QK0A 2ZU6B 4EPZA 3S7FA 4WWNA 1OCCE 3ENEA 2Y4TA 5JMND 3LCAA 1TNZA 1S64A 4CT0A 5AYWD 4JXTA 2IF4A 2DWZA 3CHSA 4PS7A 3EHMA 1TNOA 2VSOE 1TNUA 5G05C 4N2SA 3F6QA 4AM9A 5KJNA 1DCQA 4AXHA 4HOTA 3EUVA 3CLJA 3KAEA 1O1TA 5CEDB 4HLLA 3L6AA 4TXRA 1IHGA 3ZU7B 4CRWA 4U0ZA 1WAO1 4FADA 3FUDA 4I17A 3PVLA 3O4ZA 3ZYKA 2P9SG 4W9RA 4ACLA 3QC1A 4GZCA 4B8CB 2CFZA 3T5XA 1QNFA 4N3BA 4BFRA 2Y69E 4CYMD 1IKND 3P1UA 4WNFA 2C0MA 4UWHA 2P58C 1H2VC 1XNFA 1FCHA 3PUJA 4GCNA 3ONKA 2QYUA 3EHRA 1TNBA 2F37A 4F3VA 2V5QC 3FEXA 2KZTB 3HVEB 3LYAA 5ENQD 1SW6A 1Y6IA 1PC2A 4UI9J 2PL2A 3LJ3A 1Q2ZA 1TN7A 3UM3A 3G2WA 1U3DA 4BY6A 1E8WA 3UKUG 4K0RA 4GTVA 4IN3B 3E30A 3HXCA 3Q7FA 4V3IA 2GRRB 1SZ9A 5AQ9A 4JEUA 5ENPD 2WXMA 3HXEA 2WVIA 4O1OA 3T5VA 3FFLA 3I5PA 2VGXA 4HRNA 3SI5A 2WXFA 2BKGA 3AU4A 3SQVA 3ABKE 1KZOA 4DI3A 2V5FA 4XKCA 4DK5A 3PZ2A 3CQCB 4U7EB 2L6JA 4U8HA 4OVVA 4MKTA 3ASGA 1ZBPA 3DSXA 3FH8A 5G05J 1SVXA 3MCXA 3ML9A 5T8IA 2XPYA 4CT4A 3L9TA 3LPZA 4L1BA 2FBNA 2LAHA 3PZ4A 2OOEA 3PE3A 1X5BA 2WXOA 3Q15A 4RVBA 3V30A 4GAAA 5AJLA 1H6KA 1W3BA 4J8EA 2IQCA 3R7RA 3AJIA 4TXQA 5KCMA 3PZDA 4BT8A 1SA4A 3OXLA 3QOUA 2GRMA 4FULA 3UM0A 3FU5A 2C0LA 2NYJA 3UM1A 1H2UA 4F1PA 4AEZC 3UKRG 4MRUA 2FI7A 5KJMA 4HRMB 3LVRE 3PDNA 1UG3A 4PH4B 2DBAA 2J4BA 3HHMA 5CRUA 2R03A 3L13A 2KC7A 3OXFA 1JWGA 3D3MA 5ENOD 3AS8A 4HVBA 4GPKA 3D9KA 2LNIA 4FP7A 4CGWA 2WXNA 3CK7A 4KXKB 4RQIA 3FEYA 4O60A 4JHRA 3GZSA 1KT1A 1RW2A 2PZIA 1Z5SC 4ANVA 4XKBA 4CGVA 5JA4D 3C3QA 3DXKG 3TWTA 2KBXA 5FWQA 4RG6A 4WNEA 5D0QD 4OVUA 3QJZA 2AXZA 5AENA 4LCTA 4JA7A 3MV3B 2OVFA 3ZW3A 3V2XA 4Y6WA 1IQRA 3W9FA 3FTYA 4L7TA 5CECB 3EHQA 4X8QA 1UJKA 4G23A 3I3NA 3NBNB 2HE0A 3PS6A 4C0MA 3CIAA 1H6PA 3BG1B 2RKKA 2GRQB 2BUGA 2PNNA 3UT7A 2AVPA 3BG0B 4N3AA 4F6RD 3ZHEB 5ANRA 4LRZA 3AG3E 4HBDA 4OYSA 3NB2A 4TUUA 4U95D 1TJFA 3AG2E 2V0PA 3T8MA 4EZLA 3S7JA 3WG7E 1FPPA 1JCSA 4LUNU 3FHEA 2Y3AA 2I2OA 4HOSA 2FF4A 2CHZA 1DNPA 5AIJA 1RZ4A 4LG6A 4U63A 5EX3A 4BWRA 3U9WA 5AQBA 4G8LA 4G26A 4AOFA 1JCQA 2KXPC 4B94A 5A6CA 1K1BA 2GW1A 3EU5A 1N4SA 1E90A 3ISMC 1WY6A 3JXJA 3AS4A 1HX8A 3UPVA 4KZCA 4B8AA 1UN9A 5FZQA 3L82A 4CDMA 5C2YA 3OTNA 2QFCA 5AN8A 5HS0A 3UQ3A 5LCWC 2EIME 2EIJE 2IO2C 2XS8A 4IYPA 1MQSA 4I9EA 3FUJA 2ETCA 2L0TB 3G2TA 3PNLB 3JCKC 3VLEA 2IY0C 1N4RA 2X3MA 1U3CA 4L2LA 2CHXA 2X6KA 5BT1A 3UIPC 4J8YA 3DBSA 4KVOA 2VTBA 4GYWA 2MRIA 5KBAA 2ETBA 4HLEA 4JHKA 1OWMA 4JZYA 2P9KG 3DPYA 1YCSB 1OWNA 2YINA 4YVQC 2IEJA 5H7PA 2XENA 4PS8A 2OV8A 1OCRE 3FTZA 4GTMA 4UWFA 3IXEA 3KSLA 2P2CP 5CHEE 2BTDA 3TWRA 4K5BA 5A7DB 3IHYA 4HOUA 3CVUA 5JJ7A 4GMJA 4C0EA 3ZYMA 2R5SA 1L5JA 3U66A 3ASHA 3TJPA 5ARGA 2H6FA 3RKVA 1BPOA 2CG3A 2LSVA 2X6JA 2M63A 4ANUA 3GZ1A 4DX1A 4CZ2D 2F0YA 2JLBA 2L9BA 1DVPA 5BV0A 4JVSA 4FJYA 1UOHA 3B7BA 4N2QA 3PREA 4B0ZA 2QC9A 4TRQA 3D9NA 4GTSA 3FH5A 3HXBA 1N52A 1WG0A 2ETAA 3LVQE 4QFVA 3ZNGA 3I4GA 1A5EA 1WM5A 3APCA 2X6IA 4K5AB 3S7BA 4APOA 5CMYA 5EYPF 4BEPA 4ATGA 4GB9A 3BEEA 2XPIA 3SBSA 2I1KA 1HZ4A 4N5QA 4J0UA 4PUCA 3CVNA 2VGXB 3FULA 3CKBA 1E8XA 5CBNA 2J9QA 3UMVA 2VQ2A 3SGHA 2EINE 3Q4AB 5JHAA 4HS2A 5FZRA 4DI4A 4M7CA 4LNBA 4LERA 3X2QE 1H2TC 1JPLA 4UI9K 4YDYA 2FEZA 4HRLA 2ZXWE 3LXUX 3D9LA 3UX4A 3D9IA 3E37A 3FY4A 5EIDA 3QKYA 2XZTG 3SF4A 2R59A 4GA1A 2HYZA 3ULEG 3NZUA 5AQAA 2AXUA 5ENTD 3EHNA 1H19A 4AY6A 3D9PA 3IKOB 3DEPA 4L9PA 3ML8A 1SQMA 4R7LA 4M3OA 5C1DA 5J90A 4GZ6A 2DZNA 4WNDA 2WQHA 3J5QB 2BF0X 4I2WA 3Q75A 2NC9A 2ILRA 4LSZE 5BXUA 3ASOE 3MA5A 5T3RA 4J7WA 3CR3A 3NZSA 5FQ7A 3B13A 5D2MC 3HRAA 2GGFA 2WXGA 4KBQA 4KVMA 3DSTA 5FIOA 3FUEA 4YDEA 4K03A 2JEKA 4A1GA 3DSWA 1Z3YA 5J08A 2XS1A 1N54A 1JWFA 3ZXSA 4Z68A 1VDYA 3S7DA 2WQ7A 2CHWA 3ZXPA 4ANXA 3TAXA 1QYMA 1MZCA 3JUIA 5CCLA 2PQNA 1O5MA 4UQXA 2OEWA 4F53A 4ILHB 4U04A 1LF8A 3QARA 1N0RA 4WUYA 3T9KA 5ENSD 2FULA 2VGYA 2ZGDA 3Q9NC 2HM8A 4ZFHA 1OWLA 3D9MA 1MX4A 3SO8A 3C5RA 2WXKA 4GYOA 2WXHA 3R9AB 5AARA 3TWQA 3SZ7A 3TWUA 5M72A 2MHKA 3APFA 4JA9A 3RO3A 3UUXA 3FU0A 3RRNB 5DBKA 3ULQA 5HI7A 3E34A 4I1AA 1FT1A 4HI8A 4WWPA 3OAWA 4RG9A 3N71A 5JJ6A 3HIZA 1QBQA 2LAIA 3NQPA 1B89A 3SHFA 4I6GA 3LS8A 3QDNA 4EQFA 3RJVA 2LXMA 4NIKA 4TUMA 4A55A 2WQ6A 2J07A 2DIWA 1LD8A 4AVXA 5FJYA 4NQ0A 3EJNA 1ZB1A 2F8XK 4LNUD 3AG1E 4DJAA 3EU9A 4U07A 4EBAA 2QYJA 3DPDA 4EHMA 3U64A 2CG2A 2XEVA 3ZIMA 3TWVA 5CCMA 3JQ0A 3EIJA 2A4ZA 2YHCA 3SY2A 2VGEA 4DX2A 2P9PG 1NFIE 5BUZA 1HXIA 1EYHA 3RSEG 2LO6A 2X38A 4GTPA 4U0UA 3TXNA 4DX6D 1N94A 3QWWA 2EIKE 5LP0A 4GPMA 5FQ6A 1Y8MA 4U8YD 4BETA 5ITZF 3LEWA 4FHKA 4KZ0A 2FO1E 5ARFA 3SFXA 3QB2A 4Q69A 3VLDA 1MJ0A 2KM4A 1OY3D 4CCAA 3MKRA 3KD7A 3UXGA 5EKQD 3TWXA 2X6HA 1HU3A 3RIBA 3CSFA 5EDSA 3ASNE 2ZIRA 1ELWA 3ZFWA 4YVOA 3ZGQA 2PM7A 4FJZA 4HQDA 1TJCA 4I1OB 4CEMA 4AIFA 3SFYA 4DUIA 5EIBE 5LX8A 2XZDG 4I43A 1NA0A 3ZPJA 3HYMB 3TWWA 4G1TA 4H7YA 2HR2A 1HG2A 4GCOA 5BXOA 5JHBA 2P9IG 1ELRA 4O1PA 4JD2G
chains in the Genus database with same CATH topology
2DCPA 4JEUA 1DVPA 2WXMA 4GU5A 1HG5A 4E85A 5BV0A 2WVIA 3MYVA 4JVSA 4LEUA 3T5VA 4FJYA 3FFLA 3MX3A 3TG4A 4N2QA 3PREA 4B0ZA 4TRQA 3I5PA 4UQYA 3ASFA 4FU3A 4H7XA 3D9NA 3UT8A 2VTBB 3FH5A 2YQ8A 2VGXA 4I2ZA 1N52A 4ABNA 4GA0A 4ILGA 3CEQA 3LVQE 4JPSA 4QFVA 3I4GA 3QAQA 3SI5A 1WM5A 1KT0A 3LY8A 3APCA 1IQUA 4I9CA 2X6IA 3CK8A 3S7BA 4WWOA 2WXFA 4APOA 2IOSA 3AU4A 5CMYA 4FA6A 2AW6A 4ATGA 1HS6A 3MKQB 4GB9A 3BEEA 2XPIA 2PQRA 4DI3A 2V5FA 4XKCA 3SBSA 3FUIA 4DK5A 3KS2A 3CQCB 2I1KA 1HZ4A 3APDA 4J0UA 4PUCA 2L6JA 3CVNA 4U8HA 3LY7A 4OVVA 3S2AA 1E7VA 1NP7A 2VGXB 4IULA 4MKTA 3ASGA 3FULA 2VSYA 3CKBA 1ZBPA 3FTSA 3PH0C 3FH8A 1E8XA 2VJ8A 5G05J 3VLFA 3MCXA 3ML9A 5T8IA 4AJWA 2XPYA 1NA3A 3LPZA 5G2NA 1UN8A 4CT4A 2J9QA 3CVLA 3HDXA 3UMVA 2VQ2A 4MS6A 4L1BA 2FBNA 2LAHA 4PS3A 5EX0A 2OOEA 3GYZA 4I1MA 2ONDA 4EECA 3SGHA 4G2VA 3PE3A 1X5BA 5T4YA 2XGSA 1QQEA 5JJTA 3FUHA 3Q4AB 3CV0A 5D0OD 2WXOA 2WXLA 4XE0A 5DIZA 4BT9A 3Q15A 1HE8A 4L23A 5JHAA 4NURA 4HORA 4HS2A 4RVBA 4Q96A 3FDHA 5FZRA 4GAAA 2WXIA 4DI4A 2VSNA 3QNKA 5AJLA 3TXMA 1E7UA 2RG8A 2MOWA 3ZHEA 1H6KA 2WXPA 4LERA 3FTWA 1W3BA 4J8EA 4HFGA 3FTUA 2IQCA 3CHRA 3Q47B 3JQ1A 4XI9A 1QZ2A 1H2TC 1JPLA 3R7RA 4UI9K 3SD5A 1HFAA 4EZKA 5E76A 2FEZA 2VYIA 3UT4A 2YHEA 3MV2B 5KCMA 3PZDA 4BT8A 3LXUX 4Y6CA 3OXLA 3PEUB 4APFA 1NZNA 5LFAA 3D9LA 3QOUA 5LOZA 3SNXA 3B7RL 2GRMA 3AS5A 3UX4A 3D9IA 4BX8A 4FULA 3FU5A 3CVQA 2C0LA 4MLPA 3FY4A 1H2UA 2RD0A 4FHJA 5BW8C 4AEZC 3K9IA 3QKYA 4MRUA 2FI7A 3SF4A 5ENNA 1OWPA 5KJMA 2IJGX 2KCVA 4BTAA 2R59A 4ILIA 4GA1A 3LVRE 3PDNA 2HYZA 1UG3A 2AXVA 2XRYA 4PH4B 2DBAA 5AJDA 3MEKA 3NZUA 2J4BA 3IHVA 3HHMA 5FZSA 3L13A 2YNQA 4KYOB 2KC7A 3OXFA 4G25A 4AP2A 1JWGA 4UWLA 5BV1A 2AXUA 4N3CA 4WNGA 4A1SA 3FUMA 2J4DA 3D3MA 3EHNA 4J6IA 5A23A 3IV0A 3VTYA 2XGMA 4EZJA 4GA2A 5FTPA 1H19A 4JHJA 3EIQC 4AY6A 3AS8A 4HVBA 3CVWA 3D9PA 3IKOB 4G11A 1KLXA 3CQGB 3FU6A 4JW1A 4UWKA 1MHQA 3Q5MA 4GPKA 3B7TA 3QWPA 3D9KA 3ML8A 1YA0A 1SQMA 2LNIA 3IBEA 4R7LA 4M3OA 3IEGA 4FP7A 4CGWA 3PUKA 4I6JA 5C1DA 2WXNA 1P5QA 3I4RB 5J90A 3CK7A 3CHOA 3D9OA 3EDTB 4GZ6A 3P2BA 4KXKB 4J8FA 4WNDA 3FEYA 3RU0A 4UI9C 4N5CA 3ZN3A 4XX5A 4JHRA 3GZSA 3MGBA 1KT1A 2WB2A 3OXGA 4XIFA 2WQHA 2GRLA 2BF0X 2PM6A 4I2WA 3NF1A 3U4TA 2PZIA 3URZA 4F1SA 5LCWJ 4ANVA 4XKBA 4O6FA 5G55A 2NC9A 4CGVA 2ILRA 4U0SA 5FQ8A 2I9CA 1HF8A 1UW4B 4TV3A 2XGOA 2XRZA 3MA5A 3LDZA 5T3RA 2L0IA 3CKCA 3G2VA 2V8SE 3CR3A 4KT6B 5FWQA 4RG6A 4WNEA 2Y4UA 3NZSA 5D0QD 3B13A 5FQ7A 4OVUA 4FC8A 2GGFA 3QJZA 4D10C 1FVHA 4FLHA 2WXGA 4KBQA 2AXZA 5AENA 2IONA 4KVMA 4AV7A 4LCTA 5KJLA 4EBAG 4JA7A 3GW4A 3FUEA 2OVFA 3MV3B 4N39A 3ZW3A 2UWJG 4K03A 2JEKA 1IYGA 4A1GA 3CK9A 4Y6WA 4DPRA 2J09A 1IQRA 4GZ5A 4E6HA 3Q49B 1OUVA 4WAFA 1INZA 3E4BA 1Z3YA 3FUFA 3GZ2A 2NSZA 3CGHA 5J08A 3FTYA 4XI0A 3FU3A 3L17A 3TGOA 4L7TA 1N54A 1TEZA 2KCKA 1JWFA 3ZXSA 1UJKA 4YNDA 4L2YA 2QY7A 1OWOA 1E8ZA 4BTBA 3CHPA 3I3NA 4G23A 1VDYA 3S7DA 3PS6A 2WQ7A 2CHWA 1HH8A 4ANXA 4C0MA 3CIAA 4RSYA 3TAXA 3BG1B 4J8SA 2KCLA 5E75A 3L22A 1A17A 2BUGA 3UT7A 3JUIA 3LY9A 2AVPA 2PQNA 3BG0B 4N3AA 3ZHEB 3ZYLA 3ONLA 4UQXA 2WM9A 5ANRA 3ZVVA 4LRZA 2A5UA 4DLQA 4Q94A 4F53A 2WMOA 4OYSA 2XCBA 4ILHB 2UY1B 4AY5A 4TUUA 3L54A 3PNTB 4U04A 1TJFA 2NXPA 1LF8A 3QARA 2VSXE 2V0PA 4P29A 4WUYA 4A3VA 4BX9A 3T8MA 4GZ3A 1ZU2A 4EZLA 3S7JA 2FULA 2HO1A 2VGYA 1JUQA 1EF1C 2FO7A 2HM8A 1OWLA 4LUNU 3D9MA 4C9BB 2I1JA 3SBTB 1HO8A 3FHEA 2Y3AA 2WXQA 2I2OA 3CVVA 2WXKA 4GYOA 4CDRA 2WXHA 4HOSA 2FF4A 2OVBA 3ESKA 3R9AB 2CHZA 1DNPA 3L08A 5AIJA 4HXIA 3CVXA 1S0PA 2LSUA 3SZ7A 4U63A 2R17C 3CVYA 3MZLB 5BPPA 1Z3XA 1EPUA 5M72A 5FQ4A 1XGWA 5EX3A 2MHKA 3APFA 3ESLA 3JYSA 4JA9A 3RO3A 1SZAA 3FU0A 4J8DA 3RRUA 3RRNB 3U9WA 3UUXA 4BWRA 5DBKA 4ACKA 3ULQA 4ME2A 5HI7A 4URKA 3FWVA 3C98A 4G26A 5CCLA 4I1AA 2KATA 4AOFA 2WXJA 4WWPA 3VTXA 4DLOA 4B94A 5A6CA 3TL5A 3WXXA 4JC8A 3FP3A 3OAWA 4RG9A 2C2LA 5BNWA 2WPVA 5KJKA 3N71A 2GW1A 5ANLA 5JJ6A 3HIZA 5FT9A 1E90A 4GMLA 2LAIA 3LKUA 1WY6A 4G24A 4JEHA 3AS4A 3NQPA 1HX8A 3UPVA 4JL0A 1B89A 3FTXA 4KZCA 2IOLA 3CHMA 4I6GA 5G04C 3SHFA 3LS8A 3PRZA 3QDNA 1UN9A 2UY1A 2CFUA 4B8AA 5FZQA 1EDUA 3TG5A 4EQFA 3RJVA 4PDXA 3MKQA 4A55A 4CDMA 5C2YA 3OTNA 3L16A 4F7AA 2WQ6A 2J49A 2J07A 2DIWA 1H0AA 2QFCA 1Z6TA 2ZU6B 3QK0A 3RK6A 4AVXA 4EPZA 3S7FA 5FJYA 4I6EA 4B89A 4NQ0A 3EJNA 2E2EA 4WWNA 3UQ3A 4BSXA 5LCWC 3FTVA 1UJJA 4DJAA 3ENEA 2Y4TA 1E96B 3PE4A 4IYPA 1MQSA 3ZRHA 4I9EA 3FUJA 2Q7FA 4U07A 3LCAA 4EBAA 2L0TB 3G2TA 4CT0A 5AYWD 4JXTA 3DPDA 2IF4A 3U64A 3PNLB 2CG2A 2XEVA 3JCKC 3CHSA 4PS7A 3RO2A 2VTBA 3ZIMA 2KZTA 3R7QA 2V4LA 1GW6A 3VLEA 5CCMA 4NACA 5HQ8A 3EHMA 3JQ0A 2VSOE 5G05C 3EIJA 4N2SA 2X3MA 2A4ZA 1U3CA 4L2LA 4AM9A 5KJNA 2YHCA 4AXHA 4HOTA 3G2SA 3D9JA 2CHXA 2EQXA 3CLJA 3ZYQA 3KAEA 5CMWA 2X6KA 3B7UX 3L6AA 4KMOA 3MJWA 5BT1A 5BUZA 1IHGA 2IU1A 1HXIA 2AWIA 3CSTA 1EYHA 5G04J 2J08A 2LO6A 3DBSA 4U0ZA 4CRWA 1WAO1 4KVOA 4IRUA 4FADA 3FUDA 4I17A 1PAQA 3AU5A 2E0IA 2X38A 3PVLA 4GYWA 4CDNA 2MRIA 3ASDA 3O4ZA 3ZYKA 3HVEA 4U0UA 4HLEA 3TXNA 4W9RA 4JHKA 1OWMA 4ACLA 3QC1A 3O48A 3QWWA 4JZYA 5LP0A 2XQ0A 4GZCA 4B8CB 1FVFA 4A3TA 1OWNA 2XHEA 2CFZA 2YINA 3RRMB 4YVQC 2I6HA 3T5XA 1QNFA 4UWGA 4N3BA 5FQ6A 4BFRA 1Y8MA 3PEVB 3KEZA 3LEWA 4FHKA 4KZ0A 2X6FA 3P1UA 3QWVA 4WNFA 5ARFA 4PS8A 2OV8A 2C0MA 3QB2A 4Q69A 3FTZA 4HOQA 3VLDA 4ANWA 2KM4A 4UWFA 4UWHA 4CCAA 3MKRA 2P58C 3KD7A 4FLBA 2IFUA 5EKQD 1H2VC 1XNFA 3FH7A 1FCHA 2WMNA 3PUJA 4GCNA 2X6HA 5CHEE 3ONKA 2BTDA 1PY1A 1HU3A 3RIBA 3CSFA 4UQZA 3FUNA 5EDSA 1ELKA 4F3VA 4NRHB 5A7DB 3IHYA 2XCCA 3FEXA 4HOUA 3SFZA 1ELWA 3CVUA 2KZTB 3HVEB 4YVOA 3LYAA 4GMJA 3ZFWA 3ZGQA 4C0EA 5JJ7A 2PM7A 2R5SA 4FJZA 3ZYMA 3B7SA 3CVPA 1TJCA 1L5JA 3U66A 4I1OB 3ASHA 1Y6IA 1PC2A 4UI9J 4CEMA 2PL2A 3TJPA 4XZ4A 3LJ3A 4AIFA 3G2WA 1U3DA 5ARGA 3RKVA 1BPOA 3ZEFA 2CG3A 1E8WA 2LSVA 3CHQA 2X6JA 4GYYA 1E8YA 4BY6A 5LX8A 3G2UA 2M63A 4I43A 1NA0A 4K0RA 3ZPJA 3U3WA 4ANUA 4IN3B 3HYMB 3GZ1A 4G1TA 4H7YA 2HR2A 2WXRA 1HG2A 2XPZA 4GCOA 2JLBA 4V3IA 5JHBA 4GZDA 1ELRA 3FUKA 2L9BA 1SZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQ8 A;  4Q69 A;  3OTN A;  5E76 A;  4F7A A;  3EHM A;  3MYV A;  3JQ0 A;  3CGH A;  5T4Y A;  3SGH A;  3MX3 A;  5T3R A;  4F53 A;  3CKC A;  4L7T A;  3EJN A;  3EHN A;  3GZS A;  5FQ7 A;  3SNX A;  3IV0 A;  4PUC A;  3FDH A;  3QNK A;  5LX8 A;  3CKB A;  5FQ6 A;  3NQP A;  3I4G A;  3KEZ A;  3MCX A;  4LER A;  3LEW A;  4MRU A;  5FQ4 A;  3JYS A;  3CK8 A;  3CK9 A;  3P1U A;  3HDX A;  3L22 A;  3JQ1 A;  5E75 A;  5J90 A;  3CK7 A; 
#chains in the Genus database with same CATH topology
 3PZ1 A;  2RFM A;  4E85 A;  3MYV A;  4DX7 D;  3ULY A;  3BUA A;  4UQY A;  3ASF A;  4H7X A;  4GTR A;  2L6B A;  4ILG A;  5B3S E;  4WWO A;  4FA6 A;  2B0O E;  3FUI A;  3KS2 A;  1G3N B;  1OXJ A;  3APD A;  4K5C A;  1NP7 A;  2VSY A;  3D9H A;  5FIN A;  2VJ8 A;  4AJW A;  5G2N A;  1NA3 A;  5KNG A;  1UN8 A;  5AAO A;  3HDX A;  4DX5 D;  5EX0 A;  1BD8 A;  1TN6 A;  3GYZ A;  4OAU C;  2OND A;  1DCE A;  4G2V A;  5T4Y A;  2XGS A;  1QQE A;  5JJT A;  3FUH A;  3CV0 A;  3Q7A A;  4BT9 A;  1HE8 A;  4L23 A;  4GTQ A;  3TXM A;  2LUH A;  1E7U A;  2RG8 A;  2Y1L E;  3ZHE A;  2WXP A;  1N95 A;  3FTU A;  3Q47 B;  4XI9 A;  1QZ2 A;  2OCC E;  1HFA A;  4EZK A;  1TR4 A;  1BU9 A;  3MV2 B;  4APF A;  5LFA A;  1MX6 A;  5LOZ A;  3SNX A;  4ZHB A;  3CVQ A;  2RD0 A;  4BES A;  3K9I A;  3C72 A;  1OWP A;  4ILI A;  3DRA A;  3ZUV B;  3AAA C;  2AXV A;  2DYS E;  2YNQ A;  5BV1 A;  4N3C A;  4A1S A;  2J4D A;  5IY5 E;  2QZA A;  5EN5 D;  2ZGG A;  3IV0 A;  3VTY A;  4EZJ A;  2H6I A;  4JHJ A;  3EIQ C;  3CVW A;  4G11 A;  1N4P A;  3FU6 A;  4UWK A;  1MHQ A;  3Q5M A;  3IBE A;  3IEG A;  3PUK A;  4I6J A;  3I4R B;  3D9O A;  3CHO A;  3RU0 A;  2J8S D;  2DVW A;  3DWL G;  4J8F A;  4UI9 C;  4UUC A;  2WB2 A;  2R2L A;  4XIF A;  1MYO A;  1D9S A;  3UIO C;  5LCW J;  5G55 A;  4HI9 A;  5FQ8 A;  4TV3 A;  1OCZ E;  2XGO A;  3CKC A;  3G2V A;  4QQI A;  2Y4U A;  4FC8 A;  1FVH A;  4EBA G;  3GW4 A;  2UWJ G;  1IYG A;  3CK9 A;  4XEI G;  4DPR A;  1K8K G;  2J09 A;  4E6H A;  3Q49 B;  1OUV A;  4WAF A;  1INZ A;  3E4B A;  3FUF A;  3GZ2 A;  3CGH A;  1NL4 A;  3FU3 A;  3L17 A;  1JCR A;  4YND A;  4L2Y A;  1OWO A;  3CHP A;  1AWC B;  2DYR E;  3W9G A;  1FT2 A;  1HH8 A;  4MBG A;  4RSY A;  1BI7 B;  5E75 A;  3L22 A;  3AG4 E;  2WM9 A;  3ZVV A;  4Q94 A;  3KEA A;  2WMO A;  5CRV A;  1H6O A;  1BI8 B;  4TXP A;  2NXP A;  4P29 A;  3TWS A;  4GZ3 A;  1ZU2 A;  2H6H A;  2B6C A;  3HG0 D;  2HO1 A;  1JUQ A;  2FO7 A;  5EYL A;  1D8D A;  2BED A;  2I1J A;  4LNG A;  3C3O A;  4BSZ B;  4CDR A;  2OVB A;  2AJA A;  3L08 A;  1D8E A;  3CVX A;  1WDY A;  2LSU A;  3ABM E;  3MZL B;  1EPU A;  5FQ4 A;  1XGW A;  1SZA A;  2H6G A;  4ACK A;  3BQO A;  1K3Z D;  3FWV A;  2KAT A;  2WXJ A;  3TL5 A;  4JC8 A;  5BNW A;  5ANL A;  4GML A;  3LKU A;  2DZO A;  3NOC D;  4JL0 A;  3FTX A;  1KPS B;  3DSS A;  5G04 C;  3PRZ A;  5ENR D;  1N4Q A;  2CFU A;  1EDU A;  4PDX A;  3MKQ A;  2J49 A;  1H0A A;  1Z6T A;  3RK6 A;  4OAV B;  1S70 B;  4B89 A;  3JXI A;  4I6E A;  4BSX A;  2E2E A;  3FTV A;  1UJJ A;  2R05 A;  1E96 B;  3PE4 A;  3ZRH A;  1V55 E;  2Q7F A;  1X81 A;  3RO2 A;  2KZT A;  3R7Q A;  1MX2 A;  3V79 K;  2V4L A;  1GW6 A;  5HQ8 A;  4NAC A;  3PZ3 A;  3Q73 A;  5B1A E;  2P9L G;  3G2S A;  3D9J A;  1SA5 A;  2EQX A;  3ZYQ A;  5CMW A;  1IHB A;  3B7U X;  4KMO A;  3MJW A;  3UTM A;  2IU1 A;  2AWI A;  3CST A;  5G04 J;  2J08 A;  4A63 B;  4IRU A;  3HXF A;  1PAQ A;  3AU5 A;  2E0I A;  4CDN A;  5EIL A;  3ASD A;  2LXL A;  1K1A A;  2IO3 C;  1IXV A;  3HVE A;  1LTX A;  3O48 A;  2XQ0 A;  1FVF A;  4A3T A;  2XHE A;  3UI2 A;  4G8K A;  3RRM B;  2I6H A;  4UWG A;  3PEV B;  2XEH A;  3KEZ A;  1YMP A;  2X6F A;  3Q9U C;  3ABL E;  2GRN B;  3QWV A;  3DSU A;  4HOQ A;  4ANW A;  3R9M A;  1BLX B;  3V31 A;  4FLB A;  2IFU A;  4HNA D;  3FH7 A;  2WMN A;  5HRY A;  5KNH D;  1PY1 A;  4UQZ A;  3FUN A;  1ELK A;  4NRH B;  2XCC A;  3SFZ A;  2Y0B G;  3B7S A;  3CVP A;  4C48 B;  4XZ4 A;  3ZEF A;  4GYY A;  3CHQ A;  1E8Y A;  3G2U A;  3U3W A;  1U2V G;  2WXR A;  2XPZ A;  4GZD A;  3FUK A;  3J5P A;  3C3R A;  2DCP A;  4ATZ D;  4GU5 A;  1HG5 A;  4LEU A;  3MX3 A;  3TG4 A;  1N11 A;  5CEA A;  4FU3 A;  2XEE A;  3UT8 A;  2VTB B;  2YQ8 A;  4I2Z A;  4ABN A;  5CER B;  4GA0 A;  3CEQ A;  4JPS A;  3QAQ A;  1KT0 A;  3LY8 A;  1IQU A;  4I9C A;  3CK8 A;  2IOS A;  2AW6 A;  1HS6 A;  3MKQ B;  2PQR A;  2JAB A;  2F8Y A;  4GTO A;  3LY7 A;  3S2A A;  1E7V A;  4IUL A;  3FTS A;  3PH0 C;  3VLF A;  3CVL A;  3KSQ A;  4MS6 A;  3LJN A;  4PS3 A;  1V54 E;  1AP7 A;  4I1M A;  4EEC A;  2R02 A;  5D0O D;  4XE0 A;  2WXL A;  5DIZ A;  3RAU A;  4NUR A;  4HOR A;  4Q96 A;  3FDH A;  2EIL E;  2WXI A;  2VSN A;  3QNK A;  1N0Q A;  2MOW A;  3FTW A;  2BKK B;  4HFG A;  3CHR A;  3JQ1 A;  4YDW A;  5AQ7 A;  3SD5 A;  5E76 A;  4HB5 A;  2VYI A;  3UT4 A;  4GMR A;  2YHE A;  4Y6C A;  3PEU B;  1NZN A;  3B7R L;  3AS5 A;  4BX8 A;  1TN8 A;  4MLP A;  4FHJ A;  5BW8 C;  5ENN A;  2IJG X;  2KCV A;  4BTA A;  2XRY A;  5AJD A;  3MEK A;  4JB8 P;  3IHV A;  5FZS A;  5D66 A;  4KYO B;  4G25 A;  4AP2 A;  4UWL A;  4WNG A;  3FUM A;  5A23 A;  4J6I A;  1YYH A;  3E33 A;  2XGM A;  4GA2 A;  5FTP A;  2OEV A;  4YDO A;  1KLX A;  3CQG B;  4JW1 A;  3Q79 A;  3B7T A;  3JUE A;  3QWP A;  1NI1 A;  2A5E A;  1YA0 A;  4GTT A;  3HXD A;  1P5Q A;  2P9N G;  3EDT B;  3P2B A;  4N5C A;  3ZN3 A;  4XX5 A;  3MGB A;  5HKP A;  3BU8 A;  3OXG A;  2GRL A;  5B1B E;  3DSV A;  2PM6 A;  3NF1 A;  3U4T A;  3URZ A;  3UM2 A;  4F1S A;  2GRO B;  3E32 A;  4O6F A;  4RLY A;  3B95 A;  4U0S A;  2I9C A;  1HF8 A;  1UW4 B;  2XRZ A;  3LDZ A;  3Q78 A;  2L0I A;  2V8S E;  4KT6 B;  3DEO A;  4D10 C;  4FLH A;  4BER A;  1OCO E;  2ION A;  4AV7 A;  5KJL A;  2MYO A;  4B93 B;  4N39 A;  1TYQ G;  4U8V D;  4GZ5 A;  2NSZ A;  4XI0 A;  3TGO A;  2P9U G;  1TEZ A;  2KCK A;  2QY7 A;  1E8Z A;  4BTB A;  3NOG D;  3NAW A;  2RFA A;  4J8S A;  2KCL A;  1A17 A;  3LY9 A;  3ZYL A;  2V4H C;  3ONL A;  4DRX E;  2A5U A;  4DLQ A;  2XCB A;  2UY1 B;  4AY5 A;  3L54 A;  3PNT B;  1N9A A;  2VSX E;  4A3V A;  4BX9 A;  1EF1 C;  5CBO A;  4C9B B;  3SBT B;  1HO8 A;  2WXQ A;  3CVV A;  1KZP A;  3DXM G;  3ESK A;  4HXI A;  1S0P A;  1O1R A;  2R17 C;  3CVY A;  5BPP A;  1Z3X A;  2GRP B;  3V2O A;  3JYS A;  3ESL A;  3RRU A;  4J8D A;  3UIN C;  4ME2 A;  4URK A;  1OT8 A;  3C98 A;  1LD7 A;  1S63 A;  4U96 D;  3VTX A;  4DLO A;  1TNY A;  3WXX A;  3FP3 A;  5KJK A;  2C2L A;  2WPV A;  3T8K A;  1O1S A;  5FT9 A;  2ZIS A;  4JEH A;  4G24 A;  3ZKJ A;  2IOL A;  3CHM A;  2UY1 A;  3TG5 A;  5KWD A;  4F7A A;  3L16 A;  1DC2 A;  3QK0 A;  2ZU6 B;  4EPZ A;  3S7F A;  4WWN A;  1OCC E;  3ENE A;  2Y4T A;  5JMN D;  3LCA A;  1TNZ A;  1S64 A;  4CT0 A;  5AYW D;  4JXT A;  2IF4 A;  2DWZ A;  3CHS A;  4PS7 A;  3EHM A;  1TNO A;  2VSO E;  1TNU A;  5G05 C;  4N2S A;  3F6Q A;  4AM9 A;  5KJN A;  1DCQ A;  4AXH A;  4HOT A;  3EUV A;  3CLJ A;  3KAE A;  1O1T A;  5CED B;  4HLL A;  3L6A A;  4TXR A;  1IHG A;  3ZU7 B;  4CRW A;  4U0Z A;  1WAO 1;  4FAD A;  3FUD A;  4I17 A;  3PVL A;  3O4Z A;  3ZYK A;  2P9S G;  4W9R A;  4ACL A;  3QC1 A;  4GZC A;  4B8C B;  2CFZ A;  3T5X A;  1QNF A;  4N3B A;  4BFR A;  2Y69 E;  4CYM D;  1IKN D;  3P1U A;  4WNF A;  2C0M A;  4UWH A;  2P58 C;  1H2V C;  1XNF A;  1FCH A;  3PUJ A;  4GCN A;  3ONK A;  2QYU A;  3EHR A;  1TNB A;  2F37 A;  4F3V A;  2V5Q C;  3FEX A;  2KZT B;  3HVE B;  3LYA A;  5ENQ D;  1SW6 A;  1Y6I A;  1PC2 A;  4UI9 J;  2PL2 A;  3LJ3 A;  1Q2Z A;  1TN7 A;  3UM3 A;  3G2W A;  1U3D A;  4BY6 A;  1E8W A;  3UKU G;  4K0R A;  4GTV A;  4IN3 B;  3E30 A;  3HXC A;  3Q7F A;  4V3I A;  2GRR B;  1SZ9 A;  5AQ9 A;  4JEU A;  5ENP D;  2WXM A;  3HXE A;  2WVI A;  4O1O A;  3T5V A;  3FFL A;  3I5P A;  2VGX A;  4HRN A;  3SI5 A;  2WXF A;  2BKG A;  3AU4 A;  3SQV A;  3ABK E;  1KZO A;  4DI3 A;  2V5F A;  4XKC A;  4DK5 A;  3PZ2 A;  3CQC B;  4U7E B;  2L6J A;  4U8H A;  4OVV A;  4MKT A;  3ASG A;  1ZBP A;  3DSX A;  3FH8 A;  5G05 J;  1SVX A;  3MCX A;  3ML9 A;  5T8I A;  2XPY A;  4CT4 A;  3L9T A;  3LPZ A;  4L1B A;  2FBN A;  2LAH A;  3PZ4 A;  2OOE A;  3PE3 A;  1X5B A;  2WXO A;  3Q15 A;  4RVB A;  3V30 A;  4GAA A;  5AJL A;  1H6K A;  1W3B A;  4J8E A;  2IQC A;  3R7R A;  3AJI A;  4TXQ A;  5KCM A;  3PZD A;  4BT8 A;  1SA4 A;  3OXL A;  3QOU A;  2GRM A;  4FUL A;  3UM0 A;  3FU5 A;  2C0L A;  2NYJ A;  3UM1 A;  1H2U A;  4F1P A;  4AEZ C;  3UKR G;  4MRU A;  2FI7 A;  5KJM A;  4HRM B;  3LVR E;  3PDN A;  1UG3 A;  4PH4 B;  2DBA A;  2J4B A;  3HHM A;  5CRU A;  2R03 A;  3L13 A;  2KC7 A;  3OXF A;  1JWG A;  3D3M A;  5ENO D;  3AS8 A;  4HVB A;  4GPK A;  3D9K A;  2LNI A;  4FP7 A;  4CGW A;  2WXN A;  3CK7 A;  4KXK B;  4RQI A;  3FEY A;  4O60 A;  4JHR A;  3GZS A;  1KT1 A;  1RW2 A;  2PZI A;  1Z5S C;  4ANV A;  4XKB A;  4CGV A;  5JA4 D;  3C3Q A;  3DXK G;  3TWT A;  2KBX A;  5FWQ A;  4RG6 A;  4WNE A;  5D0Q D;  4OVU A;  3QJZ A;  2AXZ A;  5AEN A;  4LCT A;  4JA7 A;  3MV3 B;  2OVF A;  3ZW3 A;  3V2X A;  4Y6W A;  1IQR A;  3W9F A;  3FTY A;  4L7T A;  5CEC B;  3EHQ A;  4X8Q A;  1UJK A;  4G23 A;  3I3N A;  3NBN B;  2HE0 A;  3PS6 A;  4C0M A;  3CIA A;  1H6P A;  3BG1 B;  2RKK A;  2GRQ B;  2BUG A;  2PNN A;  3UT7 A;  2AVP A;  3BG0 B;  4N3A A;  4F6R D;  3ZHE B;  5ANR A;  4LRZ A;  3AG3 E;  4HBD A;  4OYS A;  3NB2 A;  4TUU A;  4U95 D;  1TJF A;  3AG2 E;  2V0P A;  3T8M A;  4EZL A;  3S7J A;  3WG7 E;  1FPP A;  1JCS A;  4LUN U;  3FHE A;  2Y3A A;  2I2O A;  4HOS A;  2FF4 A;  2CHZ A;  1DNP A;  5AIJ A;  1RZ4 A;  4LG6 A;  4U63 A;  5EX3 A;  4BWR A;  3U9W A;  5AQB A;  4G8L A;  4G26 A;  4AOF A;  1JCQ A;  2KXP C;  4B94 A;  5A6C A;  1K1B A;  2GW1 A;  3EU5 A;  1N4S A;  1E90 A;  3ISM C;  1WY6 A;  3JXJ A;  3AS4 A;  1HX8 A;  3UPV A;  4KZC A;  4B8A A;  1UN9 A;  5FZQ A;  3L82 A;  4CDM A;  5C2Y A;  3OTN A;  2QFC A;  5AN8 A;  5HS0 A;  3UQ3 A;  5LCW C;  2EIM E;  2EIJ E;  2IO2 C;  2XS8 A;  4IYP A;  1MQS A;  4I9E A;  3FUJ A;  2ETC A;  2L0T B;  3G2T A;  3PNL B;  3JCK C;  3VLE A;  2IY0 C;  1N4R A;  2X3M A;  1U3C A;  4L2L A;  2CHX A;  2X6K A;  5BT1 A;  3UIP C;  4J8Y A;  3DBS A;  4KVO A;  2VTB A;  4GYW A;  2MRI A;  5KBA A;  2ETB A;  4HLE A;  4JHK A;  1OWM A;  4JZY A;  2P9K G;  3DPY A;  1YCS B;  1OWN A;  2YIN A;  4YVQ C;  2IEJ A;  5H7P A;  2XEN A;  4PS8 A;  2OV8 A;  1OCR E;  3FTZ A;  4GTM A;  4UWF A;  3IXE A;  3KSL A;  2P2C P;  5CHE E;  2BTD A;  3TWR A;  4K5B A;  5A7D B;  3IHY A;  4HOU A;  3CVU A;  5JJ7 A;  4GMJ A;  4C0E A;  3ZYM A;  2R5S A;  1L5J A;  3U66 A;  3ASH A;  3TJP A;  5ARG A;  2H6F A;  3RKV A;  1BPO A;  2CG3 A;  2LSV A;  2X6J A;  2M63 A;  4ANU A;  3GZ1 A;  4DX1 A;  4CZ2 D;  2F0Y A;  2JLB A;  2L9B A;  1DVP A;  5BV0 A;  4JVS A;  4FJY A;  1UOH A;  3B7B A;  4N2Q A;  3PRE A;  4B0Z A;  2QC9 A;  4TRQ A;  3D9N A;  4GTS A;  3FH5 A;  3HXB A;  1N52 A;  1WG0 A;  2ETA A;  3LVQ E;  4QFV A;  3ZNG A;  3I4G A;  1A5E A;  1WM5 A;  3APC A;  2X6I A;  4K5A B;  3S7B A;  4APO A;  5CMY A;  5EYP F;  4BEP A;  4ATG A;  4GB9 A;  3BEE A;  2XPI A;  3SBS A;  2I1K A;  1HZ4 A;  4N5Q A;  4J0U A;  4PUC A;  3CVN A;  2VGX B;  3FUL A;  3CKB A;  1E8X A;  5CBN A;  2J9Q A;  3UMV A;  2VQ2 A;  3SGH A;  2EIN E;  3Q4A B;  5JHA A;  4HS2 A;  5FZR A;  4DI4 A;  4M7C A;  4LNB A;  4LER A;  3X2Q E;  1H2T C;  1JPL A;  4UI9 K;  4YDY A;  2FEZ A;  4HRL A;  2ZXW E;  3LXU X;  3D9L A;  3UX4 A;  3D9I A;  3E37 A;  3FY4 A;  5EID A;  3QKY A;  2XZT G;  3SF4 A;  2R59 A;  4GA1 A;  2HYZ A;  3ULE G;  3NZU A;  5AQA A;  2AXU A;  5ENT D;  3EHN A;  1H19 A;  4AY6 A;  3D9P A;  3IKO B;  3DEP A;  4L9P A;  3ML8 A;  1SQM A;  4R7L A;  4M3O A;  5C1D A;  5J90 A;  4GZ6 A;  2DZN A;  4WND A;  2WQH A;  3J5Q B;  2BF0 X;  4I2W A;  3Q75 A;  2NC9 A;  2ILR A;  4LSZ E;  5BXU A;  3ASO E;  3MA5 A;  5T3R A;  4J7W A;  3CR3 A;  3NZS A;  5FQ7 A;  3B13 A;  5D2M C;  3HRA A;  2GGF A;  2WXG A;  4KBQ A;  4KVM A;  3DST A;  5FIO A;  3FUE A;  4YDE A;  4K03 A;  2JEK A;  4A1G A;  3DSW A;  1Z3Y A;  5J08 A;  2XS1 A;  1N54 A;  1JWF A;  3ZXS A;  4Z68 A;  1VDY A;  3S7D A;  2WQ7 A;  2CHW A;  3ZXP A;  4ANX A;  3TAX A;  1QYM A;  1MZC A;  3JUI A;  5CCL A;  2PQN A;  1O5M A;  4UQX A;  2OEW A;  4F53 A;  4ILH B;  4U04 A;  1LF8 A;  3QAR A;  1N0R A;  4WUY A;  3T9K A;  5ENS D;  2FUL A;  2VGY A;  2ZGD A;  3Q9N C;  2HM8 A;  4ZFH A;  1OWL A;  3D9M A;  1MX4 A;  3SO8 A;  3C5R A;  2WXK A;  4GYO A;  2WXH A;  3R9A B;  5AAR A;  3TWQ A;  3SZ7 A;  3TWU A;  5M72 A;  2MHK A;  3APF A;  4JA9 A;  3RO3 A;  3UUX A;  3FU0 A;  3RRN B;  5DBK A;  3ULQ A;  5HI7 A;  3E34 A;  4I1A A;  1FT1 A;  4HI8 A;  4WWP A;  3OAW A;  4RG9 A;  3N71 A;  5JJ6 A;  3HIZ A;  1QBQ A;  2LAI A;  3NQP A;  1B89 A;  3SHF A;  4I6G A;  3LS8 A;  3QDN A;  4EQF A;  3RJV A;  2LXM A;  4NIK A;  4TUM A;  4A55 A;  2WQ6 A;  2J07 A;  2DIW A;  1LD8 A;  4AVX A;  5FJY A;  4NQ0 A;  3EJN A;  1ZB1 A;  2F8X K;  4LNU D;  3AG1 E;  4DJA A;  3EU9 A;  4U07 A;  4EBA A;  2QYJ A;  3DPD A;  4EHM A;  3U64 A;  2CG2 A;  2XEV A;  3ZIM A;  3TWV A;  5CCM A;  3JQ0 A;  3EIJ A;  2A4Z A;  2YHC A;  3SY2 A;  2VGE A;  4DX2 A;  2P9P G;  1NFI E;  5BUZ A;  1HXI A;  1EYH A;  3RSE G;  2LO6 A;  2X38 A;  4GTP A;  4U0U A;  3TXN A;  4DX6 D;  1N94 A;  3QWW A;  2EIK E;  5LP0 A;  4GPM A;  5FQ6 A;  1Y8M A;  4U8Y D;  4BET A;  5ITZ F;  3LEW A;  4FHK A;  4KZ0 A;  2FO1 E;  5ARF A;  3SFX A;  3QB2 A;  4Q69 A;  3VLD A;  1MJ0 A;  2KM4 A;  1OY3 D;  4CCA A;  3MKR A;  3KD7 A;  3UXG A;  5EKQ D;  3TWX A;  2X6H A;  1HU3 A;  3RIB A;  3CSF A;  5EDS A;  3ASN E;  2ZIR A;  1ELW A;  3ZFW A;  4YVO A;  3ZGQ A;  2PM7 A;  4FJZ A;  4HQD A;  1TJC A;  4I1O B;  4CEM A;  4AIF A;  3SFY A;  4DUI A;  5EIB E;  5LX8 A;  2XZD G;  4I43 A;  1NA0 A;  3ZPJ A;  3HYM B;  3TWW A;  4G1T A;  4H7Y A;  2HR2 A;  1HG2 A;  4GCO A;  5BXO A;  5JHB A;  2P9I G;  1ELR A;  4O1P A;  4JD2 G; 
#chains in the Genus database with same CATH homology
 2DCP A;  4JEU A;  1DVP A;  2WXM A;  4GU5 A;  1HG5 A;  4E85 A;  5BV0 A;  2WVI A;  3MYV A;  4JVS A;  4LEU A;  3T5V A;  4FJY A;  3FFL A;  3MX3 A;  3TG4 A;  4N2Q A;  3PRE A;  4B0Z A;  4TRQ A;  3I5P A;  4UQY A;  3ASF A;  4FU3 A;  4H7X A;  3D9N A;  3UT8 A;  2VTB B;  3FH5 A;  2YQ8 A;  2VGX A;  4I2Z A;  1N52 A;  4ABN A;  4GA0 A;  4ILG A;  3CEQ A;  3LVQ E;  4JPS A;  4QFV A;  3I4G A;  3QAQ A;  3SI5 A;  1WM5 A;  1KT0 A;  3LY8 A;  3APC A;  1IQU A;  4I9C A;  2X6I A;  3CK8 A;  3S7B A;  4WWO A;  2WXF A;  4APO A;  2IOS A;  3AU4 A;  5CMY A;  4FA6 A;  2AW6 A;  4ATG A;  1HS6 A;  3MKQ B;  4GB9 A;  3BEE A;  2XPI A;  2PQR A;  4DI3 A;  2V5F A;  4XKC A;  3SBS A;  3FUI A;  4DK5 A;  3KS2 A;  3CQC B;  2I1K A;  1HZ4 A;  3APD A;  4J0U A;  4PUC A;  2L6J A;  3CVN A;  4U8H A;  3LY7 A;  4OVV A;  3S2A A;  1E7V A;  1NP7 A;  2VGX B;  4IUL A;  4MKT A;  3ASG A;  3FUL A;  2VSY A;  3CKB A;  1ZBP A;  3FTS A;  3PH0 C;  3FH8 A;  1E8X A;  2VJ8 A;  5G05 J;  3VLF A;  3MCX A;  3ML9 A;  5T8I A;  4AJW A;  2XPY A;  1NA3 A;  3LPZ A;  5G2N A;  1UN8 A;  4CT4 A;  2J9Q A;  3CVL A;  3HDX A;  3UMV A;  2VQ2 A;  4MS6 A;  4L1B A;  2FBN A;  2LAH A;  4PS3 A;  5EX0 A;  2OOE A;  3GYZ A;  4I1M A;  2OND A;  4EEC A;  3SGH A;  4G2V A;  3PE3 A;  1X5B A;  5T4Y A;  2XGS A;  1QQE A;  5JJT A;  3FUH A;  3Q4A B;  3CV0 A;  5D0O D;  2WXO A;  2WXL A;  4XE0 A;  5DIZ A;  4BT9 A;  3Q15 A;  1HE8 A;  4L23 A;  5JHA A;  4NUR A;  4HOR A;  4HS2 A;  4RVB A;  4Q96 A;  3FDH A;  5FZR A;  4GAA A;  2WXI A;  4DI4 A;  2VSN A;  3QNK A;  5AJL A;  3TXM A;  1E7U A;  2RG8 A;  2MOW A;  3ZHE A;  1H6K A;  2WXP A;  4LER A;  3FTW A;  1W3B A;  4J8E A;  4HFG A;  3FTU A;  2IQC A;  3CHR A;  3Q47 B;  3JQ1 A;  4XI9 A;  1QZ2 A;  1H2T C;  1JPL A;  3R7R A;  4UI9 K;  3SD5 A;  1HFA A;  4EZK A;  5E76 A;  2FEZ A;  2VYI A;  3UT4 A;  2YHE A;  3MV2 B;  5KCM A;  3PZD A;  4BT8 A;  3LXU X;  4Y6C A;  3OXL A;  3PEU B;  4APF A;  1NZN A;  5LFA A;  3D9L A;  3QOU A;  5LOZ A;  3SNX A;  3B7R L;  2GRM A;  3AS5 A;  3UX4 A;  3D9I A;  4BX8 A;  4FUL A;  3FU5 A;  3CVQ A;  2C0L A;  4MLP A;  3FY4 A;  1H2U A;  2RD0 A;  4FHJ A;  5BW8 C;  4AEZ C;  3K9I A;  3QKY A;  4MRU A;  2FI7 A;  3SF4 A;  5ENN A;  1OWP A;  5KJM A;  2IJG X;  2KCV A;  4BTA A;  2R59 A;  4ILI A;  4GA1 A;  3LVR E;  3PDN A;  2HYZ A;  1UG3 A;  2AXV A;  2XRY A;  4PH4 B;  2DBA A;  5AJD A;  3MEK A;  3NZU A;  2J4B A;  3IHV A;  3HHM A;  5FZS A;  3L13 A;  2YNQ A;  4KYO B;  2KC7 A;  3OXF A;  4G25 A;  4AP2 A;  1JWG A;  4UWL A;  5BV1 A;  2AXU A;  4N3C A;  4WNG A;  4A1S A;  3FUM A;  2J4D A;  3D3M A;  3EHN A;  4J6I A;  5A23 A;  3IV0 A;  3VTY A;  2XGM A;  4EZJ A;  4GA2 A;  5FTP A;  1H19 A;  4JHJ A;  3EIQ C;  4AY6 A;  3AS8 A;  4HVB A;  3CVW A;  3D9P A;  3IKO B;  4G11 A;  1KLX A;  3CQG B;  3FU6 A;  4JW1 A;  4UWK A;  1MHQ A;  3Q5M A;  4GPK A;  3B7T A;  3QWP A;  3D9K A;  3ML8 A;  1YA0 A;  1SQM A;  2LNI A;  3IBE A;  4R7L A;  4M3O A;  3IEG A;  4FP7 A;  4CGW A;  3PUK A;  4I6J A;  5C1D A;  2WXN A;  1P5Q A;  3I4R B;  5J90 A;  3CK7 A;  3CHO A;  3D9O A;  3EDT B;  4GZ6 A;  3P2B A;  4KXK B;  4J8F A;  4WND A;  3FEY A;  3RU0 A;  4UI9 C;  4N5C A;  3ZN3 A;  4XX5 A;  4JHR A;  3GZS A;  3MGB A;  1KT1 A;  2WB2 A;  3OXG A;  4XIF A;  2WQH A;  2GRL A;  2BF0 X;  2PM6 A;  4I2W A;  3NF1 A;  3U4T A;  2PZI A;  3URZ A;  4F1S A;  5LCW J;  4ANV A;  4XKB A;  4O6F A;  5G55 A;  2NC9 A;  4CGV A;  2ILR A;  4U0S A;  5FQ8 A;  2I9C A;  1HF8 A;  1UW4 B;  4TV3 A;  2XGO A;  2XRZ A;  3MA5 A;  3LDZ A;  5T3R A;  2L0I A;  3CKC A;  3G2V A;  2V8S E;  3CR3 A;  4KT6 B;  5FWQ A;  4RG6 A;  4WNE A;  2Y4U A;  3NZS A;  5D0Q D;  3B13 A;  5FQ7 A;  4OVU A;  4FC8 A;  2GGF A;  3QJZ A;  4D10 C;  1FVH A;  4FLH A;  2WXG A;  4KBQ A;  2AXZ A;  5AEN A;  2ION A;  4KVM A;  4AV7 A;  4LCT A;  5KJL A;  4EBA G;  4JA7 A;  3GW4 A;  3FUE A;  2OVF A;  3MV3 B;  4N39 A;  3ZW3 A;  2UWJ G;  4K03 A;  2JEK A;  1IYG A;  4A1G A;  3CK9 A;  4Y6W A;  4DPR A;  2J09 A;  1IQR A;  4GZ5 A;  4E6H A;  3Q49 B;  1OUV A;  4WAF A;  1INZ A;  3E4B A;  1Z3Y A;  3FUF A;  3GZ2 A;  2NSZ A;  3CGH A;  5J08 A;  3FTY A;  4XI0 A;  3FU3 A;  3L17 A;  3TGO A;  4L7T A;  1N54 A;  1TEZ A;  2KCK A;  1JWF A;  3ZXS A;  1UJK A;  4YND A;  4L2Y A;  2QY7 A;  1OWO A;  1E8Z A;  4BTB A;  3CHP A;  3I3N A;  4G23 A;  1VDY A;  3S7D A;  3PS6 A;  2WQ7 A;  2CHW A;  1HH8 A;  4ANX A;  4C0M A;  3CIA A;  4RSY A;  3TAX A;  3BG1 B;  4J8S A;  2KCL A;  5E75 A;  3L22 A;  1A17 A;  2BUG A;  3UT7 A;  3JUI A;  3LY9 A;  2AVP A;  2PQN A;  3BG0 B;  4N3A A;  3ZHE B;  3ZYL A;  3ONL A;  4UQX A;  2WM9 A;  5ANR A;  3ZVV A;  4LRZ A;  2A5U A;  4DLQ A;  4Q94 A;  4F53 A;  2WMO A;  4OYS A;  2XCB A;  4ILH B;  2UY1 B;  4AY5 A;  4TUU A;  3L54 A;  3PNT B;  4U04 A;  1TJF A;  2NXP A;  1LF8 A;  3QAR A;  2VSX E;  2V0P A;  4P29 A;  4WUY A;  4A3V A;  4BX9 A;  3T8M A;  4GZ3 A;  1ZU2 A;  4EZL A;  3S7J A;  2FUL A;  2HO1 A;  2VGY A;  1JUQ A;  1EF1 C;  2FO7 A;  2HM8 A;  1OWL A;  4LUN U;  3D9M A;  4C9B B;  2I1J A;  3SBT B;  1HO8 A;  3FHE A;  2Y3A A;  2WXQ A;  2I2O A;  3CVV A;  2WXK A;  4GYO A;  4CDR A;  2WXH A;  4HOS A;  2FF4 A;  2OVB A;  3ESK A;  3R9A B;  2CHZ A;  1DNP A;  3L08 A;  5AIJ A;  4HXI A;  3CVX A;  1S0P A;  2LSU A;  3SZ7 A;  4U63 A;  2R17 C;  3CVY A;  3MZL B;  5BPP A;  1Z3X A;  1EPU A;  5M72 A;  5FQ4 A;  1XGW A;  5EX3 A;  2MHK A;  3APF A;  3ESL A;  3JYS A;  4JA9 A;  3RO3 A;  1SZA A;  3FU0 A;  4J8D A;  3RRU A;  3RRN B;  3U9W A;  3UUX A;  4BWR A;  5DBK A;  4ACK A;  3ULQ A;  4ME2 A;  5HI7 A;  4URK A;  3FWV A;  3C98 A;  4G26 A;  5CCL A;  4I1A A;  2KAT A;  4AOF A;  2WXJ A;  4WWP A;  3VTX A;  4DLO A;  4B94 A;  5A6C A;  3TL5 A;  3WXX A;  4JC8 A;  3FP3 A;  3OAW A;  4RG9 A;  2C2L A;  5BNW A;  2WPV A;  5KJK A;  3N71 A;  2GW1 A;  5ANL A;  5JJ6 A;  3HIZ A;  5FT9 A;  1E90 A;  4GML A;  2LAI A;  3LKU A;  1WY6 A;  4G24 A;  4JEH A;  3AS4 A;  3NQP A;  1HX8 A;  3UPV A;  4JL0 A;  1B89 A;  3FTX A;  4KZC A;  2IOL A;  3CHM A;  4I6G A;  5G04 C;  3SHF A;  3LS8 A;  3PRZ A;  3QDN A;  1UN9 A;  2UY1 A;  2CFU A;  4B8A A;  5FZQ A;  1EDU A;  3TG5 A;  4EQF A;  3RJV A;  4PDX A;  3MKQ A;  4A55 A;  4CDM A;  5C2Y A;  3OTN A;  3L16 A;  4F7A A;  2WQ6 A;  2J49 A;  2J07 A;  2DIW A;  1H0A A;  2QFC A;  1Z6T A;  2ZU6 B;  3QK0 A;  3RK6 A;  4AVX A;  4EPZ A;  3S7F A;  5FJY A;  4I6E A;  4B89 A;  4NQ0 A;  3EJN A;  2E2E A;  4WWN A;  3UQ3 A;  4BSX A;  5LCW C;  3FTV A;  1UJJ A;  4DJA A;  3ENE A;  2Y4T A;  1E96 B;  3PE4 A;  4IYP A;  1MQS A;  3ZRH A;  4I9E A;  3FUJ A;  2Q7F A;  4U07 A;  3LCA A;  4EBA A;  2L0T B;  3G2T A;  4CT0 A;  5AYW D;  4JXT A;  3DPD A;  2IF4 A;  3U64 A;  3PNL B;  2CG2 A;  2XEV A;  3JCK C;  3CHS A;  4PS7 A;  3RO2 A;  2VTB A;  3ZIM A;  2KZT A;  3R7Q A;  2V4L A;  1GW6 A;  3VLE A;  5CCM A;  4NAC A;  5HQ8 A;  3EHM A;  3JQ0 A;  2VSO E;  5G05 C;  3EIJ A;  4N2S A;  2X3M A;  2A4Z A;  1U3C A;  4L2L A;  4AM9 A;  5KJN A;  2YHC A;  4AXH A;  4HOT A;  3G2S A;  3D9J A;  2CHX A;  2EQX A;  3CLJ A;  3ZYQ A;  3KAE A;  5CMW A;  2X6K A;  3B7U X;  3L6A A;  4KMO A;  3MJW A;  5BT1 A;  5BUZ A;  1IHG A;  2IU1 A;  1HXI A;  2AWI A;  3CST A;  1EYH A;  5G04 J;  2J08 A;  2LO6 A;  3DBS A;  4U0Z A;  4CRW A;  1WAO 1;  4KVO A;  4IRU A;  4FAD A;  3FUD A;  4I17 A;  1PAQ A;  3AU5 A;  2E0I A;  2X38 A;  3PVL A;  4GYW A;  4CDN A;  2MRI A;  3ASD A;  3O4Z A;  3ZYK A;  3HVE A;  4U0U A;  4HLE A;  3TXN A;  4W9R A;  4JHK A;  1OWM A;  4ACL A;  3QC1 A;  3O48 A;  3QWW A;  4JZY A;  5LP0 A;  2XQ0 A;  4GZC A;  4B8C B;  1FVF A;  4A3T A;  1OWN A;  2XHE A;  2CFZ A;  2YIN A;  3RRM B;  4YVQ C;  2I6H A;  3T5X A;  1QNF A;  4UWG A;  4N3B A;  5FQ6 A;  4BFR A;  1Y8M A;  3PEV B;  3KEZ A;  3LEW A;  4FHK A;  4KZ0 A;  2X6F A;  3P1U A;  3QWV A;  4WNF A;  5ARF A;  4PS8 A;  2OV8 A;  2C0M A;  3QB2 A;  4Q69 A;  3FTZ A;  4HOQ A;  3VLD A;  4ANW A;  2KM4 A;  4UWF A;  4UWH A;  4CCA A;  3MKR A;  2P58 C;  3KD7 A;  4FLB A;  2IFU A;  5EKQ D;  1H2V C;  1XNF A;  3FH7 A;  1FCH A;  2WMN A;  3PUJ A;  4GCN A;  2X6H A;  5CHE E;  3ONK A;  2BTD A;  1PY1 A;  1HU3 A;  3RIB A;  3CSF A;  4UQZ A;  3FUN A;  5EDS A;  1ELK A;  4F3V A;  4NRH B;  5A7D B;  3IHY A;  2XCC A;  3FEX A;  4HOU A;  3SFZ A;  1ELW A;  3CVU A;  2KZT B;  3HVE B;  4YVO A;  3LYA A;  4GMJ A;  3ZFW A;  3ZGQ A;  4C0E A;  5JJ7 A;  2PM7 A;  2R5S A;  4FJZ A;  3ZYM A;  3B7S A;  3CVP A;  1TJC A;  1L5J A;  3U66 A;  4I1O B;  3ASH A;  1Y6I A;  1PC2 A;  4UI9 J;  4CEM A;  2PL2 A;  3TJP A;  4XZ4 A;  3LJ3 A;  4AIF A;  3G2W A;  1U3D A;  5ARG A;  3RKV A;  1BPO A;  3ZEF A;  2CG3 A;  1E8W A;  2LSV A;  3CHQ A;  2X6J A;  4GYY A;  1E8Y A;  4BY6 A;  5LX8 A;  3G2U A;  2M63 A;  4I43 A;  1NA0 A;  4K0R A;  3ZPJ A;  3U3W A;  4ANU A;  4IN3 B;  3HYM B;  3GZ1 A;  4G1T A;  4H7Y A;  2HR2 A;  2WXR A;  1HG2 A;  2XPZ A;  4GCO A;  2JLB A;  4V3I A;  5JHB A;  4GZD A;  1ELR A;  3FUK A;  2L9B A;  1SZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...