3SNXA

Crystal structure of a putative susd-like carbohydrate binding protein (bt_1439) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
455
structure length
455
Chain Sequence
QVAVAGNAERLFNGAWYNLFEYGTTYANIGYRALQCQDDMMASDVVSRPKYGFNSSYQFNDVAIPSDGRTSFAWYLIYKTIDNCNTAISIKGDSEELRQAQGQALALRAFCYLHLVQHYQFTYLKDKDAPCVPIYTEPTTSGTKPKGKSTVAQVYQQIFDDLNLAQDYLTNYVRKGDGQKFKPNTDVVNGLMARAYLLTGQWGEAAKAAEAARKGYSLMTTTAEYEGFNNISNKEWIWGSPQTLSQSDASYNFYYLDATYVGAYSSFMADPHLMDTFVKGDIRLPLFQWMREGYLGYKKFHMRSDDTADLVLMRSAEMYLIEAEAKVRDGVALDQAVAPLNTLRTARGVGNYDVTGKTKEQVIDEILMERRRELWGEGFGITDVLRNQKAVERMALSEDMQKTEVDCWQEGGSFAKRNPLGHWFLNFPDGKAFSANSSYYLYAIPEKEINANPNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN
publication title Crystal structure of a PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN (BT_1439) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.88 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 165
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3snxA00
5FQ7A 3CK8A 3CK7A 4L7TA 4PUCA 3SGHA 3KEZA 3EJNA 5FQ4A 3SNXA 5T3RA 3MYVA 3JQ0A 3P1UA 3FDHA 3HDXA 3QNKA 5LX8A 3CK9A 3OTNA 5FQ6A 3EHNA 3CKCA 3LEWA 3GZSA 5E76A 3JYSA 3L22A 5J90A 3CGHA 5FQ8A 3NQPA 3I4GA 5E75A 5T4YA 3MX3A 3IV0A 4F53A 3CKBA 4F7AA 3MCXA 4MRUA 4LERA 4Q69A 3JQ1A 3EHMA
chains in the Genus database with same CATH superfamily
3HIZA 4U04A 3FTUA 4BX9A 2F37A 3HXEA 4JHJA 5EYPF 1B89A 3APDA 5A7DB 4DI3A 1H2UA 3CHMA 3T9KA 1BU9A 4APFA 1OT8A 4OYSA 1WAO1 2VYIA 2BF0X 3OXLA 3HVEA 4J6IA 3CVNA 1HF8A 3ZVVA 4I2WA 3PEUB 4L1BA 3ZXSA 2WXLA 4UWHA 5EYLA 1N0QA 4HXIA 2XCCA 1U3DA 3OTNA 4YVOA 5FQ6A 2KC7A 1TEZA 3FTVA 3FTYA 4JHRA 4N2SA 3G2TA 1UW4B 2P9NG 1IHGA 2R59A 3JUEA 3MYVA 5HKPA 1E7UA 4F1PA 5KWDA 4JD2G 3ESKA 2XPYA 2MRIA 4E6HA 3FUNA 5KJMA 3IHVA 4CCAA 4TXQA 1DVPA 2XZDG 1N4QA 1OY3D 3TWTA 3FU3A 4YDYA 5T8IA 2XZTG 2VTBA 4DPRA 4G25A 5KJLA 2XHEA 3ZXPA 1G3NB 2J49A 3AG4E 3UUXA 2WXJA 1XNFA 1QBQA 1TN8A 3SO8A 1HZ4A 1V55E 4HNAD 1NA0A 3D9OA 2VJ8A 4RQIA 3R7RA 3UI2A 3EHMA 3ZHEA 1W3BA 3VLFA 2FEZA 4DX1A 3VLDA 4YDEA 2IO2C 4U8VD 3UT4A 2L0IA 3PZ4A 2A5UA 4U0UA 3JUIA 4FADA 4J8EA 4GYWA 4W9RA 4TUUA 3TAXA 5JMND 2FF4A 3CVLA 2P58C 4I6JA 1A5EA 2E2EA 2XS8A 1VDYA 5BV1A 2BEDA 5EN5D 1TJFA 3Q5MA 3D9HA 4M3OA 1TNZA 5DBKA 4RLYA 3G2WA 3R9MA 4I1OB 3FTXA 4I2ZA 2P9SG 2J09A 3BEEA 5FQ7A 4AIFA 1ZU2A 3CQGB 4HOQA 3AU4A 1V54E 3MKRA 1WY6A 1U3CA 3MV3B 3FEYA 3LY8A 3CHRA 3UM0A 1HG5A 2P9PG 2IF4A 2V0PA 4GU5A 4AEZC 4UWKA 4MKTA 3DSTA 1TN7A 1NI1A 2H6HA 5JA4D 4GTSA 3TGOA 1JCSA 3NOGD 1SVXA 3APFA 2OEVA 3U4TA 5AQBA 3HG0D 2L6JA 1IQRA 1N9AA 3I4RB 3LVQE 3GYZA 4APOA 2EQXA 3C3QA 4N3AA 5HS0A 2VSYA 2GRQB 3B7SA 1JCRA 4WUYA 4PS3A 2AXVA 2PM6A 3QARA 2OOEA 4J8YA 3TWSA 1S64A 2DZNA 3FUIA 4LNBA 3OXFA 5FQ8A 4N3BA 1E96B 1WDYA 3SY2A 1D8EA 4UWFA 3PDNA 2X6IA 5FQ4A 1K8KG 2CHXA 1OCZE 1SQMA 2LAHA 2B0OE 4IULA 3LCAA 3D9IA 3T8MA 1QQEA 4HOUA 2YHEA 3L6AA 5B1BE 1HU3A 5KJNA 5AAOA 2Y4TA 2XENA 3L9TA 3CVWA 3Q9UC 3TWRA 1TNOA 3G2SA 3ONKA 2C2LA 4LUNU 4ATZD 1S0PA 3SFYA 3UMVA 5AIJA 4JW1A 1KT1A 3MCXA 2XRZA 3EU5A 4EHMA 4GMRA 3D9PA 3N71A 4F6RD 4WAFA 3DSXA 1LF8A 4DX7D 4WNDA 2AW6A 4XI9A 4EQFA 1SZAA 4TXPA 5T4YA 1TNYA 4ILHB 4AM9A 3JCKC 3UINC 1N4SA 5A6CA 4H7XA 2YQ8A 2IJGX 4HRLA 2WB2A 2WXQA 1BI8B 2EIME 4KMOA 4XX5A 1TNBA 3LXUX 1X81A 2WXIA 1JWFA 5AARA 1HG2A 2GRLA 5CHEE 3HXDA 2OCCE 3UKUG 2B6CA 3B95A 2KZTA 3DEPA 3PUKA 4JEUA 4GZ3A 3CV0A 3E37A 2YHCA 1UJJA 2NXPA 5ARGA 3DSVA 2VGXA 3EUVA 3PE4A 3C3RA 3CVPA 4RVBA 4N39A 3UIPC 3DWLG 2JABA 3BQOA 3Q75A 3VTYA 4U0SA 3D9LA 2BKGA 4ILGA 4XKCA 3RKVA 5B1AE 3MJWA 2CHWA 4J8FA 1YA0A 4GZ5A 2ETCA 5CBOA 2H6IA 3ZNGA 1N4RA 2EIKE 3TG4A 5E76A 1UOHA 2AXUA 4B93B 4PH4B 2V8SE 4BSXA 2QYJA 3QAQA 2ILRA 4HI9A 3FHEA 2C0LA 3U9WA 3CEQA 4ANWA 4DJAA 3FTSA 4EZKA 4B94A 4I1AA 1E7VA 4OAVB 1UN8A 4F1SA 5CEDB 4G24A 3KS2A 5LCWJ 4J8SA 4KT6B 3LPZA 3UM3A 4GMJA 3CHOA 4HOTA 1IHBA 2Y69E 5T3RA 3DSWA 3HYMB 4K03A 1JPLA 3W9GA 2DBAA 5BXOA 3OXGA 1UG3A 4D10C 2V4HC 4OVUA 5FT9A 3SFZA 1HH8A 4U07A 4JEHA 4B89A 1E8YA 5ANLA 3ASOE 4AJWA 2PM7A 4I9EA 3FUHA 4FLBA 2GW1A 2WPVA 3EIJA 2R2LA 2WXKA 1KLXA 1H6KA 3PZ3A 3RU0A 1D9SA 4IRUA 2Y1LE 3JXIA 4BX8A 2ZIRA 5EILA 1GW6A 4GPKA 2VGYA 2QZAA 3RO3A 4NRHB 3MV2B 2XEEA 1E8WA 3SBTB 3Q9NC 2QYUA 1OWMA 4U96D 3E4BA 5BXUA 4G8LA 5JJTA 3LVRE 2J08A 4KZCA 3DPDA 4U95D 4BSZB 5EDSA 4N5QA 5D0OD 1XGWA 3ULYA 4GZ6A 4A1GA 3Q78A 1X5BA 3FULA 3PH0C 1D8DA 5ENSD 3HRAA 3IKOB 4EZJA 4BTBA 3ZPJA 2DYRE 4Q94A 5ITZF 5J90A 3WG7E 4WNFA 4DX2A 3ABKE 1SA5A 2MOWA 3AU5A 3QC1A 2CG3A 4I1MA 1K3ZD 4A63B 5E75A 4DUIA 2LO6A 2FULA 2I1KA 5ENTD 3S2AA 2WXOA 3U64A 4RSYA 3TWQA 2EINE 2ETAA 3Q4AB 2IY0C 1AWCB 4GTMA 3HHMA 1HS6A 1BPOA 1JUQA 4CZ2D 4HFGA 4EZLA 4KVOA 1IQUA 3PREA 4BEPA 4N2QA 2X38A 3D9JA 3LY7A 3JQ1A 5AQ7A 3HXFA 1N54A 2XGMA 5KJKA 3CVUA 1L5JA 1AP7A 2V4LA 3MZLB 1NL4A 4KVMA 2XEVA 2IONA 2P9LG 2OVFA 2XGSA 3RRMB 3B7TA 3LDZA 4BETA 3FU5A 1OUVA 4JA7A 3QNKA 4WNGA 2UWJG 5CEAA 1IKND 2IU1A 5KBAA 1HE8A 2WXHA 4GA1A 4L9PA 5BNWA 2V5QC 1H0AA 4H7YA 3W9FA 4C9BB 3TWWA 4LERA 3V31A 4ATGA 4B8CB 2AWIA 2ZU6B 1NFIE 3IXEA 4O60A 3T5VA 2LNIA 4B8AA 4PS7A 3TWVA 2WMNA 3ASFA 1H19A 2WM9A 4FJYA 2V5FA 2GRMA 1DNPA 5ARFA 3PRZA 1BD8A 1H2VC 1YYHA 4C0MA 4KXKB 4PUCA 3TWXA 2RG8A 3D9NA 5FZSA 4KYOB 3O4ZA 3DSSA 1OXJA 2JLBA 3FUEA 2VSNA 2LAIA 4J8DA 3FUMA 2X6JA 4Q69A 1KZOA 3CIAA 4F53A 3CK8A 1Y6IA 4L7TA 4YDWA 3FTWA 4LNGA 4R7LA 2RKKA 3B13A 5LX8A 4AOFA 2R5SA 1UJKA 3UXGA 3UPVA 2ONDA 2WXFA 3RO2A 2VSOE 4ZFHA 4XI0A 3PNTB 2DYSE 1TNUA 2CHZA 4F7AA 5FJYA 3HXBA 3QB2A 1K1BA 4N3CA 3LYAA 3Q73A 3C98A 3V30A 3S7BA 3Q15A 1PY1A 4BERA 1MHQA 4BY6A 2XQ0A 2OVBA 3D9KA 4ANXA 4EBAA 4BT8A 3S7FA 4G11A 3R9AB 3SBSA 3CHQA 5LFAA 4K0RA 3B7RL 4GCOA 1SW6A 4CDRA 3QKYA 3SFXA 5HI7A 2WVIA 2I1JA 1N0RA 3QWPA 1MQSA 1DC2A 4GZDA 3ZYQA 4I6GA 3MEKA 3QWVA 3V2XA 5G05C 2I2OA 2IOSA 4UWGA 2UY1B 5C1DA 1NP7A 2FBNA 3TJPA 3FU6A 5HRYA 3KD7A 3ASHA 2WQHA 5AYWD 3CQCB 5G04C 5ENRD 4JL0A 1LD8A 2L0TB 4LNUD 2NC9A 3LY9A 5FWQA 3ZN3A 4L23A 1PAQA 3CLJA 3PVLA 5AENA 4UQXA 3ENEA 2LSVA 1INZA 3RK6A 1LTXA 5KCMA 2RFMA 4AVXA 4FULA 4U8YD 2IOLA 1Z3XA 5J08A 1JCQA 1KZPA 3T8KA 3KSQA 4I43A 2L9BA 2WXMA 1S63A 1FT2A 2HO1A 3U3WA 1ELRA 2J07A 2GRNB 2YNQA 2F0YA 5D0QD 2WMOA 3J5QB 4I17A 2IEJA 3BUAA 2BKKB 2BTDA 3URZA 4CGVA 4K5AB 1H6OA 2X6HA 3C72A 5CERB 1EDUA 1OCCE 5CBNA 4C0EA 5AJLA 4FC8A 2ETBA 4HOSA 3AG1E 4U63A 3C5RA 3HVEB 3T5XA 3ULEG 3FUDA 2ZGGA 3P1UA 2WQ7A 4I9CA 2M63A 3UM1A 1S70B 3LKUA 3L13A 4G8KA 1HFAA 5BPPA 1E8XA 3NQPA 3CVVA 2NYJA 3SGHA 3QOUA 3ISMC 4GTOA 4AV7A 2J4DA 4GYYA 5ENOD 3SZ7A 2CG2A 3EHNA 2QFCA 3L22A 4FA6A 1O1RA 2F8XK 4JHKA 4UI9K 2GGFA 3HDXA 4DX6D 3JXJA 3ULQA 2YINA 3ML8A 3EDTB 1K1AA 2ZISA 4HS2A 3RIBA 3UIOC 3UM2A 2ZXWE 4TRQA 2VTBB 4ME2A 5KNHD 1YCSB 3NZSA 4JA9A 1EYHA 4NQ0A 4N5CA 3TXMA 4DK5A 5IY5E 2LXLA 3ZW3A 4TUMA 3ZYMA 3CKBA 3Q7FA 1HX8A 3S7DA 5EX0A 5ENQD 1H6PA 3X2QE 1ELWA 3ZHEB 2P9UG 4LG6A 1MZCA 1JWGA 4J0UA 4UI9C 1ZB1A 2KXPC 4A3VA 3GZSA 4BESA 3ZFWA 3FU0A 3MX3A 4YDOA 3CVXA 4RG6A 3CVYA 3ZKJA 1E90A 4FLHA 4ACKA 2J9QA 3RSEG 5CRVA 3GW4A 4DLQA 5JJ7A 3MGBA 4HLLA 2PNNA 4F3VA 5BT1A 1OCRE 2R03A 3IEGA 3WXXA 2J4BA 2WXNA 3MKQA 2GRRB 5C2YA 4BT9A 3EJNA 4G23A 3ABLE 3ZYKA 4PDXA 2AXZA 2WXRA 4U0ZA 4L2YA 3FH7A 4LRZA 4GPMA 2GRPB 3SF4A 4GA2A 4HORA 2Y0BG 2Q7FA 3FY4A 4YNDA 4ABNA 2L6BA 2VGEA 2LSUA 3SNXA 4U7EB 4FHJA 1U2VG 3ZEFA 2KCVA 2ZGDA 2R02A 4MBGA 3RRUA 4CT0A 3KSLA 5EX3A 3PS6A 3E33A 3FUKA 4JZYA 4Y6CA 3UQ3A 3NBNB 5LOZA 4GTVA 2R05A 3QJZA 3L17A 3L08A 1OWPA 5CMYA 1ELKA 4FHKA 4ZHBA 3ZUVB 1OWOA 3SQVA 4BFRA 4J7WA 1FVFA 2X3MA 1N4PA 2XS1A 3L54A 2H6GA 3EHQA 3L16A 4FU3A 2A5EA 2DIWA 3F6QA 4KZ0A 1N11A 5JHAA 4ACLA 3Q49B 1EF1C 4JVSA 1QZ2A 2OV8A 3IHYA 3TG5A 3RAUA 4K5CA 3Q7AA 3V79K 5AN8A 1UN9A 2WQ6A 1Z5SC 4A1SA 2PQRA 2PQNA 3CGHA 5BUZA 3SD5A 4RG9A 1RW2A 4IYPA 1KPSB 1MX4A 3KEZA 4GZCA 5D2MC 5M72A 3JQ0A 2I6HA 4GTQA 3E34A 2J8SD 4NURA 5G55A 1FVHA 1DCQA 2A4ZA 3LEWA 3CHSA 4U8HA 2FO7A 5ANRA 3CK7A 1WM5A 4JXTA 3ESLA 4ANVA 1Q2ZA 3IBEA 2F8YA 2P9KG 4CYMD 4M7CA 3PE3A 4UUCA 2RFAA 4ILIA 3FH8A 4FJZA 3LS8A 2JEKA 4IN3B 2KATA 1SZ9A 1IXVA 2KZTB 3AAAC 4BTAA 4G1TA 3EU9A 2XEHA 4G26A 3B7UX 2VGXB 4X8QA 2EIJE 3CSTA 1TJCA 4WNEA 3ZGQA 5ENNA 2MYOA 3LJ3A 3D9MA 5AQAA 1PC2A 4O1PA 5LCWC 3BU8A 3G2VA 3PZ2A 4LCTA 4G2VA 1SA4A 3NOCD 2P2CP 3PEVB 3FWVA 3DSUA 1FT1A 4L2LA 1RZ4A 3I4GA 1MX6A 2R17C 3TL5A 4OVVA 4UI9J 3D3MA 1OWNA 3V2OA 1Z6TA 1EPUA 3NB2A 3Q79A 4NIKA 4LEUA 2LXMA 2KCKA 2H6FA 3PZ1A 2QC9A 3P2BA 4CGWA 2RD0A 3PUJA 3BG1B 3ZIMA 3GZ1A 3MA5A 3FEXA 4XE0A 3UT7A 2XPIA 1BLXB 4HI8A 2KBXA 3R7QA 2HYZA 4TXRA 3DPYA 3I3NA 3VTXA 3ZRHA 4GMLA 3FP3A 4ANUA 5CCMA 2C0MA 5HQ8A 5CRUA 3E30A 2XGOA 3PNLB 3U66A 3L82A 2DZOA 1A17A 3CVQA 4AXHA 5FZQA 3AG2E 5KNGA 4HB5A 3AG3E 4Z68A 4A3TA 4QFVA 1HO8A 2HE0A 3TXNA 4HVBA 5A23A 3VLEA 1QNFA 3NZUA 1O5MA 2Y4UA 1E8ZA 2VSXE 1N95A 1O1SA 4O6FA 3DXMG 4DRXE 1N52A 5AQ9A 2LUHA 2PL2A 1WG0A 4HQDA 4PS8A 2IQCA 5FIOA 4UQYA 4TV3A 3B7BA 3CSFA 4OAUC 3FUJA 3MKQB 3KEAA 3DBSA 3AS4A 4Q96A 1LD7A 4O1OA 3UKRG 3HXCA 4MLPA 5EIBE 4DI4A 3UX4A 3Q47B 4GTRA 3ASDA 4KBQA 3EHRA 1O1TA 2E0IA 4CDNA 3J5PA 3AJIA 1OWLA 2XRYA 3LJNA 4GYOA 4AP2A 3QDNA 2QY7A 4YVQC 4CDMA 5EIDA 3JYSA 2I9CA 5JJ6A 3NF1A 4CEMA 4URKA 4XKBA 3NAWA 2FI7A 1H2TC 5AJDA 1HXIA 3ASGA 2Y3AA 5BV0A 5BW8C 4CRWA 3BG0B 5G2NA 2DWZA 1P5QA 5LP0A 1NA3A 5H7PA 3AS8A 2DVWA 1N94A 4GTTA 3AS5A 1TN6A 2VQ2A 4WWPA 3UT8A 4CT4A 2IFUA 3DEOA 3GZ2A 4MS6A 4LSZE 3C3OA 2BUGA 3OAWA 1DCEA 3APCA 4JB8P 4K5BA 1Y8MA 5FTPA 2HM8A 1NZNA 4FP7A 4GA0A 4WWOA 4EPZA 2X6FA 3KAEA 4XZ4A 4DX5D 1TYQG 4MRUA 3SI5A 4HRMB 3E32A 3RRNB 4EECA 3SHFA 4C48B 2AJAA 2CFZA 5ENPD 1QYMA 2FO1E 4GTPA 1MJ0A 2IO3C 1IYGA 1FPPA 4Y6WA 4B0ZA 4V3IA 3S7JA 3FFLA 5CCLA 2EILE 3DXKG 1YMPA 2P9IG 3EIQC 5FINA 2PZIA 4AY6A 2NSZA 4HLEA 3TWUA 5CMWA 2GROB 1FCHA 1Z3YA 2KM4A 3ABME 4HRNA 3RJVA 3ZU7B 5DIZA 3IV0A 3FTZA 4GB9A 2DCPA 3FH5A 3PZDA 5EKQD 4QQIA 3ONLA 4P29A 2UY1A 5CECB 4GCNA 3O48A 2WXGA 4JC8A 2CFUA 5FZRA 1OCOE 2OEWA 4EBAG 4BWRA 3CHPA 4UQZA 3K9IA 3ASNE 2MHKA 3UTMA 4UWLA 3CR3A 4AY5A 1ZBPA 4JPSA 1BI7B 4DLOA 3CKCA 4NACA 1MX2A 4GAAA 2X6KA 4WWNA 5G05J 1MYOA 1KT0A 2AVPA 3QWWA 4XEIG 5JHBA 1TR4A 4A55A 3G2UA 4I6EA 3ZYLA 2WXPA 3FDHA 2XPZA 3FUFA 5D66A 3CK9A 3DRAA 3QK0A 5B3SE 2KCLA 5G04J 3ML9A 2HR2A 3I5PA 2XCBA 4XIFA 4E85A 4HBDA
chains in the Genus database with same CATH topology
2WQHA 3FHEA 2C0LA 3HIZA 4U04A 5AYWD 2JEKA 3CQCB 3FTUA 5G04C 3U9WA 4IN3B 2KATA 1SZ9A 3CEQA 4JL0A 4ANWA 4DJAA 3FTSA 2KZTB 4BTAA 4BX9A 4EZKA 4B94A 4G1TA 4JHJA 4I1AA 1E7VA 2L0TB 1B89A 3APDA 1UN8A 5A7DB 4DI3A 1H2UA 2NC9A 4G26A 4F1SA 3B7UX 2VGXB 4G24A 3LY9A 3CHMA 3KS2A 5FWQA 3ZN3A 4APFA 4OYSA 3CSTA 1TJCA 1WAO1 4L23A 5LCWJ 4J8SA 1PAQA 2VYIA 3CLJA 4KT6B 2BF0X 4WNEA 3ZGQA 3OXLA 5ENNA 3HVEA 3LJ3A 3PVLA 3LPZA 3D9MA 5AENA 4UQXA 3ENEA 4J6IA 2LSVA 4GMJA 3CHOA 3RK6A 3CVNA 1INZA 1PC2A 1HF8A 3ZVVA 4I2WA 4HOTA 5LCWC 5KCMA 3PEUB 3G2VA 4L1BA 5T3RA 3ZXSA 4LCTA 4AVXA 2WXLA 4G2VA 3HYMB 4UWHA 4FULA 2IOLA 4HXIA 2XCCA 1Z3XA 5J08A 4K03A 3PEVB 1U3DA 3FWVA 3OTNA 4YVOA 5FQ6A 4I43A 2KC7A 1JPLA 1TEZA 2L9BA 2WXMA 3FTVA 4L2LA 2HO1A 3FTYA 3U3WA 3I4GA 1ELRA 4JHRA 2DBAA 3G2TA 1UW4B 2J07A 2R17C 4N2SA 3OXGA 1UG3A 4D10C 3TL5A 2YNQA 4OVUA 4OVVA 2WMOA 4UI9J 5D0QD 3D3MA 4I17A 1IHGA 2R59A 5FT9A 3SFZA 1OWNA 1HH8A 3MYVA 4U07A 2BTDA 1Z6TA 3URZA 1EPUA 4CGVA 1E7UA 4JEHA 2X6HA 4LEUA 4B89A 1EDUA 2KCKA 3ESKA 3P2BA 4CGWA 1E8YA 2RD0A 5ANLA 3PUJA 4C0EA 3BG1B 3ZIMA 5AJLA 4AJWA 2XPYA 2MRIA 2PM7A 4FC8A 4I9EA 4E6HA 3FUHA 3FUNA 4FLBA 3GZ1A 3MA5A 5KJMA 3FEXA 4HOSA 4XE0A 2GW1A 4U63A 2WPVA 3IHVA 3UT7A 4CCAA 3HVEB 3T5XA 2XPIA 1DVPA 3EIJA 3R7QA 3FUDA 2HYZA 2WXKA 3P1UA 3I3NA 2WQ7A 1KLXA 4I9CA 1H6KA 3VTXA 3ZRHA 4GMLA 3FP3A 2M63A 3RU0A 4ANUA 3LKUA 4IRUA 3FU3A 5CCMA 2C0MA 5T8IA 3L13A 4BX8A 2VTBA 1HFAA 5BPPA 1E8XA 3NQPA 4DPRA 5HQ8A 3CVVA 1GW6A 4GPKA 2VGYA 3RO3A 4G25A 4NRHB 3MV2B 2XGOA 3PNLB 5KJLA 3U66A 1E8WA 2XHEA 3SGHA 3SBTB 1A17A 3QOUA 3CVQA 4AXHA 4AV7A 1OWMA 5FZQA 3E4BA 2J49A 4A3TA 3UUXA 2WXJA 1XNFA 2J4DA 4GYYA 5JJTA 3LVRE 4QFVA 1HO8A 2J08A 1HZ4A 3TXNA 4HVBA 5A23A 3SZ7A 2CG2A 3EHNA 1QNFA 3VLEA 4KZCA 3DPDA 1NA0A 2QFCA 3D9OA 2VJ8A 3L22A 4FA6A 3NZUA 3R7RA 5EDSA 5D0OD 3EHMA 1XGWA 3ZHEA 2Y4UA 1E8ZA 2VSXE 1W3BA 4GZ6A 3VLFA 4JHKA 4UI9K 4O6FA 2FEZA 2GGFA 4A1GA 3VLDA 3HDXA 1N52A 1X5BA 2PL2A 3FULA 3UT4A 3PH0C 3ULQA 2L0IA 2YINA 3ML8A 3EDTB 4PS8A 2A5UA 3IKOB 3JUIA 4HS2A 4U0UA 4EZJA 2IQCA 4BTBA 4UQYA 4TV3A 3ZPJA 4FADA 3RIBA 4Q94A 5J90A 4J8EA 4GYWA 4W9RA 4WNFA 3CSFA 4TRQA 4TUUA 2VTBB 3TAXA 2FF4A 4ME2A 3CVLA 2P58C 4I6JA 3FUJA 2E2EA 3MKQB 3DBSA 1VDYA 3AS4A 3NZSA 4Q96A 5BV1A 1TJFA 3Q5MA 2MOWA 4JA9A 3AU5A 4M3OA 1EYHA 3QC1A 4NQ0A 2CG3A 4MLPA 4N5CA 5DBKA 3TXMA 3G2WA 4I1MA 4DI4A 4DK5A 4I1OB 3UX4A 3Q47B 3ZW3A 3ASDA 5E75A 2LO6A 3FTXA 4I2ZA 3ZYMA 2J09A 4KBQA 3CKBA 2FULA 2I1KA 1HX8A 3S7DA 3BEEA 5EX0A 5FQ7A 3S2AA 4AIFA 2WXOA 1ZU2A 3CQGB 1ELWA 3ZHEB 4HOQA 3AU4A 3U64A 4RSYA 2E0IA 4CDNA 3MKRA 3Q4AB 1OWLA 1U3CA 1WY6A 3MV3B 1JWGA 3FEYA 2XRYA 3LY8A 3CHRA 3HHMA 1HG5A 1HS6A 1BPOA 4J0UA 1JUQA 4UI9C 4GYOA 4AP2A 2IF4A 3QDNA 2V0PA 2QY7A 4HFGA 4YVQC 4A3VA 4EZLA 3GZSA 4KVOA 3JYSA 2I9CA 4CDMA 4GU5A 5JJ6A 3ZFWA 1IQUA 3FU0A 3PREA 4AEZC 3NF1A 4N2QA 3MX3A 4UWKA 4CEMA 2X38A 3D9JA 3LY7A 4MKTA 4URKA 4XKBA 3JQ1A 3CVXA 4RG6A 1N54A 2XGMA 2FI7A 5KJKA 3CVYA 3TGOA 3CVUA 1E90A 1H2TC 4FLHA 1L5JA 3APFA 5AJDA 1HXIA 2J9QA 3ASGA 2V4LA 4ACKA 2Y3AA 3MZLB 5BV0A 3U4TA 5BW8C 4KVMA 4CRWA 3GW4A 4DLQA 2XEVA 3BG0B 5JJ7A 3MGBA 2IONA 5G2NA 1P5QA 2XGSA 1IQRA 2L6JA 2OVFA 5LP0A 4F3VA 5BT1A 3RRMB 3B7TA 3I4RB 3GYZA 3IEGA 3LVQE 4APOA 1NA3A 2EQXA 3AS8A 3LDZA 3WXXA 2J4BA 3FU5A 1OUVA 2WXNA 3MKQA 4N3AA 4JA7A 5C2YA 4BT9A 3EJNA 4G23A 2VSYA 3B7SA 4WUYA 3AS5A 3ZYKA 3QNKA 4PS3A 4WNGA 2AXVA 2PM6A 2UWJG 2AXZA 2VQ2A 4PDXA 4WWPA 3UT8A 3QARA 2OOEA 2WXRA 4CT4A 2IFUA 2IU1A 4U0ZA 4L2YA 1HE8A 3FH7A 3GZ2A 4LRZA 4MS6A 3FUIA 3OXFA 2WXHA 4GA1A 3SF4A 4GA2A 4HORA 5FQ8A 2BUGA 5BNWA 3OAWA 4N3BA 2Q7FA 1H0AA 3FY4A 4H7YA 4YNDA 4C9BB 1E96B 4ABNA 4LERA 4UWFA 2LSUA 3APCA 4ATGA 4B8CB 3PDNA 2AWIA 2X6IA 2ZU6B 5FQ4A 3SNXA 1Y8MA 2CHXA 4FHJA 3ZEFA 2KCVA 3T5VA 5FTPA 2HM8A 1SQMA 2LAHA 2LNIA 3RRUA 4IULA 3LCAA 4B8AA 4CT0A 4PS7A 3D9IA 3T8MA 1NZNA 1QQEA 5EX3A 4FP7A 4GA0A 3PS6A 4HOUA 2YHEA 4WWOA 2WMNA 4EPZA 2X6FA 3ASFA 3KAEA 1H19A 3L6AA 3FUKA 4XZ4A 1HU3A 2WM9A 4FJYA 2V5FA 5KJNA 2GRMA 1DNPA 4JZYA 2Y4TA 5ARFA 3PRZA 4MRUA 4Y6CA 3UQ3A 1H2VC 3SI5A 4C0MA 3RRNB 3CVWA 4KXKB 4EECA 4PUCA 3SHFA 5LOZA 2CFZA 1IYGA 2RG8A 3D9NA 3G2SA 3ONKA 5FZSA 4Y6WA 2C2LA 4KYOB 4LUNU 3O4ZA 4B0ZA 3QJZA 1S0PA 3L17A 4V3IA 3S7JA 3UMVA 3FFLA 3L08A 5AIJA 5CCLA 1OWPA 4JW1A 5CMYA 2JLBA 3FUEA 1ELKA 1KT1A 4FHKA 2VSNA 2LAIA 3MCXA 3FUMA 4J8DA 2X6JA 4Q69A 3CIAA 1OWOA 4F53A 3CK8A 1Y6IA 4L7TA 4BFRA 3EIQC 1FVFA 3FTWA 2X3MA 2XRZA 4R7LA 3L54A 2PZIA 3B13A 5LX8A 4AY6A 4AOFA 2R5SA 1UJKA 3D9PA 2NSZA 3N71A 4WAFA 3L16A 4FU3A 1LF8A 4HLEA 4WNDA 3UPVA 2DIWA 2ONDA 2AW6A 2WXFA 4XI9A 3RO2A 2VSOE 5CMWA 4EQFA 1SZAA 1FCHA 1Z3YA 2KM4A 4KZ0A 4XI0A 5T4YA 3PNTB 4ILHB 4AM9A 3RJVA 2CHZA 3JCKC 4F7AA 5FJYA 5DIZA 3QB2A 3IV0A 5A6CA 5JHAA 3FTZA 4GB9A 4N3CA 4ACLA 2DCPA 4H7XA 2YQ8A 3LYAA 3Q49B 1EF1C 3C98A 3FH5A 3PZDA 4JVSA 5EKQD 1QZ2A 2IJGX 2OV8A 3IHYA 2WXQA 3ONLA 4P29A 2WB2A 2UY1A 4KMOA 4GCNA 3TG5A 3S7BA 4XX5A 3LXUX 3O48A 1UN9A 2WXGA 2CFUA 4JC8A 5FZRA 2WQ6A 3Q15A 1PY1A 2WXIA 1MHQA 4A1SA 2PQRA 2PQNA 4EBAG 1JWFA 3CGHA 5BUZA 3SD5A 1HG2A 4BWRA 2GRLA 4RG9A 5CHEE 3CHPA 4UQZA 3K9IA 4BY6A 2XQ0A 2OVBA 3D9KA 4ANXA 2MHKA 4IYPA 4EBAA 4BT8A 2KZTA 4UWLA 3KEZA 3PUKA 4GZCA 3S7FA 5M72A 3CR3A 4G11A 3JQ0A 4JEUA 3R9AB 2I6HA 4AY5A 4GZ3A 3CV0A 3SBSA 3CHQA 2YHCA 1UJJA 5LFAA 4NURA 2NXPA 4K0RA 1ZBPA 5ARGA 5G55A 2VGXA 3PE4A 1FVHA 4JPSA 3B7RL 3CVPA 4GCOA 4CDRA 4DLOA 4RVBA 2A4ZA 3CKCA 3QKYA 4NACA 4N39A 3LEWA 3CHSA 5HI7A 2WVIA 4GAAA 2X6KA 4WWNA 3VTYA 4U8HA 4U0SA 3D9LA 5G05J 1KT0A 2AVPA 2FO7A 2I1JA 3QWPA 4ILGA 4XKCA 1MQSA 3RKVA 3QWWA 5ANRA 4GZDA 3CK7A 1WM5A 3MJWA 4JXTA 3ESLA 2CHWA 4I6GA 3ZYQA 5JHBA 3MEKA 4ANVA 4A55A 3G2UA 3IBEA 4I6EA 4J8FA 3ZYLA 2WXPA 3FDHA 3QWVA 2XPZA 3FUFA 5G05C 1YA0A 4GZ5A 2I2OA 2IOSA 3CK9A 4UWGA 2UY1B 5C1DA 3QK0A 3TG4A 1NP7A 2KCLA 3PE3A 2FBNA 5G04J 5E76A 3ML9A 3TJPA 2AXUA 3FU6A 2HR2A 4ILIA 4PH4B 2V8SE 4BSXA 3FH8A 3I5PA 2XCBA 4FJZA 3QAQA 3LS8A 3KD7A 2ILRA 4XIFA 4E85A 3ASHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQ7 A;  3CK8 A;  3CK7 A;  4L7T A;  4PUC A;  3SGH A;  3KEZ A;  3EJN A;  5FQ4 A;  3SNX A;  5T3R A;  3MYV A;  3JQ0 A;  3P1U A;  3FDH A;  3HDX A;  3QNK A;  5LX8 A;  3CK9 A;  3OTN A;  5FQ6 A;  3EHN A;  3CKC A;  3LEW A;  3GZS A;  5E76 A;  3JYS A;  3L22 A;  5J90 A;  3CGH A;  5FQ8 A;  3NQP A;  3I4G A;  5E75 A;  5T4Y A;  3MX3 A;  3IV0 A;  4F53 A;  3CKB A;  4F7A A;  3MCX A;  4MRU A;  4LER A;  4Q69 A;  3JQ1 A;  3EHM A; 
#chains in the Genus database with same CATH topology
 3HIZ A;  4U04 A;  3FTU A;  4BX9 A;  2F37 A;  3HXE A;  4JHJ A;  5EYP F;  1B89 A;  3APD A;  5A7D B;  4DI3 A;  1H2U A;  3CHM A;  3T9K A;  1BU9 A;  4APF A;  1OT8 A;  4OYS A;  1WAO 1;  2VYI A;  2BF0 X;  3OXL A;  3HVE A;  4J6I A;  3CVN A;  1HF8 A;  3ZVV A;  4I2W A;  3PEU B;  4L1B A;  3ZXS A;  2WXL A;  4UWH A;  5EYL A;  1N0Q A;  4HXI A;  2XCC A;  1U3D A;  3OTN A;  4YVO A;  5FQ6 A;  2KC7 A;  1TEZ A;  3FTV A;  3FTY A;  4JHR A;  4N2S A;  3G2T A;  1UW4 B;  2P9N G;  1IHG A;  2R59 A;  3JUE A;  3MYV A;  5HKP A;  1E7U A;  4F1P A;  5KWD A;  4JD2 G;  3ESK A;  2XPY A;  2MRI A;  4E6H A;  3FUN A;  5KJM A;  3IHV A;  4CCA A;  4TXQ A;  1DVP A;  2XZD G;  1N4Q A;  1OY3 D;  3TWT A;  3FU3 A;  4YDY A;  5T8I A;  2XZT G;  2VTB A;  4DPR A;  4G25 A;  5KJL A;  2XHE A;  3ZXP A;  1G3N B;  2J49 A;  3AG4 E;  3UUX A;  2WXJ A;  1XNF A;  1QBQ A;  1TN8 A;  3SO8 A;  1HZ4 A;  1V55 E;  4HNA D;  1NA0 A;  3D9O A;  2VJ8 A;  4RQI A;  3R7R A;  3UI2 A;  3EHM A;  3ZHE A;  1W3B A;  3VLF A;  2FEZ A;  4DX1 A;  3VLD A;  4YDE A;  2IO2 C;  4U8V D;  3UT4 A;  2L0I A;  3PZ4 A;  2A5U A;  4U0U A;  3JUI A;  4FAD A;  4J8E A;  4GYW A;  4W9R A;  4TUU A;  3TAX A;  5JMN D;  2FF4 A;  3CVL A;  2P58 C;  4I6J A;  1A5E A;  2E2E A;  2XS8 A;  1VDY A;  5BV1 A;  2BED A;  5EN5 D;  1TJF A;  3Q5M A;  3D9H A;  4M3O A;  1TNZ A;  5DBK A;  4RLY A;  3G2W A;  3R9M A;  4I1O B;  3FTX A;  4I2Z A;  2P9S G;  2J09 A;  3BEE A;  5FQ7 A;  4AIF A;  1ZU2 A;  3CQG B;  4HOQ A;  3AU4 A;  1V54 E;  3MKR A;  1WY6 A;  1U3C A;  3MV3 B;  3FEY A;  3LY8 A;  3CHR A;  3UM0 A;  1HG5 A;  2P9P G;  2IF4 A;  2V0P A;  4GU5 A;  4AEZ C;  4UWK A;  4MKT A;  3DST A;  1TN7 A;  1NI1 A;  2H6H A;  5JA4 D;  4GTS A;  3TGO A;  1JCS A;  3NOG D;  1SVX A;  3APF A;  2OEV A;  3U4T A;  5AQB A;  3HG0 D;  2L6J A;  1IQR A;  1N9A A;  3I4R B;  3LVQ E;  3GYZ A;  4APO A;  2EQX A;  3C3Q A;  4N3A A;  5HS0 A;  2VSY A;  2GRQ B;  3B7S A;  1JCR A;  4WUY A;  4PS3 A;  2AXV A;  2PM6 A;  3QAR A;  2OOE A;  4J8Y A;  3TWS A;  1S64 A;  2DZN A;  3FUI A;  4LNB A;  3OXF A;  5FQ8 A;  4N3B A;  1E96 B;  1WDY A;  3SY2 A;  1D8E A;  4UWF A;  3PDN A;  2X6I A;  5FQ4 A;  1K8K G;  2CHX A;  1OCZ E;  1SQM A;  2LAH A;  2B0O E;  4IUL A;  3LCA A;  3D9I A;  3T8M A;  1QQE A;  4HOU A;  2YHE A;  3L6A A;  5B1B E;  1HU3 A;  5KJN A;  5AAO A;  2Y4T A;  2XEN A;  3L9T A;  3CVW A;  3Q9U C;  3TWR A;  1TNO A;  3G2S A;  3ONK A;  2C2L A;  4LUN U;  4ATZ D;  1S0P A;  3SFY A;  3UMV A;  5AIJ A;  4JW1 A;  1KT1 A;  3MCX A;  2XRZ A;  3EU5 A;  4EHM A;  4GMR A;  3D9P A;  3N71 A;  4F6R D;  4WAF A;  3DSX A;  1LF8 A;  4DX7 D;  4WND A;  2AW6 A;  4XI9 A;  4EQF A;  1SZA A;  4TXP A;  5T4Y A;  1TNY A;  4ILH B;  4AM9 A;  3JCK C;  3UIN C;  1N4S A;  5A6C A;  4H7X A;  2YQ8 A;  2IJG X;  4HRL A;  2WB2 A;  2WXQ A;  1BI8 B;  2EIM E;  4KMO A;  4XX5 A;  1TNB A;  3LXU X;  1X81 A;  2WXI A;  1JWF A;  5AAR A;  1HG2 A;  2GRL A;  5CHE E;  3HXD A;  2OCC E;  3UKU G;  2B6C A;  3B95 A;  2KZT A;  3DEP A;  3PUK A;  4JEU A;  4GZ3 A;  3CV0 A;  3E37 A;  2YHC A;  1UJJ A;  2NXP A;  5ARG A;  3DSV A;  2VGX A;  3EUV A;  3PE4 A;  3C3R A;  3CVP A;  4RVB A;  4N39 A;  3UIP C;  3DWL G;  2JAB A;  3BQO A;  3Q75 A;  3VTY A;  4U0S A;  3D9L A;  2BKG A;  4ILG A;  4XKC A;  3RKV A;  5B1A E;  3MJW A;  2CHW A;  4J8F A;  1YA0 A;  4GZ5 A;  2ETC A;  5CBO A;  2H6I A;  3ZNG A;  1N4R A;  2EIK E;  3TG4 A;  5E76 A;  1UOH A;  2AXU A;  4B93 B;  4PH4 B;  2V8S E;  4BSX A;  2QYJ A;  3QAQ A;  2ILR A;  4HI9 A;  3FHE A;  2C0L A;  3U9W A;  3CEQ A;  4ANW A;  4DJA A;  3FTS A;  4EZK A;  4B94 A;  4I1A A;  1E7V A;  4OAV B;  1UN8 A;  4F1S A;  5CED B;  4G24 A;  3KS2 A;  5LCW J;  4J8S A;  4KT6 B;  3LPZ A;  3UM3 A;  4GMJ A;  3CHO A;  4HOT A;  1IHB A;  2Y69 E;  5T3R A;  3DSW A;  3HYM B;  4K03 A;  1JPL A;  3W9G A;  2DBA A;  5BXO A;  3OXG A;  1UG3 A;  4D10 C;  2V4H C;  4OVU A;  5FT9 A;  3SFZ A;  1HH8 A;  4U07 A;  4JEH A;  4B89 A;  1E8Y A;  5ANL A;  3ASO E;  4AJW A;  2PM7 A;  4I9E A;  3FUH A;  4FLB A;  2GW1 A;  2WPV A;  3EIJ A;  2R2L A;  2WXK A;  1KLX A;  1H6K A;  3PZ3 A;  3RU0 A;  1D9S A;  4IRU A;  2Y1L E;  3JXI A;  4BX8 A;  2ZIR A;  5EIL A;  1GW6 A;  4GPK A;  2VGY A;  2QZA A;  3RO3 A;  4NRH B;  3MV2 B;  2XEE A;  1E8W A;  3SBT B;  3Q9N C;  2QYU A;  1OWM A;  4U96 D;  3E4B A;  5BXU A;  4G8L A;  5JJT A;  3LVR E;  2J08 A;  4KZC A;  3DPD A;  4U95 D;  4BSZ B;  5EDS A;  4N5Q A;  5D0O D;  1XGW A;  3ULY A;  4GZ6 A;  4A1G A;  3Q78 A;  1X5B A;  3FUL A;  3PH0 C;  1D8D A;  5ENS D;  3HRA A;  3IKO B;  4EZJ A;  4BTB A;  3ZPJ A;  2DYR E;  4Q94 A;  5ITZ F;  5J90 A;  3WG7 E;  4WNF A;  4DX2 A;  3ABK E;  1SA5 A;  2MOW A;  3AU5 A;  3QC1 A;  2CG3 A;  4I1M A;  1K3Z D;  4A63 B;  5E75 A;  4DUI A;  2LO6 A;  2FUL A;  2I1K A;  5ENT D;  3S2A A;  2WXO A;  3U64 A;  4RSY A;  3TWQ A;  2EIN E;  2ETA A;  3Q4A B;  2IY0 C;  1AWC B;  4GTM A;  3HHM A;  1HS6 A;  1BPO A;  1JUQ A;  4CZ2 D;  4HFG A;  4EZL A;  4KVO A;  1IQU A;  3PRE A;  4BEP A;  4N2Q A;  2X38 A;  3D9J A;  3LY7 A;  3JQ1 A;  5AQ7 A;  3HXF A;  1N54 A;  2XGM A;  5KJK A;  3CVU A;  1L5J A;  1AP7 A;  2V4L A;  3MZL B;  1NL4 A;  4KVM A;  2XEV A;  2ION A;  2P9L G;  2OVF A;  2XGS A;  3RRM B;  3B7T A;  3LDZ A;  4BET A;  3FU5 A;  1OUV A;  4JA7 A;  3QNK A;  4WNG A;  2UWJ G;  5CEA A;  1IKN D;  2IU1 A;  5KBA A;  1HE8 A;  2WXH A;  4GA1 A;  4L9P A;  5BNW A;  2V5Q C;  1H0A A;  4H7Y A;  3W9F A;  4C9B B;  3TWW A;  4LER A;  3V31 A;  4ATG A;  4B8C B;  2AWI A;  2ZU6 B;  1NFI E;  3IXE A;  4O60 A;  3T5V A;  2LNI A;  4B8A A;  4PS7 A;  3TWV A;  2WMN A;  3ASF A;  1H19 A;  2WM9 A;  4FJY A;  2V5F A;  2GRM A;  1DNP A;  5ARF A;  3PRZ A;  1BD8 A;  1H2V C;  1YYH A;  4C0M A;  4KXK B;  4PUC A;  3TWX A;  2RG8 A;  3D9N A;  5FZS A;  4KYO B;  3O4Z A;  3DSS A;  1OXJ A;  2JLB A;  3FUE A;  2VSN A;  2LAI A;  4J8D A;  3FUM A;  2X6J A;  4Q69 A;  1KZO A;  3CIA A;  4F53 A;  3CK8 A;  1Y6I A;  4L7T A;  4YDW A;  3FTW A;  4LNG A;  4R7L A;  2RKK A;  3B13 A;  5LX8 A;  4AOF A;  2R5S A;  1UJK A;  3UXG A;  3UPV A;  2OND A;  2WXF A;  3RO2 A;  2VSO E;  4ZFH A;  4XI0 A;  3PNT B;  2DYS E;  1TNU A;  2CHZ A;  4F7A A;  5FJY A;  3HXB A;  3QB2 A;  1K1B A;  4N3C A;  3LYA A;  3Q73 A;  3C98 A;  3V30 A;  3S7B A;  3Q15 A;  1PY1 A;  4BER A;  1MHQ A;  4BY6 A;  2XQ0 A;  2OVB A;  3D9K A;  4ANX A;  4EBA A;  4BT8 A;  3S7F A;  4G11 A;  3R9A B;  3SBS A;  3CHQ A;  5LFA A;  4K0R A;  3B7R L;  4GCO A;  1SW6 A;  4CDR A;  3QKY A;  3SFX A;  5HI7 A;  2WVI A;  2I1J A;  1N0R A;  3QWP A;  1MQS A;  1DC2 A;  4GZD A;  3ZYQ A;  4I6G A;  3MEK A;  3QWV A;  3V2X A;  5G05 C;  2I2O A;  2IOS A;  4UWG A;  2UY1 B;  5C1D A;  1NP7 A;  2FBN A;  3TJP A;  3FU6 A;  5HRY A;  3KD7 A;  3ASH A;  2WQH A;  5AYW D;  3CQC B;  5G04 C;  5ENR D;  4JL0 A;  1LD8 A;  2L0T B;  4LNU D;  2NC9 A;  3LY9 A;  5FWQ A;  3ZN3 A;  4L23 A;  1PAQ A;  3CLJ A;  3PVL A;  5AEN A;  4UQX A;  3ENE A;  2LSV A;  1INZ A;  3RK6 A;  1LTX A;  5KCM A;  2RFM A;  4AVX A;  4FUL A;  4U8Y D;  2IOL A;  1Z3X A;  5J08 A;  1JCQ A;  1KZP A;  3T8K A;  3KSQ A;  4I43 A;  2L9B A;  2WXM A;  1S63 A;  1FT2 A;  2HO1 A;  3U3W A;  1ELR A;  2J07 A;  2GRN B;  2YNQ A;  2F0Y A;  5D0Q D;  2WMO A;  3J5Q B;  4I17 A;  2IEJ A;  3BUA A;  2BKK B;  2BTD A;  3URZ A;  4CGV A;  4K5A B;  1H6O A;  2X6H A;  3C72 A;  5CER B;  1EDU A;  1OCC E;  5CBN A;  4C0E A;  5AJL A;  4FC8 A;  2ETB A;  4HOS A;  3AG1 E;  4U63 A;  3C5R A;  3HVE B;  3T5X A;  3ULE G;  3FUD A;  2ZGG A;  3P1U A;  2WQ7 A;  4I9C A;  2M63 A;  3UM1 A;  1S70 B;  3LKU A;  3L13 A;  4G8K A;  1HFA A;  5BPP A;  1E8X A;  3NQP A;  3CVV A;  2NYJ A;  3SGH A;  3QOU A;  3ISM C;  4GTO A;  4AV7 A;  2J4D A;  4GYY A;  5ENO D;  3SZ7 A;  2CG2 A;  3EHN A;  2QFC A;  3L22 A;  4FA6 A;  1O1R A;  2F8X K;  4JHK A;  4UI9 K;  2GGF A;  3HDX A;  4DX6 D;  3JXJ A;  3ULQ A;  2YIN A;  3ML8 A;  3EDT B;  1K1A A;  2ZIS A;  4HS2 A;  3RIB A;  3UIO C;  3UM2 A;  2ZXW E;  4TRQ A;  2VTB B;  4ME2 A;  5KNH D;  1YCS B;  3NZS A;  4JA9 A;  1EYH A;  4NQ0 A;  4N5C A;  3TXM A;  4DK5 A;  5IY5 E;  2LXL A;  3ZW3 A;  4TUM A;  3ZYM A;  3CKB A;  3Q7F A;  1HX8 A;  3S7D A;  5EX0 A;  5ENQ D;  1H6P A;  3X2Q E;  1ELW A;  3ZHE B;  2P9U G;  4LG6 A;  1MZC A;  1JWG A;  4J0U A;  4UI9 C;  1ZB1 A;  2KXP C;  4A3V A;  3GZS A;  4BES A;  3ZFW A;  3FU0 A;  3MX3 A;  4YDO A;  3CVX A;  4RG6 A;  3CVY A;  3ZKJ A;  1E90 A;  4FLH A;  4ACK A;  2J9Q A;  3RSE G;  5CRV A;  3GW4 A;  4DLQ A;  5JJ7 A;  3MGB A;  4HLL A;  2PNN A;  4F3V A;  5BT1 A;  1OCR E;  2R03 A;  3IEG A;  3WXX A;  2J4B A;  2WXN A;  3MKQ A;  2GRR B;  5C2Y A;  4BT9 A;  3EJN A;  4G23 A;  3ABL E;  3ZYK A;  4PDX A;  2AXZ A;  2WXR A;  4U0Z A;  4L2Y A;  3FH7 A;  4LRZ A;  4GPM A;  2GRP B;  3SF4 A;  4GA2 A;  4HOR A;  2Y0B G;  2Q7F A;  3FY4 A;  4YND A;  4ABN A;  2L6B A;  2VGE A;  2LSU A;  3SNX A;  4U7E B;  4FHJ A;  1U2V G;  3ZEF A;  2KCV A;  2ZGD A;  2R02 A;  4MBG A;  3RRU A;  4CT0 A;  3KSL A;  5EX3 A;  3PS6 A;  3E33 A;  3FUK A;  4JZY A;  4Y6C A;  3UQ3 A;  3NBN B;  5LOZ A;  4GTV A;  2R05 A;  3QJZ A;  3L17 A;  3L08 A;  1OWP A;  5CMY A;  1ELK A;  4FHK A;  4ZHB A;  3ZUV B;  1OWO A;  3SQV A;  4BFR A;  4J7W A;  1FVF A;  2X3M A;  1N4P A;  2XS1 A;  3L54 A;  2H6G A;  3EHQ A;  3L16 A;  4FU3 A;  2A5E A;  2DIW A;  3F6Q A;  4KZ0 A;  1N11 A;  5JHA A;  4ACL A;  3Q49 B;  1EF1 C;  4JVS A;  1QZ2 A;  2OV8 A;  3IHY A;  3TG5 A;  3RAU A;  4K5C A;  3Q7A A;  3V79 K;  5AN8 A;  1UN9 A;  2WQ6 A;  1Z5S C;  4A1S A;  2PQR A;  2PQN A;  3CGH A;  5BUZ A;  3SD5 A;  4RG9 A;  1RW2 A;  4IYP A;  1KPS B;  1MX4 A;  3KEZ A;  4GZC A;  5D2M C;  5M72 A;  3JQ0 A;  2I6H A;  4GTQ A;  3E34 A;  2J8S D;  4NUR A;  5G55 A;  1FVH A;  1DCQ A;  2A4Z A;  3LEW A;  3CHS A;  4U8H A;  2FO7 A;  5ANR A;  3CK7 A;  1WM5 A;  4JXT A;  3ESL A;  4ANV A;  1Q2Z A;  3IBE A;  2F8Y A;  2P9K G;  4CYM D;  4M7C A;  3PE3 A;  4UUC A;  2RFA A;  4ILI A;  3FH8 A;  4FJZ A;  3LS8 A;  2JEK A;  4IN3 B;  2KAT A;  1SZ9 A;  1IXV A;  2KZT B;  3AAA C;  4BTA A;  4G1T A;  3EU9 A;  2XEH A;  4G26 A;  3B7U X;  2VGX B;  4X8Q A;  2EIJ E;  3CST A;  1TJC A;  4WNE A;  3ZGQ A;  5ENN A;  2MYO A;  3LJ3 A;  3D9M A;  5AQA A;  1PC2 A;  4O1P A;  5LCW C;  3BU8 A;  3G2V A;  3PZ2 A;  4LCT A;  4G2V A;  1SA4 A;  3NOC D;  2P2C P;  3PEV B;  3FWV A;  3DSU A;  1FT1 A;  4L2L A;  1RZ4 A;  3I4G A;  1MX6 A;  2R17 C;  3TL5 A;  4OVV A;  4UI9 J;  3D3M A;  1OWN A;  3V2O A;  1Z6T A;  1EPU A;  3NB2 A;  3Q79 A;  4NIK A;  4LEU A;  2LXM A;  2KCK A;  2H6F A;  3PZ1 A;  2QC9 A;  3P2B A;  4CGW A;  2RD0 A;  3PUJ A;  3BG1 B;  3ZIM A;  3GZ1 A;  3MA5 A;  3FEX A;  4XE0 A;  3UT7 A;  2XPI A;  1BLX B;  4HI8 A;  2KBX A;  3R7Q A;  2HYZ A;  4TXR A;  3DPY A;  3I3N A;  3VTX A;  3ZRH A;  4GML A;  3FP3 A;  4ANU A;  5CCM A;  2C0M A;  5HQ8 A;  5CRU A;  3E30 A;  2XGO A;  3PNL B;  3U66 A;  3L82 A;  2DZO A;  1A17 A;  3CVQ A;  4AXH A;  5FZQ A;  3AG2 E;  5KNG A;  4HB5 A;  3AG3 E;  4Z68 A;  4A3T A;  4QFV A;  1HO8 A;  2HE0 A;  3TXN A;  4HVB A;  5A23 A;  3VLE A;  1QNF A;  3NZU A;  1O5M A;  2Y4U A;  1E8Z A;  2VSX E;  1N95 A;  1O1S A;  4O6F A;  3DXM G;  4DRX E;  1N52 A;  5AQ9 A;  2LUH A;  2PL2 A;  1WG0 A;  4HQD A;  4PS8 A;  2IQC A;  5FIO A;  4UQY A;  4TV3 A;  3B7B A;  3CSF A;  4OAU C;  3FUJ A;  3MKQ B;  3KEA A;  3DBS A;  3AS4 A;  4Q96 A;  1LD7 A;  4O1O A;  3UKR G;  3HXC A;  4MLP A;  5EIB E;  4DI4 A;  3UX4 A;  3Q47 B;  4GTR A;  3ASD A;  4KBQ A;  3EHR A;  1O1T A;  2E0I A;  4CDN A;  3J5P A;  3AJI A;  1OWL A;  2XRY A;  3LJN A;  4GYO A;  4AP2 A;  3QDN A;  2QY7 A;  4YVQ C;  4CDM A;  5EID A;  3JYS A;  2I9C A;  5JJ6 A;  3NF1 A;  4CEM A;  4URK A;  4XKB A;  3NAW A;  2FI7 A;  1H2T C;  5AJD A;  1HXI A;  3ASG A;  2Y3A A;  5BV0 A;  5BW8 C;  4CRW A;  3BG0 B;  5G2N A;  2DWZ A;  1P5Q A;  5LP0 A;  1NA3 A;  5H7P A;  3AS8 A;  2DVW A;  1N94 A;  4GTT A;  3AS5 A;  1TN6 A;  2VQ2 A;  4WWP A;  3UT8 A;  4CT4 A;  2IFU A;  3DEO A;  3GZ2 A;  4MS6 A;  4LSZ E;  3C3O A;  2BUG A;  3OAW A;  1DCE A;  3APC A;  4JB8 P;  4K5B A;  1Y8M A;  5FTP A;  2HM8 A;  1NZN A;  4FP7 A;  4GA0 A;  4WWO A;  4EPZ A;  2X6F A;  3KAE A;  4XZ4 A;  4DX5 D;  1TYQ G;  4MRU A;  3SI5 A;  4HRM B;  3E32 A;  3RRN B;  4EEC A;  3SHF A;  4C48 B;  2AJA A;  2CFZ A;  5ENP D;  1QYM A;  2FO1 E;  4GTP A;  1MJ0 A;  2IO3 C;  1IYG A;  1FPP A;  4Y6W A;  4B0Z A;  4V3I A;  3S7J A;  3FFL A;  5CCL A;  2EIL E;  3DXK G;  1YMP A;  2P9I G;  3EIQ C;  5FIN A;  2PZI A;  4AY6 A;  2NSZ A;  4HLE A;  3TWU A;  5CMW A;  2GRO B;  1FCH A;  1Z3Y A;  2KM4 A;  3ABM E;  4HRN A;  3RJV A;  3ZU7 B;  5DIZ A;  3IV0 A;  3FTZ A;  4GB9 A;  2DCP A;  3FH5 A;  3PZD A;  5EKQ D;  4QQI A;  3ONL A;  4P29 A;  2UY1 A;  5CEC B;  4GCN A;  3O48 A;  2WXG A;  4JC8 A;  2CFU A;  5FZR A;  1OCO E;  2OEW A;  4EBA G;  4BWR A;  3CHP A;  4UQZ A;  3K9I A;  3ASN E;  2MHK A;  3UTM A;  4UWL A;  3CR3 A;  4AY5 A;  1ZBP A;  4JPS A;  1BI7 B;  4DLO A;  3CKC A;  4NAC A;  1MX2 A;  4GAA A;  2X6K A;  4WWN A;  5G05 J;  1MYO A;  1KT0 A;  2AVP A;  3QWW A;  4XEI G;  5JHB A;  1TR4 A;  4A55 A;  3G2U A;  4I6E A;  3ZYL A;  2WXP A;  3FDH A;  2XPZ A;  3FUF A;  5D66 A;  3CK9 A;  3DRA A;  3QK0 A;  5B3S E;  2KCL A;  5G04 J;  3ML9 A;  2HR2 A;  3I5P A;  2XCB A;  4XIF A;  4E85 A;  4HBD A; 
#chains in the Genus database with same CATH homology
 2WQH A;  3FHE A;  2C0L A;  3HIZ A;  4U04 A;  5AYW D;  2JEK A;  3CQC B;  3FTU A;  5G04 C;  3U9W A;  4IN3 B;  2KAT A;  1SZ9 A;  3CEQ A;  4JL0 A;  4ANW A;  4DJA A;  3FTS A;  2KZT B;  4BTA A;  4BX9 A;  4EZK A;  4B94 A;  4G1T A;  4JHJ A;  4I1A A;  1E7V A;  2L0T B;  1B89 A;  3APD A;  1UN8 A;  5A7D B;  4DI3 A;  1H2U A;  2NC9 A;  4G26 A;  4F1S A;  3B7U X;  2VGX B;  4G24 A;  3LY9 A;  3CHM A;  3KS2 A;  5FWQ A;  3ZN3 A;  4APF A;  4OYS A;  3CST A;  1TJC A;  1WAO 1;  4L23 A;  5LCW J;  4J8S A;  1PAQ A;  2VYI A;  3CLJ A;  4KT6 B;  2BF0 X;  4WNE A;  3ZGQ A;  3OXL A;  5ENN A;  3HVE A;  3LJ3 A;  3PVL A;  3LPZ A;  3D9M A;  5AEN A;  4UQX A;  3ENE A;  4J6I A;  2LSV A;  4GMJ A;  3CHO A;  3RK6 A;  3CVN A;  1INZ A;  1PC2 A;  1HF8 A;  3ZVV A;  4I2W A;  4HOT A;  5LCW C;  5KCM A;  3PEU B;  3G2V A;  4L1B A;  5T3R A;  3ZXS A;  4LCT A;  4AVX A;  2WXL A;  4G2V A;  3HYM B;  4UWH A;  4FUL A;  2IOL A;  4HXI A;  2XCC A;  1Z3X A;  5J08 A;  4K03 A;  3PEV B;  1U3D A;  3FWV A;  3OTN A;  4YVO A;  5FQ6 A;  4I43 A;  2KC7 A;  1JPL A;  1TEZ A;  2L9B A;  2WXM A;  3FTV A;  4L2L A;  2HO1 A;  3FTY A;  3U3W A;  3I4G A;  1ELR A;  4JHR A;  2DBA A;  3G2T A;  1UW4 B;  2J07 A;  2R17 C;  4N2S A;  3OXG A;  1UG3 A;  4D10 C;  3TL5 A;  2YNQ A;  4OVU A;  4OVV A;  2WMO A;  4UI9 J;  5D0Q D;  3D3M A;  4I17 A;  1IHG A;  2R59 A;  5FT9 A;  3SFZ A;  1OWN A;  1HH8 A;  3MYV A;  4U07 A;  2BTD A;  1Z6T A;  3URZ A;  1EPU A;  4CGV A;  1E7U A;  4JEH A;  2X6H A;  4LEU A;  4B89 A;  1EDU A;  2KCK A;  3ESK A;  3P2B A;  4CGW A;  1E8Y A;  2RD0 A;  5ANL A;  3PUJ A;  4C0E A;  3BG1 B;  3ZIM A;  5AJL A;  4AJW A;  2XPY A;  2MRI A;  2PM7 A;  4FC8 A;  4I9E A;  4E6H A;  3FUH A;  3FUN A;  4FLB A;  3GZ1 A;  3MA5 A;  5KJM A;  3FEX A;  4HOS A;  4XE0 A;  2GW1 A;  4U63 A;  2WPV A;  3IHV A;  3UT7 A;  4CCA A;  3HVE B;  3T5X A;  2XPI A;  1DVP A;  3EIJ A;  3R7Q A;  3FUD A;  2HYZ A;  2WXK A;  3P1U A;  3I3N A;  2WQ7 A;  1KLX A;  4I9C A;  1H6K A;  3VTX A;  3ZRH A;  4GML A;  3FP3 A;  2M63 A;  3RU0 A;  4ANU A;  3LKU A;  4IRU A;  3FU3 A;  5CCM A;  2C0M A;  5T8I A;  3L13 A;  4BX8 A;  2VTB A;  1HFA A;  5BPP A;  1E8X A;  3NQP A;  4DPR A;  5HQ8 A;  3CVV A;  1GW6 A;  4GPK A;  2VGY A;  3RO3 A;  4G25 A;  4NRH B;  3MV2 B;  2XGO A;  3PNL B;  5KJL A;  3U66 A;  1E8W A;  2XHE A;  3SGH A;  3SBT B;  1A17 A;  3QOU A;  3CVQ A;  4AXH A;  4AV7 A;  1OWM A;  5FZQ A;  3E4B A;  2J49 A;  4A3T A;  3UUX A;  2WXJ A;  1XNF A;  2J4D A;  4GYY A;  5JJT A;  3LVR E;  4QFV A;  1HO8 A;  2J08 A;  1HZ4 A;  3TXN A;  4HVB A;  5A23 A;  3SZ7 A;  2CG2 A;  3EHN A;  1QNF A;  3VLE A;  4KZC A;  3DPD A;  1NA0 A;  2QFC A;  3D9O A;  2VJ8 A;  3L22 A;  4FA6 A;  3NZU A;  3R7R A;  5EDS A;  5D0O D;  3EHM A;  1XGW A;  3ZHE A;  2Y4U A;  1E8Z A;  2VSX E;  1W3B A;  4GZ6 A;  3VLF A;  4JHK A;  4UI9 K;  4O6F A;  2FEZ A;  2GGF A;  4A1G A;  3VLD A;  3HDX A;  1N52 A;  1X5B A;  2PL2 A;  3FUL A;  3UT4 A;  3PH0 C;  3ULQ A;  2L0I A;  2YIN A;  3ML8 A;  3EDT B;  4PS8 A;  2A5U A;  3IKO B;  3JUI A;  4HS2 A;  4U0U A;  4EZJ A;  2IQC A;  4BTB A;  4UQY A;  4TV3 A;  3ZPJ A;  4FAD A;  3RIB A;  4Q94 A;  5J90 A;  4J8E A;  4GYW A;  4W9R A;  4WNF A;  3CSF A;  4TRQ A;  4TUU A;  2VTB B;  3TAX A;  2FF4 A;  4ME2 A;  3CVL A;  2P58 C;  4I6J A;  3FUJ A;  2E2E A;  3MKQ B;  3DBS A;  1VDY A;  3AS4 A;  3NZS A;  4Q96 A;  5BV1 A;  1TJF A;  3Q5M A;  2MOW A;  4JA9 A;  3AU5 A;  4M3O A;  1EYH A;  3QC1 A;  4NQ0 A;  2CG3 A;  4MLP A;  4N5C A;  5DBK A;  3TXM A;  3G2W A;  4I1M A;  4DI4 A;  4DK5 A;  4I1O B;  3UX4 A;  3Q47 B;  3ZW3 A;  3ASD A;  5E75 A;  2LO6 A;  3FTX A;  4I2Z A;  3ZYM A;  2J09 A;  4KBQ A;  3CKB A;  2FUL A;  2I1K A;  1HX8 A;  3S7D A;  3BEE A;  5EX0 A;  5FQ7 A;  3S2A A;  4AIF A;  2WXO A;  1ZU2 A;  3CQG B;  1ELW A;  3ZHE B;  4HOQ A;  3AU4 A;  3U64 A;  4RSY A;  2E0I A;  4CDN A;  3MKR A;  3Q4A B;  1OWL A;  1U3C A;  1WY6 A;  3MV3 B;  1JWG A;  3FEY A;  2XRY A;  3LY8 A;  3CHR A;  3HHM A;  1HG5 A;  1HS6 A;  1BPO A;  4J0U A;  1JUQ A;  4UI9 C;  4GYO A;  4AP2 A;  2IF4 A;  3QDN A;  2V0P A;  2QY7 A;  4HFG A;  4YVQ C;  4A3V A;  4EZL A;  3GZS A;  4KVO A;  3JYS A;  2I9C A;  4CDM A;  4GU5 A;  5JJ6 A;  3ZFW A;  1IQU A;  3FU0 A;  3PRE A;  4AEZ C;  3NF1 A;  4N2Q A;  3MX3 A;  4UWK A;  4CEM A;  2X38 A;  3D9J A;  3LY7 A;  4MKT A;  4URK A;  4XKB A;  3JQ1 A;  3CVX A;  4RG6 A;  1N54 A;  2XGM A;  2FI7 A;  5KJK A;  3CVY A;  3TGO A;  3CVU A;  1E90 A;  1H2T C;  4FLH A;  1L5J A;  3APF A;  5AJD A;  1HXI A;  2J9Q A;  3ASG A;  2V4L A;  4ACK A;  2Y3A A;  3MZL B;  5BV0 A;  3U4T A;  5BW8 C;  4KVM A;  4CRW A;  3GW4 A;  4DLQ A;  2XEV A;  3BG0 B;  5JJ7 A;  3MGB A;  2ION A;  5G2N A;  1P5Q A;  2XGS A;  1IQR A;  2L6J A;  2OVF A;  5LP0 A;  4F3V A;  5BT1 A;  3RRM B;  3B7T A;  3I4R B;  3GYZ A;  3IEG A;  3LVQ E;  4APO A;  1NA3 A;  2EQX A;  3AS8 A;  3LDZ A;  3WXX A;  2J4B A;  3FU5 A;  1OUV A;  2WXN A;  3MKQ A;  4N3A A;  4JA7 A;  5C2Y A;  4BT9 A;  3EJN A;  4G23 A;  2VSY A;  3B7S A;  4WUY A;  3AS5 A;  3ZYK A;  3QNK A;  4PS3 A;  4WNG A;  2AXV A;  2PM6 A;  2UWJ G;  2AXZ A;  2VQ2 A;  4PDX A;  4WWP A;  3UT8 A;  3QAR A;  2OOE A;  2WXR A;  4CT4 A;  2IFU A;  2IU1 A;  4U0Z A;  4L2Y A;  1HE8 A;  3FH7 A;  3GZ2 A;  4LRZ A;  4MS6 A;  3FUI A;  3OXF A;  2WXH A;  4GA1 A;  3SF4 A;  4GA2 A;  4HOR A;  5FQ8 A;  2BUG A;  5BNW A;  3OAW A;  4N3B A;  2Q7F A;  1H0A A;  3FY4 A;  4H7Y A;  4YND A;  4C9B B;  1E96 B;  4ABN A;  4LER A;  4UWF A;  2LSU A;  3APC A;  4ATG A;  4B8C B;  3PDN A;  2AWI A;  2X6I A;  2ZU6 B;  5FQ4 A;  3SNX A;  1Y8M A;  2CHX A;  4FHJ A;  3ZEF A;  2KCV A;  3T5V A;  5FTP A;  2HM8 A;  1SQM A;  2LAH A;  2LNI A;  3RRU A;  4IUL A;  3LCA A;  4B8A A;  4CT0 A;  4PS7 A;  3D9I A;  3T8M A;  1NZN A;  1QQE A;  5EX3 A;  4FP7 A;  4GA0 A;  3PS6 A;  4HOU A;  2YHE A;  4WWO A;  2WMN A;  4EPZ A;  2X6F A;  3ASF A;  3KAE A;  1H19 A;  3L6A A;  3FUK A;  4XZ4 A;  1HU3 A;  2WM9 A;  4FJY A;  2V5F A;  5KJN A;  2GRM A;  1DNP A;  4JZY A;  2Y4T A;  5ARF A;  3PRZ A;  4MRU A;  4Y6C A;  3UQ3 A;  1H2V C;  3SI5 A;  4C0M A;  3RRN B;  3CVW A;  4KXK B;  4EEC A;  4PUC A;  3SHF A;  5LOZ A;  2CFZ A;  1IYG A;  2RG8 A;  3D9N A;  3G2S A;  3ONK A;  5FZS A;  4Y6W A;  2C2L A;  4KYO B;  4LUN U;  3O4Z A;  4B0Z A;  3QJZ A;  1S0P A;  3L17 A;  4V3I A;  3S7J A;  3UMV A;  3FFL A;  3L08 A;  5AIJ A;  5CCL A;  1OWP A;  4JW1 A;  5CMY A;  2JLB A;  3FUE A;  1ELK A;  1KT1 A;  4FHK A;  2VSN A;  2LAI A;  3MCX A;  3FUM A;  4J8D A;  2X6J A;  4Q69 A;  3CIA A;  1OWO A;  4F53 A;  3CK8 A;  1Y6I A;  4L7T A;  4BFR A;  3EIQ C;  1FVF A;  3FTW A;  2X3M A;  2XRZ A;  4R7L A;  3L54 A;  2PZI A;  3B13 A;  5LX8 A;  4AY6 A;  4AOF A;  2R5S A;  1UJK A;  3D9P A;  2NSZ A;  3N71 A;  4WAF A;  3L16 A;  4FU3 A;  1LF8 A;  4HLE A;  4WND A;  3UPV A;  2DIW A;  2OND A;  2AW6 A;  2WXF A;  4XI9 A;  3RO2 A;  2VSO E;  5CMW A;  4EQF A;  1SZA A;  1FCH A;  1Z3Y A;  2KM4 A;  4KZ0 A;  4XI0 A;  5T4Y A;  3PNT B;  4ILH B;  4AM9 A;  3RJV A;  2CHZ A;  3JCK C;  4F7A A;  5FJY A;  5DIZ A;  3QB2 A;  3IV0 A;  5A6C A;  5JHA A;  3FTZ A;  4GB9 A;  4N3C A;  4ACL A;  2DCP A;  4H7X A;  2YQ8 A;  3LYA A;  3Q49 B;  1EF1 C;  3C98 A;  3FH5 A;  3PZD A;  4JVS A;  5EKQ D;  1QZ2 A;  2IJG X;  2OV8 A;  3IHY A;  2WXQ A;  3ONL A;  4P29 A;  2WB2 A;  2UY1 A;  4KMO A;  4GCN A;  3TG5 A;  3S7B A;  4XX5 A;  3LXU X;  3O48 A;  1UN9 A;  2WXG A;  2CFU A;  4JC8 A;  5FZR A;  2WQ6 A;  3Q15 A;  1PY1 A;  2WXI A;  1MHQ A;  4A1S A;  2PQR A;  2PQN A;  4EBA G;  1JWF A;  3CGH A;  5BUZ A;  3SD5 A;  1HG2 A;  4BWR A;  2GRL A;  4RG9 A;  5CHE E;  3CHP A;  4UQZ A;  3K9I A;  4BY6 A;  2XQ0 A;  2OVB A;  3D9K A;  4ANX A;  2MHK A;  4IYP A;  4EBA A;  4BT8 A;  2KZT A;  4UWL A;  3KEZ A;  3PUK A;  4GZC A;  3S7F A;  5M72 A;  3CR3 A;  4G11 A;  3JQ0 A;  4JEU A;  3R9A B;  2I6H A;  4AY5 A;  4GZ3 A;  3CV0 A;  3SBS A;  3CHQ A;  2YHC A;  1UJJ A;  5LFA A;  4NUR A;  2NXP A;  4K0R A;  1ZBP A;  5ARG A;  5G55 A;  2VGX A;  3PE4 A;  1FVH A;  4JPS A;  3B7R L;  3CVP A;  4GCO A;  4CDR A;  4DLO A;  4RVB A;  2A4Z A;  3CKC A;  3QKY A;  4NAC A;  4N39 A;  3LEW A;  3CHS A;  5HI7 A;  2WVI A;  4GAA A;  2X6K A;  4WWN A;  3VTY A;  4U8H A;  4U0S A;  3D9L A;  5G05 J;  1KT0 A;  2AVP A;  2FO7 A;  2I1J A;  3QWP A;  4ILG A;  4XKC A;  1MQS A;  3RKV A;  3QWW A;  5ANR A;  4GZD A;  3CK7 A;  1WM5 A;  3MJW A;  4JXT A;  3ESL A;  2CHW A;  4I6G A;  3ZYQ A;  5JHB A;  3MEK A;  4ANV A;  4A55 A;  3G2U A;  3IBE A;  4I6E A;  4J8F A;  3ZYL A;  2WXP A;  3FDH A;  3QWV A;  2XPZ A;  3FUF A;  5G05 C;  1YA0 A;  4GZ5 A;  2I2O A;  2IOS A;  3CK9 A;  4UWG A;  2UY1 B;  5C1D A;  3QK0 A;  3TG4 A;  1NP7 A;  2KCL A;  3PE3 A;  2FBN A;  5G04 J;  5E76 A;  3ML9 A;  3TJP A;  2AXU A;  3FU6 A;  2HR2 A;  4ILI A;  4PH4 B;  2V8S E;  4BSX A;  3FH8 A;  3I5P A;  2XCB A;  4FJZ A;  3QAQ A;  3LS8 A;  3KD7 A;  2ILR A;  4XIF A;  4E85 A;  3ASH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...