3SNXA

Crystal structure of a putative susd-like carbohydrate binding protein (bt_1439) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
455
structure length
455
Chain Sequence
QVAVAGNAERLFNGAWYNLFEYGTTYANIGYRALQCQDDMMASDVVSRPKYGFNSSYQFNDVAIPSDGRTSFAWYLIYKTIDNCNTAISIKGDSEELRQAQGQALALRAFCYLHLVQHYQFTYLKDKDAPCVPIYTEPTTSGTKPKGKSTVAQVYQQIFDDLNLAQDYLTNYVRKGDGQKFKPNTDVVNGLMARAYLLTGQWGEAAKAAEAARKGYSLMTTTAEYEGFNNISNKEWIWGSPQTLSQSDASYNFYYLDATYVGAYSSFMADPHLMDTFVKGDIRLPLFQWMREGYLGYKKFHMRSDDTADLVLMRSAEMYLIEAEAKVRDGVALDQAVAPLNTLRTARGVGNYDVTGKTKEQVIDEILMERRRELWGEGFGITDVLRNQKAVERMALSEDMQKTEVDCWQEGGSFAKRNPLGHWFLNFPDGKAFSANSSYYLYAIPEKEINANPNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN
publication title Crystal structure of a PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN (BT_1439) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.88 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 165
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3snxA00
4PUCA 5J90A 3EHNA 3EJNA 3JQ1A 5T3RA 3SNXA 4L7TA 4MRUA 4F7AA 3SGHA 3KEZA 3GZSA 3MYVA 3CKBA 5E75A 5T4YA 3LEWA 3IV0A 3I4GA 4LERA 3EHMA 3FDHA 3CK7A 5FQ7A 4Q69A 5LX8A 3JQ0A 3L22A 3MCXA 3MX3A 5E76A 3CKCA 3CGHA 3P1UA 3OTNA 3JYSA 3HDXA 5FQ8A 3CK9A 5FQ4A 3QNKA 5FQ6A 4F53A 3CK8A 3NQPA
chains in the Genus database with same CATH superfamily
4BFRA 2A5UA 4B94A 2E0IA 1NFIE 3SHFA 4AV7A 2ETCA 4LERA 2NYJA 3UM3A 2VGXB 3JQ0A 4GZ5A 2P58C 3KAEA 2V5QC 3J5PA 4U8HA 3ONLA 5FINA 5AAOA 5JJTA 2I2OA 3NF1A 3JUIA 1QBQA 2WXGA 4UQXA 5E75A 2XZDG 4E6HA 1OCOE 4G2VA 4MBGA 5FZSA 4EBAA 2LAHA 4HOQA 5G05J 4I1OB 4M7CA 5T3RA 1B89A 3D9HA 4U96D 2XGOA 3JCKC 1MJ0A 3AJIA 3Q78A 3QK0A 5B3SE 3FH5A 2FEZA 5EYLA 2AW6A 2ZU6B 2OV8A 1BU9A 5IY5E 3HHMA 3TXMA 2WB2A 4EECA 4GPKA 2WXFA 4HRNA 4U95D 3CKBA 2FBNA 3FUHA 1E7VA 1RZ4A 2RFMA 2PNNA 4Q69A 3VTYA 4XIFA 3R9AB 3D9NA 1H6PA 4TRQA 5AIJA 2EQXA 1TJCA 1S0PA 3LVRE 4HOTA 2XEEA 5JA4D 2F8XK 4AY5A 3ML9A 3EJNA 3G2UA 3TWVA 4BETA 4HRLA 4XI0A 3IV0A 5FQ7A 3FTXA 3RSEG 4EZLA 1ZB1A 1OCCE 1WAO1 3JQ1A 4BTAA 1BPOA 4TV3A 5KWDA 3SQVA 2PQNA 3AG2E 4IN3B 1YA0A 2VSXE 2VSOE 3PUKA 3CVQA 1U3CA 3RAUA 1EPUA 5FQ4A 5B1AE 4FA6A 3Q49B 4CCAA 4GTTA 4O1PA 3TJPA 1LD7A 2ETAA 2P9IG 1N4QA 5LP0A 4B8CB 5ENNA 2FF4A 3LYAA 3ASFA 1FPPA 4BESA 4JD2G 5T8IA 2DIWA 4FHKA 2I9CA 4U0ZA 5G55A 3HXBA 4GMLA 4OAVB 3IHYA 4DX2A 3BG1B 1JCRA 4NACA 1TR4A 3RRUA 1OT8A 4DI3A 2NXPA 1N9AA 2KZTB 5KNGA 3GW4A 1H0AA 1X81A 3TG4A 3ZN3A 3ABLE 4K5CA 5ANLA 5BNWA 1K1AA 1D8EA 3QJZA 3P2BA 1IQUA 4QQIA 1U2VG 2QYJA 3ZU7B 2R05A 1O5MA 4F6RD 4G26A 2WXKA 4ILHB 4I6JA 4U04A 4EBAG 5LX8A 2V4HC 3RU0A 1DCQA 2ZISA 2OOEA 1TEZA 2RD0A 2VGEA 4FLBA 1JCSA 5JJ6A 1KPSB 1ELRA 3CV0A 3C5RA 4WUYA 4ACLA 3S7BA 3L13A 3V2OA 1MX6A 1N0QA 4G1TA 4RG6A 2Y4UA 2WXNA 4KMOA 3NBNB 5EIDA 4H7YA 3W9FA 3ABKE 3ZFWA 3FHEA 4G8LA 5ENQD 3D9LA 2RG8A 1WM5A 4B89A 4MRUA 5C1DA 4LG6A 2A5EA 1H6OA 3MV3B 4KVMA 3APDA 5AQBA 5EDSA 2X38A 4XX5A 3CK9A 3QNKA 2X3MA 3G2SA 1UJJA 4AVXA 4BX9A 2QYUA 3IBEA 2IONA 3NB2A 1N54A 1S63A 4N5QA 4KT6B 2EINE 1NA3A 3FUEA 5FQ6A 3B7UX 3CSTA 4IRUA 3UQ3A 3N71A 2OCCE 2VGYA 2IEJA 3HG0D 2J09A 4JC8A 3Q7AA 5ANRA 5HKPA 1AP7A 3R7RA 4ZFHA 1Q2ZA 3FU6A 2C2LA 3EHQA 3PZ4A 5ENPD 1QZ2A 1V55E 3U4TA 3D9KA 3U64A 2WXIA 4ATGA 1V54E 3UT7A 3L22A 4DK5A 4FC8A 2WMOA 3ZNGA 3Q73A 2L9BA 4GCNA 1VDYA 4GTMA 3D9JA 2WXRA 4U07A 3FEYA 1N52A 3CVWA 3CVPA 1H19A 3E30A 2EIME 3RIBA 1IYGA 3SF4A 2Y4TA 3URZA 2XPYA 5BW8C 5KJNA 3L82A 4U7EB 1QYMA 2XENA 5CHEE 1KZOA 3BG0B 3PH0C 2ILRA 4ACKA 2VYIA 2XQ0A 3ASOE 1ZBPA 1JWGA 2WXMA 1IHBA 3UM0A 3LJNA 4N5CA 3U66A 3I4GA 3MKRA 3G2WA 5HS0A 2AWIA 1MZCA 4JEHA 5KJLA 2V0PA 2WXPA 3MGBA 4K03A 3CVNA 2XCCA 1E90A 3AS5A 4XKBA 3PRZA 3EIQC 4GTVA 3KEZA 4EZJA 2P9UG 4JHKA 2FO1E 5FT9A 3APCA 3MZLB 2F0YA 4Y6WA 4DX6D 3CVLA 4ANVA 1HZ4A 3FUDA 5JJ7A 3MJWA 2YQ8A 3SBTB 3ZIMA 1YYHA 4FHJA 4HBDA 4JB8P 2P9LG 4F1PA 2X6JA 3CVVA 1YMPA 5DBKA 3DEOA 2WXLA 3TWSA 4UUCA 4L9PA 1N94A 4O1OA 2VTBB 3EHNA 4L7TA 3Q47B 3DEPA 3V30A 3TWXA 4BT8A 1DVPA 4A63B 3Q4AB 4WNEA 2DWZA 3TL5A 2LXMA 2IJGX 3L54A 4NIKA 4TUUA 1NI1A 3JXIA 4WWNA 3AG3E 1Y6IA 2HO1A 5M72A 1PC2A 2GROB 2VGXA 1OY3D 3PREA 4GAAA 2L0TB 4V3IA 2P2CP 1OCZE 3DXMG 4BSZB 3KSQA 4HI8A 3LY8A 5LFAA 2UY1B 2R02A 3O4ZA 3PE4A 1NZNA 4KYOB 4LNGA 5FZRA 4HRMB 3MYVA 2LSVA 2XS8A 4AM9A 1SA4A 4ZHBA 3CGHA 4GZCA 4BX8A 4RLYA 5D0QD 1ZU2A 2GW1A 1Y8MA 4J7WA 4C48B 3KSLA 2H6IA 1SQMA 3ABME 1O1SA 4GU5A 5LOZA 3CLJA 4L1BA 3ASNE 3ZYLA 1L5JA 4O60A 2GRQB 4CGWA 2DYRE 2CHZA 1N11A 4GA2A 4WNDA 5AN8A 3FH7A 2JEKA 1XGWA 4EHMA 4U8YD 3UPVA 4AIFA 1E96B 3UM2A 2P9KG 4I2ZA 2I1KA 4IYPA 3CHOA 4TXRA 2IFUA 5ENRD 4IULA 3S7DA 4AXHA 4YDYA 3DSUA 3HIZA 3OAWA 4G8KA 3QKYA 1UW4B 4XEIG 3PVLA 4GMJA 1N4PA 3FWVA 4WWOA 2IOLA 5FIOA 3MX3A 3HXCA 3ZKJA 4D10C 3PZDA 4ILGA 4A3TA 4WNGA 2LSUA 3T8MA 3FU3A 4HQDA 3IHVA 1TN6A 1BLXB 5FZQA 3ZHEA 3FTUA 2H6FA 3WXXA 4DI4A 1UN9A 5CEDB 3SI5A 5FQ8A 3KD7A 4BWRA 3IEGA 1P5QA 1IQRA 3B95A 4UQZA 3QOUA 3NOGD 1E8WA 2WXJA 2C0MA 3C3OA 2AJAA 3UUXA 4FULA 3L9TA 1UJKA 3R7QA 3UT4A 3VLDA 3ZHEB 3IKOB 5AQAA 4F53A 5KCMA 4CT4A 2XHEA 1SW6A 3LJ3A 2Y0BG 5EILA 3DRAA 1FT2A 4JEUA 1FVHA 3B7BA 4LRZA 5D66A 1LF8A 2YHCA 3C98A 3RRMB 2XRZA 1JPLA 4CZ2D 3FUNA 3LVQE 1OWPA 4A1GA 2KZTA 1KT0A 4U0SA 5D0OD 1E8ZA 1OWOA 1O1RA 2PL2A 2BKKB 4CYMD 4N2SA 3SFXA 3AU5A 4BSXA 1EYHA 4ANUA 3CHMA 3AAAC 2L6BA 5HQ8A 2BKGA 4YDWA 3BU8A 2MHKA 5CMWA 1MX2A 4GYWA 3VTXA 4N3CA 3G2VA 1E8XA 2DCPA 3FTVA 4J8FA 3ULEG 2H6HA 2CG2A 3JUEA 2XEHA 3FUJA 2WQHA 3KS2A 1TNBA 1H2VC 2AVPA 5E76A 1NP7A 5BV0A 3HRAA 3ZRHA 4M3OA 3DSXA 4DX7D 2M63A 5DIZA 1JWFA 3AS4A 4CEMA 3L16A 3T9KA 2QY7A 3TWQA 2Q7FA 2J49A 4I43A 4DX5D 3SD5A 3RK6A 3QWWA 3ESKA 1KZPA 5CCLA 5ENTD 1BI7B 3DXKG 2XRYA 3FU0A 2MOWA 4C0EA 4F7AA 3MKQA 3LS8A 3TWRA 3ZVVA 4R7LA 1JUQA 2WMNA 1WDYA 3JYSA 5KNHD 3HDXA 2E2EA 2Y3AA 3GYZA 1OXJA 3QWPA 1DNPA 3MKQB 3DPDA 4ILIA 2F8YA 4MLPA 3P1UA 3B7RL 3ZUVB 3ZEFA 2J9QA 1HH8A 2OVFA 5CERB 3CQCB 1SVXA 4GMRA 3CHRA 2GRMA 3LKUA 4UWHA 2BTDA 1OWMA 3UXGA 4UI9C 3BUAA 3CQGB 3D9MA 4JL0A 1WG0A 2VQ2A 4FADA 4QFVA 4JZYA 4C9BB 3I4RB 2DVWA 2BUGA 2ETBA 3E34A 2VJ8A 5HRYA 5CMYA 3R9MA 5A7DB 2LXLA 2KXPC 5AARA 4JW1A 2IO3C 3ZYMA 4DX1A 2PQRA 3K9IA 4GTSA 3NZSA 2X6HA 3SY2A 2KCKA 3OXFA 1BD8A 4RSYA 2WQ6A 3CKCA 4I6EA 1H2TC 4FP7A 4G24A 1XNFA 4ANXA 3Q7FA 5CRUA 3RO2A 2R17C 5LCWC 4KXKB 3ULQA 5B1BE 5KJKA 4JHRA 3Q9UC 5BXOA 3EHMA 2OEWA 1Z5SC 3QARA 4UWFA 4I9EA 3PE3A 2R5SA 3RO3A 5G04C 2XGMA 3UI2A 3U9WA 2RFAA 4UI9K 2HM8A 2XZTG 3CHSA 2B0OE 1N95A 3CHPA 3HXFA 3ML8A 2MRIA 3QWVA 5BXUA 4MKTA 5CRVA 4B0ZA 1E8YA 5ENSD 2C0LA 4GYOA 4FLHA 3ASHA 5CBNA 5A6CA 3FUMA 3BQOA 3ZGQA 2KM4A 5ITZF 1AWCB 2CFUA 1HU3A 4UQYA 4KZCA 3S7FA 3V2XA 2ZGGA 4I1AA 3EUVA 3SO8A 2AXZA 4H7XA 3TWUA 1LTXA 5A23A 3LDZA 4DLOA 3L6AA 3D9OA 3HXEA 4HB5A 4BY6A 3UTMA 5ARGA 1WY6A 3ZPJA 2WM9A 2VTBA 4OVVA 4I2WA 3ZXSA 4CGVA 5J90A 3UM1A 1Z3YA 4HOUA 3MEKA 3C72A 3ESLA 4JHJA 2B6CA 2LNIA 3PNTB 3BEEA 3LXUX 2IQCA 4BT9A 2VSYA 5CBOA 3Q5MA 1KLXA 1EDUA 3UKRG 2IOSA 1YCSB 4I6GA 3B7TA 3LY7A 1OWLA 4HFGA 2UY1A 4GZ3A 4A55A 1TNYA 5G05C 3DSSA 2J08A 3RRNB 3C3QA 3NQPA 4HS2A 2GRNB 2YHEA 5J08A 1HO8A 2HYZA 3TWWA 4F3VA 3FDHA 4AY6A 5CECB 4GA1A 3LY9A 4K0RA 4YDOA 3ENEA 4G25A 4XZ4A 2GRPB 5C2YA 2J07A 4LSZE 4F1SA 2XPZA 2L6JA 4OVUA 2AXVA 4GCOA 4WWPA 4ME2A 4I17A 3LPZA 4GZDA 4XKCA 1DCEA 3UT8A 1OCRE 3GZ2A 3L17A 1HX8A 1HF8A 2HE0A 2QC9A 5T4YA 4LUNU 4J8SA 4B8AA 5KJMA 2IY0C 3D9IA 4HNAD 3X2QE 3J5QB 3CK8A 2P9NG 4BEPA 4YDEA 5CEAA 2GRLA 3Q79A 1BI8B 4TUMA 3ASDA 3CVXA 3OTNA 3TXNA 2OEVA 4Z68A 4LNBA 3UMVA 3FP3A 2XS1A 4GPMA 3APFA 4J8DA 1NL4A 1FCHA 2BF0X 3I3NA 3SBSA 3CEQA 3PZ1A 4G23A 5BPPA 5AQ7A 4LEUA 4C0MA 3PZ2A 3DBSA 1JCQA 3FU5A 3PEUB 1Z3XA 4TXPA 4GTPA 2ONDA 4HOSA 4B93B 1K8KG 3S7JA 1OWNA 2CHXA 4CDMA 1HFAA 2VSNA 4HXIA 1A17A 4N3AA 1HE8A 4ANWA 2LO6A 5EYPF 4OYSA 5EX3A 5H7PA 3I5PA 3FUKA 4EQFA 3UX4A 4AJWA 4GTRA 2AXUA 4L2LA 3CVYA 5JMND 1S70B 4GTQA 4GZ6A 2KBXA 2YINA 4AP2A 2PZIA 2KCVA 2EIJE 2P9PG 1TN8A 3ZYKA 3Q9NC 5AENA 3E33A 1K3ZD 3CVUA 4P29A 2H6GA 4WAFA 1OUVA 3F6QA 3TGOA 3VLEA 1HXIA 1TNUA 3QB2A 4GA0A 2R2LA 5BT1A 4JA7A 2DZOA 2Y69E 2X6FA 5JHBA 1TNZA 3QDNA 3SZ7A 2IU1A 3MCXA 3SFZA 3ZW3A 2FI7A 4N3BA 4AOFA 2GGFA 1A5EA 2FO7A 3PEVB 4NRHB 3HXDA 4JVSA 4PDXA 3RJVA 3FY4A 3DWLG 4KBQA 3SGHA 3FTYA 3HYMB 4GYYA 2L0IA 2NSZA 5FTPA 1SZ9A 5BV1A 4ATZD 1MHQA 4XE0A 5AJLA 2PM6A 4YVOA 3CIAA 3T5VA 3PS6A 4PS7A 3O48A 4A1SA 4E85A 1QQEA 2JABA 4HLLA 3LEWA 3EDTB 4Y6CA 3CHQA 4LCTA 3AG1E 4O6FA 2XCBA 1S64A 5AJDA 1IKND 3U3WA 1MQSA 3ISMC 3GZSA 2QFCA 5CCMA 4ABNA 3OXLA 5G2NA 2PM7A 4AEZC 4G11A 5AYWD 1NA0A 1FVFA 1EF1C 2ZGDA 3G2TA 1K1BA 2GRRB 2IO2C 4FJYA 2J4DA 2WQ7A 2R59A 2DBAA 1HG2A 2J8SD 4CT0A 2KCLA 3PNLB 1ELKA 4W9RA 1SZAA 3AU4A 1TYQG 4JXTA 2ZIRA 1QNFA 3ONKA 1INZA 3DSWA 2RKKA 3SNXA 2CFZA 4I1MA 3SFYA 2EIKE 3HVEA 2WXQA 3D9PA 2V8SE 3MA5A 1H6KA 1D8DA 4FU3A 1H2UA 4K5AB 3TG5A 4GB9A 5EIBE 4Q96A 1DC2A 4J0UA 1FT1A 3EU9A 4BTBA 4PUCA 2EILE 4NQ0A 3UIOC 1GW6A 2BEDA 1ELWA 3HVEB 5EX0A 3L08A 2MYOA 5FWQA 4RQIA 1UN8A 1O1TA 3W9GA 3AS8A 1D9SA 4CRWA 2WXHA 4WNFA 4YNDA 3ZXPA 4TXQA 2KATA 4LNUD 3NOCD 1IHGA 2FULA 3T5XA 4U0UA 3UIPC 3KEAA 3PUJA 3NAWA 1TNOA 1PAQA 2J4BA 3DSVA 4U8VD 1UG3A 3EHRA 2CG3A 1G3NB 3C3RA 4UWKA 2NC9A 3PDNA 3E37A 4HI9A 4MS6A 3UINC 2ZXWE 3TWTA 4U63A 2XPIA 3Q75A 3B13A 1W3BA 2XEVA 3CSFA 2P9SG 4PH4B 4I9CA 4XI9A 5D2MC 3LCAA 5FJYA 3ASGA 4HLEA 3V79K 3DPYA 3VLFA 5HI7A 2WPVA 4N2QA 2HR2A 2X6IA 4FJZA 2I6HA 4JA9A 2XGSA 4CDNA 2OVBA 3JXJA 4HORA 2V5FA 3MV2B 2LAIA 1LD8A 1U3DA 2DZNA 3B7SA 3EU5A 4UI9J 1N4SA 3NZUA 2KC7A 3E4BA 4APOA 4HVBA 4CDRA 1TN7A 1HS6A 3WG7E 4A3VA 3AG4E 2DYSE 2WXOA 3FFLA 4BERA 4KZ0A 3D3MA 3ULYA 3S2AA 1N4RA 2QZAA 2WVIA 1TJFA 3IXEA 3GZ1A 4EPZA 2I1JA 2Y1LE 4Q94A 4DUIA 3FH8A 4UWGA 4L2YA 1X5BA 1HG5A 4PS3A 1MYOA 5LCWJ 4L23A 5BUZA 3FTZA 4RVBA 3QC1A 4J8EA 3CK7A 3PZ3A 4DRXE 2LUHA 3FULA 1SA5A 1KT1A 4JPSA 5ENOD 4OAUC 3FTSA 4KVOA 3FUFA 4UWLA 5KBAA 5G04J 3FEXA 3E32A 4EZKA 3RKVA 3UKUG 2JLBA 1Z6TA 4J8YA 3OXGA 5AQ9A 1PY1A 3V31A 4J6IA 1IXVA 3CR3A 4URKA 4NURA 2IF4A 3TAXA 3T8KA 2UWJG 2CHWA 4YVQC 3FTWA 2F37A 5EKQD 4K5BA 4PS8A 2YNQA 4N39A 1N0RA 4RG9A 4GTOA 5JHAA 4X8QA 1E7UA 1RW2A 2X6KA 1MX4A 2R03A 3FUIA 1UOHA 5ARFA 5EN5D 3Q15A 4DPRA 2V4LA 4DJAA 4APFA 3QAQA 2A4ZA 3ZYQA 3EIJA 3DSTA 4DLQA
chains in the Genus database with same CATH topology
4BFRA 5BT1A 2XQ0A 2A5UA 4JA7A 4B94A 2Y3AA 3GYZA 1ZBPA 1JWGA 2WXMA 2E0IA 2X6FA 5JHBA 3SHFA 3QDNA 3QWPA 4N5CA 4AV7A 1DNPA 3U66A 3I4GA 4LERA 3MKQB 3MKRA 3DPDA 3G2WA 2VGXB 4ILIA 3SZ7A 3JQ0A 2IU1A 3MCXA 3SFZA 3ZW3A 2AWIA 4MLPA 4JEHA 5KJLA 3P1UA 2FI7A 4GZ5A 3B7RL 3ZEFA 2J9QA 2P58C 2V0PA 1HH8A 2WXPA 3MGBA 4N3BA 4K03A 4AOFA 3CVNA 2OVFA 2GGFA 2FO7A 3CQCB 3KAEA 2XCCA 3PEVB 4NRHB 3CHRA 2GRMA 1E90A 3AS5A 3LKUA 4U8HA 4JVSA 4PDXA 4XKBA 3RJVA 3ONLA 3FY4A 3PRZA 3EIQC 5JJTA 4UWHA 4KBQA 2I2OA 3NF1A 2BTDA 3JUIA 3SGHA 1OWMA 3FTYA 3KEZA 4EZJA 3HYMB 4GYYA 2WXGA 4UQXA 5E75A 4JHKA 2L0IA 4UI9C 5FT9A 3CQGB 3D9MA 2NSZA 4JL0A 2VQ2A 3APCA 3MZLB 5FTPA 4E6HA 4FADA 4G2VA 1SZ9A 4QFVA 5BV1A 4JZYA 4C9BB 5FZSA 3I4RB 4Y6WA 1MHQA 3CVLA 4XE0A 2BUGA 5AJLA 2PM6A 2LAHA 4HOQA 2VJ8A 4YVOA 4ANVA 4EBAA 1HZ4A 5G05J 4I1OB 3FUDA 5JJ7A 3CIAA 3MJWA 5CMYA 2YQ8A 3SBTB 3T5VA 3ZIMA 5A7DB 4FHJA 3PS6A 4JW1A 5T3RA 1B89A 4PS7A 3O48A 3ZYMA 2PQRA 2XGOA 3K9IA 4A1SA 4E85A 1QQEA 2X6JA 3LEWA 3CVVA 3EDTB 3NZSA 2X6HA 3JCKC 2KCKA 3OXFA 4Y6CA 4RSYA 5DBKA 2WQ6A 2WXLA 3CKCA 3QK0A 1H2TC 4I6EA 3CHQA 4LCTA 4FP7A 3FH5A 4G24A 2FEZA 2AW6A 4O6FA 2ZU6B 1XNFA 4ANXA 2XCBA 2OV8A 2VTBB 3RO2A 5AJDA 3HHMA 3EHNA 3TXMA 2R17C 2WB2A 4EECA 5LCWC 4KXKB 2WXFA 4L7TA 3ULQA 3U3WA 4GPKA 3Q47B 5KJKA 1MQSA 3GZSA 2QFCA 3CKBA 2FBNA 3FUHA 4JHRA 1E7VA 5CCMA 4ABNA 4BT8A 1DVPA 3EHMA 4Q69A 3Q4AB 3VTYA 4WNEA 3OXLA 5G2NA 3TL5A 3QARA 4UWFA 4XIFA 2PM7A 4AEZC 4G11A 3R9AB 3D9NA 4I9EA 4TRQA 2IJGX 1NA0A 3L54A 5AYWD 1FVFA 3PE3A 1EF1C 2R5SA 5AIJA 2EQXA 3G2TA 1TJCA 1S0PA 4TUUA 3LVRE 3RO3A 5G04C 2XGMA 4HOTA 4WWNA 1Y6IA 2HO1A 4AY5A 3ML9A 3EJNA 3G2UA 3U9WA 5M72A 1PC2A 4UI9K 2HM8A 4FJYA 2J4DA 2VGXA 2WQ7A 4XI0A 2R59A 2DBAA 1HG2A 3IV0A 3CHSA 5FQ7A 3PREA 3FTXA 4GAAA 4CT0A 2KCLA 3CHPA 2L0TB 3ML8A 2MRIA 3PNLB 3QWVA 4V3IA 4MKTA 4EZLA 1ELKA 4W9RA 4B0ZA 1SZAA 3LY8A 5LFAA 3AU4A 2UY1B 4JXTA 1E8YA 1QNFA 3ONKA 1WAO1 1INZA 2C0LA 3JQ1A 4GYOA 3O4ZA 3PE4A 3SNXA 2CFZA 1NZNA 4I1MA 4KYOB 1BPOA 4BTAA 4FLHA 3ASHA 5FZRA 3HVEA 4TV3A 2WXQA 3D9PA 3MYVA 2V8SE 3MA5A 5A6CA 2LSVA 3FUMA 3ZGQA 1H6KA 2KM4A 4AM9A 2PQNA 4FU3A 4IN3B 1YA0A 2CFUA 1HU3A 2VSXE 4UQYA 1H2UA 2VSOE 3CGHA 3PUKA 4KZCA 4GZCA 3CVQA 4BX8A 3S7FA 3TG5A 1U3CA 4GB9A 5D0QD 1EPUA 4Q96A 5FQ4A 1ZU2A 2GW1A 1Y8MA 4J0UA 4I1AA 4FA6A 3Q49B 4BTBA 4CCAA 4PUCA 2AXZA 4H7XA 3TJPA 4NQ0A 5LP0A 5A23A 4B8CB 1GW6A 3LDZA 1SQMA 4DLOA 5ENNA 3L6AA 3D9OA 2FF4A 4GU5A 1ELWA 4BY6A 5LOZA 3HVEB 3CLJA 4L1BA 5ARGA 5EX0A 3L08A 3LYAA 1WY6A 3ZYLA 1L5JA 4CGWA 3ZPJA 2WM9A 2CHZA 3ASFA 2VTBA 4GA2A 4OVVA 5FWQA 4WNDA 5T8IA 4I2WA 3ZXSA 1UN8A 3FH7A 2DIWA 2JEKA 4FHKA 2I9CA 4U0ZA 5G55A 4CGVA 5J90A 1XGWA 3AS8A 4CRWA 4GMLA 3UPVA 1Z3YA 4HOUA 2WXHA 4WNFA 4YNDA 4AIFA 3MEKA 3ESLA 1E96B 4JHJA 3IHYA 4I2ZA 2KATA 2I1KA 3BG1B 4IYPA 2LNIA 3CHOA 1IHGA 2FULA 2IFUA 3PNTB 4NACA 3T5XA 4U0UA 3BEEA 4IULA 3S7DA 3RRUA 3LXUX 4DI3A 2NXPA 4AXHA 2IQCA 3PUJA 4BT9A 2KZTB 3HIZA 3OAWA 2VSYA 1PAQA 2J4BA 3QKYA 1UG3A 3GW4A 1UW4B 3Q5MA 1KLXA 1EDUA 1H0AA 2CG3A 3TG4A 3ZN3A 2IOSA 4I6GA 3B7TA 4UWKA 2NC9A 5ANLA 3PVLA 4GMJA 3FWVA 3LY7A 3PDNA 1OWLA 4MS6A 4WWOA 2IOLA 5BNWA 4HFGA 3MX3A 3QJZA 4U63A 2UY1A 4GZ3A 4A55A 5G05C 2XPIA 3P2BA 1IQUA 4D10C 2J08A 3RRNB 3B13A 1W3BA 3NQPA 3PZDA 2XEVA 3CSFA 4HS2A 4ILGA 4A3TA 4PH4B 4I9CA 4XI9A 4WNGA 2YHEA 3LCAA 5FJYA 2LSUA 3T8MA 5J08A 3ASGA 4HLEA 1HO8A 3FU3A 4G26A 2WXKA 4ILHB 2HYZA 4I6JA 4U04A 4EBAG 4F3VA 3FDHA 3IHVA 3VLFA 5LX8A 5HI7A 2WPVA 5FZQA 3ZHEA 4N2QA 3FTUA 4AY6A 2HR2A 2X6IA 4GA1A 4DI4A 3WXXA 3RU0A 1UN9A 3LY9A 4K0RA 3ENEA 3SI5A 4FJZA 2I6HA 2OOEA 4JA9A 5FQ8A 1TEZA 4G25A 3KD7A 4BWRA 3IEGA 4XZ4A 5C2YA 2J07A 1P5QA 1IQRA 2RD0A 4F1SA 2XGSA 4CDNA 4FLBA 4UQZA 2OVBA 2XPZA 4HORA 3QOUA 2L6JA 4OVUA 2AXVA 5JJ6A 2V5FA 4GCOA 1ELRA 3CV0A 3MV2B 1E8WA 4WWPA 4WUYA 2LAIA 4ME2A 4ACLA 4I17A 3L13A 1U3DA 2WXJA 2C0MA 3B7SA 3LPZA 3S7BA 4GZDA 4XKCA 4UI9J 3UUXA 3UT8A 4FULA 4G1TA 4RG6A 3GZ2A 2Y4UA 3NZUA 3L17A 2KC7A 1HX8A 2WXNA 3E4BA 4KMOA 1UJKA 3R7QA 3UT4A 3VLDA 4H7YA 3ZHEB 4APOA 3IKOB 1HF8A 4CDRA 4HVBA 3ZFWA 4F53A 5KCMA 3FHEA 1HS6A 4CT4A 3D9LA 2XHEA 4A3VA 2RG8A 3LJ3A 2WXOA 1WM5A 3FFLA 4B89A 4KZ0A 3D3MA 4MRUA 5C1DA 4JEUA 1FVHA 3S2AA 4LRZA 1LF8A 5T4YA 2YHCA 3C98A 3RRMB 2WVIA 1TJFA 3MV3B 2XRZA 3GZ1A 4EPZA 4KVMA 4LUNU 4J8SA 1JPLA 3FUNA 2I1JA 3LVQE 4B8AA 1OWPA 3APDA 5EDSA 4A1GA 3D9IA 5KJMA 2X38A 2KZTA 1KT0A 4XX5A 3CK9A 4Q94A 3QNKA 4U0SA 5D0OD 2X3MA 3CK8A 3FH8A 4UWGA 1E8ZA 1OWOA 4L2YA 1X5BA 3G2SA 1HG5A 1UJJA 4PS3A 2PL2A 5LCWJ 4N2SA 4L23A 4AVXA 2GRLA 3AU5A 5BUZA 3FTZA 4RVBA 4BX9A 4BSXA 3QC1A 4J8EA 3IBEA 2IONA 1EYHA 4ANUA 3CHMA 3CK7A 3ASDA 1N54A 4KT6B 3CVXA 5HQ8A 3OTNA 3TXNA 3FULA 4JPSA 1KT1A 1NA3A 2MHKA 3FUEA 3FTSA 4GYWA 5CMWA 4KVOA 3VTXA 4N3CA 3G2VA 5FQ6A 1E8XA 3FUFA 3UMVA 4UWLA 2DCPA 5G04J 3FP3A 3FEXA 3APFA 3B7UX 3CSTA 3FTVA 4J8DA 1FCHA 2BF0X 3RKVA 4EZKA 4IRUA 3I3NA 2JLBA 1Z6TA 3N71A 3SBSA 3UQ3A 4J8FA 2VGYA 3CEQA 4G23A 5BPPA 2CG2A 4LEUA 3FUJA 2WQHA 3OXGA 3KS2A 4C0MA 2J09A 4JC8A 1PY1A 1H2VC 2AVPA 4J6IA 3DBSA 5ANRA 3R7RA 5E76A 1NP7A 3FU5A 3PEUB 1Z3XA 3CR3A 3FU6A 2C2LA 4URKA 2ONDA 4HOSA 5BV0A 3ZRHA 3S7JA 4NURA 2IF4A 1OWNA 4M3OA 1QZ2A 3TAXA 2CHXA 4CDMA 1HFAA 2VSNA 2UWJG 2M63A 4HXIA 1A17A 2CHWA 4YVQC 5DIZA 3U4TA 1JWFA 3D9KA 3FTWA 3AS4A 4N3AA 3U64A 4CEMA 1HE8A 3L16A 2WXIA 5EKQD 4ATGA 4PS8A 3UT7A 2QY7A 2LO6A 4ANWA 2YNQA 2Q7FA 4N39A 4OYSA 2J49A 4I43A 5EX3A 3L22A 3I5PA 4DK5A 3SD5A 4FC8A 3RK6A 3FUKA 2WMOA 4EQFA 3QWWA 2L9BA 3UX4A 3ESKA 4GCNA 4AJWA 1VDYA 5CCLA 4RG9A 2AXUA 4L2LA 3CVYA 3D9JA 5JHAA 2WXRA 4GZ6A 4U07A 2XRYA 3FU0A 3FEYA 1E7UA 2MOWA 4C0EA 4F7AA 3MKQA 2YINA 1N52A 3LS8A 2PZIA 4AP2A 2KCVA 3CVWA 3CVPA 1H19A 2X6KA 3ZYKA 3ZVVA 3RIBA 3FUIA 5AENA 4R7LA 1JUQA 5ARFA 4P29A 3CVUA 1IYGA 3SF4A 2WMNA 2Y4TA 3Q15A 2XPYA 3URZA 5BW8C 4DPRA 2V4LA 4DJAA 4WAFA 1OUVA 5KJNA 3JYSA 3TGOA 3VLEA 3HDXA 2E2EA 4APFA 3QAQA 1HXIA 2A4ZA 3ZYQA 5CHEE 3BG0B 3QB2A 3EIJA 3PH0C 2ILRA 4ACKA 4GA0A 2VYIA 4DLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUC A;  5J90 A;  3EHN A;  3EJN A;  3JQ1 A;  5T3R A;  3SNX A;  4L7T A;  4MRU A;  4F7A A;  3SGH A;  3KEZ A;  3GZS A;  3MYV A;  3CKB A;  5E75 A;  5T4Y A;  3LEW A;  3IV0 A;  3I4G A;  4LER A;  3EHM A;  3FDH A;  3CK7 A;  5FQ7 A;  4Q69 A;  5LX8 A;  3JQ0 A;  3L22 A;  3MCX A;  3MX3 A;  5E76 A;  3CKC A;  3CGH A;  3P1U A;  3OTN A;  3JYS A;  3HDX A;  5FQ8 A;  3CK9 A;  5FQ4 A;  3QNK A;  5FQ6 A;  4F53 A;  3CK8 A;  3NQP A; 
#chains in the Genus database with same CATH topology
 4BFR A;  2A5U A;  4B94 A;  2E0I A;  1NFI E;  3SHF A;  4AV7 A;  2ETC A;  4LER A;  2NYJ A;  3UM3 A;  2VGX B;  3JQ0 A;  4GZ5 A;  2P58 C;  3KAE A;  2V5Q C;  3J5P A;  4U8H A;  3ONL A;  5FIN A;  5AAO A;  5JJT A;  2I2O A;  3NF1 A;  3JUI A;  1QBQ A;  2WXG A;  4UQX A;  5E75 A;  2XZD G;  4E6H A;  1OCO E;  4G2V A;  4MBG A;  5FZS A;  4EBA A;  2LAH A;  4HOQ A;  5G05 J;  4I1O B;  4M7C A;  5T3R A;  1B89 A;  3D9H A;  4U96 D;  2XGO A;  3JCK C;  1MJ0 A;  3AJI A;  3Q78 A;  3QK0 A;  5B3S E;  3FH5 A;  2FEZ A;  5EYL A;  2AW6 A;  2ZU6 B;  2OV8 A;  1BU9 A;  5IY5 E;  3HHM A;  3TXM A;  2WB2 A;  4EEC A;  4GPK A;  2WXF A;  4HRN A;  4U95 D;  3CKB A;  2FBN A;  3FUH A;  1E7V A;  1RZ4 A;  2RFM A;  2PNN A;  4Q69 A;  3VTY A;  4XIF A;  3R9A B;  3D9N A;  1H6P A;  4TRQ A;  5AIJ A;  2EQX A;  1TJC A;  1S0P A;  3LVR E;  4HOT A;  2XEE A;  5JA4 D;  2F8X K;  4AY5 A;  3ML9 A;  3EJN A;  3G2U A;  3TWV A;  4BET A;  4HRL A;  4XI0 A;  3IV0 A;  5FQ7 A;  3FTX A;  3RSE G;  4EZL A;  1ZB1 A;  1OCC E;  1WAO 1;  3JQ1 A;  4BTA A;  1BPO A;  4TV3 A;  5KWD A;  3SQV A;  2PQN A;  3AG2 E;  4IN3 B;  1YA0 A;  2VSX E;  2VSO E;  3PUK A;  3CVQ A;  1U3C A;  3RAU A;  1EPU A;  5FQ4 A;  5B1A E;  4FA6 A;  3Q49 B;  4CCA A;  4GTT A;  4O1P A;  3TJP A;  1LD7 A;  2ETA A;  2P9I G;  1N4Q A;  5LP0 A;  4B8C B;  5ENN A;  2FF4 A;  3LYA A;  3ASF A;  1FPP A;  4BES A;  4JD2 G;  5T8I A;  2DIW A;  4FHK A;  2I9C A;  4U0Z A;  5G55 A;  3HXB A;  4GML A;  4OAV B;  3IHY A;  4DX2 A;  3BG1 B;  1JCR A;  4NAC A;  1TR4 A;  3RRU A;  1OT8 A;  4DI3 A;  2NXP A;  1N9A A;  2KZT B;  5KNG A;  3GW4 A;  1H0A A;  1X81 A;  3TG4 A;  3ZN3 A;  3ABL E;  4K5C A;  5ANL A;  5BNW A;  1K1A A;  1D8E A;  3QJZ A;  3P2B A;  1IQU A;  4QQI A;  1U2V G;  2QYJ A;  3ZU7 B;  2R05 A;  1O5M A;  4F6R D;  4G26 A;  2WXK A;  4ILH B;  4I6J A;  4U04 A;  4EBA G;  5LX8 A;  2V4H C;  3RU0 A;  1DCQ A;  2ZIS A;  2OOE A;  1TEZ A;  2RD0 A;  2VGE A;  4FLB A;  1JCS A;  5JJ6 A;  1KPS B;  1ELR A;  3CV0 A;  3C5R A;  4WUY A;  4ACL A;  3S7B A;  3L13 A;  3V2O A;  1MX6 A;  1N0Q A;  4G1T A;  4RG6 A;  2Y4U A;  2WXN A;  4KMO A;  3NBN B;  5EID A;  4H7Y A;  3W9F A;  3ABK E;  3ZFW A;  3FHE A;  4G8L A;  5ENQ D;  3D9L A;  2RG8 A;  1WM5 A;  4B89 A;  4MRU A;  5C1D A;  4LG6 A;  2A5E A;  1H6O A;  3MV3 B;  4KVM A;  3APD A;  5AQB A;  5EDS A;  2X38 A;  4XX5 A;  3CK9 A;  3QNK A;  2X3M A;  3G2S A;  1UJJ A;  4AVX A;  4BX9 A;  2QYU A;  3IBE A;  2ION A;  3NB2 A;  1N54 A;  1S63 A;  4N5Q A;  4KT6 B;  2EIN E;  1NA3 A;  3FUE A;  5FQ6 A;  3B7U X;  3CST A;  4IRU A;  3UQ3 A;  3N71 A;  2OCC E;  2VGY A;  2IEJ A;  3HG0 D;  2J09 A;  4JC8 A;  3Q7A A;  5ANR A;  5HKP A;  1AP7 A;  3R7R A;  4ZFH A;  1Q2Z A;  3FU6 A;  2C2L A;  3EHQ A;  3PZ4 A;  5ENP D;  1QZ2 A;  1V55 E;  3U4T A;  3D9K A;  3U64 A;  2WXI A;  4ATG A;  1V54 E;  3UT7 A;  3L22 A;  4DK5 A;  4FC8 A;  2WMO A;  3ZNG A;  3Q73 A;  2L9B A;  4GCN A;  1VDY A;  4GTM A;  3D9J A;  2WXR A;  4U07 A;  3FEY A;  1N52 A;  3CVW A;  3CVP A;  1H19 A;  3E30 A;  2EIM E;  3RIB A;  1IYG A;  3SF4 A;  2Y4T A;  3URZ A;  2XPY A;  5BW8 C;  5KJN A;  3L82 A;  4U7E B;  1QYM A;  2XEN A;  5CHE E;  1KZO A;  3BG0 B;  3PH0 C;  2ILR A;  4ACK A;  2VYI A;  2XQ0 A;  3ASO E;  1ZBP A;  1JWG A;  2WXM A;  1IHB A;  3UM0 A;  3LJN A;  4N5C A;  3U66 A;  3I4G A;  3MKR A;  3G2W A;  5HS0 A;  2AWI A;  1MZC A;  4JEH A;  5KJL A;  2V0P A;  2WXP A;  3MGB A;  4K03 A;  3CVN A;  2XCC A;  1E90 A;  3AS5 A;  4XKB A;  3PRZ A;  3EIQ C;  4GTV A;  3KEZ A;  4EZJ A;  2P9U G;  4JHK A;  2FO1 E;  5FT9 A;  3APC A;  3MZL B;  2F0Y A;  4Y6W A;  4DX6 D;  3CVL A;  4ANV A;  1HZ4 A;  3FUD A;  5JJ7 A;  3MJW A;  2YQ8 A;  3SBT B;  3ZIM A;  1YYH A;  4FHJ A;  4HBD A;  4JB8 P;  2P9L G;  4F1P A;  2X6J A;  3CVV A;  1YMP A;  5DBK A;  3DEO A;  2WXL A;  3TWS A;  4UUC A;  4L9P A;  1N94 A;  4O1O A;  2VTB B;  3EHN A;  4L7T A;  3Q47 B;  3DEP A;  3V30 A;  3TWX A;  4BT8 A;  1DVP A;  4A63 B;  3Q4A B;  4WNE A;  2DWZ A;  3TL5 A;  2LXM A;  2IJG X;  3L54 A;  4NIK A;  4TUU A;  1NI1 A;  3JXI A;  4WWN A;  3AG3 E;  1Y6I A;  2HO1 A;  5M72 A;  1PC2 A;  2GRO B;  2VGX A;  1OY3 D;  3PRE A;  4GAA A;  2L0T B;  4V3I A;  2P2C P;  1OCZ E;  3DXM G;  4BSZ B;  3KSQ A;  4HI8 A;  3LY8 A;  5LFA A;  2UY1 B;  2R02 A;  3O4Z A;  3PE4 A;  1NZN A;  4KYO B;  4LNG A;  5FZR A;  4HRM B;  3MYV A;  2LSV A;  2XS8 A;  4AM9 A;  1SA4 A;  4ZHB A;  3CGH A;  4GZC A;  4BX8 A;  4RLY A;  5D0Q D;  1ZU2 A;  2GW1 A;  1Y8M A;  4J7W A;  4C48 B;  3KSL A;  2H6I A;  1SQM A;  3ABM E;  1O1S A;  4GU5 A;  5LOZ A;  3CLJ A;  4L1B A;  3ASN E;  3ZYL A;  1L5J A;  4O60 A;  2GRQ B;  4CGW A;  2DYR E;  2CHZ A;  1N11 A;  4GA2 A;  4WND A;  5AN8 A;  3FH7 A;  2JEK A;  1XGW A;  4EHM A;  4U8Y D;  3UPV A;  4AIF A;  1E96 B;  3UM2 A;  2P9K G;  4I2Z A;  2I1K A;  4IYP A;  3CHO A;  4TXR A;  2IFU A;  5ENR D;  4IUL A;  3S7D A;  4AXH A;  4YDY A;  3DSU A;  3HIZ A;  3OAW A;  4G8K A;  3QKY A;  1UW4 B;  4XEI G;  3PVL A;  4GMJ A;  1N4P A;  3FWV A;  4WWO A;  2IOL A;  5FIO A;  3MX3 A;  3HXC A;  3ZKJ A;  4D10 C;  3PZD A;  4ILG A;  4A3T A;  4WNG A;  2LSU A;  3T8M A;  3FU3 A;  4HQD A;  3IHV A;  1TN6 A;  1BLX B;  5FZQ A;  3ZHE A;  3FTU A;  2H6F A;  3WXX A;  4DI4 A;  1UN9 A;  5CED B;  3SI5 A;  5FQ8 A;  3KD7 A;  4BWR A;  3IEG A;  1P5Q A;  1IQR A;  3B95 A;  4UQZ A;  3QOU A;  3NOG D;  1E8W A;  2WXJ A;  2C0M A;  3C3O A;  2AJA A;  3UUX A;  4FUL A;  3L9T A;  1UJK A;  3R7Q A;  3UT4 A;  3VLD A;  3ZHE B;  3IKO B;  5AQA A;  4F53 A;  5KCM A;  4CT4 A;  2XHE A;  1SW6 A;  3LJ3 A;  2Y0B G;  5EIL A;  3DRA A;  1FT2 A;  4JEU A;  1FVH A;  3B7B A;  4LRZ A;  5D66 A;  1LF8 A;  2YHC A;  3C98 A;  3RRM B;  2XRZ A;  1JPL A;  4CZ2 D;  3FUN A;  3LVQ E;  1OWP A;  4A1G A;  2KZT A;  1KT0 A;  4U0S A;  5D0O D;  1E8Z A;  1OWO A;  1O1R A;  2PL2 A;  2BKK B;  4CYM D;  4N2S A;  3SFX A;  3AU5 A;  4BSX A;  1EYH A;  4ANU A;  3CHM A;  3AAA C;  2L6B A;  5HQ8 A;  2BKG A;  4YDW A;  3BU8 A;  2MHK A;  5CMW A;  1MX2 A;  4GYW A;  3VTX A;  4N3C A;  3G2V A;  1E8X A;  2DCP A;  3FTV A;  4J8F A;  3ULE G;  2H6H A;  2CG2 A;  3JUE A;  2XEH A;  3FUJ A;  2WQH A;  3KS2 A;  1TNB A;  1H2V C;  2AVP A;  5E76 A;  1NP7 A;  5BV0 A;  3HRA A;  3ZRH A;  4M3O A;  3DSX A;  4DX7 D;  2M63 A;  5DIZ A;  1JWF A;  3AS4 A;  4CEM A;  3L16 A;  3T9K A;  2QY7 A;  3TWQ A;  2Q7F A;  2J49 A;  4I43 A;  4DX5 D;  3SD5 A;  3RK6 A;  3QWW A;  3ESK A;  1KZP A;  5CCL A;  5ENT D;  1BI7 B;  3DXK G;  2XRY A;  3FU0 A;  2MOW A;  4C0E A;  4F7A A;  3MKQ A;  3LS8 A;  3TWR A;  3ZVV A;  4R7L A;  1JUQ A;  2WMN A;  1WDY A;  3JYS A;  5KNH D;  3HDX A;  2E2E A;  2Y3A A;  3GYZ A;  1OXJ A;  3QWP A;  1DNP A;  3MKQ B;  3DPD A;  4ILI A;  2F8Y A;  4MLP A;  3P1U A;  3B7R L;  3ZUV B;  3ZEF A;  2J9Q A;  1HH8 A;  2OVF A;  5CER B;  3CQC B;  1SVX A;  4GMR A;  3CHR A;  2GRM A;  3LKU A;  4UWH A;  2BTD A;  1OWM A;  3UXG A;  4UI9 C;  3BUA A;  3CQG B;  3D9M A;  4JL0 A;  1WG0 A;  2VQ2 A;  4FAD A;  4QFV A;  4JZY A;  4C9B B;  3I4R B;  2DVW A;  2BUG A;  2ETB A;  3E34 A;  2VJ8 A;  5HRY A;  5CMY A;  3R9M A;  5A7D B;  2LXL A;  2KXP C;  5AAR A;  4JW1 A;  2IO3 C;  3ZYM A;  4DX1 A;  2PQR A;  3K9I A;  4GTS A;  3NZS A;  2X6H A;  3SY2 A;  2KCK A;  3OXF A;  1BD8 A;  4RSY A;  2WQ6 A;  3CKC A;  4I6E A;  1H2T C;  4FP7 A;  4G24 A;  1XNF A;  4ANX A;  3Q7F A;  5CRU A;  3RO2 A;  2R17 C;  5LCW C;  4KXK B;  3ULQ A;  5B1B E;  5KJK A;  4JHR A;  3Q9U C;  5BXO A;  3EHM A;  2OEW A;  1Z5S C;  3QAR A;  4UWF A;  4I9E A;  3PE3 A;  2R5S A;  3RO3 A;  5G04 C;  2XGM A;  3UI2 A;  3U9W A;  2RFA A;  4UI9 K;  2HM8 A;  2XZT G;  3CHS A;  2B0O E;  1N95 A;  3CHP A;  3HXF A;  3ML8 A;  2MRI A;  3QWV A;  5BXU A;  4MKT A;  5CRV A;  4B0Z A;  1E8Y A;  5ENS D;  2C0L A;  4GYO A;  4FLH A;  3ASH A;  5CBN A;  5A6C A;  3FUM A;  3BQO A;  3ZGQ A;  2KM4 A;  5ITZ F;  1AWC B;  2CFU A;  1HU3 A;  4UQY A;  4KZC A;  3S7F A;  3V2X A;  2ZGG A;  4I1A A;  3EUV A;  3SO8 A;  2AXZ A;  4H7X A;  3TWU A;  1LTX A;  5A23 A;  3LDZ A;  4DLO A;  3L6A A;  3D9O A;  3HXE A;  4HB5 A;  4BY6 A;  3UTM A;  5ARG A;  1WY6 A;  3ZPJ A;  2WM9 A;  2VTB A;  4OVV A;  4I2W A;  3ZXS A;  4CGV A;  5J90 A;  3UM1 A;  1Z3Y A;  4HOU A;  3MEK A;  3C72 A;  3ESL A;  4JHJ A;  2B6C A;  2LNI A;  3PNT B;  3BEE A;  3LXU X;  2IQC A;  4BT9 A;  2VSY A;  5CBO A;  3Q5M A;  1KLX A;  1EDU A;  3UKR G;  2IOS A;  1YCS B;  4I6G A;  3B7T A;  3LY7 A;  1OWL A;  4HFG A;  2UY1 A;  4GZ3 A;  4A55 A;  1TNY A;  5G05 C;  3DSS A;  2J08 A;  3RRN B;  3C3Q A;  3NQP A;  4HS2 A;  2GRN B;  2YHE A;  5J08 A;  1HO8 A;  2HYZ A;  3TWW A;  4F3V A;  3FDH A;  4AY6 A;  5CEC B;  4GA1 A;  3LY9 A;  4K0R A;  4YDO A;  3ENE A;  4G25 A;  4XZ4 A;  2GRP B;  5C2Y A;  2J07 A;  4LSZ E;  4F1S A;  2XPZ A;  2L6J A;  4OVU A;  2AXV A;  4GCO A;  4WWP A;  4ME2 A;  4I17 A;  3LPZ A;  4GZD A;  4XKC A;  1DCE A;  3UT8 A;  1OCR E;  3GZ2 A;  3L17 A;  1HX8 A;  1HF8 A;  2HE0 A;  2QC9 A;  5T4Y A;  4LUN U;  4J8S A;  4B8A A;  5KJM A;  2IY0 C;  3D9I A;  4HNA D;  3X2Q E;  3J5Q B;  3CK8 A;  2P9N G;  4BEP A;  4YDE A;  5CEA A;  2GRL A;  3Q79 A;  1BI8 B;  4TUM A;  3ASD A;  3CVX A;  3OTN A;  3TXN A;  2OEV A;  4Z68 A;  4LNB A;  3UMV A;  3FP3 A;  2XS1 A;  4GPM A;  3APF A;  4J8D A;  1NL4 A;  1FCH A;  2BF0 X;  3I3N A;  3SBS A;  3CEQ A;  3PZ1 A;  4G23 A;  5BPP A;  5AQ7 A;  4LEU A;  4C0M A;  3PZ2 A;  3DBS A;  1JCQ A;  3FU5 A;  3PEU B;  1Z3X A;  4TXP A;  4GTP A;  2OND A;  4HOS A;  4B93 B;  1K8K G;  3S7J A;  1OWN A;  2CHX A;  4CDM A;  1HFA A;  2VSN A;  4HXI A;  1A17 A;  4N3A A;  1HE8 A;  4ANW A;  2LO6 A;  5EYP F;  4OYS A;  5EX3 A;  5H7P A;  3I5P A;  3FUK A;  4EQF A;  3UX4 A;  4AJW A;  4GTR A;  2AXU A;  4L2L A;  3CVY A;  5JMN D;  1S70 B;  4GTQ A;  4GZ6 A;  2KBX A;  2YIN A;  4AP2 A;  2PZI A;  2KCV A;  2EIJ E;  2P9P G;  1TN8 A;  3ZYK A;  3Q9N C;  5AEN A;  3E33 A;  1K3Z D;  3CVU A;  4P29 A;  2H6G A;  4WAF A;  1OUV A;  3F6Q A;  3TGO A;  3VLE A;  1HXI A;  1TNU A;  3QB2 A;  4GA0 A;  2R2L A;  5BT1 A;  4JA7 A;  2DZO A;  2Y69 E;  2X6F A;  5JHB A;  1TNZ A;  3QDN A;  3SZ7 A;  2IU1 A;  3MCX A;  3SFZ A;  3ZW3 A;  2FI7 A;  4N3B A;  4AOF A;  2GGF A;  1A5E A;  2FO7 A;  3PEV B;  4NRH B;  3HXD A;  4JVS A;  4PDX A;  3RJV A;  3FY4 A;  3DWL G;  4KBQ A;  3SGH A;  3FTY A;  3HYM B;  4GYY A;  2L0I A;  2NSZ A;  5FTP A;  1SZ9 A;  5BV1 A;  4ATZ D;  1MHQ A;  4XE0 A;  5AJL A;  2PM6 A;  4YVO A;  3CIA A;  3T5V A;  3PS6 A;  4PS7 A;  3O48 A;  4A1S A;  4E85 A;  1QQE A;  2JAB A;  4HLL A;  3LEW A;  3EDT B;  4Y6C A;  3CHQ A;  4LCT A;  3AG1 E;  4O6F A;  2XCB A;  1S64 A;  5AJD A;  1IKN D;  3U3W A;  1MQS A;  3ISM C;  3GZS A;  2QFC A;  5CCM A;  4ABN A;  3OXL A;  5G2N A;  2PM7 A;  4AEZ C;  4G11 A;  5AYW D;  1NA0 A;  1FVF A;  1EF1 C;  2ZGD A;  3G2T A;  1K1B A;  2GRR B;  2IO2 C;  4FJY A;  2J4D A;  2WQ7 A;  2R59 A;  2DBA A;  1HG2 A;  2J8S D;  4CT0 A;  2KCL A;  3PNL B;  1ELK A;  4W9R A;  1SZA A;  3AU4 A;  1TYQ G;  4JXT A;  2ZIR A;  1QNF A;  3ONK A;  1INZ A;  3DSW A;  2RKK A;  3SNX A;  2CFZ A;  4I1M A;  3SFY A;  2EIK E;  3HVE A;  2WXQ A;  3D9P A;  2V8S E;  3MA5 A;  1H6K A;  1D8D A;  4FU3 A;  1H2U A;  4K5A B;  3TG5 A;  4GB9 A;  5EIB E;  4Q96 A;  1DC2 A;  4J0U A;  1FT1 A;  3EU9 A;  4BTB A;  4PUC A;  2EIL E;  4NQ0 A;  3UIO C;  1GW6 A;  2BED A;  1ELW A;  3HVE B;  5EX0 A;  3L08 A;  2MYO A;  5FWQ A;  4RQI A;  1UN8 A;  1O1T A;  3W9G A;  3AS8 A;  1D9S A;  4CRW A;  2WXH A;  4WNF A;  4YND A;  3ZXP A;  4TXQ A;  2KAT A;  4LNU D;  3NOC D;  1IHG A;  2FUL A;  3T5X A;  4U0U A;  3UIP C;  3KEA A;  3PUJ A;  3NAW A;  1TNO A;  1PAQ A;  2J4B A;  3DSV A;  4U8V D;  1UG3 A;  3EHR A;  2CG3 A;  1G3N B;  3C3R A;  4UWK A;  2NC9 A;  3PDN A;  3E37 A;  4HI9 A;  4MS6 A;  3UIN C;  2ZXW E;  3TWT A;  4U63 A;  2XPI A;  3Q75 A;  3B13 A;  1W3B A;  2XEV A;  3CSF A;  2P9S G;  4PH4 B;  4I9C A;  4XI9 A;  5D2M C;  3LCA A;  5FJY A;  3ASG A;  4HLE A;  3V79 K;  3DPY A;  3VLF A;  5HI7 A;  2WPV A;  4N2Q A;  2HR2 A;  2X6I A;  4FJZ A;  2I6H A;  4JA9 A;  2XGS A;  4CDN A;  2OVB A;  3JXJ A;  4HOR A;  2V5F A;  3MV2 B;  2LAI A;  1LD8 A;  1U3D A;  2DZN A;  3B7S A;  3EU5 A;  4UI9 J;  1N4S A;  3NZU A;  2KC7 A;  3E4B A;  4APO A;  4HVB A;  4CDR A;  1TN7 A;  1HS6 A;  3WG7 E;  4A3V A;  3AG4 E;  2DYS E;  2WXO A;  3FFL A;  4BER A;  4KZ0 A;  3D3M A;  3ULY A;  3S2A A;  1N4R A;  2QZA A;  2WVI A;  1TJF A;  3IXE A;  3GZ1 A;  4EPZ A;  2I1J A;  2Y1L E;  4Q94 A;  4DUI A;  3FH8 A;  4UWG A;  4L2Y A;  1X5B A;  1HG5 A;  4PS3 A;  1MYO A;  5LCW J;  4L23 A;  5BUZ A;  3FTZ A;  4RVB A;  3QC1 A;  4J8E A;  3CK7 A;  3PZ3 A;  4DRX E;  2LUH A;  3FUL A;  1SA5 A;  1KT1 A;  4JPS A;  5ENO D;  4OAU C;  3FTS A;  4KVO A;  3FUF A;  4UWL A;  5KBA A;  5G04 J;  3FEX A;  3E32 A;  4EZK A;  3RKV A;  3UKU G;  2JLB A;  1Z6T A;  4J8Y A;  3OXG A;  5AQ9 A;  1PY1 A;  3V31 A;  4J6I A;  1IXV A;  3CR3 A;  4URK A;  4NUR A;  2IF4 A;  3TAX A;  3T8K A;  2UWJ G;  2CHW A;  4YVQ C;  3FTW A;  2F37 A;  5EKQ D;  4K5B A;  4PS8 A;  2YNQ A;  4N39 A;  1N0R A;  4RG9 A;  4GTO A;  5JHA A;  4X8Q A;  1E7U A;  1RW2 A;  2X6K A;  1MX4 A;  2R03 A;  3FUI A;  1UOH A;  5ARF A;  5EN5 D;  3Q15 A;  4DPR A;  2V4L A;  4DJA A;  4APF A;  3QAQ A;  2A4Z A;  3ZYQ A;  3EIJ A;  3DST A;  4DLQ A; 
#chains in the Genus database with same CATH homology
 4BFR A;  5BT1 A;  2XQ0 A;  2A5U A;  4JA7 A;  4B94 A;  2Y3A A;  3GYZ A;  1ZBP A;  1JWG A;  2WXM A;  2E0I A;  2X6F A;  5JHB A;  3SHF A;  3QDN A;  3QWP A;  4N5C A;  4AV7 A;  1DNP A;  3U66 A;  3I4G A;  4LER A;  3MKQ B;  3MKR A;  3DPD A;  3G2W A;  2VGX B;  4ILI A;  3SZ7 A;  3JQ0 A;  2IU1 A;  3MCX A;  3SFZ A;  3ZW3 A;  2AWI A;  4MLP A;  4JEH A;  5KJL A;  3P1U A;  2FI7 A;  4GZ5 A;  3B7R L;  3ZEF A;  2J9Q A;  2P58 C;  2V0P A;  1HH8 A;  2WXP A;  3MGB A;  4N3B A;  4K03 A;  4AOF A;  3CVN A;  2OVF A;  2GGF A;  2FO7 A;  3CQC B;  3KAE A;  2XCC A;  3PEV B;  4NRH B;  3CHR A;  2GRM A;  1E90 A;  3AS5 A;  3LKU A;  4U8H A;  4JVS A;  4PDX A;  4XKB A;  3RJV A;  3ONL A;  3FY4 A;  3PRZ A;  3EIQ C;  5JJT A;  4UWH A;  4KBQ A;  2I2O A;  3NF1 A;  2BTD A;  3JUI A;  3SGH A;  1OWM A;  3FTY A;  3KEZ A;  4EZJ A;  3HYM B;  4GYY A;  2WXG A;  4UQX A;  5E75 A;  4JHK A;  2L0I A;  4UI9 C;  5FT9 A;  3CQG B;  3D9M A;  2NSZ A;  4JL0 A;  2VQ2 A;  3APC A;  3MZL B;  5FTP A;  4E6H A;  4FAD A;  4G2V A;  1SZ9 A;  4QFV A;  5BV1 A;  4JZY A;  4C9B B;  5FZS A;  3I4R B;  4Y6W A;  1MHQ A;  3CVL A;  4XE0 A;  2BUG A;  5AJL A;  2PM6 A;  2LAH A;  4HOQ A;  2VJ8 A;  4YVO A;  4ANV A;  4EBA A;  1HZ4 A;  5G05 J;  4I1O B;  3FUD A;  5JJ7 A;  3CIA A;  3MJW A;  5CMY A;  2YQ8 A;  3SBT B;  3T5V A;  3ZIM A;  5A7D B;  4FHJ A;  3PS6 A;  4JW1 A;  5T3R A;  1B89 A;  4PS7 A;  3O48 A;  3ZYM A;  2PQR A;  2XGO A;  3K9I A;  4A1S A;  4E85 A;  1QQE A;  2X6J A;  3LEW A;  3CVV A;  3EDT B;  3NZS A;  2X6H A;  3JCK C;  2KCK A;  3OXF A;  4Y6C A;  4RSY A;  5DBK A;  2WQ6 A;  2WXL A;  3CKC A;  3QK0 A;  1H2T C;  4I6E A;  3CHQ A;  4LCT A;  4FP7 A;  3FH5 A;  4G24 A;  2FEZ A;  2AW6 A;  4O6F A;  2ZU6 B;  1XNF A;  4ANX A;  2XCB A;  2OV8 A;  2VTB B;  3RO2 A;  5AJD A;  3HHM A;  3EHN A;  3TXM A;  2R17 C;  2WB2 A;  4EEC A;  5LCW C;  4KXK B;  2WXF A;  4L7T A;  3ULQ A;  3U3W A;  4GPK A;  3Q47 B;  5KJK A;  1MQS A;  3GZS A;  2QFC A;  3CKB A;  2FBN A;  3FUH A;  4JHR A;  1E7V A;  5CCM A;  4ABN A;  4BT8 A;  1DVP A;  3EHM A;  4Q69 A;  3Q4A B;  3VTY A;  4WNE A;  3OXL A;  5G2N A;  3TL5 A;  3QAR A;  4UWF A;  4XIF A;  2PM7 A;  4AEZ C;  4G11 A;  3R9A B;  3D9N A;  4I9E A;  4TRQ A;  2IJG X;  1NA0 A;  3L54 A;  5AYW D;  1FVF A;  3PE3 A;  1EF1 C;  2R5S A;  5AIJ A;  2EQX A;  3G2T A;  1TJC A;  1S0P A;  4TUU A;  3LVR E;  3RO3 A;  5G04 C;  2XGM A;  4HOT A;  4WWN A;  1Y6I A;  2HO1 A;  4AY5 A;  3ML9 A;  3EJN A;  3G2U A;  3U9W A;  5M72 A;  1PC2 A;  4UI9 K;  2HM8 A;  4FJY A;  2J4D A;  2VGX A;  2WQ7 A;  4XI0 A;  2R59 A;  2DBA A;  1HG2 A;  3IV0 A;  3CHS A;  5FQ7 A;  3PRE A;  3FTX A;  4GAA A;  4CT0 A;  2KCL A;  3CHP A;  2L0T B;  3ML8 A;  2MRI A;  3PNL B;  3QWV A;  4V3I A;  4MKT A;  4EZL A;  1ELK A;  4W9R A;  4B0Z A;  1SZA A;  3LY8 A;  5LFA A;  3AU4 A;  2UY1 B;  4JXT A;  1E8Y A;  1QNF A;  3ONK A;  1WAO 1;  1INZ A;  2C0L A;  3JQ1 A;  4GYO A;  3O4Z A;  3PE4 A;  3SNX A;  2CFZ A;  1NZN A;  4I1M A;  4KYO B;  1BPO A;  4BTA A;  4FLH A;  3ASH A;  5FZR A;  3HVE A;  4TV3 A;  2WXQ A;  3D9P A;  3MYV A;  2V8S E;  3MA5 A;  5A6C A;  2LSV A;  3FUM A;  3ZGQ A;  1H6K A;  2KM4 A;  4AM9 A;  2PQN A;  4FU3 A;  4IN3 B;  1YA0 A;  2CFU A;  1HU3 A;  2VSX E;  4UQY A;  1H2U A;  2VSO E;  3CGH A;  3PUK A;  4KZC A;  4GZC A;  3CVQ A;  4BX8 A;  3S7F A;  3TG5 A;  1U3C A;  4GB9 A;  5D0Q D;  1EPU A;  4Q96 A;  5FQ4 A;  1ZU2 A;  2GW1 A;  1Y8M A;  4J0U A;  4I1A A;  4FA6 A;  3Q49 B;  4BTB A;  4CCA A;  4PUC A;  2AXZ A;  4H7X A;  3TJP A;  4NQ0 A;  5LP0 A;  5A23 A;  4B8C B;  1GW6 A;  3LDZ A;  1SQM A;  4DLO A;  5ENN A;  3L6A A;  3D9O A;  2FF4 A;  4GU5 A;  1ELW A;  4BY6 A;  5LOZ A;  3HVE B;  3CLJ A;  4L1B A;  5ARG A;  5EX0 A;  3L08 A;  3LYA A;  1WY6 A;  3ZYL A;  1L5J A;  4CGW A;  3ZPJ A;  2WM9 A;  2CHZ A;  3ASF A;  2VTB A;  4GA2 A;  4OVV A;  5FWQ A;  4WND A;  5T8I A;  4I2W A;  3ZXS A;  1UN8 A;  3FH7 A;  2DIW A;  2JEK A;  4FHK A;  2I9C A;  4U0Z A;  5G55 A;  4CGV A;  5J90 A;  1XGW A;  3AS8 A;  4CRW A;  4GML A;  3UPV A;  1Z3Y A;  4HOU A;  2WXH A;  4WNF A;  4YND A;  4AIF A;  3MEK A;  3ESL A;  1E96 B;  4JHJ A;  3IHY A;  4I2Z A;  2KAT A;  2I1K A;  3BG1 B;  4IYP A;  2LNI A;  3CHO A;  1IHG A;  2FUL A;  2IFU A;  3PNT B;  4NAC A;  3T5X A;  4U0U A;  3BEE A;  4IUL A;  3S7D A;  3RRU A;  3LXU X;  4DI3 A;  2NXP A;  4AXH A;  2IQC A;  3PUJ A;  4BT9 A;  2KZT B;  3HIZ A;  3OAW A;  2VSY A;  1PAQ A;  2J4B A;  3QKY A;  1UG3 A;  3GW4 A;  1UW4 B;  3Q5M A;  1KLX A;  1EDU A;  1H0A A;  2CG3 A;  3TG4 A;  3ZN3 A;  2IOS A;  4I6G A;  3B7T A;  4UWK A;  2NC9 A;  5ANL A;  3PVL A;  4GMJ A;  3FWV A;  3LY7 A;  3PDN A;  1OWL A;  4MS6 A;  4WWO A;  2IOL A;  5BNW A;  4HFG A;  3MX3 A;  3QJZ A;  4U63 A;  2UY1 A;  4GZ3 A;  4A55 A;  5G05 C;  2XPI A;  3P2B A;  1IQU A;  4D10 C;  2J08 A;  3RRN B;  3B13 A;  1W3B A;  3NQP A;  3PZD A;  2XEV A;  3CSF A;  4HS2 A;  4ILG A;  4A3T A;  4PH4 B;  4I9C A;  4XI9 A;  4WNG A;  2YHE A;  3LCA A;  5FJY A;  2LSU A;  3T8M A;  5J08 A;  3ASG A;  4HLE A;  1HO8 A;  3FU3 A;  4G26 A;  2WXK A;  4ILH B;  2HYZ A;  4I6J A;  4U04 A;  4EBA G;  4F3V A;  3FDH A;  3IHV A;  3VLF A;  5LX8 A;  5HI7 A;  2WPV A;  5FZQ A;  3ZHE A;  4N2Q A;  3FTU A;  4AY6 A;  2HR2 A;  2X6I A;  4GA1 A;  4DI4 A;  3WXX A;  3RU0 A;  1UN9 A;  3LY9 A;  4K0R A;  3ENE A;  3SI5 A;  4FJZ A;  2I6H A;  2OOE A;  4JA9 A;  5FQ8 A;  1TEZ A;  4G25 A;  3KD7 A;  4BWR A;  3IEG A;  4XZ4 A;  5C2Y A;  2J07 A;  1P5Q A;  1IQR A;  2RD0 A;  4F1S A;  2XGS A;  4CDN A;  4FLB A;  4UQZ A;  2OVB A;  2XPZ A;  4HOR A;  3QOU A;  2L6J A;  4OVU A;  2AXV A;  5JJ6 A;  2V5F A;  4GCO A;  1ELR A;  3CV0 A;  3MV2 B;  1E8W A;  4WWP A;  4WUY A;  2LAI A;  4ME2 A;  4ACL A;  4I17 A;  3L13 A;  1U3D A;  2WXJ A;  2C0M A;  3B7S A;  3LPZ A;  3S7B A;  4GZD A;  4XKC A;  4UI9 J;  3UUX A;  3UT8 A;  4FUL A;  4G1T A;  4RG6 A;  3GZ2 A;  2Y4U A;  3NZU A;  3L17 A;  2KC7 A;  1HX8 A;  2WXN A;  3E4B A;  4KMO A;  1UJK A;  3R7Q A;  3UT4 A;  3VLD A;  4H7Y A;  3ZHE B;  4APO A;  3IKO B;  1HF8 A;  4CDR A;  4HVB A;  3ZFW A;  4F53 A;  5KCM A;  3FHE A;  1HS6 A;  4CT4 A;  3D9L A;  2XHE A;  4A3V A;  2RG8 A;  3LJ3 A;  2WXO A;  1WM5 A;  3FFL A;  4B89 A;  4KZ0 A;  3D3M A;  4MRU A;  5C1D A;  4JEU A;  1FVH A;  3S2A A;  4LRZ A;  1LF8 A;  5T4Y A;  2YHC A;  3C98 A;  3RRM B;  2WVI A;  1TJF A;  3MV3 B;  2XRZ A;  3GZ1 A;  4EPZ A;  4KVM A;  4LUN U;  4J8S A;  1JPL A;  3FUN A;  2I1J A;  3LVQ E;  4B8A A;  1OWP A;  3APD A;  5EDS A;  4A1G A;  3D9I A;  5KJM A;  2X38 A;  2KZT A;  1KT0 A;  4XX5 A;  3CK9 A;  4Q94 A;  3QNK A;  4U0S A;  5D0O D;  2X3M A;  3CK8 A;  3FH8 A;  4UWG A;  1E8Z A;  1OWO A;  4L2Y A;  1X5B A;  3G2S A;  1HG5 A;  1UJJ A;  4PS3 A;  2PL2 A;  5LCW J;  4N2S A;  4L23 A;  4AVX A;  2GRL A;  3AU5 A;  5BUZ A;  3FTZ A;  4RVB A;  4BX9 A;  4BSX A;  3QC1 A;  4J8E A;  3IBE A;  2ION A;  1EYH A;  4ANU A;  3CHM A;  3CK7 A;  3ASD A;  1N54 A;  4KT6 B;  3CVX A;  5HQ8 A;  3OTN A;  3TXN A;  3FUL A;  4JPS A;  1KT1 A;  1NA3 A;  2MHK A;  3FUE A;  3FTS A;  4GYW A;  5CMW A;  4KVO A;  3VTX A;  4N3C A;  3G2V A;  5FQ6 A;  1E8X A;  3FUF A;  3UMV A;  4UWL A;  2DCP A;  5G04 J;  3FP3 A;  3FEX A;  3APF A;  3B7U X;  3CST A;  3FTV A;  4J8D A;  1FCH A;  2BF0 X;  3RKV A;  4EZK A;  4IRU A;  3I3N A;  2JLB A;  1Z6T A;  3N71 A;  3SBS A;  3UQ3 A;  4J8F A;  2VGY A;  3CEQ A;  4G23 A;  5BPP A;  2CG2 A;  4LEU A;  3FUJ A;  2WQH A;  3OXG A;  3KS2 A;  4C0M A;  2J09 A;  4JC8 A;  1PY1 A;  1H2V C;  2AVP A;  4J6I A;  3DBS A;  5ANR A;  3R7R A;  5E76 A;  1NP7 A;  3FU5 A;  3PEU B;  1Z3X A;  3CR3 A;  3FU6 A;  2C2L A;  4URK A;  2OND A;  4HOS A;  5BV0 A;  3ZRH A;  3S7J A;  4NUR A;  2IF4 A;  1OWN A;  4M3O A;  1QZ2 A;  3TAX A;  2CHX A;  4CDM A;  1HFA A;  2VSN A;  2UWJ G;  2M63 A;  4HXI A;  1A17 A;  2CHW A;  4YVQ C;  5DIZ A;  3U4T A;  1JWF A;  3D9K A;  3FTW A;  3AS4 A;  4N3A A;  3U64 A;  4CEM A;  1HE8 A;  3L16 A;  2WXI A;  5EKQ D;  4ATG A;  4PS8 A;  3UT7 A;  2QY7 A;  2LO6 A;  4ANW A;  2YNQ A;  2Q7F A;  4N39 A;  4OYS A;  2J49 A;  4I43 A;  5EX3 A;  3L22 A;  3I5P A;  4DK5 A;  3SD5 A;  4FC8 A;  3RK6 A;  3FUK A;  2WMO A;  4EQF A;  3QWW A;  2L9B A;  3UX4 A;  3ESK A;  4GCN A;  4AJW A;  1VDY A;  5CCL A;  4RG9 A;  2AXU A;  4L2L A;  3CVY A;  3D9J A;  5JHA A;  2WXR A;  4GZ6 A;  4U07 A;  2XRY A;  3FU0 A;  3FEY A;  1E7U A;  2MOW A;  4C0E A;  4F7A A;  3MKQ A;  2YIN A;  1N52 A;  3LS8 A;  2PZI A;  4AP2 A;  2KCV A;  3CVW A;  3CVP A;  1H19 A;  2X6K A;  3ZYK A;  3ZVV A;  3RIB A;  3FUI A;  5AEN A;  4R7L A;  1JUQ A;  5ARF A;  4P29 A;  3CVU A;  1IYG A;  3SF4 A;  2WMN A;  2Y4T A;  3Q15 A;  2XPY A;  3URZ A;  5BW8 C;  4DPR A;  2V4L A;  4DJA A;  4WAF A;  1OUV A;  5KJN A;  3JYS A;  3TGO A;  3VLE A;  3HDX A;  2E2E A;  4APF A;  3QAQ A;  1HXI A;  2A4Z A;  3ZYQ A;  5CHE E;  3BG0 B;  3QB2 A;  3EIJ A;  3PH0 C;  2ILR A;  4ACK A;  4GA0 A;  2VYI A;  4DLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...