3SNXA

Crystal structure of a putative susd-like carbohydrate binding protein (bt_1439) from bacteroides thetaiotaomicron vpi-5482 at 1.88 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
455
structure length
455
Chain Sequence
QVAVAGNAERLFNGAWYNLFEYGTTYANIGYRALQCQDDMMASDVVSRPKYGFNSSYQFNDVAIPSDGRTSFAWYLIYKTIDNCNTAISIKGDSEELRQAQGQALALRAFCYLHLVQHYQFTYLKDKDAPCVPIYTEPTTSGTKPKGKSTVAQVYQQIFDDLNLAQDYLTNYVRKGDGQKFKPNTDVVNGLMARAYLLTGQWGEAAKAAEAARKGYSLMTTTAEYEGFNNISNKEWIWGSPQTLSQSDASYNFYYLDATYVGAYSSFMADPHLMDTFVKGDIRLPLFQWMREGYLGYKKFHMRSDDTADLVLMRSAEMYLIEAEAKVRDGVALDQAVAPLNTLRTARGVGNYDVTGKTKEQVIDEILMERRRELWGEGFGITDVLRNQKAVERMALSEDMQKTEVDCWQEGGSFAKRNPLGHWFLNFPDGKAFSANSSYYLYAIPEKEINANPNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN (BT_1439) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.88 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords PUTATIVE SUSD-LIKE CARBOHYDRATE BINDING PROTEIN
total genus 165
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3snxA00
5J90A 3L22A 3P1UA 5T3RA 3CKBA 3JQ0A 5FQ4A 3CKCA 3MCXA 5E76A 5FQ7A 3IV0A 3MYVA 3JYSA 3SGHA 3NQPA 3EJNA 3I4GA 4Q69A 3HDXA 3GZSA 3JQ1A 3EHMA 3CK8A 5LX8A 5FQ6A 3CGHA 3CK7A 3FDHA 4F7AA 3SNXA 3EHNA 4PUCA 5T4YA 3MX3A 4L7TA 3OTNA 4F53A 4LERA 3KEZA 5E75A 4MRUA 3LEWA 5FQ8A 3QNKA 3CK9A
chains in the Genus database with same CATH superfamily
5JMND 2P9SG 4M7CA 3UQ3A 1TYQG 5CMYA 3IV0A 3DSVA 4C48B 5HI7A 2QC9A 3RO2A 5EIBE 3BQOA 1N54A 1LTXA 4DUIA 4J0UA 5FIOA 2XS1A 2X6JA 5FZRA 3RRUA 4FJZA 4YDOA 1KLXA 3OXGA 3FU6A 2PQNA 4A63B 1SZAA 3D9PA 3PE4A 4O60A 3ULYA 3HHMA 1SZ9A 1D8EA 3FUNA 3TWSA 3UT8A 3JCKC 3X2QE 3LEWA 3CVQA 2FBNA 4I1OB 3L6AA 5J08A 5LOZA 5EKQD 2OEVA 4U8VD 2KZTA 4WWPA 4XZ4A 2KCKA 4G23A 5KNGA 3JXJA 1A17A 3SNXA 3Q47B 4HOSA 3ASFA 3KAEA 4I43A 3DPYA 1Z3XA 4HRMB 2OEWA 3WG7E 1OUVA 2I2OA 3ZYKA 3SQVA 2XEVA 1VDYA 2KCLA 3RJVA 4UWLA 3ABME 4N2SA 5IY5E 2VGYA 1HG2A 4AY5A 4JHJA 1HH8A 3LS8A 1NL4A 1EYHA 1BU9A 3DSSA 3QDNA 4LRZA 3ZYLA 2WXHA 2GROB 4GTPA 2WXQA 4EZJA 3RSEG 1JPLA 1N95A 3N71A 4G11A 4HLLA 4EHMA 2QFCA 4WWNA 3FU5A 1K1BA 1L5JA 5CERB 3DRAA 3ZGQA 2WXMA 2X6IA 2ZU6B 4WAFA 4J8DA 2BF0X 1S0PA 1LD7A 3FTZA 1BPOA 1IHGA 2EIJE 2CHXA 4H7YA 4TRQA 2WM9A 5C1DA 3DEOA 3VLFA 3ZN3A 5FJYA 4P29A 1BLXB 4GB9A 3V2OA 3CVXA 1ZBPA 1E7UA 2XEEA 3K9IA 3C98A 2HYZA 1HS6A 4YDYA 2ZIRA 1DCEA 1HG5A 3SD5A 1PY1A 3UMVA 1BD8A 3O4ZA 3ASOE 2C2LA 1H2VC 2XENA 4J7WA 4C0MA 4L2LA 4MRUA 3CVPA 4OAUC 3FUFA 4CDMA 3CKBA 2IOSA 1NZNA 3Q73A 3AS4A 3QKYA 3QWPA 4ACKA 3DSTA 3BEEA 5ENTD 3AAAC 3EIJA 4GZCA 2VSOE 3TJPA 4R7LA 3PUKA 3J5PA 4UWHA 3TWXA 1K8KG 4J8SA 3FUKA 4TXQA 5FTPA 1OCRE 3SHFA 3ABLE 1SW6A 2J4BA 3ESKA 3C5RA 3NOCD 3RRMB 4EBAA 3MYVA 5CHEE 4I6JA 2GRLA 1NA0A 4XEIG 1FVHA 5AQ7A 1NA3A 4HNAD 4UQYA 4BX8A 4GU5A 2XGSA 4G8KA 5JHAA 3ZUVB 3PEVB 5B1BE 2I9CA 3MV3B 3IBEA 3E30A 4K03A 1HZ4A 5EDSA 4K0RA 3CHPA 4TUMA 4HS2A 4YNDA 3LJNA 5BXUA 3Q9NC 1UJJA 3ZXSA 4DPRA 4YDEA 2DBAA 5KJMA 1OCZE 4BSZB 4HORA 4C9BB 4KVOA 3ESLA 3PDNA 4HQDA 2LXMA 3LVQE 1MX6A 2DWZA 4CT4A 4CCAA 1NFIE 2WXLA 4HB5A 3CVVA 2ZGGA 1E96B 3JQ0A 2VGXA 5EILA 3ASNE 4J8FA 2XGMA 2PNNA 4GZ6A 4WNEA 3URZA 1MX4A 2L6JA 3CK9A 1N9AA 1QYMA 3MZLB 4CYMD 2X6FA 5A6CA 4HVBA 5KBAA 1P5QA 1X81A 4URKA 2CFUA 2LSVA 4G2VA 5AQAA 4U96D 3JUIA 5KJKA 2WXIA 3QC1A 2HE0A 2FI7A 2KCVA 3UIOC 2C0LA 3PS6A 2R02A 3ZNGA 5LX8A 5ENSD 2WXGA 4ATGA 4I1AA 1DCQA 2CG3A 3S7DA 2WMNA 3UM2A 1XNFA 4G25A 2OV8A 3DSXA 3RRNB 4APFA 4N5CA 4PDXA 3RK6A 3APFA 5KJNA 2P9KG 5HRYA 3LYAA 4BTBA 1U3CA 4FA6A 3CHMA 2WB2A 1G3NB 1N52A 3R9MA 4HRNA 4GCOA 5ANLA 1S64A 2XRYA 4B94A 2FO1E 2VSYA 4CEMA 5JJ7A 2EIKE 2A5EA 5AYWD 4J8EA 5CECB 3KSLA 2IFUA 3AG3E 3ZW3A 5FT9A 3HDXA 4L2YA 3FU3A 3ASGA 4I2ZA 3ML9A 3T8KA 1SA4A 4BWRA 1NI1A 4RVBA 4LERA 5KJLA 4ZHBA 5AN8A 4RLYA 1YYHA 3QOUA 2LNIA 5KWDA 3Q75A 3IHVA 3CSTA 3CK8A 1TNYA 2E2EA 4BX9A 3CVWA 3G2SA 3MKQA 2XRZA 1V55E 2NYJA 1TN7A 2H6IA 1O1RA 5AQBA 4GZ5A 3PRZA 4XE0A 2ETCA 4DJAA 4K5AB 1Y6IA 4JVSA 3SI5A 3OXLA 1WG0A 3HXDA 3SZ7A 5JJTA 3Q7AA 4AY6A 3D9OA 2KATA 4HLEA 2BTDA 3CV0A 2EQXA 3SBTB 2DCPA 4OAVB 3I4GA 4G8LA 4GMRA 4DLOA 2AWIA 3PZ2A 4N2QA 1YCSB 4GYYA 4ATZD 3D9HA 4BFRA 3RKVA 2V0PA 3VTXA 3B7UX 2WPVA 3ASDA 4KBQA 3O48A 2J07A 3FEXA 5G04J 2LSUA 3G2WA 2Y3AA 3Q5MA 4L9PA 3DBSA 1DC2A 4GA0A 3B13A 4YDWA 1N4SA 2RFAA 2VGXB 3ONLA 4GPKA 4BY6A 2MOWA 4FADA 3C3RA 2LO6A 1JWGA 2WMOA 4PS8A 3EHQA 5FINA 3E32A 3BUAA 1DNPA 4B93B 3GYZA 1EF1C 3ULEG 2JABA 4NIKA 3V2XA 1OCCE 1UJKA 4DX7D 3Q9UC 1KZPA 1ELKA 3EUVA 4CZ2D 4LG6A 3D3MA 5M72A 4JB8P 1JUQA 3LY8A 2Y4UA 3FTXA 3D9LA 5BT1A 3AG4E 4I2WA 2F0YA 4IYPA 4CDRA 4U0ZA 3FH7A 4U0SA 4ANWA 5G05J 2XPYA 5EN5D 4B8CB 4GPMA 4KYOB 2AVPA 3CHSA 3Q79A 3S7FA 1ZB1A 5DBKA 1MJ0A 5ARGA 2JLBA 3EU9A 4GTMA 4CRWA 1Z6TA 2EIME 2EINE 4XI9A 3V79K 1O1TA 3SGHA 4BERA 4FU3A 2XPZA 3MKRA 4KXKB 1K3ZD 4KZCA 4ILIA 4IULA 4HBDA 4ANVA 5DIZA 4TXRA 2DYSE 3QNKA 4KMOA 3TG4A 4A1SA 5ENOD 3B7SA 5FQ4A 3SFZA 2WXFA 4MKTA 1HE8A 1MYOA 1HO8A 3FWVA 2BKGA 3QB2A 4C0EA 1XGWA 2IOLA 3I3NA 1SVXA 2UY1B 1QQEA 3UINC 3SY2A 5BUZA 4BTAA 4JHKA 1AWCB 2RD0A 4GCNA 2VQ2A 3U3WA 5ENQD 3EHRA 1LD8A 2WXRA 3UI2A 1S63A 2WVIA 4QFVA 4XIFA 5FZSA 2V4HC 4MBGA 3G2UA 5AJDA 4AOFA 2B0OE 5FZQA 2I1JA 5G55A 4BT9A 4GTTA 4KZ0A 3L13A 3TAXA 1TJFA 2XS8A 3ULQA 3CVYA 3EU5A 4E85A 3D9NA 4GZDA 3MA5A 2L6BA 2DZNA 2WQHA 3PEUB 5CRVA 4I6EA 2XPIA 3AS5A 5LCWJ 4FLHA 2XZTG 2UY1A 1IQRA 1JWFA 3FTVA 4Y6CA 4F53A 4GMJA 2PL2A 1MX2A 3FHEA 5CMWA 2XZDG 3FTYA 3MKQB 3UT4A 1OWPA 1ELRA 5B1AE 3KSQA 4UWGA 1UOHA 1TR4A 1A5EA 2WQ6A 2JEKA 4GA2A 3W9FA 3PNTB 1IHBA 4EPZA 4YVQC 2YQ8A 1HXIA 2NXPA 4U7EB 3NZUA 4J6IA 2V5FA 3DWLG 1OWMA 1IXVA 2VSNA 3ZVVA 3LVRE 5AENA 4H7XA 3Q49B 4JZYA 3LCAA 4AVXA 2R2LA 5E76A 4ACLA 5AQ9A 2XHEA 4TV3A 1X5BA 3FDHA 4E6HA 5HKPA 5CCLA 2CG2A 4I17A 5CBOA 4GTSA 3B7RL 2E0IA 2F37A 3SF4A 3LDZA 1H19A 1KPSB 3W9GA 3JYSA 1Q2ZA 3Q7FA 4JPSA 2Y4TA 4UQXA 5ITZF 4BT8A 5FQ6A 1MQSA 3U64A 1BI7B 4Y6WA 4GYOA 3OTNA 1N94A 4N39A 3C3QA 3R7QA 5FWQA 4U63A 2WXNA 2OVBA 3EHMA 4KVMA 3JUEA 2V8SE 3R9AB 3ZKJA 3SBSA 3PUJA 3GW4A 2WXPA 4N3CA 2LXLA 4LCTA 1QBQA 2MHKA 3FTSA 4JA7A 2L0TB 4IRUA 3QJZA 3LY9A 5CRUA 4RG9A 3PREA 4UWKA 3T8MA 1IYGA 3MJWA 4U8HA 3FH8A 3ENEA 4UWFA 4B8AA 3TWVA 4FP7A 4LNBA 2Q7FA 4JEUA 2J09A 4ANXA 3HG0D 4FC8A 3RAUA 3CVUA 3MEKA 2OVFA 3FP3A 5D2MC 4GZ3A 2LAIA 2B6CA 3UKRG 3CK7A 4CGWA 2BUGA 1KT1A 2IO3C 4LNGA 3L82A 1E7VA 4V3IA 2OCCE 1MZCA 5EX0A 4A3TA 2P9PG 5G04C 3ZPJA 3IKOB 4HOQA 1TNOA 3FUEA 4GAAA 3L08A 3QWVA 1WY6A 4HXIA 3FUHA 3JQ1A 3NBNB 4F3VA 1WM5A 3U66A 3PVLA 2IQCA 2Y1LE 2KBXA 2F8XK 4DX6D 4ME2A 1FCHA 4MLPA 4TUUA 1TEZA 2HO1A 1O5MA 3KEAA 3QARA 3ZRHA 2X6HA 1H2TC 4Q94A 3PZ3A 3G2TA 4EECA 2OOEA 3T5XA 2J08A 3LY7A 3T9KA 1N11A 4GTQA 4FLBA 4F1PA 1D8DA 4FHJA 3F6QA 3LKUA 2DZOA 5FQ8A 1QZ2A 3ZHEA 3UT7A 4N3BA 3AU5A 2UWJG 2IF4A 3TL5A 1OXJA 2DVWA 5AIJA 5JA4D 4PS3A 3UX4A 1WDYA 3PNLB 4EQFA 3C3OA 3EDTB 2GGFA 3ABKE 2R03A 1UG3A 5EIDA 4W9RA 4M3OA 2GRMA 5AAOA 4QQIA 4B0ZA 4G24A 4I9CA 2IONA 2RFMA 5ENPD 4EBAG 2GRPB 3UM3A 4Q69A 3BU8A 1WAO1 1N0QA 5ANRA 5BPPA 4OVVA 4OVUA 2GRQB 3HXBA 3FU0A 3UPVA 4RG6A 3EIQC 1BI8B 2RG8A 2VTBA 3NF1A 2ZISA 2FEZA 1QNFA 5BV1A 1UN8A 4I9EA 3FH5A 4JL0A 3CSFA 2PQRA 3CIAA 4K5CA 2R5SA 4XI0A 2XQ0A 3L22A 3S7JA 1RW2A 1U2VG 5LP0A 4FULA 1TN8A 2J49A 2P58C 4PS7A 3D9KA 4UUCA 1TN6A 2FULA 4A3VA 5KNHD 5D0QD 3E34A 4GTOA 4PH4B 4GMLA 4AP2A 2AXUA 2KM4A 3D9IA 3FTUA 2FF4A 1UN9A 4LNUD 5BXOA 5D66A 1TJCA 3S7BA 4DRXE 3MCXA 1E8XA 1H6OA 3OXFA 2ETBA 5AJLA 4BSXA 3TG5A 3ZFWA 5G2NA 4JC8A 1Y8MA 1W3BA 4LUNU 5HS0A 2HM8A 1PAQA 2P2CP 4JXTA 4GYWA 4XX5A 2ETAA 4JW1A 3FTWA 4IN3B 2L0IA 3TGOA 1RZ4A 2L9BA 2AXZA 2CFZA 1LF8A 3L9TA 3CHRA 2I1KA 2IEJA 3BG0B 3CHQA 4HFGA 3GZ2A 4UI9K 5G05C 1YA0A 1IKND 3PZ4A 1HU3A 4Z68A 3FULA 3SFXA 4DI3A 2YNQA 2J8SD 5A7DB 4DX5D 3V30A 1SA5A 5H7PA 3VLEA 4O1OA 2NSZA 4NACA 4X8QA 1TNZA 3D9JA 4AM9A 3ZXPA 1AP7A 2M63A 3CQCB 4Q96A 1KT0A 4GTRA 2NC9A 3VTYA 1JCQA 4HOUA 4MS6A 4GTVA 2IJGX 3ZIMA 3D9MA 3HVEB 3QWWA 4HI9A 3ZHEB 2QZAA 3UIPC 1ZU2A 3V31A 1H6KA 4WWOA 2V5QC 3EHNA 2WXKA 3MX3A 4K5BA 3CVLA 1E90A 3S2AA 4CDNA 3NZSA 1MHQA 1OY3D 4U04A 3HXFA 1YMPA 3UUXA 4F1SA 3CGHA 1JCRA 1OWNA 3DSWA 2HR2A 2J4DA 3NOGD 4HRLA 3CQGB 2LUHA 2BKKB 3MV2B 4EZLA 4JD2G 1JCSA 2PZIA 4I1MA 2H6HA 4WUYA 3C72A 4L1BA 1N4QA 2VGEA 2P9NG 5ENRD 5T4YA 4AJWA 3NAWA 2KZTB 1H6PA 3CHOA 2X38A 5ARFA 4O1PA 4NRHB 4RQIA 4N3AA 3NB2A 3DPDA 5CBNA 2ILRA 4DLQA 4AEZC 2QYJA 3DEPA 3I5PA 5LCWC 3E4BA 3FUJA 1E8YA 2BEDA 2WQ7A 3RIBA 4HOTA 2XCBA 1DVPA 4CT0A 1UW4B 2DIWA 3ISMC 4U0UA 3TXNA 3UKUG 4ILGA 3TWUA 1TNBA 3IEGA 2MYOA 3FFLA 4JHRA 2H6GA 2VJ8A 4D10C 4L23A 3FUIA 3CEQA 4L7TA 2CHZA 2P9LG 4XKBA 2AW6A 1TNUA 3B7BA 3ZU7B 3I4RB 4WNDA 4RSYA 4BEPA 1ELWA 3PZ1A 3T5VA 5LFAA 3FY4A 2RKKA 3LXUX 1OCOE 5JJ6A 2MRIA 5CEAA 4LEUA 4I6GA 3U4TA 3P1UA 3FEYA 1INZA 4UQZA 4APOA 1FPPA 4JEHA 4XKCA 3JXIA 5CEDB 1PC2A 1OWOA 3LPZA 3AS8A 2Y0BG 4OYSA 3CVNA 4DI4A 2I6HA 2J9QA 3E37A 3FUMA 3AU4A 1N4RA 2IO2C 2A5UA 3HXEA 3L17A 4EZKA 3FUDA 1FT1A 3AJIA 4NQ0A 5B3SE 4AV7A 3RU0A 3TXMA 3PZDA 2GRNB 2DYRE 3B95A 2A4ZA 4FJYA 5T8IA 4AXHA 2X6KA 3DXMG 3TWRA 2F8YA 1NP7A 5KCMA 2V4LA 3SFYA 2GW1A 2ONDA 3APDA 1H2UA 3U9WA 2WXJA 3CKCA 1GW6A 4YVOA 2XGOA 2IU1A 3HXCA 4F7AA 2ZGDA 4DX1A 4TXPA 2KXPC 3LJ3A 3TWWA 2YHCA 3GZ1A 1O1SA 3L16A 2YHEA 3PE3A 4A1GA 5BV0A 4WNGA 1HFAA 3G2VA 1OT8A 3TWTA 1EDUA 4GA1A 3QK0A 4CGVA 3B7TA 2ZXWE 3Q4AB 2FO7A 4A55A 5JHBA 5EYLA 2XEHA 4BESA 2P9IG 4B89A 2EILE 4JA9A 1EPUA 3UM0A 3MGBA 3UTMA 2VYIA 5E75A 2LAHA 4G26A 4UI9J 1D9SA 1U3DA 5J90A 4N5QA 1HX8A 2KC7A 1E8WA 3PH0C 3TWQA 3ZYMA 1Z5SC 4J8YA 3ONKA 3HYMB 4G1TA 3HRAA 1K1AA 3DSUA 2QYUA 1FVFA 4ZFHA 2R59A 2Y69E 3ZYQA 1IQUA 1S70B 4FHKA 2H6FA 2AXVA 5A23A 4U8YD 1OWLA 3E33A 3ML8A 5EYPF 2PM7A 4O6FA 3BG1B 5D0OD 5AARA 2GRRB 2CHWA 1N4PA 3P2BA 2IY0C 4KT6B 3VLDA 5FQ7A 3RO3A 2P9UG 4ABNA 3HIZA 4F6RD 2X3MA 3IHYA 1E8ZA 3J5QB 5BW8C 4WNFA 4BETA 2VTBB 3DXKG 5ENNA 3WXXA 3IXEA 4DX2A 2AJAA 3Q78A 5T3RA 4UI9C 2C0MA 3QAQA 3AG1E 1KZOA 1V54E 2YINA 4NURA 5C2YA 2R05A 2PM6A 2VSXE 3HVEA 4HI8A 4PUCA 3CLJA 5BNWA 1FT2A 1N0RA 3Q15A 1SQMA 5EX3A 3NQPA 3EJNA 2XCCA 3ASHA 3GZSA 4DK5A 1H0AA 4U07A 5CCMA 4ANUA 3OAWA 2QY7A 3CR3A 3ZEFA 4U95D 1HF8A 3KEZA 3APCA 2R17C 2WXOA 3KD7A 1B89A 1Z3YA 5HQ8A 3KS2A 4ILHB 3SO8A 3UXGA 4AIFA 3AG2E 3R7RA 3L54A 3UM1A 4LSZE
chains in the Genus database with same CATH topology
4CDNA 3R7QA 3NZSA 5FWQA 1MHQA 3UQ3A 5AYWD 4J8EA 5CMYA 4U63A 3IV0A 2WXNA 2IFUA 3ZW3A 5FT9A 3HDXA 5HI7A 2OVBA 4L2YA 3FU3A 3ASGA 4U04A 4I2ZA 3EHMA 3UUXA 4F1SA 3RO2A 4KVMA 3CGHA 3ML9A 2V8SE 1OWNA 3R9AB 4BWRA 2HR2A 3SBSA 1N54A 2J4DA 3PUJA 4RVBA 4J0UA 4LERA 5KJLA 3GW4A 2WXPA 4N3CA 3CQGB 2X6JA 4LCTA 3MV2B 4EZLA 2MHKA 5FZRA 3RRUA 4FJZA 1KLXA 3FTSA 4JA7A 3OXGA 3FU6A 2PQNA 2PZIA 2L0TB 4I1MA 3QOUA 4IRUA 1SZAA 2LNIA 3D9PA 3QJZA 3LY9A 3PE4A 4RG9A 4WUYA 3IHVA 3HHMA 3PREA 4L1BA 1SZ9A 4UWKA 3T8MA 1IYGA 3CSTA 3CK8A 3MJWA 3FUNA 2E2EA 4U8HA 3FH8A 3UT8A 3ENEA 4BX9A 3CVWA 4UWFA 4B8AA 3G2SA 3MKQA 4FP7A 3JCKC 2XRZA 5T4YA 2Q7FA 4AJWA 4JEUA 3LEWA 3CVQA 2FBNA 2J09A 4I1OB 3L6AA 4ANXA 5J08A 5LOZA 2KZTB 4FC8A 5EKQD 3CHOA 2X38A 3CVUA 4GPKA 5ARFA 3MEKA 2OVFA 4NRHB 3FP3A 4GZ5A 4N3AA 4GZ3A 3PRZA 3DPDA 4XE0A 2ILRA 2LAIA 2KZTA 4DLQA 4WWPA 4DJAA 4XZ4A 2KCKA 4G23A 1Y6IA 3CK7A 4AEZC 4CGWA 4JVSA 3I5PA 1A17A 3SNXA 2BUGA 1KT1A 3OXLA 3Q47B 3SI5A 5LCWC 4HOSA 3E4BA 3FUJA 3ASFA 3KAEA 4I43A 1E7VA 3SZ7A 1E8YA 1Z3XA 2WQ7A 4V3IA 5JJTA 3RIBA 4HOTA 5EX0A 4A3TA 4AY6A 5G04C 3D9OA 1OUVA 2KATA 1DVPA 2XCBA 2I2OA 4CT0A 4HLEA 3ZPJA 3ZYKA 2XEVA 1VDYA 2BTDA 2KCLA 1UW4B 3IKOB 3CV0A 4UWLA 4HOQA 2EQXA 2DIWA 3FUEA 4GAAA 4U0UA 2DCPA 3L08A 2VGYA 3QWVA 3SBTB 1HG2A 4N2SA 3I4GA 1WY6A 3TXNA 4HXIA 3FUHA 4ILGA 4AY5A 3JQ1A 3IEGA 4JHJA 4DLOA 2AWIA 3FFLA 1HH8A 4F3VA 4N2QA 3LS8A 1WM5A 4GYYA 4JHRA 3U66A 2VJ8A 3PVLA 4BFRA 2IQCA 3RKVA 2V0PA 4D10C 4L23A 3VTXA 1EYHA 3B7UX 3FUIA 2WPVA 3CEQA 4L7TA 3RJVA 3ASDA 4KBQA 3O48A 2J07A 3QDNA 4LRZA 2CHZA 4ME2A 3ZYLA 2WXHA 4XKBA 2AW6A 1FCHA 3FEXA 4MLPA 4TUUA 2HO1A 1TEZA 2WXQA 5G04J 4EZJA 3I4RB 2LSUA 3QARA 4WNDA 3ZRHA 3G2WA 1JPLA 2X6HA 1H2TC 4RSYA 2Y3AA 3Q5MA 3N71A 4G11A 4Q94A 3G2TA 4EECA 2QFCA 2OOEA 3DBSA 3T5XA 2J08A 1ELWA 4WWNA 3FU5A 3LY7A 1L5JA 4GA0A 3B13A 3T5VA 5LFAA 4FLBA 3FY4A 2VGXB 3LXUX 3ONLA 2WXMA 3ZGQA 4FHJA 5JJ6A 2MRIA 2MOWA 2X6IA 4BY6A 2ZU6B 3LKUA 4LEUA 4WAFA 4I6GA 4J8DA 5FQ8A 4FADA 2LO6A 1QZ2A 1JWGA 1S0PA 2BF0X 2WMOA 4PS8A 3FTZA 3U4TA 1BPOA 1IHGA 3P1UA 3ZHEA 2CHXA 4H7YA 3FEYA 4N3BA 3UT7A 1INZA 4TRQA 4UQZA 1DNPA 2UWJG 2IF4A 2WM9A 3AU5A 3TL5A 5C1DA 3VLFA 4APOA 4JEHA 4XKCA 3ZN3A 5FJYA 3GYZA 1EF1C 4P29A 1PC2A 4GB9A 1UJKA 1OWOA 5AIJA 3CVXA 3LPZA 1ZBPA 1ELKA 3AS8A 4PS3A 3UX4A 1E7UA 4OYSA 3PNLB 3CVNA 4EQFA 4DI4A 3EDTB 2I6HA 2GGFA 2J9QA 3K9IA 3C98A 2HYZA 3FUMA 3D3MA 5M72A 1HS6A 3AU4A 2A5UA 3L17A 1JUQA 4EZKA 3FUDA 3LY8A 2Y4UA 3FTXA 3D9LA 4NQ0A 5BT1A 1UG3A 4AV7A 4I2WA 3RU0A 1HG5A 4W9RA 3TXMA 4M3OA 1PY1A 4IYPA 3SD5A 3PZDA 4U0ZA 3FH7A 4U0SA 4ANWA 4CDRA 5G05J 3UMVA 2XPYA 2GRMA 5T8IA 2A4ZA 4FJYA 4B8CB 4AXHA 2X6KA 3O4ZA 4KYOB 2AVPA 2C2LA 1H2VC 4B0ZA 3CHSA 3S7FA 4C0MA 4L2LA 4MRUA 5DBKA 1NP7A 5ARGA 2JLBA 2V4LA 5KCMA 4G24A 4I9CA 3CVPA 2GW1A 2IONA 3FUFA 2ONDA 3APDA 4CDMA 1H2UA 4CRWA 3CKBA 3U9WA 1Z6TA 3CKCA 2WXJA 2IOSA 1NZNA 4EBAG 4XI9A 1GW6A 4YVOA 3SGHA 4Q69A 4FU3A 1WAO1 2XPZA 3AS4A 3QKYA 3MKRA 2XGOA 4KXKB 3QWPA 2IU1A 4ACKA 5ANRA 5BPPA 4KZCA 4F7AA 3BEEA 4ILIA 4OVVA 4IULA 4OVUA 4ANVA 5DIZA 3EIJA 4GZCA 3QNKA 2VSOE 3FU0A 3LJ3A 4KMOA 2YHCA 3TG4A 3TJPA 4A1SA 3GZ1A 4R7LA 3B7SA 3PUKA 3UPVA 4RG6A 3L16A 3EIQC 5FQ4A 2RG8A 2YHEA 3SFZA 2VTBA 2WXFA 3NF1A 3PE3A 4UWHA 4MKTA 2FEZA 4A1GA 1QNFA 1HE8A 5BV1A 1UN8A 5BV0A 4I9EA 3FH5A 4J8SA 4WNGA 3FUKA 1HO8A 3FWVA 1HFAA 4JL0A 3CSFA 5FTPA 3G2VA 3SHFA 2PQRA 3QB2A 4C0EA 1EDUA 1XGWA 2IOLA 3I3NA 4GA1A 3CIAA 2UY1B 1QQEA 3QK0A 2R5SA 5BUZA 4BTAA 4JHKA 3B7TA 4XI0A 2RD0A 4CGVA 2J4BA 2XQ0A 3ESKA 3L22A 3Q4AB 3S7JA 2FO7A 4A55A 4GCNA 3RRMB 4EBAA 3MYVA 5JHBA 2VQ2A 5LP0A 5CHEE 4FULA 3U3WA 4I6JA 4B89A 4JA9A 2WXRA 2J49A 2GRLA 2P58C 4PS7A 1NA0A 1EPUA 3MGBA 1FVHA 3D9KA 1NA3A 2WVIA 2VYIA 4QFVA 4UQYA 5E75A 4BX8A 2FULA 4A3VA 2LAHA 4XIFA 5FZSA 4G26A 4GU5A 4UI9J 2XGSA 1U3DA 5J90A 3G2UA 5JHAA 1HX8A 2KC7A 5D0QD 3PEVB 1E8WA 3PH0C 5AJDA 3ZYMA 4AOFA 2I9CA 5FZQA 4PH4B 2I1JA 4GMLA 3MV3B 5G55A 4AP2A 2AXUA 4BT9A 3IBEA 3ONKA 4K03A 1HZ4A 4KZ0A 3HYMB 3L13A 5EDSA 4G1TA 2KM4A 3D9IA 4K0RA 3TAXA 1TJFA 3CHPA 4HS2A 3ULQA 3FTUA 2FF4A 1UN9A 3D9NA 4GZDA 4YNDA 4E85A 3CVYA 1FVFA 2R59A 3MA5A 3ZYQA 1IQUA 1UJJA 3ZXSA 4DPRA 1TJCA 3S7BA 4FHKA 2DBAA 3MCXA 2AXVA 1E8XA 2WQHA 3PEUB 5KJMA 5A23A 3OXFA 4HORA 1OWLA 3ML8A 4I6EA 2XPIA 3AS5A 5AJLA 4C9BB 4KVOA 2PM7A 4O6FA 3ESLA 3TG5A 4BSXA 3BG1B 3PDNA 5D0OD 5LCWJ 4FLHA 2UY1A 3ZFWA 1IQRA 1JWFA 2CHWA 3FTVA 4Y6CA 3LVQE 4F53A 5G2NA 4GMJA 4CT4A 3P2BA 2PL2A 4CCAA 2WXLA 4JC8A 1Y8MA 4KT6B 1W3BA 3CVVA 1E96B 4LUNU 3JQ0A 3VLDA 2VGXA 2HM8A 1PAQA 3FHEA 5FQ7A 4JXTA 3RO3A 5CMWA 4GYWA 3FTYA 3MKQB 4XX5A 3UT4A 4JW1A 4ABNA 1OWPA 3HIZA 2X3MA 3FTWA 3IHYA 1E8ZA 4IN3B 5BW8C 2L0IA 4J8FA 4WNFA 1ELRA 2XGMA 3TGOA 2VTBB 4GZ6A 2L9BA 4WNEA 5ENNA 2AXZA 3URZA 2L6JA 3WXXA 2CFZA 3CK9A 1LF8A 3CHRA 4UWGA 2I1KA 5T3RA 3MZLB 3BG0B 3CHQA 4UI9C 2X6FA 4HFGA 2WQ6A 5A6CA 2C0MA 2JEKA 3GZ2A 3QAQA 1P5QA 4UI9K 5G05C 4HVBA 4GA2A 1YA0A 2YINA 4NURA 5C2YA 1HU3A 2PM6A 2VSXE 3PNTB 4EPZA 4YVQC 3FULA 2YQ8A 1HXIA 2NXPA 4DI3A 4URKA 3HVEA 3NZUA 4J6IA 2YNQA 4PUCA 3CLJA 2CFUA 2V5FA 2LSVA 4G2VA 1OWMA 5BNWA 2VSNA 3ZVVA 3JUIA 5A7DB 3LVRE 5AENA 3Q15A 1SQMA 4H7XA 5KJKA 3Q49B 4JZYA 5EX3A 3VLEA 2WXIA 3LCAA 3QC1A 4AVXA 2NSZA 4NACA 5E76A 4ACLA 2FI7A 2KCVA 3NQPA 3EJNA 2C0LA 2XCCA 3ASHA 3PS6A 3D9JA 3GZSA 4DK5A 2XHEA 4AM9A 1H0AA 4TV3A 1X5BA 2M63A 4U07A 5LX8A 2WXGA 3CQCB 4Q96A 3FDHA 5CCMA 1KT0A 4ATGA 4ANUA 3OAWA 2QY7A 2NC9A 3CR3A 4I1AA 3VTYA 3ZEFA 4E6HA 1HF8A 2CG3A 3KEZA 3S7DA 3APCA 2WMNA 2CG2A 5CCLA 2R17C 4I17A 1XNFA 2WXOA 4G25A 4HOUA 3B7RL 4MS6A 3KD7A 1B89A 2OV8A 2E0IA 3RRNB 1Z3YA 2IJGX 4APFA 3ZIMA 3SF4A 3D9MA 4N5CA 4PDXA 3RK6A 3HVEB 1H19A 3LDZA 3APFA 5HQ8A 3KS2A 3JYSA 3QWWA 5KJNA 4ILHB 2Y4TA 4JPSA 3ZHEB 4UQXA 4AIFA 3LYAA 4BTBA 4BT8A 5FQ6A 1U3CA 4FA6A 1ZU2A 3R7RA 1MQSA 3CHMA 3U64A 2WB2A 1H6KA 3L54A 4Y6WA 4WWOA 1N52A 3EHNA 4GYOA 5ANLA 4GCOA 2WXKA 2XRYA 3MX3A 3OTNA 4B94A 2VSYA 3CVLA 1E90A 4CEMA 4N39A 5JJ7A 3S2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J90 A;  3L22 A;  3P1U A;  5T3R A;  3CKB A;  3JQ0 A;  5FQ4 A;  3CKC A;  3MCX A;  5E76 A;  5FQ7 A;  3IV0 A;  3MYV A;  3JYS A;  3SGH A;  3NQP A;  3EJN A;  3I4G A;  4Q69 A;  3HDX A;  3GZS A;  3JQ1 A;  3EHM A;  3CK8 A;  5LX8 A;  5FQ6 A;  3CGH A;  3CK7 A;  3FDH A;  4F7A A;  3SNX A;  3EHN A;  4PUC A;  5T4Y A;  3MX3 A;  4L7T A;  3OTN A;  4F53 A;  4LER A;  3KEZ A;  5E75 A;  4MRU A;  3LEW A;  5FQ8 A;  3QNK A;  3CK9 A; 
#chains in the Genus database with same CATH topology
 5JMN D;  2P9S G;  4M7C A;  3UQ3 A;  1TYQ G;  5CMY A;  3IV0 A;  3DSV A;  4C48 B;  5HI7 A;  2QC9 A;  3RO2 A;  5EIB E;  3BQO A;  1N54 A;  1LTX A;  4DUI A;  4J0U A;  5FIO A;  2XS1 A;  2X6J A;  5FZR A;  3RRU A;  4FJZ A;  4YDO A;  1KLX A;  3OXG A;  3FU6 A;  2PQN A;  4A63 B;  1SZA A;  3D9P A;  3PE4 A;  4O60 A;  3ULY A;  3HHM A;  1SZ9 A;  1D8E A;  3FUN A;  3TWS A;  3UT8 A;  3JCK C;  3X2Q E;  3LEW A;  3CVQ A;  2FBN A;  4I1O B;  3L6A A;  5J08 A;  5LOZ A;  5EKQ D;  2OEV A;  4U8V D;  2KZT A;  4WWP A;  4XZ4 A;  2KCK A;  4G23 A;  5KNG A;  3JXJ A;  1A17 A;  3SNX A;  3Q47 B;  4HOS A;  3ASF A;  3KAE A;  4I43 A;  3DPY A;  1Z3X A;  4HRM B;  2OEW A;  3WG7 E;  1OUV A;  2I2O A;  3ZYK A;  3SQV A;  2XEV A;  1VDY A;  2KCL A;  3RJV A;  4UWL A;  3ABM E;  4N2S A;  5IY5 E;  2VGY A;  1HG2 A;  4AY5 A;  4JHJ A;  1HH8 A;  3LS8 A;  1NL4 A;  1EYH A;  1BU9 A;  3DSS A;  3QDN A;  4LRZ A;  3ZYL A;  2WXH A;  2GRO B;  4GTP A;  2WXQ A;  4EZJ A;  3RSE G;  1JPL A;  1N95 A;  3N71 A;  4G11 A;  4HLL A;  4EHM A;  2QFC A;  4WWN A;  3FU5 A;  1K1B A;  1L5J A;  5CER B;  3DRA A;  3ZGQ A;  2WXM A;  2X6I A;  2ZU6 B;  4WAF A;  4J8D A;  2BF0 X;  1S0P A;  1LD7 A;  3FTZ A;  1BPO A;  1IHG A;  2EIJ E;  2CHX A;  4H7Y A;  4TRQ A;  2WM9 A;  5C1D A;  3DEO A;  3VLF A;  3ZN3 A;  5FJY A;  4P29 A;  1BLX B;  4GB9 A;  3V2O A;  3CVX A;  1ZBP A;  1E7U A;  2XEE A;  3K9I A;  3C98 A;  2HYZ A;  1HS6 A;  4YDY A;  2ZIR A;  1DCE A;  1HG5 A;  3SD5 A;  1PY1 A;  3UMV A;  1BD8 A;  3O4Z A;  3ASO E;  2C2L A;  1H2V C;  2XEN A;  4J7W A;  4C0M A;  4L2L A;  4MRU A;  3CVP A;  4OAU C;  3FUF A;  4CDM A;  3CKB A;  2IOS A;  1NZN A;  3Q73 A;  3AS4 A;  3QKY A;  3QWP A;  4ACK A;  3DST A;  3BEE A;  5ENT D;  3AAA C;  3EIJ A;  4GZC A;  2VSO E;  3TJP A;  4R7L A;  3PUK A;  3J5P A;  4UWH A;  3TWX A;  1K8K G;  4J8S A;  3FUK A;  4TXQ A;  5FTP A;  1OCR E;  3SHF A;  3ABL E;  1SW6 A;  2J4B A;  3ESK A;  3C5R A;  3NOC D;  3RRM B;  4EBA A;  3MYV A;  5CHE E;  4I6J A;  2GRL A;  1NA0 A;  4XEI G;  1FVH A;  5AQ7 A;  1NA3 A;  4HNA D;  4UQY A;  4BX8 A;  4GU5 A;  2XGS A;  4G8K A;  5JHA A;  3ZUV B;  3PEV B;  5B1B E;  2I9C A;  3MV3 B;  3IBE A;  3E30 A;  4K03 A;  1HZ4 A;  5EDS A;  4K0R A;  3CHP A;  4TUM A;  4HS2 A;  4YND A;  3LJN A;  5BXU A;  3Q9N C;  1UJJ A;  3ZXS A;  4DPR A;  4YDE A;  2DBA A;  5KJM A;  1OCZ E;  4BSZ B;  4HOR A;  4C9B B;  4KVO A;  3ESL A;  3PDN A;  4HQD A;  2LXM A;  3LVQ E;  1MX6 A;  2DWZ A;  4CT4 A;  4CCA A;  1NFI E;  2WXL A;  4HB5 A;  3CVV A;  2ZGG A;  1E96 B;  3JQ0 A;  2VGX A;  5EIL A;  3ASN E;  4J8F A;  2XGM A;  2PNN A;  4GZ6 A;  4WNE A;  3URZ A;  1MX4 A;  2L6J A;  3CK9 A;  1N9A A;  1QYM A;  3MZL B;  4CYM D;  2X6F A;  5A6C A;  4HVB A;  5KBA A;  1P5Q A;  1X81 A;  4URK A;  2CFU A;  2LSV A;  4G2V A;  5AQA A;  4U96 D;  3JUI A;  5KJK A;  2WXI A;  3QC1 A;  2HE0 A;  2FI7 A;  2KCV A;  3UIO C;  2C0L A;  3PS6 A;  2R02 A;  3ZNG A;  5LX8 A;  5ENS D;  2WXG A;  4ATG A;  4I1A A;  1DCQ A;  2CG3 A;  3S7D A;  2WMN A;  3UM2 A;  1XNF A;  4G25 A;  2OV8 A;  3DSX A;  3RRN B;  4APF A;  4N5C A;  4PDX A;  3RK6 A;  3APF A;  5KJN A;  2P9K G;  5HRY A;  3LYA A;  4BTB A;  1U3C A;  4FA6 A;  3CHM A;  2WB2 A;  1G3N B;  1N52 A;  3R9M A;  4HRN A;  4GCO A;  5ANL A;  1S64 A;  2XRY A;  4B94 A;  2FO1 E;  2VSY A;  4CEM A;  5JJ7 A;  2EIK E;  2A5E A;  5AYW D;  4J8E A;  5CEC B;  3KSL A;  2IFU A;  3AG3 E;  3ZW3 A;  5FT9 A;  3HDX A;  4L2Y A;  3FU3 A;  3ASG A;  4I2Z A;  3ML9 A;  3T8K A;  1SA4 A;  4BWR A;  1NI1 A;  4RVB A;  4LER A;  5KJL A;  4ZHB A;  5AN8 A;  4RLY A;  1YYH A;  3QOU A;  2LNI A;  5KWD A;  3Q75 A;  3IHV A;  3CST A;  3CK8 A;  1TNY A;  2E2E A;  4BX9 A;  3CVW A;  3G2S A;  3MKQ A;  2XRZ A;  1V55 E;  2NYJ A;  1TN7 A;  2H6I A;  1O1R A;  5AQB A;  4GZ5 A;  3PRZ A;  4XE0 A;  2ETC A;  4DJA A;  4K5A B;  1Y6I A;  4JVS A;  3SI5 A;  3OXL A;  1WG0 A;  3HXD A;  3SZ7 A;  5JJT A;  3Q7A A;  4AY6 A;  3D9O A;  2KAT A;  4HLE A;  2BTD A;  3CV0 A;  2EQX A;  3SBT B;  2DCP A;  4OAV B;  3I4G A;  4G8L A;  4GMR A;  4DLO A;  2AWI A;  3PZ2 A;  4N2Q A;  1YCS B;  4GYY A;  4ATZ D;  3D9H A;  4BFR A;  3RKV A;  2V0P A;  3VTX A;  3B7U X;  2WPV A;  3ASD A;  4KBQ A;  3O48 A;  2J07 A;  3FEX A;  5G04 J;  2LSU A;  3G2W A;  2Y3A A;  3Q5M A;  4L9P A;  3DBS A;  1DC2 A;  4GA0 A;  3B13 A;  4YDW A;  1N4S A;  2RFA A;  2VGX B;  3ONL A;  4GPK A;  4BY6 A;  2MOW A;  4FAD A;  3C3R A;  2LO6 A;  1JWG A;  2WMO A;  4PS8 A;  3EHQ A;  5FIN A;  3E32 A;  3BUA A;  1DNP A;  4B93 B;  3GYZ A;  1EF1 C;  3ULE G;  2JAB A;  4NIK A;  3V2X A;  1OCC E;  1UJK A;  4DX7 D;  3Q9U C;  1KZP A;  1ELK A;  3EUV A;  4CZ2 D;  4LG6 A;  3D3M A;  5M72 A;  4JB8 P;  1JUQ A;  3LY8 A;  2Y4U A;  3FTX A;  3D9L A;  5BT1 A;  3AG4 E;  4I2W A;  2F0Y A;  4IYP A;  4CDR A;  4U0Z A;  3FH7 A;  4U0S A;  4ANW A;  5G05 J;  2XPY A;  5EN5 D;  4B8C B;  4GPM A;  4KYO B;  2AVP A;  3CHS A;  3Q79 A;  3S7F A;  1ZB1 A;  5DBK A;  1MJ0 A;  5ARG A;  2JLB A;  3EU9 A;  4GTM A;  4CRW A;  1Z6T A;  2EIM E;  2EIN E;  4XI9 A;  3V79 K;  1O1T A;  3SGH A;  4BER A;  4FU3 A;  2XPZ A;  3MKR A;  4KXK B;  1K3Z D;  4KZC A;  4ILI A;  4IUL A;  4HBD A;  4ANV A;  5DIZ A;  4TXR A;  2DYS E;  3QNK A;  4KMO A;  3TG4 A;  4A1S A;  5ENO D;  3B7S A;  5FQ4 A;  3SFZ A;  2WXF A;  4MKT A;  1HE8 A;  1MYO A;  1HO8 A;  3FWV A;  2BKG A;  3QB2 A;  4C0E A;  1XGW A;  2IOL A;  3I3N A;  1SVX A;  2UY1 B;  1QQE A;  3UIN C;  3SY2 A;  5BUZ A;  4BTA A;  4JHK A;  1AWC B;  2RD0 A;  4GCN A;  2VQ2 A;  3U3W A;  5ENQ D;  3EHR A;  1LD8 A;  2WXR A;  3UI2 A;  1S63 A;  2WVI A;  4QFV A;  4XIF A;  5FZS A;  2V4H C;  4MBG A;  3G2U A;  5AJD A;  4AOF A;  2B0O E;  5FZQ A;  2I1J A;  5G55 A;  4BT9 A;  4GTT A;  4KZ0 A;  3L13 A;  3TAX A;  1TJF A;  2XS8 A;  3ULQ A;  3CVY A;  3EU5 A;  4E85 A;  3D9N A;  4GZD A;  3MA5 A;  2L6B A;  2DZN A;  2WQH A;  3PEU B;  5CRV A;  4I6E A;  2XPI A;  3AS5 A;  5LCW J;  4FLH A;  2XZT G;  2UY1 A;  1IQR A;  1JWF A;  3FTV A;  4Y6C A;  4F53 A;  4GMJ A;  2PL2 A;  1MX2 A;  3FHE A;  5CMW A;  2XZD G;  3FTY A;  3MKQ B;  3UT4 A;  1OWP A;  1ELR A;  5B1A E;  3KSQ A;  4UWG A;  1UOH A;  1TR4 A;  1A5E A;  2WQ6 A;  2JEK A;  4GA2 A;  3W9F A;  3PNT B;  1IHB A;  4EPZ A;  4YVQ C;  2YQ8 A;  1HXI A;  2NXP A;  4U7E B;  3NZU A;  4J6I A;  2V5F A;  3DWL G;  1OWM A;  1IXV A;  2VSN A;  3ZVV A;  3LVR E;  5AEN A;  4H7X A;  3Q49 B;  4JZY A;  3LCA A;  4AVX A;  2R2L A;  5E76 A;  4ACL A;  5AQ9 A;  2XHE A;  4TV3 A;  1X5B A;  3FDH A;  4E6H A;  5HKP A;  5CCL A;  2CG2 A;  4I17 A;  5CBO A;  4GTS A;  3B7R L;  2E0I A;  2F37 A;  3SF4 A;  3LDZ A;  1H19 A;  1KPS B;  3W9G A;  3JYS A;  1Q2Z A;  3Q7F A;  4JPS A;  2Y4T A;  4UQX A;  5ITZ F;  4BT8 A;  5FQ6 A;  1MQS A;  3U64 A;  1BI7 B;  4Y6W A;  4GYO A;  3OTN A;  1N94 A;  4N39 A;  3C3Q A;  3R7Q A;  5FWQ A;  4U63 A;  2WXN A;  2OVB A;  3EHM A;  4KVM A;  3JUE A;  2V8S E;  3R9A B;  3ZKJ A;  3SBS A;  3PUJ A;  3GW4 A;  2WXP A;  4N3C A;  2LXL A;  4LCT A;  1QBQ A;  2MHK A;  3FTS A;  4JA7 A;  2L0T B;  4IRU A;  3QJZ A;  3LY9 A;  5CRU A;  4RG9 A;  3PRE A;  4UWK A;  3T8M A;  1IYG A;  3MJW A;  4U8H A;  3FH8 A;  3ENE A;  4UWF A;  4B8A A;  3TWV A;  4FP7 A;  4LNB A;  2Q7F A;  4JEU A;  2J09 A;  4ANX A;  3HG0 D;  4FC8 A;  3RAU A;  3CVU A;  3MEK A;  2OVF A;  3FP3 A;  5D2M C;  4GZ3 A;  2LAI A;  2B6C A;  3UKR G;  3CK7 A;  4CGW A;  2BUG A;  1KT1 A;  2IO3 C;  4LNG A;  3L82 A;  1E7V A;  4V3I A;  2OCC E;  1MZC A;  5EX0 A;  4A3T A;  2P9P G;  5G04 C;  3ZPJ A;  3IKO B;  4HOQ A;  1TNO A;  3FUE A;  4GAA A;  3L08 A;  3QWV A;  1WY6 A;  4HXI A;  3FUH A;  3JQ1 A;  3NBN B;  4F3V A;  1WM5 A;  3U66 A;  3PVL A;  2IQC A;  2Y1L E;  2KBX A;  2F8X K;  4DX6 D;  4ME2 A;  1FCH A;  4MLP A;  4TUU A;  1TEZ A;  2HO1 A;  1O5M A;  3KEA A;  3QAR A;  3ZRH A;  2X6H A;  1H2T C;  4Q94 A;  3PZ3 A;  3G2T A;  4EEC A;  2OOE A;  3T5X A;  2J08 A;  3LY7 A;  3T9K A;  1N11 A;  4GTQ A;  4FLB A;  4F1P A;  1D8D A;  4FHJ A;  3F6Q A;  3LKU A;  2DZO A;  5FQ8 A;  1QZ2 A;  3ZHE A;  3UT7 A;  4N3B A;  3AU5 A;  2UWJ G;  2IF4 A;  3TL5 A;  1OXJ A;  2DVW A;  5AIJ A;  5JA4 D;  4PS3 A;  3UX4 A;  1WDY A;  3PNL B;  4EQF A;  3C3O A;  3EDT B;  2GGF A;  3ABK E;  2R03 A;  1UG3 A;  5EID A;  4W9R A;  4M3O A;  2GRM A;  5AAO A;  4QQI A;  4B0Z A;  4G24 A;  4I9C A;  2ION A;  2RFM A;  5ENP D;  4EBA G;  2GRP B;  3UM3 A;  4Q69 A;  3BU8 A;  1WAO 1;  1N0Q A;  5ANR A;  5BPP A;  4OVV A;  4OVU A;  2GRQ B;  3HXB A;  3FU0 A;  3UPV A;  4RG6 A;  3EIQ C;  1BI8 B;  2RG8 A;  2VTB A;  3NF1 A;  2ZIS A;  2FEZ A;  1QNF A;  5BV1 A;  1UN8 A;  4I9E A;  3FH5 A;  4JL0 A;  3CSF A;  2PQR A;  3CIA A;  4K5C A;  2R5S A;  4XI0 A;  2XQ0 A;  3L22 A;  3S7J A;  1RW2 A;  1U2V G;  5LP0 A;  4FUL A;  1TN8 A;  2J49 A;  2P58 C;  4PS7 A;  3D9K A;  4UUC A;  1TN6 A;  2FUL A;  4A3V A;  5KNH D;  5D0Q D;  3E34 A;  4GTO A;  4PH4 B;  4GML A;  4AP2 A;  2AXU A;  2KM4 A;  3D9I A;  3FTU A;  2FF4 A;  1UN9 A;  4LNU D;  5BXO A;  5D66 A;  1TJC A;  3S7B A;  4DRX E;  3MCX A;  1E8X A;  1H6O A;  3OXF A;  2ETB A;  5AJL A;  4BSX A;  3TG5 A;  3ZFW A;  5G2N A;  4JC8 A;  1Y8M A;  1W3B A;  4LUN U;  5HS0 A;  2HM8 A;  1PAQ A;  2P2C P;  4JXT A;  4GYW A;  4XX5 A;  2ETA A;  4JW1 A;  3FTW A;  4IN3 B;  2L0I A;  3TGO A;  1RZ4 A;  2L9B A;  2AXZ A;  2CFZ A;  1LF8 A;  3L9T A;  3CHR A;  2I1K A;  2IEJ A;  3BG0 B;  3CHQ A;  4HFG A;  3GZ2 A;  4UI9 K;  5G05 C;  1YA0 A;  1IKN D;  3PZ4 A;  1HU3 A;  4Z68 A;  3FUL A;  3SFX A;  4DI3 A;  2YNQ A;  2J8S D;  5A7D B;  4DX5 D;  3V30 A;  1SA5 A;  5H7P A;  3VLE A;  4O1O A;  2NSZ A;  4NAC A;  4X8Q A;  1TNZ A;  3D9J A;  4AM9 A;  3ZXP A;  1AP7 A;  2M63 A;  3CQC B;  4Q96 A;  1KT0 A;  4GTR A;  2NC9 A;  3VTY A;  1JCQ A;  4HOU A;  4MS6 A;  4GTV A;  2IJG X;  3ZIM A;  3D9M A;  3HVE B;  3QWW A;  4HI9 A;  3ZHE B;  2QZA A;  3UIP C;  1ZU2 A;  3V31 A;  1H6K A;  4WWO A;  2V5Q C;  3EHN A;  2WXK A;  3MX3 A;  4K5B A;  3CVL A;  1E90 A;  3S2A A;  4CDN A;  3NZS A;  1MHQ A;  1OY3 D;  4U04 A;  3HXF A;  1YMP A;  3UUX A;  4F1S A;  3CGH A;  1JCR A;  1OWN A;  3DSW A;  2HR2 A;  2J4D A;  3NOG D;  4HRL A;  3CQG B;  2LUH A;  2BKK B;  3MV2 B;  4EZL A;  4JD2 G;  1JCS A;  2PZI A;  4I1M A;  2H6H A;  4WUY A;  3C72 A;  4L1B A;  1N4Q A;  2VGE A;  2P9N G;  5ENR D;  5T4Y A;  4AJW A;  3NAW A;  2KZT B;  1H6P A;  3CHO A;  2X38 A;  5ARF A;  4O1P A;  4NRH B;  4RQI A;  4N3A A;  3NB2 A;  3DPD A;  5CBN A;  2ILR A;  4DLQ A;  4AEZ C;  2QYJ A;  3DEP A;  3I5P A;  5LCW C;  3E4B A;  3FUJ A;  1E8Y A;  2BED A;  2WQ7 A;  3RIB A;  4HOT A;  2XCB A;  1DVP A;  4CT0 A;  1UW4 B;  2DIW A;  3ISM C;  4U0U A;  3TXN A;  3UKU G;  4ILG A;  3TWU A;  1TNB A;  3IEG A;  2MYO A;  3FFL A;  4JHR A;  2H6G A;  2VJ8 A;  4D10 C;  4L23 A;  3FUI A;  3CEQ A;  4L7T A;  2CHZ A;  2P9L G;  4XKB A;  2AW6 A;  1TNU A;  3B7B A;  3ZU7 B;  3I4R B;  4WND A;  4RSY A;  4BEP A;  1ELW A;  3PZ1 A;  3T5V A;  5LFA A;  3FY4 A;  2RKK A;  3LXU X;  1OCO E;  5JJ6 A;  2MRI A;  5CEA A;  4LEU A;  4I6G A;  3U4T A;  3P1U A;  3FEY A;  1INZ A;  4UQZ A;  4APO A;  1FPP A;  4JEH A;  4XKC A;  3JXI A;  5CED B;  1PC2 A;  1OWO A;  3LPZ A;  3AS8 A;  2Y0B G;  4OYS A;  3CVN A;  4DI4 A;  2I6H A;  2J9Q A;  3E37 A;  3FUM A;  3AU4 A;  1N4R A;  2IO2 C;  2A5U A;  3HXE A;  3L17 A;  4EZK A;  3FUD A;  1FT1 A;  3AJI A;  4NQ0 A;  5B3S E;  4AV7 A;  3RU0 A;  3TXM A;  3PZD A;  2GRN B;  2DYR E;  3B95 A;  2A4Z A;  4FJY A;  5T8I A;  4AXH A;  2X6K A;  3DXM G;  3TWR A;  2F8Y A;  1NP7 A;  5KCM A;  2V4L A;  3SFY A;  2GW1 A;  2OND A;  3APD A;  1H2U A;  3U9W A;  2WXJ A;  3CKC A;  1GW6 A;  4YVO A;  2XGO A;  2IU1 A;  3HXC A;  4F7A A;  2ZGD A;  4DX1 A;  4TXP A;  2KXP C;  3LJ3 A;  3TWW A;  2YHC A;  3GZ1 A;  1O1S A;  3L16 A;  2YHE A;  3PE3 A;  4A1G A;  5BV0 A;  4WNG A;  1HFA A;  3G2V A;  1OT8 A;  3TWT A;  1EDU A;  4GA1 A;  3QK0 A;  4CGV A;  3B7T A;  2ZXW E;  3Q4A B;  2FO7 A;  4A55 A;  5JHB A;  5EYL A;  2XEH A;  4BES A;  2P9I G;  4B89 A;  2EIL E;  4JA9 A;  1EPU A;  3UM0 A;  3MGB A;  3UTM A;  2VYI A;  5E75 A;  2LAH A;  4G26 A;  4UI9 J;  1D9S A;  1U3D A;  5J90 A;  4N5Q A;  1HX8 A;  2KC7 A;  1E8W A;  3PH0 C;  3TWQ A;  3ZYM A;  1Z5S C;  4J8Y A;  3ONK A;  3HYM B;  4G1T A;  3HRA A;  1K1A A;  3DSU A;  2QYU A;  1FVF A;  4ZFH A;  2R59 A;  2Y69 E;  3ZYQ A;  1IQU A;  1S70 B;  4FHK A;  2H6F A;  2AXV A;  5A23 A;  4U8Y D;  1OWL A;  3E33 A;  3ML8 A;  5EYP F;  2PM7 A;  4O6F A;  3BG1 B;  5D0O D;  5AAR A;  2GRR B;  2CHW A;  1N4P A;  3P2B A;  2IY0 C;  4KT6 B;  3VLD A;  5FQ7 A;  3RO3 A;  2P9U G;  4ABN A;  3HIZ A;  4F6R D;  2X3M A;  3IHY A;  1E8Z A;  3J5Q B;  5BW8 C;  4WNF A;  4BET A;  2VTB B;  3DXK G;  5ENN A;  3WXX A;  3IXE A;  4DX2 A;  2AJA A;  3Q78 A;  5T3R A;  4UI9 C;  2C0M A;  3QAQ A;  3AG1 E;  1KZO A;  1V54 E;  2YIN A;  4NUR A;  5C2Y A;  2R05 A;  2PM6 A;  2VSX E;  3HVE A;  4HI8 A;  4PUC A;  3CLJ A;  5BNW A;  1FT2 A;  1N0R A;  3Q15 A;  1SQM A;  5EX3 A;  3NQP A;  3EJN A;  2XCC A;  3ASH A;  3GZS A;  4DK5 A;  1H0A A;  4U07 A;  5CCM A;  4ANU A;  3OAW A;  2QY7 A;  3CR3 A;  3ZEF A;  4U95 D;  1HF8 A;  3KEZ A;  3APC A;  2R17 C;  2WXO A;  3KD7 A;  1B89 A;  1Z3Y A;  5HQ8 A;  3KS2 A;  4ILH B;  3SO8 A;  3UXG A;  4AIF A;  3AG2 E;  3R7R A;  3L54 A;  3UM1 A;  4LSZ E; 
#chains in the Genus database with same CATH homology
 4CDN A;  3R7Q A;  3NZS A;  5FWQ A;  1MHQ A;  3UQ3 A;  5AYW D;  4J8E A;  5CMY A;  4U63 A;  3IV0 A;  2WXN A;  2IFU A;  3ZW3 A;  5FT9 A;  3HDX A;  5HI7 A;  2OVB A;  4L2Y A;  3FU3 A;  3ASG A;  4U04 A;  4I2Z A;  3EHM A;  3UUX A;  4F1S A;  3RO2 A;  4KVM A;  3CGH A;  3ML9 A;  2V8S E;  1OWN A;  3R9A B;  4BWR A;  2HR2 A;  3SBS A;  1N54 A;  2J4D A;  3PUJ A;  4RVB A;  4J0U A;  4LER A;  5KJL A;  3GW4 A;  2WXP A;  4N3C A;  3CQG B;  2X6J A;  4LCT A;  3MV2 B;  4EZL A;  2MHK A;  5FZR A;  3RRU A;  4FJZ A;  1KLX A;  3FTS A;  4JA7 A;  3OXG A;  3FU6 A;  2PQN A;  2PZI A;  2L0T B;  4I1M A;  3QOU A;  4IRU A;  1SZA A;  2LNI A;  3D9P A;  3QJZ A;  3LY9 A;  3PE4 A;  4RG9 A;  4WUY A;  3IHV A;  3HHM A;  3PRE A;  4L1B A;  1SZ9 A;  4UWK A;  3T8M A;  1IYG A;  3CST A;  3CK8 A;  3MJW A;  3FUN A;  2E2E A;  4U8H A;  3FH8 A;  3UT8 A;  3ENE A;  4BX9 A;  3CVW A;  4UWF A;  4B8A A;  3G2S A;  3MKQ A;  4FP7 A;  3JCK C;  2XRZ A;  5T4Y A;  2Q7F A;  4AJW A;  4JEU A;  3LEW A;  3CVQ A;  2FBN A;  2J09 A;  4I1O B;  3L6A A;  4ANX A;  5J08 A;  5LOZ A;  2KZT B;  4FC8 A;  5EKQ D;  3CHO A;  2X38 A;  3CVU A;  4GPK A;  5ARF A;  3MEK A;  2OVF A;  4NRH B;  3FP3 A;  4GZ5 A;  4N3A A;  4GZ3 A;  3PRZ A;  3DPD A;  4XE0 A;  2ILR A;  2LAI A;  2KZT A;  4DLQ A;  4WWP A;  4DJA A;  4XZ4 A;  2KCK A;  4G23 A;  1Y6I A;  3CK7 A;  4AEZ C;  4CGW A;  4JVS A;  3I5P A;  1A17 A;  3SNX A;  2BUG A;  1KT1 A;  3OXL A;  3Q47 B;  3SI5 A;  5LCW C;  4HOS A;  3E4B A;  3FUJ A;  3ASF A;  3KAE A;  4I43 A;  1E7V A;  3SZ7 A;  1E8Y A;  1Z3X A;  2WQ7 A;  4V3I A;  5JJT A;  3RIB A;  4HOT A;  5EX0 A;  4A3T A;  4AY6 A;  5G04 C;  3D9O A;  1OUV A;  2KAT A;  1DVP A;  2XCB A;  2I2O A;  4CT0 A;  4HLE A;  3ZPJ A;  3ZYK A;  2XEV A;  1VDY A;  2BTD A;  2KCL A;  1UW4 B;  3IKO B;  3CV0 A;  4UWL A;  4HOQ A;  2EQX A;  2DIW A;  3FUE A;  4GAA A;  4U0U A;  2DCP A;  3L08 A;  2VGY A;  3QWV A;  3SBT B;  1HG2 A;  4N2S A;  3I4G A;  1WY6 A;  3TXN A;  4HXI A;  3FUH A;  4ILG A;  4AY5 A;  3JQ1 A;  3IEG A;  4JHJ A;  4DLO A;  2AWI A;  3FFL A;  1HH8 A;  4F3V A;  4N2Q A;  3LS8 A;  1WM5 A;  4GYY A;  4JHR A;  3U66 A;  2VJ8 A;  3PVL A;  4BFR A;  2IQC A;  3RKV A;  2V0P A;  4D10 C;  4L23 A;  3VTX A;  1EYH A;  3B7U X;  3FUI A;  2WPV A;  3CEQ A;  4L7T A;  3RJV A;  3ASD A;  4KBQ A;  3O48 A;  2J07 A;  3QDN A;  4LRZ A;  2CHZ A;  4ME2 A;  3ZYL A;  2WXH A;  4XKB A;  2AW6 A;  1FCH A;  3FEX A;  4MLP A;  4TUU A;  2HO1 A;  1TEZ A;  2WXQ A;  5G04 J;  4EZJ A;  3I4R B;  2LSU A;  3QAR A;  4WND A;  3ZRH A;  3G2W A;  1JPL A;  2X6H A;  1H2T C;  4RSY A;  2Y3A A;  3Q5M A;  3N71 A;  4G11 A;  4Q94 A;  3G2T A;  4EEC A;  2QFC A;  2OOE A;  3DBS A;  3T5X A;  2J08 A;  1ELW A;  4WWN A;  3FU5 A;  3LY7 A;  1L5J A;  4GA0 A;  3B13 A;  3T5V A;  5LFA A;  4FLB A;  3FY4 A;  2VGX B;  3LXU X;  3ONL A;  2WXM A;  3ZGQ A;  4FHJ A;  5JJ6 A;  2MRI A;  2MOW A;  2X6I A;  4BY6 A;  2ZU6 B;  3LKU A;  4LEU A;  4WAF A;  4I6G A;  4J8D A;  5FQ8 A;  4FAD A;  2LO6 A;  1QZ2 A;  1JWG A;  1S0P A;  2BF0 X;  2WMO A;  4PS8 A;  3FTZ A;  3U4T A;  1BPO A;  1IHG A;  3P1U A;  3ZHE A;  2CHX A;  4H7Y A;  3FEY A;  4N3B A;  3UT7 A;  1INZ A;  4TRQ A;  4UQZ A;  1DNP A;  2UWJ G;  2IF4 A;  2WM9 A;  3AU5 A;  3TL5 A;  5C1D A;  3VLF A;  4APO A;  4JEH A;  4XKC A;  3ZN3 A;  5FJY A;  3GYZ A;  1EF1 C;  4P29 A;  1PC2 A;  4GB9 A;  1UJK A;  1OWO A;  5AIJ A;  3CVX A;  3LPZ A;  1ZBP A;  1ELK A;  3AS8 A;  4PS3 A;  3UX4 A;  1E7U A;  4OYS A;  3PNL B;  3CVN A;  4EQF A;  4DI4 A;  3EDT B;  2I6H A;  2GGF A;  2J9Q A;  3K9I A;  3C98 A;  2HYZ A;  3FUM A;  3D3M A;  5M72 A;  1HS6 A;  3AU4 A;  2A5U A;  3L17 A;  1JUQ A;  4EZK A;  3FUD A;  3LY8 A;  2Y4U A;  3FTX A;  3D9L A;  4NQ0 A;  5BT1 A;  1UG3 A;  4AV7 A;  4I2W A;  3RU0 A;  1HG5 A;  4W9R A;  3TXM A;  4M3O A;  1PY1 A;  4IYP A;  3SD5 A;  3PZD A;  4U0Z A;  3FH7 A;  4U0S A;  4ANW A;  4CDR A;  5G05 J;  3UMV A;  2XPY A;  2GRM A;  5T8I A;  2A4Z A;  4FJY A;  4B8C B;  4AXH A;  2X6K A;  3O4Z A;  4KYO B;  2AVP A;  2C2L A;  1H2V C;  4B0Z A;  3CHS A;  3S7F A;  4C0M A;  4L2L A;  4MRU A;  5DBK A;  1NP7 A;  5ARG A;  2JLB A;  2V4L A;  5KCM A;  4G24 A;  4I9C A;  3CVP A;  2GW1 A;  2ION A;  3FUF A;  2OND A;  3APD A;  4CDM A;  1H2U A;  4CRW A;  3CKB A;  3U9W A;  1Z6T A;  3CKC A;  2WXJ A;  2IOS A;  1NZN A;  4EBA G;  4XI9 A;  1GW6 A;  4YVO A;  3SGH A;  4Q69 A;  4FU3 A;  1WAO 1;  2XPZ A;  3AS4 A;  3QKY A;  3MKR A;  2XGO A;  4KXK B;  3QWP A;  2IU1 A;  4ACK A;  5ANR A;  5BPP A;  4KZC A;  4F7A A;  3BEE A;  4ILI A;  4OVV A;  4IUL A;  4OVU A;  4ANV A;  5DIZ A;  3EIJ A;  4GZC A;  3QNK A;  2VSO E;  3FU0 A;  3LJ3 A;  4KMO A;  2YHC A;  3TG4 A;  3TJP A;  4A1S A;  3GZ1 A;  4R7L A;  3B7S A;  3PUK A;  3UPV A;  4RG6 A;  3L16 A;  3EIQ C;  5FQ4 A;  2RG8 A;  2YHE A;  3SFZ A;  2VTB A;  2WXF A;  3NF1 A;  3PE3 A;  4UWH A;  4MKT A;  2FEZ A;  4A1G A;  1QNF A;  1HE8 A;  5BV1 A;  1UN8 A;  5BV0 A;  4I9E A;  3FH5 A;  4J8S A;  4WNG A;  3FUK A;  1HO8 A;  3FWV A;  1HFA A;  4JL0 A;  3CSF A;  5FTP A;  3G2V A;  3SHF A;  2PQR A;  3QB2 A;  4C0E A;  1EDU A;  1XGW A;  2IOL A;  3I3N A;  4GA1 A;  3CIA A;  2UY1 B;  1QQE A;  3QK0 A;  2R5S A;  5BUZ A;  4BTA A;  4JHK A;  3B7T A;  4XI0 A;  2RD0 A;  4CGV A;  2J4B A;  2XQ0 A;  3ESK A;  3L22 A;  3Q4A B;  3S7J A;  2FO7 A;  4A55 A;  4GCN A;  3RRM B;  4EBA A;  3MYV A;  5JHB A;  2VQ2 A;  5LP0 A;  5CHE E;  4FUL A;  3U3W A;  4I6J A;  4B89 A;  4JA9 A;  2WXR A;  2J49 A;  2GRL A;  2P58 C;  4PS7 A;  1NA0 A;  1EPU A;  3MGB A;  1FVH A;  3D9K A;  1NA3 A;  2WVI A;  2VYI A;  4QFV A;  4UQY A;  5E75 A;  4BX8 A;  2FUL A;  4A3V A;  2LAH A;  4XIF A;  5FZS A;  4G26 A;  4GU5 A;  4UI9 J;  2XGS A;  1U3D A;  5J90 A;  3G2U A;  5JHA A;  1HX8 A;  2KC7 A;  5D0Q D;  3PEV B;  1E8W A;  3PH0 C;  5AJD A;  3ZYM A;  4AOF A;  2I9C A;  5FZQ A;  4PH4 B;  2I1J A;  4GML A;  3MV3 B;  5G55 A;  4AP2 A;  2AXU A;  4BT9 A;  3IBE A;  3ONK A;  4K03 A;  1HZ4 A;  4KZ0 A;  3HYM B;  3L13 A;  5EDS A;  4G1T A;  2KM4 A;  3D9I A;  4K0R A;  3TAX A;  1TJF A;  3CHP A;  4HS2 A;  3ULQ A;  3FTU A;  2FF4 A;  1UN9 A;  3D9N A;  4GZD A;  4YND A;  4E85 A;  3CVY A;  1FVF A;  2R59 A;  3MA5 A;  3ZYQ A;  1IQU A;  1UJJ A;  3ZXS A;  4DPR A;  1TJC A;  3S7B A;  4FHK A;  2DBA A;  3MCX A;  2AXV A;  1E8X A;  2WQH A;  3PEU B;  5KJM A;  5A23 A;  3OXF A;  4HOR A;  1OWL A;  3ML8 A;  4I6E A;  2XPI A;  3AS5 A;  5AJL A;  4C9B B;  4KVO A;  2PM7 A;  4O6F A;  3ESL A;  3TG5 A;  4BSX A;  3BG1 B;  3PDN A;  5D0O D;  5LCW J;  4FLH A;  2UY1 A;  3ZFW A;  1IQR A;  1JWF A;  2CHW A;  3FTV A;  4Y6C A;  3LVQ E;  4F53 A;  5G2N A;  4GMJ A;  4CT4 A;  3P2B A;  2PL2 A;  4CCA A;  2WXL A;  4JC8 A;  1Y8M A;  4KT6 B;  1W3B A;  3CVV A;  1E96 B;  4LUN U;  3JQ0 A;  3VLD A;  2VGX A;  2HM8 A;  1PAQ A;  3FHE A;  5FQ7 A;  4JXT A;  3RO3 A;  5CMW A;  4GYW A;  3FTY A;  3MKQ B;  4XX5 A;  3UT4 A;  4JW1 A;  4ABN A;  1OWP A;  3HIZ A;  2X3M A;  3FTW A;  3IHY A;  1E8Z A;  4IN3 B;  5BW8 C;  2L0I A;  4J8F A;  4WNF A;  1ELR A;  2XGM A;  3TGO A;  2VTB B;  4GZ6 A;  2L9B A;  4WNE A;  5ENN A;  2AXZ A;  3URZ A;  2L6J A;  3WXX A;  2CFZ A;  3CK9 A;  1LF8 A;  3CHR A;  4UWG A;  2I1K A;  5T3R A;  3MZL B;  3BG0 B;  3CHQ A;  4UI9 C;  2X6F A;  4HFG A;  2WQ6 A;  5A6C A;  2C0M A;  2JEK A;  3GZ2 A;  3QAQ A;  1P5Q A;  4UI9 K;  5G05 C;  4HVB A;  4GA2 A;  1YA0 A;  2YIN A;  4NUR A;  5C2Y A;  1HU3 A;  2PM6 A;  2VSX E;  3PNT B;  4EPZ A;  4YVQ C;  3FUL A;  2YQ8 A;  1HXI A;  2NXP A;  4DI3 A;  4URK A;  3HVE A;  3NZU A;  4J6I A;  2YNQ A;  4PUC A;  3CLJ A;  2CFU A;  2V5F A;  2LSV A;  4G2V A;  1OWM A;  5BNW A;  2VSN A;  3ZVV A;  3JUI A;  5A7D B;  3LVR E;  5AEN A;  3Q15 A;  1SQM A;  4H7X A;  5KJK A;  3Q49 B;  4JZY A;  5EX3 A;  3VLE A;  2WXI A;  3LCA A;  3QC1 A;  4AVX A;  2NSZ A;  4NAC A;  5E76 A;  4ACL A;  2FI7 A;  2KCV A;  3NQP A;  3EJN A;  2C0L A;  2XCC A;  3ASH A;  3PS6 A;  3D9J A;  3GZS A;  4DK5 A;  2XHE A;  4AM9 A;  1H0A A;  4TV3 A;  1X5B A;  2M63 A;  4U07 A;  5LX8 A;  2WXG A;  3CQC B;  4Q96 A;  3FDH A;  5CCM A;  1KT0 A;  4ATG A;  4ANU A;  3OAW A;  2QY7 A;  2NC9 A;  3CR3 A;  4I1A A;  3VTY A;  3ZEF A;  4E6H A;  1HF8 A;  2CG3 A;  3KEZ A;  3S7D A;  3APC A;  2WMN A;  2CG2 A;  5CCL A;  2R17 C;  4I17 A;  1XNF A;  2WXO A;  4G25 A;  4HOU A;  3B7R L;  4MS6 A;  3KD7 A;  1B89 A;  2OV8 A;  2E0I A;  3RRN B;  1Z3Y A;  2IJG X;  4APF A;  3ZIM A;  3SF4 A;  3D9M A;  4N5C A;  4PDX A;  3RK6 A;  3HVE B;  1H19 A;  3LDZ A;  3APF A;  5HQ8 A;  3KS2 A;  3JYS A;  3QWW A;  5KJN A;  4ILH B;  2Y4T A;  4JPS A;  3ZHE B;  4UQX A;  4AIF A;  3LYA A;  4BTB A;  4BT8 A;  5FQ6 A;  1U3C A;  4FA6 A;  1ZU2 A;  3R7R A;  1MQS A;  3CHM A;  3U64 A;  2WB2 A;  1H6K A;  3L54 A;  4Y6W A;  4WWO A;  1N52 A;  3EHN A;  4GYO A;  5ANL A;  4GCO A;  2WXK A;  2XRY A;  3MX3 A;  3OTN A;  4B94 A;  2VSY A;  3CVL A;  1E90 A;  4CEM A;  4N39 A;  5JJ7 A;  3S2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...