2I9CA

Crystal structure of the protein rpa1889 from rhodopseudomonas palustris cga009
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
121
structure length
121
Chain Sequence
KLDLHQMTTQDLVALFAKVTVEQDDALLGNQISRFNRLFGVMAEIADELKARDGDQRTALLSLFEYPNMQVRLQAAKLTLAVAPVKAREQLEAIVSSKWFPQAGDAGMCLDLLDDGTFKPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein RPA1889
publication title Crystal Structure of the Protein RPA1889 from Rhodopseudomonas palustris CGA009
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 47
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09450 DUF2019 Domain of unknown function (DUF2019)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2i9cA01
4FJYA 3LS8A 1E8YA 3HIZA 4KZCA 1E90A 3PS6A 4PS3A 2WXNA 3APFA 4JPSA 4G11A 3NZSA 3ZIMA 3TL5A 4UWFA 2X6KA 4L2YA 3DBSA 4WWOA 3NZUA 2WXRA 4FA6A 4L23A 4J6IA 4WWNA 3ZVVA 2WXJA 4TUUA 4FJZA 3QK0A 3L17A 5JHAA 2WXOA 3R7RA 4FADA 4URKA 4HVBA 1E8XA 3ENEA 4AOFA 5EDSA 3L13A 3ML9A 3APDA 5ENNA 2CHZA 1HE8A 3T8MA 1E8WA 2WXGA 3PRZA 4EZLA 5G55A 2A5UA 5T8IA 4ANXA 2WXLA 2V4LA 2X6FA 2Y3AA 2WXQA 4BFRA 3LJ3A 3MJWA 3ZW3A 3L08A 3OAWA 4ANVA 3S2AA 2WXIA 2X38A 4OVUA 4UWLA 4WAFA 4ANUA 3DPDA 3L54A 4HLEA 2WXHA 5G2NA 5ANLA 3QAQA 4FHKA 3CSFA 2CHWA 4UWGA 3IHYA 4A55A 3IBEA 3L16A 4PH4B 4XZ4A 2X6IA 4PS7A 1E7VA 2WXPA 4TV3A 5JHBA 3P2BA 4ANWA 4AJWA 4UWKA 4DK5A 4WWPA 4XX5A 2A4ZA 4KZ0A 4EZJA 3ML8A 2WXKA 4OYSA 3SD5A 4EZKA 4UWHA 4FULA 4FHJA 2I9CA 3CSTA 4XE0A 3PREA 3R7QA 3HHMA 3QARA 2X6JA 3TJPA 1E7UA 4PS8A 2WXFA 4OVVA 2WXMA 2X6HA 2CHXA 2RD0A 1E8ZA 4GB9A 4L1BA 4F1SA 3APCA 4FLHA 3QJZA
chains in the Genus database with same CATH superfamily
1IXVA 3LS8A 2DIWA 1ZB1A 2YHEA 4HBDA 1UJKA 1HFAA 1HX8A 3ZIMA 3IHVA 4G8KA 1JCSA 2KC7A 4FA6A 4JW1A 3ZVVA 1IQUA 1D9SA 4DI4A 1N4QA 4GZ6A 2PL2A 3C98A 2R05A 3AG1E 3T8MA 4M7CA 1TNUA 4ANXA 5IY5E 2P9KG 3B7BA 2WXIA 4U96D 1MHQA 3PDNA 4G23A 2VSOE 3FUEA 2NYJA 3TXMA 3Q9UC 3JQ0A 4GA2A 4JC8A 2OEVA 1WG0A 3HYMB 2GRRB 4B93B 4GTMA 4J8YA 2IF4A 3CV0A 5ANRA 2L0TB 4K5CA 4I17A 3B7SA 4CT0A 4C48B 5HKPA 4RG6A 4XI0A 3KSQA 3L22A 3FUDA 5BNWA 3E33A 2OVBA 2XPYA 4DJAA 3JXIA 4F1SA 5D66A 3QJZA 1U3DA 4U63A 1QZ2A 3FEXA 3UIPC 5T4YA 4RLYA 2ONDA 2PQRA 4GYYA 4UWFA 2F8YA 1H2TC 3AJIA 3PE3A 2XEVA 1MQSA 4HRLA 4U0ZA 3CR3A 4J6IA 3LXUX 4DI3A 1N95A 3VLEA 4MLPA 4IYPA 1TJCA 5KBAA 4HB5A 2UWJG 4ZFHA 1XGWA 4APFA 3B7TA 4GTSA 2P9NG 3HVEB 4CT4A 4FU3A 4CRWA 4UQZA 3UT7A 5FT9A 2J9QA 2KCLA 1Z3XA 2P9PG 4OAVB 3QC1A 2CFUA 2XZTG 3IEGA 3KSLA 5JA4D 4EBAG 3S7FA 4CCAA 3ONKA 3MV3B 3E32A 4PS7A 4KBQA 1Z5SC 2CFZA 2FO7A 4L2LA 4WNEA 1IKND 4AEZC 4JEUA 1L5JA 3VLFA 2ZXWE 4HOTA 4UWHA 5E76A 4F1PA 3V2XA 2VSYA 3E30A 3CVQA 3C3RA 1LF8A 4HOQA 5CCMA 3PVLA 2WXFA 1OWMA 1QQEA 2ZIRA 4FP7A 3R9MA 2DZNA 1E8ZA 4GB9A 5H7PA 4G1TA 3S7JA 4GMRA 3QNKA 1JCRA 2NSZA 3B13A 4CEMA 3MZLB 2V4HC 4Q96A 1EDUA 4N5CA 3ZYLA 3BQOA 4L2YA 3SZ7A 4O6FA 3HXCA 5KJMA 4RQIA 4BEPA 3Q79A 3D9IA 3GYZA 1X5BA 1Q2ZA 1IHBA 1PAQA 4G26A 3D9JA 2OV8A 4I6JA 4LERA 4EZLA 4F6RD 3I4GA 4B94A 1H2VC 3EJNA 4F53A 1QBQA 2VQ2A 1KLXA 4RVBA 1IYGA 5BT1A 3TWQA 3ULQA 3S7DA 3GZSA 2ZU6B 3ZYQA 1JPLA 3KEZA 4DLOA 3AS4A 3ML8A 5HRYA 3TWXA 1YMPA 1PC2A 3NOGD 1NZNA 4PS8A 1TNOA 4O60A 4B8CB 4L1BA 3ZXSA 3RAUA 3TWVA 3AG4E 4DPRA 2J8SD 4HXIA 3Q15A 3Q7FA 3E4BA 1S70B 4TXRA 3TAXA 5B3SE 4TRQA 3UIOC 2WMOA 5HI7A 1H0AA 3V30A 2WQ7A 4WWNA 2FBNA 2WXJA 2P2CP 4H7YA 1O1RA 4KVOA 1N0QA 3FU6A 1E8XA 3FH8A 1YCSB 4YNDA 3OTNA 4U0UA 2WXGA 4U8VD 3SF4A 5BXOA 4JHJA 3DPYA 3W9FA 2LO6A 4DX7D 2IOLA 2J08A 2IJGX 1X81A 2UY1A 1EPUA 3EHRA 4PH4B 4DX2A 3EDTB 3ESLA 3ZKJA 3UUXA 3KS2A 3P2BA 3QOUA 3CVXA 5FIOA 5FINA 3MA5A 4F7AA 2MYOA 2I1JA 3LY8A 2KM4A 3P1UA 2EQXA 3U3WA 4CDNA 4HLLA 3CHSA 2KBXA 1H6KA 3FP3A 3UMVA 1OCRE 2IO2C 3FUJA 1UN9A 2BUGA 4Q94A 4N39A 3ZNGA 4NRHB 2VGXA 3RRMB 4ILGA 5FQ6A 1OWPA 1E90A 4PS3A 4KT6B 3DSTA 4JD2G 3CHOA 3PZ1A 2XS1A 5KWDA 1OT8A 4J0UA 4V3IA 2RG8A 3KAEA 3CVVA 2GRMA 4ACKA 3HXBA 2VSNA 1NFIE 4FADA 2WQHA 2H6GA 2LAIA 3FUIA 2V0PA 5ENNA 3FH5A 4LUNU 4UI9K 4PDXA 5LCWJ 2Y3AA 3PE4A 4KMOA 5KNGA 4M3OA 3LJ3A 4Q69A 5BPPA 3CHMA 3I3NA 1TEZA 4B0ZA 4K5AB 4UI9C 3ZEFA 3CVUA 3RO2A 5LOZA 3ESKA 3L9TA 4UWGA 1UG3A 3T5VA 4LCTA 4BTAA 3L16A 3ZHEA 5FZSA 3OXFA 3PNTB 1E7VA 5AJLA 3GW4A 3ONLA 5D0OD 3ASFA 3RO3A 2XGMA 2Y4TA 5LX8A 4FULA 1N54A 4HQDA 4HOSA 3SI5A 3BEEA 4I1AA 3R7QA 3BG0B 3ISMC 4HFGA 2F0YA 3Q4AB 2GRLA 4AV7A 3K9IA 5J90A 3D3MA 1A5EA 1EYHA 3UM1A 2DZOA 3FY4A 2WXNA 1E96B 2DWZA 3N71A 4JPSA 1MYOA 4G11A 2X6KA 2L9BA 3SHFA 2L6JA 3CK7A 2R2LA 5C2YA 3DEOA 3PEVB 5A7DB 2B6CA 4BT9A 4KVMA 1NI1A 1UW4B 4KYOB 3O48A 1SA5A 4J8DA 2GGFA 3LPZA 1TN6A 1K3ZD 2OCCE 2I6HA 4G8LA 4I1MA 2DBAA 4WAFA 3F6QA 3UT4A 4XI9A 3DPDA 2X3MA 4NACA 2I1KA 3JXJA 4UUCA 4LEUA 4DX1A 1H2UA 2IO3C 3Q75A 4BX9A 1N11A 1K8KG 3LY7A 2WPVA 2IY0C 2YHCA 3FTWA 3LDZA 4UWKA 4DK5A 2A4ZA 2E2EA 2L6BA 3QWVA 4A1SA 1HS6A 3ASGA 3LCAA 5FZRA 3I5PA 3TJPA 3Q47B 1SZ9A 3C3OA 5CERB 4GU5A 5CMWA 2F8XK 4MS6A 2BF0X 3RKVA 2PM7A 1N4SA 5G04J 2V5FA 2KXPC 4GTRA 3UQ3A 2R02A 3ASHA 2J07A 4BERA 3OXLA 2HM8A 3MCXA 2XEHA 1O1SA 2GRPB 4HI8A 2KCKA 1N94A 2H6FA 2P58C 1H6OA 5JHAA 2WXOA 2KCVA 5AQBA 3R7RA 3ZYKA 2XCBA 5AQAA 1QNFA 3GZ2A 1PY1A 3NBNB 2EIKE 3JQ1A 2HE0A 3AAAC 1XNFA 1KZOA 3AS5A 2J4BA 5BUZA 2XZDG 2VGXB 3IXEA 2WQ6A 3MJWA 3EU5A 3RSEG 3OAWA 4OVUA 3TWWA 5EKQD 2P9UG 4HLEA 1MX6A 4I9EA 4U07A 4G24A 4JEHA 1D8EA 3CVWA 3CVPA 1IHGA 2QY7A 3CK9A 3SFZA 2LXLA 3MKQB 4AY5A 3TG5A 2P9IG 1N4RA 2FF4A 5FQ4A 3CHQA 3AU5A 2LXMA 4GMLA 3CLJA 4AY6A 2YQ8A 2WXKA 4BETA 3DXMG 3TWSA 1B89A 3QWPA 2ZGGA 3V2OA 2C0LA 4BY6A 3HRAA 4TXPA 2OOEA 1HG2A 3QDNA 5ITZF 4FLHA 2IOSA 2AJAA 3MX3A 4GTVA 3HIZA 3TWUA 5CBNA 1OCCE 4B89A 3MGBA 4N2SA 1ELRA 2PZIA 1N0RA 4HOUA 3DBSA 2WB2A 3ZHEB 4WWOA 4E6HA 1JCQA 1SA4A 3FUKA 3ASNE 4FC8A 4C0EA 3B7RL 4F3VA 1ZU2A 5EILA 5KJLA 1Y6IA 3EHQA 3SY2A 5CRUA 3ML9A 2HR2A 3SO8A 3FTSA 1OWOA 2WXLA 2Y1LE 4EHMA 3URZA 1S0PA 4ANUA 1S64A 4LG6A 3D9HA 3MYVA 4HRMB 2J49A 2VTBB 3QAQA 2FI7A 5AENA 3CGHA 5AQ9A 4RSYA 4XZ4A 4GZCA 5D2MC 1QYMA 3EIQC 4QFVA 4C0MA 4WUYA 1Y8MA 3SFXA 2XHEA 2WVIA 3FTVA 2XGOA 1Z3YA 4OYSA 5EYLA 4GTTA 1WDYA 5ARFA 1V54E 3CSTA 3LYAA 3BU8A 3Q5MA 2L0IA 1E7UA 1JUQA 3FU3A 3EUVA 3JUEA 2B0OE 3APCA 1TNYA 1K1AA 3DSWA 3ZFWA 2VJ8A 1WM5A 4GTOA 4YDOA 4NIKA 3VTYA 3PUKA 3D9LA 3D9PA 3UI2A 2FEZA 1H19A 2M63A 5BXUA 3V79K 1HF8A 1FVHA 3Q7AA 4MRUA 1FVFA 4TUUA 3FUFA 3UPVA 3G2SA 5M72A 2AW6A 5EDSA 3APDA 3Q9NC 3PZDA 2CG3A 5HQ8A 3PUJA 3L82A 3RRUA 4UQXA 4DLQA 3J5PA 3ASDA 4RG9A 4EQFA 5FJYA 3S2AA 4UWLA 4ZHBA 2DCPA 4HORA 5DIZA 2WMNA 1HXIA 4GTQA 4GPKA 5KJNA 4BSZB 1N9AA 2KATA 3U66A 3IV0A 3TG4A 2WXPA 2ILRA 2VSXE 2QFCA 5ENQD 2HO1A 4BX8A 4BSXA 1BLXB 3EHMA 1N4PA 4G2VA 2LUHA 3CHPA 3ULEG 2AWIA 1O5MA 3G2TA 5AJDA 4ME2A 4EBAA 3LVQE 2DVWA 4GYOA 1BU9A 4N3BA 1FT1A 5EIBE 4OVVA 3UM0A 2PM6A 2X6HA 5B1BE 2LSUA 5A23A 1LTXA 4N3AA 1P5QA 3LJNA 3ABLE 3X2QE 3GZ1A 3I4RB 3VLDA 4HRNA 1DC2A 2YNQA 1V55E 3V31A 1UJJA 4JA9A 3HG0D 4I43A 3FTZA 5EX0A 4A1GA 4GAAA 5G05J 4J7WA 2BKGA 4AVXA 3FWVA 3QKYA 4U8YD 3OXGA 3RK6A 4FJZA 2C0MA 2IQCA 5AN8A 4FLBA 4HI9A 5ENTD 2CHZA 4ILIA 3C3QA 2A5UA 5EYPF 2X6FA 3MV2B 2OVFA 4WNDA 2ETAA 5KNHD 1U3CA 4GZDA 5BW8C 1HZ4A 1JWGA 4ILHB 5ANLA 4MKTA 3CSFA 5J08A 2BEDA 4GCOA 2H6IA 1N52A 2EIJE 1S63A 4JHKA 2QYJA 3DEPA 2C2LA 5ARGA 1TNBA 5AYWD 1DNPA 1ELWA 5CCLA 1BI8B 2AXUA 1OXJA 5ENPD 1NA3A 3PEUB 2AXZA 4EZKA 4L9PA 4XE0A 5E75A 3HXEA 4L7TA 2KZTA 5AARA 4LNBA 1YYHA 1OCZE 5B1AE 4LRZA 3TWTA 3CQGB 5LCWC 3FUHA 3D9OA 5BV1A 4GPMA 3TL5A 2BKKB 2H6HA 4ACLA 3R9AB 5AAOA 4HNAD 4LSZE 1FT2A 4JVSA 3LEWA 4DX5D 4GZ3A 2R17C 3AS8A 1HE8A 3LKUA 1EF1C 5C1DA 4CGWA 3B7UX 2LSVA 3BUAA 4ANVA 2R5SA 2BTDA 3L54A 4XIFA 4GCNA 3NOCD 1LD7A 3T9KA 1MX4A 1JWFA 4U95D 3O4ZA 2WM9A 3FU5A 3L6AA 3DSSA 5A6CA 4TUMA 5AQ7A 2FO1E 1D8DA 4AJWA 3UXGA 4Y6CA 1DCQA 3MEKA 2NXPA 2I9CA 3AG2E 4W9RA 3QARA 4OAUC 3ZXPA 4HS2A 2Y69E 2RFAA 3FUNA 5EIDA 4B8AA 2JABA 2PQNA 5D0QD 2XENA 3D9MA 4XKCA 1K1BA 5ENOD 4CDRA 2CG2A 4GTPA 1Z6TA 2XRYA 4IULA 2QC9A 3L17A 3FDHA 4URKA 1OWNA 3C72A 3HXFA 4JXTA 2UY1B 3PZ2A 4K0RA 3WG7E 1ZBPA 4U7EB 3FTYA 4TXQA 4D10C 2WXQA 4BFRA 3ZW3A 3UINC 3DSXA 2IEJA 5CECB 2RKKA 3CVLA 4G25A 2ZGDA 3IBEA 2LNIA 3Q73A 4BESA 3TGOA 1NA0A 3CVNA 1BPOA 5G04C 4N3CA 5CEDB 4ANWA 3FHEA 3LY9A 4EZJA 4A63B 4X8QA 3J5QB 3U4TA 1BI7B 4AP2A 3PZ3A 2X6JA 2XS8A 4ATZD 3IKOB 4LNGA 4WNGA 3DSUA 3TWRA 3FTXA 4GA1A 2R59A 3PS6A 3APFA 1HU3A 3CVYA 4NURA 3NZSA 4AXHA 1SZAA 4YVOA 3EU9A 1WY6A 3CHRA 1BD8A 4L23A 3E37A 3DRAA 2I2OA 4I6EA 1SQMA 3SGHA 1LD8A 3E34A 3SQVA 4Z68A 3L13A 3VTXA 3W9GA 5JMND 2AVPA 1TN8A 1O1TA 2KZTB 3FULA 4ATGA 1TN7A 3JYSA 4WNFA 4A3TA 3AG3E 3MKRA 2DYSE 2V5QC 2J4DA 4EECA 4H7XA 1KPSB 4J8EA 1H6PA 4DX6D 1IQRA 2P9SG 2WXHA 3NQPA 1G3NB 2A5EA 5ENRD 1DVPA 1WAO1 1ELKA 4CYMD 3UT8A 4N5QA 4ABNA 5JHBA 2ETBA 3KEAA 3DWLG 3ABME 3DXKG 4GA0A 2RFMA 3PH0C 1HO8A 3U64A 3EIJA 3SBTB 2MRIA 2NC9A 5LFAA 5CMYA 2Y4UA 2VGEA 4K5BA 4XEIG 2CHXA 4APOA 3ASOE 3BG1B 1AWCB 2ETCA 2Q7FA 1E8YA 3Q78A 5DBKA 1TNZA 1AP7A 3ZN3A 2R03A 4EPZA 2HYZA 1OWLA 3NZUA 5JJ6A 1KZPA 2OEWA 3RIBA 1MZCA 3PNLB 5JJTA 3QK0A 1SVXA 3NB2A 4HVBA 3B95A 5HS0A 3FUMA 3WXXA 4BT8A 3TXNA 3UX4A 3ZPJA 1KT1A 3ULYA 5T3RA 3PRZA 5G55A 4CZ2D 3JUIA 1KT0A 4JHRA 2GRNB 3FTUA 3Q49B 2YINA 4O1PA 1INZA 2JLBA 4UQYA 5EN5D 3D9NA 3PZ4A 3FFLA 3UKUG 4TV3A 2MHKA 1VDYA 4LNUD 2FULA 5CRVA 4WWPA 2IONA 2V8SE 4R7LA 2XEEA 3SFYA 5CBOA 1HG5A 3UM2A 1DCEA 4KXKB 2XRZA 3CKCA 3D9KA 3ZYMA 5FZQA 2AXVA 3S7BA 4YVQC 2J09A 3ZRHA 3G2WA 2Y0BG 2PNNA 3CQCB 2GW1A 4BWRA 1YA0A 4I1OB 4CGVA 2JEKA 3ZUVB 4E85A 3KD7A 4JA7A 4C9BB 1OUVA 5FWQA 4I6GA 4J8FA 2EILE 3QWWA 2VGYA 3C5RA 2XGSA 2IU1A 1E8WA 1NP7A 5T8IA 2V4LA 4NQ0A 3L08A 4BTBA 1TYQG 5KCMA 2X38A 3T5XA 4K03A 4AIFA 5CEAA 2XPIA 4FHKA 5KJKA 5AIJA 4JB8P 1A17A 2X6IA 4Y6WA 2DYRE 4YDYA 3CEQA 3G2UA 3FEYA 3ZGQA 3EHNA 5G05C 4XX5A 4GMJA 4J8SA 2XCCA 1MJ0A 4FHJA 4IRUA 3CK8A 2E0IA 2P9LG 3PREA 4MBGA 3HHMA 1FPPA 3NAWA 3MKQA 3HVEA 2WXMA 4UI9J 2RD0A 4P29A 4N2QA 4I2WA 4FJYA 4YDEA 4KZCA 4CDMA 3RRNB 2GROB 4QQIA 1OCOE 3UKRG 4JL0A 4JZYA 3SNXA 4GYWA 3CIAA 4DUIA 4AM9A 4I2ZA 4A3VA 1MX2A 3AU4A 1FCHA 1UN8A 3UTMA 2WXRA 4YDWA 1RW2A 5JJ7A 1HH8A 4XKBA 5EX3A 2XQ0A 1RZ4A 2QYUA 3ABKE 5CHEE 5FTPA 3LVRE 2VYIA 3ENEA 4AOFA 1GW6A 3FH7A 2ZISA 1NL4A 4PUCA 1TR4A 3JCKC 2MOWA 1U2VG 3FU0A 3T8KA 4U04A 4O1OA 3RU0A 1OY3D 3HXDA 4DRXE 5ENSD 1TJFA 4I9CA 5G2NA 1UOHA 3NF1A 2CHWA 3IHYA 4U8HA 4A55A 1W3BA 3U9WA 4GZ5A 4U0SA 3ZU7B 3SBSA 2F37A 2GRQB 3DSVA 1SW6A 5BV0A 2EINE 4KZ0A 3SD5A 3CKBA 3RJVA 2VTBA 3HDXA 4IN3B 2EIME 3QB2A 5LP0A 3G2VA 2XPZA 2LAHA 3UM3A 2IFUA 5FQ8A 2QZAA 5FQ7A
chains in the Genus database with same CATH topology
3LS8A 2DIWA 3RRMB 4ILGA 3ZFWA 5FQ6A 1OWPA 2VJ8A 2YHEA 2R59A 1E90A 1WM5A 3PS6A 4GA1A 4PS3A 3APFA 1HU3A 1UJKA 3VTYA 3PUKA 4KT6B 3D9LA 3CVYA 1HFAA 3D9PA 4NURA 1HX8A 3NZSA 3ZIMA 2FEZA 4AXHA 3IHVA 1H19A 3CHOA 2M63A 1SZAA 4YVOA 4J0UA 2KC7A 4V3IA 1WY6A 3CHRA 4FA6A 2RG8A 1HF8A 4JW1A 4L23A 1FVHA 3KAEA 3CVVA 3ZVVA 4MRUA 2GRMA 1FVFA 4TUUA 4ACKA 3FUFA 1IQUA 3UPVA 2I2OA 2VSNA 3G2SA 4I6EA 4DI4A 4FADA 1SQMA 4GZ6A 5M72A 2AW6A 3SGHA 2WQHA 5EDSA 3L13A 2PL2A 3C98A 2LAIA 3VTXA 3APDA 2AVPA 3FUIA 2V0PA 5ENNA 2KZTB 2CG3A 3FH5A 3FULA 3PZDA 3T8MA 4ATGA 3PUJA 5HQ8A 4LUNU 3JYSA 4WNFA 4UI9K 3RRUA 4UQXA 4ANXA 4A3TA 4PDXA 3ASDA 4DLQA 2Y3AA 3PE4A 5LCWJ 4KMOA 3MKRA 4M3OA 3LJ3A 4RG9A 4EQFA 5FJYA 2J4DA 4Q69A 3S2AA 5BPPA 4EECA 2WXIA 3CHMA 4H7XA 4UWLA 2DCPA 3I3NA 1TEZA 4B0ZA 4J8EA 5DIZA 4HORA 1MHQA 3PDNA 2WMNA 1IQRA 4G23A 4UI9C 2WXHA 1HXIA 2VSOE 3FUEA 3NQPA 3ZEFA 3CVUA 3TXMA 3RO2A 4GPKA 5LOZA 5KJNA 1DVPA 1WAO1 1ELKA 3ESKA 3JQ0A 4UWGA 1UG3A 4GA2A 3T5VA 4JC8A 4LCTA 3UT8A 2KATA 3U66A 4BTAA 3L16A 3HYMB 3IV0A 3ZHEA 5FZSA 3OXFA 4ABNA 3TG4A 3PNTB 1E7VA 2ILRA 2WXPA 5AJLA 5JHBA 2VSXE 3GW4A 2IF4A 3ONLA 2QFCA 5D0OD 3CV0A 5ANRA 3ASFA 2HO1A 3RO3A 4BX8A 4BSXA 3EHMA 4GA0A 2L0TB 4G2VA 3CHPA 2XGMA 2Y4TA 3PH0C 5LX8A 4I17A 1HO8A 3B7SA 3U64A 2AWIA 3EIJA 4CT0A 4FULA 1N54A 4RG6A 4XI0A 3G2TA 3SBTB 4HOSA 2MRIA 5AJDA 3SI5A 4ME2A 3L22A 4EBAA 2NC9A 3FUDA 5LFAA 3BEEA 5BNWA 3LVQE 4I1AA 3R7QA 5CMYA 4GYOA 2OVBA 4N3BA 2XPYA 4OVVA 4DJAA 3BG0B 2Y4UA 2PM6A 4HFGA 3Q4AB 2GRLA 2X6HA 2CHXA 2LSUA 3K9IA 4AV7A 4F1SA 4APOA 5J90A 5A23A 3D3MA 1P5QA 3QJZA 4N3AA 3BG1B 1U3DA 1EYHA 4U63A 2Q7FA 1QZ2A 1E8YA 3FEXA 3FY4A 5T4YA 2WXNA 3GZ1A 3I4RB 5DBKA 1E96B 3VLDA 2ONDA 3N71A 4JPSA 4G11A 2PQRA 3ZN3A 4GYYA 4UWFA 2YNQA 4EPZA 2HYZA 1H2TC 2X6KA 3PE3A 1UJJA 4JA9A 2XEVA 4I43A 3FTZA 5EX0A 4A1GA 1OWLA 3NZUA 2L9BA 1MQSA 5JJ6A 4U0ZA 3SHFA 4GAAA 5G05J 2L6JA 3CR3A 4J6IA 3RIBA 3CK7A 4AVXA 3LXUX 5C2YA 4DI3A 3FWVA 3QKYA 3VLEA 3OXGA 3PNLB 3PEVB 4FJZA 3QK0A 4MLPA 3RK6A 5JJTA 2C0MA 5A7DB 4IYPA 1TJCA 4BT9A 4KVMA 2UWJG 2IQCA 1UW4B 4HVBA 3FUMA 3WXXA 1XGWA 3TXNA 4KYOB 3UX4A 3ZPJA 4BT8A 4APFA 3O48A 4FLBA 1KT1A 3B7TA 2CHZA 5T3RA 3HVEB 4J8DA 4ILIA 3PRZA 2GGFA 3LPZA 4CT4A 5G55A 2A5UA 4FU3A 4CRWA 2X6FA 3JUIA 1KT0A 3MV2B 2OVFA 4WNDA 4UQZA 3UT7A 5FT9A 2I6HA 4I1MA 1U3CA 4GZDA 4JHRA 2DBAA 2J9QA 2KCLA 4WAFA 1HZ4A 5BW8C 1Z3XA 3UT4A 1JWGA 3FTUA 4ILHB 4XI9A 3DPDA 3QC1A 3Q49B 2X3MA 5ANLA 4MKTA 2YINA 4NACA 2I1KA 2CFUA 3CSFA 1INZA 2JLBA 4UQYA 5J08A 3IEGA 4LEUA 4GCOA 4EBAG 1N52A 3S7FA 1H2UA 3D9NA 4JHKA 3FFLA 4CCAA 3ONKA 2C2LA 3MV3B 4BX9A 3LY7A 4PS7A 4TV3A 2WPVA 2MHKA 1VDYA 2YHCA 5ARGA 4KBQA 2CFZA 2FO7A 2FULA 3FTWA 3LDZA 4L2LA 1DNPA 4UWKA 4WNEA 1ELWA 5AYWD 4AEZC 2AXUA 4DK5A 4WWPA 5CCLA 2A4ZA 2E2EA 2IONA 4JEUA 1L5JA 3VLFA 1NA3A 2V8SE 2AXZA 3PEUB 4EZKA 4HOTA 4UWHA 5E76A 3QWVA 2VSYA 4A1SA 3CVQA 4R7LA 1HS6A 1LF8A 3ASGA 3LCAA 4HOQA 4XE0A 5E75A 5CCMA 3PVLA 5FZRA 4L7TA 2KZTA 3I5PA 3TJPA 1HG5A 2WXFA 1OWMA 3Q47B 1QQEA 4KXKB 2XRZA 4FP7A 3CKCA 1SZ9A 1E8ZA 3D9KA 4GB9A 4LRZA 3ZYMA 4G1TA 3S7JA 5FZQA 3QNKA 2AXVA 2NSZA 3CQGB 3B13A 4GU5A 5LCWC 5CMWA 4CEMA 3FUHA 3D9OA 4MS6A 3S7BA 4YVQC 3MZLB 5BV1A 2J09A 2BF0X 4Q96A 3ZRHA 3RKVA 3G2WA 3TL5A 1EDUA 2PM7A 4N5CA 3ZYLA 3CQCB 4L2YA 5G04J 2V5FA 2GW1A 3SZ7A 4BWRA 3UQ3A 4ACLA 1YA0A 4O6FA 3ASHA 2J07A 3OXLA 2HM8A 4I1OB 3MCXA 5KJMA 4CGVA 3R9AB 2KCKA 2JEKA 4E85A 3D9IA 3GYZA 1X5BA 3KD7A 4JA7A 4C9BB 2P58C 5JHAA 2WXOA 1OUVA 5FWQA 2KCVA 4JVSA 4I6GA 3R7RA 3ZYKA 2XCBA 1QNFA 1PAQA 3GZ2A 4G26A 3LEWA 4J8FA 1PY1A 4GZ3A 2R17C 3D9JA 3JQ1A 3QWWA 1XNFA 2OV8A 2VGYA 3AS5A 4I6JA 3AS8A 1HE8A 2XGSA 2IU1A 1E8WA 3LKUA 4LERA 4EZLA 1NP7A 5T8IA 2V4LA 1EF1C 3I4GA 2J4BA 4NQ0A 4B94A 5BUZA 5C1DA 4CGWA 2VGXB 2WQ6A 3B7UX 3MJWA 1H2VC 2LSVA 3EJNA 3L08A 4BTBA 3OAWA 4F53A 4ANVA 5KCMA 2X38A 4OVUA 2R5SA 3T5XA 2VQ2A 2BTDA 4K03A 5EKQD 4AIFA 3L54A 4HLEA 1KLXA 2XPIA 4I9EA 4U07A 4RVBA 4XIFA 1IYGA 4FHKA 4GCNA 4G24A 4JEHA 5BT1A 5KJKA 3CVPA 3CVWA 1JWFA 1IHGA 2QY7A 3CK9A 3SFZA 3ULQA 3O4ZA 3MKQB 3S7DA 5AIJA 3GZSA 2WM9A 3FU5A 1A17A 2X6IA 2ZU6B 3L6AA 4Y6WA 4AY5A 3TG5A 5A6CA 3ZYQA 3CEQA 1JPLA 3KEZA 2FF4A 5FQ4A 3G2UA 4AJWA 3FEYA 3CHQA 4DLOA 3AU5A 3AS4A 3ZGQA 3EHNA 4GMLA 5G05C 3CLJA 4XX5A 2YQ8A 4AY6A 3ML8A 2WXKA 4GMJA 4Y6CA 4J8SA 1B89A 2XCCA 3QWPA 3MEKA 2NXPA 4FHJA 2I9CA 3CK8A 2E0IA 4IRUA 3PREA 2C0LA 1PC2A 4BY6A 4W9RA 3HHMA 3QARA 3MKQA 1NZNA 4HS2A 3HVEA 4PS8A 2WXMA 2OOEA 4UI9J 4B8CB 4L1BA 2RD0A 4P29A 3ZXSA 1HG2A 3QDNA 3FUNA 4N2QA 5FQ7A 4FLHA 4I2WA 4B8AA 2IOSA 2PQNA 4FJYA 3MX3A 3HIZA 4KZCA 4CDMA 3RRNB 5D0QD 4DPRA 4HXIA 3Q15A 4B89A 3MGBA 4N2SA 4JL0A 3E4BA 4JZYA 1ELRA 2PZIA 3D9MA 4GYWA 3CIAA 4XKCA 3SNXA 3TAXA 4AM9A 4I2ZA 4HOUA 4A3VA 3DBSA 2WB2A 3ZHEB 4WWOA 4TRQA 3AU4A 4E6HA 1FCHA 1UN8A 2WMOA 4CDRA 2CG2A 5HI7A 2WXRA 1H0AA 3FUKA 5JJ7A 1HH8A 2WQ7A 4FC8A 4WWNA 4C0EA 4XKBA 5EX3A 1Z6TA 3B7RL 4F3VA 1ZU2A 2XRYA 2FBNA 4IULA 2WXJA 2XQ0A 3L17A 4H7YA 5KJLA 1Y6IA 3FDHA 4KVOA 5CHEE 4URKA 5FTPA 1OWNA 3LVRE 3FU6A 2VYIA 4JXTA 1E8XA 3ENEA 2UY1B 3FH8A 4AOFA 1GW6A 3FH7A 3ML9A 2HR2A 4YNDA 4K0RA 4PUCA 3JCKC 3FTSA 1ZBPA 2MOWA 2WXGA 3OTNA 1OWOA 4U0UA 3FU0A 3SF4A 3FTYA 4U04A 2WXLA 4D10C 2WXQA 3RU0A 4BFRA 3ZW3A 4JHJA 3URZA 2LO6A 1S0PA 4ANUA 1TJFA 3MYVA 2IOLA 4I9CA 2J49A 5G2NA 2J08A 2VTBB 3QAQA 2FI7A 3CVLA 2IJGX 4G25A 3NF1A 2UY1A 5AENA 2CHWA 1EPUA 3CGHA 3IHYA 4U8HA 4A55A 3IBEA 2LNIA 1W3BA 4PH4B 4RSYA 4XZ4A 3U9WA 3TGOA 4GZ5A 4U0SA 4GZCA 3SBSA 1NA0A 3CVNA 1BPOA 3EDTB 3ESLA 4N3CA 5G04C 3UUXA 3EIQC 3KS2A 4QFVA 3P2BA 4C0MA 4ANWA 4WUYA 1Y8MA 2XHEA 2WVIA 3FTVA 3FHEA 3QOUA 2XGOA 5BV0A 3LY9A 3CVXA 4KZ0A 4EZJA 1Z3YA 4OYSA 3SD5A 3MA5A 4F7AA 3CKBA 2I1JA 3LY8A 3RJVA 2KM4A 3P1UA 3U4TA 2VTBA 2EQXA 3HDXA 3QB2A 4IN3B 4CDNA 3U3WA 5LP0A 3CHSA 3CSTA 5ARFA 1H6KA 3FP3A 3LYAA 3Q5MA 3UMVA 3G2VA 4AP2A 2L0IA 2XPZA 3FUJA 2LAHA 1UN9A 2X6JA 1E7UA 2BUGA 1JUQA 4Q94A 2IFUA 3FU3A 5FQ8A 3IKOB 4N39A 3APCA 4WNGA 4NRHB 2VGXA 3FTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJY A;  3LS8 A;  1E8Y A;  3HIZ A;  4KZC A;  1E90 A;  3PS6 A;  4PS3 A;  2WXN A;  3APF A;  4JPS A;  4G11 A;  3NZS A;  3ZIM A;  3TL5 A;  4UWF A;  2X6K A;  4L2Y A;  3DBS A;  4WWO A;  3NZU A;  2WXR A;  4FA6 A;  4L23 A;  4J6I A;  4WWN A;  3ZVV A;  2WXJ A;  4TUU A;  4FJZ A;  3QK0 A;  3L17 A;  5JHA A;  2WXO A;  3R7R A;  4FAD A;  4URK A;  4HVB A;  1E8X A;  3ENE A;  4AOF A;  5EDS A;  3L13 A;  3ML9 A;  3APD A;  5ENN A;  2CHZ A;  1HE8 A;  3T8M A;  1E8W A;  2WXG A;  3PRZ A;  4EZL A;  5G55 A;  2A5U A;  5T8I A;  4ANX A;  2WXL A;  2V4L A;  2X6F A;  2Y3A A;  2WXQ A;  4BFR A;  3LJ3 A;  3MJW A;  3ZW3 A;  3L08 A;  3OAW A;  4ANV A;  3S2A A;  2WXI A;  2X38 A;  4OVU A;  4UWL A;  4WAF A;  4ANU A;  3DPD A;  3L54 A;  4HLE A;  2WXH A;  5G2N A;  5ANL A;  3QAQ A;  4FHK A;  3CSF A;  2CHW A;  4UWG A;  3IHY A;  4A55 A;  3IBE A;  3L16 A;  4PH4 B;  4XZ4 A;  2X6I A;  4PS7 A;  1E7V A;  2WXP A;  4TV3 A;  5JHB A;  3P2B A;  4ANW A;  4AJW A;  4UWK A;  4DK5 A;  4WWP A;  4XX5 A;  2A4Z A;  4KZ0 A;  4EZJ A;  3ML8 A;  2WXK A;  4OYS A;  3SD5 A;  4EZK A;  4UWH A;  4FUL A;  4FHJ A;  2I9C A;  3CST A;  4XE0 A;  3PRE A;  3R7Q A;  3HHM A;  3QAR A;  2X6J A;  3TJP A;  1E7U A;  4PS8 A;  2WXF A;  4OVV A;  2WXM A;  2X6H A;  2CHX A;  2RD0 A;  1E8Z A;  4GB9 A;  4L1B A;  4F1S A;  3APC A;  4FLH A;  3QJZ A; 
#chains in the Genus database with same CATH topology
 1IXV A;  3LS8 A;  2DIW A;  1ZB1 A;  2YHE A;  4HBD A;  1UJK A;  1HFA A;  1HX8 A;  3ZIM A;  3IHV A;  4G8K A;  1JCS A;  2KC7 A;  4FA6 A;  4JW1 A;  3ZVV A;  1IQU A;  1D9S A;  4DI4 A;  1N4Q A;  4GZ6 A;  2PL2 A;  3C98 A;  2R05 A;  3AG1 E;  3T8M A;  4M7C A;  1TNU A;  4ANX A;  5IY5 E;  2P9K G;  3B7B A;  2WXI A;  4U96 D;  1MHQ A;  3PDN A;  4G23 A;  2VSO E;  3FUE A;  2NYJ A;  3TXM A;  3Q9U C;  3JQ0 A;  4GA2 A;  4JC8 A;  2OEV A;  1WG0 A;  3HYM B;  2GRR B;  4B93 B;  4GTM A;  4J8Y A;  2IF4 A;  3CV0 A;  5ANR A;  2L0T B;  4K5C A;  4I17 A;  3B7S A;  4CT0 A;  4C48 B;  5HKP A;  4RG6 A;  4XI0 A;  3KSQ A;  3L22 A;  3FUD A;  5BNW A;  3E33 A;  2OVB A;  2XPY A;  4DJA A;  3JXI A;  4F1S A;  5D66 A;  3QJZ A;  1U3D A;  4U63 A;  1QZ2 A;  3FEX A;  3UIP C;  5T4Y A;  4RLY A;  2OND A;  2PQR A;  4GYY A;  4UWF A;  2F8Y A;  1H2T C;  3AJI A;  3PE3 A;  2XEV A;  1MQS A;  4HRL A;  4U0Z A;  3CR3 A;  4J6I A;  3LXU X;  4DI3 A;  1N95 A;  3VLE A;  4MLP A;  4IYP A;  1TJC A;  5KBA A;  4HB5 A;  2UWJ G;  4ZFH A;  1XGW A;  4APF A;  3B7T A;  4GTS A;  2P9N G;  3HVE B;  4CT4 A;  4FU3 A;  4CRW A;  4UQZ A;  3UT7 A;  5FT9 A;  2J9Q A;  2KCL A;  1Z3X A;  2P9P G;  4OAV B;  3QC1 A;  2CFU A;  2XZT G;  3IEG A;  3KSL A;  5JA4 D;  4EBA G;  3S7F A;  4CCA A;  3ONK A;  3MV3 B;  3E32 A;  4PS7 A;  4KBQ A;  1Z5S C;  2CFZ A;  2FO7 A;  4L2L A;  4WNE A;  1IKN D;  4AEZ C;  4JEU A;  1L5J A;  3VLF A;  2ZXW E;  4HOT A;  4UWH A;  5E76 A;  4F1P A;  3V2X A;  2VSY A;  3E30 A;  3CVQ A;  3C3R A;  1LF8 A;  4HOQ A;  5CCM A;  3PVL A;  2WXF A;  1OWM A;  1QQE A;  2ZIR A;  4FP7 A;  3R9M A;  2DZN A;  1E8Z A;  4GB9 A;  5H7P A;  4G1T A;  3S7J A;  4GMR A;  3QNK A;  1JCR A;  2NSZ A;  3B13 A;  4CEM A;  3MZL B;  2V4H C;  4Q96 A;  1EDU A;  4N5C A;  3ZYL A;  3BQO A;  4L2Y A;  3SZ7 A;  4O6F A;  3HXC A;  5KJM A;  4RQI A;  4BEP A;  3Q79 A;  3D9I A;  3GYZ A;  1X5B A;  1Q2Z A;  1IHB A;  1PAQ A;  4G26 A;  3D9J A;  2OV8 A;  4I6J A;  4LER A;  4EZL A;  4F6R D;  3I4G A;  4B94 A;  1H2V C;  3EJN A;  4F53 A;  1QBQ A;  2VQ2 A;  1KLX A;  4RVB A;  1IYG A;  5BT1 A;  3TWQ A;  3ULQ A;  3S7D A;  3GZS A;  2ZU6 B;  3ZYQ A;  1JPL A;  3KEZ A;  4DLO A;  3AS4 A;  3ML8 A;  5HRY A;  3TWX A;  1YMP A;  1PC2 A;  3NOG D;  1NZN A;  4PS8 A;  1TNO A;  4O60 A;  4B8C B;  4L1B A;  3ZXS A;  3RAU A;  3TWV A;  3AG4 E;  4DPR A;  2J8S D;  4HXI A;  3Q15 A;  3Q7F A;  3E4B A;  1S70 B;  4TXR A;  3TAX A;  5B3S E;  4TRQ A;  3UIO C;  2WMO A;  5HI7 A;  1H0A A;  3V30 A;  2WQ7 A;  4WWN A;  2FBN A;  2WXJ A;  2P2C P;  4H7Y A;  1O1R A;  4KVO A;  1N0Q A;  3FU6 A;  1E8X A;  3FH8 A;  1YCS B;  4YND A;  3OTN A;  4U0U A;  2WXG A;  4U8V D;  3SF4 A;  5BXO A;  4JHJ A;  3DPY A;  3W9F A;  2LO6 A;  4DX7 D;  2IOL A;  2J08 A;  2IJG X;  1X81 A;  2UY1 A;  1EPU A;  3EHR A;  4PH4 B;  4DX2 A;  3EDT B;  3ESL A;  3ZKJ A;  3UUX A;  3KS2 A;  3P2B A;  3QOU A;  3CVX A;  5FIO A;  5FIN A;  3MA5 A;  4F7A A;  2MYO A;  2I1J A;  3LY8 A;  2KM4 A;  3P1U A;  2EQX A;  3U3W A;  4CDN A;  4HLL A;  3CHS A;  2KBX A;  1H6K A;  3FP3 A;  3UMV A;  1OCR E;  2IO2 C;  3FUJ A;  1UN9 A;  2BUG A;  4Q94 A;  4N39 A;  3ZNG A;  4NRH B;  2VGX A;  3RRM B;  4ILG A;  5FQ6 A;  1OWP A;  1E90 A;  4PS3 A;  4KT6 B;  3DST A;  4JD2 G;  3CHO A;  3PZ1 A;  2XS1 A;  5KWD A;  1OT8 A;  4J0U A;  4V3I A;  2RG8 A;  3KAE A;  3CVV A;  2GRM A;  4ACK A;  3HXB A;  2VSN A;  1NFI E;  4FAD A;  2WQH A;  2H6G A;  2LAI A;  3FUI A;  2V0P A;  5ENN A;  3FH5 A;  4LUN U;  4UI9 K;  4PDX A;  5LCW J;  2Y3A A;  3PE4 A;  4KMO A;  5KNG A;  4M3O A;  3LJ3 A;  4Q69 A;  5BPP A;  3CHM A;  3I3N A;  1TEZ A;  4B0Z A;  4K5A B;  4UI9 C;  3ZEF A;  3CVU A;  3RO2 A;  5LOZ A;  3ESK A;  3L9T A;  4UWG A;  1UG3 A;  3T5V A;  4LCT A;  4BTA A;  3L16 A;  3ZHE A;  5FZS A;  3OXF A;  3PNT B;  1E7V A;  5AJL A;  3GW4 A;  3ONL A;  5D0O D;  3ASF A;  3RO3 A;  2XGM A;  2Y4T A;  5LX8 A;  4FUL A;  1N54 A;  4HQD A;  4HOS A;  3SI5 A;  3BEE A;  4I1A A;  3R7Q A;  3BG0 B;  3ISM C;  4HFG A;  2F0Y A;  3Q4A B;  2GRL A;  4AV7 A;  3K9I A;  5J90 A;  3D3M A;  1A5E A;  1EYH A;  3UM1 A;  2DZO A;  3FY4 A;  2WXN A;  1E96 B;  2DWZ A;  3N71 A;  4JPS A;  1MYO A;  4G11 A;  2X6K A;  2L9B A;  3SHF A;  2L6J A;  3CK7 A;  2R2L A;  5C2Y A;  3DEO A;  3PEV B;  5A7D B;  2B6C A;  4BT9 A;  4KVM A;  1NI1 A;  1UW4 B;  4KYO B;  3O48 A;  1SA5 A;  4J8D A;  2GGF A;  3LPZ A;  1TN6 A;  1K3Z D;  2OCC E;  2I6H A;  4G8L A;  4I1M A;  2DBA A;  4WAF A;  3F6Q A;  3UT4 A;  4XI9 A;  3DPD A;  2X3M A;  4NAC A;  2I1K A;  3JXJ A;  4UUC A;  4LEU A;  4DX1 A;  1H2U A;  2IO3 C;  3Q75 A;  4BX9 A;  1N11 A;  1K8K G;  3LY7 A;  2WPV A;  2IY0 C;  2YHC A;  3FTW A;  3LDZ A;  4UWK A;  4DK5 A;  2A4Z A;  2E2E A;  2L6B A;  3QWV A;  4A1S A;  1HS6 A;  3ASG A;  3LCA A;  5FZR A;  3I5P A;  3TJP A;  3Q47 B;  1SZ9 A;  3C3O A;  5CER B;  4GU5 A;  5CMW A;  2F8X K;  4MS6 A;  2BF0 X;  3RKV A;  2PM7 A;  1N4S A;  5G04 J;  2V5F A;  2KXP C;  4GTR A;  3UQ3 A;  2R02 A;  3ASH A;  2J07 A;  4BER A;  3OXL A;  2HM8 A;  3MCX A;  2XEH A;  1O1S A;  2GRP B;  4HI8 A;  2KCK A;  1N94 A;  2H6F A;  2P58 C;  1H6O A;  5JHA A;  2WXO A;  2KCV A;  5AQB A;  3R7R A;  3ZYK A;  2XCB A;  5AQA A;  1QNF A;  3GZ2 A;  1PY1 A;  3NBN B;  2EIK E;  3JQ1 A;  2HE0 A;  3AAA C;  1XNF A;  1KZO A;  3AS5 A;  2J4B A;  5BUZ A;  2XZD G;  2VGX B;  3IXE A;  2WQ6 A;  3MJW A;  3EU5 A;  3RSE G;  3OAW A;  4OVU A;  3TWW A;  5EKQ D;  2P9U G;  4HLE A;  1MX6 A;  4I9E A;  4U07 A;  4G24 A;  4JEH A;  1D8E A;  3CVW A;  3CVP A;  1IHG A;  2QY7 A;  3CK9 A;  3SFZ A;  2LXL A;  3MKQ B;  4AY5 A;  3TG5 A;  2P9I G;  1N4R A;  2FF4 A;  5FQ4 A;  3CHQ A;  3AU5 A;  2LXM A;  4GML A;  3CLJ A;  4AY6 A;  2YQ8 A;  2WXK A;  4BET A;  3DXM G;  3TWS A;  1B89 A;  3QWP A;  2ZGG A;  3V2O A;  2C0L A;  4BY6 A;  3HRA A;  4TXP A;  2OOE A;  1HG2 A;  3QDN A;  5ITZ F;  4FLH A;  2IOS A;  2AJA A;  3MX3 A;  4GTV A;  3HIZ A;  3TWU A;  5CBN A;  1OCC E;  4B89 A;  3MGB A;  4N2S A;  1ELR A;  2PZI A;  1N0R A;  4HOU A;  3DBS A;  2WB2 A;  3ZHE B;  4WWO A;  4E6H A;  1JCQ A;  1SA4 A;  3FUK A;  3ASN E;  4FC8 A;  4C0E A;  3B7R L;  4F3V A;  1ZU2 A;  5EIL A;  5KJL A;  1Y6I A;  3EHQ A;  3SY2 A;  5CRU A;  3ML9 A;  2HR2 A;  3SO8 A;  3FTS A;  1OWO A;  2WXL A;  2Y1L E;  4EHM A;  3URZ A;  1S0P A;  4ANU A;  1S64 A;  4LG6 A;  3D9H A;  3MYV A;  4HRM B;  2J49 A;  2VTB B;  3QAQ A;  2FI7 A;  5AEN A;  3CGH A;  5AQ9 A;  4RSY A;  4XZ4 A;  4GZC A;  5D2M C;  1QYM A;  3EIQ C;  4QFV A;  4C0M A;  4WUY A;  1Y8M A;  3SFX A;  2XHE A;  2WVI A;  3FTV A;  2XGO A;  1Z3Y A;  4OYS A;  5EYL A;  4GTT A;  1WDY A;  5ARF A;  1V54 E;  3CST A;  3LYA A;  3BU8 A;  3Q5M A;  2L0I A;  1E7U A;  1JUQ A;  3FU3 A;  3EUV A;  3JUE A;  2B0O E;  3APC A;  1TNY A;  1K1A A;  3DSW A;  3ZFW A;  2VJ8 A;  1WM5 A;  4GTO A;  4YDO A;  4NIK A;  3VTY A;  3PUK A;  3D9L A;  3D9P A;  3UI2 A;  2FEZ A;  1H19 A;  2M63 A;  5BXU A;  3V79 K;  1HF8 A;  1FVH A;  3Q7A A;  4MRU A;  1FVF A;  4TUU A;  3FUF A;  3UPV A;  3G2S A;  5M72 A;  2AW6 A;  5EDS A;  3APD A;  3Q9N C;  3PZD A;  2CG3 A;  5HQ8 A;  3PUJ A;  3L82 A;  3RRU A;  4UQX A;  4DLQ A;  3J5P A;  3ASD A;  4RG9 A;  4EQF A;  5FJY A;  3S2A A;  4UWL A;  4ZHB A;  2DCP A;  4HOR A;  5DIZ A;  2WMN A;  1HXI A;  4GTQ A;  4GPK A;  5KJN A;  4BSZ B;  1N9A A;  2KAT A;  3U66 A;  3IV0 A;  3TG4 A;  2WXP A;  2ILR A;  2VSX E;  2QFC A;  5ENQ D;  2HO1 A;  4BX8 A;  4BSX A;  1BLX B;  3EHM A;  1N4P A;  4G2V A;  2LUH A;  3CHP A;  3ULE G;  2AWI A;  1O5M A;  3G2T A;  5AJD A;  4ME2 A;  4EBA A;  3LVQ E;  2DVW A;  4GYO A;  1BU9 A;  4N3B A;  1FT1 A;  5EIB E;  4OVV A;  3UM0 A;  2PM6 A;  2X6H A;  5B1B E;  2LSU A;  5A23 A;  1LTX A;  4N3A A;  1P5Q A;  3LJN A;  3ABL E;  3X2Q E;  3GZ1 A;  3I4R B;  3VLD A;  4HRN A;  1DC2 A;  2YNQ A;  1V55 E;  3V31 A;  1UJJ A;  4JA9 A;  3HG0 D;  4I43 A;  3FTZ A;  5EX0 A;  4A1G A;  4GAA A;  5G05 J;  4J7W A;  2BKG A;  4AVX A;  3FWV A;  3QKY A;  4U8Y D;  3OXG A;  3RK6 A;  4FJZ A;  2C0M A;  2IQC A;  5AN8 A;  4FLB A;  4HI9 A;  5ENT D;  2CHZ A;  4ILI A;  3C3Q A;  2A5U A;  5EYP F;  2X6F A;  3MV2 B;  2OVF A;  4WND A;  2ETA A;  5KNH D;  1U3C A;  4GZD A;  5BW8 C;  1HZ4 A;  1JWG A;  4ILH B;  5ANL A;  4MKT A;  3CSF A;  5J08 A;  2BED A;  4GCO A;  2H6I A;  1N52 A;  2EIJ E;  1S63 A;  4JHK A;  2QYJ A;  3DEP A;  2C2L A;  5ARG A;  1TNB A;  5AYW D;  1DNP A;  1ELW A;  5CCL A;  1BI8 B;  2AXU A;  1OXJ A;  5ENP D;  1NA3 A;  3PEU B;  2AXZ A;  4EZK A;  4L9P A;  4XE0 A;  5E75 A;  3HXE A;  4L7T A;  2KZT A;  5AAR A;  4LNB A;  1YYH A;  1OCZ E;  5B1A E;  4LRZ A;  3TWT A;  3CQG B;  5LCW C;  3FUH A;  3D9O A;  5BV1 A;  4GPM A;  3TL5 A;  2BKK B;  2H6H A;  4ACL A;  3R9A B;  5AAO A;  4HNA D;  4LSZ E;  1FT2 A;  4JVS A;  3LEW A;  4DX5 D;  4GZ3 A;  2R17 C;  3AS8 A;  1HE8 A;  3LKU A;  1EF1 C;  5C1D A;  4CGW A;  3B7U X;  2LSV A;  3BUA A;  4ANV A;  2R5S A;  2BTD A;  3L54 A;  4XIF A;  4GCN A;  3NOC D;  1LD7 A;  3T9K A;  1MX4 A;  1JWF A;  4U95 D;  3O4Z A;  2WM9 A;  3FU5 A;  3L6A A;  3DSS A;  5A6C A;  4TUM A;  5AQ7 A;  2FO1 E;  1D8D A;  4AJW A;  3UXG A;  4Y6C A;  1DCQ A;  3MEK A;  2NXP A;  2I9C A;  3AG2 E;  4W9R A;  3QAR A;  4OAU C;  3ZXP A;  4HS2 A;  2Y69 E;  2RFA A;  3FUN A;  5EID A;  4B8A A;  2JAB A;  2PQN A;  5D0Q D;  2XEN A;  3D9M A;  4XKC A;  1K1B A;  5ENO D;  4CDR A;  2CG2 A;  4GTP A;  1Z6T A;  2XRY A;  4IUL A;  2QC9 A;  3L17 A;  3FDH A;  4URK A;  1OWN A;  3C72 A;  3HXF A;  4JXT A;  2UY1 B;  3PZ2 A;  4K0R A;  3WG7 E;  1ZBP A;  4U7E B;  3FTY A;  4TXQ A;  4D10 C;  2WXQ A;  4BFR A;  3ZW3 A;  3UIN C;  3DSX A;  2IEJ A;  5CEC B;  2RKK A;  3CVL A;  4G25 A;  2ZGD A;  3IBE A;  2LNI A;  3Q73 A;  4BES A;  3TGO A;  1NA0 A;  3CVN A;  1BPO A;  5G04 C;  4N3C A;  5CED B;  4ANW A;  3FHE A;  3LY9 A;  4EZJ A;  4A63 B;  4X8Q A;  3J5Q B;  3U4T A;  1BI7 B;  4AP2 A;  3PZ3 A;  2X6J A;  2XS8 A;  4ATZ D;  3IKO B;  4LNG A;  4WNG A;  3DSU A;  3TWR A;  3FTX A;  4GA1 A;  2R59 A;  3PS6 A;  3APF A;  1HU3 A;  3CVY A;  4NUR A;  3NZS A;  4AXH A;  1SZA A;  4YVO A;  3EU9 A;  1WY6 A;  3CHR A;  1BD8 A;  4L23 A;  3E37 A;  3DRA A;  2I2O A;  4I6E A;  1SQM A;  3SGH A;  1LD8 A;  3E34 A;  3SQV A;  4Z68 A;  3L13 A;  3VTX A;  3W9G A;  5JMN D;  2AVP A;  1TN8 A;  1O1T A;  2KZT B;  3FUL A;  4ATG A;  1TN7 A;  3JYS A;  4WNF A;  4A3T A;  3AG3 E;  3MKR A;  2DYS E;  2V5Q C;  2J4D A;  4EEC A;  4H7X A;  1KPS B;  4J8E A;  1H6P A;  4DX6 D;  1IQR A;  2P9S G;  2WXH A;  3NQP A;  1G3N B;  2A5E A;  5ENR D;  1DVP A;  1WAO 1;  1ELK A;  4CYM D;  3UT8 A;  4N5Q A;  4ABN A;  5JHB A;  2ETB A;  3KEA A;  3DWL G;  3ABM E;  3DXK G;  4GA0 A;  2RFM A;  3PH0 C;  1HO8 A;  3U64 A;  3EIJ A;  3SBT B;  2MRI A;  2NC9 A;  5LFA A;  5CMY A;  2Y4U A;  2VGE A;  4K5B A;  4XEI G;  2CHX A;  4APO A;  3ASO E;  3BG1 B;  1AWC B;  2ETC A;  2Q7F A;  1E8Y A;  3Q78 A;  5DBK A;  1TNZ A;  1AP7 A;  3ZN3 A;  2R03 A;  4EPZ A;  2HYZ A;  1OWL A;  3NZU A;  5JJ6 A;  1KZP A;  2OEW A;  3RIB A;  1MZC A;  3PNL B;  5JJT A;  3QK0 A;  1SVX A;  3NB2 A;  4HVB A;  3B95 A;  5HS0 A;  3FUM A;  3WXX A;  4BT8 A;  3TXN A;  3UX4 A;  3ZPJ A;  1KT1 A;  3ULY A;  5T3R A;  3PRZ A;  5G55 A;  4CZ2 D;  3JUI A;  1KT0 A;  4JHR A;  2GRN B;  3FTU A;  3Q49 B;  2YIN A;  4O1P A;  1INZ A;  2JLB A;  4UQY A;  5EN5 D;  3D9N A;  3PZ4 A;  3FFL A;  3UKU G;  4TV3 A;  2MHK A;  1VDY A;  4LNU D;  2FUL A;  5CRV A;  4WWP A;  2ION A;  2V8S E;  4R7L A;  2XEE A;  3SFY A;  5CBO A;  1HG5 A;  3UM2 A;  1DCE A;  4KXK B;  2XRZ A;  3CKC A;  3D9K A;  3ZYM A;  5FZQ A;  2AXV A;  3S7B A;  4YVQ C;  2J09 A;  3ZRH A;  3G2W A;  2Y0B G;  2PNN A;  3CQC B;  2GW1 A;  4BWR A;  1YA0 A;  4I1O B;  4CGV A;  2JEK A;  3ZUV B;  4E85 A;  3KD7 A;  4JA7 A;  4C9B B;  1OUV A;  5FWQ A;  4I6G A;  4J8F A;  2EIL E;  3QWW A;  2VGY A;  3C5R A;  2XGS A;  2IU1 A;  1E8W A;  1NP7 A;  5T8I A;  2V4L A;  4NQ0 A;  3L08 A;  4BTB A;  1TYQ G;  5KCM A;  2X38 A;  3T5X A;  4K03 A;  4AIF A;  5CEA A;  2XPI A;  4FHK A;  5KJK A;  5AIJ A;  4JB8 P;  1A17 A;  2X6I A;  4Y6W A;  2DYR E;  4YDY A;  3CEQ A;  3G2U A;  3FEY A;  3ZGQ A;  3EHN A;  5G05 C;  4XX5 A;  4GMJ A;  4J8S A;  2XCC A;  1MJ0 A;  4FHJ A;  4IRU A;  3CK8 A;  2E0I A;  2P9L G;  3PRE A;  4MBG A;  3HHM A;  1FPP A;  3NAW A;  3MKQ A;  3HVE A;  2WXM A;  4UI9 J;  2RD0 A;  4P29 A;  4N2Q A;  4I2W A;  4FJY A;  4YDE A;  4KZC A;  4CDM A;  3RRN B;  2GRO B;  4QQI A;  1OCO E;  3UKR G;  4JL0 A;  4JZY A;  3SNX A;  4GYW A;  3CIA A;  4DUI A;  4AM9 A;  4I2Z A;  4A3V A;  1MX2 A;  3AU4 A;  1FCH A;  1UN8 A;  3UTM A;  2WXR A;  4YDW A;  1RW2 A;  5JJ7 A;  1HH8 A;  4XKB A;  5EX3 A;  2XQ0 A;  1RZ4 A;  2QYU A;  3ABK E;  5CHE E;  5FTP A;  3LVR E;  2VYI A;  3ENE A;  4AOF A;  1GW6 A;  3FH7 A;  2ZIS A;  1NL4 A;  4PUC A;  1TR4 A;  3JCK C;  2MOW A;  1U2V G;  3FU0 A;  3T8K A;  4U04 A;  4O1O A;  3RU0 A;  1OY3 D;  3HXD A;  4DRX E;  5ENS D;  1TJF A;  4I9C A;  5G2N A;  1UOH A;  3NF1 A;  2CHW A;  3IHY A;  4U8H A;  4A55 A;  1W3B A;  3U9W A;  4GZ5 A;  4U0S A;  3ZU7 B;  3SBS A;  2F37 A;  2GRQ B;  3DSV A;  1SW6 A;  5BV0 A;  2EIN E;  4KZ0 A;  3SD5 A;  3CKB A;  3RJV A;  2VTB A;  3HDX A;  4IN3 B;  2EIM E;  3QB2 A;  5LP0 A;  3G2V A;  2XPZ A;  2LAH A;  3UM3 A;  2IFU A;  5FQ8 A;  2QZA A;  5FQ7 A; 
#chains in the Genus database with same CATH homology
 3LS8 A;  2DIW A;  3RRM B;  4ILG A;  3ZFW A;  5FQ6 A;  1OWP A;  2VJ8 A;  2YHE A;  2R59 A;  1E90 A;  1WM5 A;  3PS6 A;  4GA1 A;  4PS3 A;  3APF A;  1HU3 A;  1UJK A;  3VTY A;  3PUK A;  4KT6 B;  3D9L A;  3CVY A;  1HFA A;  3D9P A;  4NUR A;  1HX8 A;  3NZS A;  3ZIM A;  2FEZ A;  4AXH A;  3IHV A;  1H19 A;  3CHO A;  2M63 A;  1SZA A;  4YVO A;  4J0U A;  2KC7 A;  4V3I A;  1WY6 A;  3CHR A;  4FA6 A;  2RG8 A;  1HF8 A;  4JW1 A;  4L23 A;  1FVH A;  3KAE A;  3CVV A;  3ZVV A;  4MRU A;  2GRM A;  1FVF A;  4TUU A;  4ACK A;  3FUF A;  1IQU A;  3UPV A;  2I2O A;  2VSN A;  3G2S A;  4I6E A;  4DI4 A;  4FAD A;  1SQM A;  4GZ6 A;  5M72 A;  2AW6 A;  3SGH A;  2WQH A;  5EDS A;  3L13 A;  2PL2 A;  3C98 A;  2LAI A;  3VTX A;  3APD A;  2AVP A;  3FUI A;  2V0P A;  5ENN A;  2KZT B;  2CG3 A;  3FH5 A;  3FUL A;  3PZD A;  3T8M A;  4ATG A;  3PUJ A;  5HQ8 A;  4LUN U;  3JYS A;  4WNF A;  4UI9 K;  3RRU A;  4UQX A;  4ANX A;  4A3T A;  4PDX A;  3ASD A;  4DLQ A;  2Y3A A;  3PE4 A;  5LCW J;  4KMO A;  3MKR A;  4M3O A;  3LJ3 A;  4RG9 A;  4EQF A;  5FJY A;  2J4D A;  4Q69 A;  3S2A A;  5BPP A;  4EEC A;  2WXI A;  3CHM A;  4H7X A;  4UWL A;  2DCP A;  3I3N A;  1TEZ A;  4B0Z A;  4J8E A;  5DIZ A;  4HOR A;  1MHQ A;  3PDN A;  2WMN A;  1IQR A;  4G23 A;  4UI9 C;  2WXH A;  1HXI A;  2VSO E;  3FUE A;  3NQP A;  3ZEF A;  3CVU A;  3TXM A;  3RO2 A;  4GPK A;  5LOZ A;  5KJN A;  1DVP A;  1WAO 1;  1ELK A;  3ESK A;  3JQ0 A;  4UWG A;  1UG3 A;  4GA2 A;  3T5V A;  4JC8 A;  4LCT A;  3UT8 A;  2KAT A;  3U66 A;  4BTA A;  3L16 A;  3HYM B;  3IV0 A;  3ZHE A;  5FZS A;  3OXF A;  4ABN A;  3TG4 A;  3PNT B;  1E7V A;  2ILR A;  2WXP A;  5AJL A;  5JHB A;  2VSX E;  3GW4 A;  2IF4 A;  3ONL A;  2QFC A;  5D0O D;  3CV0 A;  5ANR A;  3ASF A;  2HO1 A;  3RO3 A;  4BX8 A;  4BSX A;  3EHM A;  4GA0 A;  2L0T B;  4G2V A;  3CHP A;  2XGM A;  2Y4T A;  3PH0 C;  5LX8 A;  4I17 A;  1HO8 A;  3B7S A;  3U64 A;  2AWI A;  3EIJ A;  4CT0 A;  4FUL A;  1N54 A;  4RG6 A;  4XI0 A;  3G2T A;  3SBT B;  4HOS A;  2MRI A;  5AJD A;  3SI5 A;  4ME2 A;  3L22 A;  4EBA A;  2NC9 A;  3FUD A;  5LFA A;  3BEE A;  5BNW A;  3LVQ E;  4I1A A;  3R7Q A;  5CMY A;  4GYO A;  2OVB A;  4N3B A;  2XPY A;  4OVV A;  4DJA A;  3BG0 B;  2Y4U A;  2PM6 A;  4HFG A;  3Q4A B;  2GRL A;  2X6H A;  2CHX A;  2LSU A;  3K9I A;  4AV7 A;  4F1S A;  4APO A;  5J90 A;  5A23 A;  3D3M A;  1P5Q A;  3QJZ A;  4N3A A;  3BG1 B;  1U3D A;  1EYH A;  4U63 A;  2Q7F A;  1QZ2 A;  1E8Y A;  3FEX A;  3FY4 A;  5T4Y A;  2WXN A;  3GZ1 A;  3I4R B;  5DBK A;  1E96 B;  3VLD A;  2OND A;  3N71 A;  4JPS A;  4G11 A;  2PQR A;  3ZN3 A;  4GYY A;  4UWF A;  2YNQ A;  4EPZ A;  2HYZ A;  1H2T C;  2X6K A;  3PE3 A;  1UJJ A;  4JA9 A;  2XEV A;  4I43 A;  3FTZ A;  5EX0 A;  4A1G A;  1OWL A;  3NZU A;  2L9B A;  1MQS A;  5JJ6 A;  4U0Z A;  3SHF A;  4GAA A;  5G05 J;  2L6J A;  3CR3 A;  4J6I A;  3RIB A;  3CK7 A;  4AVX A;  3LXU X;  5C2Y A;  4DI3 A;  3FWV A;  3QKY A;  3VLE A;  3OXG A;  3PNL B;  3PEV B;  4FJZ A;  3QK0 A;  4MLP A;  3RK6 A;  5JJT A;  2C0M A;  5A7D B;  4IYP A;  1TJC A;  4BT9 A;  4KVM A;  2UWJ G;  2IQC A;  1UW4 B;  4HVB A;  3FUM A;  3WXX A;  1XGW A;  3TXN A;  4KYO B;  3UX4 A;  3ZPJ A;  4BT8 A;  4APF A;  3O48 A;  4FLB A;  1KT1 A;  3B7T A;  2CHZ A;  5T3R A;  3HVE B;  4J8D A;  4ILI A;  3PRZ A;  2GGF A;  3LPZ A;  4CT4 A;  5G55 A;  2A5U A;  4FU3 A;  4CRW A;  2X6F A;  3JUI A;  1KT0 A;  3MV2 B;  2OVF A;  4WND A;  4UQZ A;  3UT7 A;  5FT9 A;  2I6H A;  4I1M A;  1U3C A;  4GZD A;  4JHR A;  2DBA A;  2J9Q A;  2KCL A;  4WAF A;  1HZ4 A;  5BW8 C;  1Z3X A;  3UT4 A;  1JWG A;  3FTU A;  4ILH B;  4XI9 A;  3DPD A;  3QC1 A;  3Q49 B;  2X3M A;  5ANL A;  4MKT A;  2YIN A;  4NAC A;  2I1K A;  2CFU A;  3CSF A;  1INZ A;  2JLB A;  4UQY A;  5J08 A;  3IEG A;  4LEU A;  4GCO A;  4EBA G;  1N52 A;  3S7F A;  1H2U A;  3D9N A;  4JHK A;  3FFL A;  4CCA A;  3ONK A;  2C2L A;  3MV3 B;  4BX9 A;  3LY7 A;  4PS7 A;  4TV3 A;  2WPV A;  2MHK A;  1VDY A;  2YHC A;  5ARG A;  4KBQ A;  2CFZ A;  2FO7 A;  2FUL A;  3FTW A;  3LDZ A;  4L2L A;  1DNP A;  4UWK A;  4WNE A;  1ELW A;  5AYW D;  4AEZ C;  2AXU A;  4DK5 A;  4WWP A;  5CCL A;  2A4Z A;  2E2E A;  2ION A;  4JEU A;  1L5J A;  3VLF A;  1NA3 A;  2V8S E;  2AXZ A;  3PEU B;  4EZK A;  4HOT A;  4UWH A;  5E76 A;  3QWV A;  2VSY A;  4A1S A;  3CVQ A;  4R7L A;  1HS6 A;  1LF8 A;  3ASG A;  3LCA A;  4HOQ A;  4XE0 A;  5E75 A;  5CCM A;  3PVL A;  5FZR A;  4L7T A;  2KZT A;  3I5P A;  3TJP A;  1HG5 A;  2WXF A;  1OWM A;  3Q47 B;  1QQE A;  4KXK B;  2XRZ A;  4FP7 A;  3CKC A;  1SZ9 A;  1E8Z A;  3D9K A;  4GB9 A;  4LRZ A;  3ZYM A;  4G1T A;  3S7J A;  5FZQ A;  3QNK A;  2AXV A;  2NSZ A;  3CQG B;  3B13 A;  4GU5 A;  5LCW C;  5CMW A;  4CEM A;  3FUH A;  3D9O A;  4MS6 A;  3S7B A;  4YVQ C;  3MZL B;  5BV1 A;  2J09 A;  2BF0 X;  4Q96 A;  3ZRH A;  3RKV A;  3G2W A;  3TL5 A;  1EDU A;  2PM7 A;  4N5C A;  3ZYL A;  3CQC B;  4L2Y A;  5G04 J;  2V5F A;  2GW1 A;  3SZ7 A;  4BWR A;  3UQ3 A;  4ACL A;  1YA0 A;  4O6F A;  3ASH A;  2J07 A;  3OXL A;  2HM8 A;  4I1O B;  3MCX A;  5KJM A;  4CGV A;  3R9A B;  2KCK A;  2JEK A;  4E85 A;  3D9I A;  3GYZ A;  1X5B A;  3KD7 A;  4JA7 A;  4C9B B;  2P58 C;  5JHA A;  2WXO A;  1OUV A;  5FWQ A;  2KCV A;  4JVS A;  4I6G A;  3R7R A;  3ZYK A;  2XCB A;  1QNF A;  1PAQ A;  3GZ2 A;  4G26 A;  3LEW A;  4J8F A;  1PY1 A;  4GZ3 A;  2R17 C;  3D9J A;  3JQ1 A;  3QWW A;  1XNF A;  2OV8 A;  2VGY A;  3AS5 A;  4I6J A;  3AS8 A;  1HE8 A;  2XGS A;  2IU1 A;  1E8W A;  3LKU A;  4LER A;  4EZL A;  1NP7 A;  5T8I A;  2V4L A;  1EF1 C;  3I4G A;  2J4B A;  4NQ0 A;  4B94 A;  5BUZ A;  5C1D A;  4CGW A;  2VGX B;  2WQ6 A;  3B7U X;  3MJW A;  1H2V C;  2LSV A;  3EJN A;  3L08 A;  4BTB A;  3OAW A;  4F53 A;  4ANV A;  5KCM A;  2X38 A;  4OVU A;  2R5S A;  3T5X A;  2VQ2 A;  2BTD A;  4K03 A;  5EKQ D;  4AIF A;  3L54 A;  4HLE A;  1KLX A;  2XPI A;  4I9E A;  4U07 A;  4RVB A;  4XIF A;  1IYG A;  4FHK A;  4GCN A;  4G24 A;  4JEH A;  5BT1 A;  5KJK A;  3CVP A;  3CVW A;  1JWF A;  1IHG A;  2QY7 A;  3CK9 A;  3SFZ A;  3ULQ A;  3O4Z A;  3MKQ B;  3S7D A;  5AIJ A;  3GZS A;  2WM9 A;  3FU5 A;  1A17 A;  2X6I A;  2ZU6 B;  3L6A A;  4Y6W A;  4AY5 A;  3TG5 A;  5A6C A;  3ZYQ A;  3CEQ A;  1JPL A;  3KEZ A;  2FF4 A;  5FQ4 A;  3G2U A;  4AJW A;  3FEY A;  3CHQ A;  4DLO A;  3AU5 A;  3AS4 A;  3ZGQ A;  3EHN A;  4GML A;  5G05 C;  3CLJ A;  4XX5 A;  2YQ8 A;  4AY6 A;  3ML8 A;  2WXK A;  4GMJ A;  4Y6C A;  4J8S A;  1B89 A;  2XCC A;  3QWP A;  3MEK A;  2NXP A;  4FHJ A;  2I9C A;  3CK8 A;  2E0I A;  4IRU A;  3PRE A;  2C0L A;  1PC2 A;  4BY6 A;  4W9R A;  3HHM A;  3QAR A;  3MKQ A;  1NZN A;  4HS2 A;  3HVE A;  4PS8 A;  2WXM A;  2OOE A;  4UI9 J;  4B8C B;  4L1B A;  2RD0 A;  4P29 A;  3ZXS A;  1HG2 A;  3QDN A;  3FUN A;  4N2Q A;  5FQ7 A;  4FLH A;  4I2W A;  4B8A A;  2IOS A;  2PQN A;  4FJY A;  3MX3 A;  3HIZ A;  4KZC A;  4CDM A;  3RRN B;  5D0Q D;  4DPR A;  4HXI A;  3Q15 A;  4B89 A;  3MGB A;  4N2S A;  4JL0 A;  3E4B A;  4JZY A;  1ELR A;  2PZI A;  3D9M A;  4GYW A;  3CIA A;  4XKC A;  3SNX A;  3TAX A;  4AM9 A;  4I2Z A;  4HOU A;  4A3V A;  3DBS A;  2WB2 A;  3ZHE B;  4WWO A;  4TRQ A;  3AU4 A;  4E6H A;  1FCH A;  1UN8 A;  2WMO A;  4CDR A;  2CG2 A;  5HI7 A;  2WXR A;  1H0A A;  3FUK A;  5JJ7 A;  1HH8 A;  2WQ7 A;  4FC8 A;  4WWN A;  4C0E A;  4XKB A;  5EX3 A;  1Z6T A;  3B7R L;  4F3V A;  1ZU2 A;  2XRY A;  2FBN A;  4IUL A;  2WXJ A;  2XQ0 A;  3L17 A;  4H7Y A;  5KJL A;  1Y6I A;  3FDH A;  4KVO A;  5CHE E;  4URK A;  5FTP A;  1OWN A;  3LVR E;  3FU6 A;  2VYI A;  4JXT A;  1E8X A;  3ENE A;  2UY1 B;  3FH8 A;  4AOF A;  1GW6 A;  3FH7 A;  3ML9 A;  2HR2 A;  4YND A;  4K0R A;  4PUC A;  3JCK C;  3FTS A;  1ZBP A;  2MOW A;  2WXG A;  3OTN A;  1OWO A;  4U0U A;  3FU0 A;  3SF4 A;  3FTY A;  4U04 A;  2WXL A;  4D10 C;  2WXQ A;  3RU0 A;  4BFR A;  3ZW3 A;  4JHJ A;  3URZ A;  2LO6 A;  1S0P A;  4ANU A;  1TJF A;  3MYV A;  2IOL A;  4I9C A;  2J49 A;  5G2N A;  2J08 A;  2VTB B;  3QAQ A;  2FI7 A;  3CVL A;  2IJG X;  4G25 A;  3NF1 A;  2UY1 A;  5AEN A;  2CHW A;  1EPU A;  3CGH A;  3IHY A;  4U8H A;  4A55 A;  3IBE A;  2LNI A;  1W3B A;  4PH4 B;  4RSY A;  4XZ4 A;  3U9W A;  3TGO A;  4GZ5 A;  4U0S A;  4GZC A;  3SBS A;  1NA0 A;  3CVN A;  1BPO A;  3EDT B;  3ESL A;  4N3C A;  5G04 C;  3UUX A;  3EIQ C;  3KS2 A;  4QFV A;  3P2B A;  4C0M A;  4ANW A;  4WUY A;  1Y8M A;  2XHE A;  2WVI A;  3FTV A;  3FHE A;  3QOU A;  2XGO A;  5BV0 A;  3LY9 A;  3CVX A;  4KZ0 A;  4EZJ A;  1Z3Y A;  4OYS A;  3SD5 A;  3MA5 A;  4F7A A;  3CKB A;  2I1J A;  3LY8 A;  3RJV A;  2KM4 A;  3P1U A;  3U4T A;  2VTB A;  2EQX A;  3HDX A;  3QB2 A;  4IN3 B;  4CDN A;  3U3W A;  5LP0 A;  3CHS A;  3CST A;  5ARF A;  1H6K A;  3FP3 A;  3LYA A;  3Q5M A;  3UMV A;  3G2V A;  4AP2 A;  2L0I A;  2XPZ A;  3FUJ A;  2LAH A;  1UN9 A;  2X6J A;  1E7U A;  2BUG A;  1JUQ A;  4Q94 A;  2IFU A;  3FU3 A;  5FQ8 A;  3IKO B;  4N39 A;  3APC A;  4WNG A;  4NRH B;  2VGX A;  3FTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...