3RKVA

C-terminal domain of protein c56c10.10, a putative peptidylprolyl isomerase, from caenorhabditis elegans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
147
structure length
147
Chain Sequence
b'LKSVEALRQKGNELFVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKADSRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords putative peptidylprolyl isomerase
publication title C-terminal domain of protein C56C10.10, a putative peptidylprolyl isomerase, from Caenorhabditis elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Isomerase
total genus 63
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rkvA00
3LKUA 3FWVA 3PDNA 4GYWA 2QFCA 3R9AB 2KCVA 4JL0A 2FF4A 2PZIA 3LCAA 4N5CA 3ULQA 1HZ4A 2L6JA 2VYIA 2C2LA 3TAXA 3IEGA 2Q7FA 4GA1A 1KT0A 5HQ8A 4N3BA 2UY1B 5BNWA 3Q15A 4AM9A 3CKBA 4YNDA 5BT1A 4CDRA 3GYZA 2PQRA 3LY8A 3Q5MA 5A7DB 4J8FA 1ZU2A 4BTBA 4APOA 4WNDA 4W9RA 4XI9A 3CVLA 3QDNA 4I9EA 2KCLA 1ZBPA 3FP3A 4G2VA 4YVQC 5EX0A 4N2QA 1TJCA 3ASHA 5KJLA 4AIFA 3S7JA 3WXXA 2YQ8A 2VGYA 2XGOA 4U0UA 3RKVA 4CGWA 5JJ7A 5KJKA 3URZA 3CVQA 3CVNA 2HR2A 5A6CA 5ARGA 5FTPA 2YHCA 4J8EA 5AYWD 4GCNA 5EX3A 5CHEE 1NA0A 2AVPA 3RU0A 3UUXA 3RJVA 3MA5A 4JA7A 3AS5A 1Y8MA 3HYMB 3OXLA 3NF1A 2FEZA 2LSUA 2LNIA 2DBAA 4N2SA 4I2WA 1IYGA 1E96B 3ASDA 4NQ0A 2IFUA 1HXIA 4LEUA 4N3AA 2HYZA 4N3CA 3KS2A 2P58C 3U3WA 2PQNA 2BUGA 3O48A 3OXFA 4U0SA 4HORA 1KT1A 4UQYA 4J0UA 1HH8A 3LY7A 3TG4A 4H7XA 3ZN3A 3QWPA 4UI9J 3OXGA 3ZHEA 3TGOA 4G1TA 4GZ3A 3S7FA 1IHGA 3CK7A 2WQHA 3CV0A 3GZ1A 3U4TA 2C0LA 2Y4TA 2VSYA 3Q4AB 4WNEA 5KJMA 5G05C 2UWJG 4ME2A 5FZQA 4U04A 4HOTA 4A1SA 5CCLA 3S7BA 4WNFA 4N39A 5FZRA 4J8DA 3GZ2A 4G25A 3ESKA 4G26A 1PC2A 3LY9A 4AY5A 5G04J 4KYOB 2R5SA 4WUYA 4U0ZA 3FFLA 2WPVA 2XPIA 3Q49B 4XIFA 3AS4A 3CEQA 3TG5A 3JYSA 2OOEA 3AS8A 4UI9K 3VTXA 4UI9C 3QOUA 4O6FA 1KLXA 3CKCA 2V5FA 3ZGQA 3ZPJA 3SZ7A 3UPVA 2NC9A 5HI7A 3BEEA 3PE4A 3ZFWA 4I1AA 1WM5A 2C0MA 4AY6A 2LSVA 4ABNA 5G05J 4I2ZA 1QZ2A 3CK9A 1XNFA 2VGXB 3K9IA 4GA2A 3LPZA 4BT9A 2Y4UA 3MEKA 4H7YA 5JJTA 2PL2A 3ASGA 4F3VA 3SF4A 3S7DA 5G04C 1A17A 3E4BA 2FBNA 4GYYA 1FCHA 5LCWJ 4I9CA 1NA3A 3ZHEB 1W3BA 1WAO1 2FI7A 4Y6WA 4HOUA 2XGMA 4HOQA 4U07A 4BWRA 3QWVA 2UY1A 5D0OD 4BTAA 5CCMA 3PE3A 2FO7A 3N71A 3QKYA 4HOSA 2XCCA 3MKRA 4GCOA 4GYOA 2ONDA 2VQ2A 4CGVA 2I6HA 3RO3A 5EKQD 2KCKA 2J9QA 3RO2A 3ASFA 4B94A 1ELRA 3Q47B 4G23A 5ARFA 3GW4A 3KAEA 5FT9A 3CVPA 4JHRA 4EQFA 3QWWA 4KXKB 2HO1A 5FJYA 4GZ5A 5D0QD 5C1DA 3UQ3A 5BW8C 4GZ6A 4NRHB 1NZNA 5LCWC 1YA0A 5JJ6A 1QQEA 3EDTB 4Y6CA 2IF4A 4RG6A 5FZSA 5DIZA 4JA9A 4XI0A 4UQZA 2MHKA 2KATA 4YVOA 3RIBA 2GW1A 5M72A 1OUVA 3LYAA 3VTYA 4WNGA 2JLBA 4UQXA 4RG9A 2KC7A 3MV2B 4BT8A 2E2EA 5KJNA 5DBKA 2VSNA 1ELWA 4GA0A 4KBQA 2XCBA 4I17A 3CK8A 4IN3B 4G24A 2XGSA 3MV3B 3KD7A 4GPKA 2XEVA 2VGXA 1P5QA 1B89A
chains in the Genus database with same CATH superfamily
3UIOC 4O1PA 3R9AB 2KCVA 4NIKA 2IU1A 4HQDA 4JL0A 3TWVA 4B93B 3L82A 3FU6A 2PZIA 4N5CA 3ABLE 3ULQA 2F0YA 1HZ4A 3CGHA 5E75A 2C2LA 4UWGA 3ULYA 1BLXB 2UY1B 5BNWA 3SQVA 2GRPB 5CEAA 4AM9A 3ZW3A 5BT1A 2PQRA 3Q5MA 2GRLA 2ZGDA 1SZ9A 3PH0C 4JEUA 5AIJA 1MX6A 1ZU2A 1GW6A 3E33A 3E34A 5ENNA 3AU5A 3BU8A 3T5VA 1MHQA 3DSTA 1MX2A 4G2VA 4YVQC 4N2QA 4FC8A 1TN6A 3S7JA 3Q75A 1FT1A 3Q7AA 5KJKA 3URZA 4I1OB 1N0QA 1TNYA 3CVNA 3BQOA 3UMVA 5ENQD 3FHEA 3SD5A 3D9MA 1TN7A 1S70B 4DLQA 4JHJA 4PDXA 3PVLA 1NA0A 3UUXA 3RRNB 2J49A 1KZOA 3SY2A 3C3RA 2R03A 2FEZA 1K1BA 2VTBA 4A3TA 3ASDA 2IFUA 4OVVA 2KM4A 4TXRA 3MKQA 4LEUA 3DXKG 3LJ3A 3JUIA 4N3CA 4L7TA 1TJFA 2BUGA 1K3ZD 4U0SA 3T8KA 3RRMB 2XEHA 4UQYA 4Q94A 4KZCA 4LUNU 3LY7A 4UI9J 3QJZA 1OWPA 4N5QA 3HRAA 3ZHEA 2F37A 2AXUA 3ABKE 5T3RA 5EILA 4GZ3A 3S7FA 1IHGA 2QYJA 1NL4A 3CK7A 4FP7A 5JA4D 4U96D 2CHZA 3FU5A 3Q73A 3IV0A 4V3IA 3CV0A 3GZ1A 4GPMA 2C0LA 5T4YA 2LAIA 5LP0A 3Q4AB 3ZYMA 4WNEA 4XE0A 2NYJA 2R2LA 4QQIA 1H19A 5FZQA 2L0TB 1RZ4A 1A5EA 4WNFA 3V2XA 3GZ2A 4G25A 4G26A 4UUCA 2DIWA 4B8AA 3NZUA 4GMJA 4WUYA 4EHMA 2P9PG 4Z68A 4OAVB 3P1UA 3CVYA 3Q49B 3AS4A 4GZDA 3JYSA 4F1PA 4OVUA 3FUIA 2EIKE 1KLXA 2LUHA 3CKCA 1YMPA 1SW6A 3PNTB 4BY6A 2VTBB 3UPVA 2NC9A 3CLJA 2R59A 1WM5A 3JXJA 4NURA 2LSVA 5ENSD 1OWMA 3FTVA 3TL5A 3T5XA 2X6HA 2EINE 1OCOE 3JQ0A 1OCCE 3K9IA 4GA2A 3LXUX 3TWTA 3MEKA 3C5RA 4H7YA 5AAOA 2WXFA 3CIAA 3D9JA 3PEVB 3E32A 3S7DA 3E4BA 4TUUA 2P9KG 2H6GA 3JQ1A 5KCMA 4M7CA 3D3MA 3T8MA 3ZHEB 2X6FA 2L9BA 2ZISA 3FULA 5ITZF 5ENTD 4HI9A 1NP7A 1TEZA 1TNOA 1KZPA 3FUMA 4CCAA 2FI7A 4ATGA 3SNXA 4QFVA 1OXJA 3NQPA 2Y1LE 1N4QA 1JUQA 1IHBA 4K03A 4EZKA 3L6AA 1EF1C 3RAUA 2XPZA 1U3DA 3U66A 3Q9NC 2ONDA 3RO3A 4HBDA 2KCKA 1BU9A 3ASFA 2XZDG 4CEMA 1N4SA 3J5QB 2IY0C 3GW4A 3CVPA 4ZFHA 3QWWA 4YDEA 2MRIA 2PNNA 3HIZA 4BSXA 4YDOA 4NRHB 5LCWC 5FWQA 2RG8A 3UM0A 3UM2A 4HFGA 4F6RD 3HHMA 3CSTA 2DVWA 1MQSA 3G2SA 5B3SE 2GRNB 1SZAA 5JHAA 4UQZA 3TXMA 4EECA 5FQ4A 4GTPA 1EPUA 3AJIA 4WWOA 4FHKA 2LO6A 3U9WA 3LYAA 4L2YA 2B6CA 4CDNA 2P9UG 5CEDB 4LSZE 4O60A 4C0EA 1SVXA 4NACA 1E8ZA 3MV2B 4BT8A 2E2EA 3CQGB 5KJNA 2QZAA 3TWUA 3ZU7B 3BG0B 5DBKA 5KWDA 1BI8B 2YINA 4I17A 3HVEA 4EZLA 2XEVA 3ML9A 3W9FA 3LKUA 4A3VA 2GRQB 3FWVA 2QFCA 1H6PA 1OCZE 3D9NA 2FF4A 5EIBE 4APFA 3LCAA 4FU3A 3SGHA 1INZA 2L6JA 5H7PA 5B1BE 4B89A 4UWFA 2Y69E 5HQ8A 2RFAA 5CERB 3V79K 3JXIA 3CKBA 2IO3C 4GTSA 4JB8P 1Z6TA 4BTBA 1UJJA 4APOA 4XI9A 3QDNA 3HXDA 2J8SD 3AG4E 3AG2E 4I1MA 2GRMA 3G2VA 4U8YD 4I9EA 1ZBPA 5EIDA 3LS8A 2HM8A 3DWLG 3ASHA 3CVVA 2A5EA 4J7WA 4U8VD 4AIFA 4HB5A 3WXXA 3KSQA 3DPYA 4CGWA 3UKRG 5CRVA 2HR2A 3DEPA 2V0PA 4JEHA 1Z3YA 5A6CA 5ARGA 1HE8A 2YHCA 5AYWD 4GCNA 3CHMA 3CQCB 4LRZA 4AEZC 4JA7A 3HYMB 3NF1A 3RRUA 1K8KG 3S2AA 5ENPD 4NQ0A 4C0MA 1QNFA 3KEZA 3IXEA 2I1JA 3JCKC 2HYZA 4IULA 2IO2C 1E7UA 2PQNA 4E85A 5AQBA 4Q69A 2ETAA 3B7TA 2MYOA 3G2TA 3FUNA 4GTTA 4MS6A 3FEYA 1UN9A 2P9IG 3PZ2A 1HFAA 3OTNA 3DSWA 4ANWA 3TG4A 2AJAA 3TGOA 1N52A 5CBNA 4E6HA 2EIME 4G1TA 3RK6A 3IHYA 4DX1A 4KVMA 1YCSB 4GTMA 2IJGX 2WXHA 1EDUA 4ANVA 3D9PA 2V5QC 2LXMA 1UG3A 1S0PA 2RFMA 2L6BA 2X6IA 3ONKA 3TJPA 2DWZA 2VSYA 1HU3A 2LAHA 3CHQA 4ACLA 2IOLA 4JVSA 2UWJG 3UI2A 3ZXPA 3Q78A 4A1SA 1IQUA 3S7BA 2P9SG 2X3MA 2WXMA 4CT0A 3DEOA 5EDSA 3FEXA 3F6QA 3FTZA 4F53A 3APFA 4JC8A 4KYOB 2X6KA 3I4RB 2WPVA 4O1OA 3FUJA 4YDYA 5EYLA 3PZ1A 4UI9K 2PM6A 4FLHA 2JEKA 5ANRA 2ZIRA 2YNQA 2ETCA 4EPZA 4EBAG 4G8KA 3PZDA 2I1KA 2WXNA 3BEEA 3EHRA 4ABNA 3IKOB 5G05J 4I2ZA 1QZ2A 2KBXA 4DX7D 3R7QA 2WXGA 4J6IA 1E90A 1UJKA 4JW1A 1OT8A 2QY7A 1JWGA 5JJTA 5C2YA 2PL2A 4DPRA 1N95A 3X2QE 2VSXE 3FUKA 2B0OE 4KT6B 3V30A 4TXPA 1O1TA 5G04C 2NXPA 3ZYKA 1A17A 3UT8A 3NBNB 5HS0A 3FTXA 5LCWJ 4A55A 2VGEA 4DUIA 2IQCA 1OWLA 1WAO1 4G8LA 4K5CA 2P9LG 1S64A 1FVFA 4BX9A 5J90A 4Y6WA 1NI1A 2VJ8A 1Q2ZA 3CR3A 1N11A 3PNLB 4U07A 4L23A 1N0RA 3FUFA 5JMND 3VLFA 3QWVA 5D0OD 4B8CB 3G2WA 2YHEA 4ILGA 2XENA 5CCMA 3FTUA 1MX4A 3QKYA 4HOSA 3L13A 3MKRA 3ZEFA 4GYOA 4FA6A 3CVUA 3Q79A 4UWLA 4I43A 3Q7FA 3EU9A 3NZSA 4LERA 1U2VG 1O1RA 3ABME 5ARFA 4ANUA 5FT9A 4LCTA 3FTSA 5AQ7A 4EQFA 3ZUVB 2HO1A 1H6KA 5FJYA 4GZ5A 1ELKA 2X38A 5C1DA 5G55A 4FJZA 5BW8C 3MGBA 5AENA 4GTOA 5JJ6A 4BSZB 3AG1E 2V4HC 4L9PA 1QQEA 2Y3AA 5AJLA 2CG3A 1D8EA 3C3OA 5JHBA 4TV3A 2QC9A 5DIZA 3KSLA 4JA9A 2H6FA 4BETA 4D10C 1X81A 2WM9A 4URKA 4K5AB 3MKQB 2EIJE 4R7LA 2J08A 4MBGA 4LNBA 4RSYA 3UX4A 4ILHB 4GA0A 4KBQA 2XCBA 1N4PA 4IN3B 3C3QA 2AW6A 3KD7A 3ZYQA 2FULA 3FH5A 3HXEA 2VGXA 4GB9A 2CHWA 3UM3A 3PDNA 5FQ7A 4U63A 1H2TC 3LEWA 3ISMC 1H6OA 2WXOA 2VYIA 3FH7A 5CBOA 3UTMA 2XHEA 5KNGA 1KT0A 1O5MA 3EHQA 3ASNE 4N3BA 3FY4A 4MKTA 3B7SA 1BD8A 1QBQA 3LDZA 2R02A 3HDXA 2KXPC 3TXNA 4J8FA 3ONLA 3SBTB 4WNDA 4W9RA 1HO8A 3CVLA 4DJAA 3HXFA 2XRZA 2WVIA 4MRUA 4I6JA 2OV8A 2V4LA 1KPSB 5HRYA 2KCLA 5EX0A 1TJCA 3DSXA 4KMOA 2RKKA 4X8QA 3ZRHA 2YQ8A 1BPOA 3ULEG 3RKVA 5JJ7A 2J07A 3CVQA 4FULA 5FIOA 5AJDA 4JXTA 5FTPA 1D9SA 3ZXSA 3UT7A 4XKCA 3HXCA 4J8EA 3NOCD 5CHEE 2CG2A 2XQ0A 3RU0A 4UWHA 5T8IA 3FTYA 1Y8MA 3OXLA 3SO8A 4AXHA 4DK5A 2LSUA 2DBAA 3FDHA 4N2SA 5CMYA 4FADA 2IOSA 3L08A 5EYPF 3TWWA 1TR4A 3EHNA 4CYMD 3KS2A 1SQMA 4BESA 2P58C 2AXZA 3O48A 3OXFA 4RLYA 3ZKJA 3V31A 1KT1A 3TWSA 1X5BA 1HX8A 4BX8A 2ZU6B 2E0IA 5BV0A 2DYSE 1HH8A 3OAWA 3ZN3A 2F8XK 3OXGA 4F7AA 5FINA 1UN8A 2DCPA 3DBSA 4DI3A 3L9TA 1RW2A 4AJWA 4ACKA 4HVBA 3U64A 1TNBA 2DZOA 3QC1A 1NFIE 5ANLA 2DZNA 3RSEG 5FQ6A 3SI5A 2OCCE 4GTQA 2ZXWE 5G2NA 3CVWA 1SA5A 5CRUA 4P29A 5KJMA 4JZYA 4ME2A 3FH8A 3PZ4A 4N39A 5FZRA 4J8DA 4HI8A 4CZ2D 1UW4B 5G04J 3UINC 3TWXA 2R5SA 1DCEA 4U0ZA 4BEPA 1N4RA 4HRLA 2XPIA 2DYRE 3EIQC 4EBAA 2A4ZA 3CEQA 3AS8A 5AQ9A 3L22A 3VTXA 3QOUA 5BXUA 4PUCA 3D9LA 4FJYA 3PZ3A 3ZGQA 3ZPJA 3JUEA 5HI7A 4K0RA 3ZFWA 5LX8A 2AXVA 2C0MA 4XX5A 3HVEB 3CK9A 4AP2A 1G3NB 1K1AA 1LTXA 1XNFA 4DI4A 4TUMA 1OWOA 4YDWA 3MJWA 2Y4UA 3CHPA 2LXLA 5BXOA 4B0ZA 4RVBA 3T9KA 3IBEA 4F3VA 3AU4A 3DXMG 3SF4A 1OWNA 3HXBA 1YYHA 1FCHA 4I9CA 2OEWA 1W3BA 4HLEA 1DCQA 2OVBA 5IY5E 3D9IA 4GMRA 1VDYA 3EU5A 3UM1A 4IYPA 3DSUA 5AN8A 3FUDA 2IONA 4IRUA 3SHFA 3MYVA 3I4GA 4FHJA 1JCSA 1BI7B 2WXIA 4M3OA 4HXIA 2VQ2A 3L54A 3P2BA 1TNUA 4HRNA 5EKQD 2WQ6A 3DPDA 2J9QA 4AV7A 4KZ0A 4DX5D 4TRQA 4PH4B 4B94A 3IHVA 3VLEA 3Q47B 4G23A 2EQXA 3KAEA 2V8SE 4JHRA 2OVFA 3WG7E 3HG0D 5D0QD 5ENRD 2I2OA 3UQ3A 1PAQA 4GZ6A 1NZNA 1AP7A 1AWCB 2WXRA 5LFAA 3FTWA 2VSOE 1WG0A 3EDTB 4Y6CA 3ZIMA 4RG6A 3APCA 5KNHD 4GTRA 4PS3A 1U3CA 2J09A 2RD0A 1UOHA 4XI0A 1Y6IA 4HRMB 3D9OA 3LVQE 2KATA 4YVOA 3RIBA 1L5JA 2GW1A 5M72A 3ASOE 3VTYA 4WNGA 1EYHA 4K5BA 2WXKA 2KC7A 2H6IA 4DRXE 4GZCA 2WXPA 2OEVA 5AQAA 1D8DA 2X6JA 5BUZA 3ZYLA 3NB2A 1OY3D 4G24A 4GPKA 3C72A 3NAWA 4GYWA 3UXGA 4RQIA 3UIPC 4ZHBA 3B7UX 1DNPA 2A5UA 1Z3XA 2L0IA 3E30A 4WWPA 4TXQA 3DRAA 3TAXA 3IEGA 3ENEA 1QYMA 2Q7FA 4PS7A 4GA1A 3TWRA 1IKND 2XS8A 3Q15A 3AAAC 3BUAA 4L1BA 2WMOA 1XGWA 4WWNA 4YNDA 4CDRA 3GYZA 2J4DA 3LY8A 3EJNA 4HS2A 5A7DB 3PS6A 2WMNA 3SFYA 2HE0A 3MZLB 4CRWA 3NOGD 5BPPA 1E8YA 4ATZD 1WDYA 2ILRA 3FP3A 3QAQA 1S63A 5KJLA 2CFZA 5J08A 2VGYA 2XGOA 4U0UA 4J8SA 3ZNGA 3DSSA 4CDMA 1V54E 3EHMA 1TNZA 5E76A 4OAUC 3ZVVA 5EX3A 2GGFA 3QK0A 2AVPA 4GMLA 3RJVA 4DX2A 4HNAD 3MA5A 2M63A 3O4ZA 3AS5A 3APDA 2LNIA 1LD8A 3SFXA 3C98A 4I2WA 3B13A 1IYGA 1E96B 1HXIA 3DSVA 3LVRE 1N54A 3R7RA 2BKGA 2MOWA 4GTVA 4N3AA 3U3WA 2ETBA 2FO1E 1H0AA 4HORA 1E8WA 2BEDA 3W9GA 1HG5A 4GAAA 5ENOD 1TYQG 5D66A 5EN5D 3R9MA 4J0UA 2R05A 4L2LA 4H7XA 4C9BB 1WY6A 3QWPA 5FQ8A 2KZTA 3Q9UC 2BF0X 1DVPA 1H2VC 2WQHA 2P2CP 1MZCA 1Z5SC 2AWIA 4DLOA 3PREA 1MJ0A 3ESLA 1MYOA 3B7BA 2CFUA 4AOFA 3U4TA 2Y4TA 3PEUB 1TN8A 5G05C 3ML8A 2Y0BG 3B7RL 3G2UA 3QARA 4U04A 4MLPA 4HOTA 5CCLA 3AG3E 4J8YA 3ESKA 1PC2A 3LY9A 4XZ4A 4AY5A 3PUKA 2WQ7A 4JHKA 1OCRE 3FFLA 4OYSA 4XIFA 4AVXA 3TG5A 3BG1B 4FLBA 2OOEA 2JABA 3PUJA 1HF8A 4UI9C 2PM7A 4O6FA 4UWKA 2V5FA 4ILIA 1IXVA 2WXJA 3SZ7A 4Q96A 4BERA 2WXLA 3TWQA 2XZTG 2CHXA 3PE4A 2P9NG 1N9AA 4I1AA 2H6HA 4AY6A 2BTDA 5AARA 4XEIG 1SA4A 2F8YA 3CHOA 2VGXB 1ZB1A 4LNGA 1LF8A 4A1GA 3LPZA 1PY1A 4BT9A 1IQRA 2GRRB 2BKKB 2XEEA 3FUEA 4F1SA 3ASGA 3E37A 4G11A 5D2MC 4JPSA 1V55E 3KEAA 5HKPA 2FBNA 3GZSA 4GYYA 5BV1A 1NA3A 2KZTB 3D9KA 1LD7A 2I9CA 1E8XA 4C48B 3CSFA 3QNKA 3V2OA 3L16A 1HS6A 1JCRA 4HOUA 3CHRA 2XGMA 4HOQA 4BWRA 5LOZA 3FU3A 2ZGGA 1N94A 4I6GA 1DC2A 2UY1A 4JD2G 3CHSA 3EUVA 4BTAA 2XPYA 3PRZA 3PE3A 2FO7A 3N71A 5B1AE 4WAFA 2XCCA 4ANXA 4GCOA 1JWFA 4CGVA 2I6HA 2IEJA 3CVXA 1FPPA 2R17C 3D9HA 4CT4A 3RO2A 4A63B 4BFRA 4PS8A 3UKUG 1ELRA 4GU5A 1JCQA 1E7VA 3EIJA 4DX6D 3I5PA 5A23A 3VLDA 4KVOA 4KXKB 1H2UA 4U8HA 1FVHA 1HG2A 1YA0A 4XKBA 3LJNA 4LG6A 2IF4A 5CECB 3UT4A 2EILE 5FZSA 3SFZA 5CMWA 2J4BA 4I6EA 1FT2A 2XS1A 2QYUA 2GROB 3J5PA 3MCXA 2MHKA 3SBSA 4U95D 1O1SA 3FU0A 1OUVA 5KBAA 3MX3A 4EZJA 2NSZA 2WXQA 2JLBA 4UQXA 4RG9A 4U7EB 3QB2A 4LNUD 2VSNA 1ELWA 4HLLA 3CK8A 2XGSA 3B95A 3MV3B 1JPLA 3FUHA 3L17A 1P5QA 3I3NA 2WB2A 1B89A 2XRYA
chains in the Genus database with same CATH topology
3LKUA 4GB9A 2CHWA 4A3VA 3FWVA 3PDNA 4GYWA 2QFCA 3R9AB 2KCVA 2IU1A 3D9NA 4JL0A 5FQ7A 2FF4A 4U63A 1H2TC 3B7UX 3FU6A 1DNPA 2PZIA 4APFA 3LCAA 3LEWA 4FU3A 4N5CA 2A5UA 3ULQA 1Z3XA 2L0IA 4WWPA 3SGHA 1HZ4A 3CGHA 1INZA 2L6JA 2WXOA 2VYIA 5E75A 2C2LA 3FH7A 3TAXA 3IEGA 3ENEA 4PS7A 2Q7FA 4B89A 2XHEA 4GA1A 4UWFA 4UWGA 1KT0A 5HQ8A 4N3BA 3FY4A 2UY1B 5BNWA 3Q15A 4L1BA 4MKTA 2WMOA 4AM9A 3B7SA 3CKBA 3ZW3A 1XGWA 4WWNA 4YNDA 3LDZA 5BT1A 4CDRA 3GYZA 2J4DA 3HDXA 3TXNA 2PQRA 3LY8A 3EJNA 3Q5MA 2GRLA 1SZ9A 3PH0C 3PS6A 4HS2A 5A7DB 2WMNA 4JEUA 4J8FA 5AIJA 1Z6TA 1ZU2A 3MZLB 3ONLA 4BTBA 4CRWA 1UJJA 4APOA 3SBTB 4WNDA 4W9RA 1HO8A 1GW6A 4XI9A 5BPPA 3CVLA 4DJAA 3QDNA 2XRZA 2WVIA 1E8YA 5ENNA 3AU5A 4MRUA 4I6JA 3T5VA 2OV8A 2V4LA 1MHQA 4I1MA 2GRMA 3G2VA 3CVUA 4I9EA 2KCLA 1ZBPA 2ILRA 3FP3A 3LS8A 4G2VA 3QAQA 4YVQC 1TJCA 5EX0A 2HM8A 4N2QA 4KMOA 3ASHA 5KJLA 4FC8A 3CVVA 2CFZA 3ZRHA 4AIFA 3S7JA 3WXXA 2YQ8A 5J08A 2VGYA 2XGOA 1BPOA 4U0UA 3RKVA 4J8SA 4CGWA 2J07A 5JJ7A 5KJKA 3URZA 3CVQA 4I1OB 3CVNA 2HR2A 3UMVA 4FULA 4CDMA 3FHEA 2V0PA 4JEHA 3SD5A 1Z3YA 5A6CA 5AJDA 4JXTA 3EHMA 5ARGA 5FTPA 3D9MA 3ZXSA 1HE8A 3UT7A 4XKCA 2YHCA 4DLQA 5E76A 4J8EA 5AYWD 4GCNA 4JHJA 4PDXA 3PVLA 5CHEE 2CG2A 2GGFA 5EX3A 3ZVVA 3CHMA 3QK0A 1NA0A 3CQCB 2AVPA 2XQ0A 3RU0A 4GMLA 4UWHA 3UUXA 3RJVA 5T8IA 3RRNB 2J49A 4LRZA 3MA5A 2M63A 3FTYA 3O4ZA 4AEZC 4JA7A 3AS5A 1Y8MA 3HYMB 3OXLA 3NF1A 2FEZA 4AXHA 4DK5A 3RRUA 2LSUA 3APDA 3S2AA 2VTBA 2LNIA 2DBAA 3FDHA 4N2SA 3C98A 4A3TA 4I2WA 5CMYA 4FADA 3B13A 1IYGA 1E96B 3ASDA 4NQ0A 2IFUA 4C0MA 1HXIA 2IOSA 2KM4A 4OVVA 3LVRE 1N54A 3L08A 3MKQA 3R7RA 2MOWA 1QNFA 3KEZA 4LEUA 2I1JA 3JCKC 4N3AA 2HYZA 3EHNA 3LJ3A 3JUIA 4N3CA 4L7TA 4IULA 3KS2A 1SQMA 1TJFA 1E7UA 2P58C 3U3WA 2PQNA 2BUGA 4E85A 2AXZA 3O48A 3OXFA 4Q69A 4U0SA 1H0AA 4HORA 1KT1A 1E8WA 1X5BA 3RRMB 1HG5A 1HX8A 3B7TA 4GAAA 4BX8A 3G2TA 3FUNA 2ZU6B 2E0IA 5BV0A 4UQYA 4Q94A 4MS6A 3FEYA 1UN9A 4J0UA 1HFAA 4KZCA 1HH8A 4L2LA 3OTNA 3OAWA 3LY7A 4LUNU 4ANWA 3TG4A 4H7XA 3ZN3A 4C9BB 1WY6A 3QWPA 3QJZA 4UI9J 5FQ8A 1OWPA 2KZTA 3OXGA 3ZHEA 3TGOA 1N52A 2BF0X 4E6HA 4F7AA 4G1TA 2AXUA 1DVPA 1UN8A 5T3RA 2DCPA 4GZ3A 3RK6A 3S7FA 3DBSA 1IHGA 3IHYA 1H2VC 3CK7A 4FP7A 4DI3A 2WQHA 4KVMA 2CHZA 3FU5A 4AJWA 3IV0A 2IJGX 2WXHA 1EDUA 4ACKA 3D9PA 4V3IA 4ANVA 4HVBA 3U64A 3CV0A 2AWIA 1UG3A 4DLOA 3PREA 3GZ1A 3QC1A 1S0PA 3ESLA 5ANLA 5FQ6A 3SI5A 2CFUA 4AOFA 3U4TA 2X6IA 2C0LA 5T4YA 3ONKA 2Y4TA 3TJPA 2VSYA 1HU3A 2LAHA 2LAIA 3CHQA 4ACLA 5LP0A 5G2NA 3Q4AB 3PEUB 3ZYMA 4WNEA 3CVWA 2IOLA 4XE0A 4JVSA 4P29A 5G05C 5KJMA 2UWJG 1H19A 3ML8A 4JZYA 3B7RL 4ME2A 5FZQA 2L0TB 3G2UA 3QARA 4U04A 4MLPA 4HOTA 4A1SA 3FH8A 1IQUA 3S7BA 5CCLA 4WNFA 2X3MA 4N39A 2WXMA 5FZRA 4J8DA 3GZ2A 4CT0A 4G25A 5EDSA 3ESKA 4G26A 1PC2A 3FEXA 3FTZA 3LY9A 4XZ4A 4F53A 2DIWA 4AY5A 3PUKA 1UW4B 4B8AA 3NZUA 5G04J 4JHKA 2WQ7A 3APFA 4JC8A 4GMJA 4KYOB 2R5SA 4WUYA 4U0ZA 3FFLA 2X6KA 3I4RB 2WPVA 2XPIA 3P1UA 4OYSA 3CVYA 3FUJA 3EIQC 3Q49B 4XIFA 4AVXA 4EBAA 2A4ZA 3AS4A 4GZDA 3CEQA 3TG5A 3BG1B 3JYSA 2OOEA 3AS8A 4FLBA 4UI9K 3PUJA 2PM6A 3L22A 1HF8A 4FLHA 3VTXA 2JEKA 4UI9C 5ANRA 2PM7A 3QOUA 4OVUA 4O6FA 3FUIA 4UWKA 1KLXA 2YNQA 4PUCA 3D9LA 3CKCA 4FJYA 4EPZA 2V5FA 4EBAG 4ILIA 3ZGQA 3ZPJA 2WXJA 3SZ7A 3PNTB 3PZDA 4Q96A 4BY6A 2WXLA 2VTBB 2I1KA 3UPVA 2NC9A 3CLJA 2R59A 5HI7A 2CHXA 2WXNA 3BEEA 3PE4A 4K0RA 3ZFWA 5LX8A 2AXVA 4I1AA 1WM5A 4NURA 2C0MA 4AY6A 2LSVA 4ABNA 3IKOB 2BTDA 4I2ZA 5G05J 1OWMA 4XX5A 1QZ2A 3HVEB 3FTVA 3R7QA 3CK9A 3TL5A 4AP2A 3T5XA 2X6HA 3CHOA 1XNFA 2VGXB 2WXGA 3JQ0A 1LF8A 4DI4A 3K9IA 4A1GA 4GA2A 4J6IA 1OWOA 1E90A 3LXUX 3LPZA 1PY1A 1UJKA 1IQRA 4BT9A 3MJWA 2Y4UA 4JW1A 3CHPA 3MEKA 4H7YA 2WXFA 2QY7A 3FUEA 1JWGA 4B0ZA 4RVBA 5JJTA 5C2YA 3CIAA 4F1SA 3D9JA 2PL2A 4DPRA 3PEVB 3ASGA 2VSXE 3IBEA 3FUKA 4G11A 4F3VA 4JPSA 3AU4A 4KT6B 3SF4A 1OWNA 3S7DA 5G04C 2NXPA 3ZYKA 1A17A 3E4BA 4TUUA 3UT8A 3JQ1A 2FBNA 3GZSA 4GYYA 1FCHA 3FTXA 5KCMA 5BV1A 3D3MA 4I9CA 3T8MA 4A55A 1NA3A 2KZTB 5LCWJ 3ZHEB 2IQCA 2X6FA 3D9KA 1OWLA 1W3BA 4HLEA 1WAO1 2L9BA 2I9CA 1E8XA 3FULA 1NP7A 3CSFA 3QNKA 1FVFA 4BX9A 2OVBA 5J90A 1TEZA 3FUMA 3L16A 3D9IA 4CCAA 2FI7A 4Y6WA 2VJ8A 1HS6A 4ATGA 3CR3A 3SNXA 4HOUA 4QFVA 3PNLB 3NQPA 1VDYA 3CHRA 1JUQA 2XGMA 4HOQA 4L23A 4U07A 4IYPA 4BWRA 5LOZA 3FU3A 3FUFA 3FUDA 4K03A 3VLFA 2IONA 3QWVA 4IRUA 4I6GA 4EZKA 3SHFA 3L6AA 3MYVA 2UY1A 5D0OD 4B8CB 3G2WA 2YHEA 3CHSA 1EF1C 3I4GA 4ILGA 4FHJA 2WXIA 4BTAA 2XPYA 3FTUA 2XPZA 3PE3A 3PRZA 2FO7A 3N71A 4M3OA 5CCMA 1U3DA 4WAFA 3QKYA 4HXIA 3U66A 3L13A 4HOSA 2XCCA 4ANXA 3MKRA 4GCOA 3ZEFA 4GYOA 2ONDA 1JWFA 2VQ2A 2I6HA 3L54A 3P2BA 3RO3A 5EKQD 4FA6A 4CGVA 4UWLA 2WQ6A 3CVXA 2KCKA 4I43A 2R17C 3DPDA 4CT4A 2J9QA 4AV7A 3RO2A 4KZ0A 3ASFA 4BFRA 4PS8A 4TRQA 4PH4B 3NZSA 4B94A 4CEMA 4LERA 3IHVA 3VLEA 1ELRA 3Q47B 4G23A 4GU5A 1E7VA 5ARFA 3GW4A 2EQXA 3KAEA 4LCTA 3FTSA 5FT9A 3CVPA 2V8SE 4JHRA 3EIJA 4ANUA 4EQFA 3I5PA 5A23A 2OVFA 3QWWA 4KVOA 3VLDA 4KXKB 1H2UA 2HO1A 1FVHA 4U8HA 1H6KA 5FJYA 4GZ5A 1ELKA 5D0QD 2MRIA 2I2OA 2X38A 5C1DA 5G55A 3UQ3A 3HIZA 4FJZA 5BW8C 3MGBA 1HG2A 1PAQA 4GZ6A 4BSXA 4NRHB 1NZNA 5AENA 5LCWC 5FWQA 1YA0A 5JJ6A 2RG8A 2WXRA 5LFAA 3FTWA 1QQEA 2VSOE 2Y3AA 4XKBA 3EDTB 4Y6CA 3ZIMA 5AJLA 4HFGA 2IF4A 4RG6A 2CG3A 3APCA 3UT4A 4PS3A 5JHBA 3HHMA 4TV3A 1U3CA 2J09A 5DIZA 5FZSA 4JA9A 3CSTA 3SFZA 5CMWA 1MQSA 2RD0A 2J4BA 4XI0A 1Y6IA 3G2SA 4I6EA 1SZAA 4D10C 3D9OA 5JHAA 2WM9A 4UQZA 4URKA 3LVQE 3TXMA 4EECA 3MCXA 2MHKA 5FQ4A 3SBSA 2KATA 4YVOA 1EPUA 3MKQB 3RIBA 4WWOA 1L5JA 3FU0A 2GW1A 4FHKA 2LO6A 3U9WA 5M72A 1OUVA 3LYAA 4L2YA 4CDNA 4R7LA 3MX3A 3VTYA 4WNGA 4C0EA 2NSZA 2WXQA 4EZJA 2J08A 1EYHA 4NACA 2JLBA 4UQXA 2WXKA 4RG9A 1E8ZA 2KC7A 3MV2B 2E2EA 3CQGB 4BT8A 5KJNA 4GZCA 3BG0B 3QB2A 5DBKA 2WXPA 4RSYA 2YINA 2VSNA 3UX4A 1ELWA 2X6JA 4ILHB 5BUZA 4GA0A 3ZYLA 4KBQA 2XCBA 3HVEA 4I17A 3CK8A 4IN3B 4G24A 2XGSA 4EZLA 2AW6A 3KD7A 3MV3B 3ZYQA 2FULA 4GPKA 1JPLA 2XEVA 3FH5A 2VGXA 3FUHA 3ML9A 3L17A 1P5QA 3I3NA 2WB2A 1B89A 2XRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKU A;  3FWV A;  3PDN A;  4GYW A;  2QFC A;  3R9A B;  2KCV A;  4JL0 A;  2FF4 A;  2PZI A;  3LCA A;  4N5C A;  3ULQ A;  1HZ4 A;  2L6J A;  2VYI A;  2C2L A;  3TAX A;  3IEG A;  2Q7F A;  4GA1 A;  1KT0 A;  5HQ8 A;  4N3B A;  2UY1 B;  5BNW A;  3Q15 A;  4AM9 A;  3CKB A;  4YND A;  5BT1 A;  4CDR A;  3GYZ A;  2PQR A;  3LY8 A;  3Q5M A;  5A7D B;  4J8F A;  1ZU2 A;  4BTB A;  4APO A;  4WND A;  4W9R A;  4XI9 A;  3CVL A;  3QDN A;  4I9E A;  2KCL A;  1ZBP A;  3FP3 A;  4G2V A;  4YVQ C;  5EX0 A;  4N2Q A;  1TJC A;  3ASH A;  5KJL A;  4AIF A;  3S7J A;  3WXX A;  2YQ8 A;  2VGY A;  2XGO A;  4U0U A;  3RKV A;  4CGW A;  5JJ7 A;  5KJK A;  3URZ A;  3CVQ A;  3CVN A;  2HR2 A;  5A6C A;  5ARG A;  5FTP A;  2YHC A;  4J8E A;  5AYW D;  4GCN A;  5EX3 A;  5CHE E;  1NA0 A;  2AVP A;  3RU0 A;  3UUX A;  3RJV A;  3MA5 A;  4JA7 A;  3AS5 A;  1Y8M A;  3HYM B;  3OXL A;  3NF1 A;  2FEZ A;  2LSU A;  2LNI A;  2DBA A;  4N2S A;  4I2W A;  1IYG A;  1E96 B;  3ASD A;  4NQ0 A;  2IFU A;  1HXI A;  4LEU A;  4N3A A;  2HYZ A;  4N3C A;  3KS2 A;  2P58 C;  3U3W A;  2PQN A;  2BUG A;  3O48 A;  3OXF A;  4U0S A;  4HOR A;  1KT1 A;  4UQY A;  4J0U A;  1HH8 A;  3LY7 A;  3TG4 A;  4H7X A;  3ZN3 A;  3QWP A;  4UI9 J;  3OXG A;  3ZHE A;  3TGO A;  4G1T A;  4GZ3 A;  3S7F A;  1IHG A;  3CK7 A;  2WQH A;  3CV0 A;  3GZ1 A;  3U4T A;  2C0L A;  2Y4T A;  2VSY A;  3Q4A B;  4WNE A;  5KJM A;  5G05 C;  2UWJ G;  4ME2 A;  5FZQ A;  4U04 A;  4HOT A;  4A1S A;  5CCL A;  3S7B A;  4WNF A;  4N39 A;  5FZR A;  4J8D A;  3GZ2 A;  4G25 A;  3ESK A;  4G26 A;  1PC2 A;  3LY9 A;  4AY5 A;  5G04 J;  4KYO B;  2R5S A;  4WUY A;  4U0Z A;  3FFL A;  2WPV A;  2XPI A;  3Q49 B;  4XIF A;  3AS4 A;  3CEQ A;  3TG5 A;  3JYS A;  2OOE A;  3AS8 A;  4UI9 K;  3VTX A;  4UI9 C;  3QOU A;  4O6F A;  1KLX A;  3CKC A;  2V5F A;  3ZGQ A;  3ZPJ A;  3SZ7 A;  3UPV A;  2NC9 A;  5HI7 A;  3BEE A;  3PE4 A;  3ZFW A;  4I1A A;  1WM5 A;  2C0M A;  4AY6 A;  2LSV A;  4ABN A;  5G05 J;  4I2Z A;  1QZ2 A;  3CK9 A;  1XNF A;  2VGX B;  3K9I A;  4GA2 A;  3LPZ A;  4BT9 A;  2Y4U A;  3MEK A;  4H7Y A;  5JJT A;  2PL2 A;  3ASG A;  4F3V A;  3SF4 A;  3S7D A;  5G04 C;  1A17 A;  3E4B A;  2FBN A;  4GYY A;  1FCH A;  5LCW J;  4I9C A;  1NA3 A;  3ZHE B;  1W3B A;  1WAO 1;  2FI7 A;  4Y6W A;  4HOU A;  2XGM A;  4HOQ A;  4U07 A;  4BWR A;  3QWV A;  2UY1 A;  5D0O D;  4BTA A;  5CCM A;  3PE3 A;  2FO7 A;  3N71 A;  3QKY A;  4HOS A;  2XCC A;  3MKR A;  4GCO A;  4GYO A;  2OND A;  2VQ2 A;  4CGV A;  2I6H A;  3RO3 A;  5EKQ D;  2KCK A;  2J9Q A;  3RO2 A;  3ASF A;  4B94 A;  1ELR A;  3Q47 B;  4G23 A;  5ARF A;  3GW4 A;  3KAE A;  5FT9 A;  3CVP A;  4JHR A;  4EQF A;  3QWW A;  4KXK B;  2HO1 A;  5FJY A;  4GZ5 A;  5D0Q D;  5C1D A;  3UQ3 A;  5BW8 C;  4GZ6 A;  4NRH B;  1NZN A;  5LCW C;  1YA0 A;  5JJ6 A;  1QQE A;  3EDT B;  4Y6C A;  2IF4 A;  4RG6 A;  5FZS A;  5DIZ A;  4JA9 A;  4XI0 A;  4UQZ A;  2MHK A;  2KAT A;  4YVO A;  3RIB A;  2GW1 A;  5M72 A;  1OUV A;  3LYA A;  3VTY A;  4WNG A;  2JLB A;  4UQX A;  4RG9 A;  2KC7 A;  3MV2 B;  4BT8 A;  2E2E A;  5KJN A;  5DBK A;  2VSN A;  1ELW A;  4GA0 A;  4KBQ A;  2XCB A;  4I17 A;  3CK8 A;  4IN3 B;  4G24 A;  2XGS A;  3MV3 B;  3KD7 A;  4GPK A;  2XEV A;  2VGX A;  1P5Q A;  1B89 A; 
#chains in the Genus database with same CATH topology
 3UIO C;  4O1P A;  3R9A B;  2KCV A;  4NIK A;  2IU1 A;  4HQD A;  4JL0 A;  3TWV A;  4B93 B;  3L82 A;  3FU6 A;  2PZI A;  4N5C A;  3ABL E;  3ULQ A;  2F0Y A;  1HZ4 A;  3CGH A;  5E75 A;  2C2L A;  4UWG A;  3ULY A;  1BLX B;  2UY1 B;  5BNW A;  3SQV A;  2GRP B;  5CEA A;  4AM9 A;  3ZW3 A;  5BT1 A;  2PQR A;  3Q5M A;  2GRL A;  2ZGD A;  1SZ9 A;  3PH0 C;  4JEU A;  5AIJ A;  1MX6 A;  1ZU2 A;  1GW6 A;  3E33 A;  3E34 A;  5ENN A;  3AU5 A;  3BU8 A;  3T5V A;  1MHQ A;  3DST A;  1MX2 A;  4G2V A;  4YVQ C;  4N2Q A;  4FC8 A;  1TN6 A;  3S7J A;  3Q75 A;  1FT1 A;  3Q7A A;  5KJK A;  3URZ A;  4I1O B;  1N0Q A;  1TNY A;  3CVN A;  3BQO A;  3UMV A;  5ENQ D;  3FHE A;  3SD5 A;  3D9M A;  1TN7 A;  1S70 B;  4DLQ A;  4JHJ A;  4PDX A;  3PVL A;  1NA0 A;  3UUX A;  3RRN B;  2J49 A;  1KZO A;  3SY2 A;  3C3R A;  2R03 A;  2FEZ A;  1K1B A;  2VTB A;  4A3T A;  3ASD A;  2IFU A;  4OVV A;  2KM4 A;  4TXR A;  3MKQ A;  4LEU A;  3DXK G;  3LJ3 A;  3JUI A;  4N3C A;  4L7T A;  1TJF A;  2BUG A;  1K3Z D;  4U0S A;  3T8K A;  3RRM B;  2XEH A;  4UQY A;  4Q94 A;  4KZC A;  4LUN U;  3LY7 A;  4UI9 J;  3QJZ A;  1OWP A;  4N5Q A;  3HRA A;  3ZHE A;  2F37 A;  2AXU A;  3ABK E;  5T3R A;  5EIL A;  4GZ3 A;  3S7F A;  1IHG A;  2QYJ A;  1NL4 A;  3CK7 A;  4FP7 A;  5JA4 D;  4U96 D;  2CHZ A;  3FU5 A;  3Q73 A;  3IV0 A;  4V3I A;  3CV0 A;  3GZ1 A;  4GPM A;  2C0L A;  5T4Y A;  2LAI A;  5LP0 A;  3Q4A B;  3ZYM A;  4WNE A;  4XE0 A;  2NYJ A;  2R2L A;  4QQI A;  1H19 A;  5FZQ A;  2L0T B;  1RZ4 A;  1A5E A;  4WNF A;  3V2X A;  3GZ2 A;  4G25 A;  4G26 A;  4UUC A;  2DIW A;  4B8A A;  3NZU A;  4GMJ A;  4WUY A;  4EHM A;  2P9P G;  4Z68 A;  4OAV B;  3P1U A;  3CVY A;  3Q49 B;  3AS4 A;  4GZD A;  3JYS A;  4F1P A;  4OVU A;  3FUI A;  2EIK E;  1KLX A;  2LUH A;  3CKC A;  1YMP A;  1SW6 A;  3PNT B;  4BY6 A;  2VTB B;  3UPV A;  2NC9 A;  3CLJ A;  2R59 A;  1WM5 A;  3JXJ A;  4NUR A;  2LSV A;  5ENS D;  1OWM A;  3FTV A;  3TL5 A;  3T5X A;  2X6H A;  2EIN E;  1OCO E;  3JQ0 A;  1OCC E;  3K9I A;  4GA2 A;  3LXU X;  3TWT A;  3MEK A;  3C5R A;  4H7Y A;  5AAO A;  2WXF A;  3CIA A;  3D9J A;  3PEV B;  3E32 A;  3S7D A;  3E4B A;  4TUU A;  2P9K G;  2H6G A;  3JQ1 A;  5KCM A;  4M7C A;  3D3M A;  3T8M A;  3ZHE B;  2X6F A;  2L9B A;  2ZIS A;  3FUL A;  5ITZ F;  5ENT D;  4HI9 A;  1NP7 A;  1TEZ A;  1TNO A;  1KZP A;  3FUM A;  4CCA A;  2FI7 A;  4ATG A;  3SNX A;  4QFV A;  1OXJ A;  3NQP A;  2Y1L E;  1N4Q A;  1JUQ A;  1IHB A;  4K03 A;  4EZK A;  3L6A A;  1EF1 C;  3RAU A;  2XPZ A;  1U3D A;  3U66 A;  3Q9N C;  2OND A;  3RO3 A;  4HBD A;  2KCK A;  1BU9 A;  3ASF A;  2XZD G;  4CEM A;  1N4S A;  3J5Q B;  2IY0 C;  3GW4 A;  3CVP A;  4ZFH A;  3QWW A;  4YDE A;  2MRI A;  2PNN A;  3HIZ A;  4BSX A;  4YDO A;  4NRH B;  5LCW C;  5FWQ A;  2RG8 A;  3UM0 A;  3UM2 A;  4HFG A;  4F6R D;  3HHM A;  3CST A;  2DVW A;  1MQS A;  3G2S A;  5B3S E;  2GRN B;  1SZA A;  5JHA A;  4UQZ A;  3TXM A;  4EEC A;  5FQ4 A;  4GTP A;  1EPU A;  3AJI A;  4WWO A;  4FHK A;  2LO6 A;  3U9W A;  3LYA A;  4L2Y A;  2B6C A;  4CDN A;  2P9U G;  5CED B;  4LSZ E;  4O60 A;  4C0E A;  1SVX A;  4NAC A;  1E8Z A;  3MV2 B;  4BT8 A;  2E2E A;  3CQG B;  5KJN A;  2QZA A;  3TWU A;  3ZU7 B;  3BG0 B;  5DBK A;  5KWD A;  1BI8 B;  2YIN A;  4I17 A;  3HVE A;  4EZL A;  2XEV A;  3ML9 A;  3W9F A;  3LKU A;  4A3V A;  2GRQ B;  3FWV A;  2QFC A;  1H6P A;  1OCZ E;  3D9N A;  2FF4 A;  5EIB E;  4APF A;  3LCA A;  4FU3 A;  3SGH A;  1INZ A;  2L6J A;  5H7P A;  5B1B E;  4B89 A;  4UWF A;  2Y69 E;  5HQ8 A;  2RFA A;  5CER B;  3V79 K;  3JXI A;  3CKB A;  2IO3 C;  4GTS A;  4JB8 P;  1Z6T A;  4BTB A;  1UJJ A;  4APO A;  4XI9 A;  3QDN A;  3HXD A;  2J8S D;  3AG4 E;  3AG2 E;  4I1M A;  2GRM A;  3G2V A;  4U8Y D;  4I9E A;  1ZBP A;  5EID A;  3LS8 A;  2HM8 A;  3DWL G;  3ASH A;  3CVV A;  2A5E A;  4J7W A;  4U8V D;  4AIF A;  4HB5 A;  3WXX A;  3KSQ A;  3DPY A;  4CGW A;  3UKR G;  5CRV A;  2HR2 A;  3DEP A;  2V0P A;  4JEH A;  1Z3Y A;  5A6C A;  5ARG A;  1HE8 A;  2YHC A;  5AYW D;  4GCN A;  3CHM A;  3CQC B;  4LRZ A;  4AEZ C;  4JA7 A;  3HYM B;  3NF1 A;  3RRU A;  1K8K G;  3S2A A;  5ENP D;  4NQ0 A;  4C0M A;  1QNF A;  3KEZ A;  3IXE A;  2I1J A;  3JCK C;  2HYZ A;  4IUL A;  2IO2 C;  1E7U A;  2PQN A;  4E85 A;  5AQB A;  4Q69 A;  2ETA A;  3B7T A;  2MYO A;  3G2T A;  3FUN A;  4GTT A;  4MS6 A;  3FEY A;  1UN9 A;  2P9I G;  3PZ2 A;  1HFA A;  3OTN A;  3DSW A;  4ANW A;  3TG4 A;  2AJA A;  3TGO A;  1N52 A;  5CBN A;  4E6H A;  2EIM E;  4G1T A;  3RK6 A;  3IHY A;  4DX1 A;  4KVM A;  1YCS B;  4GTM A;  2IJG X;  2WXH A;  1EDU A;  4ANV A;  3D9P A;  2V5Q C;  2LXM A;  1UG3 A;  1S0P A;  2RFM A;  2L6B A;  2X6I A;  3ONK A;  3TJP A;  2DWZ A;  2VSY A;  1HU3 A;  2LAH A;  3CHQ A;  4ACL A;  2IOL A;  4JVS A;  2UWJ G;  3UI2 A;  3ZXP A;  3Q78 A;  4A1S A;  1IQU A;  3S7B A;  2P9S G;  2X3M A;  2WXM A;  4CT0 A;  3DEO A;  5EDS A;  3FEX A;  3F6Q A;  3FTZ A;  4F53 A;  3APF A;  4JC8 A;  4KYO B;  2X6K A;  3I4R B;  2WPV A;  4O1O A;  3FUJ A;  4YDY A;  5EYL A;  3PZ1 A;  4UI9 K;  2PM6 A;  4FLH A;  2JEK A;  5ANR A;  2ZIR A;  2YNQ A;  2ETC A;  4EPZ A;  4EBA G;  4G8K A;  3PZD A;  2I1K A;  2WXN A;  3BEE A;  3EHR A;  4ABN A;  3IKO B;  5G05 J;  4I2Z A;  1QZ2 A;  2KBX A;  4DX7 D;  3R7Q A;  2WXG A;  4J6I A;  1E90 A;  1UJK A;  4JW1 A;  1OT8 A;  2QY7 A;  1JWG A;  5JJT A;  5C2Y A;  2PL2 A;  4DPR A;  1N95 A;  3X2Q E;  2VSX E;  3FUK A;  2B0O E;  4KT6 B;  3V30 A;  4TXP A;  1O1T A;  5G04 C;  2NXP A;  3ZYK A;  1A17 A;  3UT8 A;  3NBN B;  5HS0 A;  3FTX A;  5LCW J;  4A55 A;  2VGE A;  4DUI A;  2IQC A;  1OWL A;  1WAO 1;  4G8L A;  4K5C A;  2P9L G;  1S64 A;  1FVF A;  4BX9 A;  5J90 A;  4Y6W A;  1NI1 A;  2VJ8 A;  1Q2Z A;  3CR3 A;  1N11 A;  3PNL B;  4U07 A;  4L23 A;  1N0R A;  3FUF A;  5JMN D;  3VLF A;  3QWV A;  5D0O D;  4B8C B;  3G2W A;  2YHE A;  4ILG A;  2XEN A;  5CCM A;  3FTU A;  1MX4 A;  3QKY A;  4HOS A;  3L13 A;  3MKR A;  3ZEF A;  4GYO A;  4FA6 A;  3CVU A;  3Q79 A;  4UWL A;  4I43 A;  3Q7F A;  3EU9 A;  3NZS A;  4LER A;  1U2V G;  1O1R A;  3ABM E;  5ARF A;  4ANU A;  5FT9 A;  4LCT A;  3FTS A;  5AQ7 A;  4EQF A;  3ZUV B;  2HO1 A;  1H6K A;  5FJY A;  4GZ5 A;  1ELK A;  2X38 A;  5C1D A;  5G55 A;  4FJZ A;  5BW8 C;  3MGB A;  5AEN A;  4GTO A;  5JJ6 A;  4BSZ B;  3AG1 E;  2V4H C;  4L9P A;  1QQE A;  2Y3A A;  5AJL A;  2CG3 A;  1D8E A;  3C3O A;  5JHB A;  4TV3 A;  2QC9 A;  5DIZ A;  3KSL A;  4JA9 A;  2H6F A;  4BET A;  4D10 C;  1X81 A;  2WM9 A;  4URK A;  4K5A B;  3MKQ B;  2EIJ E;  4R7L A;  2J08 A;  4MBG A;  4LNB A;  4RSY A;  3UX4 A;  4ILH B;  4GA0 A;  4KBQ A;  2XCB A;  1N4P A;  4IN3 B;  3C3Q A;  2AW6 A;  3KD7 A;  3ZYQ A;  2FUL A;  3FH5 A;  3HXE A;  2VGX A;  4GB9 A;  2CHW A;  3UM3 A;  3PDN A;  5FQ7 A;  4U63 A;  1H2T C;  3LEW A;  3ISM C;  1H6O A;  2WXO A;  2VYI A;  3FH7 A;  5CBO A;  3UTM A;  2XHE A;  5KNG A;  1KT0 A;  1O5M A;  3EHQ A;  3ASN E;  4N3B A;  3FY4 A;  4MKT A;  3B7S A;  1BD8 A;  1QBQ A;  3LDZ A;  2R02 A;  3HDX A;  2KXP C;  3TXN A;  4J8F A;  3ONL A;  3SBT B;  4WND A;  4W9R A;  1HO8 A;  3CVL A;  4DJA A;  3HXF A;  2XRZ A;  2WVI A;  4MRU A;  4I6J A;  2OV8 A;  2V4L A;  1KPS B;  5HRY A;  2KCL A;  5EX0 A;  1TJC A;  3DSX A;  4KMO A;  2RKK A;  4X8Q A;  3ZRH A;  2YQ8 A;  1BPO A;  3ULE G;  3RKV A;  5JJ7 A;  2J07 A;  3CVQ A;  4FUL A;  5FIO A;  5AJD A;  4JXT A;  5FTP A;  1D9S A;  3ZXS A;  3UT7 A;  4XKC A;  3HXC A;  4J8E A;  3NOC D;  5CHE E;  2CG2 A;  2XQ0 A;  3RU0 A;  4UWH A;  5T8I A;  3FTY A;  1Y8M A;  3OXL A;  3SO8 A;  4AXH A;  4DK5 A;  2LSU A;  2DBA A;  3FDH A;  4N2S A;  5CMY A;  4FAD A;  2IOS A;  3L08 A;  5EYP F;  3TWW A;  1TR4 A;  3EHN A;  4CYM D;  3KS2 A;  1SQM A;  4BES A;  2P58 C;  2AXZ A;  3O48 A;  3OXF A;  4RLY A;  3ZKJ A;  3V31 A;  1KT1 A;  3TWS A;  1X5B A;  1HX8 A;  4BX8 A;  2ZU6 B;  2E0I A;  5BV0 A;  2DYS E;  1HH8 A;  3OAW A;  3ZN3 A;  2F8X K;  3OXG A;  4F7A A;  5FIN A;  1UN8 A;  2DCP A;  3DBS A;  4DI3 A;  3L9T A;  1RW2 A;  4AJW A;  4ACK A;  4HVB A;  3U64 A;  1TNB A;  2DZO A;  3QC1 A;  1NFI E;  5ANL A;  2DZN A;  3RSE G;  5FQ6 A;  3SI5 A;  2OCC E;  4GTQ A;  2ZXW E;  5G2N A;  3CVW A;  1SA5 A;  5CRU A;  4P29 A;  5KJM A;  4JZY A;  4ME2 A;  3FH8 A;  3PZ4 A;  4N39 A;  5FZR A;  4J8D A;  4HI8 A;  4CZ2 D;  1UW4 B;  5G04 J;  3UIN C;  3TWX A;  2R5S A;  1DCE A;  4U0Z A;  4BEP A;  1N4R A;  4HRL A;  2XPI A;  2DYR E;  3EIQ C;  4EBA A;  2A4Z A;  3CEQ A;  3AS8 A;  5AQ9 A;  3L22 A;  3VTX A;  3QOU A;  5BXU A;  4PUC A;  3D9L A;  4FJY A;  3PZ3 A;  3ZGQ A;  3ZPJ A;  3JUE A;  5HI7 A;  4K0R A;  3ZFW A;  5LX8 A;  2AXV A;  2C0M A;  4XX5 A;  3HVE B;  3CK9 A;  4AP2 A;  1G3N B;  1K1A A;  1LTX A;  1XNF A;  4DI4 A;  4TUM A;  1OWO A;  4YDW A;  3MJW A;  2Y4U A;  3CHP A;  2LXL A;  5BXO A;  4B0Z A;  4RVB A;  3T9K A;  3IBE A;  4F3V A;  3AU4 A;  3DXM G;  3SF4 A;  1OWN A;  3HXB A;  1YYH A;  1FCH A;  4I9C A;  2OEW A;  1W3B A;  4HLE A;  1DCQ A;  2OVB A;  5IY5 E;  3D9I A;  4GMR A;  1VDY A;  3EU5 A;  3UM1 A;  4IYP A;  3DSU A;  5AN8 A;  3FUD A;  2ION A;  4IRU A;  3SHF A;  3MYV A;  3I4G A;  4FHJ A;  1JCS A;  1BI7 B;  2WXI A;  4M3O A;  4HXI A;  2VQ2 A;  3L54 A;  3P2B A;  1TNU A;  4HRN A;  5EKQ D;  2WQ6 A;  3DPD A;  2J9Q A;  4AV7 A;  4KZ0 A;  4DX5 D;  4TRQ A;  4PH4 B;  4B94 A;  3IHV A;  3VLE A;  3Q47 B;  4G23 A;  2EQX A;  3KAE A;  2V8S E;  4JHR A;  2OVF A;  3WG7 E;  3HG0 D;  5D0Q D;  5ENR D;  2I2O A;  3UQ3 A;  1PAQ A;  4GZ6 A;  1NZN A;  1AP7 A;  1AWC B;  2WXR A;  5LFA A;  3FTW A;  2VSO E;  1WG0 A;  3EDT B;  4Y6C A;  3ZIM A;  4RG6 A;  3APC A;  5KNH D;  4GTR A;  4PS3 A;  1U3C A;  2J09 A;  2RD0 A;  1UOH A;  4XI0 A;  1Y6I A;  4HRM B;  3D9O A;  3LVQ E;  2KAT A;  4YVO A;  3RIB A;  1L5J A;  2GW1 A;  5M72 A;  3ASO E;  3VTY A;  4WNG A;  1EYH A;  4K5B A;  2WXK A;  2KC7 A;  2H6I A;  4DRX E;  4GZC A;  2WXP A;  2OEV A;  5AQA A;  1D8D A;  2X6J A;  5BUZ A;  3ZYL A;  3NB2 A;  1OY3 D;  4G24 A;  4GPK A;  3C72 A;  3NAW A;  4GYW A;  3UXG A;  4RQI A;  3UIP C;  4ZHB A;  3B7U X;  1DNP A;  2A5U A;  1Z3X A;  2L0I A;  3E30 A;  4WWP A;  4TXQ A;  3DRA A;  3TAX A;  3IEG A;  3ENE A;  1QYM A;  2Q7F A;  4PS7 A;  4GA1 A;  3TWR A;  1IKN D;  2XS8 A;  3Q15 A;  3AAA C;  3BUA A;  4L1B A;  2WMO A;  1XGW A;  4WWN A;  4YND A;  4CDR A;  3GYZ A;  2J4D A;  3LY8 A;  3EJN A;  4HS2 A;  5A7D B;  3PS6 A;  2WMN A;  3SFY A;  2HE0 A;  3MZL B;  4CRW A;  3NOG D;  5BPP A;  1E8Y A;  4ATZ D;  1WDY A;  2ILR A;  3FP3 A;  3QAQ A;  1S63 A;  5KJL A;  2CFZ A;  5J08 A;  2VGY A;  2XGO A;  4U0U A;  4J8S A;  3ZNG A;  3DSS A;  4CDM A;  1V54 E;  3EHM A;  1TNZ A;  5E76 A;  4OAU C;  3ZVV A;  5EX3 A;  2GGF A;  3QK0 A;  2AVP A;  4GML A;  3RJV A;  4DX2 A;  4HNA D;  3MA5 A;  2M63 A;  3O4Z A;  3AS5 A;  3APD A;  2LNI A;  1LD8 A;  3SFX A;  3C98 A;  4I2W A;  3B13 A;  1IYG A;  1E96 B;  1HXI A;  3DSV A;  3LVR E;  1N54 A;  3R7R A;  2BKG A;  2MOW A;  4GTV A;  4N3A A;  3U3W A;  2ETB A;  2FO1 E;  1H0A A;  4HOR A;  1E8W A;  2BED A;  3W9G A;  1HG5 A;  4GAA A;  5ENO D;  1TYQ G;  5D66 A;  5EN5 D;  3R9M A;  4J0U A;  2R05 A;  4L2L A;  4H7X A;  4C9B B;  1WY6 A;  3QWP A;  5FQ8 A;  2KZT A;  3Q9U C;  2BF0 X;  1DVP A;  1H2V C;  2WQH A;  2P2C P;  1MZC A;  1Z5S C;  2AWI A;  4DLO A;  3PRE A;  1MJ0 A;  3ESL A;  1MYO A;  3B7B A;  2CFU A;  4AOF A;  3U4T A;  2Y4T A;  3PEU B;  1TN8 A;  5G05 C;  3ML8 A;  2Y0B G;  3B7R L;  3G2U A;  3QAR A;  4U04 A;  4MLP A;  4HOT A;  5CCL A;  3AG3 E;  4J8Y A;  3ESK A;  1PC2 A;  3LY9 A;  4XZ4 A;  4AY5 A;  3PUK A;  2WQ7 A;  4JHK A;  1OCR E;  3FFL A;  4OYS A;  4XIF A;  4AVX A;  3TG5 A;  3BG1 B;  4FLB A;  2OOE A;  2JAB A;  3PUJ A;  1HF8 A;  4UI9 C;  2PM7 A;  4O6F A;  4UWK A;  2V5F A;  4ILI A;  1IXV A;  2WXJ A;  3SZ7 A;  4Q96 A;  4BER A;  2WXL A;  3TWQ A;  2XZT G;  2CHX A;  3PE4 A;  2P9N G;  1N9A A;  4I1A A;  2H6H A;  4AY6 A;  2BTD A;  5AAR A;  4XEI G;  1SA4 A;  2F8Y A;  3CHO A;  2VGX B;  1ZB1 A;  4LNG A;  1LF8 A;  4A1G A;  3LPZ A;  1PY1 A;  4BT9 A;  1IQR A;  2GRR B;  2BKK B;  2XEE A;  3FUE A;  4F1S A;  3ASG A;  3E37 A;  4G11 A;  5D2M C;  4JPS A;  1V55 E;  3KEA A;  5HKP A;  2FBN A;  3GZS A;  4GYY A;  5BV1 A;  1NA3 A;  2KZT B;  3D9K A;  1LD7 A;  2I9C A;  1E8X A;  4C48 B;  3CSF A;  3QNK A;  3V2O A;  3L16 A;  1HS6 A;  1JCR A;  4HOU A;  3CHR A;  2XGM A;  4HOQ A;  4BWR A;  5LOZ A;  3FU3 A;  2ZGG A;  1N94 A;  4I6G A;  1DC2 A;  2UY1 A;  4JD2 G;  3CHS A;  3EUV A;  4BTA A;  2XPY A;  3PRZ A;  3PE3 A;  2FO7 A;  3N71 A;  5B1A E;  4WAF A;  2XCC A;  4ANX A;  4GCO A;  1JWF A;  4CGV A;  2I6H A;  2IEJ A;  3CVX A;  1FPP A;  2R17 C;  3D9H A;  4CT4 A;  3RO2 A;  4A63 B;  4BFR A;  4PS8 A;  3UKU G;  1ELR A;  4GU5 A;  1JCQ A;  1E7V A;  3EIJ A;  4DX6 D;  3I5P A;  5A23 A;  3VLD A;  4KVO A;  4KXK B;  1H2U A;  4U8H A;  1FVH A;  1HG2 A;  1YA0 A;  4XKB A;  3LJN A;  4LG6 A;  2IF4 A;  5CEC B;  3UT4 A;  2EIL E;  5FZS A;  3SFZ A;  5CMW A;  2J4B A;  4I6E A;  1FT2 A;  2XS1 A;  2QYU A;  2GRO B;  3J5P A;  3MCX A;  2MHK A;  3SBS A;  4U95 D;  1O1S A;  3FU0 A;  1OUV A;  5KBA A;  3MX3 A;  4EZJ A;  2NSZ A;  2WXQ A;  2JLB A;  4UQX A;  4RG9 A;  4U7E B;  3QB2 A;  4LNU D;  2VSN A;  1ELW A;  4HLL A;  3CK8 A;  2XGS A;  3B95 A;  3MV3 B;  1JPL A;  3FUH A;  3L17 A;  1P5Q A;  3I3N A;  2WB2 A;  1B89 A;  2XRY A; 
#chains in the Genus database with same CATH homology
 3LKU A;  4GB9 A;  2CHW A;  4A3V A;  3FWV A;  3PDN A;  4GYW A;  2QFC A;  3R9A B;  2KCV A;  2IU1 A;  3D9N A;  4JL0 A;  5FQ7 A;  2FF4 A;  4U63 A;  1H2T C;  3B7U X;  3FU6 A;  1DNP A;  2PZI A;  4APF A;  3LCA A;  3LEW A;  4FU3 A;  4N5C A;  2A5U A;  3ULQ A;  1Z3X A;  2L0I A;  4WWP A;  3SGH A;  1HZ4 A;  3CGH A;  1INZ A;  2L6J A;  2WXO A;  2VYI A;  5E75 A;  2C2L A;  3FH7 A;  3TAX A;  3IEG A;  3ENE A;  4PS7 A;  2Q7F A;  4B89 A;  2XHE A;  4GA1 A;  4UWF A;  4UWG A;  1KT0 A;  5HQ8 A;  4N3B A;  3FY4 A;  2UY1 B;  5BNW A;  3Q15 A;  4L1B A;  4MKT A;  2WMO A;  4AM9 A;  3B7S A;  3CKB A;  3ZW3 A;  1XGW A;  4WWN A;  4YND A;  3LDZ A;  5BT1 A;  4CDR A;  3GYZ A;  2J4D A;  3HDX A;  3TXN A;  2PQR A;  3LY8 A;  3EJN A;  3Q5M A;  2GRL A;  1SZ9 A;  3PH0 C;  3PS6 A;  4HS2 A;  5A7D B;  2WMN A;  4JEU A;  4J8F A;  5AIJ A;  1Z6T A;  1ZU2 A;  3MZL B;  3ONL A;  4BTB A;  4CRW A;  1UJJ A;  4APO A;  3SBT B;  4WND A;  4W9R A;  1HO8 A;  1GW6 A;  4XI9 A;  5BPP A;  3CVL A;  4DJA A;  3QDN A;  2XRZ A;  2WVI A;  1E8Y A;  5ENN A;  3AU5 A;  4MRU A;  4I6J A;  3T5V A;  2OV8 A;  2V4L A;  1MHQ A;  4I1M A;  2GRM A;  3G2V A;  3CVU A;  4I9E A;  2KCL A;  1ZBP A;  2ILR A;  3FP3 A;  3LS8 A;  4G2V A;  3QAQ A;  4YVQ C;  1TJC A;  5EX0 A;  2HM8 A;  4N2Q A;  4KMO A;  3ASH A;  5KJL A;  4FC8 A;  3CVV A;  2CFZ A;  3ZRH A;  4AIF A;  3S7J A;  3WXX A;  2YQ8 A;  5J08 A;  2VGY A;  2XGO A;  1BPO A;  4U0U A;  3RKV A;  4J8S A;  4CGW A;  2J07 A;  5JJ7 A;  5KJK A;  3URZ A;  3CVQ A;  4I1O B;  3CVN A;  2HR2 A;  3UMV A;  4FUL A;  4CDM A;  3FHE A;  2V0P A;  4JEH A;  3SD5 A;  1Z3Y A;  5A6C A;  5AJD A;  4JXT A;  3EHM A;  5ARG A;  5FTP A;  3D9M A;  3ZXS A;  1HE8 A;  3UT7 A;  4XKC A;  2YHC A;  4DLQ A;  5E76 A;  4J8E A;  5AYW D;  4GCN A;  4JHJ A;  4PDX A;  3PVL A;  5CHE E;  2CG2 A;  2GGF A;  5EX3 A;  3ZVV A;  3CHM A;  3QK0 A;  1NA0 A;  3CQC B;  2AVP A;  2XQ0 A;  3RU0 A;  4GML A;  4UWH A;  3UUX A;  3RJV A;  5T8I A;  3RRN B;  2J49 A;  4LRZ A;  3MA5 A;  2M63 A;  3FTY A;  3O4Z A;  4AEZ C;  4JA7 A;  3AS5 A;  1Y8M A;  3HYM B;  3OXL A;  3NF1 A;  2FEZ A;  4AXH A;  4DK5 A;  3RRU A;  2LSU A;  3APD A;  3S2A A;  2VTB A;  2LNI A;  2DBA A;  3FDH A;  4N2S A;  3C98 A;  4A3T A;  4I2W A;  5CMY A;  4FAD A;  3B13 A;  1IYG A;  1E96 B;  3ASD A;  4NQ0 A;  2IFU A;  4C0M A;  1HXI A;  2IOS A;  2KM4 A;  4OVV A;  3LVR E;  1N54 A;  3L08 A;  3MKQ A;  3R7R A;  2MOW A;  1QNF A;  3KEZ A;  4LEU A;  2I1J A;  3JCK C;  4N3A A;  2HYZ A;  3EHN A;  3LJ3 A;  3JUI A;  4N3C A;  4L7T A;  4IUL A;  3KS2 A;  1SQM A;  1TJF A;  1E7U A;  2P58 C;  3U3W A;  2PQN A;  2BUG A;  4E85 A;  2AXZ A;  3O48 A;  3OXF A;  4Q69 A;  4U0S A;  1H0A A;  4HOR A;  1KT1 A;  1E8W A;  1X5B A;  3RRM B;  1HG5 A;  1HX8 A;  3B7T A;  4GAA A;  4BX8 A;  3G2T A;  3FUN A;  2ZU6 B;  2E0I A;  5BV0 A;  4UQY A;  4Q94 A;  4MS6 A;  3FEY A;  1UN9 A;  4J0U A;  1HFA A;  4KZC A;  1HH8 A;  4L2L A;  3OTN A;  3OAW A;  3LY7 A;  4LUN U;  4ANW A;  3TG4 A;  4H7X A;  3ZN3 A;  4C9B B;  1WY6 A;  3QWP A;  3QJZ A;  4UI9 J;  5FQ8 A;  1OWP A;  2KZT A;  3OXG A;  3ZHE A;  3TGO A;  1N52 A;  2BF0 X;  4E6H A;  4F7A A;  4G1T A;  2AXU A;  1DVP A;  1UN8 A;  5T3R A;  2DCP A;  4GZ3 A;  3RK6 A;  3S7F A;  3DBS A;  1IHG A;  3IHY A;  1H2V C;  3CK7 A;  4FP7 A;  4DI3 A;  2WQH A;  4KVM A;  2CHZ A;  3FU5 A;  4AJW A;  3IV0 A;  2IJG X;  2WXH A;  1EDU A;  4ACK A;  3D9P A;  4V3I A;  4ANV A;  4HVB A;  3U64 A;  3CV0 A;  2AWI A;  1UG3 A;  4DLO A;  3PRE A;  3GZ1 A;  3QC1 A;  1S0P A;  3ESL A;  5ANL A;  5FQ6 A;  3SI5 A;  2CFU A;  4AOF A;  3U4T A;  2X6I A;  2C0L A;  5T4Y A;  3ONK A;  2Y4T A;  3TJP A;  2VSY A;  1HU3 A;  2LAH A;  2LAI A;  3CHQ A;  4ACL A;  5LP0 A;  5G2N A;  3Q4A B;  3PEU B;  3ZYM A;  4WNE A;  3CVW A;  2IOL A;  4XE0 A;  4JVS A;  4P29 A;  5G05 C;  5KJM A;  2UWJ G;  1H19 A;  3ML8 A;  4JZY A;  3B7R L;  4ME2 A;  5FZQ A;  2L0T B;  3G2U A;  3QAR A;  4U04 A;  4MLP A;  4HOT A;  4A1S A;  3FH8 A;  1IQU A;  3S7B A;  5CCL A;  4WNF A;  2X3M A;  4N39 A;  2WXM A;  5FZR A;  4J8D A;  3GZ2 A;  4CT0 A;  4G25 A;  5EDS A;  3ESK A;  4G26 A;  1PC2 A;  3FEX A;  3FTZ A;  3LY9 A;  4XZ4 A;  4F53 A;  2DIW A;  4AY5 A;  3PUK A;  1UW4 B;  4B8A A;  3NZU A;  5G04 J;  4JHK A;  2WQ7 A;  3APF A;  4JC8 A;  4GMJ A;  4KYO B;  2R5S A;  4WUY A;  4U0Z A;  3FFL A;  2X6K A;  3I4R B;  2WPV A;  2XPI A;  3P1U A;  4OYS A;  3CVY A;  3FUJ A;  3EIQ C;  3Q49 B;  4XIF A;  4AVX A;  4EBA A;  2A4Z A;  3AS4 A;  4GZD A;  3CEQ A;  3TG5 A;  3BG1 B;  3JYS A;  2OOE A;  3AS8 A;  4FLB A;  4UI9 K;  3PUJ A;  2PM6 A;  3L22 A;  1HF8 A;  4FLH A;  3VTX A;  2JEK A;  4UI9 C;  5ANR A;  2PM7 A;  3QOU A;  4OVU A;  4O6F A;  3FUI A;  4UWK A;  1KLX A;  2YNQ A;  4PUC A;  3D9L A;  3CKC A;  4FJY A;  4EPZ A;  2V5F A;  4EBA G;  4ILI A;  3ZGQ A;  3ZPJ A;  2WXJ A;  3SZ7 A;  3PNT B;  3PZD A;  4Q96 A;  4BY6 A;  2WXL A;  2VTB B;  2I1K A;  3UPV A;  2NC9 A;  3CLJ A;  2R59 A;  5HI7 A;  2CHX A;  2WXN A;  3BEE A;  3PE4 A;  4K0R A;  3ZFW A;  5LX8 A;  2AXV A;  4I1A A;  1WM5 A;  4NUR A;  2C0M A;  4AY6 A;  2LSV A;  4ABN A;  3IKO B;  2BTD A;  4I2Z A;  5G05 J;  1OWM A;  4XX5 A;  1QZ2 A;  3HVE B;  3FTV A;  3R7Q A;  3CK9 A;  3TL5 A;  4AP2 A;  3T5X A;  2X6H A;  3CHO A;  1XNF A;  2VGX B;  2WXG A;  3JQ0 A;  1LF8 A;  4DI4 A;  3K9I A;  4A1G A;  4GA2 A;  4J6I A;  1OWO A;  1E90 A;  3LXU X;  3LPZ A;  1PY1 A;  1UJK A;  1IQR A;  4BT9 A;  3MJW A;  2Y4U A;  4JW1 A;  3CHP A;  3MEK A;  4H7Y A;  2WXF A;  2QY7 A;  3FUE A;  1JWG A;  4B0Z A;  4RVB A;  5JJT A;  5C2Y A;  3CIA A;  4F1S A;  3D9J A;  2PL2 A;  4DPR A;  3PEV B;  3ASG A;  2VSX E;  3IBE A;  3FUK A;  4G11 A;  4F3V A;  4JPS A;  3AU4 A;  4KT6 B;  3SF4 A;  1OWN A;  3S7D A;  5G04 C;  2NXP A;  3ZYK A;  1A17 A;  3E4B A;  4TUU A;  3UT8 A;  3JQ1 A;  2FBN A;  3GZS A;  4GYY A;  1FCH A;  3FTX A;  5KCM A;  5BV1 A;  3D3M A;  4I9C A;  3T8M A;  4A55 A;  1NA3 A;  2KZT B;  5LCW J;  3ZHE B;  2IQC A;  2X6F A;  3D9K A;  1OWL A;  1W3B A;  4HLE A;  1WAO 1;  2L9B A;  2I9C A;  1E8X A;  3FUL A;  1NP7 A;  3CSF A;  3QNK A;  1FVF A;  4BX9 A;  2OVB A;  5J90 A;  1TEZ A;  3FUM A;  3L16 A;  3D9I A;  4CCA A;  2FI7 A;  4Y6W A;  2VJ8 A;  1HS6 A;  4ATG A;  3CR3 A;  3SNX A;  4HOU A;  4QFV A;  3PNL B;  3NQP A;  1VDY A;  3CHR A;  1JUQ A;  2XGM A;  4HOQ A;  4L23 A;  4U07 A;  4IYP A;  4BWR A;  5LOZ A;  3FU3 A;  3FUF A;  3FUD A;  4K03 A;  3VLF A;  2ION A;  3QWV A;  4IRU A;  4I6G A;  4EZK A;  3SHF A;  3L6A A;  3MYV A;  2UY1 A;  5D0O D;  4B8C B;  3G2W A;  2YHE A;  3CHS A;  1EF1 C;  3I4G A;  4ILG A;  4FHJ A;  2WXI A;  4BTA A;  2XPY A;  3FTU A;  2XPZ A;  3PE3 A;  3PRZ A;  2FO7 A;  3N71 A;  4M3O A;  5CCM A;  1U3D A;  4WAF A;  3QKY A;  4HXI A;  3U66 A;  3L13 A;  4HOS A;  2XCC A;  4ANX A;  3MKR A;  4GCO A;  3ZEF A;  4GYO A;  2OND A;  1JWF A;  2VQ2 A;  2I6H A;  3L54 A;  3P2B A;  3RO3 A;  5EKQ D;  4FA6 A;  4CGV A;  4UWL A;  2WQ6 A;  3CVX A;  2KCK A;  4I43 A;  2R17 C;  3DPD A;  4CT4 A;  2J9Q A;  4AV7 A;  3RO2 A;  4KZ0 A;  3ASF A;  4BFR A;  4PS8 A;  4TRQ A;  4PH4 B;  3NZS A;  4B94 A;  4CEM A;  4LER A;  3IHV A;  3VLE A;  1ELR A;  3Q47 B;  4G23 A;  4GU5 A;  1E7V A;  5ARF A;  3GW4 A;  2EQX A;  3KAE A;  4LCT A;  3FTS A;  5FT9 A;  3CVP A;  2V8S E;  4JHR A;  3EIJ A;  4ANU A;  4EQF A;  3I5P A;  5A23 A;  2OVF A;  3QWW A;  4KVO A;  3VLD A;  4KXK B;  1H2U A;  2HO1 A;  1FVH A;  4U8H A;  1H6K A;  5FJY A;  4GZ5 A;  1ELK A;  5D0Q D;  2MRI A;  2I2O A;  2X38 A;  5C1D A;  5G55 A;  3UQ3 A;  3HIZ A;  4FJZ A;  5BW8 C;  3MGB A;  1HG2 A;  1PAQ A;  4GZ6 A;  4BSX A;  4NRH B;  1NZN A;  5AEN A;  5LCW C;  5FWQ A;  1YA0 A;  5JJ6 A;  2RG8 A;  2WXR A;  5LFA A;  3FTW A;  1QQE A;  2VSO E;  2Y3A A;  4XKB A;  3EDT B;  4Y6C A;  3ZIM A;  5AJL A;  4HFG A;  2IF4 A;  4RG6 A;  2CG3 A;  3APC A;  3UT4 A;  4PS3 A;  5JHB A;  3HHM A;  4TV3 A;  1U3C A;  2J09 A;  5DIZ A;  5FZS A;  4JA9 A;  3CST A;  3SFZ A;  5CMW A;  1MQS A;  2RD0 A;  2J4B A;  4XI0 A;  1Y6I A;  3G2S A;  4I6E A;  1SZA A;  4D10 C;  3D9O A;  5JHA A;  2WM9 A;  4UQZ A;  4URK A;  3LVQ E;  3TXM A;  4EEC A;  3MCX A;  2MHK A;  5FQ4 A;  3SBS A;  2KAT A;  4YVO A;  1EPU A;  3MKQ B;  3RIB A;  4WWO A;  1L5J A;  3FU0 A;  2GW1 A;  4FHK A;  2LO6 A;  3U9W A;  5M72 A;  1OUV A;  3LYA A;  4L2Y A;  4CDN A;  4R7L A;  3MX3 A;  3VTY A;  4WNG A;  4C0E A;  2NSZ A;  2WXQ A;  4EZJ A;  2J08 A;  1EYH A;  4NAC A;  2JLB A;  4UQX A;  2WXK A;  4RG9 A;  1E8Z A;  2KC7 A;  3MV2 B;  2E2E A;  3CQG B;  4BT8 A;  5KJN A;  4GZC A;  3BG0 B;  3QB2 A;  5DBK A;  2WXP A;  4RSY A;  2YIN A;  2VSN A;  3UX4 A;  1ELW A;  2X6J A;  4ILH B;  5BUZ A;  4GA0 A;  3ZYL A;  4KBQ A;  2XCB A;  3HVE A;  4I17 A;  3CK8 A;  4IN3 B;  4G24 A;  2XGS A;  4EZL A;  2AW6 A;  3KD7 A;  3MV3 B;  3ZYQ A;  2FUL A;  4GPK A;  1JPL A;  2XEV A;  3FH5 A;  2VGX A;  3FUH A;  3ML9 A;  3L17 A;  1P5Q A;  3I3N A;  2WB2 A;  1B89 A;  2XRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...