3RKVA

C-terminal domain of protein c56c10.10, a putative peptidylprolyl isomerase, from caenorhabditis elegans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
147
structure length
147
Chain Sequence
LKSVEALRQKGNELFVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKADSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords putative peptidylprolyl isomerase
publication title C-terminal domain of protein C56C10.10, a putative peptidylprolyl isomerase, from Caenorhabditis elegans
rcsb
source organism Caenorhabditis elegans
total genus 63
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rkvA00
3NF1A 4WNEA 4CGVA 4XIFA 3CVQA 5AYWD 2LNIA 3RJVA 2C0MA 3LKUA 3LCAA 2Q7FA 3QOUA 5BT1A 2XEVA 5HQ8A 3Q47B 3FWVA 5EX0A 2HR2A 2HO1A 2YQ8A 4A1SA 1IHGA 3S7DA 3ZFWA 3WXXA 4UQXA 2C2LA 2GW1A 2QFCA 3CVLA 3RO3A 5G04C 1OUVA 4GYWA 5KJLA 5JJ7A 2VSNA 4GA1A 4GA2A 4GZ3A 4YNDA 5BW8C 4GZ6A 2WQHA 3KAEA 5CCLA 4GYOA 3ULQA 4G25A 4AIFA 3KD7A 3TAXA 2P58C 4YVOA 5DIZA 2LSVA 4N3AA 4UQZA 2VSYA 3PDNA 4U0SA 3RKVA 4AY6A 3ZHEB 4XI9A 4HOSA 2UY1B 4IN3B 3LY7A 4UI9K 3N71A 2Y4UA 5A7DB 4N3BA 2VGXB 1XNFA 2FI7A 2LSUA 4RG6A 4U0UA 4J0UA 3ESKA 2XGSA 4GYYA 5FJYA 1HZ4A 4XI0A 2DBAA 4W9RA 2J9QA 4I9CA 4G2VA 4CGWA 1PC2A 5CHEE 5G04J 3TGOA 1KT1A 4RG9A 5BNWA 3QWPA 3Q15A 3OXGA 4UQYA 3OXFA 4ABNA 4U07A 2ONDA 4I1AA 3LY8A 4GPKA 2XGOA 4BT9A 4O6FA 5LCWC 3TG5A 3S7BA 2MHKA 4H7YA 4GCOA 4JL0A 3LPZA 5CCMA 4NQ0A 4HOQA 3QWVA 3QDNA 5FZSA 4AY5A 5EKQD 4GCNA 3EDTB 3ASFA 2XPIA 3CV0A 5JJ6A 1WM5A 5JJTA 2AVPA 1P5QA 3ASHA 3UPVA 3TG4A 2OOEA 2XCCA 2FF4A 4J8EA 4KXKB 3PE3A 3KS2A 1HH8A 4J8FA 2XCBA 4I2WA 4B94A 5KJMA 5ARGA 3S7FA 2IFUA 4LEUA 3S7JA 4N2QA 2WPVA 3CEQA 3MV3B 2HYZA 4G24A 2R5SA 3GZ1A 2UY1A 3LYAA 2VGXA 5LCWJ 2KCLA 3ASDA 4UI9C 3RU0A 3GZ2A 2V5FA 4N5CA 1HXIA 3AS4A 2FBNA 4G26A 2PQRA 3UUXA 1Y8MA 1YA0A 4HOUA 4U04A 4HOTA 4I9EA 4H7XA 1ELRA 4APOA 1NA0A 1ZU2A 2C0LA 3BEEA 3MA5A 2IF4A 5ARFA 2XGMA 4WNFA 3Q5MA 4Y6CA 3FFLA 2L6JA 1B89A 5DBKA 3CVNA 4I17A 3K9IA 4U0ZA 3QKYA 2KCVA 3HYMB 4CDRA 3CKCA 4BT8A 4N2SA 3CK7A 5A6CA 2VGYA 2PZIA 3Q49B 1NZNA 2KCKA 3IEGA 3ZPJA 4BTBA 4GA0A 2Y4TA 2VQ2A 1IYGA 4JA7A 3VTYA 3R9AB 3PE4A 3AS8A 4KYOB 5D0QD 4BWRA 3QWWA 2NC9A 3URZA 3CK9A 2E2EA 4YVQC 5EX3A 4WNDA 4HORA 3MKRA 4UI9J 3RIBA 4F3VA 5G05C 2VYIA 3CKBA 5FTPA 2PQNA 5FZRA 1NA3A 3ZGQA 4I2ZA 1QZ2A 2KC7A 1WAO1 3ZN3A 4G23A 4WUYA 3SF4A 1KT0A 5M72A 3CVPA 2BUGA 2PL2A 2UWJG 4EQFA 5C1DA 3Q4AB 5D0OD 3CK8A 2I6HA 5FZQA 4N39A 3VTXA 3ZHEA 4AM9A 2KATA 3O48A 1KLXA 3OXLA 1FCHA 2FEZA 4JHRA 4J8DA 1TJCA 5KJKA 3AS5A 3SZ7A 3FP3A 2JLBA 3GW4A 4JA9A 1ZBPA 3U4TA 4WNGA 4G1TA 3U3WA 2YHCA 5FT9A 1QQEA 3MEKA 4ME2A 2FO7A 4NRHB 5G05J 1W3BA 1A17A 3UQ3A 4N3CA 3MV2B 4KBQA 3ASGA 1E96B 4GZ5A 4Y6WA 3E4BA 3GYZA 4BTAA 3RO2A 5KJNA 1ELWA 3JYSA 5HI7A 3LY9A
chains in the Genus database with same CATH superfamily
1HU3A 4CGVA 3FTWA 4XIFA 4LG6A 1U3CA 2LNIA 5AYWD 3LCAA 4HBDA 1IXVA 4KZ0A 4GTOA 2YINA 3DSUA 5KBAA 3B7UX 2A5EA 3AAAC 5HQ8A 3EHQA 3FWVA 2LXLA 3B13A 5EX0A 1D9SA 2ZISA 3EJNA 2P2CP 4A1SA 4I1MA 2Y0BG 3U66A 2V0PA 4M7CA 4GPMA 2WXFA 2QFCA 1UOHA 3RO3A 2M63A 4APFA 2WM9A 1OCZE 2VSNA 4GA1A 4GA2A 2X6HA 4F6RD 2QC9A 4I43A 4URKA 3D3MA 2RFAA 4U95D 2I9CA 4YNDA 5BW8C 1OCOE 4GYOA 4IULA 3KD7A 2P58C 2ZXWE 1EDUA 2VTBB 3LS8A 3ML8A 4UQZA 4GTRA 3S2AA 2VSYA 3EHRA 4U0SA 3TL5A 3R7QA 4U8YD 3CHRA 4AJWA 3RKVA 4HS2A 4I6JA 3HXFA 1MX2A 2UY1B 1N95A 4UI9K 3LVQE 5AQ7A 4B89A 3E33A 2WXMA 4U8HA 3FH7A 2LSUA 4RG6A 2DZOA 4U0UA 1MX4A 2XEHA 1G3NB 3RRMB 3ZVVA 3Q73A 4YDYA 2BF0X 4LUNU 4FU3A 2KBXA 1HZ4A 3PS6A 4ACKA 1GW6A 4G8KA 1K8KG 3PRZA 5EDSA 5CHEE 3C3QA 3Q15A 3OXGA 2AXVA 1UW4B 5KNHD 3SNXA 2E0IA 2LAIA 2ONDA 3LY8A 4I1OB 4AP2A 4O6FA 2VSOE 4FJZA 1S0PA 3S7BA 4GU5A 3ESLA 1N0QA 4EZKA 4Q96A 3ULYA 3WG7E 5CCMA 1NFIE 4EHMA 5AENA 5BUZA 1MHQA 3HXBA 1WY6A 4F1SA 1Z3XA 2RG8A 3QDNA 3D9NA 3UM0A 4EBAG 4BETA 4DX2A 2EIKE 5EIBE 5AIJA 4GCNA 4OAUC 3DPYA 5KCMA 1E8WA 1Z3YA 2AVPA 3UPVA 2B0OE 4L9PA 1TNYA 2OVFA 4GZDA 2BEDA 2WXQA 3BQOA 2FF4A 3R7RA 2I2OA 5T4YA 4FLHA 1HH8A 5LOZA 2V8SE 5J08A 4C9BB 3UT4A 1HO8A 4FA6A 3CVXA 2ZGGA 3P2BA 2V4LA 4LEUA 4WWNA 4OVUA 4N2QA 3MV3B 2HYZA 1XGWA 5EYPF 4J8YA 4NACA 4FHKA 3OAWA 3PEVB 2J4DA 4UWFA 2F37A 1H19A 3RAUA 1YMPA 1L5JA 2CHXA 2PQRA 3EUVA 3DSVA 3ZU7B 2EIJE 3Q78A 3TWRA 4KT6B 1ELRA 4APOA 1BI8B 2XRZA 3BEEA 1N4RA 4U63A 3I4RB 3MCXA 3FTYA 4JXTA 4WNFA 2IOLA 5BV0A 3K9IA 2LAHA 4LERA 3T9KA 2KCVA 4CDNA 3CVYA 4DRXE 1SZ9A 3DEOA 3CKCA 4CDRA 2GRNB 3PUKA 2PZIA 3ZYKA 3TWSA 3DSWA 3ZEFA 4HXIA 3DSTA 4L1BA 4BTBA 4GA0A 3DSSA 4JC8A 2L0IA 1IYGA 3VTYA 3PE4A 4KYOB 3V30A 3AG4E 1TNZA 3HVEA 4YDWA 4Q94A 3TJPA 5EX3A 3QC1A 4O1OA 4HORA 4O60A 2DZNA 2VYIA 3CKBA 3SGHA 4CT4A 5FZRA 1QBQA 4JPSA 1OWLA 2GRLA 3MZLB 4XEIG 2WXPA 3FEXA 4LRZA 3PEUB 4ANWA 4AXHA 4DJAA 3CVPA 2PL2A 2XPZA 5D0OD 5KNGA 4N39A 4AM9A 3ZHEA 1NP7A 3UKUG 3O48A 3Q75A 4EECA 3ENEA 3GZSA 2NYJA 3FTSA 3LEWA 4JHRA 4DX1A 3BG1B 2VJ8A 2J4BA 1S64A 2H6HA 3SZ7A 3FP3A 4UWKA 1DVPA 3HXEA 2YHCA 4F7AA 1QQEA 4DI4A 2CG2A 1TNUA 3V2OA 3FTUA 3TWVA 3CVUA 5JHAA 3TWUA 4ZHBA 2X6FA 2H6FA 4KBQA 2ETCA 3ASGA 3CIAA 1YYHA 2H6GA 4GTPA 1ELWA 4HQDA 1EYHA 4L23A 1WG0A 4A1GA 3SQVA 4UWLA 3LKUA 3UT7A 3BUAA 1N4QA 3ONLA 2J07A 2Q7FA 5ENNA 3DSXA 4BEPA 5BT1A 3PREA 3E32A 3C5RA 1E8XA 2P9LG 1FVHA 5ENSD 2HO1A 3JXIA 3D9OA 2AW6A 2YQ8A 4XE0A 5BXOA 1SVXA 1IHGA 3S7DA 3SBSA 1ZB1A 1N52A 2X38A 3LJNA 3WXXA 3NZUA 3DBSA 4UQXA 1AWCB 2WXLA 4L2YA 1BLXB 2GW1A 4ZFHA 4TXQA 1E8YA 5EILA 4C0EA 3EU9A 4FLBA 5CMWA 1OUVA 5AQAA 2Y3AA 3AJIA 5JJ7A 4XKBA 5ITZF 1HFAA 4CDMA 2MOWA 4GZ3A 3Q9NC 4GMLA 3ULEG 3CR3A 5EIDA 3ULQA 4U96D 4AIFA 3KSQA 5DIZA 1HG5A 1Z5SC 1H2UA 3FUEA 2L9BA 4AY6A 3SD5A 2WQ7A 3ZXSA 4XI9A 2JEKA 3N71A 4N3BA 4KVMA 2FI7A 3NOGD 3SY2A 2XGSA 3Q79A 4DK5A 3U9WA 3MX3A 4GYYA 1N4SA 2CHWA 5T8IA 3IHVA 4I9CA 4EPZA 4G2VA 1IKND 3FH8A 4B93B 4BSXA 4DLOA 5G04J 1HE8A 3CSTA 5AQ9A 3MJWA 1BD8A 4RVBA 2V5QC 5FQ8A 3B95A 3JUIA 4F1PA 5ANLA 3ZNGA 4BT9A 3AU4A 4FP7A 1N94A 3IXEA 4TXRA 3Q9UC 4H7YA 3CHPA 4GCOA 2DCPA 3B7TA 4NQ0A 2AJAA 3ASOE 3SO8A 1JCSA 2FO1E 3QWVA 2WQ6A 4MKTA 2XS8A 5FIOA 1BI7B 5FZSA 4AY5A 2B6CA 4HRNA 1UJKA 5JJ6A 4YDOA 4K0RA 3UX4A 4PS8A 3IKOB 2XCCA 2LXMA 3ZYLA 4KZCA 4KXKB 4FULA 3PE3A 5ENQD 5JA4D 2XCBA 2Y69E 4RQIA 4PS7A 4B94A 3UM2A 5JHBA 4K5CA 4DX5D 3QAQA 5KJMA 3QB2A 2IFUA 4BX9A 1EPUA 3ZYMA 4EZLA 4G24A 4J8SA 2UY1A 2KXPC 4LNUD 3HHMA 3G2VA 1HS6A 3MGBA 5LCWJ 2KCLA 2AXUA 3ASDA 5T3RA 4UI9C 3RU0A 3GZ2A 2X6KA 4N5CA 5CERB 1OWOA 5CEAA 4G26A 2J8SD 1Y8MA 2X6IA 1YA0A 4HOUA 4HOTA 2R17C 3FTVA 4H7XA 2WXOA 1NL4A 1NA0A 2C0LA 2IF4A 2XGMA 4AV7A 1OWPA 3FFLA 2L6JA 1B89A 3T8MA 2PNNA 2P9KG 2OEWA 3FUMA 4TUUA 4B8CB 3PZ3A 3APFA 3Q7FA 4BT8A 4N2SA 3TWQA 2VGYA 1KZOA 3IEGA 3ZPJA 5J90A 3VLDA 3B7BA 3T5VA 4JVSA 2F8XK 2QYUA 4BSZB 3SBTB 3FUHA 2XRYA 4AEZC 3UM1A 1TYQG 3D9HA 4JW1A 2OCCE 2E2EA 4YVQC 3CHQA 3EIQC 3UMVA 4DPRA 1LD8A 3TXMA 2IO3C 5EN5D 4GMJA 5FTPA 3PZ4A 3FTZA 5FQ7A 3B7RL 2ZIRA 2IJGX 1QZ2A 4HB5A 2KC7A 3UI2A 3V2XA 2GGFA 2IO2C 4RLYA 1SQMA 1WAO1 3SF4A 4B0ZA 5M72A 2I1KA 3FUNA 2UWJG 3Q4AB 5LFAA 1MZCA 5E76A 3VTXA 5KWDA 1E7VA 1KLXA 4J8DA 2CFUA 3AS5A 2KZTA 4JA9A 3HXCA 5HRYA 4WWPA 2KM4A 3F6QA 2AXZA 3G2UA 4G1TA 3L82A 1JCRA 5FT9A 1H0AA 1TEZA 2R2LA 3UINC 1UN8A 1LD7A 1N54A 2FO7A 5G05J 1HG2A 3UQ3A 4N3CA 5FINA 3DEPA 4HRMB 3LDZA 4PDXA 3APCA 4FHJA 1E96B 2WXHA 4GZ5A 4JB8P 5CECB 4BTAA 3HDXA 5KJNA 3X2QE 1DNPA 3JYSA 2J49A 5HI7A 3L13A 1S70B 5HS0A 2NXPA 2EIME 3CVQA 3PNTB 1HX8A 3NZSA 4L7TA 1NI1A 3NB2A 3MKQA 4ANVA 1X81A 3Q47B 2WXRA 4C0MA 5FQ4A 2ILRA 3FUDA 3ZFWA 2P9SG 3IV0A 3CHSA 3HVEB 3ABKE 2C2LA 2GRRB 2GROB 1N0RA 2ETBA 3G2SA 5KJLA 3I5PA 4V3IA 1Q2ZA 3UTMA 3C72A 4CCAA 3CHMA 4E85A 1EF1C 3D9IA 1V54E 1S63A 3ZXPA 3FUJA 3T5XA 2WQHA 3KAEA 4QFVA 4P29A 3SFZA 1FVFA 3FY4A 3L22A 3TAXA 4A63B 4TV3A 4YVOA 3MYVA 1OCRE 2LSVA 2R05A 3P1UA 3PDNA 3FUKA 3ZW3A 2WXKA 3FEYA 3ZHEB 4YDEA 4HOSA 5CRVA 1D8DA 3LY7A 1H2VC 4ACLA 2VGXB 1XNFA 1INZA 1UG3A 4ILHB 4E6HA 4J0UA 1A5EA 2BKGA 3ESKA 4I6GA 3FTXA 2DBAA 4KVOA 5CMYA 1QYMA 3FU6A 4FC8A 1PC2A 3AG1E 3D9LA 3TGOA 1KT1A 3QWPA 4UQYA 1X5BA 2WXGA 4LNBA 3OXFA 3CVVA 4GTQA 4U07A 1AP7A 4TUMA 4I1AA 5ENPD 4GPKA 2WXNA 2ZU6B 2XGOA 3DPDA 3JUEA 1O1RA 3G2TA 2MHKA 3IHYA 4JL0A 1JWGA 2J09A 4HOQA 3D9PA 4XKCA 1BU9A 3ML9A 3RRNB 5ANRA 3HIZA 2P9IG 5AARA 5EKQD 3DXKG 3D9MA 3AU5A 4UUCA 3ASNE 4A3TA 3ASFA 3CV0A 2MRIA 5JJTA 3ASHA 2OOEA 5B1BE 2P9UG 2P9PG 3ONKA 4DX7D 4J8EA 3FU5A 3LXUX 1BPOA 5IY5E 1H6OA 2ZGDA 4I2WA 4Z68A 4MS6A 1TR4A 5ARGA 3S7JA 4DUIA 3CEQA 2R5SA 5LP0A 4DI3A 4GTSA 3SFXA 4XX5A 3HRAA 4FADA 3AS4A 3E37A 4TXPA 4ATGA 2H6IA 5A23A 2DWZA 3UUXA 2X6JA 1KZPA 2XHEA 2XPYA 2R03A 4K5AB 4JHJA 4HFGA 4J7WA 4HLLA 4PH4B 3FH5A 3Q5MA 4HNAD 2FULA 5FWQA 3HXDA 4I17A 3L08A 4U0ZA 4F53A 3QKYA 1OT8A 1H6KA 4J6IA 3JQ1A 3I3NA 3CGHA 1IHBA 5A6CA 1NZNA 3CHOA 1O1TA 4R7LA 4K5BA 4JA7A 4EZJA 3AG3E 3NBNB 4BWRA 4UWGA 1SZAA 3CK9A 1OY3D 4U7EB 3O4ZA 1SW6A 4WNDA 2F8YA 3E34A 3ABLE 1DCEA 4ILIA 2PQNA 3EHMA 5H7PA 1OXJA 3FUIA 4BESA 4BX8A 5CBNA 1SA5A 1RZ4A 4GB9A 1YCSB 4HVBA 1U2VG 2VTBA 2F0YA 2GRQB 3ZKJA 1H2TC 3L54A 2BUGA 3RK6A 1K3ZD 1MQSA 3CK8A 4FJYA 1UN9A 2I6HA 2KATA 3L9TA 4Q69A 2QZAA 1FPPA 3OXLA 1O1SA 1FCHA 3FUFA 2FEZA 3PVLA 5KJKA 3APDA 4GZCA 2JLBA 1ZBPA 5ENOD 2X3MA 3U3WA 2QYJA 2BKKB 5ENTD 2HE0A 5JMND 3MEKA 1V55E 4C48B 1E8ZA 4ME2A 4K03A 3RSEG 1N11A 4OYSA 1TN6A 1A17A 4I6EA 4TRQA 2I1JA 2DVWA 4ILGA 3MV2B 3BU8A 2HM8A 3G2WA 2IQCA 2XZDG 4QQIA 3GYZA 1JPLA 3NQPA 3LY9A 3D9KA 3VLFA 3NF1A 1E7UA 1K1AA 4WNEA 2VGEA 2EQXA 3ABME 3RJVA 2C0MA 1MX6A 4CRWA 3ZUVB 4CEMA 3QOUA 3U64A 4HI9A 4NURA 3UXGA 2XEVA 3B7SA 1WDYA 3DRAA 3T8KA 2XS1A 5EYLA 4HLEA 2HR2A 5AQBA 4ANXA 1TJFA 5CEDB 4M3OA 4A3VA 4PS3A 2A5UA 3ZRHA 2L6BA 1TN7A 1U3DA 4D10C 3CVLA 1JWFA 4AVXA 3QK0A 5G04C 4GYWA 1HF8A 3FULA 4IRUA 3QNKA 1PAQA 3FDHA 2CG3A 1FT2A 3AG2E 4LSZE 4PUCA 2WMNA 4O1PA 5BPPA 4GZ6A 2IONA 5CCLA 4G25A 2J08A 4GTVA 4GTTA 4N3AA 3PNLB 3KSLA 2YHEA 5G2NA 4JHKA 1VDYA 1JCQA 4LCTA 1KPSB 5E75A 4EBAA 4KMOA 3L6AA 4CYMD 2XEEA 3V31A 4AOFA 1D8EA 4IN3B 2Y4UA 5A7DB 5LX8A 1OCCE 3UT8A 4CZ2D 2XENA 4WWOA 2IEJA 2RKKA 3SI5A 2KZTB 1JUQA 3L16A 3IBEA 4RSYA 2WB2A 5AAOA 1IQUA 5FJYA 4BERA 3OTNA 2IY0C 4XI0A 4W9RA 5D2MC 5D66A 2IOSA 1RW2A 2J9QA 3C3RA 4CGWA 4JEUA 4G11A 1TNBA 4L2LA 3CVWA 3TWWA 4RG9A 5BNWA 3TWXA 1SA4A 4ABNA 2DYSE 1N4PA 2V4HC 3RRUA 5B3SE 1OWNA 4B8AA 2WMOA 5LCWC 3LJ3A 3TG5A 4U8VD 5AJLA 2WXIA 1E90A 2WVIA 3LPZA 3BG0B 5CRUA 4CT0A 2JABA 3KEAA 2BTDA 2P9NG 3ZYQA 3QJZA 3MKQB 2ETAA 3PZ1A 2XQ0A 3EDTB 2XPIA 1WM5A 1P5QA 2R02A 3PH0C 3TG4A 4G8LA 2NSZA 3CSFA 1LF8A 3FU0A 3KS2A 4J8FA 3W9FA 1ELKA 1H6PA 3S7FA 4GTMA 2WPVA 3J5QB 4LNGA 4DX6D 3GZ1A 4NIKA 1QNFA 3LYAA 2VGXA 3FU3A 4ANUA 3CQCB 2V5FA 4BY6A 1HXIA 4GAAA 1N9AA 2FBNA 3D9JA 3ISMC 5BV1A 4N5QA 2DYRE 3V79K 4ATZD 4U04A 3FHEA 1DC2A 4I9EA 3Q7AA 1O5MA 2OVBA 3TWTA 1ZU2A 1Z6TA 3MA5A 5ARFA 4UWHA 3SHFA 4Y6CA 2QY7A 2WXJA 1IQRA 5DBKA 3CVNA 3NOCD 1PY1A 5HKPA 4OVVA 4BFRA 2A4ZA 2GRMA 3HYMB 3CK7A 3EU5A 3Q49B 4JZYA 2KCKA 2CHZA 4XZ4A 3JXJA 4GMRA 2Y4TA 1UJJA 2VQ2A 2VSXE 4WAFA 3VLEA 3R9AB 3JQ0A 3AS8A 5D0QD 3R9MA 3QWWA 2NC9A 2EILE 4IYPA 3URZA 3JCKC 2LO6A 3CQGB 2R59A 3MKRA 4UI9J 3I4GA 3RIBA 2RFMA 3SFYA 4F3VA 3TXNA 2OEVA 2XZTG 2EINE 5G05C 3NAWA 3J5PA 1NA3A 3ZGQA 3W9GA 1K1BA 4I2ZA 5AN8A 3UM3A 3PUJA 5B1AE 3C98A 1MJ0A 4DLQA 3ZN3A 4G23A 4WUYA 5BXUA 1KT0A 3KEZA 5AJDA 2AWIA 4EQFA 5C1DA 4MBGA 2L0TB 3L17A 4OAVB 1Y6IA 5FZQA 3EHNA 3E30A 3DXMG 4X8QA 2Y1LE 3UKRG 3HG0D 4HI8A 1OWMA 1TJCA 3PZ2A 3QARA 3EIJA 3GW4A 3U4TA 3C3OA 4WNGA 2DIWA 2MYOA 5C2YA 2YNQA 3LVRE 3UIOC 1MYOA 1TNOA 4JEHA 2RD0A 4A55A 1TN8A 4NRHB 5G55A 1W3BA 4HRLA 2GRPB 1LTXA 3UIPC 5CBOA 2PM7A 2PM6A 1FT1A 3CLJA 3PZDA 5ENRD 4JD2G 2OV8A 4MRUA 4Y6WA 2CFZA 4MLPA 3E4BA 3RO2A 2LUHA 3DWLG 3ZIMA 2IU1A 1DCQA 5FQ6A
chains in the Genus database with same CATH topology
3VLFA 3NF1A 1E7UA 1HU3A 4A1GA 4WNEA 4CGVA 3FTWA 2EQXA 4XIFA 2NXPA 3CVQA 3PNTB 1U3CA 2LNIA 5AYWD 4UWLA 3RJVA 2C0MA 3LKUA 3LCAA 1HX8A 4KZ0A 3NZSA 3UT7A 3ONLA 2J07A 4CRWA 2Q7FA 2YINA 4L7TA 4CEMA 5ENNA 3QOUA 3U64A 3B7UX 5HI7A 3MKQA 5BT1A 3PREA 4NURA 4ANVA 2XEVA 3B7SA 5HQ8A 1E8XA 3Q47B 3FWVA 3B13A 1FVHA 5EX0A 4HLEA 2HR2A 2HO1A 2WXRA 3D9OA 2AW6A 4ANXA 4C0MA 1TJFA 2YQ8A 5FQ4A 4XE0A 3EJNA 4M3OA 2ILRA 3FUDA 3SBSA 1IHGA 3S7DA 4A1SA 4A3VA 4I1MA 1N52A 2X38A 3U66A 2V0PA 3ZFWA 3WXXA 3NZUA 3IV0A 3DBSA 4PS3A 4UQXA 3CHSA 3HVEB 2WXLA 2WXFA 2A5UA 4L2YA 3ZRHA 2C2LA 2GW1A 1E8YA 1U3DA 2QFCA 4D10C 3CVLA 1JWFA 4AVXA 4C0EA 3RO3A 3QK0A 5G04C 4FLBA 5CMWA 1OUVA 4GYWA 3G2SA 5KJLA 2M63A 2Y3AA 3I5PA 4V3IA 4XKBA 1HF8A 5JJ7A 4APFA 2WM9A 3FULA 4IRUA 4CCAA 3CHMA 4E85A 2VSNA 3QNKA 4GA1A 4GA2A 1HFAA 4CDMA 1EF1C 2X6HA 3D9IA 2MOWA 4I43A 4GZ3A 4URKA 3D3MA 1PAQA 4GMLA 3FDHA 2CG3A 3CR3A 4PUCA 2I9CA 2WMNA 4YNDA 5BW8C 5BPPA 3FUJA 4GZ6A 3T5XA 2IONA 2WQHA 3KAEA 4QFVA 5CCLA 4P29A 4GYOA 4IULA 3SFZA 4G25A 3ULQA 1FVFA 3FY4A 4AIFA 3KD7A 3L22A 3TAXA 2P58C 2J08A 1EDUA 2VTBB 4TV3A 4YVOA 3LS8A 3MYVA 5DIZA 3ML8A 2LSVA 4N3AA 4UQZA 3PNLB 3P1UA 1HG5A 3S2AA 2VSYA 3PDNA 1H2UA 2YHEA 3FUEA 4U0SA 3FUKA 5G2NA 3ZW3A 4JHKA 3TL5A 2WXKA 3FEYA 3R7QA 1VDYA 3CHRA 4AJWA 4LCTA 5E75A 3RKVA 4HS2A 2L9BA 4I6JA 3SD5A 4KMOA 4EBAA 4AY6A 3ZHEB 3L6AA 3ZXSA 2WQ7A 4XI9A 4HOSA 4AOFA 2UY1B 4IN3B 2JEKA 3LY7A 4UI9K 3LVQE 3N71A 2Y4UA 5A7DB 4N3BA 4B89A 5LX8A 1H2VC 4ACLA 2VGXB 1XNFA 4KVMA 2FI7A 3UT8A 1INZA 1UG3A 2WXMA 4ILHB 3FH7A 4U8HA 4WWOA 4E6HA 2LSUA 4RG6A 4J0UA 4U0UA 3SI5A 2KZTB 1JUQA 3ESKA 2XGSA 3IBEA 3L16A 4RSYA 2WB2A 3RRMB 3ZVVA 4I6GA 4DK5A 3U9WA 3MX3A 4GYYA 2BF0X 1IQUA 5FJYA 4LUNU 3OTNA 4FU3A 1HZ4A 3FTXA 4XI0A 3PS6A 2DBAA 4W9RA 4KVOA 4ACKA 2CHWA 5T8IA 1GW6A 3IHVA 2IOSA 5CMYA 2J9QA 4I9CA 4EPZA 4G2VA 4CGWA 3PRZA 4JEUA 3FU6A 4G11A 5EDSA 4FC8A 3FH8A 1PC2A 4BSXA 5CHEE 4DLOA 5G04J 1HE8A 4L2LA 3D9LA 3CSTA 3CVWA 3MJWA 1KT1A 3TGOA 4RG9A 5BNWA 4RVBA 3QWPA 3Q15A 3OXGA 4UQYA 1X5BA 5FQ8A 2AXVA 2WXGA 1UW4B 3OXFA 3CVVA 4ABNA 3JUIA 3SNXA 2E0IA 5ANLA 3RRUA 2LAIA 4U07A 2ONDA 4I1AA 3LY8A 4GPKA 1OWNA 2WXNA 2ZU6B 2XGOA 4I1OB 4AP2A 4O6FA 3AU4A 2WMOA 4B8AA 4BT9A 4FP7A 5LCWC 3DPDA 2VSOE 4FJZA 3LJ3A 3TG5A 1S0PA 5AJLA 3S7BA 4GU5A 3ESLA 3G2TA 4EZKA 2MHKA 2WXIA 4Q96A 3IHYA 3CHPA 4GCOA 1E90A 4H7YA 2WVIA 2DCPA 3B7TA 3LPZA 1JWGA 4JL0A 5CCMA 3BG0B 5AENA 4NQ0A 5BUZA 1MHQA 1WY6A 2J09A 4F1SA 4HOQA 3D9PA 4XKCA 1Z3XA 3ML9A 3QWVA 3RRNB 5ANRA 4CT0A 3HIZA 2WQ6A 2RG8A 3QDNA 2BTDA 4MKTA 3D9NA 3ZYQA 3QJZA 5FZSA 4EBAG 4AY5A 3MKQB 5EKQD 5AIJA 4GCNA 2XQ0A 3D9MA 3AU5A 5KCMA 1E8WA 1UJKA 1Z3YA 4A3TA 3EDTB 3ASFA 2XPIA 3CV0A 5JJ6A 1WM5A 2MRIA 5JJTA 2AVPA 1P5QA 3PH0C 3ASHA 4K0RA 3TG4A 3UX4A 3UPVA 2OOEA 2NSZA 4PS8A 2OVFA 3IKOB 4GZDA 3CSFA 2XCCA 2WXQA 3ZYLA 3ONKA 1LF8A 4KZCA 2FF4A 3R7RA 2I2OA 3FU0A 4J8EA 4KXKB 4FULA 3FU5A 3PE3A 5T4YA 3LXUX 3KS2A 1BPOA 1HH8A 4FLHA 4J8FA 2XCBA 2V8SE 5LOZA 5J08A 4I2WA 4C9BB 3UT4A 4PS7A 1HO8A 4B94A 4FA6A 5JHBA 3CVXA 4MS6A 1ELKA 3P2BA 3QAQA 5KJMA 2V4LA 3QB2A 5ARGA 3S7FA 2IFUA 4BX9A 4LEUA 1EPUA 3S7JA 3ZYMA 4WWNA 4OVUA 4N2QA 2WPVA 3CEQA 3MV3B 4EZLA 2HYZA 4G24A 4J8SA 1XGWA 2R5SA 3GZ1A 2UY1A 4NACA 4FHKA 1QNFA 5LP0A 4DI3A 3LYAA 2VGXA 3FU3A 3HHMA 3OAWA 3G2VA 3PEVB 1HS6A 4ANUA 3MGBA 3CQCB 2KCLA 2AXUA 3ASDA 5T3RA 5LCWJ 4UI9C 4XX5A 2J4DA 3RU0A 3GZ2A 4UWFA 1H19A 2V5FA 4BY6A 2X6KA 4N5CA 4FADA 1HXIA 1OWOA 3AS4A 4GAAA 4ATGA 2FBNA 1L5JA 4G26A 2CHXA 2PQRA 5A23A 3D9JA 5BV1A 3UUXA 2X6JA 1Y8MA 2X6IA 1YA0A 4HOUA 4U04A 2XHEA 3FHEA 4HOTA 2R17C 2XPYA 3FTVA 4I9EA 4H7XA 2WXOA 4KT6B 1ELRA 4APOA 2OVBA 1NA0A 4JHJA 2XRZA 1ZU2A 1Z6TA 2C0LA 3BEEA 3MA5A 2IF4A 4HFGA 5ARFA 4U63A 3I4RB 3MCXA 4UWHA 3FTYA 4JXTA 3FH5A 2XGMA 4PH4B 3SHFA 4AV7A 4WNFA 3Q5MA 1OWPA 2QY7A 2WXJA 3FFLA 4Y6CA 2L6JA 1IQRA 2FULA 5FWQA 1B89A 2IOLA 3CVNA 5DBKA 3T8MA 5BV0A 1PY1A 4I17A 3K9IA 3L08A 4U0ZA 4OVVA 4F53A 3QKYA 4BFRA 2LAHA 4LERA 2A4ZA 2KCVA 3FUMA 4TUUA 4B8CB 4CDNA 3CVYA 3APFA 2GRMA 3HYMB 1SZ9A 1H6KA 3CKCA 4J6IA 4CDRA 4BT8A 4N2SA 3JQ1A 3I3NA 3CGHA 3CK7A 5A6CA 2VGYA 3PUKA 2PZIA 3Q49B 3ZYKA 4JZYA 1NZNA 2CHZA 2KCKA 3IEGA 4XZ4A 3ZPJA 3ZEFA 4HXIA 3VLDA 5J90A 4L1BA 4BTBA 3CHOA 4GA0A 2Y4TA 1UJJA 2VQ2A 2VSXE 4JC8A 2L0IA 3T5VA 1IYGA 4R7LA 4WAFA 4JVSA 4JA7A 3VLEA 3VTYA 4EZJA 3R9AB 3JQ0A 3PE4A 3SBTB 3AS8A 3FUHA 4KYOB 5D0QD 4BWRA 3QWWA 4IYPA 2NC9A 4UWGA 3URZA 1SZAA 2XRYA 3CK9A 3HVEA 3JCKC 3O4ZA 4Q94A 4AEZC 2LO6A 4JW1A 3TJPA 2E2EA 3CQGB 4YVQC 5EX3A 2R59A 3CHQA 3QC1A 3EIQC 4WNDA 4HORA 3MKRA 4UI9J 3I4GA 3RIBA 4F3VA 3TXNA 3UMVA 4DPRA 2VYIA 5G05C 3TXMA 3CKBA 3SGHA 4ILIA 4GMJA 5FTPA 2PQNA 3EHMA 5FZRA 4CT4A 3FTZA 5FQ7A 3B7RL 1NA3A 4JPSA 3ZGQA 1OWLA 2GRLA 4I2ZA 2IJGX 3MZLB 1QZ2A 2KC7A 3FUIA 2WXPA 3PUJA 2GGFA 3C98A 4BX8A 3FEXA 4DLQA 1SQMA 4GB9A 4LRZA 1WAO1 3PEUB 3ZN3A 4HVBA 2VTBA 4G23A 4WUYA 4ANWA 3SF4A 4B0ZA 4AXHA 1KT0A 3KEZA 5AJDA 5M72A 2I1KA 1H2TC 3FUNA 3L54A 2AWIA 4DJAA 3CVPA 2BUGA 2PL2A 2UWJG 4EQFA 5C1DA 3RK6A 3Q4AB 5LFAA 2XPZA 5D0OD 1MQSA 3CK8A 4FJYA 1UN9A 5E76A 2L0TB 3L17A 1Y6IA 2I6HA 5FZQA 3EHNA 4N39A 3VTXA 3ZHEA 4AM9A 2KATA 1E7VA 1NP7A 3O48A 4EECA 1KLXA 4Q69A 3ENEA 3GZSA 3OXLA 3FTSA 3LEWA 1FCHA 3FUFA 2FEZA 3PVLA 4J8DA 3BG1B 4JHRA 2CFUA 1OWMA 1TJCA 2VJ8A 2J4BA 3QARA 3APDA 5KJKA 4GZCA 3EIJA 3AS5A 2KZTA 3SZ7A 3FP3A 2JLBA 3GW4A 4JA9A 1ZBPA 4WWPA 4UWKA 2KM4A 3U4TA 1DVPA 2X3MA 4WNGA 2AXZA 2DIWA 3G2UA 4G1TA 3U3WA 5C2YA 2YNQA 3LVRE 2YHCA 5FT9A 4F7AA 1QQEA 1H0AA 3MEKA 4DI4A 1E8ZA 2CG2A 4ME2A 1TEZA 4JEHA 4K03A 2RD0A 3FTUA 1UN8A 3CVUA 1N54A 2FO7A 4A55A 5JHAA 4NRHB 5G55A 5G05J 1W3BA 4OYSA 2X6FA 1HG2A 1A17A 4I6EA 3UQ3A 4N3CA 2PM7A 2PM6A 3CLJA 3PZDA 4TRQA 2I1JA 4ILGA 2OV8A 3MV2B 4KBQA 3LDZA 4PDXA 3APCA 4FHJA 3ASGA 1E96B 2WXHA 3CIAA 2HM8A 3G2WA 4GZ5A 2IQCA 4MRUA 4Y6WA 2CFZA 4MLPA 3E4BA 3GYZA 4BTAA 1JPLA 3RO2A 3HDXA 5KJNA 1ELWA 1DNPA 3JYSA 1EYHA 2IU1A 2J49A 3NQPA 4L23A 5FQ6A 3LY9A 3ZIMA 3D9KA 3L13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF1 A;  4WNE A;  4CGV A;  4XIF A;  3CVQ A;  5AYW D;  2LNI A;  3RJV A;  2C0M A;  3LKU A;  3LCA A;  2Q7F A;  3QOU A;  5BT1 A;  2XEV A;  5HQ8 A;  3Q47 B;  3FWV A;  5EX0 A;  2HR2 A;  2HO1 A;  2YQ8 A;  4A1S A;  1IHG A;  3S7D A;  3ZFW A;  3WXX A;  4UQX A;  2C2L A;  2GW1 A;  2QFC A;  3CVL A;  3RO3 A;  5G04 C;  1OUV A;  4GYW A;  5KJL A;  5JJ7 A;  2VSN A;  4GA1 A;  4GA2 A;  4GZ3 A;  4YND A;  5BW8 C;  4GZ6 A;  2WQH A;  3KAE A;  5CCL A;  4GYO A;  3ULQ A;  4G25 A;  4AIF A;  3KD7 A;  3TAX A;  2P58 C;  4YVO A;  5DIZ A;  2LSV A;  4N3A A;  4UQZ A;  2VSY A;  3PDN A;  4U0S A;  3RKV A;  4AY6 A;  3ZHE B;  4XI9 A;  4HOS A;  2UY1 B;  4IN3 B;  3LY7 A;  4UI9 K;  3N71 A;  2Y4U A;  5A7D B;  4N3B A;  2VGX B;  1XNF A;  2FI7 A;  2LSU A;  4RG6 A;  4U0U A;  4J0U A;  3ESK A;  2XGS A;  4GYY A;  5FJY A;  1HZ4 A;  4XI0 A;  2DBA A;  4W9R A;  2J9Q A;  4I9C A;  4G2V A;  4CGW A;  1PC2 A;  5CHE E;  5G04 J;  3TGO A;  1KT1 A;  4RG9 A;  5BNW A;  3QWP A;  3Q15 A;  3OXG A;  4UQY A;  3OXF A;  4ABN A;  4U07 A;  2OND A;  4I1A A;  3LY8 A;  4GPK A;  2XGO A;  4BT9 A;  4O6F A;  5LCW C;  3TG5 A;  3S7B A;  2MHK A;  4H7Y A;  4GCO A;  4JL0 A;  3LPZ A;  5CCM A;  4NQ0 A;  4HOQ A;  3QWV A;  3QDN A;  5FZS A;  4AY5 A;  5EKQ D;  4GCN A;  3EDT B;  3ASF A;  2XPI A;  3CV0 A;  5JJ6 A;  1WM5 A;  5JJT A;  2AVP A;  1P5Q A;  3ASH A;  3UPV A;  3TG4 A;  2OOE A;  2XCC A;  2FF4 A;  4J8E A;  4KXK B;  3PE3 A;  3KS2 A;  1HH8 A;  4J8F A;  2XCB A;  4I2W A;  4B94 A;  5KJM A;  5ARG A;  3S7F A;  2IFU A;  4LEU A;  3S7J A;  4N2Q A;  2WPV A;  3CEQ A;  3MV3 B;  2HYZ A;  4G24 A;  2R5S A;  3GZ1 A;  2UY1 A;  3LYA A;  2VGX A;  5LCW J;  2KCL A;  3ASD A;  4UI9 C;  3RU0 A;  3GZ2 A;  2V5F A;  4N5C A;  1HXI A;  3AS4 A;  2FBN A;  4G26 A;  2PQR A;  3UUX A;  1Y8M A;  1YA0 A;  4HOU A;  4U04 A;  4HOT A;  4I9E A;  4H7X A;  1ELR A;  4APO A;  1NA0 A;  1ZU2 A;  2C0L A;  3BEE A;  3MA5 A;  2IF4 A;  5ARF A;  2XGM A;  4WNF A;  3Q5M A;  4Y6C A;  3FFL A;  2L6J A;  1B89 A;  5DBK A;  3CVN A;  4I17 A;  3K9I A;  4U0Z A;  3QKY A;  2KCV A;  3HYM B;  4CDR A;  3CKC A;  4BT8 A;  4N2S A;  3CK7 A;  5A6C A;  2VGY A;  2PZI A;  3Q49 B;  1NZN A;  2KCK A;  3IEG A;  3ZPJ A;  4BTB A;  4GA0 A;  2Y4T A;  2VQ2 A;  1IYG A;  4JA7 A;  3VTY A;  3R9A B;  3PE4 A;  3AS8 A;  4KYO B;  5D0Q D;  4BWR A;  3QWW A;  2NC9 A;  3URZ A;  3CK9 A;  2E2E A;  4YVQ C;  5EX3 A;  4WND A;  4HOR A;  3MKR A;  4UI9 J;  3RIB A;  4F3V A;  5G05 C;  2VYI A;  3CKB A;  5FTP A;  2PQN A;  5FZR A;  1NA3 A;  3ZGQ A;  4I2Z A;  1QZ2 A;  2KC7 A;  1WAO 1;  3ZN3 A;  4G23 A;  4WUY A;  3SF4 A;  1KT0 A;  5M72 A;  3CVP A;  2BUG A;  2PL2 A;  2UWJ G;  4EQF A;  5C1D A;  3Q4A B;  5D0O D;  3CK8 A;  2I6H A;  5FZQ A;  4N39 A;  3VTX A;  3ZHE A;  4AM9 A;  2KAT A;  3O48 A;  1KLX A;  3OXL A;  1FCH A;  2FEZ A;  4JHR A;  4J8D A;  1TJC A;  5KJK A;  3AS5 A;  3SZ7 A;  3FP3 A;  2JLB A;  3GW4 A;  4JA9 A;  1ZBP A;  3U4T A;  4WNG A;  4G1T A;  3U3W A;  2YHC A;  5FT9 A;  1QQE A;  3MEK A;  4ME2 A;  2FO7 A;  4NRH B;  5G05 J;  1W3B A;  1A17 A;  3UQ3 A;  4N3C A;  3MV2 B;  4KBQ A;  3ASG A;  1E96 B;  4GZ5 A;  4Y6W A;  3E4B A;  3GYZ A;  4BTA A;  3RO2 A;  5KJN A;  1ELW A;  3JYS A;  5HI7 A;  3LY9 A; 
#chains in the Genus database with same CATH topology
 1HU3 A;  4CGV A;  3FTW A;  4XIF A;  4LG6 A;  1U3C A;  2LNI A;  5AYW D;  3LCA A;  4HBD A;  1IXV A;  4KZ0 A;  4GTO A;  2YIN A;  3DSU A;  5KBA A;  3B7U X;  2A5E A;  3AAA C;  5HQ8 A;  3EHQ A;  3FWV A;  2LXL A;  3B13 A;  5EX0 A;  1D9S A;  2ZIS A;  3EJN A;  2P2C P;  4A1S A;  4I1M A;  2Y0B G;  3U66 A;  2V0P A;  4M7C A;  4GPM A;  2WXF A;  2QFC A;  1UOH A;  3RO3 A;  2M63 A;  4APF A;  2WM9 A;  1OCZ E;  2VSN A;  4GA1 A;  4GA2 A;  2X6H A;  4F6R D;  2QC9 A;  4I43 A;  4URK A;  3D3M A;  2RFA A;  4U95 D;  2I9C A;  4YND A;  5BW8 C;  1OCO E;  4GYO A;  4IUL A;  3KD7 A;  2P58 C;  2ZXW E;  1EDU A;  2VTB B;  3LS8 A;  3ML8 A;  4UQZ A;  4GTR A;  3S2A A;  2VSY A;  3EHR A;  4U0S A;  3TL5 A;  3R7Q A;  4U8Y D;  3CHR A;  4AJW A;  3RKV A;  4HS2 A;  4I6J A;  3HXF A;  1MX2 A;  2UY1 B;  1N95 A;  4UI9 K;  3LVQ E;  5AQ7 A;  4B89 A;  3E33 A;  2WXM A;  4U8H A;  3FH7 A;  2LSU A;  4RG6 A;  2DZO A;  4U0U A;  1MX4 A;  2XEH A;  1G3N B;  3RRM B;  3ZVV A;  3Q73 A;  4YDY A;  2BF0 X;  4LUN U;  4FU3 A;  2KBX A;  1HZ4 A;  3PS6 A;  4ACK A;  1GW6 A;  4G8K A;  1K8K G;  3PRZ A;  5EDS A;  5CHE E;  3C3Q A;  3Q15 A;  3OXG A;  2AXV A;  1UW4 B;  5KNH D;  3SNX A;  2E0I A;  2LAI A;  2OND A;  3LY8 A;  4I1O B;  4AP2 A;  4O6F A;  2VSO E;  4FJZ A;  1S0P A;  3S7B A;  4GU5 A;  3ESL A;  1N0Q A;  4EZK A;  4Q96 A;  3ULY A;  3WG7 E;  5CCM A;  1NFI E;  4EHM A;  5AEN A;  5BUZ A;  1MHQ A;  3HXB A;  1WY6 A;  4F1S A;  1Z3X A;  2RG8 A;  3QDN A;  3D9N A;  3UM0 A;  4EBA G;  4BET A;  4DX2 A;  2EIK E;  5EIB E;  5AIJ A;  4GCN A;  4OAU C;  3DPY A;  5KCM A;  1E8W A;  1Z3Y A;  2AVP A;  3UPV A;  2B0O E;  4L9P A;  1TNY A;  2OVF A;  4GZD A;  2BED A;  2WXQ A;  3BQO A;  2FF4 A;  3R7R A;  2I2O A;  5T4Y A;  4FLH A;  1HH8 A;  5LOZ A;  2V8S E;  5J08 A;  4C9B B;  3UT4 A;  1HO8 A;  4FA6 A;  3CVX A;  2ZGG A;  3P2B A;  2V4L A;  4LEU A;  4WWN A;  4OVU A;  4N2Q A;  3MV3 B;  2HYZ A;  1XGW A;  5EYP F;  4J8Y A;  4NAC A;  4FHK A;  3OAW A;  3PEV B;  2J4D A;  4UWF A;  2F37 A;  1H19 A;  3RAU A;  1YMP A;  1L5J A;  2CHX A;  2PQR A;  3EUV A;  3DSV A;  3ZU7 B;  2EIJ E;  3Q78 A;  3TWR A;  4KT6 B;  1ELR A;  4APO A;  1BI8 B;  2XRZ A;  3BEE A;  1N4R A;  4U63 A;  3I4R B;  3MCX A;  3FTY A;  4JXT A;  4WNF A;  2IOL A;  5BV0 A;  3K9I A;  2LAH A;  4LER A;  3T9K A;  2KCV A;  4CDN A;  3CVY A;  4DRX E;  1SZ9 A;  3DEO A;  3CKC A;  4CDR A;  2GRN B;  3PUK A;  2PZI A;  3ZYK A;  3TWS A;  3DSW A;  3ZEF A;  4HXI A;  3DST A;  4L1B A;  4BTB A;  4GA0 A;  3DSS A;  4JC8 A;  2L0I A;  1IYG A;  3VTY A;  3PE4 A;  4KYO B;  3V30 A;  3AG4 E;  1TNZ A;  3HVE A;  4YDW A;  4Q94 A;  3TJP A;  5EX3 A;  3QC1 A;  4O1O A;  4HOR A;  4O60 A;  2DZN A;  2VYI A;  3CKB A;  3SGH A;  4CT4 A;  5FZR A;  1QBQ A;  4JPS A;  1OWL A;  2GRL A;  3MZL B;  4XEI G;  2WXP A;  3FEX A;  4LRZ A;  3PEU B;  4ANW A;  4AXH A;  4DJA A;  3CVP A;  2PL2 A;  2XPZ A;  5D0O D;  5KNG A;  4N39 A;  4AM9 A;  3ZHE A;  1NP7 A;  3UKU G;  3O48 A;  3Q75 A;  4EEC A;  3ENE A;  3GZS A;  2NYJ A;  3FTS A;  3LEW A;  4JHR A;  4DX1 A;  3BG1 B;  2VJ8 A;  2J4B A;  1S64 A;  2H6H A;  3SZ7 A;  3FP3 A;  4UWK A;  1DVP A;  3HXE A;  2YHC A;  4F7A A;  1QQE A;  4DI4 A;  2CG2 A;  1TNU A;  3V2O A;  3FTU A;  3TWV A;  3CVU A;  5JHA A;  3TWU A;  4ZHB A;  2X6F A;  2H6F A;  4KBQ A;  2ETC A;  3ASG A;  3CIA A;  1YYH A;  2H6G A;  4GTP A;  1ELW A;  4HQD A;  1EYH A;  4L23 A;  1WG0 A;  4A1G A;  3SQV A;  4UWL A;  3LKU A;  3UT7 A;  3BUA A;  1N4Q A;  3ONL A;  2J07 A;  2Q7F A;  5ENN A;  3DSX A;  4BEP A;  5BT1 A;  3PRE A;  3E32 A;  3C5R A;  1E8X A;  2P9L G;  1FVH A;  5ENS D;  2HO1 A;  3JXI A;  3D9O A;  2AW6 A;  2YQ8 A;  4XE0 A;  5BXO A;  1SVX A;  1IHG A;  3S7D A;  3SBS A;  1ZB1 A;  1N52 A;  2X38 A;  3LJN A;  3WXX A;  3NZU A;  3DBS A;  4UQX A;  1AWC B;  2WXL A;  4L2Y A;  1BLX B;  2GW1 A;  4ZFH A;  4TXQ A;  1E8Y A;  5EIL A;  4C0E A;  3EU9 A;  4FLB A;  5CMW A;  1OUV A;  5AQA A;  2Y3A A;  3AJI A;  5JJ7 A;  4XKB A;  5ITZ F;  1HFA A;  4CDM A;  2MOW A;  4GZ3 A;  3Q9N C;  4GML A;  3ULE G;  3CR3 A;  5EID A;  3ULQ A;  4U96 D;  4AIF A;  3KSQ A;  5DIZ A;  1HG5 A;  1Z5S C;  1H2U A;  3FUE A;  2L9B A;  4AY6 A;  3SD5 A;  2WQ7 A;  3ZXS A;  4XI9 A;  2JEK A;  3N71 A;  4N3B A;  4KVM A;  2FI7 A;  3NOG D;  3SY2 A;  2XGS A;  3Q79 A;  4DK5 A;  3U9W A;  3MX3 A;  4GYY A;  1N4S A;  2CHW A;  5T8I A;  3IHV A;  4I9C A;  4EPZ A;  4G2V A;  1IKN D;  3FH8 A;  4B93 B;  4BSX A;  4DLO A;  5G04 J;  1HE8 A;  3CST A;  5AQ9 A;  3MJW A;  1BD8 A;  4RVB A;  2V5Q C;  5FQ8 A;  3B95 A;  3JUI A;  4F1P A;  5ANL A;  3ZNG A;  4BT9 A;  3AU4 A;  4FP7 A;  1N94 A;  3IXE A;  4TXR A;  3Q9U C;  4H7Y A;  3CHP A;  4GCO A;  2DCP A;  3B7T A;  4NQ0 A;  2AJA A;  3ASO E;  3SO8 A;  1JCS A;  2FO1 E;  3QWV A;  2WQ6 A;  4MKT A;  2XS8 A;  5FIO A;  1BI7 B;  5FZS A;  4AY5 A;  2B6C A;  4HRN A;  1UJK A;  5JJ6 A;  4YDO A;  4K0R A;  3UX4 A;  4PS8 A;  3IKO B;  2XCC A;  2LXM A;  3ZYL A;  4KZC A;  4KXK B;  4FUL A;  3PE3 A;  5ENQ D;  5JA4 D;  2XCB A;  2Y69 E;  4RQI A;  4PS7 A;  4B94 A;  3UM2 A;  5JHB A;  4K5C A;  4DX5 D;  3QAQ A;  5KJM A;  3QB2 A;  2IFU A;  4BX9 A;  1EPU A;  3ZYM A;  4EZL A;  4G24 A;  4J8S A;  2UY1 A;  2KXP C;  4LNU D;  3HHM A;  3G2V A;  1HS6 A;  3MGB A;  5LCW J;  2KCL A;  2AXU A;  3ASD A;  5T3R A;  4UI9 C;  3RU0 A;  3GZ2 A;  2X6K A;  4N5C A;  5CER B;  1OWO A;  5CEA A;  4G26 A;  2J8S D;  1Y8M A;  2X6I A;  1YA0 A;  4HOU A;  4HOT A;  2R17 C;  3FTV A;  4H7X A;  2WXO A;  1NL4 A;  1NA0 A;  2C0L A;  2IF4 A;  2XGM A;  4AV7 A;  1OWP A;  3FFL A;  2L6J A;  1B89 A;  3T8M A;  2PNN A;  2P9K G;  2OEW A;  3FUM A;  4TUU A;  4B8C B;  3PZ3 A;  3APF A;  3Q7F A;  4BT8 A;  4N2S A;  3TWQ A;  2VGY A;  1KZO A;  3IEG A;  3ZPJ A;  5J90 A;  3VLD A;  3B7B A;  3T5V A;  4JVS A;  2F8X K;  2QYU A;  4BSZ B;  3SBT B;  3FUH A;  2XRY A;  4AEZ C;  3UM1 A;  1TYQ G;  3D9H A;  4JW1 A;  2OCC E;  2E2E A;  4YVQ C;  3CHQ A;  3EIQ C;  3UMV A;  4DPR A;  1LD8 A;  3TXM A;  2IO3 C;  5EN5 D;  4GMJ A;  5FTP A;  3PZ4 A;  3FTZ A;  5FQ7 A;  3B7R L;  2ZIR A;  2IJG X;  1QZ2 A;  4HB5 A;  2KC7 A;  3UI2 A;  3V2X A;  2GGF A;  2IO2 C;  4RLY A;  1SQM A;  1WAO 1;  3SF4 A;  4B0Z A;  5M72 A;  2I1K A;  3FUN A;  2UWJ G;  3Q4A B;  5LFA A;  1MZC A;  5E76 A;  3VTX A;  5KWD A;  1E7V A;  1KLX A;  4J8D A;  2CFU A;  3AS5 A;  2KZT A;  4JA9 A;  3HXC A;  5HRY A;  4WWP A;  2KM4 A;  3F6Q A;  2AXZ A;  3G2U A;  4G1T A;  3L82 A;  1JCR A;  5FT9 A;  1H0A A;  1TEZ A;  2R2L A;  3UIN C;  1UN8 A;  1LD7 A;  1N54 A;  2FO7 A;  5G05 J;  1HG2 A;  3UQ3 A;  4N3C A;  5FIN A;  3DEP A;  4HRM B;  3LDZ A;  4PDX A;  3APC A;  4FHJ A;  1E96 B;  2WXH A;  4GZ5 A;  4JB8 P;  5CEC B;  4BTA A;  3HDX A;  5KJN A;  3X2Q E;  1DNP A;  3JYS A;  2J49 A;  5HI7 A;  3L13 A;  1S70 B;  5HS0 A;  2NXP A;  2EIM E;  3CVQ A;  3PNT B;  1HX8 A;  3NZS A;  4L7T A;  1NI1 A;  3NB2 A;  3MKQ A;  4ANV A;  1X81 A;  3Q47 B;  2WXR A;  4C0M A;  5FQ4 A;  2ILR A;  3FUD A;  3ZFW A;  2P9S G;  3IV0 A;  3CHS A;  3HVE B;  3ABK E;  2C2L A;  2GRR B;  2GRO B;  1N0R A;  2ETB A;  3G2S A;  5KJL A;  3I5P A;  4V3I A;  1Q2Z A;  3UTM A;  3C72 A;  4CCA A;  3CHM A;  4E85 A;  1EF1 C;  3D9I A;  1V54 E;  1S63 A;  3ZXP A;  3FUJ A;  3T5X A;  2WQH A;  3KAE A;  4QFV A;  4P29 A;  3SFZ A;  1FVF A;  3FY4 A;  3L22 A;  3TAX A;  4A63 B;  4TV3 A;  4YVO A;  3MYV A;  1OCR E;  2LSV A;  2R05 A;  3P1U A;  3PDN A;  3FUK A;  3ZW3 A;  2WXK A;  3FEY A;  3ZHE B;  4YDE A;  4HOS A;  5CRV A;  1D8D A;  3LY7 A;  1H2V C;  4ACL A;  2VGX B;  1XNF A;  1INZ A;  1UG3 A;  4ILH B;  4E6H A;  4J0U A;  1A5E A;  2BKG A;  3ESK A;  4I6G A;  3FTX A;  2DBA A;  4KVO A;  5CMY A;  1QYM A;  3FU6 A;  4FC8 A;  1PC2 A;  3AG1 E;  3D9L A;  3TGO A;  1KT1 A;  3QWP A;  4UQY A;  1X5B A;  2WXG A;  4LNB A;  3OXF A;  3CVV A;  4GTQ A;  4U07 A;  1AP7 A;  4TUM A;  4I1A A;  5ENP D;  4GPK A;  2WXN A;  2ZU6 B;  2XGO A;  3DPD A;  3JUE A;  1O1R A;  3G2T A;  2MHK A;  3IHY A;  4JL0 A;  1JWG A;  2J09 A;  4HOQ A;  3D9P A;  4XKC A;  1BU9 A;  3ML9 A;  3RRN B;  5ANR A;  3HIZ A;  2P9I G;  5AAR A;  5EKQ D;  3DXK G;  3D9M A;  3AU5 A;  4UUC A;  3ASN E;  4A3T A;  3ASF A;  3CV0 A;  2MRI A;  5JJT A;  3ASH A;  2OOE A;  5B1B E;  2P9U G;  2P9P G;  3ONK A;  4DX7 D;  4J8E A;  3FU5 A;  3LXU X;  1BPO A;  5IY5 E;  1H6O A;  2ZGD A;  4I2W A;  4Z68 A;  4MS6 A;  1TR4 A;  5ARG A;  3S7J A;  4DUI A;  3CEQ A;  2R5S A;  5LP0 A;  4DI3 A;  4GTS A;  3SFX A;  4XX5 A;  3HRA A;  4FAD A;  3AS4 A;  3E37 A;  4TXP A;  4ATG A;  2H6I A;  5A23 A;  2DWZ A;  3UUX A;  2X6J A;  1KZP A;  2XHE A;  2XPY A;  2R03 A;  4K5A B;  4JHJ A;  4HFG A;  4J7W A;  4HLL A;  4PH4 B;  3FH5 A;  3Q5M A;  4HNA D;  2FUL A;  5FWQ A;  3HXD A;  4I17 A;  3L08 A;  4U0Z A;  4F53 A;  3QKY A;  1OT8 A;  1H6K A;  4J6I A;  3JQ1 A;  3I3N A;  3CGH A;  1IHB A;  5A6C A;  1NZN A;  3CHO A;  1O1T A;  4R7L A;  4K5B A;  4JA7 A;  4EZJ A;  3AG3 E;  3NBN B;  4BWR A;  4UWG A;  1SZA A;  3CK9 A;  1OY3 D;  4U7E B;  3O4Z A;  1SW6 A;  4WND A;  2F8Y A;  3E34 A;  3ABL E;  1DCE A;  4ILI A;  2PQN A;  3EHM A;  5H7P A;  1OXJ A;  3FUI A;  4BES A;  4BX8 A;  5CBN A;  1SA5 A;  1RZ4 A;  4GB9 A;  1YCS B;  4HVB A;  1U2V G;  2VTB A;  2F0Y A;  2GRQ B;  3ZKJ A;  1H2T C;  3L54 A;  2BUG A;  3RK6 A;  1K3Z D;  1MQS A;  3CK8 A;  4FJY A;  1UN9 A;  2I6H A;  2KAT A;  3L9T A;  4Q69 A;  2QZA A;  1FPP A;  3OXL A;  1O1S A;  1FCH A;  3FUF A;  2FEZ A;  3PVL A;  5KJK A;  3APD A;  4GZC A;  2JLB A;  1ZBP A;  5ENO D;  2X3M A;  3U3W A;  2QYJ A;  2BKK B;  5ENT D;  2HE0 A;  5JMN D;  3MEK A;  1V55 E;  4C48 B;  1E8Z A;  4ME2 A;  4K03 A;  3RSE G;  1N11 A;  4OYS A;  1TN6 A;  1A17 A;  4I6E A;  4TRQ A;  2I1J A;  2DVW A;  4ILG A;  3MV2 B;  3BU8 A;  2HM8 A;  3G2W A;  2IQC A;  2XZD G;  4QQI A;  3GYZ A;  1JPL A;  3NQP A;  3LY9 A;  3D9K A;  3VLF A;  3NF1 A;  1E7U A;  1K1A A;  4WNE A;  2VGE A;  2EQX A;  3ABM E;  3RJV A;  2C0M A;  1MX6 A;  4CRW A;  3ZUV B;  4CEM A;  3QOU A;  3U64 A;  4HI9 A;  4NUR A;  3UXG A;  2XEV A;  3B7S A;  1WDY A;  3DRA A;  3T8K A;  2XS1 A;  5EYL A;  4HLE A;  2HR2 A;  5AQB A;  4ANX A;  1TJF A;  5CED B;  4M3O A;  4A3V A;  4PS3 A;  2A5U A;  3ZRH A;  2L6B A;  1TN7 A;  1U3D A;  4D10 C;  3CVL A;  1JWF A;  4AVX A;  3QK0 A;  5G04 C;  4GYW A;  1HF8 A;  3FUL A;  4IRU A;  3QNK A;  1PAQ A;  3FDH A;  2CG3 A;  1FT2 A;  3AG2 E;  4LSZ E;  4PUC A;  2WMN A;  4O1P A;  5BPP A;  4GZ6 A;  2ION A;  5CCL A;  4G25 A;  2J08 A;  4GTV A;  4GTT A;  4N3A A;  3PNL B;  3KSL A;  2YHE A;  5G2N A;  4JHK A;  1VDY A;  1JCQ A;  4LCT A;  1KPS B;  5E75 A;  4EBA A;  4KMO A;  3L6A A;  4CYM D;  2XEE A;  3V31 A;  4AOF A;  1D8E A;  4IN3 B;  2Y4U A;  5A7D B;  5LX8 A;  1OCC E;  3UT8 A;  4CZ2 D;  2XEN A;  4WWO A;  2IEJ A;  2RKK A;  3SI5 A;  2KZT B;  1JUQ A;  3L16 A;  3IBE A;  4RSY A;  2WB2 A;  5AAO A;  1IQU A;  5FJY A;  4BER A;  3OTN A;  2IY0 C;  4XI0 A;  4W9R A;  5D2M C;  5D66 A;  2IOS A;  1RW2 A;  2J9Q A;  3C3R A;  4CGW A;  4JEU A;  4G11 A;  1TNB A;  4L2L A;  3CVW A;  3TWW A;  4RG9 A;  5BNW A;  3TWX A;  1SA4 A;  4ABN A;  2DYS E;  1N4P A;  2V4H C;  3RRU A;  5B3S E;  1OWN A;  4B8A A;  2WMO A;  5LCW C;  3LJ3 A;  3TG5 A;  4U8V D;  5AJL A;  2WXI A;  1E90 A;  2WVI A;  3LPZ A;  3BG0 B;  5CRU A;  4CT0 A;  2JAB A;  3KEA A;  2BTD A;  2P9N G;  3ZYQ A;  3QJZ A;  3MKQ B;  2ETA A;  3PZ1 A;  2XQ0 A;  3EDT B;  2XPI A;  1WM5 A;  1P5Q A;  2R02 A;  3PH0 C;  3TG4 A;  4G8L A;  2NSZ A;  3CSF A;  1LF8 A;  3FU0 A;  3KS2 A;  4J8F A;  3W9F A;  1ELK A;  1H6P A;  3S7F A;  4GTM A;  2WPV A;  3J5Q B;  4LNG A;  4DX6 D;  3GZ1 A;  4NIK A;  1QNF A;  3LYA A;  2VGX A;  3FU3 A;  4ANU A;  3CQC B;  2V5F A;  4BY6 A;  1HXI A;  4GAA A;  1N9A A;  2FBN A;  3D9J A;  3ISM C;  5BV1 A;  4N5Q A;  2DYR E;  3V79 K;  4ATZ D;  4U04 A;  3FHE A;  1DC2 A;  4I9E A;  3Q7A A;  1O5M A;  2OVB A;  3TWT A;  1ZU2 A;  1Z6T A;  3MA5 A;  5ARF A;  4UWH A;  3SHF A;  4Y6C A;  2QY7 A;  2WXJ A;  1IQR A;  5DBK A;  3CVN A;  3NOC D;  1PY1 A;  5HKP A;  4OVV A;  4BFR A;  2A4Z A;  2GRM A;  3HYM B;  3CK7 A;  3EU5 A;  3Q49 B;  4JZY A;  2KCK A;  2CHZ A;  4XZ4 A;  3JXJ A;  4GMR A;  2Y4T A;  1UJJ A;  2VQ2 A;  2VSX E;  4WAF A;  3VLE A;  3R9A B;  3JQ0 A;  3AS8 A;  5D0Q D;  3R9M A;  3QWW A;  2NC9 A;  2EIL E;  4IYP A;  3URZ A;  3JCK C;  2LO6 A;  3CQG B;  2R59 A;  3MKR A;  4UI9 J;  3I4G A;  3RIB A;  2RFM A;  3SFY A;  4F3V A;  3TXN A;  2OEV A;  2XZT G;  2EIN E;  5G05 C;  3NAW A;  3J5P A;  1NA3 A;  3ZGQ A;  3W9G A;  1K1B A;  4I2Z A;  5AN8 A;  3UM3 A;  3PUJ A;  5B1A E;  3C98 A;  1MJ0 A;  4DLQ A;  3ZN3 A;  4G23 A;  4WUY A;  5BXU A;  1KT0 A;  3KEZ A;  5AJD A;  2AWI A;  4EQF A;  5C1D A;  4MBG A;  2L0T B;  3L17 A;  4OAV B;  1Y6I A;  5FZQ A;  3EHN A;  3E30 A;  3DXM G;  4X8Q A;  2Y1L E;  3UKR G;  3HG0 D;  4HI8 A;  1OWM A;  1TJC A;  3PZ2 A;  3QAR A;  3EIJ A;  3GW4 A;  3U4T A;  3C3O A;  4WNG A;  2DIW A;  2MYO A;  5C2Y A;  2YNQ A;  3LVR E;  3UIO C;  1MYO A;  1TNO A;  4JEH A;  2RD0 A;  4A55 A;  1TN8 A;  4NRH B;  5G55 A;  1W3B A;  4HRL A;  2GRP B;  1LTX A;  3UIP C;  5CBO A;  2PM7 A;  2PM6 A;  1FT1 A;  3CLJ A;  3PZD A;  5ENR D;  4JD2 G;  2OV8 A;  4MRU A;  4Y6W A;  2CFZ A;  4MLP A;  3E4B A;  3RO2 A;  2LUH A;  3DWL G;  3ZIM A;  2IU1 A;  1DCQ A;  5FQ6 A; 
#chains in the Genus database with same CATH homology
 3VLF A;  3NF1 A;  1E7U A;  1HU3 A;  4A1G A;  4WNE A;  4CGV A;  3FTW A;  2EQX A;  4XIF A;  2NXP A;  3CVQ A;  3PNT B;  1U3C A;  2LNI A;  5AYW D;  4UWL A;  3RJV A;  2C0M A;  3LKU A;  3LCA A;  1HX8 A;  4KZ0 A;  3NZS A;  3UT7 A;  3ONL A;  2J07 A;  4CRW A;  2Q7F A;  2YIN A;  4L7T A;  4CEM A;  5ENN A;  3QOU A;  3U64 A;  3B7U X;  5HI7 A;  3MKQ A;  5BT1 A;  3PRE A;  4NUR A;  4ANV A;  2XEV A;  3B7S A;  5HQ8 A;  1E8X A;  3Q47 B;  3FWV A;  3B13 A;  1FVH A;  5EX0 A;  4HLE A;  2HR2 A;  2HO1 A;  2WXR A;  3D9O A;  2AW6 A;  4ANX A;  4C0M A;  1TJF A;  2YQ8 A;  5FQ4 A;  4XE0 A;  3EJN A;  4M3O A;  2ILR A;  3FUD A;  3SBS A;  1IHG A;  3S7D A;  4A1S A;  4A3V A;  4I1M A;  1N52 A;  2X38 A;  3U66 A;  2V0P A;  3ZFW A;  3WXX A;  3NZU A;  3IV0 A;  3DBS A;  4PS3 A;  4UQX A;  3CHS A;  3HVE B;  2WXL A;  2WXF A;  2A5U A;  4L2Y A;  3ZRH A;  2C2L A;  2GW1 A;  1E8Y A;  1U3D A;  2QFC A;  4D10 C;  3CVL A;  1JWF A;  4AVX A;  4C0E A;  3RO3 A;  3QK0 A;  5G04 C;  4FLB A;  5CMW A;  1OUV A;  4GYW A;  3G2S A;  5KJL A;  2M63 A;  2Y3A A;  3I5P A;  4V3I A;  4XKB A;  1HF8 A;  5JJ7 A;  4APF A;  2WM9 A;  3FUL A;  4IRU A;  4CCA A;  3CHM A;  4E85 A;  2VSN A;  3QNK A;  4GA1 A;  4GA2 A;  1HFA A;  4CDM A;  1EF1 C;  2X6H A;  3D9I A;  2MOW A;  4I43 A;  4GZ3 A;  4URK A;  3D3M A;  1PAQ A;  4GML A;  3FDH A;  2CG3 A;  3CR3 A;  4PUC A;  2I9C A;  2WMN A;  4YND A;  5BW8 C;  5BPP A;  3FUJ A;  4GZ6 A;  3T5X A;  2ION A;  2WQH A;  3KAE A;  4QFV A;  5CCL A;  4P29 A;  4GYO A;  4IUL A;  3SFZ A;  4G25 A;  3ULQ A;  1FVF A;  3FY4 A;  4AIF A;  3KD7 A;  3L22 A;  3TAX A;  2P58 C;  2J08 A;  1EDU A;  2VTB B;  4TV3 A;  4YVO A;  3LS8 A;  3MYV A;  5DIZ A;  3ML8 A;  2LSV A;  4N3A A;  4UQZ A;  3PNL B;  3P1U A;  1HG5 A;  3S2A A;  2VSY A;  3PDN A;  1H2U A;  2YHE A;  3FUE A;  4U0S A;  3FUK A;  5G2N A;  3ZW3 A;  4JHK A;  3TL5 A;  2WXK A;  3FEY A;  3R7Q A;  1VDY A;  3CHR A;  4AJW A;  4LCT A;  5E75 A;  3RKV A;  4HS2 A;  2L9B A;  4I6J A;  3SD5 A;  4KMO A;  4EBA A;  4AY6 A;  3ZHE B;  3L6A A;  3ZXS A;  2WQ7 A;  4XI9 A;  4HOS A;  4AOF A;  2UY1 B;  4IN3 B;  2JEK A;  3LY7 A;  4UI9 K;  3LVQ E;  3N71 A;  2Y4U A;  5A7D B;  4N3B A;  4B89 A;  5LX8 A;  1H2V C;  4ACL A;  2VGX B;  1XNF A;  4KVM A;  2FI7 A;  3UT8 A;  1INZ A;  1UG3 A;  2WXM A;  4ILH B;  3FH7 A;  4U8H A;  4WWO A;  4E6H A;  2LSU A;  4RG6 A;  4J0U A;  4U0U A;  3SI5 A;  2KZT B;  1JUQ A;  3ESK A;  2XGS A;  3IBE A;  3L16 A;  4RSY A;  2WB2 A;  3RRM B;  3ZVV A;  4I6G A;  4DK5 A;  3U9W A;  3MX3 A;  4GYY A;  2BF0 X;  1IQU A;  5FJY A;  4LUN U;  3OTN A;  4FU3 A;  1HZ4 A;  3FTX A;  4XI0 A;  3PS6 A;  2DBA A;  4W9R A;  4KVO A;  4ACK A;  2CHW A;  5T8I A;  1GW6 A;  3IHV A;  2IOS A;  5CMY A;  2J9Q A;  4I9C A;  4EPZ A;  4G2V A;  4CGW A;  3PRZ A;  4JEU A;  3FU6 A;  4G11 A;  5EDS A;  4FC8 A;  3FH8 A;  1PC2 A;  4BSX A;  5CHE E;  4DLO A;  5G04 J;  1HE8 A;  4L2L A;  3D9L A;  3CST A;  3CVW A;  3MJW A;  1KT1 A;  3TGO A;  4RG9 A;  5BNW A;  4RVB A;  3QWP A;  3Q15 A;  3OXG A;  4UQY A;  1X5B A;  5FQ8 A;  2AXV A;  2WXG A;  1UW4 B;  3OXF A;  3CVV A;  4ABN A;  3JUI A;  3SNX A;  2E0I A;  5ANL A;  3RRU A;  2LAI A;  4U07 A;  2OND A;  4I1A A;  3LY8 A;  4GPK A;  1OWN A;  2WXN A;  2ZU6 B;  2XGO A;  4I1O B;  4AP2 A;  4O6F A;  3AU4 A;  2WMO A;  4B8A A;  4BT9 A;  4FP7 A;  5LCW C;  3DPD A;  2VSO E;  4FJZ A;  3LJ3 A;  3TG5 A;  1S0P A;  5AJL A;  3S7B A;  4GU5 A;  3ESL A;  3G2T A;  4EZK A;  2MHK A;  2WXI A;  4Q96 A;  3IHY A;  3CHP A;  4GCO A;  1E90 A;  4H7Y A;  2WVI A;  2DCP A;  3B7T A;  3LPZ A;  1JWG A;  4JL0 A;  5CCM A;  3BG0 B;  5AEN A;  4NQ0 A;  5BUZ A;  1MHQ A;  1WY6 A;  2J09 A;  4F1S A;  4HOQ A;  3D9P A;  4XKC A;  1Z3X A;  3ML9 A;  3QWV A;  3RRN B;  5ANR A;  4CT0 A;  3HIZ A;  2WQ6 A;  2RG8 A;  3QDN A;  2BTD A;  4MKT A;  3D9N A;  3ZYQ A;  3QJZ A;  5FZS A;  4EBA G;  4AY5 A;  3MKQ B;  5EKQ D;  5AIJ A;  4GCN A;  2XQ0 A;  3D9M A;  3AU5 A;  5KCM A;  1E8W A;  1UJK A;  1Z3Y A;  4A3T A;  3EDT B;  3ASF A;  2XPI A;  3CV0 A;  5JJ6 A;  1WM5 A;  2MRI A;  5JJT A;  2AVP A;  1P5Q A;  3PH0 C;  3ASH A;  4K0R A;  3TG4 A;  3UX4 A;  3UPV A;  2OOE A;  2NSZ A;  4PS8 A;  2OVF A;  3IKO B;  4GZD A;  3CSF A;  2XCC A;  2WXQ A;  3ZYL A;  3ONK A;  1LF8 A;  4KZC A;  2FF4 A;  3R7R A;  2I2O A;  3FU0 A;  4J8E A;  4KXK B;  4FUL A;  3FU5 A;  3PE3 A;  5T4Y A;  3LXU X;  3KS2 A;  1BPO A;  1HH8 A;  4FLH A;  4J8F A;  2XCB A;  2V8S E;  5LOZ A;  5J08 A;  4I2W A;  4C9B B;  3UT4 A;  4PS7 A;  1HO8 A;  4B94 A;  4FA6 A;  5JHB A;  3CVX A;  4MS6 A;  1ELK A;  3P2B A;  3QAQ A;  5KJM A;  2V4L A;  3QB2 A;  5ARG A;  3S7F A;  2IFU A;  4BX9 A;  4LEU A;  1EPU A;  3S7J A;  3ZYM A;  4WWN A;  4OVU A;  4N2Q A;  2WPV A;  3CEQ A;  3MV3 B;  4EZL A;  2HYZ A;  4G24 A;  4J8S A;  1XGW A;  2R5S A;  3GZ1 A;  2UY1 A;  4NAC A;  4FHK A;  1QNF A;  5LP0 A;  4DI3 A;  3LYA A;  2VGX A;  3FU3 A;  3HHM A;  3OAW A;  3G2V A;  3PEV B;  1HS6 A;  4ANU A;  3MGB A;  3CQC B;  2KCL A;  2AXU A;  3ASD A;  5T3R A;  5LCW J;  4UI9 C;  4XX5 A;  2J4D A;  3RU0 A;  3GZ2 A;  4UWF A;  1H19 A;  2V5F A;  4BY6 A;  2X6K A;  4N5C A;  4FAD A;  1HXI A;  1OWO A;  3AS4 A;  4GAA A;  4ATG A;  2FBN A;  1L5J A;  4G26 A;  2CHX A;  2PQR A;  5A23 A;  3D9J A;  5BV1 A;  3UUX A;  2X6J A;  1Y8M A;  2X6I A;  1YA0 A;  4HOU A;  4U04 A;  2XHE A;  3FHE A;  4HOT A;  2R17 C;  2XPY A;  3FTV A;  4I9E A;  4H7X A;  2WXO A;  4KT6 B;  1ELR A;  4APO A;  2OVB A;  1NA0 A;  4JHJ A;  2XRZ A;  1ZU2 A;  1Z6T A;  2C0L A;  3BEE A;  3MA5 A;  2IF4 A;  4HFG A;  5ARF A;  4U63 A;  3I4R B;  3MCX A;  4UWH A;  3FTY A;  4JXT A;  3FH5 A;  2XGM A;  4PH4 B;  3SHF A;  4AV7 A;  4WNF A;  3Q5M A;  1OWP A;  2QY7 A;  2WXJ A;  3FFL A;  4Y6C A;  2L6J A;  1IQR A;  2FUL A;  5FWQ A;  1B89 A;  2IOL A;  3CVN A;  5DBK A;  3T8M A;  5BV0 A;  1PY1 A;  4I17 A;  3K9I A;  3L08 A;  4U0Z A;  4OVV A;  4F53 A;  3QKY A;  4BFR A;  2LAH A;  4LER A;  2A4Z A;  2KCV A;  3FUM A;  4TUU A;  4B8C B;  4CDN A;  3CVY A;  3APF A;  2GRM A;  3HYM B;  1SZ9 A;  1H6K A;  3CKC A;  4J6I A;  4CDR A;  4BT8 A;  4N2S A;  3JQ1 A;  3I3N A;  3CGH A;  3CK7 A;  5A6C A;  2VGY A;  3PUK A;  2PZI A;  3Q49 B;  3ZYK A;  4JZY A;  1NZN A;  2CHZ A;  2KCK A;  3IEG A;  4XZ4 A;  3ZPJ A;  3ZEF A;  4HXI A;  3VLD A;  5J90 A;  4L1B A;  4BTB A;  3CHO A;  4GA0 A;  2Y4T A;  1UJJ A;  2VQ2 A;  2VSX E;  4JC8 A;  2L0I A;  3T5V A;  1IYG A;  4R7L A;  4WAF A;  4JVS A;  4JA7 A;  3VLE A;  3VTY A;  4EZJ A;  3R9A B;  3JQ0 A;  3PE4 A;  3SBT B;  3AS8 A;  3FUH A;  4KYO B;  5D0Q D;  4BWR A;  3QWW A;  4IYP A;  2NC9 A;  4UWG A;  3URZ A;  1SZA A;  2XRY A;  3CK9 A;  3HVE A;  3JCK C;  3O4Z A;  4Q94 A;  4AEZ C;  2LO6 A;  4JW1 A;  3TJP A;  2E2E A;  3CQG B;  4YVQ C;  5EX3 A;  2R59 A;  3CHQ A;  3QC1 A;  3EIQ C;  4WND A;  4HOR A;  3MKR A;  4UI9 J;  3I4G A;  3RIB A;  4F3V A;  3TXN A;  3UMV A;  4DPR A;  2VYI A;  5G05 C;  3TXM A;  3CKB A;  3SGH A;  4ILI A;  4GMJ A;  5FTP A;  2PQN A;  3EHM A;  5FZR A;  4CT4 A;  3FTZ A;  5FQ7 A;  3B7R L;  1NA3 A;  4JPS A;  3ZGQ A;  1OWL A;  2GRL A;  4I2Z A;  2IJG X;  3MZL B;  1QZ2 A;  2KC7 A;  3FUI A;  2WXP A;  3PUJ A;  2GGF A;  3C98 A;  4BX8 A;  3FEX A;  4DLQ A;  1SQM A;  4GB9 A;  4LRZ A;  1WAO 1;  3PEU B;  3ZN3 A;  4HVB A;  2VTB A;  4G23 A;  4WUY A;  4ANW A;  3SF4 A;  4B0Z A;  4AXH A;  1KT0 A;  3KEZ A;  5AJD A;  5M72 A;  2I1K A;  1H2T C;  3FUN A;  3L54 A;  2AWI A;  4DJA A;  3CVP A;  2BUG A;  2PL2 A;  2UWJ G;  4EQF A;  5C1D A;  3RK6 A;  3Q4A B;  5LFA A;  2XPZ A;  5D0O D;  1MQS A;  3CK8 A;  4FJY A;  1UN9 A;  5E76 A;  2L0T B;  3L17 A;  1Y6I A;  2I6H A;  5FZQ A;  3EHN A;  4N39 A;  3VTX A;  3ZHE A;  4AM9 A;  2KAT A;  1E7V A;  1NP7 A;  3O48 A;  4EEC A;  1KLX A;  4Q69 A;  3ENE A;  3GZS A;  3OXL A;  3FTS A;  3LEW A;  1FCH A;  3FUF A;  2FEZ A;  3PVL A;  4J8D A;  3BG1 B;  4JHR A;  2CFU A;  1OWM A;  1TJC A;  2VJ8 A;  2J4B A;  3QAR A;  3APD A;  5KJK A;  4GZC A;  3EIJ A;  3AS5 A;  2KZT A;  3SZ7 A;  3FP3 A;  2JLB A;  3GW4 A;  4JA9 A;  1ZBP A;  4WWP A;  4UWK A;  2KM4 A;  3U4T A;  1DVP A;  2X3M A;  4WNG A;  2AXZ A;  2DIW A;  3G2U A;  4G1T A;  3U3W A;  5C2Y A;  2YNQ A;  3LVR E;  2YHC A;  5FT9 A;  4F7A A;  1QQE A;  1H0A A;  3MEK A;  4DI4 A;  1E8Z A;  2CG2 A;  4ME2 A;  1TEZ A;  4JEH A;  4K03 A;  2RD0 A;  3FTU A;  1UN8 A;  3CVU A;  1N54 A;  2FO7 A;  4A55 A;  5JHA A;  4NRH B;  5G55 A;  5G05 J;  1W3B A;  4OYS A;  2X6F A;  1HG2 A;  1A17 A;  4I6E A;  3UQ3 A;  4N3C A;  2PM7 A;  2PM6 A;  3CLJ A;  3PZD A;  4TRQ A;  2I1J A;  4ILG A;  2OV8 A;  3MV2 B;  4KBQ A;  3LDZ A;  4PDX A;  3APC A;  4FHJ A;  3ASG A;  1E96 B;  2WXH A;  3CIA A;  2HM8 A;  3G2W A;  4GZ5 A;  2IQC A;  4MRU A;  4Y6W A;  2CFZ A;  4MLP A;  3E4B A;  3GYZ A;  4BTA A;  1JPL A;  3RO2 A;  3HDX A;  5KJN A;  1ELW A;  1DNP A;  3JYS A;  1EYH A;  2IU1 A;  2J49 A;  3NQP A;  4L23 A;  5FQ6 A;  3LY9 A;  3ZIM A;  3D9K A;  3L13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...