3RKVA

C-terminal domain of protein c56c10.10, a putative peptidylprolyl isomerase, from caenorhabditis elegans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
147
structure length
147
Chain Sequence
LKSVEALRQKGNELFVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKADSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C-terminal domain of protein C56C10.10, a putative peptidylprolyl isomerase, from Caenorhabditis elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Isomerase
molecule keywords putative peptidylprolyl isomerase
total genus 63
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rkvA00
4J8EA 4AIFA 3CVQA 4N2QA 2J9QA 4HOQA 2P58C 2KCLA 1XNFA 2YHCA 4U04A 2HR2A 5FT9A 4YVOA 3R9AB 1HH8A 1WAO1 1Y8MA 2HO1A 2Q7FA 2IF4A 2UY1A 2VYIA 2VSYA 3Q4AB 4GZ6A 4J0UA 4YNDA 5EKQD 5EX0A 5AYWD 5CCMA 3NF1A 4WNFA 3TG5A 3URZA 3UUXA 3LY8A 3KAEA 4AY5A 4AY6A 1NZNA 2C0LA 3GW4A 4Y6CA 2L6JA 5G04J 3RIBA 2XGSA 2Y4UA 3CKBA 5ARFA 1A17A 3U4TA 1IHGA 3TGOA 3FP3A 3RJVA 4APOA 2IFUA 4U0SA 4XIFA 5FZQA 4G1TA 5BW8C 4GPKA 4ABNA 1ELRA 4KBQA 3GZ2A 5A6CA 2FF4A 2VGXA 2PQRA 3IEGA 3TG4A 2LSUA 2WQHA 3MA5A 5FTPA 4GCOA 4N5CA 4G26A 4UQZA 1FCHA 3MV3B 5KJLA 3GZ1A 3LY9A 3QDNA 4UI9J 2XCBA 3Q47B 4BTBA 3WXXA 3OXFA 4HOUA 4G2VA 1QZ2A 3RO2A 3ZFWA 4W9RA 4XI9A 3E4BA 2KC7A 4JHRA 4WNEA 2HYZA 4YVQC 5LCWJ 4J8DA 5KJNA 3N71A 4I9CA 2OOEA 5JJTA 4GYYA 3CK9A 3LKUA 3KD7A 1E96B 2UWJG 3CVLA 4RG9A 5EX3A 4I2WA 4CDRA 2V5FA 3ZN3A 3LCAA 3HYMB 3RKVA 2MHKA 2VQ2A 3CK7A 3SF4A 2XGOA 4N3CA 4CGVA 5G05J 2PQNA 3KS2A 4ME2A 4O6FA 3TAXA 4HOSA 4WUYA 2R5SA 1KLXA 4UI9K 4UQYA 2XGMA 4HOTA 3PE4A 4GYWA 4H7XA 1WM5A 3LPZA 5FJYA 3PE3A 4I1AA 5FZRA 3OXLA 1NA3A 2NC9A 1TJCA 4U0ZA 1KT1A 2ONDA 2GW1A 2XCCA 4I17A 3CV0A 3K9IA 3ZHEA 3FFLA 4UQXA 4B94A 4H7YA 4LEUA 5G04C 5G05C 4GA1A 2WPVA 3ULQA 5DIZA 2FI7A 4N39A 5BNWA 2VSNA 2PL2A 2C0MA 3AS4A 5KJMA 3LY7A 4A1SA 2C2LA 4NRHB 5CHEE 1KT0A 4AM9A 5A7DB 5LCWC 4GA2A 5JJ6A 5JJ7A 5DBKA 2FO7A 3ESKA 1B89A 1W3BA 2KCKA 4JA7A 3CKCA 3BEEA 4JL0A 3RO3A 3ASFA 1ZBPA 2LSVA 4G24A 3MV2B 3QWVA 4XI0A 1PC2A 3MEKA 3LYAA 5C1DA 4BT8A 4N3AA 2KATA 3QKYA 4RG6A 2LNIA 3Q49B 3MKRA 3QWPA 3U3WA 3ZGQA 4NQ0A 2E2EA 4BTAA 1P5QA 4Y6WA 2VGYA 4I2ZA 3S7BA 4N2SA 4GCNA 4U0UA 4G23A 2BUGA 3OXGA 4I9EA 5D0QD 3S7FA 1YA0A 2FBNA 2XPIA 4BWRA 3RU0A 2VGXB 4F3VA 4GZ3A 2QFCA 1HZ4A 4GYOA 3ASDA 1ELWA 4J8FA 5HQ8A 2YQ8A 4BT9A 2XEVA 4JA9A 5FZSA 3AS8A 3SZ7A 3CEQA 1OUVA 2I6HA 4G25A 3ASHA 3ZHEB 3Q5MA 2DBAA 3JYSA 3FWVA 4GA0A 5D0OD 3S7JA 2KCVA 4WNGA 2PZIA 1HXIA 4KXKB 4U07A 4GZ5A 3ZPJA 4CGWA 4KYOB 3UPVA 3AS5A 1QQEA 3GYZA 3VTYA 5BT1A 3CVNA 2Y4TA 4IN3B 4N3BA 4UI9C 5HI7A 3Q15A 3PDNA 2JLBA 3CK8A 3ASGA 3S7DA 1NA0A 2UY1B 3QOUA 4EQFA 3QWWA 5CCLA 3CVPA 5KJKA 3VTXA 5M72A 5ARGA 1ZU2A 3EDTB 3UQ3A 2FEZA 1IYGA 2AVPA 4HORA 3O48A 4WNDA
chains in the Genus database with same CATH superfamily
3L13A 3E30A 3J5PA 3QK0A 4KVOA 2X6KA 1FVFA 3CKBA 3FP3A 2IEJA 5H7PA 3U66A 4N5CA 3GZ1A 2CG2A 1D9SA 4JC8A 2KC7A 2L0TB 2OOEA 3APDA 4BX8A 2XS8A 4KMOA 4CRWA 2RG8A 1H0AA 2EINE 2J09A 3TL5A 2YNQA 3KSQA 5A23A 3ZYKA 1TJCA 2VSXE 2GW1A 1V54E 3UM1A 1X5BA 3X2QE 3JQ1A 4MS6A 4P29A 3BQOA 3BUAA 5JJ6A 3BEEA 1SQMA 1ZBPA 3NAWA 3Q75A 3ZUVB 3F6QA 3HXDA 3L08A 2GGFA 3MKRA 4F7AA 3EIJA 3OXGA 1NP7A 2EQXA 1OUVA 5AJDA 3ZPJA 4CGWA 4KXKB 1SVXA 3FTWA 3SQVA 3NOGD 4HOTA 2AVPA 3O48A 3PEUB 4WAFA 2Q7FA 2VYIA 3LY8A 1O1TA 2Y69E 2L6JA 1IKND 3ONLA 4PS3A 1ELRA 3DBSA 3IEGA 3TWTA 1N0QA 5FTPA 4PUCA 5KNGA 3MZLB 4FHJA 5KJNA 2CHWA 4I9CA 2XS1A 2R05A 4AVXA 3LCAA 2XGOA 5G05J 2IQCA 3FU5A 1EYHA 1YYHA 1KLXA 4I1AA 4MRUA 4YDYA 4XKCA 4LG6A 3AG4E 4H7YA 3CGHA 5BV0A 4FU3A 2HM8A 4A1SA 2R59A 1E7VA 4KZCA 1B89A 4IULA 2CHXA 2LUHA 3BG0B 5FQ7A 4N3AA 3QWPA 3SY2A 1EPUA 4AXHA 3SHFA 4F3VA 2QFCA 1HZ4A 4BT9A 2DYRE 3NZSA 2I6HA 5D0OD 3AS5A 3VTYA 3D9LA 2H6HA 1TR4A 5M72A 5EILA 3ML9A 1SZ9A 5FT9A 2KCLA 5J08A 4HRMB 3PEVB 2HO1A 3ASNE 3FY4A 4DX5D 5T8IA 1KZOA 1H19A 3HG0D 4B8AA 4ABNA 4URKA 4IRUA 2PQRA 3CQGB 3EHNA 3T5XA 3QDNA 3HVEB 1U3DA 3E4BA 4EECA 4U8HA 1UJJA 3R9MA 1V55E 2WXKA 5ENQD 1E96B 2AXZA 2RFMA 1HU3A 1SZAA 5ENTD 2QYUA 5JA4D 3PREA 5ENRD 4I17A 4BESA 1MZCA 4B94A 4CYMD 2WPVA 2X6IA 2VSNA 3LY7A 5LFAA 5A7DB 3UIPC 5E76A 1N4QA 4K0RA 3ABLE 3ZRHA 1H6PA 3IHYA 4B0ZA 5C1DA 4U95D 3SFZA 4GTPA 3FTUA 4K03A 1KPSB 3UX4A 2IO3C 2FO1E 3EUVA 1OY3D 2GROB 3IBEA 2PM7A 4EBAA 3LDZA 3PZDA 5KJKA 4I6JA 5AQ9A 2YHCA 2HR2A 2P9KG 2IF4A 4LSZE 3URZA 3GZSA 1LD7A 3C5RA 1LD8A 4EZLA 5CBOA 3RJVA 1BU9A 2A5UA 5FZQA 4HNAD 3PZ3A 4FULA 5BPPA 3GZ2A 3E32A 4UWFA 4HVBA 4GCOA 3FUMA 1UJKA 2P9LG 5ENPD 2XQ0A 3UT4A 2XZDG 3PRZA 3ZFWA 3LJNA 4WNEA 5LCWJ 2OVBA 4C9BB 4GYYA 4BX9A 3LKUA 4GTVA 4I1OB 4HRNA 2FULA 1MX4A 1WM5A 3LEWA 5EIBE 2GRQB 3MX3A 2J8SD 3K9IA 3Q9NC 4NIKA 3B7SA 4PDXA 2P2CP 3CHPA 3OTNA 2ZU6B 5AQ7A 4AJWA 2BF0X 2R03A 4GTOA 1FVHA 4L9PA 1JPLA 4APFA 5JMND 3ESKA 2NYJA 2WXOA 3FEXA 5CMWA 4F1PA 3PNTB 1KZPA 4BT8A 1TNUA 3FUJA 4RG6A 3PUKA 2J07A 2LNIA 2XRZA 3PZ1A 3IV0A 5FQ6A 3TAXA 1MJ0A 2I1KA 1DCQA 3ASDA 4J8FA 2CHZA 4DI3A 4DJAA 2I9CA 4U96D 3S7JA 3WG7E 3AAAC 4I6GA 5ITZF 5T3RA 2OVFA 1UN8A 3CVPA 1PAQA 3ML8A 4Q94A 4HORA 1OXJA 4QFVA 2BKKB 4AIFA 2AJAA 4C0EA 1D8DA 5FQ4A 5T4YA 3C72A 5AYWD 2OV8A 5BUZA 3KAEA 1O5MA 3ABKE 2V4LA 4LERA 4LCTA 1A17A 4HI8A 3Q9UC 3C3OA 1EF1C 2J08A 2WQHA 1SW6A 3LY9A 2WXMA 3UM2A 2F8YA 1TN7A 3ESLA 3ISMC 2QYJA 3SD5A 2VQ2A 5ANRA 3HXCA 2XGMA 4ILIA 3IHVA 2IU1A 2F0YA 3NOCD 3OXLA 4FADA 3PNLB 1N11A 3UT8A 3CHOA 1U3CA 3AS4A 3UM0A 3FUEA 3APFA 2FO7A 1L5JA 4FC8A 3TXNA 3PVLA 3MV2B 4A55A 4ATZD 4J7WA 2VGYA 3JUIA 2QC9A 3D9HA 3SZ7A 3LXUX 2V8SE 2X6FA 2KCVA 4ANWA 4EZKA 3C98A 3KSLA 2LAHA 1N52A 2DZOA 1Z3YA 3EDTB 2E0IA 3U4TA 2P58C 4JVSA 3R9AB 5KBAA 5ANLA 2VSYA 5EKQD 1PY1A 3CHQA 4O60A 5BW8C 3ZXPA 3MA5A 3QJZA 1MYOA 4XI9A 4JHRA 4ATGA 5HRYA 1WY6A 2V5FA 3CK7A 4N3CA 4ME2A 2RKKA 3RAUA 4GAAA 3CSTA 3FU3A 4I43A 5KNHD 4Q69A 3DSUA 4M3OA 4UQXA 5G05C 3CLJA 2Y3AA 3R7QA 4J6IA 3AG2E 4AM9A 5BV1A 2WVIA 2ETAA 3ZVVA 1NI1A 2VGEA 4BTAA 3L9TA 3TXMA 4G23A 3S7FA 4G8KA 3I3NA 1Y6IA 5HQ8A 2YQ8A 2XZTG 1QNFA 3V79K 4KYOB 5KWDA 5BT1A 2DWZA 2KM4A 5CERB 4OAUC 2WXQA 4JHKA 3AG1E 4A3VA 3DSVA 1OCZE 2MOWA 2HE0A 4QQIA 5D66A 4GTQA 3NQPA 5HS0A 3UINC 4TXRA 4ANVA 3TG4A 5FIOA 2WMNA 3G2VA 4BTBA 1N54A 5IY5E 4W9RA 1VDYA 5AENA 2LAIA 2RFAA 3L6AA 2OEWA 3FTVA 2JABA 1MX2A 4O6FA 4JXTA 4J8YA 1BI7B 3CVYA 5EN5D 2WB2A 3FTZA 3FFLA 4PH4B 3J5QB 4FHKA 2A5EA 2J49A 4Q96A 1S63A 1TNZA 1W3BA 3ASFA 4GU5A 4WWOA 4Y6WA 2PNNA 4GPMA 1TN6A 4GYOA 1ELWA 2XEVA 3ASOE 4AOFA 4O1OA 3JYSA 4HB5A 1HXIA 5FWQA 3B13A 3UQ3A 2FEZA 4B89A 2M63A 1XNFA 2LXLA 3UKRG 4AY5A 1FT2A 5G04J 3V30A 4LRZA 4RQIA 3FUIA 5A6CA 1K3ZD 2LXMA 3MV3B 5KJLA 2OCCE 4UI9J 2XCBA 3Q47B 1HG2A 1DC2A 3I5PA 5JJTA 3CHMA 2CG3A 2H6FA 2PQNA 3SFXA 4BSZB 3D9MA 4UQYA 3D3MA 1TNOA 3IKOB 2XPZA 4PS8A 2WXLA 5KJMA 3LJ3A 2XENA 3CR3A 4NRHB 1Z5SC 3L82A 1IQUA 4C0MA 4DPRA 4EBAG 3HXBA 2L0IA 3DSWA 3DXMG 1P5QA 5J90A 4OAVB 4GMRA 2B6CA 4U0UA 2BUGA 3D9JA 4JA9A 3ZHEB 2DBAA 3DEOA 2XRYA 2MYOA 3QB2A 5BXOA 4IN3B 2Y4TA 2WXNA 3CK8A 1OWOA 3TWQA 1NA0A 3CVXA 3QOUA 1JWFA 1N9AA 3PZ2A 4ACLA 1EDUA 1HH8A 1NL4A 1Y8MA 1Q2ZA 5CCMA 5AAOA 3Q79A 3ZYLA 4APOA 4HI9A 4U0SA 2GRRB 4G1TA 4HFGA 3RRUA 3TWUA 4CT0A 4G26A 4BY6A 3HRAA 1OWMA 1DNPA 5AN8A 4BERA 4A1GA 3UXGA 4J8DA 1K8KG 4L7TA 2UWJG 3CVLA 5EX3A 3HYMB 3HDXA 4ANUA 3TWXA 3TWWA 4WUYA 4AP2A 2ZGDA 2ETCA 5FJYA 5AQAA 5LX8A 1OCCE 4O1PA 3Q73A 3FDHA 3SBTB 3HVEA 3ONKA 1TNBA 4HLEA 4RVBA 3MEKA 3T9KA 3U3WA 3DXKG 3EHMA 2OEVA 3B7RL 4I9EA 2IY0C 5JHBA 1H2VC 1TNYA 3SO8A 4GA0A 4AY6A 4GZ5A 4OVVA 4MBGA 4N3BA 1JCSA 4CZ2D 3QWWA 3T8KA 3VTXA 3Q49B 1IYGA 1BD8A 5D0QD 3LS8A 3MKQA 3IXEA 1WAO1 4GZ6A 2DIWA 4WNFA 4D10C 1NZNA 4WWPA 2NXPA 3U64A 5LOZA 5EIDA 3JUEA 3P1UA 3JQ0A 4XIFA 4GZCA 3BU8A 3MGBA 4XE0A 3V2OA 2LSUA 4JW1A 4L2YA 4M7CA 3ZU7B 4UQZA 3FUDA 1HS6A 1HFAA 3FH8A 3N71A 4NURA 1E8WA 5CEAA 4ILGA 3RKVA 3O4ZA 2GRMA 3S2AA 3G2WA 1Z3XA 4CCAA 4PS7A 2J4DA 2ZGGA 2ILRA 2XCCA 2WXPA 2IONA 5BNWA 1HG5A 3JCKC 4K5CA 4MLPA 2AW6A 2KCKA 3L22A 5CRVA 1PC2A 3SI5A 2KATA 5B3SE 1OWNA 3VLEA 4DX2A 1IXVA 1RW2A 3G2TA 2A4ZA 5AIJA 5FZSA 2GRPB 1E8ZA 4OVUA 3SFYA 4HBDA 1AWCB 2VJ8A 3RK6A 4EQFA 5CCLA 4F6RD 1ZU2A 4FJYA 2J9QA 3ZEFA 1UG3A 4CDNA 5E75A 2EIJE 3UUXA 3GW4A 1N0RA 3DWLG 4R7LA 4UWHA 4FP7A 2F8XK 3ZW3A 4HQDA 3TWRA 2WXRA 4KT6B 3DPYA 3FUFA 4WWNA 2BEDA 4YDWA 4EHMA 1QZ2A 3RO2A 3RRMB 3T8MA 3KEZA 4XZ4A 4I2WA 3ZN3A 3NBNB 3KEAA 5EYPF 4F53A 3AJIA 4HOSA 2R5SA 3PE3A 1BLXB 3MYVA 3TJPA 2VTBA 5JHAA 4GA1A 2R2LA 2FI7A 4U8VD 2C2LA 3PUJA 2H6GA 3G2SA 4DLQA 4JA7A 3U9WA 2NSZA 2I1JA 3L16A 2QY7A 2WXIA 3Q7AA 3MJWA 1MHQA 4UWGA 3GYZA 1S70B 3CVNA 2P9IG 3PDNA 3S7DA 4DX7D 4IYPA 2CFUA 5ARGA 4U7EB 4G8LA 1K1BA 3AU5A 1IQRA 5D2MC 4EZJA 2R17C 3V31A 4MKTA 4BFRA 2C0LA 1E8YA 4HLLA 4DX1A 1JCQA 3L17A 4HXIA 1HO8A 4DI4A 1E90A 5B1BE 1UOHA 3EIQC 4OYSA 3OXFA 1H2TC 4BSXA 3D9KA 1N4PA 2AWIA 3CIAA 5EYLA 3VLDA 4CDRA 4A63B 3DSSA 1A5EA 3CSFA 2V5QC 5AARA 1QYMA 1SA5A 1FPPA 3LPZA 4GZDA 2NC9A 5CBNA 4TRQA 3ZNGA 4TV3A 4KZ0A 3ULQA 3SNXA 3B7BA 5DIZA 1AP7A 4ACKA 3I4RB 3FH7A 5JJ7A 1G3NB 2KZTB 4JL0A 2LSVA 4G24A 3LYAA 4C48B 4FJZA 2IOLA 3B95A 4I1MA 3ZGQA 4EPZA 4ANXA 3CVVA 1YA0A 3FUKA 2VGXB 3PS6A 3E37A 3FTXA 3ZKJA 4A3TA 3ZIMA 4F1SA 2WXJA 3RSEG 3ABME 3NB2A 1QBQA 1BI8B 2LO6A 3D9IA 5HKPA 3Q4AB 3APCA 1OT8A 4DX6D 1INZA 3SGHA 4U8YD 2XEHA 3FH5A 3D9NA 3CHSA 1RZ4A 4L23A 2V0PA 1XGWA 3MCXA 2F37A 4FLHA 2GRNB 3C3RA 2EIME 2ZISA 5ENSD 3E33A 1JUQA 1TN8A 4RSYA 4G11A 4G2VA 5CEDB 1N95A 2QZAA 4BETA 2MHKA 1E7UA 5G2NA 4JEHA 4ILHB 2ZIRA 1ELKA 3FULA 3TWSA 4ZFHA 2DYSE 1KT1A 1WDYA 2ONDA 3TWVA 3ZXSA 5G04C 5ENNA 1N4RA 3BG1B 2C0MA 3UMVA 4U63A 2X6JA 1KT0A 5CHEE 3E34A 2P9PG 4UWLA 4HRLA 5DBKA 1K1AA 3CKCA 4E6HA 3FEYA 4NQ0A 2KZTA 4I2ZA 4N2SA 4GCNA 4BWRA 2FBNA 4GZ3A 2Y0BG 4HS2A 3ASHA 2X3MA 3Q5MA 2WXGA 3FUHA 1IHBA 1OCOE 4GTSA 1LF8A 2DZNA 1QQEA 3OAWA 4UI9C 3D9OA 3Q15A 1YCSB 3LVRE 4V3IA 3HIZA 1YMPA 4AEZC 4N2QA 4L2LA 1JWGA 2WM9A 2AXUA 3UKUG 2UY1A 3NF1A 3TG5A 3G2UA 3RIBA 5ARFA 1IHGA 3TGOA 2IFUA 4KVMA 4UWKA 2XEEA 4DRXE 4KBQA 3QAQA 4LNGA 3HXEA 1DVPA 3AG3E 4BEPA 2XHEA 3FU0A 1NFIE 3RRNB 3CQCB 4GMLA 4K5BA 3CK9A 4RG9A 3KD7A 5LCWC 3CVWA 3SF4A 4CGVA 3KS2A 3P2BA 3UI2A 2H6IA 4TXPA 2VTBB 4UI9K 1N94A 2AXVA 4E85A 2I2OA 5FZRA 1NA3A 3DPDA 5EDSA 1MX6A 1WG0A 5AJLA 3CV0A 3ZHEA 1TJFA 3CHRA 5AQBA 4N5QA 1U2VG 2BKGA 3ENEA 1H6KA 4XKBA 2ETBA 3FU6A 4JEUA 2CFZA 3QC1A 5CMYA 3DEPA 3QWVA 3L54A 4GMJA 4UUCA 3QKYA 2ZXWE 3DSXA 1JCRA 3UT7A 3EJNA 3FUNA 2GRLA 3CEQA 3B7TA 3UM3A 5FQ8A 3UPVA 4JB8P 5HI7A 1S0PA 3ASGA 4TXQA 2XPYA 3PZ4A 2DVWA 2WQ7A 3HHMA 2IOSA 2YHEA 5LP0A 4WNDA 1SA4A 4HOQA 4U04A 3JXJA 4YVOA 3RO3A 5C2YA 4J0UA 5BXUA 1OWLA 4I6EA 1FT1A 4Y6CA 2Y4UA 4TUMA 3T5VA 3DRAA 3EHRA 2FF4A 2VGXA 1FCHA 4YDOA 2R02A 1UW4B 2WQ6A 2DCPA 3ULYA 1BPOA 2MRIA 4ZHBA 1X81A 2HYZA 4J8SA 3ZYQA 1H6OA 2L9BA 2V4HC 2IJGX 3QNKA 3FHEA 4GTTA 4RLYA 3NZUA 3ZYMA 3AU4A 1ZB1A 1N4SA 3V2XA 1TEZA 1HE8A 4XEIG 4YDEA 2KXPC 2J4BA 1OCRE 2P9SG 2WXHA 3R7RA 5KCMA 4JHJA 1E8XA 4LUNU 4N39A 5FINA 2BTDA 1O1RA 4X8QA 4DLOA 4CT4A 4NACA 4GTMA 3D9PA 4XI0A 3MKQB 2X6HA 2E2EA 3UTMA 2L6BA 1Z6TA 3UIOC 1DCEA 4LNBA 2KBXA 3FTYA 5B1AE 3AS8A 1S64A 3LVQE 4FA6A 3FWVA 1UN9A 3QARA 4DUIA 2EIKE 2P9NG 1H2UA 3EU9A 2WXFA 1LTXA 2P9UG 4J8EA 3CVQA 1OWPA 1HX8A 2EILE 1MQSA 3EU5A 5EX0A 4YNDA 3W9FA 4XX5A 3Q78A 2XGSA 2X38A 3C3QA 4GTRA 4GB9A 4JD2G 1TYQG 3W9GA 4GPKA 1HF8A 4TUUA 3CVUA 1GW6A 3B7UX 1O1SA 2PM6A 3JXIA 4DK5A 5G55A 3WXXA 4AV7A 4HOUA 3FTSA 5CECB 2B0OE 4YVQC 4L1BA 2IO2C 4B8CB 3SBSA 2RD0A 2VSOE 3PE4A 4GYWA 3I4GA 4H7XA 4U0ZA 4LEUA 3HXFA 2PL2A 3EHQA 3VLFA 4GA2A 3ULEG 4B93B 3PH0C 5CRUA 3S7BA 4JPSA 2JEKA 2XPIA 3RU0A 4LNUD 2WMOA 4Z68A 3Q7FA 4CDMA 1D8EA 5ENOD 4G25A 3DSTA 2Y1LE 4JZYA 4WNGA 2PZIA 4U07A 4CEMA 2YINA 4FLBA 2JLBA 2UY1B 4K5AB
chains in the Genus database with same CATH topology
4AIFA 4C0EA 3L13A 1EDUA 1HH8A 1Y8MA 5FQ4A 5T4YA 3Q4AB 3APCA 5AYWD 1INZA 5CCMA 3QK0A 2OV8A 4KVOA 3KAEA 2X6KA 3SGHA 5BUZA 4AY6A 2V4LA 4LERA 3FH5A 4LCTA 3ZYLA 1FVFA 3CKBA 3D9NA 3CHSA 1A17A 3FP3A 4L23A 2V0PA 1XGWA 4APOA 3MCXA 4U0SA 4G1TA 4HFGA 3RRUA 1EF1C 2J08A 3U66A 4FLHA 2WQHA 4CT0A 4N5CA 4G26A 4BY6A 3GZ1A 3LY9A 2WXMA 2CG2A 1JUQA 1OWMA 1DNPA 4RSYA 4G11A 4G2VA 4JC8A 2KC7A 4A1GA 2L0TB 4J8DA 2OOEA 3ESLA 4L7TA 3APDA 3SD5A 4BX8A 2UWJG 3CVLA 5EX3A 4KMOA 4CRWA 3HYMB 2MHKA 2VQ2A 3HDXA 2RG8A 4ANUA 1H0AA 1E7UA 5G2NA 4JEHA 5ANRA 2J09A 3TL5A 4WUYA 2YNQA 2XGMA 4ILHB 4ILIA 4AP2A 1ELKA 3IHVA 2IU1A 3FULA 5FJYA 5A23A 3OXLA 4FADA 3ZYKA 1TJCA 2VSXE 1KT1A 2ONDA 2GW1A 3PNLB 3UT8A 1X5BA 5LX8A 3CHOA 3ZXSA 5G04C 3JQ1A 1U3CA 4MS6A 5ENNA 3FDHA 3SBTB 3HVEA 3BG1B 2C0MA 3ONKA 3UMVA 3AS4A 4P29A 3FUEA 4U63A 2X6JA 1KT0A 5CHEE 3APFA 5JJ6A 4UWLA 5DBKA 4HLEA 2FO7A 1L5JA 4FC8A 3CKCA 3BEEA 3TXNA 3PVLA 1SQMA 1ZBPA 4RVBA 3MV2B 4A55A 4E6HA 3MEKA 3L08A 3FEYA 2GGFA 3MKRA 4F7AA 3EIJA 3U3WA 4NQ0A 2KZTA 2VGYA 3EHMA 4I2ZA 3B7RL 3JUIA 4N2SA 4GCNA 4I9EA 3OXGA 4BWRA 2FBNA 4GZ3A 5JHBA 1H2VC 1NP7A 2EQXA 3SZ7A 1OUVA 5AJDA 4HS2A 3ASHA 3LXUX 2X3MA 3Q5MA 2WXGA 2V8SE 4GA0A 3FUHA 2X6FA 2KCVA 3ZPJA 4ANWA 4CGWA 4KXKB 4GZ5A 1LF8A 4OVVA 1QQEA 3OAWA 4EZKA 4UI9C 4N3BA 3C98A 3D9OA 3FTWA 3Q15A 2LAHA 3QWWA 1N52A 3VTXA 1Z3YA 3EDTB 3LVRE 4V3IA 3HIZA 4AEZC 3Q49B 4HOTA 1IYGA 2E0IA 2AVPA 3O48A 3PEUB 5D0QD 4L2LA 3U4TA 4N2QA 1JWGA 4WAFA 2P58C 3LS8A 2WM9A 4JVSA 3R9AB 2AXUA 3MKQA 1WAO1 2Q7FA 2UY1A 2VYIA 2VSYA 5ANLA 5EKQD 4GZ6A 2DIWA 3NF1A 4WNFA 3TG5A 3LY8A 3G2UA 1NZNA 4D10C 4WWPA 2L6JA 3RIBA 1PY1A 2NXPA 3U64A 5LOZA 5ARFA 3ONLA 3P1UA 3CHQA 1IHGA 3JQ0A 3TGOA 4PS3A 2IFUA 4XIFA 5BW8C 4KVMA 4GZCA 4UWKA 1ELRA 3MGBA 3QAQA 4KBQA 3DBSA 4XE0A 3IEGA 2LSUA 4JW1A 3MA5A 3QJZA 1DVPA 4L2YA 5FTPA 4UQZA 3FUDA 4PUCA 3MZLB 1HS6A 4FHJA 1HFAA 2XHEA 4XI9A 4JHRA 3FH8A 3FU0A 3RRNB 3CQCB 4GMLA 2CHWA 3N71A 4I9CA 4ATGA 5KJNA 4AVXA 4NURA 3CK9A 1E8WA 3KD7A 4RG9A 5LCWC 4ILGA 1WY6A 2V5FA 3CVWA 3LCAA 3RKVA 3SF4A 3CK7A 2XGOA 4N3CA 4CGVA 3O4ZA 2GRMA 3KS2A 5G05J 3G2WA 4ME2A 3S2AA 1Z3XA 2IQCA 3FU5A 3P2BA 4GAAA 3CSTA 1EYHA 3FU3A 4I43A 4CCAA 2VTBB 1KLXA 4UI9K 4PS7A 2AXVA 4E85A 2J4DA 4Q69A 4I1AA 4MRUA 2I2OA 5FZRA 1NA3A 3DPDA 5EDSA 2ILRA 2XCCA 4XKCA 5AJLA 3CV0A 4M3OA 3ZHEA 4UQXA 4H7YA 3CGHA 3CLJA 5G05C 1TJFA 3CHRA 5BV0A 2WXPA 2Y3AA 2IONA 5BNWA 1HG5A 4FU3A 3R7QA 4J6IA 2HM8A 3JCKC 4A1SA 3ENEA 2R59A 1H6KA 4XKBA 4AM9A 4MLPA 1E7VA 2AW6A 3FU6A 4KZCA 4JEUA 1B89A 2KCKA 3L22A 5BV1A 2CFZA 2WVIA 4IULA 2CHXA 3BG0B 3QC1A 5CMYA 3QWVA 5FQ7A 1PC2A 3ZVVA 3L54A 4GMJA 3SI5A 4N3AA 2KATA 3QKYA 3QWPA 1OWNA 3VLEA 4BTAA 1EPUA 3TXMA 3G2TA 4G23A 4AXHA 3SHFA 2A4ZA 3S7FA 4F3VA 3UT7A 3EJNA 3FUNA 3I3NA 1Y6IA 1HZ4A 2QFCA 2GRLA 5HQ8A 2YQ8A 4BT9A 5AIJA 5FZSA 3NZSA 3CEQA 2I6HA 3B7TA 1E8ZA 4OVUA 1QNFA 5D0OD 5FQ8A 4KYOB 3UPVA 3AS5A 2VJ8A 3VTYA 5BT1A 2KM4A 5HI7A 3RK6A 3D9LA 1S0PA 3ASGA 2WXQA 4EQFA 5CCLA 4JHKA 5M72A 2XPYA 2WQ7A 1ZU2A 3ML9A 4FJYA 3HHMA 2IOSA 2YHEA 5LP0A 4WNDA 4A3VA 1SZ9A 2J9QA 4HOQA 5FT9A 2KCLA 2MOWA 4U04A 5J08A 4YVOA 3ZEFA 3PEVB 1UG3A 3RO3A 2HO1A 4CDNA 5E75A 5C2YA 4J0UA 3FY4A 3NQPA 1OWLA 4I6EA 3UUXA 5T8IA 4Y6CA 3GW4A 2Y4UA 1H19A 3T5VA 4R7LA 4B8AA 4UWHA 4ANVA 4FP7A 4ABNA 4URKA 2FF4A 2VGXA 2PQRA 3CQGB 4IRUA 3TG4A 3EHNA 3ZW3A 2WXRA 3T5XA 2WMNA 4KT6B 1FCHA 3QDNA 3HVEB 3G2VA 4BTBA 1N54A 3FUFA 4WWNA 1UW4B 2WQ6A 1QZ2A 2DCPA 1U3DA 4W9RA 1BPOA 3RO2A 3E4BA 1VDYA 2MRIA 4U8HA 2HYZA 3RRMB 3T8MA 4EECA 5AENA 2LAIA 4J8SA 3ZYQA 1UJJA 2WXKA 2L9BA 3KEZA 3L6AA 3QNKA 1E96B 2IJGX 4XZ4A 3FTVA 4I2WA 3FHEA 2AXZA 3ZN3A 4F53A 3NZUA 1HU3A 3ZYMA 3AU4A 4O6FA 4HOSA 4JXTA 2R5SA 3CVYA 1TEZA 1SZAA 2WB2A 1HE8A 3PE3A 3PREA 3MYVA 4I17A 2J4BA 3TJPA 3FTZA 4B94A 3FFLA 4PH4B 2WXHA 2VTBA 4FHKA 5JHAA 4GA1A 2WPVA 3R7RA 5KCMA 2FI7A 1E8XA 2X6IA 4JHJA 4LUNU 4N39A 2BTDA 2VSNA 3LY7A 4DLOA 4CT4A 2J49A 2C2LA 4NACA 4Q96A 3PUJA 3G2SA 5A7DB 5LFAA 5E76A 4DLQA 4K0RA 1W3BA 4JA7A 3U9WA 3D9PA 3ASFA 3ZRHA 4XI0A 2NSZA 3IHYA 4B0ZA 2I1JA 4GU5A 5C1DA 3MKQB 2X6HA 3SFZA 2E2EA 3L16A 4WWOA 4Y6WA 2QY7A 2WXIA 3FTUA 1Z6TA 4K03A 3UX4A 4GYOA 1ELWA 3FTYA 2XEVA 3AS8A 3LVQE 4AOFA 4FA6A 3IBEA 3JYSA 3FWVA 3MJWA 1UN9A 1MHQA 4UWGA 1HXIA 3QARA 5FWQA 3GYZA 2PM7A 3CVNA 1H2UA 3PDNA 3B13A 3S7DA 4EBAA 3LDZA 3PZDA 4IYPA 5KJKA 4I6JA 2CFUA 5ARGA 2WXFA 3UQ3A 2FEZA 4J8EA 3CVQA 1OWPA 4B89A 2M63A 1XNFA 3AU5A 2YHCA 2HR2A 1IQRA 4EZJA 1HX8A 2R17C 2IF4A 1MQSA 5EX0A 4YNDA 4MKTA 3URZA 4XX5A 4AY5A 4BFRA 3GZSA 2C0LA 1E8YA 5G04J 2XGSA 2X38A 4GB9A 4LRZA 4EZLA 3RJVA 3L17A 2A5UA 1HO8A 4HXIA 5FZQA 4DI4A 4GPKA 1HF8A 4FULA 5BPPA 1E90A 3FUIA 3GZ2A 5A6CA 4UWFA 4TUUA 3CVUA 1GW6A 3B7UX 4HVBA 4GCOA 2PM6A 3FUMA 1UJKA 3MV3B 4DK5A 5KJLA 5G55A 4UI9J 2XQ0A 2XCBA 3EIQC 3Q47B 4OYSA 3WXXA 3OXFA 4HOUA 1H2TC 3UT4A 4AV7A 1HG2A 4BSXA 3FTSA 3D9KA 3PRZA 3ZFWA 4WNEA 3I5PA 4YVQC 5LCWJ 2OVBA 2AWIA 3CIAA 4L1BA 3VLDA 4C9BB 5JJTA 4B8CB 4GYYA 3CHMA 3LKUA 4BX9A 3SBSA 2RD0A 4I1OB 4CDRA 2CG3A 2PQNA 3CSFA 2FULA 3D9MA 4UQYA 2VSOE 3D3MA 3PE4A 4GYWA 3I4GA 1WM5A 3LEWA 3LPZA 4H7XA 4GZDA 2NC9A 3MX3A 4U0ZA 4TRQA 3K9IA 4TV3A 4LEUA 3B7SA 3IKOB 4KZ0A 4PDXA 3ULQA 2XPZA 3SNXA 3CHPA 5DIZA 3OTNA 4PS8A 2ZU6B 4ACKA 2PL2A 2WXLA 2BF0X 4AJWA 5KJMA 3I4RB 3LJ3A 3VLFA 3CR3A 1FVHA 4NRHB 1JPLA 4APFA 1IQUA 3FH7A 4GA2A 5JJ7A 4C0MA 2KZTB 3ESKA 2WXOA 3FEXA 4JL0A 5CMWA 4DPRA 4EBAG 2LSVA 2L0IA 4G24A 3PNTB 3LYAA 4BT8A 4FJZA 3PH0C 3FUJA 4RG6A 3PUKA 2J07A 2IOLA 2LNIA 2XRZA 4I1MA 3ZGQA 3IV0A 1P5QA 4EPZA 5J90A 4ANXA 3S7BA 5FQ6A 4JPSA 4U0UA 3TAXA 2BUGA 3D9JA 2JEKA 3CVVA 1YA0A 3FUKA 2XPIA 3RU0A 2VGXB 2I1KA 3ASDA 4J8FA 3PS6A 2WMOA 4JA9A 4CDMA 2CHZA 4DI3A 4DJAA 3FTXA 4G25A 4A3TA 3ZIMA 3ZHEB 2I9CA 4JZYA 2DBAA 2WXJA 4F1SA 3S7JA 4WNGA 2PZIA 2XRYA 4U07A 4I6GA 4CEMA 2YINA 3QB2A 4IN3B 2Y4TA 4FLBA 2JLBA 3CK8A 2WXNA 1OWOA 2LO6A 1NA0A 2UY1B 3QOUA 5T3RA 2OVFA 3CVXA 1UN8A 3CVPA 1JWFA 1PAQA 3ML8A 4ACLA 3D9IA 4Q94A 4HORA 4QFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8E A;  4AIF A;  3CVQ A;  4N2Q A;  2J9Q A;  4HOQ A;  2P58 C;  2KCL A;  1XNF A;  2YHC A;  4U04 A;  2HR2 A;  5FT9 A;  4YVO A;  3R9A B;  1HH8 A;  1WAO 1;  1Y8M A;  2HO1 A;  2Q7F A;  2IF4 A;  2UY1 A;  2VYI A;  2VSY A;  3Q4A B;  4GZ6 A;  4J0U A;  4YND A;  5EKQ D;  5EX0 A;  5AYW D;  5CCM A;  3NF1 A;  4WNF A;  3TG5 A;  3URZ A;  3UUX A;  3LY8 A;  3KAE A;  4AY5 A;  4AY6 A;  1NZN A;  2C0L A;  3GW4 A;  4Y6C A;  2L6J A;  5G04 J;  3RIB A;  2XGS A;  2Y4U A;  3CKB A;  5ARF A;  1A17 A;  3U4T A;  1IHG A;  3TGO A;  3FP3 A;  3RJV A;  4APO A;  2IFU A;  4U0S A;  4XIF A;  5FZQ A;  4G1T A;  5BW8 C;  4GPK A;  4ABN A;  1ELR A;  4KBQ A;  3GZ2 A;  5A6C A;  2FF4 A;  2VGX A;  2PQR A;  3IEG A;  3TG4 A;  2LSU A;  2WQH A;  3MA5 A;  5FTP A;  4GCO A;  4N5C A;  4G26 A;  4UQZ A;  1FCH A;  3MV3 B;  5KJL A;  3GZ1 A;  3LY9 A;  3QDN A;  4UI9 J;  2XCB A;  3Q47 B;  4BTB A;  3WXX A;  3OXF A;  4HOU A;  4G2V A;  1QZ2 A;  3RO2 A;  3ZFW A;  4W9R A;  4XI9 A;  3E4B A;  2KC7 A;  4JHR A;  4WNE A;  2HYZ A;  4YVQ C;  5LCW J;  4J8D A;  5KJN A;  3N71 A;  4I9C A;  2OOE A;  5JJT A;  4GYY A;  3CK9 A;  3LKU A;  3KD7 A;  1E96 B;  2UWJ G;  3CVL A;  4RG9 A;  5EX3 A;  4I2W A;  4CDR A;  2V5F A;  3ZN3 A;  3LCA A;  3HYM B;  3RKV A;  2MHK A;  2VQ2 A;  3CK7 A;  3SF4 A;  2XGO A;  4N3C A;  4CGV A;  5G05 J;  2PQN A;  3KS2 A;  4ME2 A;  4O6F A;  3TAX A;  4HOS A;  4WUY A;  2R5S A;  1KLX A;  4UI9 K;  4UQY A;  2XGM A;  4HOT A;  3PE4 A;  4GYW A;  4H7X A;  1WM5 A;  3LPZ A;  5FJY A;  3PE3 A;  4I1A A;  5FZR A;  3OXL A;  1NA3 A;  2NC9 A;  1TJC A;  4U0Z A;  1KT1 A;  2OND A;  2GW1 A;  2XCC A;  4I17 A;  3CV0 A;  3K9I A;  3ZHE A;  3FFL A;  4UQX A;  4B94 A;  4H7Y A;  4LEU A;  5G04 C;  5G05 C;  4GA1 A;  2WPV A;  3ULQ A;  5DIZ A;  2FI7 A;  4N39 A;  5BNW A;  2VSN A;  2PL2 A;  2C0M A;  3AS4 A;  5KJM A;  3LY7 A;  4A1S A;  2C2L A;  4NRH B;  5CHE E;  1KT0 A;  4AM9 A;  5A7D B;  5LCW C;  4GA2 A;  5JJ6 A;  5JJ7 A;  5DBK A;  2FO7 A;  3ESK A;  1B89 A;  1W3B A;  2KCK A;  4JA7 A;  3CKC A;  3BEE A;  4JL0 A;  3RO3 A;  3ASF A;  1ZBP A;  2LSV A;  4G24 A;  3MV2 B;  3QWV A;  4XI0 A;  1PC2 A;  3MEK A;  3LYA A;  5C1D A;  4BT8 A;  4N3A A;  2KAT A;  3QKY A;  4RG6 A;  2LNI A;  3Q49 B;  3MKR A;  3QWP A;  3U3W A;  3ZGQ A;  4NQ0 A;  2E2E A;  4BTA A;  1P5Q A;  4Y6W A;  2VGY A;  4I2Z A;  3S7B A;  4N2S A;  4GCN A;  4U0U A;  4G23 A;  2BUG A;  3OXG A;  4I9E A;  5D0Q D;  3S7F A;  1YA0 A;  2FBN A;  2XPI A;  4BWR A;  3RU0 A;  2VGX B;  4F3V A;  4GZ3 A;  2QFC A;  1HZ4 A;  4GYO A;  3ASD A;  1ELW A;  4J8F A;  5HQ8 A;  2YQ8 A;  4BT9 A;  2XEV A;  4JA9 A;  5FZS A;  3AS8 A;  3SZ7 A;  3CEQ A;  1OUV A;  2I6H A;  4G25 A;  3ASH A;  3ZHE B;  3Q5M A;  2DBA A;  3JYS A;  3FWV A;  4GA0 A;  5D0O D;  3S7J A;  2KCV A;  4WNG A;  2PZI A;  1HXI A;  4KXK B;  4U07 A;  4GZ5 A;  3ZPJ A;  4CGW A;  4KYO B;  3UPV A;  3AS5 A;  1QQE A;  3GYZ A;  3VTY A;  5BT1 A;  3CVN A;  2Y4T A;  4IN3 B;  4N3B A;  4UI9 C;  5HI7 A;  3Q15 A;  3PDN A;  2JLB A;  3CK8 A;  3ASG A;  3S7D A;  1NA0 A;  2UY1 B;  3QOU A;  4EQF A;  3QWW A;  5CCL A;  3CVP A;  5KJK A;  3VTX A;  5M72 A;  5ARG A;  1ZU2 A;  3EDT B;  3UQ3 A;  2FEZ A;  1IYG A;  2AVP A;  4HOR A;  3O48 A;  4WND A; 
#chains in the Genus database with same CATH topology
 3L13 A;  3E30 A;  3J5P A;  3QK0 A;  4KVO A;  2X6K A;  1FVF A;  3CKB A;  3FP3 A;  2IEJ A;  5H7P A;  3U66 A;  4N5C A;  3GZ1 A;  2CG2 A;  1D9S A;  4JC8 A;  2KC7 A;  2L0T B;  2OOE A;  3APD A;  4BX8 A;  2XS8 A;  4KMO A;  4CRW A;  2RG8 A;  1H0A A;  2EIN E;  2J09 A;  3TL5 A;  2YNQ A;  3KSQ A;  5A23 A;  3ZYK A;  1TJC A;  2VSX E;  2GW1 A;  1V54 E;  3UM1 A;  1X5B A;  3X2Q E;  3JQ1 A;  4MS6 A;  4P29 A;  3BQO A;  3BUA A;  5JJ6 A;  3BEE A;  1SQM A;  1ZBP A;  3NAW A;  3Q75 A;  3ZUV B;  3F6Q A;  3HXD A;  3L08 A;  2GGF A;  3MKR A;  4F7A A;  3EIJ A;  3OXG A;  1NP7 A;  2EQX A;  1OUV A;  5AJD A;  3ZPJ A;  4CGW A;  4KXK B;  1SVX A;  3FTW A;  3SQV A;  3NOG D;  4HOT A;  2AVP A;  3O48 A;  3PEU B;  4WAF A;  2Q7F A;  2VYI A;  3LY8 A;  1O1T A;  2Y69 E;  2L6J A;  1IKN D;  3ONL A;  4PS3 A;  1ELR A;  3DBS A;  3IEG A;  3TWT A;  1N0Q A;  5FTP A;  4PUC A;  5KNG A;  3MZL B;  4FHJ A;  5KJN A;  2CHW A;  4I9C A;  2XS1 A;  2R05 A;  4AVX A;  3LCA A;  2XGO A;  5G05 J;  2IQC A;  3FU5 A;  1EYH A;  1YYH A;  1KLX A;  4I1A A;  4MRU A;  4YDY A;  4XKC A;  4LG6 A;  3AG4 E;  4H7Y A;  3CGH A;  5BV0 A;  4FU3 A;  2HM8 A;  4A1S A;  2R59 A;  1E7V A;  4KZC A;  1B89 A;  4IUL A;  2CHX A;  2LUH A;  3BG0 B;  5FQ7 A;  4N3A A;  3QWP A;  3SY2 A;  1EPU A;  4AXH A;  3SHF A;  4F3V A;  2QFC A;  1HZ4 A;  4BT9 A;  2DYR E;  3NZS A;  2I6H A;  5D0O D;  3AS5 A;  3VTY A;  3D9L A;  2H6H A;  1TR4 A;  5M72 A;  5EIL A;  3ML9 A;  1SZ9 A;  5FT9 A;  2KCL A;  5J08 A;  4HRM B;  3PEV B;  2HO1 A;  3ASN E;  3FY4 A;  4DX5 D;  5T8I A;  1KZO A;  1H19 A;  3HG0 D;  4B8A A;  4ABN A;  4URK A;  4IRU A;  2PQR A;  3CQG B;  3EHN A;  3T5X A;  3QDN A;  3HVE B;  1U3D A;  3E4B A;  4EEC A;  4U8H A;  1UJJ A;  3R9M A;  1V55 E;  2WXK A;  5ENQ D;  1E96 B;  2AXZ A;  2RFM A;  1HU3 A;  1SZA A;  5ENT D;  2QYU A;  5JA4 D;  3PRE A;  5ENR D;  4I17 A;  4BES A;  1MZC A;  4B94 A;  4CYM D;  2WPV A;  2X6I A;  2VSN A;  3LY7 A;  5LFA A;  5A7D B;  3UIP C;  5E76 A;  1N4Q A;  4K0R A;  3ABL E;  3ZRH A;  1H6P A;  3IHY A;  4B0Z A;  5C1D A;  4U95 D;  3SFZ A;  4GTP A;  3FTU A;  4K03 A;  1KPS B;  3UX4 A;  2IO3 C;  2FO1 E;  3EUV A;  1OY3 D;  2GRO B;  3IBE A;  2PM7 A;  4EBA A;  3LDZ A;  3PZD A;  5KJK A;  4I6J A;  5AQ9 A;  2YHC A;  2HR2 A;  2P9K G;  2IF4 A;  4LSZ E;  3URZ A;  3GZS A;  1LD7 A;  3C5R A;  1LD8 A;  4EZL A;  5CBO A;  3RJV A;  1BU9 A;  2A5U A;  5FZQ A;  4HNA D;  3PZ3 A;  4FUL A;  5BPP A;  3GZ2 A;  3E32 A;  4UWF A;  4HVB A;  4GCO A;  3FUM A;  1UJK A;  2P9L G;  5ENP D;  2XQ0 A;  3UT4 A;  2XZD G;  3PRZ A;  3ZFW A;  3LJN A;  4WNE A;  5LCW J;  2OVB A;  4C9B B;  4GYY A;  4BX9 A;  3LKU A;  4GTV A;  4I1O B;  4HRN A;  2FUL A;  1MX4 A;  1WM5 A;  3LEW A;  5EIB E;  2GRQ B;  3MX3 A;  2J8S D;  3K9I A;  3Q9N C;  4NIK A;  3B7S A;  4PDX A;  2P2C P;  3CHP A;  3OTN A;  2ZU6 B;  5AQ7 A;  4AJW A;  2BF0 X;  2R03 A;  4GTO A;  1FVH A;  4L9P A;  1JPL A;  4APF A;  5JMN D;  3ESK A;  2NYJ A;  2WXO A;  3FEX A;  5CMW A;  4F1P A;  3PNT B;  1KZP A;  4BT8 A;  1TNU A;  3FUJ A;  4RG6 A;  3PUK A;  2J07 A;  2LNI A;  2XRZ A;  3PZ1 A;  3IV0 A;  5FQ6 A;  3TAX A;  1MJ0 A;  2I1K A;  1DCQ A;  3ASD A;  4J8F A;  2CHZ A;  4DI3 A;  4DJA A;  2I9C A;  4U96 D;  3S7J A;  3WG7 E;  3AAA C;  4I6G A;  5ITZ F;  5T3R A;  2OVF A;  1UN8 A;  3CVP A;  1PAQ A;  3ML8 A;  4Q94 A;  4HOR A;  1OXJ A;  4QFV A;  2BKK B;  4AIF A;  2AJA A;  4C0E A;  1D8D A;  5FQ4 A;  5T4Y A;  3C72 A;  5AYW D;  2OV8 A;  5BUZ A;  3KAE A;  1O5M A;  3ABK E;  2V4L A;  4LER A;  4LCT A;  1A17 A;  4HI8 A;  3Q9U C;  3C3O A;  1EF1 C;  2J08 A;  2WQH A;  1SW6 A;  3LY9 A;  2WXM A;  3UM2 A;  2F8Y A;  1TN7 A;  3ESL A;  3ISM C;  2QYJ A;  3SD5 A;  2VQ2 A;  5ANR A;  3HXC A;  2XGM A;  4ILI A;  3IHV A;  2IU1 A;  2F0Y A;  3NOC D;  3OXL A;  4FAD A;  3PNL B;  1N11 A;  3UT8 A;  3CHO A;  1U3C A;  3AS4 A;  3UM0 A;  3FUE A;  3APF A;  2FO7 A;  1L5J A;  4FC8 A;  3TXN A;  3PVL A;  3MV2 B;  4A55 A;  4ATZ D;  4J7W A;  2VGY A;  3JUI A;  2QC9 A;  3D9H A;  3SZ7 A;  3LXU X;  2V8S E;  2X6F A;  2KCV A;  4ANW A;  4EZK A;  3C98 A;  3KSL A;  2LAH A;  1N52 A;  2DZO A;  1Z3Y A;  3EDT B;  2E0I A;  3U4T A;  2P58 C;  4JVS A;  3R9A B;  5KBA A;  5ANL A;  2VSY A;  5EKQ D;  1PY1 A;  3CHQ A;  4O60 A;  5BW8 C;  3ZXP A;  3MA5 A;  3QJZ A;  1MYO A;  4XI9 A;  4JHR A;  4ATG A;  5HRY A;  1WY6 A;  2V5F A;  3CK7 A;  4N3C A;  4ME2 A;  2RKK A;  3RAU A;  4GAA A;  3CST A;  3FU3 A;  4I43 A;  5KNH D;  4Q69 A;  3DSU A;  4M3O A;  4UQX A;  5G05 C;  3CLJ A;  2Y3A A;  3R7Q A;  4J6I A;  3AG2 E;  4AM9 A;  5BV1 A;  2WVI A;  2ETA A;  3ZVV A;  1NI1 A;  2VGE A;  4BTA A;  3L9T A;  3TXM A;  4G23 A;  3S7F A;  4G8K A;  3I3N A;  1Y6I A;  5HQ8 A;  2YQ8 A;  2XZT G;  1QNF A;  3V79 K;  4KYO B;  5KWD A;  5BT1 A;  2DWZ A;  2KM4 A;  5CER B;  4OAU C;  2WXQ A;  4JHK A;  3AG1 E;  4A3V A;  3DSV A;  1OCZ E;  2MOW A;  2HE0 A;  4QQI A;  5D66 A;  4GTQ A;  3NQP A;  5HS0 A;  3UIN C;  4TXR A;  4ANV A;  3TG4 A;  5FIO A;  2WMN A;  3G2V A;  4BTB A;  1N54 A;  5IY5 E;  4W9R A;  1VDY A;  5AEN A;  2LAI A;  2RFA A;  3L6A A;  2OEW A;  3FTV A;  2JAB A;  1MX2 A;  4O6F A;  4JXT A;  4J8Y A;  1BI7 B;  3CVY A;  5EN5 D;  2WB2 A;  3FTZ A;  3FFL A;  4PH4 B;  3J5Q B;  4FHK A;  2A5E A;  2J49 A;  4Q96 A;  1S63 A;  1TNZ A;  1W3B A;  3ASF A;  4GU5 A;  4WWO A;  4Y6W A;  2PNN A;  4GPM A;  1TN6 A;  4GYO A;  1ELW A;  2XEV A;  3ASO E;  4AOF A;  4O1O A;  3JYS A;  4HB5 A;  1HXI A;  5FWQ A;  3B13 A;  3UQ3 A;  2FEZ A;  4B89 A;  2M63 A;  1XNF A;  2LXL A;  3UKR G;  4AY5 A;  1FT2 A;  5G04 J;  3V30 A;  4LRZ A;  4RQI A;  3FUI A;  5A6C A;  1K3Z D;  2LXM A;  3MV3 B;  5KJL A;  2OCC E;  4UI9 J;  2XCB A;  3Q47 B;  1HG2 A;  1DC2 A;  3I5P A;  5JJT A;  3CHM A;  2CG3 A;  2H6F A;  2PQN A;  3SFX A;  4BSZ B;  3D9M A;  4UQY A;  3D3M A;  1TNO A;  3IKO B;  2XPZ A;  4PS8 A;  2WXL A;  5KJM A;  3LJ3 A;  2XEN A;  3CR3 A;  4NRH B;  1Z5S C;  3L82 A;  1IQU A;  4C0M A;  4DPR A;  4EBA G;  3HXB A;  2L0I A;  3DSW A;  3DXM G;  1P5Q A;  5J90 A;  4OAV B;  4GMR A;  2B6C A;  4U0U A;  2BUG A;  3D9J A;  4JA9 A;  3ZHE B;  2DBA A;  3DEO A;  2XRY A;  2MYO A;  3QB2 A;  5BXO A;  4IN3 B;  2Y4T A;  2WXN A;  3CK8 A;  1OWO A;  3TWQ A;  1NA0 A;  3CVX A;  3QOU A;  1JWF A;  1N9A A;  3PZ2 A;  4ACL A;  1EDU A;  1HH8 A;  1NL4 A;  1Y8M A;  1Q2Z A;  5CCM A;  5AAO A;  3Q79 A;  3ZYL A;  4APO A;  4HI9 A;  4U0S A;  2GRR B;  4G1T A;  4HFG A;  3RRU A;  3TWU A;  4CT0 A;  4G26 A;  4BY6 A;  3HRA A;  1OWM A;  1DNP A;  5AN8 A;  4BER A;  4A1G A;  3UXG A;  4J8D A;  1K8K G;  4L7T A;  2UWJ G;  3CVL A;  5EX3 A;  3HYM B;  3HDX A;  4ANU A;  3TWX A;  3TWW A;  4WUY A;  4AP2 A;  2ZGD A;  2ETC A;  5FJY A;  5AQA A;  5LX8 A;  1OCC E;  4O1P A;  3Q73 A;  3FDH A;  3SBT B;  3HVE A;  3ONK A;  1TNB A;  4HLE A;  4RVB A;  3MEK A;  3T9K A;  3U3W A;  3DXK G;  3EHM A;  2OEV A;  3B7R L;  4I9E A;  2IY0 C;  5JHB A;  1H2V C;  1TNY A;  3SO8 A;  4GA0 A;  4AY6 A;  4GZ5 A;  4OVV A;  4MBG A;  4N3B A;  1JCS A;  4CZ2 D;  3QWW A;  3T8K A;  3VTX A;  3Q49 B;  1IYG A;  1BD8 A;  5D0Q D;  3LS8 A;  3MKQ A;  3IXE A;  1WAO 1;  4GZ6 A;  2DIW A;  4WNF A;  4D10 C;  1NZN A;  4WWP A;  2NXP A;  3U64 A;  5LOZ A;  5EID A;  3JUE A;  3P1U A;  3JQ0 A;  4XIF A;  4GZC A;  3BU8 A;  3MGB A;  4XE0 A;  3V2O A;  2LSU A;  4JW1 A;  4L2Y A;  4M7C A;  3ZU7 B;  4UQZ A;  3FUD A;  1HS6 A;  1HFA A;  3FH8 A;  3N71 A;  4NUR A;  1E8W A;  5CEA A;  4ILG A;  3RKV A;  3O4Z A;  2GRM A;  3S2A A;  3G2W A;  1Z3X A;  4CCA A;  4PS7 A;  2J4D A;  2ZGG A;  2ILR A;  2XCC A;  2WXP A;  2ION A;  5BNW A;  1HG5 A;  3JCK C;  4K5C A;  4MLP A;  2AW6 A;  2KCK A;  3L22 A;  5CRV A;  1PC2 A;  3SI5 A;  2KAT A;  5B3S E;  1OWN A;  3VLE A;  4DX2 A;  1IXV A;  1RW2 A;  3G2T A;  2A4Z A;  5AIJ A;  5FZS A;  2GRP B;  1E8Z A;  4OVU A;  3SFY A;  4HBD A;  1AWC B;  2VJ8 A;  3RK6 A;  4EQF A;  5CCL A;  4F6R D;  1ZU2 A;  4FJY A;  2J9Q A;  3ZEF A;  1UG3 A;  4CDN A;  5E75 A;  2EIJ E;  3UUX A;  3GW4 A;  1N0R A;  3DWL G;  4R7L A;  4UWH A;  4FP7 A;  2F8X K;  3ZW3 A;  4HQD A;  3TWR A;  2WXR A;  4KT6 B;  3DPY A;  3FUF A;  4WWN A;  2BED A;  4YDW A;  4EHM A;  1QZ2 A;  3RO2 A;  3RRM B;  3T8M A;  3KEZ A;  4XZ4 A;  4I2W A;  3ZN3 A;  3NBN B;  3KEA A;  5EYP F;  4F53 A;  3AJI A;  4HOS A;  2R5S A;  3PE3 A;  1BLX B;  3MYV A;  3TJP A;  2VTB A;  5JHA A;  4GA1 A;  2R2L A;  2FI7 A;  4U8V D;  2C2L A;  3PUJ A;  2H6G A;  3G2S A;  4DLQ A;  4JA7 A;  3U9W A;  2NSZ A;  2I1J A;  3L16 A;  2QY7 A;  2WXI A;  3Q7A A;  3MJW A;  1MHQ A;  4UWG A;  3GYZ A;  1S70 B;  3CVN A;  2P9I G;  3PDN A;  3S7D A;  4DX7 D;  4IYP A;  2CFU A;  5ARG A;  4U7E B;  4G8L A;  1K1B A;  3AU5 A;  1IQR A;  5D2M C;  4EZJ A;  2R17 C;  3V31 A;  4MKT A;  4BFR A;  2C0L A;  1E8Y A;  4HLL A;  4DX1 A;  1JCQ A;  3L17 A;  4HXI A;  1HO8 A;  4DI4 A;  1E90 A;  5B1B E;  1UOH A;  3EIQ C;  4OYS A;  3OXF A;  1H2T C;  4BSX A;  3D9K A;  1N4P A;  2AWI A;  3CIA A;  5EYL A;  3VLD A;  4CDR A;  4A63 B;  3DSS A;  1A5E A;  3CSF A;  2V5Q C;  5AAR A;  1QYM A;  1SA5 A;  1FPP A;  3LPZ A;  4GZD A;  2NC9 A;  5CBN A;  4TRQ A;  3ZNG A;  4TV3 A;  4KZ0 A;  3ULQ A;  3SNX A;  3B7B A;  5DIZ A;  1AP7 A;  4ACK A;  3I4R B;  3FH7 A;  5JJ7 A;  1G3N B;  2KZT B;  4JL0 A;  2LSV A;  4G24 A;  3LYA A;  4C48 B;  4FJZ A;  2IOL A;  3B95 A;  4I1M A;  3ZGQ A;  4EPZ A;  4ANX A;  3CVV A;  1YA0 A;  3FUK A;  2VGX B;  3PS6 A;  3E37 A;  3FTX A;  3ZKJ A;  4A3T A;  3ZIM A;  4F1S A;  2WXJ A;  3RSE G;  3ABM E;  3NB2 A;  1QBQ A;  1BI8 B;  2LO6 A;  3D9I A;  5HKP A;  3Q4A B;  3APC A;  1OT8 A;  4DX6 D;  1INZ A;  3SGH A;  4U8Y D;  2XEH A;  3FH5 A;  3D9N A;  3CHS A;  1RZ4 A;  4L23 A;  2V0P A;  1XGW A;  3MCX A;  2F37 A;  4FLH A;  2GRN B;  3C3R A;  2EIM E;  2ZIS A;  5ENS D;  3E33 A;  1JUQ A;  1TN8 A;  4RSY A;  4G11 A;  4G2V A;  5CED B;  1N95 A;  2QZA A;  4BET A;  2MHK A;  1E7U A;  5G2N A;  4JEH A;  4ILH B;  2ZIR A;  1ELK A;  3FUL A;  3TWS A;  4ZFH A;  2DYS E;  1KT1 A;  1WDY A;  2OND A;  3TWV A;  3ZXS A;  5G04 C;  5ENN A;  1N4R A;  3BG1 B;  2C0M A;  3UMV A;  4U63 A;  2X6J A;  1KT0 A;  5CHE E;  3E34 A;  2P9P G;  4UWL A;  4HRL A;  5DBK A;  1K1A A;  3CKC A;  4E6H A;  3FEY A;  4NQ0 A;  2KZT A;  4I2Z A;  4N2S A;  4GCN A;  4BWR A;  2FBN A;  4GZ3 A;  2Y0B G;  4HS2 A;  3ASH A;  2X3M A;  3Q5M A;  2WXG A;  3FUH A;  1IHB A;  1OCO E;  4GTS A;  1LF8 A;  2DZN A;  1QQE A;  3OAW A;  4UI9 C;  3D9O A;  3Q15 A;  1YCS B;  3LVR E;  4V3I A;  3HIZ A;  1YMP A;  4AEZ C;  4N2Q A;  4L2L A;  1JWG A;  2WM9 A;  2AXU A;  3UKU G;  2UY1 A;  3NF1 A;  3TG5 A;  3G2U A;  3RIB A;  5ARF A;  1IHG A;  3TGO A;  2IFU A;  4KVM A;  4UWK A;  2XEE A;  4DRX E;  4KBQ A;  3QAQ A;  4LNG A;  3HXE A;  1DVP A;  3AG3 E;  4BEP A;  2XHE A;  3FU0 A;  1NFI E;  3RRN B;  3CQC B;  4GML A;  4K5B A;  3CK9 A;  4RG9 A;  3KD7 A;  5LCW C;  3CVW A;  3SF4 A;  4CGV A;  3KS2 A;  3P2B A;  3UI2 A;  2H6I A;  4TXP A;  2VTB B;  4UI9 K;  1N94 A;  2AXV A;  4E85 A;  2I2O A;  5FZR A;  1NA3 A;  3DPD A;  5EDS A;  1MX6 A;  1WG0 A;  5AJL A;  3CV0 A;  3ZHE A;  1TJF A;  3CHR A;  5AQB A;  4N5Q A;  1U2V G;  2BKG A;  3ENE A;  1H6K A;  4XKB A;  2ETB A;  3FU6 A;  4JEU A;  2CFZ A;  3QC1 A;  5CMY A;  3DEP A;  3QWV A;  3L54 A;  4GMJ A;  4UUC A;  3QKY A;  2ZXW E;  3DSX A;  1JCR A;  3UT7 A;  3EJN A;  3FUN A;  2GRL A;  3CEQ A;  3B7T A;  3UM3 A;  5FQ8 A;  3UPV A;  4JB8 P;  5HI7 A;  1S0P A;  3ASG A;  4TXQ A;  2XPY A;  3PZ4 A;  2DVW A;  2WQ7 A;  3HHM A;  2IOS A;  2YHE A;  5LP0 A;  4WND A;  1SA4 A;  4HOQ A;  4U04 A;  3JXJ A;  4YVO A;  3RO3 A;  5C2Y A;  4J0U A;  5BXU A;  1OWL A;  4I6E A;  1FT1 A;  4Y6C A;  2Y4U A;  4TUM A;  3T5V A;  3DRA A;  3EHR A;  2FF4 A;  2VGX A;  1FCH A;  4YDO A;  2R02 A;  1UW4 B;  2WQ6 A;  2DCP A;  3ULY A;  1BPO A;  2MRI A;  4ZHB A;  1X81 A;  2HYZ A;  4J8S A;  3ZYQ A;  1H6O A;  2L9B A;  2V4H C;  2IJG X;  3QNK A;  3FHE A;  4GTT A;  4RLY A;  3NZU A;  3ZYM A;  3AU4 A;  1ZB1 A;  1N4S A;  3V2X A;  1TEZ A;  1HE8 A;  4XEI G;  4YDE A;  2KXP C;  2J4B A;  1OCR E;  2P9S G;  2WXH A;  3R7R A;  5KCM A;  4JHJ A;  1E8X A;  4LUN U;  4N39 A;  5FIN A;  2BTD A;  1O1R A;  4X8Q A;  4DLO A;  4CT4 A;  4NAC A;  4GTM A;  3D9P A;  4XI0 A;  3MKQ B;  2X6H A;  2E2E A;  3UTM A;  2L6B A;  1Z6T A;  3UIO C;  1DCE A;  4LNB A;  2KBX A;  3FTY A;  5B1A E;  3AS8 A;  1S64 A;  3LVQ E;  4FA6 A;  3FWV A;  1UN9 A;  3QAR A;  4DUI A;  2EIK E;  2P9N G;  1H2U A;  3EU9 A;  2WXF A;  1LTX A;  2P9U G;  4J8E A;  3CVQ A;  1OWP A;  1HX8 A;  2EIL E;  1MQS A;  3EU5 A;  5EX0 A;  4YND A;  3W9F A;  4XX5 A;  3Q78 A;  2XGS A;  2X38 A;  3C3Q A;  4GTR A;  4GB9 A;  4JD2 G;  1TYQ G;  3W9G A;  4GPK A;  1HF8 A;  4TUU A;  3CVU A;  1GW6 A;  3B7U X;  1O1S A;  2PM6 A;  3JXI A;  4DK5 A;  5G55 A;  3WXX A;  4AV7 A;  4HOU A;  3FTS A;  5CEC B;  2B0O E;  4YVQ C;  4L1B A;  2IO2 C;  4B8C B;  3SBS A;  2RD0 A;  2VSO E;  3PE4 A;  4GYW A;  3I4G A;  4H7X A;  4U0Z A;  4LEU A;  3HXF A;  2PL2 A;  3EHQ A;  3VLF A;  4GA2 A;  3ULE G;  4B93 B;  3PH0 C;  5CRU A;  3S7B A;  4JPS A;  2JEK A;  2XPI A;  3RU0 A;  4LNU D;  2WMO A;  4Z68 A;  3Q7F A;  4CDM A;  1D8E A;  5ENO D;  4G25 A;  3DST A;  2Y1L E;  4JZY A;  4WNG A;  2PZI A;  4U07 A;  4CEM A;  2YIN A;  4FLB A;  2JLB A;  2UY1 B;  4K5A B; 
#chains in the Genus database with same CATH homology
 4AIF A;  4C0E A;  3L13 A;  1EDU A;  1HH8 A;  1Y8M A;  5FQ4 A;  5T4Y A;  3Q4A B;  3APC A;  5AYW D;  1INZ A;  5CCM A;  3QK0 A;  2OV8 A;  4KVO A;  3KAE A;  2X6K A;  3SGH A;  5BUZ A;  4AY6 A;  2V4L A;  4LER A;  3FH5 A;  4LCT A;  3ZYL A;  1FVF A;  3CKB A;  3D9N A;  3CHS A;  1A17 A;  3FP3 A;  4L23 A;  2V0P A;  1XGW A;  4APO A;  3MCX A;  4U0S A;  4G1T A;  4HFG A;  3RRU A;  1EF1 C;  2J08 A;  3U66 A;  4FLH A;  2WQH A;  4CT0 A;  4N5C A;  4G26 A;  4BY6 A;  3GZ1 A;  3LY9 A;  2WXM A;  2CG2 A;  1JUQ A;  1OWM A;  1DNP A;  4RSY A;  4G11 A;  4G2V A;  4JC8 A;  2KC7 A;  4A1G A;  2L0T B;  4J8D A;  2OOE A;  3ESL A;  4L7T A;  3APD A;  3SD5 A;  4BX8 A;  2UWJ G;  3CVL A;  5EX3 A;  4KMO A;  4CRW A;  3HYM B;  2MHK A;  2VQ2 A;  3HDX A;  2RG8 A;  4ANU A;  1H0A A;  1E7U A;  5G2N A;  4JEH A;  5ANR A;  2J09 A;  3TL5 A;  4WUY A;  2YNQ A;  2XGM A;  4ILH B;  4ILI A;  4AP2 A;  1ELK A;  3IHV A;  2IU1 A;  3FUL A;  5FJY A;  5A23 A;  3OXL A;  4FAD A;  3ZYK A;  1TJC A;  2VSX E;  1KT1 A;  2OND A;  2GW1 A;  3PNL B;  3UT8 A;  1X5B A;  5LX8 A;  3CHO A;  3ZXS A;  5G04 C;  3JQ1 A;  1U3C A;  4MS6 A;  5ENN A;  3FDH A;  3SBT B;  3HVE A;  3BG1 B;  2C0M A;  3ONK A;  3UMV A;  3AS4 A;  4P29 A;  3FUE A;  4U63 A;  2X6J A;  1KT0 A;  5CHE E;  3APF A;  5JJ6 A;  4UWL A;  5DBK A;  4HLE A;  2FO7 A;  1L5J A;  4FC8 A;  3CKC A;  3BEE A;  3TXN A;  3PVL A;  1SQM A;  1ZBP A;  4RVB A;  3MV2 B;  4A55 A;  4E6H A;  3MEK A;  3L08 A;  3FEY A;  2GGF A;  3MKR A;  4F7A A;  3EIJ A;  3U3W A;  4NQ0 A;  2KZT A;  2VGY A;  3EHM A;  4I2Z A;  3B7R L;  3JUI A;  4N2S A;  4GCN A;  4I9E A;  3OXG A;  4BWR A;  2FBN A;  4GZ3 A;  5JHB A;  1H2V C;  1NP7 A;  2EQX A;  3SZ7 A;  1OUV A;  5AJD A;  4HS2 A;  3ASH A;  3LXU X;  2X3M A;  3Q5M A;  2WXG A;  2V8S E;  4GA0 A;  3FUH A;  2X6F A;  2KCV A;  3ZPJ A;  4ANW A;  4CGW A;  4KXK B;  4GZ5 A;  1LF8 A;  4OVV A;  1QQE A;  3OAW A;  4EZK A;  4UI9 C;  4N3B A;  3C98 A;  3D9O A;  3FTW A;  3Q15 A;  2LAH A;  3QWW A;  1N52 A;  3VTX A;  1Z3Y A;  3EDT B;  3LVR E;  4V3I A;  3HIZ A;  4AEZ C;  3Q49 B;  4HOT A;  1IYG A;  2E0I A;  2AVP A;  3O48 A;  3PEU B;  5D0Q D;  4L2L A;  3U4T A;  4N2Q A;  1JWG A;  4WAF A;  2P58 C;  3LS8 A;  2WM9 A;  4JVS A;  3R9A B;  2AXU A;  3MKQ A;  1WAO 1;  2Q7F A;  2UY1 A;  2VYI A;  2VSY A;  5ANL A;  5EKQ D;  4GZ6 A;  2DIW A;  3NF1 A;  4WNF A;  3TG5 A;  3LY8 A;  3G2U A;  1NZN A;  4D10 C;  4WWP A;  2L6J A;  3RIB A;  1PY1 A;  2NXP A;  3U64 A;  5LOZ A;  5ARF A;  3ONL A;  3P1U A;  3CHQ A;  1IHG A;  3JQ0 A;  3TGO A;  4PS3 A;  2IFU A;  4XIF A;  5BW8 C;  4KVM A;  4GZC A;  4UWK A;  1ELR A;  3MGB A;  3QAQ A;  4KBQ A;  3DBS A;  4XE0 A;  3IEG A;  2LSU A;  4JW1 A;  3MA5 A;  3QJZ A;  1DVP A;  4L2Y A;  5FTP A;  4UQZ A;  3FUD A;  4PUC A;  3MZL B;  1HS6 A;  4FHJ A;  1HFA A;  2XHE A;  4XI9 A;  4JHR A;  3FH8 A;  3FU0 A;  3RRN B;  3CQC B;  4GML A;  2CHW A;  3N71 A;  4I9C A;  4ATG A;  5KJN A;  4AVX A;  4NUR A;  3CK9 A;  1E8W A;  3KD7 A;  4RG9 A;  5LCW C;  4ILG A;  1WY6 A;  2V5F A;  3CVW A;  3LCA A;  3RKV A;  3SF4 A;  3CK7 A;  2XGO A;  4N3C A;  4CGV A;  3O4Z A;  2GRM A;  3KS2 A;  5G05 J;  3G2W A;  4ME2 A;  3S2A A;  1Z3X A;  2IQC A;  3FU5 A;  3P2B A;  4GAA A;  3CST A;  1EYH A;  3FU3 A;  4I43 A;  4CCA A;  2VTB B;  1KLX A;  4UI9 K;  4PS7 A;  2AXV A;  4E85 A;  2J4D A;  4Q69 A;  4I1A A;  4MRU A;  2I2O A;  5FZR A;  1NA3 A;  3DPD A;  5EDS A;  2ILR A;  2XCC A;  4XKC A;  5AJL A;  3CV0 A;  4M3O A;  3ZHE A;  4UQX A;  4H7Y A;  3CGH A;  3CLJ A;  5G05 C;  1TJF A;  3CHR A;  5BV0 A;  2WXP A;  2Y3A A;  2ION A;  5BNW A;  1HG5 A;  4FU3 A;  3R7Q A;  4J6I A;  2HM8 A;  3JCK C;  4A1S A;  3ENE A;  2R59 A;  1H6K A;  4XKB A;  4AM9 A;  4MLP A;  1E7V A;  2AW6 A;  3FU6 A;  4KZC A;  4JEU A;  1B89 A;  2KCK A;  3L22 A;  5BV1 A;  2CFZ A;  2WVI A;  4IUL A;  2CHX A;  3BG0 B;  3QC1 A;  5CMY A;  3QWV A;  5FQ7 A;  1PC2 A;  3ZVV A;  3L54 A;  4GMJ A;  3SI5 A;  4N3A A;  2KAT A;  3QKY A;  3QWP A;  1OWN A;  3VLE A;  4BTA A;  1EPU A;  3TXM A;  3G2T A;  4G23 A;  4AXH A;  3SHF A;  2A4Z A;  3S7F A;  4F3V A;  3UT7 A;  3EJN A;  3FUN A;  3I3N A;  1Y6I A;  1HZ4 A;  2QFC A;  2GRL A;  5HQ8 A;  2YQ8 A;  4BT9 A;  5AIJ A;  5FZS A;  3NZS A;  3CEQ A;  2I6H A;  3B7T A;  1E8Z A;  4OVU A;  1QNF A;  5D0O D;  5FQ8 A;  4KYO B;  3UPV A;  3AS5 A;  2VJ8 A;  3VTY A;  5BT1 A;  2KM4 A;  5HI7 A;  3RK6 A;  3D9L A;  1S0P A;  3ASG A;  2WXQ A;  4EQF A;  5CCL A;  4JHK A;  5M72 A;  2XPY A;  2WQ7 A;  1ZU2 A;  3ML9 A;  4FJY A;  3HHM A;  2IOS A;  2YHE A;  5LP0 A;  4WND A;  4A3V A;  1SZ9 A;  2J9Q A;  4HOQ A;  5FT9 A;  2KCL A;  2MOW A;  4U04 A;  5J08 A;  4YVO A;  3ZEF A;  3PEV B;  1UG3 A;  3RO3 A;  2HO1 A;  4CDN A;  5E75 A;  5C2Y A;  4J0U A;  3FY4 A;  3NQP A;  1OWL A;  4I6E A;  3UUX A;  5T8I A;  4Y6C A;  3GW4 A;  2Y4U A;  1H19 A;  3T5V A;  4R7L A;  4B8A A;  4UWH A;  4ANV A;  4FP7 A;  4ABN A;  4URK A;  2FF4 A;  2VGX A;  2PQR A;  3CQG B;  4IRU A;  3TG4 A;  3EHN A;  3ZW3 A;  2WXR A;  3T5X A;  2WMN A;  4KT6 B;  1FCH A;  3QDN A;  3HVE B;  3G2V A;  4BTB A;  1N54 A;  3FUF A;  4WWN A;  1UW4 B;  2WQ6 A;  1QZ2 A;  2DCP A;  1U3D A;  4W9R A;  1BPO A;  3RO2 A;  3E4B A;  1VDY A;  2MRI A;  4U8H A;  2HYZ A;  3RRM B;  3T8M A;  4EEC A;  5AEN A;  2LAI A;  4J8S A;  3ZYQ A;  1UJJ A;  2WXK A;  2L9B A;  3KEZ A;  3L6A A;  3QNK A;  1E96 B;  2IJG X;  4XZ4 A;  3FTV A;  4I2W A;  3FHE A;  2AXZ A;  3ZN3 A;  4F53 A;  3NZU A;  1HU3 A;  3ZYM A;  3AU4 A;  4O6F A;  4HOS A;  4JXT A;  2R5S A;  3CVY A;  1TEZ A;  1SZA A;  2WB2 A;  1HE8 A;  3PE3 A;  3PRE A;  3MYV A;  4I17 A;  2J4B A;  3TJP A;  3FTZ A;  4B94 A;  3FFL A;  4PH4 B;  2WXH A;  2VTB A;  4FHK A;  5JHA A;  4GA1 A;  2WPV A;  3R7R A;  5KCM A;  2FI7 A;  1E8X A;  2X6I A;  4JHJ A;  4LUN U;  4N39 A;  2BTD A;  2VSN A;  3LY7 A;  4DLO A;  4CT4 A;  2J49 A;  2C2L A;  4NAC A;  4Q96 A;  3PUJ A;  3G2S A;  5A7D B;  5LFA A;  5E76 A;  4DLQ A;  4K0R A;  1W3B A;  4JA7 A;  3U9W A;  3D9P A;  3ASF A;  3ZRH A;  4XI0 A;  2NSZ A;  3IHY A;  4B0Z A;  2I1J A;  4GU5 A;  5C1D A;  3MKQ B;  2X6H A;  3SFZ A;  2E2E A;  3L16 A;  4WWO A;  4Y6W A;  2QY7 A;  2WXI A;  3FTU A;  1Z6T A;  4K03 A;  3UX4 A;  4GYO A;  1ELW A;  3FTY A;  2XEV A;  3AS8 A;  3LVQ E;  4AOF A;  4FA6 A;  3IBE A;  3JYS A;  3FWV A;  3MJW A;  1UN9 A;  1MHQ A;  4UWG A;  1HXI A;  3QAR A;  5FWQ A;  3GYZ A;  2PM7 A;  3CVN A;  1H2U A;  3PDN A;  3B13 A;  3S7D A;  4EBA A;  3LDZ A;  3PZD A;  4IYP A;  5KJK A;  4I6J A;  2CFU A;  5ARG A;  2WXF A;  3UQ3 A;  2FEZ A;  4J8E A;  3CVQ A;  1OWP A;  4B89 A;  2M63 A;  1XNF A;  3AU5 A;  2YHC A;  2HR2 A;  1IQR A;  4EZJ A;  1HX8 A;  2R17 C;  2IF4 A;  1MQS A;  5EX0 A;  4YND A;  4MKT A;  3URZ A;  4XX5 A;  4AY5 A;  4BFR A;  3GZS A;  2C0L A;  1E8Y A;  5G04 J;  2XGS A;  2X38 A;  4GB9 A;  4LRZ A;  4EZL A;  3RJV A;  3L17 A;  2A5U A;  1HO8 A;  4HXI A;  5FZQ A;  4DI4 A;  4GPK A;  1HF8 A;  4FUL A;  5BPP A;  1E90 A;  3FUI A;  3GZ2 A;  5A6C A;  4UWF A;  4TUU A;  3CVU A;  1GW6 A;  3B7U X;  4HVB A;  4GCO A;  2PM6 A;  3FUM A;  1UJK A;  3MV3 B;  4DK5 A;  5KJL A;  5G55 A;  4UI9 J;  2XQ0 A;  2XCB A;  3EIQ C;  3Q47 B;  4OYS A;  3WXX A;  3OXF A;  4HOU A;  1H2T C;  3UT4 A;  4AV7 A;  1HG2 A;  4BSX A;  3FTS A;  3D9K A;  3PRZ A;  3ZFW A;  4WNE A;  3I5P A;  4YVQ C;  5LCW J;  2OVB A;  2AWI A;  3CIA A;  4L1B A;  3VLD A;  4C9B B;  5JJT A;  4B8C B;  4GYY A;  3CHM A;  3LKU A;  4BX9 A;  3SBS A;  2RD0 A;  4I1O B;  4CDR A;  2CG3 A;  2PQN A;  3CSF A;  2FUL A;  3D9M A;  4UQY A;  2VSO E;  3D3M A;  3PE4 A;  4GYW A;  3I4G A;  1WM5 A;  3LEW A;  3LPZ A;  4H7X A;  4GZD A;  2NC9 A;  3MX3 A;  4U0Z A;  4TRQ A;  3K9I A;  4TV3 A;  4LEU A;  3B7S A;  3IKO B;  4KZ0 A;  4PDX A;  3ULQ A;  2XPZ A;  3SNX A;  3CHP A;  5DIZ A;  3OTN A;  4PS8 A;  2ZU6 B;  4ACK A;  2PL2 A;  2WXL A;  2BF0 X;  4AJW A;  5KJM A;  3I4R B;  3LJ3 A;  3VLF A;  3CR3 A;  1FVH A;  4NRH B;  1JPL A;  4APF A;  1IQU A;  3FH7 A;  4GA2 A;  5JJ7 A;  4C0M A;  2KZT B;  3ESK A;  2WXO A;  3FEX A;  4JL0 A;  5CMW A;  4DPR A;  4EBA G;  2LSV A;  2L0I A;  4G24 A;  3PNT B;  3LYA A;  4BT8 A;  4FJZ A;  3PH0 C;  3FUJ A;  4RG6 A;  3PUK A;  2J07 A;  2IOL A;  2LNI A;  2XRZ A;  4I1M A;  3ZGQ A;  3IV0 A;  1P5Q A;  4EPZ A;  5J90 A;  4ANX A;  3S7B A;  5FQ6 A;  4JPS A;  4U0U A;  3TAX A;  2BUG A;  3D9J A;  2JEK A;  3CVV A;  1YA0 A;  3FUK A;  2XPI A;  3RU0 A;  2VGX B;  2I1K A;  3ASD A;  4J8F A;  3PS6 A;  2WMO A;  4JA9 A;  4CDM A;  2CHZ A;  4DI3 A;  4DJA A;  3FTX A;  4G25 A;  4A3T A;  3ZIM A;  3ZHE B;  2I9C A;  4JZY A;  2DBA A;  2WXJ A;  4F1S A;  3S7J A;  4WNG A;  2PZI A;  2XRY A;  4U07 A;  4I6G A;  4CEM A;  2YIN A;  3QB2 A;  4IN3 B;  2Y4T A;  4FLB A;  2JLB A;  3CK8 A;  2WXN A;  1OWO A;  2LO6 A;  1NA0 A;  2UY1 B;  3QOU A;  5T3R A;  2OVF A;  3CVX A;  1UN8 A;  3CVP A;  1JWF A;  1PAQ A;  3ML8 A;  4ACL A;  3D9I A;  4Q94 A;  4HOR A;  4QFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...