3RKVA

C-terminal domain of protein c56c10.10, a putative peptidylprolyl isomerase, from caenorhabditis elegans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
147
structure length
147
Chain Sequence
LKSVEALRQKGNELFVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKADSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C-terminal domain of protein C56C10.10, a putative peptidylprolyl isomerase, from Caenorhabditis elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Isomerase
molecule keywords putative peptidylprolyl isomerase
total genus 63
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rkvA00
3AS4A 4I17A 4JHRA 5BW8C 2VSNA 3ASFA 3WXXA 3MA5A 1WM5A 4I9EA 1KT1A 2XEVA 5ARFA 3RJVA 2VGXB 5FTPA 3VTXA 3K9IA 1OUVA 4WNEA 3TGOA 5G05J 3QWVA 1A17A 4UQXA 4UQYA 3SZ7A 4W9RA 2IFUA 2DBAA 4J0UA 2XPIA 4Y6CA 5ARGA 4G24A 2PQNA 3CVQA 4BTBA 2Y4UA 5EX3A 2FEZA 4GPKA 3BEEA 3KS2A 4GZ5A 3ZGQA 5C1DA 2JLBA 4J8FA 4KYOB 3GYZA 2KATA 2Q7FA 3JYSA 4U0SA 5DIZA 2I6HA 4CGWA 5LCWC 2FO7A 4I1AA 2YHCA 2XGSA 2C2LA 3CVPA 1PC2A 4H7YA 5FT9A 5G04J 3CK8A 4GYOA 5KJNA 3AS5A 4G25A 4I2ZA 3RKVA 4GCOA 3CEQA 3CVLA 2XGOA 4U04A 3ASDA 3RO2A 5JJ7A 4BWRA 4EQFA 4G2VA 3U3WA 1NA3A 1TJCA 4N3AA 5A6CA 2AVPA 4N5CA 4XI0A 3NF1A 4O6FA 3CKBA 4U07A 4A1SA 3Q47B 1E96B 3GZ1A 4KXKB 2XCBA 3LY9A 4B94A 1ELRA 1FCHA 1XNFA 2KCKA 2WQHA 2Y4TA 3S7FA 4N2SA 2HR2A 4LEUA 5A7DB 3UUXA 2VGXA 4F3VA 2XGMA 1ELWA 1B89A 3QWWA 4XIFA 3VTYA 5LCWJ 3QWPA 3LPZA 2UY1A 4WNGA 4N2QA 1IHGA 3LKUA 4J8EA 5G04C 3Q15A 4AY5A 4GYWA 2YQ8A 1KT0A 4YVQC 1NZNA 3S7JA 5JJTA 3EDTB 4GZ6A 3S7BA 4XI9A 4GZ3A 1ZBPA 3LCAA 2KCVA 4I9CA 1IYGA 3TAXA 4AM9A 2L6JA 2VGYA 2C0MA 3Q49B 5EKQD 3KAEA 2OOEA 3PE4A 4ME2A 5FJYA 3ZN3A 4APOA 5KJMA 1QQEA 4KBQA 2ONDA 2HYZA 5CCMA 3Q4AB 2WPVA 3ASHA 2FBNA 3FWVA 3MV3B 3PDNA 3QKYA 4H7XA 1HZ4A 2BUGA 2J9QA 3QDNA 2VQ2A 1P5QA 2HO1A 2KC7A 1ZU2A 3MKRA 4U0ZA 2UY1B 1W3BA 3SF4A 3CV0A 2UWJG 3LY7A 3MV2B 4G1TA 4HOUA 2PL2A 4WNDA 3CK9A 3ESKA 4UI9J 1QZ2A 4HOQA 3CKCA 4HORA 4NQ0A 5JJ6A 3ASGA 4N3CA 3PE3A 4Y6WA 4YVOA 5EX0A 2KCLA 2LNIA 1NA0A 3FFLA 5D0OD 4BT9A 4HOTA 3CK7A 4UQZA 3KD7A 4AY6A 4RG6A 3E4BA 2XCCA 3IEGA 2C0LA 3MEKA 4CDRA 4YNDA 4U0UA 5G05C 2GW1A 4HOSA 4IN3B 2PZIA 4UI9K 3TG5A 3UPVA 3FP3A 5CCLA 3U4TA 4I2WA 4GA0A 5CHEE 3OXLA 4NRHB 4J8DA 3RU0A 4BT8A 3ZHEA 4JA7A 2QFCA 4G23A 3ZFWA 1YA0A 2IF4A 5FZRA 3RO3A 2MHKA 3AS8A 5M72A 3N71A 3CVNA 4GYYA 4WNFA 3ZHEB 4N3BA 2E2EA 5DBKA 4GA2A 4JL0A 4JA9A 2FI7A 4AIFA 5FZQA 1WAO1 3LY8A 3Q5MA 3ULQA 3UQ3A 3ZPJA 1Y8MA 5BNWA 4CGVA 5KJLA 2FF4A 2V5FA 5FZSA 1HXIA 3O48A 1KLXA 3URZA 5KJKA 4GA1A 3OXFA 4WUYA 2P58C 4RG9A 5D0QD 4G26A 3R9AB 4GCNA 2LSVA 2VSYA 2VYIA 4UI9C 2PQRA 3LYAA 5BT1A 3QOUA 3TG4A 3GW4A 4BTAA 4ABNA 5HI7A 5HQ8A 3RIBA 3GZ2A 3S7DA 4N39A 2R5SA 1HH8A 2NC9A 3OXGA 5AYWD 2LSUA 3HYMB
chains in the Genus database with same CATH superfamily
5B1AE 2HM8A 5ARFA 1GW6A 2XPIA 3ZGQA 3DSSA 2FO7A 4EZJA 3CVPA 1DVPA 2WVIA 2WXKA 1K8KG 1YYHA 5T4YA 3U3WA 3UTMA 1K1BA 1Q2ZA 4DLOA 3CVVA 1E96B 1TN7A 2Y4TA 3S7FA 4E6HA 2V5QC 1PY1A 3ABLE 2VGXA 1BPOA 4EECA 3NZSA 1S70B 1OWPA 3Q4AB 4ANXA 2BUGA 3ZUVB 3SGHA 1H0AA 1JWFA 4HLLA 3CSFA 1NFIE 3P1UA 4PS8A 4NQ0A 5CBNA 3ASGA 4YVOA 3PE3A 4JB8P 3SFYA 1DCQA 3HXEA 2IU1A 1N52A 1Z3YA 2H6GA 2FI7A 3PEUB 1E90A 4DX5D 1OCOE 2BKGA 3LVRE 5BV1A 4N39A 2VTBB 4U8HA 4TXPA 2J08A 1O1SA 2IEJA 1A17A 4W9RA 4HI9A 3CVQA 5EX3A 4ACKA 1X81A 2AWIA 4CGWA 4I1AA 4FJYA 4BX8A 4I1OB 4GYOA 4HFGA 2VSOE 3CEQA 3RO2A 1SA5A 4HS2A 1NA3A 3HG0D 2J4DA 1HU3A 3LY9A 3VLEA 4UWGA 1O1RA 3E30A 3FH8A 2WB2A 5E75A 4B89A 4XX5A 1KPSB 3LCAA 2L6JA 2Y3AA 5FJYA 4ZFHA 1TN6A 2VQ2A 3CV0A 3LY7A 4EZKA 3L82A 1UJJA 3JXIA 2KXPC 2EIME 4C0MA 1UW4B 2RKKA 1RZ4A 4AY6A 2CHZA 4YNDA 2ZGGA 4HRNA 4GZDA 5G55A 2XQ0A 3FUDA 4G23A 3C72A 2AJAA 2RD0A 3PRZA 4YDEA 5J90A 3UQ3A 2CFUA 1TN8A 1FVFA 3CHOA 5AIJA 1SA4A 3LYAA 1UN8A 2DWZA 1BLXB 3RIBA 3MX3A 3V30A 4L1BA 3NAWA 2MRIA 1N4RA 1RW2A 2EIJE 4A55A 2E0IA 4GPKA 4Q69A 5KNGA 1H6PA 3SHFA 2XGSA 3HVEB 3UM1A 4H7YA 3CVUA 2H6HA 3RKVA 1JPLA 3L16A 4O1OA 3I3NA 3GZ1A 3IBEA 3Q7FA 1H2UA 4F3VA 3D3MA 5LCWJ 3QWPA 4RSYA 3NOGD 5AARA 3HXCA 5EKQD 1QQEA 5CCMA 1YCSB 4K5AB 2AXZA 1V55E 1FT2A 3SF4A 3ZNGA 5G2NA 2DYRE 2XHEA 4I6JA 4IRUA 3FUFA 4WAFA 3U64A 3SFXA 2F0YA 3KSQA 4J8DA 4BT8A 4GB9A 1O5MA 5FZRA 3LEWA 4N3BA 2E2EA 5D66A 2A4ZA 4I1MA 1HXIA 5JMND 5D0QD 3R9AB 1KZOA 3AG3E 5FQ4A 5LOZA 4FULA 5BW8C 2OVFA 5FIOA 2EINE 5G05J 4UQXA 2NSZA 2PQNA 2CG3A 1N4PA 2Q7FA 2DVWA 4F53A 4JZYA 2Y1LE 2L0TB 1UN9A 3IKOB 3FTVA 4BWRA 4EQFA 4G2VA 2DZNA 2CG2A 3ZW3A 2BKKB 4GTVA 2HR2A 4GU5A 3UIPC 4AP2A 4GTRA 4GYWA 3O4ZA 4GZ6A 3S7BA 4FU3A 1V54E 5BT1A 2C0MA 4HI8A 3FHEA 3FU3A 1H2TC 2FBNA 3FUIA 4JXTA 1E7VA 4HORA 3PREA 2R02A 3E32A 3G2UA 3ZIMA 4C9BB 2NYJA 3MGBA 3Q75A 2A5UA 1OCCE 3Q7AA 1Z5SC 4XKCA 5FQ6A 1JCRA 2WXIA 3FEXA 4OVVA 3NOCD 2RFMA 1LD7A 3GW4A 4GMLA 4EBAG 1N0QA 5HQ8A 3RRMB 5E76A 3EU9A 4DX6D 1EDUA 1INZA 3NZUA 4LRZA 3SO8A 4WNEA 2F37A 4G24A 4F6RD 3X2QE 1HFAA 3ZEFA 2KM4A 2X3MA 2WMNA 3QB2A 4XE0A 5ENSD 4DX2A 4XKBA 2C2LA 5KJNA 1LTXA 4G25A 4OYSA 2GRRB 3GZSA 4F1SA 3LVQE 2BEDA 5ENOD 1S63A 1NI1A 3CHPA 2XCBA 1DC2A 3PUKA 2QY7A 4BSZB 3J5QB 3B13A 1JCSA 4FC8A 4GTQA 4XI9A 4UWFA 3L22A 5LFAA 3FWVA 2F8XK 4MRUA 3DSXA 1HE8A 1BI7B 2M63A 3LDZA 4G1TA 3FEYA 4OAVB 3D9JA 1OT8A 4EZLA 5BV0A 4BT9A 5IY5E 3EHNA 3IHVA 3BG0B 5B1BE 4A1GA 2WQ6A 1SW6A 1X5BA 4BETA 4CDNA 3T5VA 4JPSA 3CHSA 5FINA 4CEMA 4G26A 2CHWA 3FU6A 3ZXSA 3B7TA 2RG8A 5AJLA 4ILHB 4JVSA 3PZ4A 3RJVA 5FTPA 4TUUA 4FLHA 3MZLB 5BXUA 1Y6IA 1LF8A 2X38A 2IOLA 2KZTB 3FH5A 3FY4A 3OAWA 1N94A 1HG2A 3B7BA 2KBXA 3CVLA 4CCAA 1NP7A 1TJCA 3AAAC 5FQ7A 3Q73A 5KCMA 4DRXE 3MCXA 3UUXA 1ELWA 2VGEA 3DSUA 3TXMA 5T8IA 2YQ8A 3FU0A 2BF0X 4I9CA 2WXNA 3G2WA 2L0IA 1JUQA 2VGYA 4FADA 3C5RA 4MLPA 4CT4A 4KBQA 1E8WA 3QKYA 3U9WA 4IULA 2HO1A 2ILRA 1TEZA 4UI9J 2X6JA 2IJGX 4NACA 3SQVA 3EHQA 4BSXA 1UOHA 3P2BA 4UI9K 3FTYA 2R59A 4GA0A 3RSEG 5J08A 4CYMD 1FVHA 4JA7A 2QFCA 2XRZA 4DUIA 2H6IA 4Q94A 4LCTA 1KLXA 3PZDA 2P58C 4CZ2D 2VYIA 4R7LA 1VDYA 4GTMA 5AQ9A 3HYMB 4M7CA 3AS4A 4JHRA 2GRNB 5A6CA 3ZKJA 2VGXB 3VTXA 1N54A 4HVBA 3W9FA 4HRLA 4KT6B 4L9PA 2FEZA 1MYOA 3BEEA 3B7UX 2YHCA 2KZTA 4GTSA 4GCOA 3CGHA 1N4SA 4FP7A 1E8XA 4LG6A 3EIJA 1NL4A 4LERA 5ENPD 2WXRA 1OWLA 2XGMA 2UY1A 1IHGA 4BERA 4AOFA 1NZNA 4TXQA 5AN8A 1N9AA 2WPVA 2A5EA 1HZ4A 5AJDA 3ONKA 1MX4A 5CMYA 5BPPA 4HOQA 1S64A 3FU5A 3TWWA 2J49A 4F1PA 4HB5A 4TRQA 4Y6WA 5EX0A 4JC8A 2VTBA 3KSLA 3D9IA 3E4BA 3TWRA 3ZYMA 4CDRA 5G05C 2GW1A 3TL5A 2PZIA 3F6QA 3NBNB 3ZHEA 3AS8A 5M72A 3AU5A 3HXFA 3LY8A 4D10C 2L9BA 3HRAA 4GA1A 4U7EB 2B6CA 2WXHA 4GAAA 3RRUA 3GZ2A 3OXGA 3JQ1A 4KYOB 5ENQD 1WM5A 1OUVA 3QWVA 4BTBA 2WXGA 2QYUA 1WDYA 3MYVA 3KS2A 2P9NG 3DRAA 2JLBA 4AJWA 3JYSA 5DIZA 5B3SE 3UIOC 5FT9A 2LO6A 4ANWA 3NB2A 1U2VG 2X6IA 4K5BA 4GMJA 3PZ3A 4NURA 2ZGDA 2J09A 3QWWA 2P9LG 3UT8A 5G04C 2LAHA 4MKTA 1MHQA 2KCVA 4P29A 3QK0A 4ME2A 3DEPA 3HDXA 3DPDA 4U0ZA 3U66A 2UWJG 3FUMA 4WNDA 3Q79A 3ESKA 2X6FA 1D8EA 3DSTA 4UQZA 4CRWA 2IO2C 3ABKE 3BG1B 4RG6A 4E85A 3LS8A 2R03A 4CT0A 4AVXA 1JWGA 2JEKA 3D9PA 3MJWA 3RO3A 5HKPA 1Z3XA 3SBTB 2WXPA 4YDOA 1U3CA 3IXEA 1SVXA 4ABNA 1BI8B 5HI7A 3G2TA 3UM3A 2NC9A 3HXBA 5AYWD 1N0RA 1E8YA 3K9IA 1LD8A 2YINA 2OEWA 2ZISA 2IFUA 2XS8A 4EPZA 4EHMA 4LNUD 2XEHA 3APFA 1TNZA 1UJKA 4U0SA 4JD2G 4I43A 3UKUG 3E34A 1U3DA 4FJZA 3V2OA 4I2ZA 4DX7D 2DZOA 1H6KA 1OXJA 3I4GA 3CKBA 3AJIA 3CIAA 2WXLA 3Q47B 5AENA 4B94A 2R2LA 1E8ZA 2WQHA 3UT4A 3IV0A 4A63B 3LPZA 4LNGA 1KT0A 3S7JA 5JJTA 3FTUA 4JEHA 3ML8A 4GTOA 3HVEA 1K1AA 4ATZD 5KJKA 4GPMA 4L7TA 1ZB1A 3CHRA 2WXFA 2P9PG 3ASNE 3DEOA 4B8CB 1MX2A 5ENTD 2ZIRA 5D0OD 5A23A 2XCCA 3FTSA 2DCPA 5FQ8A 4HOSA 3FP3A 2DIWA 4A3TA 4LNBA 3ZFWA 4PUCA 1YA0A 1MJ0A 2XPYA 4AV7A 5DBKA 1IXVA 4CGVA 3Q5MA 3ZYLA 2VSYA 1EPUA 1N11A 3FDHA 3RAUA 2CFZA 3E33A 3Q9UC 4ILIA 3WXXA 2VSNA 1AP7A 3DXKG 3L08A 3BQOA 3FUJA 3KEZA 2VSXE 3WG7E 3GYZA 3B95A 1AWCB 4YDYA 4F7AA 3AS5A 1TNBA 3QJZA 2GRQB 4Q96A 2LAIA 1MZCA 4RQIA 3UM0A 4FLBA 2YNQA 2KCKA 4LEUA 4J7WA 1OCZE 5KBAA 3LKUA 4J8EA 3ZYQA 1A5EA 2CHXA 4HQDA 2P9KG 5KJMA 1HF8A 2ONDA 1QYMA 2IQCA 2ETAA 4I6GA 3MV2B 4ANUA 4BX9A 3ASOE 4TV3A 3FUHA 1QZ2A 2Y69E 4N3CA 3CHQA 3L6AA 4QFVA 5EILA 5CRUA 2C0LA 3ABME 3C3RA 4U96D 3UPVA 5CHEE 4GMRA 2BTDA 2ETCA 2RFAA 4G8KA 4WNFA 2PNNA 4UWHA 3ZYKA 4JA9A 3ULQA 1O1TA 3APDA 2FF4A 3URZA 1IHBA 3DSWA 3CSTA 3QNKA 3L13A 3SNXA 3ASFA 4I9EA 4XEIG 4O60A 4B93B 3MKQB 5ARGA 2PM6A 3ML9A 2WM9A 5LCWC 2QZAA 2V4LA 3FTWA 4G11A 4RLYA 5CECB 1PAQA 4J8YA 3R9MA 3NF1A 4HXIA 3D9OA 4V3IA 3B7SA 2GRMA 2AW6A 4K03A 3TWTA 4WNGA 3PVLA 2GRPB 4AM9A 1ELKA 4MS6A 1YMPA 3KAEA 4CDMA 1UG3A 3PDNA 2J9QA 1P5QA 2KC7A 3DBSA 2EQXA 2UY1B 4ILGA 4HOUA 1SZ9A 3UKRG 3EHMA 2FO1E 3IEGA 3V31A 4GTPA 4IN3B 3R7RA 3SY2A 5CCLA 2MOWA 2IY0C 2LXMA 3DWLG 4X8QA 2IO3C 2V0PA 3ENEA 2R17C 5ANLA 3CQCB 4WWNA 4XZ4A 4KMOA 2R5SA 2XS1A 3AU4A 5BXOA 3D9KA 3SFZA 3T8MA 3W9GA 4I6EA 4J0UA 3RRNB 2Y4UA 3LXUX 2GGFA 3G2VA 2J07A 1DNPA 3D9MA 3L54A 3B7RL 1PC2A 3E37A 1H6OA 5LX8A 4LSZE 3JCKC 2AVPA 4ANVA 4KXKB 1FCHA 2I2OA 2V8SE 3C98A 3ISMC 1B89A 3VTYA 2NXPA 2WQ7A 2I1JA 1MQSA 2GRLA 5ENNA 4DPRA 2I1KA 3EIQC 3JXJA 1QBQA 1OY3D 5EIBE 4KVOA 3KEAA 3FFLA 3MEKA 3SD5A 5CBOA 3TG5A 1E7UA 3VLFA 1HO8A 1TNOA 3DXMG 1TNUA 2IONA 1KZPA 4APFA 3LJ3A 2V4HC 3ULYA 4LUNU 3CVYA 3EUVA 3ZHEB 4GYYA 1IKND 2LUHA 4GA2A 4JL0A 4BESA 3O48A 3PUJA 5FWQA 3TG4A 2P2CP 1H2VC 1TNYA 1N95A 5D2MC 4U63A 2H6FA 4DLQA 3I5PA 3CQGB 3SZ7A 2GROB 5AQAA 2XPZA 4JHJA 5CRVA 2DYSE 3ESLA 2J4BA 3TWXA 3FTZA 4L2LA 3CK8A 3AG2E 4WWPA 4C0EA 1DCEA 3Q9NC 5CEDB 4XI0A 1OWOA 4O6FA 3SI5A 2QYJA 2VJ8A 4U95D 4N2SA 4QQIA 5A7DB 4EBAA 3HXDA 4HLEA 4N2QA 4YVQC 2MYOA 2XZDG 4DX1A 3DPYA 5EYLA 3TAXA 3ZVVA 2HYZA 2EILE 3JQ0A 3MV3B 1OWMA 2F8YA 1ZU2A 1W3BA 5ENRD 3LJNA 2AXUA 2XZTG 3ULEG 2QC9A 3AG4E 2KCLA 1OCRE 3PZ2A 4HOTA 3HIZA 1TR4A 2P9UG 4DK5A 4PS7A 3QC1A 1IQUA 5HRYA 2IOSA 2X6KA 2IF4A 1BU9A 3CR3A 4DJAA 5EDSA 5BUZA 3BUAA 5BNWA 1WAO1 3ZPJA 5KJLA 5JHAA 2R05A 4DI3A 2WXOA 4UI9C 2PQRA 3D9LA 3IHYA 3ZU7B 3T8KA 1FPPA 4Z68A 3DSVA 2L6BA 2XEVA 4J8SA 4BY6A 3EJNA 4PDXA 5H7PA 3T5XA 3UMVA 1JCQA 2OCCE 5C1DA 4OVUA 1TYQG 2KATA 4AXHA 4G8LA 3EU5A 4NIKA 3UXGA 3FUNA 5HS0A 5JJ7A 3PS6A 3TWVA 1QNFA 4N3AA 3T9KA 4A1SA 5ANRA 3PNLB 1WY6A 3Q78A 1HX8A 4URKA 3S2AA 2WXQA 2ZU6B 4J6IA 5LP0A 3EHRA 4AY5A 3EDTB 1IYGA 4K0RA 2HE0A 3C3QA 2P9SG 4H7XA 1H19A 3QDNA 3TXNA 3MKRA 3CK9A 3CKCA 4BFRA 3UX4A 3MKQA 5JJ6A 3UINC 3HHMA 4HBDA 2LNIA 3KD7A 5AQBA 3ONLA 4I2WA 1BD8A 3TJPA 3RK6A 3OTNA 4JHKA 4HNAD 3CLJA 3V2XA 3CVNA 3FUEA 2XRYA 3UM2A 4AIFA 4UWLA 1Y8MA 5FZSA 4PH4B 4RG9A 4JEUA 4BTAA 3VLDA 1Z6TA 1WG0A 5T3RA 2ETBA 3CHMA 2OVBA 1G3NB 4GZCA 4UWKA 4UQYA 5KNHD 3FULA 5ITZF 3ZXPA 2I9CA 4J8FA 2WXJA 5AQ7A 3D9NA 5G04J 4DI4A 3ASDA 3PH0C 4N5CA 4KVMA 4TUMA 3APCA 4M3OA 4RVBA 5C2YA 4XIFA 4YDWA 3J5PA 5EYPF 5CEAA 4ACLA 3Q15A 5CERB 3PNTB 4GZ3A 1ZBPA 3ZN3A 2OOEA 3PE4A 5JA4D 2WXMA 3TWUA 3PZ1A 3ASHA 4IYPA 3JUIA 2XEEA 2LXLA 3AG1E 4AEZC 4B0ZA 4GTTA 2PL2A 4ZHBA 1SZAA 3FUKA 4KZ0A 2JABA 2X6HA 2XENA 1NA0A 2WMOA 3PEVB 1OWNA 1IQRA 4BEPA 5EN5D 4MBGA 3RU0A 2ZXWE 4TXRA 1MX6A 4WWOA 2MHKA 3N71A 4L23A 4O1PA 3FH7A 5FZQA 2V5FA 4KZCA 3OXFA 4WUYA 4U8VD 4GCNA 1L5JA 4PS3A 2B0OE 2PM7A 3S7DA 3NQPA 1SQMA 1HH8A 3JUEA 4I17A 5KWDA 3MA5A 4HRMB 1KT1A 3C3OA 4FHJA 3TGOA 3QAQA 2DBAA 4Y6CA 3R7QA 1D9SA 4GZ5A 5CMWA 3I4RB 2I6HA 2J8SD 3L9TA 3UI2A 1N4QA 3FTXA 4L2YA 3SBSA 2FULA 2XGOA 3D9HA 4U04A 3ZRHA 1TJFA 2EIKE 4UUCA 4U07A 3L17A 4B8AA 4K5CA 1ELRA 5JHBA 1XNFA 1FT1A 2Y0BG 1K3ZD 3BU8A 3TWSA 5EIDA 3CVWA 3Q49B 4APOA 4OAUC 3UT7A 3QARA 1EYHA 2YHEA 3V79K 2OV8A 1HG5A 1EF1C 5AAOA 2P9IG 3CK7A 1XGWA 4U0UA 3TWQA 3U4TA 2OEVA 3OXLA 4NRHB 4JW1A 4U8YD 1HS6A 3CVXA 4FA6A 2AXVA 2LSVA 4A3VA 3QOUA 4N5QA 1S0PA 1D8DA 4FHKA 4C48B 3G2SA 2LSUA 4ATGA
chains in the Genus database with same CATH topology
1E8YA 4U63A 2HM8A 5ARFA 4DLQA 3I5PA 3CQGB 3K9IA 4LRZA 4WNEA 3SZ7A 2YINA 1GW6A 2IFUA 2XPIA 4G24A 2XPZA 4JHJA 4EPZA 3ESLA 1HFAA 2J4BA 3ZEFA 3ZGQA 2KM4A 2X3MA 3APFA 1UJKA 4U0SA 2WMNA 2FO7A 3FTZA 3QB2A 4I43A 4XKBA 4XE0A 4EZJA 2C2LA 3CVPA 1DVPA 4L2LA 2WVIA 5KJNA 1U3DA 3CK8A 4FJZA 4G25A 4I2ZA 2WXKA 4WWPA 4C0EA 4OYSA 3GZSA 4F1SA 1H6KA 3LVQE 5T4YA 3U3WA 4XI0A 3I4GA 1OWOA 4O6FA 3CKBA 3SI5A 4DLOA 3CIAA 3CVVA 2WXLA 1E96B 3Q47B 3CHPA 5AENA 2XCBA 4B94A 2VJ8A 3PUKA 2Y4TA 1E8ZA 2QY7A 2WQHA 3S7FA 3UT4A 4N2SA 3IV0A 4E6HA 1PY1A 5A7DB 3B13A 2VGXA 4FC8A 4EBAA 1BPOA 3LPZA 4HLEA 4EECA 4N2QA 3NZSA 1KT0A 4YVQC 3S7JA 5JJTA 4XI9A 1OWPA 3FTUA 4JEHA 3TAXA 3ML8A 3ZVVA 4UWFA 2HYZA 3L22A 3HVEA 3Q4AB 3JQ0A 5LFAA 3FWVA 4ANXA 3MV3B 2BUGA 1OWMA 5KJKA 4MRUA 3SGHA 1ZU2A 1H0AA 1JWFA 1HE8A 1W3BA 4L7TA 4G1TA 2M63A 3CSFA 3LDZA 3FEYA 3P1UA 4PS8A 3CHRA 2AXUA 4NQ0A 2WXFA 3D9JA 4B8CB 4EZLA 3ASGA 4YVOA 3PE3A 2KCLA 5D0OD 4BT9A 5BV0A 4HOTA 3EHNA 3HIZA 5A23A 3IHVA 2XCCA 3BG0B 4DK5A 3FTSA 2DCPA 4PS7A 5FQ8A 4HOSA 4A1GA 3QC1A 2WQ6A 3FP3A 2DIWA 4A3TA 2IU1A 1X5BA 1N52A 1IQUA 1Z3YA 3ZFWA 2IOSA 4PUCA 1YA0A 2X6KA 2IF4A 4CDNA 3T5VA 2XPYA 4AV7A 3CR3A 4JPSA 4DJAA 5DBKA 3CHSA 5EDSA 5BUZA 2FI7A 5BNWA 1WAO1 3ZPJA 3Q5MA 4CGVA 3PEUB 5KJLA 1E90A 5JHAA 4CEMA 3ZYLA 4DI3A 2WXOA 4G26A 3LVRE 4UI9C 2VSYA 1EPUA 2PQRA 3FDHA 5BV1A 2CHWA 3D9LA 3FU6A 3IHYA 3ZXSA 2CFZA 3B7TA 4N39A 2RG8A 2VTBB 4ILIA 4U8HA 4ILHB 4JVSA 2VSNA 5AJLA 2J08A 3WXXA 2XEVA 4J8SA 5FTPA 3RJVA 4BY6A 4TUUA 3EJNA 1A17A 4PDXA 3T5XA 3L08A 4FLHA 4W9RA 3MZLB 1Y6IA 3CVQA 1LF8A 3FUJA 3UMVA 3KEZA 5EX3A 2VSXE 4ACKA 2X38A 2IOLA 2KZTB 5C1DA 3FH5A 4OVUA 3GYZA 2KATA 2AWIA 4AXHA 4CGWA 4I1AA 4FJYA 3FY4A 3OAWA 4I1OB 4BX8A 4F7AA 1HG2A 4GYOA 3AS5A 4HFGA 3FUNA 3QJZA 2VSOE 3CEQA 3CVLA 3PS6A 3RO2A 1QNFA 4CCAA 5JJ7A 4Q96A 2LAIA 1NP7A 1NA3A 1TJCA 4HS2A 4N3AA 5FQ7A 4A1SA 2J4DA 5ANRA 1HU3A 4FLBA 2YNQA 3LY9A 3PNLB 5KCMA 2KCKA 3MCXA 1WY6A 3VLEA 4LEUA 1HX8A 3UUXA 4URKA 1ELWA 4UWGA 3S2AA 3FH8A 2WB2A 2WXQA 2ZU6B 3LKUA 4J8EA 4J6IA 3TXMA 5E75A 5T8IA 3ZYQA 2YQ8A 3FU0A 4B89A 4AY5A 5LP0A 2CHXA 2BF0X 3EDTB 4XX5A 1IYGA 3LCAA 4I9CA 2WXNA 3G2WA 2L0IA 1JUQA 2L6JA 2VGYA 2Y3AA 4K0RA 4FADA 5KJMA 5FJYA 1HF8A 4MLPA 4KBQA 2ONDA 4CT4A 2IQCA 1E8WA 4H7XA 1H19A 3QKYA 3U9WA 3QDNA 4I6GA 4IULA 2VQ2A 3TXNA 2HO1A 3MKRA 2ILRA 3CV0A 3LY7A 3MV2B 4ANUA 4BX9A 4EZKA 1TEZA 3CK9A 1UJJA 4TV3A 3FUHA 1QZ2A 4UI9J 3CKCA 2X6JA 4BFRA 2IJGX 4NACA 3UX4A 3MKQA 5JJ6A 4C0MA 4N3CA 3CHQA 3HHMA 2LNIA 1UW4B 3L6AA 4QFVA 4BSXA 3KD7A 4AY6A 3P2BA 2C0LA 2CHZA 3ONLA 4YNDA 4UI9K 3UPVA 4GZDA 5G55A 4I2WA 3FTYA 3TJPA 2R59A 4GA0A 5CHEE 3RK6A 5J08A 2XQ0A 1FVHA 4JA7A 2QFCA 3FUDA 3OTNA 4G23A 4JHKA 2BTDA 2RD0A 3CLJA 2XRZA 3CVNA 3FUEA 3PRZA 4WNFA 2XRYA 4Q94A 4UWHA 3ZYKA 4JA9A 5J90A 4AIFA 3ULQA 3UQ3A 2CFUA 1Y8MA 3APDA 4UWLA 4LCTA 2FF4A 3URZA 5FZSA 1KLXA 3PZDA 1FVFA 3CHOA 4PH4B 2P58C 4RG9A 5AIJA 2VYIA 4R7LA 3LYAA 4JEUA 4BTAA 3VLDA 1Z6TA 3CSTA 1VDYA 3L13A 3QNKA 5T3RA 3RIBA 3SNXA 3CHMA 3HYMB 3MX3A 3AS4A 4JHRA 4L1BA 3ASFA 2OVBA 4I9EA 5A6CA 2VGXB 3VTXA 1N54A 4GZCA 4HVBA 4UWKA 4UQYA 4KT6B 3MKQB 2MRIA 5ARGA 2PM6A 4A55A 2E0IA 3ML9A 3FULA 2FEZA 4GPKA 3BEEA 4Q69A 2I9CA 2WM9A 4J8FA 5LCWC 2WXJA 3B7UX 2YHCA 3SHFA 2XGSA 3HVEB 2KZTA 3D9NA 4H7YA 5G04J 2V4LA 4DI4A 3FTWA 3CVUA 4G11A 3RKVA 4GCOA 1JPLA 3ASDA 3CGHA 1PAQA 3L16A 3PH0C 4N5CA 3NF1A 4FP7A 4KVMA 3I3NA 3GZ1A 4HXIA 1E8XA 3D9OA 3IBEA 3EIJA 4V3IA 3APCA 3B7SA 4LERA 4M3OA 4RVBA 2WXRA 2GRMA 1H2UA 1OWLA 4F3VA 2XGMA 3D3MA 5C2YA 2AW6A 4K03A 4XIFA 5LCWJ 3QWPA 4RSYA 2UY1A 4WNGA 1IHGA 3PVLA 4ACLA 3Q15A 4AOFA 1NZNA 3PNTB 4GZ3A 1ZBPA 4AM9A 1ELKA 3ZN3A 4MS6A 3KAEA 2OOEA 3PE4A 5EKQD 4CDMA 2WXMA 1QQEA 5CCMA 1UG3A 2WPVA 3ASHA 3PDNA 4IYPA 1HZ4A 3JUIA 3ONKA 2J9QA 5AJDA 1P5QA 2KC7A 2AXZA 3DBSA 2EQXA 2UY1B 4ILGA 3SF4A 4AEZC 4B0ZA 4HOUA 5CMYA 5BPPA 2PL2A 1SZ9A 5G2NA 4HOQA 3EHMA 3FU5A 1SZAA 3FUKA 4KZ0A 2J49A 4TRQA 2X6HA 4Y6WA 5EX0A 1NA0A 2WMOA 2XHEA 4I6JA 4IRUA 4JC8A 2VTBA 3D9IA 3E4BA 3IEGA 3PEVB 3FUFA 3ZYMA 1OWNA 4WAFA 3U64A 1IQRA 2GW1A 5G05C 3TL5A 4IN3B 2PZIA 4CDRA 3R7RA 5CCLA 2MOWA 3RU0A 4J8DA 4BT8A 3ZHEA 4GB9A 4WWOA 2V0PA 5FZRA 2MHKA 3AS8A 5M72A 3N71A 3AU5A 3LEWA 4L23A 3FH7A 2E2EA 4N3BA 3ENEA 5FZQA 2A4ZA 3LY8A 2R17C 5ANLA 4D10C 2L9BA 2V5FA 1HXIA 4I1MA 4KZCA 4GA1A 3OXFA 3CQCB 4WUYA 5D0QD 3R9AB 2WXHA 4GCNA 1L5JA 4GAAA 4PS3A 5FQ4A 3G2SA 4WWNA 5LOZA 3RRUA 4XZ4A 2PM7A 3GZ2A 3NQPA 4KMOA 1SQMA 2R5SA 1HH8A 3AU4A 3JQ1A 3OXGA 4KYOB 3S7DA 3D9KA 4FULA 4I17A 5BW8C 3SFZA 2OVFA 3MA5A 1WM5A 1KT1A 3T8MA 4I6EA 1OUVA 4FHJA 3TGOA 5G05J 3QWVA 4UQXA 3QAQA 4J0UA 2DBAA 4Y6CA 2NSZA 2PQNA 2WXGA 4BTBA 3R7QA 2Y4UA 2CG3A 3LXUX 3RRNB 2GGFA 3G2VA 3MYVA 3KS2A 2J07A 4GZ5A 5CMWA 1DNPA 2JLBA 4AJWA 3I4RB 2Q7FA 3JYSA 5DIZA 3D9MA 2I6HA 3L54A 4F53A 3B7RL 1PC2A 5FT9A 4JZYA 2LO6A 2L0TB 3FTXA 4L2YA 3SBSA 4ANWA 2FULA 1UN9A 5LX8A 3IKOB 2XGOA 4U04A 3FTVA 4BWRA 3ZRHA 1TJFA 4EQFA 4G2VA 3JCKC 2AVPA 2X6IA 4U07A 4ANVA 2CG2A 4GMJA 3L17A 4B8AA 4KXKB 3ZW3A 1ELRA 1FCHA 1XNFA 5JHBA 2I2OA 2V8SE 4NURA 2HR2A 4GU5A 2J09A 3C98A 1B89A 3QWWA 3VTYA 2NXPA 3UT8A 4AP2A 5G04C 4GYWA 2I1JA 2WQ7A 2LAHA 3O4ZA 4MKTA 4GZ6A 3S7BA 1MHQA 3CVWA 2KCVA 4FU3A 4P29A 1MQSA 3QK0A 2GRLA 5BT1A 2C0MA 3Q49B 5ENNA 4ME2A 4APOA 3UT7A 4DPRA 2I1KA 3EIQC 3QARA 3FHEA 3FU3A 3HDXA 1H2TC 2FBNA 1EYHA 2YHEA 3DPDA 4U0ZA 3U66A 2OV8A 3FUIA 4KVOA 2UWJG 3FUMA 4JXTA 4WNDA 1E7VA 3ESKA 2X6FA 1HG5A 4HORA 3PREA 1EF1C 3G2UA 3ZIMA 3FFLA 3CK7A 4UQZA 4C9BB 4CRWA 4E85A 3BG1B 4RG6A 3LS8A 3MGBA 3MEKA 3SD5A 1XGWA 4U0UA 3TG5A 2A5UA 1E7UA 1HO8A 3U4TA 3VLFA 4CT0A 2IONA 3OXLA 4NRHB 4APFA 3LJ3A 4JW1A 4XKCA 4AVXA 5FQ6A 1HS6A 1JWGA 2JEKA 3D9PA 4LUNU 3MJWA 3CVYA 3RO3A 2WXIA 3ZHEB 1Z3XA 4GYYA 3CVXA 3FEXA 4GA2A 4JL0A 4OVVA 4FA6A 3SBTB 2WXPA 3O48A 2AXVA 3PUJA 5FWQA 2LSVA 4A3VA 3QOUA 3TG4A 1U3CA 3GW4A 1S0PA 1H2VC 4ABNA 4GMLA 4EBAG 5HI7A 3RRMB 5HQ8A 5E76A 4FHKA 3G2TA 1EDUA 1INZA 2NC9A 5AYWD 1UN8A 2LSUA 3NZUA 4ATGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AS4 A;  4I17 A;  4JHR A;  5BW8 C;  2VSN A;  3ASF A;  3WXX A;  3MA5 A;  1WM5 A;  4I9E A;  1KT1 A;  2XEV A;  5ARF A;  3RJV A;  2VGX B;  5FTP A;  3VTX A;  3K9I A;  1OUV A;  4WNE A;  3TGO A;  5G05 J;  3QWV A;  1A17 A;  4UQX A;  4UQY A;  3SZ7 A;  4W9R A;  2IFU A;  2DBA A;  4J0U A;  2XPI A;  4Y6C A;  5ARG A;  4G24 A;  2PQN A;  3CVQ A;  4BTB A;  2Y4U A;  5EX3 A;  2FEZ A;  4GPK A;  3BEE A;  3KS2 A;  4GZ5 A;  3ZGQ A;  5C1D A;  2JLB A;  4J8F A;  4KYO B;  3GYZ A;  2KAT A;  2Q7F A;  3JYS A;  4U0S A;  5DIZ A;  2I6H A;  4CGW A;  5LCW C;  2FO7 A;  4I1A A;  2YHC A;  2XGS A;  2C2L A;  3CVP A;  1PC2 A;  4H7Y A;  5FT9 A;  5G04 J;  3CK8 A;  4GYO A;  5KJN A;  3AS5 A;  4G25 A;  4I2Z A;  3RKV A;  4GCO A;  3CEQ A;  3CVL A;  2XGO A;  4U04 A;  3ASD A;  3RO2 A;  5JJ7 A;  4BWR A;  4EQF A;  4G2V A;  3U3W A;  1NA3 A;  1TJC A;  4N3A A;  5A6C A;  2AVP A;  4N5C A;  4XI0 A;  3NF1 A;  4O6F A;  3CKB A;  4U07 A;  4A1S A;  3Q47 B;  1E96 B;  3GZ1 A;  4KXK B;  2XCB A;  3LY9 A;  4B94 A;  1ELR A;  1FCH A;  1XNF A;  2KCK A;  2WQH A;  2Y4T A;  3S7F A;  4N2S A;  2HR2 A;  4LEU A;  5A7D B;  3UUX A;  2VGX A;  4F3V A;  2XGM A;  1ELW A;  1B89 A;  3QWW A;  4XIF A;  3VTY A;  5LCW J;  3QWP A;  3LPZ A;  2UY1 A;  4WNG A;  4N2Q A;  1IHG A;  3LKU A;  4J8E A;  5G04 C;  3Q15 A;  4AY5 A;  4GYW A;  2YQ8 A;  1KT0 A;  4YVQ C;  1NZN A;  3S7J A;  5JJT A;  3EDT B;  4GZ6 A;  3S7B A;  4XI9 A;  4GZ3 A;  1ZBP A;  3LCA A;  2KCV A;  4I9C A;  1IYG A;  3TAX A;  4AM9 A;  2L6J A;  2VGY A;  2C0M A;  3Q49 B;  5EKQ D;  3KAE A;  2OOE A;  3PE4 A;  4ME2 A;  5FJY A;  3ZN3 A;  4APO A;  5KJM A;  1QQE A;  4KBQ A;  2OND A;  2HYZ A;  5CCM A;  3Q4A B;  2WPV A;  3ASH A;  2FBN A;  3FWV A;  3MV3 B;  3PDN A;  3QKY A;  4H7X A;  1HZ4 A;  2BUG A;  2J9Q A;  3QDN A;  2VQ2 A;  1P5Q A;  2HO1 A;  2KC7 A;  1ZU2 A;  3MKR A;  4U0Z A;  2UY1 B;  1W3B A;  3SF4 A;  3CV0 A;  2UWJ G;  3LY7 A;  3MV2 B;  4G1T A;  4HOU A;  2PL2 A;  4WND A;  3CK9 A;  3ESK A;  4UI9 J;  1QZ2 A;  4HOQ A;  3CKC A;  4HOR A;  4NQ0 A;  5JJ6 A;  3ASG A;  4N3C A;  3PE3 A;  4Y6W A;  4YVO A;  5EX0 A;  2KCL A;  2LNI A;  1NA0 A;  3FFL A;  5D0O D;  4BT9 A;  4HOT A;  3CK7 A;  4UQZ A;  3KD7 A;  4AY6 A;  4RG6 A;  3E4B A;  2XCC A;  3IEG A;  2C0L A;  3MEK A;  4CDR A;  4YND A;  4U0U A;  5G05 C;  2GW1 A;  4HOS A;  4IN3 B;  2PZI A;  4UI9 K;  3TG5 A;  3UPV A;  3FP3 A;  5CCL A;  3U4T A;  4I2W A;  4GA0 A;  5CHE E;  3OXL A;  4NRH B;  4J8D A;  3RU0 A;  4BT8 A;  3ZHE A;  4JA7 A;  2QFC A;  4G23 A;  3ZFW A;  1YA0 A;  2IF4 A;  5FZR A;  3RO3 A;  2MHK A;  3AS8 A;  5M72 A;  3N71 A;  3CVN A;  4GYY A;  4WNF A;  3ZHE B;  4N3B A;  2E2E A;  5DBK A;  4GA2 A;  4JL0 A;  4JA9 A;  2FI7 A;  4AIF A;  5FZQ A;  1WAO 1;  3LY8 A;  3Q5M A;  3ULQ A;  3UQ3 A;  3ZPJ A;  1Y8M A;  5BNW A;  4CGV A;  5KJL A;  2FF4 A;  2V5F A;  5FZS A;  1HXI A;  3O48 A;  1KLX A;  3URZ A;  5KJK A;  4GA1 A;  3OXF A;  4WUY A;  2P58 C;  4RG9 A;  5D0Q D;  4G26 A;  3R9A B;  4GCN A;  2LSV A;  2VSY A;  2VYI A;  4UI9 C;  2PQR A;  3LYA A;  5BT1 A;  3QOU A;  3TG4 A;  3GW4 A;  4BTA A;  4ABN A;  5HI7 A;  5HQ8 A;  3RIB A;  3GZ2 A;  3S7D A;  4N39 A;  2R5S A;  1HH8 A;  2NC9 A;  3OXG A;  5AYW D;  2LSU A;  3HYM B; 
#chains in the Genus database with same CATH topology
 5B1A E;  2HM8 A;  5ARF A;  1GW6 A;  2XPI A;  3ZGQ A;  3DSS A;  2FO7 A;  4EZJ A;  3CVP A;  1DVP A;  2WVI A;  2WXK A;  1K8K G;  1YYH A;  5T4Y A;  3U3W A;  3UTM A;  1K1B A;  1Q2Z A;  4DLO A;  3CVV A;  1E96 B;  1TN7 A;  2Y4T A;  3S7F A;  4E6H A;  2V5Q C;  1PY1 A;  3ABL E;  2VGX A;  1BPO A;  4EEC A;  3NZS A;  1S70 B;  1OWP A;  3Q4A B;  4ANX A;  2BUG A;  3ZUV B;  3SGH A;  1H0A A;  1JWF A;  4HLL A;  3CSF A;  1NFI E;  3P1U A;  4PS8 A;  4NQ0 A;  5CBN A;  3ASG A;  4YVO A;  3PE3 A;  4JB8 P;  3SFY A;  1DCQ A;  3HXE A;  2IU1 A;  1N52 A;  1Z3Y A;  2H6G A;  2FI7 A;  3PEU B;  1E90 A;  4DX5 D;  1OCO E;  2BKG A;  3LVR E;  5BV1 A;  4N39 A;  2VTB B;  4U8H A;  4TXP A;  2J08 A;  1O1S A;  2IEJ A;  1A17 A;  4W9R A;  4HI9 A;  3CVQ A;  5EX3 A;  4ACK A;  1X81 A;  2AWI A;  4CGW A;  4I1A A;  4FJY A;  4BX8 A;  4I1O B;  4GYO A;  4HFG A;  2VSO E;  3CEQ A;  3RO2 A;  1SA5 A;  4HS2 A;  1NA3 A;  3HG0 D;  2J4D A;  1HU3 A;  3LY9 A;  3VLE A;  4UWG A;  1O1R A;  3E30 A;  3FH8 A;  2WB2 A;  5E75 A;  4B89 A;  4XX5 A;  1KPS B;  3LCA A;  2L6J A;  2Y3A A;  5FJY A;  4ZFH A;  1TN6 A;  2VQ2 A;  3CV0 A;  3LY7 A;  4EZK A;  3L82 A;  1UJJ A;  3JXI A;  2KXP C;  2EIM E;  4C0M A;  1UW4 B;  2RKK A;  1RZ4 A;  4AY6 A;  2CHZ A;  4YND A;  2ZGG A;  4HRN A;  4GZD A;  5G55 A;  2XQ0 A;  3FUD A;  4G23 A;  3C72 A;  2AJA A;  2RD0 A;  3PRZ A;  4YDE A;  5J90 A;  3UQ3 A;  2CFU A;  1TN8 A;  1FVF A;  3CHO A;  5AIJ A;  1SA4 A;  3LYA A;  1UN8 A;  2DWZ A;  1BLX B;  3RIB A;  3MX3 A;  3V30 A;  4L1B A;  3NAW A;  2MRI A;  1N4R A;  1RW2 A;  2EIJ E;  4A55 A;  2E0I A;  4GPK A;  4Q69 A;  5KNG A;  1H6P A;  3SHF A;  2XGS A;  3HVE B;  3UM1 A;  4H7Y A;  3CVU A;  2H6H A;  3RKV A;  1JPL A;  3L16 A;  4O1O A;  3I3N A;  3GZ1 A;  3IBE A;  3Q7F A;  1H2U A;  4F3V A;  3D3M A;  5LCW J;  3QWP A;  4RSY A;  3NOG D;  5AAR A;  3HXC A;  5EKQ D;  1QQE A;  5CCM A;  1YCS B;  4K5A B;  2AXZ A;  1V55 E;  1FT2 A;  3SF4 A;  3ZNG A;  5G2N A;  2DYR E;  2XHE A;  4I6J A;  4IRU A;  3FUF A;  4WAF A;  3U64 A;  3SFX A;  2F0Y A;  3KSQ A;  4J8D A;  4BT8 A;  4GB9 A;  1O5M A;  5FZR A;  3LEW A;  4N3B A;  2E2E A;  5D66 A;  2A4Z A;  4I1M A;  1HXI A;  5JMN D;  5D0Q D;  3R9A B;  1KZO A;  3AG3 E;  5FQ4 A;  5LOZ A;  4FUL A;  5BW8 C;  2OVF A;  5FIO A;  2EIN E;  5G05 J;  4UQX A;  2NSZ A;  2PQN A;  2CG3 A;  1N4P A;  2Q7F A;  2DVW A;  4F53 A;  4JZY A;  2Y1L E;  2L0T B;  1UN9 A;  3IKO B;  3FTV A;  4BWR A;  4EQF A;  4G2V A;  2DZN A;  2CG2 A;  3ZW3 A;  2BKK B;  4GTV A;  2HR2 A;  4GU5 A;  3UIP C;  4AP2 A;  4GTR A;  4GYW A;  3O4Z A;  4GZ6 A;  3S7B A;  4FU3 A;  1V54 E;  5BT1 A;  2C0M A;  4HI8 A;  3FHE A;  3FU3 A;  1H2T C;  2FBN A;  3FUI A;  4JXT A;  1E7V A;  4HOR A;  3PRE A;  2R02 A;  3E32 A;  3G2U A;  3ZIM A;  4C9B B;  2NYJ A;  3MGB A;  3Q75 A;  2A5U A;  1OCC E;  3Q7A A;  1Z5S C;  4XKC A;  5FQ6 A;  1JCR A;  2WXI A;  3FEX A;  4OVV A;  3NOC D;  2RFM A;  1LD7 A;  3GW4 A;  4GML A;  4EBA G;  1N0Q A;  5HQ8 A;  3RRM B;  5E76 A;  3EU9 A;  4DX6 D;  1EDU A;  1INZ A;  3NZU A;  4LRZ A;  3SO8 A;  4WNE A;  2F37 A;  4G24 A;  4F6R D;  3X2Q E;  1HFA A;  3ZEF A;  2KM4 A;  2X3M A;  2WMN A;  3QB2 A;  4XE0 A;  5ENS D;  4DX2 A;  4XKB A;  2C2L A;  5KJN A;  1LTX A;  4G25 A;  4OYS A;  2GRR B;  3GZS A;  4F1S A;  3LVQ E;  2BED A;  5ENO D;  1S63 A;  1NI1 A;  3CHP A;  2XCB A;  1DC2 A;  3PUK A;  2QY7 A;  4BSZ B;  3J5Q B;  3B13 A;  1JCS A;  4FC8 A;  4GTQ A;  4XI9 A;  4UWF A;  3L22 A;  5LFA A;  3FWV A;  2F8X K;  4MRU A;  3DSX A;  1HE8 A;  1BI7 B;  2M63 A;  3LDZ A;  4G1T A;  3FEY A;  4OAV B;  3D9J A;  1OT8 A;  4EZL A;  5BV0 A;  4BT9 A;  5IY5 E;  3EHN A;  3IHV A;  3BG0 B;  5B1B E;  4A1G A;  2WQ6 A;  1SW6 A;  1X5B A;  4BET A;  4CDN A;  3T5V A;  4JPS A;  3CHS A;  5FIN A;  4CEM A;  4G26 A;  2CHW A;  3FU6 A;  3ZXS A;  3B7T A;  2RG8 A;  5AJL A;  4ILH B;  4JVS A;  3PZ4 A;  3RJV A;  5FTP A;  4TUU A;  4FLH A;  3MZL B;  5BXU A;  1Y6I A;  1LF8 A;  2X38 A;  2IOL A;  2KZT B;  3FH5 A;  3FY4 A;  3OAW A;  1N94 A;  1HG2 A;  3B7B A;  2KBX A;  3CVL A;  4CCA A;  1NP7 A;  1TJC A;  3AAA C;  5FQ7 A;  3Q73 A;  5KCM A;  4DRX E;  3MCX A;  3UUX A;  1ELW A;  2VGE A;  3DSU A;  3TXM A;  5T8I A;  2YQ8 A;  3FU0 A;  2BF0 X;  4I9C A;  2WXN A;  3G2W A;  2L0I A;  1JUQ A;  2VGY A;  4FAD A;  3C5R A;  4MLP A;  4CT4 A;  4KBQ A;  1E8W A;  3QKY A;  3U9W A;  4IUL A;  2HO1 A;  2ILR A;  1TEZ A;  4UI9 J;  2X6J A;  2IJG X;  4NAC A;  3SQV A;  3EHQ A;  4BSX A;  1UOH A;  3P2B A;  4UI9 K;  3FTY A;  2R59 A;  4GA0 A;  3RSE G;  5J08 A;  4CYM D;  1FVH A;  4JA7 A;  2QFC A;  2XRZ A;  4DUI A;  2H6I A;  4Q94 A;  4LCT A;  1KLX A;  3PZD A;  2P58 C;  4CZ2 D;  2VYI A;  4R7L A;  1VDY A;  4GTM A;  5AQ9 A;  3HYM B;  4M7C A;  3AS4 A;  4JHR A;  2GRN B;  5A6C A;  3ZKJ A;  2VGX B;  3VTX A;  1N54 A;  4HVB A;  3W9F A;  4HRL A;  4KT6 B;  4L9P A;  2FEZ A;  1MYO A;  3BEE A;  3B7U X;  2YHC A;  2KZT A;  4GTS A;  4GCO A;  3CGH A;  1N4S A;  4FP7 A;  1E8X A;  4LG6 A;  3EIJ A;  1NL4 A;  4LER A;  5ENP D;  2WXR A;  1OWL A;  2XGM A;  2UY1 A;  1IHG A;  4BER A;  4AOF A;  1NZN A;  4TXQ A;  5AN8 A;  1N9A A;  2WPV A;  2A5E A;  1HZ4 A;  5AJD A;  3ONK A;  1MX4 A;  5CMY A;  5BPP A;  4HOQ A;  1S64 A;  3FU5 A;  3TWW A;  2J49 A;  4F1P A;  4HB5 A;  4TRQ A;  4Y6W A;  5EX0 A;  4JC8 A;  2VTB A;  3KSL A;  3D9I A;  3E4B A;  3TWR A;  3ZYM A;  4CDR A;  5G05 C;  2GW1 A;  3TL5 A;  2PZI A;  3F6Q A;  3NBN B;  3ZHE A;  3AS8 A;  5M72 A;  3AU5 A;  3HXF A;  3LY8 A;  4D10 C;  2L9B A;  3HRA A;  4GA1 A;  4U7E B;  2B6C A;  2WXH A;  4GAA A;  3RRU A;  3GZ2 A;  3OXG A;  3JQ1 A;  4KYO B;  5ENQ D;  1WM5 A;  1OUV A;  3QWV A;  4BTB A;  2WXG A;  2QYU A;  1WDY A;  3MYV A;  3KS2 A;  2P9N G;  3DRA A;  2JLB A;  4AJW A;  3JYS A;  5DIZ A;  5B3S E;  3UIO C;  5FT9 A;  2LO6 A;  4ANW A;  3NB2 A;  1U2V G;  2X6I A;  4K5B A;  4GMJ A;  3PZ3 A;  4NUR A;  2ZGD A;  2J09 A;  3QWW A;  2P9L G;  3UT8 A;  5G04 C;  2LAH A;  4MKT A;  1MHQ A;  2KCV A;  4P29 A;  3QK0 A;  4ME2 A;  3DEP A;  3HDX A;  3DPD A;  4U0Z A;  3U66 A;  2UWJ G;  3FUM A;  4WND A;  3Q79 A;  3ESK A;  2X6F A;  1D8E A;  3DST A;  4UQZ A;  4CRW A;  2IO2 C;  3ABK E;  3BG1 B;  4RG6 A;  4E85 A;  3LS8 A;  2R03 A;  4CT0 A;  4AVX A;  1JWG A;  2JEK A;  3D9P A;  3MJW A;  3RO3 A;  5HKP A;  1Z3X A;  3SBT B;  2WXP A;  4YDO A;  1U3C A;  3IXE A;  1SVX A;  4ABN A;  1BI8 B;  5HI7 A;  3G2T A;  3UM3 A;  2NC9 A;  3HXB A;  5AYW D;  1N0R A;  1E8Y A;  3K9I A;  1LD8 A;  2YIN A;  2OEW A;  2ZIS A;  2IFU A;  2XS8 A;  4EPZ A;  4EHM A;  4LNU D;  2XEH A;  3APF A;  1TNZ A;  1UJK A;  4U0S A;  4JD2 G;  4I43 A;  3UKU G;  3E34 A;  1U3D A;  4FJZ A;  3V2O A;  4I2Z A;  4DX7 D;  2DZO A;  1H6K A;  1OXJ A;  3I4G A;  3CKB A;  3AJI A;  3CIA A;  2WXL A;  3Q47 B;  5AEN A;  4B94 A;  2R2L A;  1E8Z A;  2WQH A;  3UT4 A;  3IV0 A;  4A63 B;  3LPZ A;  4LNG A;  1KT0 A;  3S7J A;  5JJT A;  3FTU A;  4JEH A;  3ML8 A;  4GTO A;  3HVE A;  1K1A A;  4ATZ D;  5KJK A;  4GPM A;  4L7T A;  1ZB1 A;  3CHR A;  2WXF A;  2P9P G;  3ASN E;  3DEO A;  4B8C B;  1MX2 A;  5ENT D;  2ZIR A;  5D0O D;  5A23 A;  2XCC A;  3FTS A;  2DCP A;  5FQ8 A;  4HOS A;  3FP3 A;  2DIW A;  4A3T A;  4LNB A;  3ZFW A;  4PUC A;  1YA0 A;  1MJ0 A;  2XPY A;  4AV7 A;  5DBK A;  1IXV A;  4CGV A;  3Q5M A;  3ZYL A;  2VSY A;  1EPU A;  1N11 A;  3FDH A;  3RAU A;  2CFZ A;  3E33 A;  3Q9U C;  4ILI A;  3WXX A;  2VSN A;  1AP7 A;  3DXK G;  3L08 A;  3BQO A;  3FUJ A;  3KEZ A;  2VSX E;  3WG7 E;  3GYZ A;  3B95 A;  1AWC B;  4YDY A;  4F7A A;  3AS5 A;  1TNB A;  3QJZ A;  2GRQ B;  4Q96 A;  2LAI A;  1MZC A;  4RQI A;  3UM0 A;  4FLB A;  2YNQ A;  2KCK A;  4LEU A;  4J7W A;  1OCZ E;  5KBA A;  3LKU A;  4J8E A;  3ZYQ A;  1A5E A;  2CHX A;  4HQD A;  2P9K G;  5KJM A;  1HF8 A;  2OND A;  1QYM A;  2IQC A;  2ETA A;  4I6G A;  3MV2 B;  4ANU A;  4BX9 A;  3ASO E;  4TV3 A;  3FUH A;  1QZ2 A;  2Y69 E;  4N3C A;  3CHQ A;  3L6A A;  4QFV A;  5EIL A;  5CRU A;  2C0L A;  3ABM E;  3C3R A;  4U96 D;  3UPV A;  5CHE E;  4GMR A;  2BTD A;  2ETC A;  2RFA A;  4G8K A;  4WNF A;  2PNN A;  4UWH A;  3ZYK A;  4JA9 A;  3ULQ A;  1O1T A;  3APD A;  2FF4 A;  3URZ A;  1IHB A;  3DSW A;  3CST A;  3QNK A;  3L13 A;  3SNX A;  3ASF A;  4I9E A;  4XEI G;  4O60 A;  4B93 B;  3MKQ B;  5ARG A;  2PM6 A;  3ML9 A;  2WM9 A;  5LCW C;  2QZA A;  2V4L A;  3FTW A;  4G11 A;  4RLY A;  5CEC B;  1PAQ A;  4J8Y A;  3R9M A;  3NF1 A;  4HXI A;  3D9O A;  4V3I A;  3B7S A;  2GRM A;  2AW6 A;  4K03 A;  3TWT A;  4WNG A;  3PVL A;  2GRP B;  4AM9 A;  1ELK A;  4MS6 A;  1YMP A;  3KAE A;  4CDM A;  1UG3 A;  3PDN A;  2J9Q A;  1P5Q A;  2KC7 A;  3DBS A;  2EQX A;  2UY1 B;  4ILG A;  4HOU A;  1SZ9 A;  3UKR G;  3EHM A;  2FO1 E;  3IEG A;  3V31 A;  4GTP A;  4IN3 B;  3R7R A;  3SY2 A;  5CCL A;  2MOW A;  2IY0 C;  2LXM A;  3DWL G;  4X8Q A;  2IO3 C;  2V0P A;  3ENE A;  2R17 C;  5ANL A;  3CQC B;  4WWN A;  4XZ4 A;  4KMO A;  2R5S A;  2XS1 A;  3AU4 A;  5BXO A;  3D9K A;  3SFZ A;  3T8M A;  3W9G A;  4I6E A;  4J0U A;  3RRN B;  2Y4U A;  3LXU X;  2GGF A;  3G2V A;  2J07 A;  1DNP A;  3D9M A;  3L54 A;  3B7R L;  1PC2 A;  3E37 A;  1H6O A;  5LX8 A;  4LSZ E;  3JCK C;  2AVP A;  4ANV A;  4KXK B;  1FCH A;  2I2O A;  2V8S E;  3C98 A;  3ISM C;  1B89 A;  3VTY A;  2NXP A;  2WQ7 A;  2I1J A;  1MQS A;  2GRL A;  5ENN A;  4DPR A;  2I1K A;  3EIQ C;  3JXJ A;  1QBQ A;  1OY3 D;  5EIB E;  4KVO A;  3KEA A;  3FFL A;  3MEK A;  3SD5 A;  5CBO A;  3TG5 A;  1E7U A;  3VLF A;  1HO8 A;  1TNO A;  3DXM G;  1TNU A;  2ION A;  1KZP A;  4APF A;  3LJ3 A;  2V4H C;  3ULY A;  4LUN U;  3CVY A;  3EUV A;  3ZHE B;  4GYY A;  1IKN D;  2LUH A;  4GA2 A;  4JL0 A;  4BES A;  3O48 A;  3PUJ A;  5FWQ A;  3TG4 A;  2P2C P;  1H2V C;  1TNY A;  1N95 A;  5D2M C;  4U63 A;  2H6F A;  4DLQ A;  3I5P A;  3CQG B;  3SZ7 A;  2GRO B;  5AQA A;  2XPZ A;  4JHJ A;  5CRV A;  2DYS E;  3ESL A;  2J4B A;  3TWX A;  3FTZ A;  4L2L A;  3CK8 A;  3AG2 E;  4WWP A;  4C0E A;  1DCE A;  3Q9N C;  5CED B;  4XI0 A;  1OWO A;  4O6F A;  3SI5 A;  2QYJ A;  2VJ8 A;  4U95 D;  4N2S A;  4QQI A;  5A7D B;  4EBA A;  3HXD A;  4HLE A;  4N2Q A;  4YVQ C;  2MYO A;  2XZD G;  4DX1 A;  3DPY A;  5EYL A;  3TAX A;  3ZVV A;  2HYZ A;  2EIL E;  3JQ0 A;  3MV3 B;  1OWM A;  2F8Y A;  1ZU2 A;  1W3B A;  5ENR D;  3LJN A;  2AXU A;  2XZT G;  3ULE G;  2QC9 A;  3AG4 E;  2KCL A;  1OCR E;  3PZ2 A;  4HOT A;  3HIZ A;  1TR4 A;  2P9U G;  4DK5 A;  4PS7 A;  3QC1 A;  1IQU A;  5HRY A;  2IOS A;  2X6K A;  2IF4 A;  1BU9 A;  3CR3 A;  4DJA A;  5EDS A;  5BUZ A;  3BUA A;  5BNW A;  1WAO 1;  3ZPJ A;  5KJL A;  5JHA A;  2R05 A;  4DI3 A;  2WXO A;  4UI9 C;  2PQR A;  3D9L A;  3IHY A;  3ZU7 B;  3T8K A;  1FPP A;  4Z68 A;  3DSV A;  2L6B A;  2XEV A;  4J8S A;  4BY6 A;  3EJN A;  4PDX A;  5H7P A;  3T5X A;  3UMV A;  1JCQ A;  2OCC E;  5C1D A;  4OVU A;  1TYQ G;  2KAT A;  4AXH A;  4G8L A;  3EU5 A;  4NIK A;  3UXG A;  3FUN A;  5HS0 A;  5JJ7 A;  3PS6 A;  3TWV A;  1QNF A;  4N3A A;  3T9K A;  4A1S A;  5ANR A;  3PNL B;  1WY6 A;  3Q78 A;  1HX8 A;  4URK A;  3S2A A;  2WXQ A;  2ZU6 B;  4J6I A;  5LP0 A;  3EHR A;  4AY5 A;  3EDT B;  1IYG A;  4K0R A;  2HE0 A;  3C3Q A;  2P9S G;  4H7X A;  1H19 A;  3QDN A;  3TXN A;  3MKR A;  3CK9 A;  3CKC A;  4BFR A;  3UX4 A;  3MKQ A;  5JJ6 A;  3UIN C;  3HHM A;  4HBD A;  2LNI A;  3KD7 A;  5AQB A;  3ONL A;  4I2W A;  1BD8 A;  3TJP A;  3RK6 A;  3OTN A;  4JHK A;  4HNA D;  3CLJ A;  3V2X A;  3CVN A;  3FUE A;  2XRY A;  3UM2 A;  4AIF A;  4UWL A;  1Y8M A;  5FZS A;  4PH4 B;  4RG9 A;  4JEU A;  4BTA A;  3VLD A;  1Z6T A;  1WG0 A;  5T3R A;  2ETB A;  3CHM A;  2OVB A;  1G3N B;  4GZC A;  4UWK A;  4UQY A;  5KNH D;  3FUL A;  5ITZ F;  3ZXP A;  2I9C A;  4J8F A;  2WXJ A;  5AQ7 A;  3D9N A;  5G04 J;  4DI4 A;  3ASD A;  3PH0 C;  4N5C A;  4KVM A;  4TUM A;  3APC A;  4M3O A;  4RVB A;  5C2Y A;  4XIF A;  4YDW A;  3J5P A;  5EYP F;  5CEA A;  4ACL A;  3Q15 A;  5CER B;  3PNT B;  4GZ3 A;  1ZBP A;  3ZN3 A;  2OOE A;  3PE4 A;  5JA4 D;  2WXM A;  3TWU A;  3PZ1 A;  3ASH A;  4IYP A;  3JUI A;  2XEE A;  2LXL A;  3AG1 E;  4AEZ C;  4B0Z A;  4GTT A;  2PL2 A;  4ZHB A;  1SZA A;  3FUK A;  4KZ0 A;  2JAB A;  2X6H A;  2XEN A;  1NA0 A;  2WMO A;  3PEV B;  1OWN A;  1IQR A;  4BEP A;  5EN5 D;  4MBG A;  3RU0 A;  2ZXW E;  4TXR A;  1MX6 A;  4WWO A;  2MHK A;  3N71 A;  4L23 A;  4O1P A;  3FH7 A;  5FZQ A;  2V5F A;  4KZC A;  3OXF A;  4WUY A;  4U8V D;  4GCN A;  1L5J A;  4PS3 A;  2B0O E;  2PM7 A;  3S7D A;  3NQP A;  1SQM A;  1HH8 A;  3JUE A;  4I17 A;  5KWD A;  3MA5 A;  4HRM B;  1KT1 A;  3C3O A;  4FHJ A;  3TGO A;  3QAQ A;  2DBA A;  4Y6C A;  3R7Q A;  1D9S A;  4GZ5 A;  5CMW A;  3I4R B;  2I6H A;  2J8S D;  3L9T A;  3UI2 A;  1N4Q A;  3FTX A;  4L2Y A;  3SBS A;  2FUL A;  2XGO A;  3D9H A;  4U04 A;  3ZRH A;  1TJF A;  2EIK E;  4UUC A;  4U07 A;  3L17 A;  4B8A A;  4K5C A;  1ELR A;  5JHB A;  1XNF A;  1FT1 A;  2Y0B G;  1K3Z D;  3BU8 A;  3TWS A;  5EID A;  3CVW A;  3Q49 B;  4APO A;  4OAU C;  3UT7 A;  3QAR A;  1EYH A;  2YHE A;  3V79 K;  2OV8 A;  1HG5 A;  1EF1 C;  5AAO A;  2P9I G;  3CK7 A;  1XGW A;  4U0U A;  3TWQ A;  3U4T A;  2OEV A;  3OXL A;  4NRH B;  4JW1 A;  4U8Y D;  1HS6 A;  3CVX A;  4FA6 A;  2AXV A;  2LSV A;  4A3V A;  3QOU A;  4N5Q A;  1S0P A;  1D8D A;  4FHK A;  4C48 B;  3G2S A;  2LSU A;  4ATG A; 
#chains in the Genus database with same CATH homology
 1E8Y A;  4U63 A;  2HM8 A;  5ARF A;  4DLQ A;  3I5P A;  3CQG B;  3K9I A;  4LRZ A;  4WNE A;  3SZ7 A;  2YIN A;  1GW6 A;  2IFU A;  2XPI A;  4G24 A;  2XPZ A;  4JHJ A;  4EPZ A;  3ESL A;  1HFA A;  2J4B A;  3ZEF A;  3ZGQ A;  2KM4 A;  2X3M A;  3APF A;  1UJK A;  4U0S A;  2WMN A;  2FO7 A;  3FTZ A;  3QB2 A;  4I43 A;  4XKB A;  4XE0 A;  4EZJ A;  2C2L A;  3CVP A;  1DVP A;  4L2L A;  2WVI A;  5KJN A;  1U3D A;  3CK8 A;  4FJZ A;  4G25 A;  4I2Z A;  2WXK A;  4WWP A;  4C0E A;  4OYS A;  3GZS A;  4F1S A;  1H6K A;  3LVQ E;  5T4Y A;  3U3W A;  4XI0 A;  3I4G A;  1OWO A;  4O6F A;  3CKB A;  3SI5 A;  4DLO A;  3CIA A;  3CVV A;  2WXL A;  1E96 B;  3Q47 B;  3CHP A;  5AEN A;  2XCB A;  4B94 A;  2VJ8 A;  3PUK A;  2Y4T A;  1E8Z A;  2QY7 A;  2WQH A;  3S7F A;  3UT4 A;  4N2S A;  3IV0 A;  4E6H A;  1PY1 A;  5A7D B;  3B13 A;  2VGX A;  4FC8 A;  4EBA A;  1BPO A;  3LPZ A;  4HLE A;  4EEC A;  4N2Q A;  3NZS A;  1KT0 A;  4YVQ C;  3S7J A;  5JJT A;  4XI9 A;  1OWP A;  3FTU A;  4JEH A;  3TAX A;  3ML8 A;  3ZVV A;  4UWF A;  2HYZ A;  3L22 A;  3HVE A;  3Q4A B;  3JQ0 A;  5LFA A;  3FWV A;  4ANX A;  3MV3 B;  2BUG A;  1OWM A;  5KJK A;  4MRU A;  3SGH A;  1ZU2 A;  1H0A A;  1JWF A;  1HE8 A;  1W3B A;  4L7T A;  4G1T A;  2M63 A;  3CSF A;  3LDZ A;  3FEY A;  3P1U A;  4PS8 A;  3CHR A;  2AXU A;  4NQ0 A;  2WXF A;  3D9J A;  4B8C B;  4EZL A;  3ASG A;  4YVO A;  3PE3 A;  2KCL A;  5D0O D;  4BT9 A;  5BV0 A;  4HOT A;  3EHN A;  3HIZ A;  5A23 A;  3IHV A;  2XCC A;  3BG0 B;  4DK5 A;  3FTS A;  2DCP A;  4PS7 A;  5FQ8 A;  4HOS A;  4A1G A;  3QC1 A;  2WQ6 A;  3FP3 A;  2DIW A;  4A3T A;  2IU1 A;  1X5B A;  1N52 A;  1IQU A;  1Z3Y A;  3ZFW A;  2IOS A;  4PUC A;  1YA0 A;  2X6K A;  2IF4 A;  4CDN A;  3T5V A;  2XPY A;  4AV7 A;  3CR3 A;  4JPS A;  4DJA A;  5DBK A;  3CHS A;  5EDS A;  5BUZ A;  2FI7 A;  5BNW A;  1WAO 1;  3ZPJ A;  3Q5M A;  4CGV A;  3PEU B;  5KJL A;  1E90 A;  5JHA A;  4CEM A;  3ZYL A;  4DI3 A;  2WXO A;  4G26 A;  3LVR E;  4UI9 C;  2VSY A;  1EPU A;  2PQR A;  3FDH A;  5BV1 A;  2CHW A;  3D9L A;  3FU6 A;  3IHY A;  3ZXS A;  2CFZ A;  3B7T A;  4N39 A;  2RG8 A;  2VTB B;  4ILI A;  4U8H A;  4ILH B;  4JVS A;  2VSN A;  5AJL A;  2J08 A;  3WXX A;  2XEV A;  4J8S A;  5FTP A;  3RJV A;  4BY6 A;  4TUU A;  3EJN A;  1A17 A;  4PDX A;  3T5X A;  3L08 A;  4FLH A;  4W9R A;  3MZL B;  1Y6I A;  3CVQ A;  1LF8 A;  3FUJ A;  3UMV A;  3KEZ A;  5EX3 A;  2VSX E;  4ACK A;  2X38 A;  2IOL A;  2KZT B;  5C1D A;  3FH5 A;  4OVU A;  3GYZ A;  2KAT A;  2AWI A;  4AXH A;  4CGW A;  4I1A A;  4FJY A;  3FY4 A;  3OAW A;  4I1O B;  4BX8 A;  4F7A A;  1HG2 A;  4GYO A;  3AS5 A;  4HFG A;  3FUN A;  3QJZ A;  2VSO E;  3CEQ A;  3CVL A;  3PS6 A;  3RO2 A;  1QNF A;  4CCA A;  5JJ7 A;  4Q96 A;  2LAI A;  1NP7 A;  1NA3 A;  1TJC A;  4HS2 A;  4N3A A;  5FQ7 A;  4A1S A;  2J4D A;  5ANR A;  1HU3 A;  4FLB A;  2YNQ A;  3LY9 A;  3PNL B;  5KCM A;  2KCK A;  3MCX A;  1WY6 A;  3VLE A;  4LEU A;  1HX8 A;  3UUX A;  4URK A;  1ELW A;  4UWG A;  3S2A A;  3FH8 A;  2WB2 A;  2WXQ A;  2ZU6 B;  3LKU A;  4J8E A;  4J6I A;  3TXM A;  5E75 A;  5T8I A;  3ZYQ A;  2YQ8 A;  3FU0 A;  4B89 A;  4AY5 A;  5LP0 A;  2CHX A;  2BF0 X;  3EDT B;  4XX5 A;  1IYG A;  3LCA A;  4I9C A;  2WXN A;  3G2W A;  2L0I A;  1JUQ A;  2L6J A;  2VGY A;  2Y3A A;  4K0R A;  4FAD A;  5KJM A;  5FJY A;  1HF8 A;  4MLP A;  4KBQ A;  2OND A;  4CT4 A;  2IQC A;  1E8W A;  4H7X A;  1H19 A;  3QKY A;  3U9W A;  3QDN A;  4I6G A;  4IUL A;  2VQ2 A;  3TXN A;  2HO1 A;  3MKR A;  2ILR A;  3CV0 A;  3LY7 A;  3MV2 B;  4ANU A;  4BX9 A;  4EZK A;  1TEZ A;  3CK9 A;  1UJJ A;  4TV3 A;  3FUH A;  1QZ2 A;  4UI9 J;  3CKC A;  2X6J A;  4BFR A;  2IJG X;  4NAC A;  3UX4 A;  3MKQ A;  5JJ6 A;  4C0M A;  4N3C A;  3CHQ A;  3HHM A;  2LNI A;  1UW4 B;  3L6A A;  4QFV A;  4BSX A;  3KD7 A;  4AY6 A;  3P2B A;  2C0L A;  2CHZ A;  3ONL A;  4YND A;  4UI9 K;  3UPV A;  4GZD A;  5G55 A;  4I2W A;  3FTY A;  3TJP A;  2R59 A;  4GA0 A;  5CHE E;  3RK6 A;  5J08 A;  2XQ0 A;  1FVH A;  4JA7 A;  2QFC A;  3FUD A;  3OTN A;  4G23 A;  4JHK A;  2BTD A;  2RD0 A;  3CLJ A;  2XRZ A;  3CVN A;  3FUE A;  3PRZ A;  4WNF A;  2XRY A;  4Q94 A;  4UWH A;  3ZYK A;  4JA9 A;  5J90 A;  4AIF A;  3ULQ A;  3UQ3 A;  2CFU A;  1Y8M A;  3APD A;  4UWL A;  4LCT A;  2FF4 A;  3URZ A;  5FZS A;  1KLX A;  3PZD A;  1FVF A;  3CHO A;  4PH4 B;  2P58 C;  4RG9 A;  5AIJ A;  2VYI A;  4R7L A;  3LYA A;  4JEU A;  4BTA A;  3VLD A;  1Z6T A;  3CST A;  1VDY A;  3L13 A;  3QNK A;  5T3R A;  3RIB A;  3SNX A;  3CHM A;  3HYM B;  3MX3 A;  3AS4 A;  4JHR A;  4L1B A;  3ASF A;  2OVB A;  4I9E A;  5A6C A;  2VGX B;  3VTX A;  1N54 A;  4GZC A;  4HVB A;  4UWK A;  4UQY A;  4KT6 B;  3MKQ B;  2MRI A;  5ARG A;  2PM6 A;  4A55 A;  2E0I A;  3ML9 A;  3FUL A;  2FEZ A;  4GPK A;  3BEE A;  4Q69 A;  2I9C A;  2WM9 A;  4J8F A;  5LCW C;  2WXJ A;  3B7U X;  2YHC A;  3SHF A;  2XGS A;  3HVE B;  2KZT A;  3D9N A;  4H7Y A;  5G04 J;  2V4L A;  4DI4 A;  3FTW A;  3CVU A;  4G11 A;  3RKV A;  4GCO A;  1JPL A;  3ASD A;  3CGH A;  1PAQ A;  3L16 A;  3PH0 C;  4N5C A;  3NF1 A;  4FP7 A;  4KVM A;  3I3N A;  3GZ1 A;  4HXI A;  1E8X A;  3D9O A;  3IBE A;  3EIJ A;  4V3I A;  3APC A;  3B7S A;  4LER A;  4M3O A;  4RVB A;  2WXR A;  2GRM A;  1H2U A;  1OWL A;  4F3V A;  2XGM A;  3D3M A;  5C2Y A;  2AW6 A;  4K03 A;  4XIF A;  5LCW J;  3QWP A;  4RSY A;  2UY1 A;  4WNG A;  1IHG A;  3PVL A;  4ACL A;  3Q15 A;  4AOF A;  1NZN A;  3PNT B;  4GZ3 A;  1ZBP A;  4AM9 A;  1ELK A;  3ZN3 A;  4MS6 A;  3KAE A;  2OOE A;  3PE4 A;  5EKQ D;  4CDM A;  2WXM A;  1QQE A;  5CCM A;  1UG3 A;  2WPV A;  3ASH A;  3PDN A;  4IYP A;  1HZ4 A;  3JUI A;  3ONK A;  2J9Q A;  5AJD A;  1P5Q A;  2KC7 A;  2AXZ A;  3DBS A;  2EQX A;  2UY1 B;  4ILG A;  3SF4 A;  4AEZ C;  4B0Z A;  4HOU A;  5CMY A;  5BPP A;  2PL2 A;  1SZ9 A;  5G2N A;  4HOQ A;  3EHM A;  3FU5 A;  1SZA A;  3FUK A;  4KZ0 A;  2J49 A;  4TRQ A;  2X6H A;  4Y6W A;  5EX0 A;  1NA0 A;  2WMO A;  2XHE A;  4I6J A;  4IRU A;  4JC8 A;  2VTB A;  3D9I A;  3E4B A;  3IEG A;  3PEV B;  3FUF A;  3ZYM A;  1OWN A;  4WAF A;  3U64 A;  1IQR A;  2GW1 A;  5G05 C;  3TL5 A;  4IN3 B;  2PZI A;  4CDR A;  3R7R A;  5CCL A;  2MOW A;  3RU0 A;  4J8D A;  4BT8 A;  3ZHE A;  4GB9 A;  4WWO A;  2V0P A;  5FZR A;  2MHK A;  3AS8 A;  5M72 A;  3N71 A;  3AU5 A;  3LEW A;  4L23 A;  3FH7 A;  2E2E A;  4N3B A;  3ENE A;  5FZQ A;  2A4Z A;  3LY8 A;  2R17 C;  5ANL A;  4D10 C;  2L9B A;  2V5F A;  1HXI A;  4I1M A;  4KZC A;  4GA1 A;  3OXF A;  3CQC B;  4WUY A;  5D0Q D;  3R9A B;  2WXH A;  4GCN A;  1L5J A;  4GAA A;  4PS3 A;  5FQ4 A;  3G2S A;  4WWN A;  5LOZ A;  3RRU A;  4XZ4 A;  2PM7 A;  3GZ2 A;  3NQP A;  4KMO A;  1SQM A;  2R5S A;  1HH8 A;  3AU4 A;  3JQ1 A;  3OXG A;  4KYO B;  3S7D A;  3D9K A;  4FUL A;  4I17 A;  5BW8 C;  3SFZ A;  2OVF A;  3MA5 A;  1WM5 A;  1KT1 A;  3T8M A;  4I6E A;  1OUV A;  4FHJ A;  3TGO A;  5G05 J;  3QWV A;  4UQX A;  3QAQ A;  4J0U A;  2DBA A;  4Y6C A;  2NSZ A;  2PQN A;  2WXG A;  4BTB A;  3R7Q A;  2Y4U A;  2CG3 A;  3LXU X;  3RRN B;  2GGF A;  3G2V A;  3MYV A;  3KS2 A;  2J07 A;  4GZ5 A;  5CMW A;  1DNP A;  2JLB A;  4AJW A;  3I4R B;  2Q7F A;  3JYS A;  5DIZ A;  3D9M A;  2I6H A;  3L54 A;  4F53 A;  3B7R L;  1PC2 A;  5FT9 A;  4JZY A;  2LO6 A;  2L0T B;  3FTX A;  4L2Y A;  3SBS A;  4ANW A;  2FUL A;  1UN9 A;  5LX8 A;  3IKO B;  2XGO A;  4U04 A;  3FTV A;  4BWR A;  3ZRH A;  1TJF A;  4EQF A;  4G2V A;  3JCK C;  2AVP A;  2X6I A;  4U07 A;  4ANV A;  2CG2 A;  4GMJ A;  3L17 A;  4B8A A;  4KXK B;  3ZW3 A;  1ELR A;  1FCH A;  1XNF A;  5JHB A;  2I2O A;  2V8S E;  4NUR A;  2HR2 A;  4GU5 A;  2J09 A;  3C98 A;  1B89 A;  3QWW A;  3VTY A;  2NXP A;  3UT8 A;  4AP2 A;  5G04 C;  4GYW A;  2I1J A;  2WQ7 A;  2LAH A;  3O4Z A;  4MKT A;  4GZ6 A;  3S7B A;  1MHQ A;  3CVW A;  2KCV A;  4FU3 A;  4P29 A;  1MQS A;  3QK0 A;  2GRL A;  5BT1 A;  2C0M A;  3Q49 B;  5ENN A;  4ME2 A;  4APO A;  3UT7 A;  4DPR A;  2I1K A;  3EIQ C;  3QAR A;  3FHE A;  3FU3 A;  3HDX A;  1H2T C;  2FBN A;  1EYH A;  2YHE A;  3DPD A;  4U0Z A;  3U66 A;  2OV8 A;  3FUI A;  4KVO A;  2UWJ G;  3FUM A;  4JXT A;  4WND A;  1E7V A;  3ESK A;  2X6F A;  1HG5 A;  4HOR A;  3PRE A;  1EF1 C;  3G2U A;  3ZIM A;  3FFL A;  3CK7 A;  4UQZ A;  4C9B B;  4CRW A;  4E85 A;  3BG1 B;  4RG6 A;  3LS8 A;  3MGB A;  3MEK A;  3SD5 A;  1XGW A;  4U0U A;  3TG5 A;  2A5U A;  1E7U A;  1HO8 A;  3U4T A;  3VLF A;  4CT0 A;  2ION A;  3OXL A;  4NRH B;  4APF A;  3LJ3 A;  4JW1 A;  4XKC A;  4AVX A;  5FQ6 A;  1HS6 A;  1JWG A;  2JEK A;  3D9P A;  4LUN U;  3MJW A;  3CVY A;  3RO3 A;  2WXI A;  3ZHE B;  1Z3X A;  4GYY A;  3CVX A;  3FEX A;  4GA2 A;  4JL0 A;  4OVV A;  4FA6 A;  3SBT B;  2WXP A;  3O48 A;  2AXV A;  3PUJ A;  5FWQ A;  2LSV A;  4A3V A;  3QOU A;  3TG4 A;  1U3C A;  3GW4 A;  1S0P A;  1H2V C;  4ABN A;  4GML A;  4EBA G;  5HI7 A;  3RRM B;  5HQ8 A;  5E76 A;  4FHK A;  3G2T A;  1EDU A;  1INZ A;  2NC9 A;  5AYW D;  1UN8 A;  2LSU A;  3NZU A;  4ATG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...