3MA5A

Crystal structure of the tetratricopeptide repeat domain protein q2s6c5_salrd from salinibacter ruber. northeast structural genomics consortium target srr115c.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
EDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Tetratricopeptide repeat domain protein
publication title Crystal structure of the tetratricopeptide repeat domain protein Q2S6C5_SALRD from Salinibacter ruber.
rcsb
source organism Salinibacter ruber
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ma5A00
4N3CA 4UQYA 3QWWA 3PE4A 4N2SA 4CGWA 2NC9A 2PL2A 4GYWA 3LY7A 2VYIA 2QFCA 5DBKA 2HR2A 4GCNA 3LY8A 5FZSA 3MKRA 3KAEA 4GCOA 4YVOA 1YA0A 5JJ7A 3JYSA 4YVQC 5G04J 5CCMA 3WXXA 3CVNA 4I2ZA 4KBQA 3K9IA 4H7XA 1HZ4A 4J0UA 3PE3A 2OOEA 4N39A 2PQRA 3MA5A 2FF4A 2Y4UA 4G25A 3ASFA 2R5SA 4AM9A 5KJNA 5KJMA 2V5FA 5BT1A 1TJCA 3IEGA 4B94A 4N5CA 4WNFA 5KJKA 3CVPA 4W9RA 1Y8MA 5G05J 2UY1B 4JL0A 2FI7A 4IN3B 3QDNA 1E96B 3SF4A 2XCBA 4KXKB 1NA3A 4GYOA 2IFUA 4JA9A 5BNWA 3KS2A 3RO2A 2PZIA 3ZN3A 4LEUA 3CKCA 3QOUA 5M72A 4WNDA 4WNEA 2KC7A 3S7BA 4G1TA 2KATA 3RIBA 3QKYA 5FJYA 5JJ6A 3ESKA 3RKVA 2XGSA 4XIFA 2XEVA 4U04A 3TG4A 4HORA 4G23A 4J8DA 3CKBA 3CV0A 3EDTB 1B89A 5HQ8A 5CCLA 2FBNA 2HO1A 2IF4A 4I9EA 2Y4TA 2LSVA 4F3VA 5EX0A 2VGXA 4I17A 1NZNA 4N3AA 4H7YA 3GZ1A 1QQEA 2C0LA 3GZ2A 2FEZA 1ZBPA 3ASDA 1OUVA 3Q47B 3LYAA 4NQ0A 2GW1A 3SZ7A 3TGOA 2I6HA 5EX3A 4U0ZA 3KD7A 2HYZA 1A17A 3FWVA 1QZ2A 1KLXA 2VGYA 3CK7A 3LPZA 4Y6CA 4HOSA 3LCAA 2KCVA 2VQ2A 3FFLA 4KYOB 2P58C 4UI9C 4WNGA 1WAO1 4I1AA 3AS8A 4UQXA 2UWJG 3CVQA 1XNFA 3AS5A 1W3BA 2LNIA 3RO3A 3ZHEB 4EQFA 4Y6WA 4AY6A 2XGMA 3UPVA 3NF1A 3ZHEA 2XPIA 4JA7A 3HYMB 3O48A 2XCCA 4HOUA 2J9QA 4CGVA 3ZGQA 5ARFA 3ASHA 3CVLA 5FZRA 4AIFA 5D0QD 5LCWC 2C2LA 4J8FA 2C0MA 3BEEA 2BUGA 4GYYA 3ZFWA 1IYGA 2LSUA 3TG5A 2E2EA 4XI9A 4APOA 1ELWA 4BT8A 4AY5A 5A6CA 1ELRA 4YNDA 3CK8A 4ME2A 4UQZA 4GZ6A 3RU0A 4GA0A 3PDNA 5AYWD 4O6FA 5CHEE 2VGXB 4WUYA 5A7DB 3ULQA 4BWRA 4G24A 3RJVA 3N71A 4NRHB 3S7FA 3R9AB 2WPVA 4BT9A 2XGOA 4RG9A 4ABNA 4XI0A 2JLBA 2VSYA 5D0OD 5FT9A 3URZA 2KCLA 2YQ8A 4HOQA 3E4BA 5G04C 5FZQA 3LKUA 3Q15A 2FO7A 5C1DA 3UUXA 4BTAA 4HOTA 4RG6A 3OXGA 2YHCA 3TAXA 4U07A 4UI9K 3U3WA 4A1SA 1WM5A 2L6JA 4GZ5A 4G2VA 4U0UA 2WQHA 5JJTA 3MV3B 5G05C 3VTYA 3Q4AB 4BTBA 1ZU2A 1KT0A 4UI9J 3QWVA 4N3BA 5EKQD 1FCHA 3MV2B 2VSNA 4GA1A 3LY9A 3Q49B 4I2WA 3ZPJA 2PQNA 3S7DA 3S7JA 1KT1A 4J8EA 2KCKA 1HXIA 3GYZA 4GPKA 1NA0A 2MHKA 4U0SA 5FTPA 2Q7FA 3AS4A 5DIZA 4I9CA 2AVPA 2UY1A 4CDRA 1P5QA 3MEKA 1IHGA 2DBAA 3CK9A 3ASGA 3FP3A 5BW8C 5ARGA 5LCWJ 3OXFA 4G26A 5HI7A 3U4TA 3VTXA 1HH8A 4N2QA 4GA2A 3CEQA 1PC2A 3OXLA 3Q5MA 2ONDA 4JHRA 3GW4A 4GZ3A 3UQ3A 5KJLA 3QWPA
chains in the Genus database with same CATH superfamily
5CECB 3SFYA 5ANRA 3QB2A 3LY7A 2VYIA 2XENA 3SGHA 3FTYA 2BEDA 4EHMA 4IYPA 2B0OE 2B6CA 3ABME 4LNUD 4M7CA 4GCNA 3ULEG 3LY8A 4MLPA 3FTSA 4A55A 4U95D 2R05A 1LF8A 4GCOA 2GRMA 4YVOA 3PNTB 3FEXA 4YVQC 3B7UX 1N4SA 3FDHA 1Q2ZA 4K5AB 3AJIA 3WXXA 1YYHA 1TR4A 3DSUA 3NQPA 4MRUA 3TWWA 4PH4B 3PE3A 2FF4A 4EECA 3EHRA 4AM9A 3D3MA 2ILRA 4CCAA 3APCA 4L9PA 3D9NA 3FUKA 5G2NA 5BT1A 4DLQA 3AG2E 5KJKA 3BG0B 3CVPA 4LERA 1Y8MA 4W9RA 5G05J 3G2UA 1N0RA 2CFZA 2VGEA 4IN3B 4YDEA 4I6GA 3QDNA 1E96B 1NA3A 3DSVA 4GYOA 1K1BA 2IFUA 1X81A 5BNWA 3KS2A 5AAOA 2IY0C 2P9IG 1ELKA 4OVVA 3ZN3A 4XKCA 3HIZA 4FULA 5H7PA 5M72A 3LVQE 4WNDA 4FJYA 3CLJA 2V4LA 2AW6A 5HKPA 2GRRB 4DX1A 1JCQA 3LJ3A 4J6IA 2XS8A 5ENQD 3ESKA 3RKVA 1H2UA 3TG4A 3ZXPA 4HORA 2ZGGA 4G23A 3CGHA 5JHAA 3D9KA 1OWPA 2J4DA 1IQUA 4GPMA 1N9AA 3MGBA 3UM3A 4P29A 2P9PG 4I9EA 1QNFA 2OEWA 5T3RA 1INZA 3DXMG 3PUKA 4TXRA 4I17A 2PNNA 3P1UA 1MZCA 3L16A 2FEZA 1ZBPA 2VSOE 4ACLA 1JUQA 4A1GA 5JA4D 3FUJA 1U2VG 5CBOA 3ZXSA 2KXPC 3ONKA 1QZ2A 2WQ7A 4I1OB 3IBEA 3LCAA 2KCVA 4JXTA 2KBXA 2XRZA 4KYOB 4TUUA 3SBTB 4HB5A 2P58C 4UI9C 4WNGA 3AS8A 1ZB1A 4UQXA 2LUHA 4R7LA 1W3BA 2WMNA 4EQFA 1PY1A 5LX8A 2ETCA 3NF1A 1D8DA 3FUFA 3O48A 4HOUA 2J9QA 4CYMD 2EINE 1X5BA 4G11A 4CGVA 2OVBA 3ZGQA 1N54A 5FZRA 4AIFA 4F1SA 4MKTA 4ANXA 3EIJA 2C2LA 2XQ0A 2C0MA 3KSQA 2AJAA 3BEEA 1E8ZA 2WXLA 3ZFWA 1Z5SC 3DXKG 2XRYA 4DI4A 4BETA 5FQ7A 4HQDA 2OVFA 3ZNGA 3SO8A 4LG6A 4APOA 4AY5A 5A6CA 2Y0BG 3I3NA 4EZLA 3FUHA 4GA0A 5AYWD 4XE0A 5KCMA 3WG7E 3SHFA 5A7DB 3ULQA 2KZTA 3RJVA 3N71A 3CVYA 2DYSE 4NRHB 1NL4A 2Y1LE 3BQOA 3R9AB 2A4ZA 2XGOA 3PZDA 4ABNA 4ILHB 5LFAA 4GTRA 2P9SG 3JUEA 2CG3A 2YNQA 3UM1A 4OAVB 3Q9NC 4YDWA 3HG0D 4BEPA 2DZNA 3UX4A 3SBSA 4K5BA 2BTDA 4G8KA 3D9PA 2WXQA 3DBSA 2A5UA 2FO7A 3HDXA 4L7TA 3HXDA 4BTAA 3KSLA 1NI1A 3DSXA 2GRQB 3JQ1A 4TUMA 3PNLB 3ZVVA 5CRVA 4FHKA 4LRZA 1WM5A 2L6JA 3HXCA 3ULYA 3CHPA 4U0UA 4BERA 3JCKC 3QARA 1JCRA 2BF0X 3SD5A 3UIOC 1H6OA 3Q4AB 1QBQA 4F6RD 4C9BB 3QWVA 1FCHA 2KM4A 1HX8A 3EHQA 3LY9A 3Q49B 4I2WA 2RFAA 2WQ6A 2XPYA 2PQNA 1KT1A 2X6FA 4GPKA 5FTPA 5D66A 4JPSA 4PUCA 1JWGA 3U64A 4CZ2D 3ASOE 2JEKA 4DJAA 1TJFA 5LCWJ 1MQSA 2E0IA 4AJWA 1FVFA 4DK5A 4TXQA 5HI7A 2VSXE 4YDOA 4QQIA 3VTXA 2ZU6B 1H0AA 3UT7A 2KZTB 2F8XK 2F37A 3TWUA 3CEQA 3UKUG 3ZU7B 3AAAC 3Q5MA 4GMRA 4GZ3A 4NACA 1QYMA 5B1AE 3VLFA 3L82A 3UKRG 2P9LG 1E8WA 3ML8A 4UUCA 3LS8A 3MZLB 1U3DA 3G2VA 3PE4A 4D10C 4N2SA 4Q96A 2IQCA 5E76A 3G2WA 1UJKA 1GW6A 2ETAA 3IHVA 5HS0A 1L5JA 5DBKA 3GZSA 1BU9A 3JQ0A 4CEMA 4FU3A 1O1SA 5KNHD 3ZIMA 4A63B 2EQXA 3PVLA 5BV0A 3KAEA 3U66A 4WWPA 5JJ7A 1S70B 3E37A 3V79K 2CHZA 1IXVA 4FLBA 3ZRHA 2NXPA 3CVNA 4U8HA 1E7UA 3CVUA 4H7XA 4J0UA 4YDYA 2OOEA 4N39A 2PQRA 2FULA 1RZ4A 3U9WA 3B95A 2X6HA 3ASFA 2QYUA 3ZKJA 4ANVA 4DX2A 4F1PA 4AOFA 4DRXE 5AQAA 2V5FA 2ZISA 4TV3A 1SQMA 4K03A 1TNYA 1TJCA 4WNFA 1WG0A 5ENRD 2FI7A 3L08A 3PEVB 4CRWA 3SF4A 4KXKB 3LXUX 3V31A 4MS6A 3PH0C 1D8EA 1AP7A 2PZIA 2V5QC 3FH5A 2WXKA 3CKCA 3QOUA 3SY2A 4WNEA 1WY6A 3FU3A 3CHMA 3EHMA 4F53A 4G1TA 3ZYKA 5T4YA 1EPUA 1IQRA 3CKBA 4KZCA 1B89A 3ZYLA 4OYSA 4ANWA 1BPOA 3B7SA 5HQ8A 2EIJE 5CCLA 4U96D 2HO1A 5BPPA 4RSYA 2Y4TA 3Q7AA 3SI5A 4UWLA 4QFVA 5AN8A 3CVWA 3V2OA 1TNUA 4H7YA 4ATGA 1QQEA 2C0LA 4XKBA 1OUVA 2ZXWE 3R7RA 2FO1E 2GW1A 2DYRE 3L6AA 3SZ7A 5EX3A 5AQ9A 3KD7A 4IULA 1KPSB 3FWVA 2VGYA 3CK7A 3FU0A 2XPZA 3C98A 4LSZE 3EJNA 2AXVA 3CVVA 2J08A 1E8XA 4I1AA 4APFA 3W9FA 3CHSA 3UM0A 2X38A 3UINC 3ZHEB 4Y6WA 3L22A 2V0PA 4AY6A 3ISMC 3UPVA 4FLHA 3FULA 2XPIA 3LEWA 4JA7A 2WB2A 1MX6A 3IKOB 1UJJA 5ARFA 3ASHA 1O5MA 3TWVA 3CSTA 3CIAA 3QC1A 2XZDG 1Y6IA 4K5CA 4PS8A 2X6IA 2PM7A 2I1KA 4BX8A 1H6KA 4JVSA 3TG5A 4XI9A 1OXJA 1MX2A 5FIOA 4BT8A 1ELRA 3FHEA 4LCTA 5FQ8A 5ENTD 3PDNA 5AARA 2XZTG 2EILE 3QJZA 3E34A 4HRNA 3T8MA 4BWRA 5D2MC 2EIME 4FP7A 1HG2A 2MOWA 3CSFA 4V3IA 4BT9A 4RG9A 1WDYA 1EF1C 4XI0A 2XHEA 5D0OD 2HE0A 3AG4E 2WXGA 5C2YA 2YQ8A 2LAIA 5G04C 5J08A 4U63A 2F0YA 5FZQA 3V2XA 5EIDA 2P9UG 4UWFA 3UUXA 2YHEA 3TWRA 1UOHA 3FTUA 3OXGA 3TAXA 4U07A 1FVHA 2EIKE 5LOZA 4BX9A 1HFAA 4XZ4A 3B13A 2GGFA 4BFRA 3MV3B 3ZUVB 4ILIA 3NZSA 3HHMA 4UI9J 4HLLA 3FH7A 3Q9UC 5EKQD 3ABKE 3DSWA 3T5XA 4LNBA 3ZPJA 3I5PA 2KCKA 3GYZA 4GZCA 1NA0A 2MHKA 3V30A 2Q7FA 3Q79A 2RFMA 2UY1A 1HS6A 3MEKA 1N0QA 3AG3E 1IHGA 4EZJA 1XGWA 3B7RL 5ARGA 2V4HC 3OXFA 3SNXA 5FWQA 4HRMB 3G2TA 3D9OA 4GTQA 2CHWA 3R9MA 5EN5D 1HH8A 2QYJA 1UG3A 4N5QA 3GW4A 3ZYQA 1UW4B 3UMVA 3MX3A 3QWPA 3FUMA 1SVXA 3APDA 1FT1A 4JD2G 4L2LA 1V54E 5E75A 4N3CA 4DX6D 4EZKA 3QWWA 3E32A 4GTPA 1UN9A 3Q75A 4GYWA 3HRAA 2QFCA 3L17A 4UWKA 2X6KA 3FUEA 3TWTA 1SZAA 4GMJA 4HBDA 2IOSA 1N11A 2L0TB 1A5EA 3UT4A 5FZSA 2I1JA 4C48B 5BXOA 2P9KG 3ML9A 3PZ2A 2L0IA 4I2ZA 4EBAA 3C5RA 4KBQA 4GTTA 3QK0A 1E7VA 4ANUA 3NBNB 3B7TA 4KVOA 1BD8A 2R5SA 4CT0A 5KJMA 4O1PA 1H2TC 1EDUA 5EIBE 4UWGA 4B0ZA 4AXHA 5FQ6A 4B89A 5ENOD 1V55E 3IV0A 1HF8A 3IEGA 5B1BE 4B94A 4N5CA 4EPZA 3NZUA 2UY1B 4Q69A 4JL0A 5J90A 2AXZA 2XCBA 4JA9A 3I4RB 3RO2A 4K0RA 2L6BA 3RRNB 4GU5A 4M3OA 1S0PA 2WXIA 1Z6TA 3CVXA 2KC7A 4XEIG 4BSXA 1N52A 1S63A 3EIQC 2KATA 5AIJA 5CERB 2H6FA 3Q73A 3QKYA 5FJYA 2XGSA 4XIFA 3MKQB 3JUIA 3JXIA 5AQBA 4J8DA 2WMOA 1KZOA 3RK6A 3NB2A 2L9BA 3I4GA 2FBNA 1S64A 2V8SE 2IF4A 2NYJA 1K3ZD 2LSVA 4GTMA 4F3VA 5ENSD 5EX0A 1SZ9A 2VGXA 3C3OA 4N3AA 3CR3A 3GZ1A 4IRUA 4C0MA 4AVXA 2QY7A 3GZ2A 3UIPC 3Q47B 1TNBA 3LYAA 3UT8A 3FTXA 4J8YA 2CG2A 4U0ZA 2WXMA 2HYZA 3P2BA 1TYQG 2F8YA 1U3CA 2WVIA 3LPZA 1JWFA 3EUVA 4Y6CA 2VQ2A 1JPLA 4C0EA 3LJNA 3NOCD 1UN8A 1WAO1 3CVQA 5ENPD 4ILGA 3RO3A 2OV8A 3BUAA 4URKA 4ZFHA 3VLDA 3ZHEA 2MRIA 3HXBA 5EYLA 2XCCA 4HXIA 4I1MA 1N4RA 4GTOA 4CDMA 3D9MA 3CVLA 4TXPA 4LNGA 1H2VC 5D0QD 3MJWA 3L54A 3DEOA 3UI2A 1SA5A 3IHYA 1SW6A 4DLOA 1YMPA 2GROB 4E6HA 2I9CA 1DC2A 1IYGA 4RVBA 3KEAA 1MHQA 3X2QE 2J49A 2E2EA 1HO8A 2H6GA 5A23A 4TRQA 1ELWA 1TN7A 3L9TA 3ENEA 3CK8A 4ME2A 2J09A 3AU4A 4PDXA 5AJLA 4GZ6A 2ETBA 2IEJA 4DX5D 3FH8A 2WXFA 4O6FA 2WM9A 4HLEA 5CHEE 4HI8A 1HE8A 2VGXB 2VTBA 5T8IA 1BI7B 2IOLA 3DPDA 4U8VD 2WPVA 3DSSA 2WXPA 1MX4A 3PUJA 2JLBA 2R03A 2NSZA 2DVWA 2VSYA 3FEYA 5FT9A 1RW2A 3PZ1A 4GZDA 4PS7A 5EILA 2KCLA 2DCPA 4L23A 3SQVA 5ITZF 3D9HA 3EHNA 5BV1A 3Q15A 4MBGA 4JW1A 3Q7FA 1OWLA 5C1DA 3OTNA 3LDZA 3JXJA 4HOTA 4I6JA 3HXEA 3TWXA 2YHCA 4UI9K 2HM8A 2JABA 3C72A 2ZGDA 4AP2A 1Z3YA 3LVRE 3J5QB 3U3WA 1O1TA 4A1SA 2WXOA 4GZ5A 1K1AA 4U7EB 4I43A 5JJTA 4KZ0A 5G05C 2DZOA 2H6HA 4BTBA 1ZU2A 4WWNA 5CRUA 1OCOE 3DEPA 4OVUA 3S2AA 2WXHA 4N3BA 3RRUA 1H6PA 3MV2B 1EYHA 2VSNA 5CEDB 3C3QA 4GA1A 2M63A 1TNOA 1DCEA 2R2LA 4J8EA 4JZYA 4Q94A 4I9CA 2AVPA 4CDRA 3CK9A 3FP3A 4JB8P 3UM2A 2Y3AA 2QZAA 4WAFA 2QC9A 2GRPB 1SA4A 1HG5A 3L13A 3ONLA 3MYVA 3R7QA 3KEZA 3FU5A 2VTBB 2DWZA 3FTZA 4GA2A 3OXLA 2IU1A 3TL5A 1DNPA 3D9IA 2A5EA 2ONDA 5ENNA 3D9LA 4JHRA 3VLEA 3UQ3A 2R59A 4A3VA 1TN8A 4UQYA 3UXGA 3ESLA 1DCQA 2BKKB 3G2SA 4O60A 4HNAD 4CGWA 2NC9A 2PL2A 1JCSA 4RLYA 3HVEA 2XS1A 3ABLE 4F7AA 4DPRA 4ZHBA 2J4BA 2J07A 2IO3C 3FUIA 4L2YA 3FUDA 2HR2A 4GAAA 4E85A 3C3RA 3D9JA 5JHBA 3MKRA 4JEUA 1YA0A 3JYSA 1PAQA 5G04J 1E90A 1OWOA 5CCMA 2R02A 4HVBA 1D9SA 3PS6A 1O1RA 3K9IA 3RSEG 1HZ4A 3Q78A 2XEEA 5JMND 3MA5A 2Y4UA 4G25A 4JEHA 5KWDA 3NOGD 5KJNA 2PM6A 3APFA 3RRMB 4J8SA 4GMLA 2OCCE 3QNKA 4FADA 3FTVA 3E30A 4J7WA 1G3NB 1N4PA 4X8QA 4B8CB 3ZW3A 3TJPA 3J5PA 3AG1E 4Z68A 3IXEA 4LEUA 5KNGA 1LD7A 4OAUC 2LO6A 5EYPF 4KVMA 5EDSA 4AV7A 4FJZA 3NAWA 5CMYA 3S7BA 3FY4A 3PEUB 1TEZA 2YINA 1Z3XA 2H6IA 3RIBA 3CHOA 5JJ6A 2XEHA 2XEVA 4U04A 5LP0A 1DVPA 4RQIA 3OAWA 5FINA 3CV0A 3EDTB 3HXFA 2R17C 4HRLA 3MKQA 4FA6A 2MYOA 3HVEB 4FHJA 4G8LA 3BU8A 2RKKA 3ASNE 2I2OA 5AQ7A 4UWHA 2X6JA 1NZNA 4DX7D 3W9GA 1TN6A 1MJ0A 4CDNA 1FT2A 5AJDA 3ASDA 3T9KA 2Y69E 4HFGA 4NQ0A 4KMOA 3TGOA 2I6HA 4I6EA 1A17A 4GTVA 2BKGA 1KLXA 2VJ8A 3QAQA 4HOSA 2LXMA 3FFLA 5BXUA 4NURA 4B93B 3SFXA 3ZEFA 4GTSA 4BY6A 3DPYA 2UWJG 1XNFA 1OT8A 3AS5A 3TWSA 2LNIA 1MYOA 3ZYMA 4GB9A 2XGMA 1OWMA 3CQGB 5BUZA 3HYMB 4KT6B 3CHRA 3E33A 3FTWA 2IJGX 5ANLA 2CHXA 5LCWC 1TNZA 3F6QA 4J8FA 4AEZC 1HU3A 2BUGA 4GYYA 3MCXA 2ZIRA 1H19A 3EU5A 5AENA 2LSUA 3DRAA 4NIKA 1N4QA 3TXMA 4DUIA 3PZ3A 3TWQA 4YNDA 1E8YA 3CHQA 4UQZA 4BESA 2DIWA 3RU0A 4WWOA 3T8KA 5IY5E 2IO2C 4HS2A 1NP7A 4WUYA 2LAHA 4G24A 1IHBA 3S7FA 2P2CP 2GRNB 2AWIA 2J8SD 2WXRA 3B7BA 1YCSB 4L1BA 3FU6A 1BI8B 3AU5A 3PZ4A 3URZA 1N94A 3UTMA 1VDYA 4HOQA 4ATZD 4PS3A 5B3SE 3E4BA 5CMWA 2LXLA 3PREA 3LKUA 1N95A 4A3TA 1KZPA 3O4ZA 4JHKA 4RG6A 4XX5A 5HRYA 4EBAG 2WXJA 4G2VA 5FQ4A 3FUNA 1LTXA 2WQHA 3VTYA 1NFIE 1KT0A 1AWCB 1OCRE 4JHJA 2GRLA 2WXNA 4HI9A 4O1OA 3S7DA 3PRZA 3S7JA 4DI3A 2X3MA 1HXIA 1BLXB 2RG8A 4U0SA 3AS4A 5DIZA 3RAUA 1P5QA 4B8AA 2DBAA 3ASGA 1OCCE 2IONA 5BW8C 4LUNU 3TXNA 4CT4A 3SFZA 3T5VA 4G26A 4U8YD 3BG1B 4FC8A 5G55A 5CEAA 3U4TA 2AXUA 1OCZE 5CBNA 4JC8A 4N2QA 2OEVA 2RD0A 4BSZB 1PC2A 3DWLG 1OWNA 3DSTA 2P9NG 3EU9A 1IKND 5KJLA 1LD8A 1FPPA 1K8KG 3CQCB 5KBAA 2CFUA 1OY3D 4ACKA
chains in the Genus database with same CATH topology
4N3CA 3MZLB 1U3DA 4UQYA 4EZKA 3G2VA 3ESLA 3QWWA 3PE4A 3G2SA 4D10C 4N2SA 4CGWA 1UN9A 4Q96A 2NC9A 2PL2A 3QB2A 4GYWA 5ANRA 2IQCA 3HVEA 3LY7A 5E76A 2VYIA 2QFCA 3G2WA 3L17A 1UJKA 4F7AA 3SGHA 1GW6A 4UWKA 2X6KA 3IHVA 3FTYA 4DPRA 1L5JA 3FUEA 5DBKA 3GZSA 2J4BA 2J07A 3JQ0A 4CEMA 1SZAA 4IYPA 3FUIA 4GMJA 4FU3A 4L2YA 3FUDA 2HR2A 2IOSA 4GCNA 4GAAA 2L0TB 3ZIMA 3LY8A 4MLPA 4E85A 3FTSA 3D9JA 2EQXA 3PVLA 4A55A 5BV0A 3UT4A 5JHBA 5FZSA 1LF8A 3MKRA 2I1JA 3KAEA 4GCOA 3U66A 2GRMA 4YVOA 3PNTB 3FEXA 4JEUA 4WWPA 1YA0A 5JJ7A 3JYSA 1PAQA 4YVQC 3B7UX 1E90A 1OWOA 5G04J 5CCMA 3FDHA 3ML9A 2CHZA 2L0IA 4FLBA 4HVBA 3ZRHA 3WXXA 2NXPA 3CVNA 4I2ZA 3PS6A 4EBAA 4U8HA 3NQPA 4KBQA 3K9IA 4MRUA 1E7UA 4PH4B 3CVUA 3QK0A 1E7VA 4H7XA 4ANUA 1HZ4A 4J0UA 3PE3A 2OOEA 3B7TA 2PQRA 4N39A 4KVOA 2FULA 3MA5A 2FF4A 2Y4UA 4G25A 4JEHA 2X6HA 3ASFA 3U9WA 4EECA 2R5SA 4AM9A 4CT0A 5KJNA 3D3MA 4ANVA 5KJMA 2ILRA 1H2TC 4CCAA 1EDUA 4AOFA 3APCA 2PM6A 4UWGA 3APFA 4B0ZA 3RRMB 4AXHA 3D9NA 5FQ6A 4B89A 3FUKA 2V5FA 4J8SA 4GMLA 4TV3A 1SQMA 5G2NA 3IV0A 3QNKA 4FADA 4K03A 5BT1A 1TJCA 1HF8A 3IEGA 3FTVA 4DLQA 4B94A 4N5CA 4WNFA 4EPZA 5KJKA 3BG0B 3CVPA 4LERA 1Y8MA 4W9RA 3NZUA 5G05J 2UY1B 3G2UA 4Q69A 4JL0A 2FI7A 2CFZA 3L08A 3PEVB 4IN3B 4CRWA 4B8CB 4I6GA 3ZW3A 5J90A 3QDNA 1E96B 2AXZA 3SF4A 2XCBA 4KXKB 3TJPA 1NA3A 3LXUX 4GYOA 2IFUA 4JA9A 4MS6A 3I4RB 5BNWA 3KS2A 3RO2A 4K0RA 3PH0C 1ELKA 2PZIA 4OVVA 3FH5A 4XKCA 3RRNB 3ZN3A 2WXKA 3HIZA 4GU5A 4LEUA 4FULA 4M3OA 3CKCA 3QOUA 5M72A 3LVQE 4WNDA 1S0PA 2LO6A 4WNEA 2WXIA 4KVMA 1Z6TA 4FJYA 5EDSA 1WY6A 3FU3A 4AV7A 4FJZA 3CVXA 2KC7A 3CHMA 3CLJA 5CMYA 4BSXA 3EHMA 3S7BA 3FY4A 1N52A 4G1TA 4F53A 3ZYKA 3PEUB 1TEZA 3EIQC 2KATA 5T4YA 5AIJA 2V4LA 2YINA 2AW6A 1Z3XA 3RIBA 3LJ3A 3CHOA 4J6IA 3QKYA 1EPUA 5FJYA 3ESKA 5JJ6A 2XGSA 4XIFA 3RKVA 1IQRA 1H2UA 2XEVA 4U04A 3TG4A 4HORA 5LP0A 1DVPA 3MKQB 4G23A 3JUIA 3OAWA 4J8DA 3CGHA 2WMOA 5JHAA 3CKBA 3RK6A 3CV0A 4KZCA 3EDTB 1B89A 3ZYLA 3D9KA 1OWPA 4OYSA 4ANWA 2R17C 1BPOA 3B7SA 3MKQA 2J4DA 5HQ8A 1IQUA 2L9BA 5CCLA 3I4GA 4FA6A 3HVEB 3MGBA 4FHJA 2FBNA 2V8SE 4P29A 2HO1A 2IF4A 4I9EA 1QNFA 5BPPA 4RSYA 5T3RA 1INZA 2Y4TA 3SI5A 2I2OA 2LSVA 4UWLA 4F3VA 4QFVA 4UWHA 3PUKA 2X6JA 5EX0A 1SZ9A 2VGXA 4I17A 1NZNA 3CVWA 4N3AA 3CR3A 4H7YA 4ATGA 3GZ1A 1QQEA 4IRUA 4C0MA 2C0LA 4AVXA 4CDNA 3P1UA 2QY7A 3GZ2A 3L16A 5AJDA 2FEZA 4XKBA 1ZBPA 2VSOE 3ASDA 4ACLA 1JUQA 1OUVA 4A1GA 3R7RA 3Q47B 4HFGA 3LYAA 3FUJA 4NQ0A 4KMOA 2GW1A 3L6AA 3SZ7A 3UT8A 3TGOA 2I6HA 3FTXA 5EX3A 2CG2A 4U0ZA 2WXMA 4I6EA 3KD7A 2HYZA 4IULA 3ZXSA 1A17A 3P2BA 3ONKA 3FWVA 1QZ2A 2WQ7A 1KLXA 4I1OB 2VGYA 3CK7A 2VJ8A 3IBEA 1U3CA 2WVIA 3LPZA 1JWFA 3FU0A 3QAQA 4Y6CA 4HOSA 3LCAA 2KCVA 2VQ2A 1JPLA 2XPZA 4C0EA 3C98A 4JXTA 3FFLA 2XRZA 4KYOB 4TUUA 4NURA 1UN8A 3SBTB 3EJNA 2AXVA 3ZEFA 3CVVA 2J08A 4BY6A 2P58C 1E8XA 4UI9C 1WAO1 4I1AA 4WNGA 4APFA 3AS8A 3CHSA 4UQXA 2UWJG 3CVQA 2X38A 1XNFA 4R7LA 3AS5A 4ILGA 1W3BA 2LNIA 3RO3A 2WMNA 3ZYMA 3ZHEB 4EQFA 4Y6WA 2OV8A 3L22A 2V0PA 4AY6A 4GB9A 4URKA 1PY1A 5LX8A 2XGMA 1OWMA 3UPVA 4FLHA 3CQGB 3NF1A 3VLDA 3ZHEA 2MRIA 3FULA 2XPIA 3LEWA 5BUZA 4JA7A 3HYMB 2WB2A 4KT6B 3CHRA 3FUFA 3O48A 2XCCA 3IKOB 2J9QA 4HOUA 4HXIA 1X5BA 4I1MA 4G11A 4CGVA 2OVBA 3ZGQA 1UJJA 4CDMA 5ARFA 1N54A 3ASHA 3FTWA 3D9MA 3CVLA 5FZRA 4AIFA 4F1SA 4MKTA 1H2VC 5D0QD 2IJGX 5ANLA 3MJWA 3L54A 4ANXA 2CHXA 5LCWC 3EIJA 2C2LA 2XQ0A 4J8FA 2C0MA 3CSTA 1HU3A 4AEZC 3BEEA 3CIAA 2BUGA 4GYYA 3IHYA 3QC1A 1E8ZA 4DLOA 3MCXA 2WXLA 3ZFWA 1H19A 1Y6IA 4PS8A 2X6IA 2XRYA 4DI4A 2PM7A 4E6HA 2I1KA 2I9CA 4BX8A 1H6KA 1IYGA 4JVSA 4RVBA 5FQ7A 1MHQA 2LSUA 5AENA 3TG5A 2J49A 2E2EA 1HO8A 4XI9A 2OVFA 3TXMA 4APOA 4TRQA 5A23A 1ELWA 4BT8A 4AY5A 5A6CA 3I3NA 1ELRA 3ENEA 4YNDA 3CK8A 1E8YA 4EZLA 3FHEA 4ME2A 2J09A 3AU4A 4LCTA 5FQ8A 3FUHA 4PDXA 5AJLA 3CHQA 4GZ6A 4UQZA 2DIWA 3RU0A 4GA0A 4WWOA 3PDNA 3FH8A 5AYWD 2WXFA 4O6FA 4XE0A 5KCMA 2WM9A 4HLEA 5CHEE 3SHFA 1HE8A 2VGXB 1NP7A 3QJZA 4HS2A 4WUYA 5A7DB 2KZTA 2LAHA 3T8MA 3ULQA 5T8IA 4BWRA 4G24A 2VTBA 4FP7A 1HG2A 3N71A 3RJVA 3CVYA 2MOWA 4NRHB 3S7FA 2IOLA 2AWIA 3DPDA 3CSFA 3R9AB 4V3IA 2WPVA 2A4ZA 2XGOA 4BT9A 4RG9A 2WXPA 3PZDA 4ABNA 4ILHB 1EF1C 2WXRA 3PUJA 4XI0A 5LFAA 2JLBA 2XHEA 2NSZA 2VSYA 2CG3A 4L1BA 2YNQA 5D0OD 3FEYA 5FT9A 3FU6A 4GZDA 3AU5A 3URZA 4PS7A 2WXGA 1VDYA 2KCLA 2DCPA 4L23A 5C2YA 3SBSA 3UX4A 2BTDA 2LAIA 2YQ8A 4HOQA 4PS3A 3D9PA 5CMWA 3E4BA 5G04C 2WXQA 5J08A 4U63A 3EHNA 5BV1A 3PREA 3DBSA 3LKUA 5FZQA 3Q15A 4A3TA 2A5UA 4JW1A 2FO7A 3O4ZA 4UWFA 1OWLA 3HDXA 5C1DA 3UUXA 3OTNA 3LDZA 4L7TA 4JHKA 2YHEA 4BTAA 4HOTA 4I6JA 4RG6A 2YHCA 3FTUA 3OXGA 3TAXA 4U07A 4UI9K 2HM8A 1FVHA 4XX5A 3JQ1A 4AP2A 3PNLB 5LOZA 1Z3YA 4BX9A 3LVRE 3ZVVA 1HFAA 4XZ4A 3U3WA 3B13A 4FHKA 4EBAG 4LRZA 4A1SA 1WM5A 2L6JA 2WXOA 4GZ5A 2WXJA 2GGFA 4G2VA 3CHPA 4U0UA 3JCKC 3QARA 5FQ4A 3FUNA 4BFRA 2WQHA 2BF0X 4I43A 3MV3B 5JJTA 4KZ0A 5G05C 3SD5A 3VTYA 3Q4AB 4BTBA 1ZU2A 4WWNA 4ILIA 3NZSA 1KT0A 3HHMA 4UI9J 4C9BB 3QWVA 4OVUA 3S2AA 2WXHA 4N3BA 3RRUA 3FH7A 5EKQD 1FCHA 3MV2B 2KM4A 1HX8A 4JHJA 1EYHA 2VSNA 4GA1A 3LY9A 3Q49B 3T5XA 2GRLA 2WXNA 4I2WA 2WQ6A 2XPYA 2M63A 3ZPJA 2PQNA 3PRZA 3S7DA 3S7JA 1KT1A 2X6FA 3I5PA 4DI3A 4J8EA 2X3MA 2KCKA 1HXIA 3GYZA 4GPKA 2RG8A 4GZCA 4JZYA 1NA0A 2MHKA 4U0SA 5FTPA 2Q7FA 4Q94A 3AS4A 5DIZA 4JPSA 4I9CA 2AVPA 2UY1A 4PUCA 1HS6A 1JWGA 3U64A 4CDRA 1P5QA 4B8AA 3MEKA 1IHGA 2DBAA 4EZJA 2JEKA 4DJAA 1TJFA 3CK9A 3ASGA 3FP3A 1XGWA 3B7RL 2IONA 5BW8C 4LUNU 5ARGA 3TXNA 5LCWJ 1MQSA 2Y3AA 4CT4A 3SFZA 3T5VA 3OXFA 4WAFA 2E0IA 4AJWA 1FVFA 4G26A 4DK5A 3BG1B 4FC8A 5G55A 1HG5A 2VSXE 5FWQA 5HI7A 3L13A 3SNXA 3G2TA 3D9OA 3U4TA 3VTXA 2ZU6B 3ONLA 3MYVA 2AXUA 1H0AA 3R7QA 3UT7A 3KEZA 3FU5A 2KZTB 2CHWA 4JC8A 2VTBB 3FTZA 1HH8A 4N2QA 4GA2A 3CEQA 2RD0A 1PC2A 3OXLA 3Q5MA 1OWNA 2IU1A 3TL5A 1DNPA 3D9IA 2ONDA 3D9LA 5ENNA 1UG3A 4JHRA 3GW4A 4GZ3A 3ZYQA 4NACA 1UW4B 3VLEA 3UQ3A 3UMVA 3VLFA 3MX3A 5KJLA 3QWPA 3FUMA 3CQCB 3APDA 2R59A 1E8WA 4L2LA 4A3VA 2CFUA 3ML8A 5E75A 3LS8A 4ACKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3C A;  4UQY A;  3QWW A;  3PE4 A;  4N2S A;  4CGW A;  2NC9 A;  2PL2 A;  4GYW A;  3LY7 A;  2VYI A;  2QFC A;  5DBK A;  2HR2 A;  4GCN A;  3LY8 A;  5FZS A;  3MKR A;  3KAE A;  4GCO A;  4YVO A;  1YA0 A;  5JJ7 A;  3JYS A;  4YVQ C;  5G04 J;  5CCM A;  3WXX A;  3CVN A;  4I2Z A;  4KBQ A;  3K9I A;  4H7X A;  1HZ4 A;  4J0U A;  3PE3 A;  2OOE A;  4N39 A;  2PQR A;  3MA5 A;  2FF4 A;  2Y4U A;  4G25 A;  3ASF A;  2R5S A;  4AM9 A;  5KJN A;  5KJM A;  2V5F A;  5BT1 A;  1TJC A;  3IEG A;  4B94 A;  4N5C A;  4WNF A;  5KJK A;  3CVP A;  4W9R A;  1Y8M A;  5G05 J;  2UY1 B;  4JL0 A;  2FI7 A;  4IN3 B;  3QDN A;  1E96 B;  3SF4 A;  2XCB A;  4KXK B;  1NA3 A;  4GYO A;  2IFU A;  4JA9 A;  5BNW A;  3KS2 A;  3RO2 A;  2PZI A;  3ZN3 A;  4LEU A;  3CKC A;  3QOU A;  5M72 A;  4WND A;  4WNE A;  2KC7 A;  3S7B A;  4G1T A;  2KAT A;  3RIB A;  3QKY A;  5FJY A;  5JJ6 A;  3ESK A;  3RKV A;  2XGS A;  4XIF A;  2XEV A;  4U04 A;  3TG4 A;  4HOR A;  4G23 A;  4J8D A;  3CKB A;  3CV0 A;  3EDT B;  1B89 A;  5HQ8 A;  5CCL A;  2FBN A;  2HO1 A;  2IF4 A;  4I9E A;  2Y4T A;  2LSV A;  4F3V A;  5EX0 A;  2VGX A;  4I17 A;  1NZN A;  4N3A A;  4H7Y A;  3GZ1 A;  1QQE A;  2C0L A;  3GZ2 A;  2FEZ A;  1ZBP A;  3ASD A;  1OUV A;  3Q47 B;  3LYA A;  4NQ0 A;  2GW1 A;  3SZ7 A;  3TGO A;  2I6H A;  5EX3 A;  4U0Z A;  3KD7 A;  2HYZ A;  1A17 A;  3FWV A;  1QZ2 A;  1KLX A;  2VGY A;  3CK7 A;  3LPZ A;  4Y6C A;  4HOS A;  3LCA A;  2KCV A;  2VQ2 A;  3FFL A;  4KYO B;  2P58 C;  4UI9 C;  4WNG A;  1WAO 1;  4I1A A;  3AS8 A;  4UQX A;  2UWJ G;  3CVQ A;  1XNF A;  3AS5 A;  1W3B A;  2LNI A;  3RO3 A;  3ZHE B;  4EQF A;  4Y6W A;  4AY6 A;  2XGM A;  3UPV A;  3NF1 A;  3ZHE A;  2XPI A;  4JA7 A;  3HYM B;  3O48 A;  2XCC A;  4HOU A;  2J9Q A;  4CGV A;  3ZGQ A;  5ARF A;  3ASH A;  3CVL A;  5FZR A;  4AIF A;  5D0Q D;  5LCW C;  2C2L A;  4J8F A;  2C0M A;  3BEE A;  2BUG A;  4GYY A;  3ZFW A;  1IYG A;  2LSU A;  3TG5 A;  2E2E A;  4XI9 A;  4APO A;  1ELW A;  4BT8 A;  4AY5 A;  5A6C A;  1ELR A;  4YND A;  3CK8 A;  4ME2 A;  4UQZ A;  4GZ6 A;  3RU0 A;  4GA0 A;  3PDN A;  5AYW D;  4O6F A;  5CHE E;  2VGX B;  4WUY A;  5A7D B;  3ULQ A;  4BWR A;  4G24 A;  3RJV A;  3N71 A;  4NRH B;  3S7F A;  3R9A B;  2WPV A;  4BT9 A;  2XGO A;  4RG9 A;  4ABN A;  4XI0 A;  2JLB A;  2VSY A;  5D0O D;  5FT9 A;  3URZ A;  2KCL A;  2YQ8 A;  4HOQ A;  3E4B A;  5G04 C;  5FZQ A;  3LKU A;  3Q15 A;  2FO7 A;  5C1D A;  3UUX A;  4BTA A;  4HOT A;  4RG6 A;  3OXG A;  2YHC A;  3TAX A;  4U07 A;  4UI9 K;  3U3W A;  4A1S A;  1WM5 A;  2L6J A;  4GZ5 A;  4G2V A;  4U0U A;  2WQH A;  5JJT A;  3MV3 B;  5G05 C;  3VTY A;  3Q4A B;  4BTB A;  1ZU2 A;  1KT0 A;  4UI9 J;  3QWV A;  4N3B A;  5EKQ D;  1FCH A;  3MV2 B;  2VSN A;  4GA1 A;  3LY9 A;  3Q49 B;  4I2W A;  3ZPJ A;  2PQN A;  3S7D A;  3S7J A;  1KT1 A;  4J8E A;  2KCK A;  1HXI A;  3GYZ A;  4GPK A;  1NA0 A;  2MHK A;  4U0S A;  5FTP A;  2Q7F A;  3AS4 A;  5DIZ A;  4I9C A;  2AVP A;  2UY1 A;  4CDR A;  1P5Q A;  3MEK A;  1IHG A;  2DBA A;  3CK9 A;  3ASG A;  3FP3 A;  5BW8 C;  5ARG A;  5LCW J;  3OXF A;  4G26 A;  5HI7 A;  3U4T A;  3VTX A;  1HH8 A;  4N2Q A;  4GA2 A;  3CEQ A;  1PC2 A;  3OXL A;  3Q5M A;  2OND A;  4JHR A;  3GW4 A;  4GZ3 A;  3UQ3 A;  5KJL A;  3QWP A; 
#chains in the Genus database with same CATH topology
 5CEC B;  3SFY A;  5ANR A;  3QB2 A;  3LY7 A;  2VYI A;  2XEN A;  3SGH A;  3FTY A;  2BED A;  4EHM A;  4IYP A;  2B0O E;  2B6C A;  3ABM E;  4LNU D;  4M7C A;  4GCN A;  3ULE G;  3LY8 A;  4MLP A;  3FTS A;  4A55 A;  4U95 D;  2R05 A;  1LF8 A;  4GCO A;  2GRM A;  4YVO A;  3PNT B;  3FEX A;  4YVQ C;  3B7U X;  1N4S A;  3FDH A;  1Q2Z A;  4K5A B;  3AJI A;  3WXX A;  1YYH A;  1TR4 A;  3DSU A;  3NQP A;  4MRU A;  3TWW A;  4PH4 B;  3PE3 A;  2FF4 A;  4EEC A;  3EHR A;  4AM9 A;  3D3M A;  2ILR A;  4CCA A;  3APC A;  4L9P A;  3D9N A;  3FUK A;  5G2N A;  5BT1 A;  4DLQ A;  3AG2 E;  5KJK A;  3BG0 B;  3CVP A;  4LER A;  1Y8M A;  4W9R A;  5G05 J;  3G2U A;  1N0R A;  2CFZ A;  2VGE A;  4IN3 B;  4YDE A;  4I6G A;  3QDN A;  1E96 B;  1NA3 A;  3DSV A;  4GYO A;  1K1B A;  2IFU A;  1X81 A;  5BNW A;  3KS2 A;  5AAO A;  2IY0 C;  2P9I G;  1ELK A;  4OVV A;  3ZN3 A;  4XKC A;  3HIZ A;  4FUL A;  5H7P A;  5M72 A;  3LVQ E;  4WND A;  4FJY A;  3CLJ A;  2V4L A;  2AW6 A;  5HKP A;  2GRR B;  4DX1 A;  1JCQ A;  3LJ3 A;  4J6I A;  2XS8 A;  5ENQ D;  3ESK A;  3RKV A;  1H2U A;  3TG4 A;  3ZXP A;  4HOR A;  2ZGG A;  4G23 A;  3CGH A;  5JHA A;  3D9K A;  1OWP A;  2J4D A;  1IQU A;  4GPM A;  1N9A A;  3MGB A;  3UM3 A;  4P29 A;  2P9P G;  4I9E A;  1QNF A;  2OEW A;  5T3R A;  1INZ A;  3DXM G;  3PUK A;  4TXR A;  4I17 A;  2PNN A;  3P1U A;  1MZC A;  3L16 A;  2FEZ A;  1ZBP A;  2VSO E;  4ACL A;  1JUQ A;  4A1G A;  5JA4 D;  3FUJ A;  1U2V G;  5CBO A;  3ZXS A;  2KXP C;  3ONK A;  1QZ2 A;  2WQ7 A;  4I1O B;  3IBE A;  3LCA A;  2KCV A;  4JXT A;  2KBX A;  2XRZ A;  4KYO B;  4TUU A;  3SBT B;  4HB5 A;  2P58 C;  4UI9 C;  4WNG A;  3AS8 A;  1ZB1 A;  4UQX A;  2LUH A;  4R7L A;  1W3B A;  2WMN A;  4EQF A;  1PY1 A;  5LX8 A;  2ETC A;  3NF1 A;  1D8D A;  3FUF A;  3O48 A;  4HOU A;  2J9Q A;  4CYM D;  2EIN E;  1X5B A;  4G11 A;  4CGV A;  2OVB A;  3ZGQ A;  1N54 A;  5FZR A;  4AIF A;  4F1S A;  4MKT A;  4ANX A;  3EIJ A;  2C2L A;  2XQ0 A;  2C0M A;  3KSQ A;  2AJA A;  3BEE A;  1E8Z A;  2WXL A;  3ZFW A;  1Z5S C;  3DXK G;  2XRY A;  4DI4 A;  4BET A;  5FQ7 A;  4HQD A;  2OVF A;  3ZNG A;  3SO8 A;  4LG6 A;  4APO A;  4AY5 A;  5A6C A;  2Y0B G;  3I3N A;  4EZL A;  3FUH A;  4GA0 A;  5AYW D;  4XE0 A;  5KCM A;  3WG7 E;  3SHF A;  5A7D B;  3ULQ A;  2KZT A;  3RJV A;  3N71 A;  3CVY A;  2DYS E;  4NRH B;  1NL4 A;  2Y1L E;  3BQO A;  3R9A B;  2A4Z A;  2XGO A;  3PZD A;  4ABN A;  4ILH B;  5LFA A;  4GTR A;  2P9S G;  3JUE A;  2CG3 A;  2YNQ A;  3UM1 A;  4OAV B;  3Q9N C;  4YDW A;  3HG0 D;  4BEP A;  2DZN A;  3UX4 A;  3SBS A;  4K5B A;  2BTD A;  4G8K A;  3D9P A;  2WXQ A;  3DBS A;  2A5U A;  2FO7 A;  3HDX A;  4L7T A;  3HXD A;  4BTA A;  3KSL A;  1NI1 A;  3DSX A;  2GRQ B;  3JQ1 A;  4TUM A;  3PNL B;  3ZVV A;  5CRV A;  4FHK A;  4LRZ A;  1WM5 A;  2L6J A;  3HXC A;  3ULY A;  3CHP A;  4U0U A;  4BER A;  3JCK C;  3QAR A;  1JCR A;  2BF0 X;  3SD5 A;  3UIO C;  1H6O A;  3Q4A B;  1QBQ A;  4F6R D;  4C9B B;  3QWV A;  1FCH A;  2KM4 A;  1HX8 A;  3EHQ A;  3LY9 A;  3Q49 B;  4I2W A;  2RFA A;  2WQ6 A;  2XPY A;  2PQN A;  1KT1 A;  2X6F A;  4GPK A;  5FTP A;  5D66 A;  4JPS A;  4PUC A;  1JWG A;  3U64 A;  4CZ2 D;  3ASO E;  2JEK A;  4DJA A;  1TJF A;  5LCW J;  1MQS A;  2E0I A;  4AJW A;  1FVF A;  4DK5 A;  4TXQ A;  5HI7 A;  2VSX E;  4YDO A;  4QQI A;  3VTX A;  2ZU6 B;  1H0A A;  3UT7 A;  2KZT B;  2F8X K;  2F37 A;  3TWU A;  3CEQ A;  3UKU G;  3ZU7 B;  3AAA C;  3Q5M A;  4GMR A;  4GZ3 A;  4NAC A;  1QYM A;  5B1A E;  3VLF A;  3L82 A;  3UKR G;  2P9L G;  1E8W A;  3ML8 A;  4UUC A;  3LS8 A;  3MZL B;  1U3D A;  3G2V A;  3PE4 A;  4D10 C;  4N2S A;  4Q96 A;  2IQC A;  5E76 A;  3G2W A;  1UJK A;  1GW6 A;  2ETA A;  3IHV A;  5HS0 A;  1L5J A;  5DBK A;  3GZS A;  1BU9 A;  3JQ0 A;  4CEM A;  4FU3 A;  1O1S A;  5KNH D;  3ZIM A;  4A63 B;  2EQX A;  3PVL A;  5BV0 A;  3KAE A;  3U66 A;  4WWP A;  5JJ7 A;  1S70 B;  3E37 A;  3V79 K;  2CHZ A;  1IXV A;  4FLB A;  3ZRH A;  2NXP A;  3CVN A;  4U8H A;  1E7U A;  3CVU A;  4H7X A;  4J0U A;  4YDY A;  2OOE A;  4N39 A;  2PQR A;  2FUL A;  1RZ4 A;  3U9W A;  3B95 A;  2X6H A;  3ASF A;  2QYU A;  3ZKJ A;  4ANV A;  4DX2 A;  4F1P A;  4AOF A;  4DRX E;  5AQA A;  2V5F A;  2ZIS A;  4TV3 A;  1SQM A;  4K03 A;  1TNY A;  1TJC A;  4WNF A;  1WG0 A;  5ENR D;  2FI7 A;  3L08 A;  3PEV B;  4CRW A;  3SF4 A;  4KXK B;  3LXU X;  3V31 A;  4MS6 A;  3PH0 C;  1D8E A;  1AP7 A;  2PZI A;  2V5Q C;  3FH5 A;  2WXK A;  3CKC A;  3QOU A;  3SY2 A;  4WNE A;  1WY6 A;  3FU3 A;  3CHM A;  3EHM A;  4F53 A;  4G1T A;  3ZYK A;  5T4Y A;  1EPU A;  1IQR A;  3CKB A;  4KZC A;  1B89 A;  3ZYL A;  4OYS A;  4ANW A;  1BPO A;  3B7S A;  5HQ8 A;  2EIJ E;  5CCL A;  4U96 D;  2HO1 A;  5BPP A;  4RSY A;  2Y4T A;  3Q7A A;  3SI5 A;  4UWL A;  4QFV A;  5AN8 A;  3CVW A;  3V2O A;  1TNU A;  4H7Y A;  4ATG A;  1QQE A;  2C0L A;  4XKB A;  1OUV A;  2ZXW E;  3R7R A;  2FO1 E;  2GW1 A;  2DYR E;  3L6A A;  3SZ7 A;  5EX3 A;  5AQ9 A;  3KD7 A;  4IUL A;  1KPS B;  3FWV A;  2VGY A;  3CK7 A;  3FU0 A;  2XPZ A;  3C98 A;  4LSZ E;  3EJN A;  2AXV A;  3CVV A;  2J08 A;  1E8X A;  4I1A A;  4APF A;  3W9F A;  3CHS A;  3UM0 A;  2X38 A;  3UIN C;  3ZHE B;  4Y6W A;  3L22 A;  2V0P A;  4AY6 A;  3ISM C;  3UPV A;  4FLH A;  3FUL A;  2XPI A;  3LEW A;  4JA7 A;  2WB2 A;  1MX6 A;  3IKO B;  1UJJ A;  5ARF A;  3ASH A;  1O5M A;  3TWV A;  3CST A;  3CIA A;  3QC1 A;  2XZD G;  1Y6I A;  4K5C A;  4PS8 A;  2X6I A;  2PM7 A;  2I1K A;  4BX8 A;  1H6K A;  4JVS A;  3TG5 A;  4XI9 A;  1OXJ A;  1MX2 A;  5FIO A;  4BT8 A;  1ELR A;  3FHE A;  4LCT A;  5FQ8 A;  5ENT D;  3PDN A;  5AAR A;  2XZT G;  2EIL E;  3QJZ A;  3E34 A;  4HRN A;  3T8M A;  4BWR A;  5D2M C;  2EIM E;  4FP7 A;  1HG2 A;  2MOW A;  3CSF A;  4V3I A;  4BT9 A;  4RG9 A;  1WDY A;  1EF1 C;  4XI0 A;  2XHE A;  5D0O D;  2HE0 A;  3AG4 E;  2WXG A;  5C2Y A;  2YQ8 A;  2LAI A;  5G04 C;  5J08 A;  4U63 A;  2F0Y A;  5FZQ A;  3V2X A;  5EID A;  2P9U G;  4UWF A;  3UUX A;  2YHE A;  3TWR A;  1UOH A;  3FTU A;  3OXG A;  3TAX A;  4U07 A;  1FVH A;  2EIK E;  5LOZ A;  4BX9 A;  1HFA A;  4XZ4 A;  3B13 A;  2GGF A;  4BFR A;  3MV3 B;  3ZUV B;  4ILI A;  3NZS A;  3HHM A;  4UI9 J;  4HLL A;  3FH7 A;  3Q9U C;  5EKQ D;  3ABK E;  3DSW A;  3T5X A;  4LNB A;  3ZPJ A;  3I5P A;  2KCK A;  3GYZ A;  4GZC A;  1NA0 A;  2MHK A;  3V30 A;  2Q7F A;  3Q79 A;  2RFM A;  2UY1 A;  1HS6 A;  3MEK A;  1N0Q A;  3AG3 E;  1IHG A;  4EZJ A;  1XGW A;  3B7R L;  5ARG A;  2V4H C;  3OXF A;  3SNX A;  5FWQ A;  4HRM B;  3G2T A;  3D9O A;  4GTQ A;  2CHW A;  3R9M A;  5EN5 D;  1HH8 A;  2QYJ A;  1UG3 A;  4N5Q A;  3GW4 A;  3ZYQ A;  1UW4 B;  3UMV A;  3MX3 A;  3QWP A;  3FUM A;  1SVX A;  3APD A;  1FT1 A;  4JD2 G;  4L2L A;  1V54 E;  5E75 A;  4N3C A;  4DX6 D;  4EZK A;  3QWW A;  3E32 A;  4GTP A;  1UN9 A;  3Q75 A;  4GYW A;  3HRA A;  2QFC A;  3L17 A;  4UWK A;  2X6K A;  3FUE A;  3TWT A;  1SZA A;  4GMJ A;  4HBD A;  2IOS A;  1N11 A;  2L0T B;  1A5E A;  3UT4 A;  5FZS A;  2I1J A;  4C48 B;  5BXO A;  2P9K G;  3ML9 A;  3PZ2 A;  2L0I A;  4I2Z A;  4EBA A;  3C5R A;  4KBQ A;  4GTT A;  3QK0 A;  1E7V A;  4ANU A;  3NBN B;  3B7T A;  4KVO A;  1BD8 A;  2R5S A;  4CT0 A;  5KJM A;  4O1P A;  1H2T C;  1EDU A;  5EIB E;  4UWG A;  4B0Z A;  4AXH A;  5FQ6 A;  4B89 A;  5ENO D;  1V55 E;  3IV0 A;  1HF8 A;  3IEG A;  5B1B E;  4B94 A;  4N5C A;  4EPZ A;  3NZU A;  2UY1 B;  4Q69 A;  4JL0 A;  5J90 A;  2AXZ A;  2XCB A;  4JA9 A;  3I4R B;  3RO2 A;  4K0R A;  2L6B A;  3RRN B;  4GU5 A;  4M3O A;  1S0P A;  2WXI A;  1Z6T A;  3CVX A;  2KC7 A;  4XEI G;  4BSX A;  1N52 A;  1S63 A;  3EIQ C;  2KAT A;  5AIJ A;  5CER B;  2H6F A;  3Q73 A;  3QKY A;  5FJY A;  2XGS A;  4XIF A;  3MKQ B;  3JUI A;  3JXI A;  5AQB A;  4J8D A;  2WMO A;  1KZO A;  3RK6 A;  3NB2 A;  2L9B A;  3I4G A;  2FBN A;  1S64 A;  2V8S E;  2IF4 A;  2NYJ A;  1K3Z D;  2LSV A;  4GTM A;  4F3V A;  5ENS D;  5EX0 A;  1SZ9 A;  2VGX A;  3C3O A;  4N3A A;  3CR3 A;  3GZ1 A;  4IRU A;  4C0M A;  4AVX A;  2QY7 A;  3GZ2 A;  3UIP C;  3Q47 B;  1TNB A;  3LYA A;  3UT8 A;  3FTX A;  4J8Y A;  2CG2 A;  4U0Z A;  2WXM A;  2HYZ A;  3P2B A;  1TYQ G;  2F8Y A;  1U3C A;  2WVI A;  3LPZ A;  1JWF A;  3EUV A;  4Y6C A;  2VQ2 A;  1JPL A;  4C0E A;  3LJN A;  3NOC D;  1UN8 A;  1WAO 1;  3CVQ A;  5ENP D;  4ILG A;  3RO3 A;  2OV8 A;  3BUA A;  4URK A;  4ZFH A;  3VLD A;  3ZHE A;  2MRI A;  3HXB A;  5EYL A;  2XCC A;  4HXI A;  4I1M A;  1N4R A;  4GTO A;  4CDM A;  3D9M A;  3CVL A;  4TXP A;  4LNG A;  1H2V C;  5D0Q D;  3MJW A;  3L54 A;  3DEO A;  3UI2 A;  1SA5 A;  3IHY A;  1SW6 A;  4DLO A;  1YMP A;  2GRO B;  4E6H A;  2I9C A;  1DC2 A;  1IYG A;  4RVB A;  3KEA A;  1MHQ A;  3X2Q E;  2J49 A;  2E2E A;  1HO8 A;  2H6G A;  5A23 A;  4TRQ A;  1ELW A;  1TN7 A;  3L9T A;  3ENE A;  3CK8 A;  4ME2 A;  2J09 A;  3AU4 A;  4PDX A;  5AJL A;  4GZ6 A;  2ETB A;  2IEJ A;  4DX5 D;  3FH8 A;  2WXF A;  4O6F A;  2WM9 A;  4HLE A;  5CHE E;  4HI8 A;  1HE8 A;  2VGX B;  2VTB A;  5T8I A;  1BI7 B;  2IOL A;  3DPD A;  4U8V D;  2WPV A;  3DSS A;  2WXP A;  1MX4 A;  3PUJ A;  2JLB A;  2R03 A;  2NSZ A;  2DVW A;  2VSY A;  3FEY A;  5FT9 A;  1RW2 A;  3PZ1 A;  4GZD A;  4PS7 A;  5EIL A;  2KCL A;  2DCP A;  4L23 A;  3SQV A;  5ITZ F;  3D9H A;  3EHN A;  5BV1 A;  3Q15 A;  4MBG A;  4JW1 A;  3Q7F A;  1OWL A;  5C1D A;  3OTN A;  3LDZ A;  3JXJ A;  4HOT A;  4I6J A;  3HXE A;  3TWX A;  2YHC A;  4UI9 K;  2HM8 A;  2JAB A;  3C72 A;  2ZGD A;  4AP2 A;  1Z3Y A;  3LVR E;  3J5Q B;  3U3W A;  1O1T A;  4A1S A;  2WXO A;  4GZ5 A;  1K1A A;  4U7E B;  4I43 A;  5JJT A;  4KZ0 A;  5G05 C;  2DZO A;  2H6H A;  4BTB A;  1ZU2 A;  4WWN A;  5CRU A;  1OCO E;  3DEP A;  4OVU A;  3S2A A;  2WXH A;  4N3B A;  3RRU A;  1H6P A;  3MV2 B;  1EYH A;  2VSN A;  5CED B;  3C3Q A;  4GA1 A;  2M63 A;  1TNO A;  1DCE A;  2R2L A;  4J8E A;  4JZY A;  4Q94 A;  4I9C A;  2AVP A;  4CDR A;  3CK9 A;  3FP3 A;  4JB8 P;  3UM2 A;  2Y3A A;  2QZA A;  4WAF A;  2QC9 A;  2GRP B;  1SA4 A;  1HG5 A;  3L13 A;  3ONL A;  3MYV A;  3R7Q A;  3KEZ A;  3FU5 A;  2VTB B;  2DWZ A;  3FTZ A;  4GA2 A;  3OXL A;  2IU1 A;  3TL5 A;  1DNP A;  3D9I A;  2A5E A;  2OND A;  5ENN A;  3D9L A;  4JHR A;  3VLE A;  3UQ3 A;  2R59 A;  4A3V A;  1TN8 A;  4UQY A;  3UXG A;  3ESL A;  1DCQ A;  2BKK B;  3G2S A;  4O60 A;  4HNA D;  4CGW A;  2NC9 A;  2PL2 A;  1JCS A;  4RLY A;  3HVE A;  2XS1 A;  3ABL E;  4F7A A;  4DPR A;  4ZHB A;  2J4B A;  2J07 A;  2IO3 C;  3FUI A;  4L2Y A;  3FUD A;  2HR2 A;  4GAA A;  4E85 A;  3C3R A;  3D9J A;  5JHB A;  3MKR A;  4JEU A;  1YA0 A;  3JYS A;  1PAQ A;  5G04 J;  1E90 A;  1OWO A;  5CCM A;  2R02 A;  4HVB A;  1D9S A;  3PS6 A;  1O1R A;  3K9I A;  3RSE G;  1HZ4 A;  3Q78 A;  2XEE A;  5JMN D;  3MA5 A;  2Y4U A;  4G25 A;  4JEH A;  5KWD A;  3NOG D;  5KJN A;  2PM6 A;  3APF A;  3RRM B;  4J8S A;  4GML A;  2OCC E;  3QNK A;  4FAD A;  3FTV A;  3E30 A;  4J7W A;  1G3N B;  1N4P A;  4X8Q A;  4B8C B;  3ZW3 A;  3TJP A;  3J5P A;  3AG1 E;  4Z68 A;  3IXE A;  4LEU A;  5KNG A;  1LD7 A;  4OAU C;  2LO6 A;  5EYP F;  4KVM A;  5EDS A;  4AV7 A;  4FJZ A;  3NAW A;  5CMY A;  3S7B A;  3FY4 A;  3PEU B;  1TEZ A;  2YIN A;  1Z3X A;  2H6I A;  3RIB A;  3CHO A;  5JJ6 A;  2XEH A;  2XEV A;  4U04 A;  5LP0 A;  1DVP A;  4RQI A;  3OAW A;  5FIN A;  3CV0 A;  3EDT B;  3HXF A;  2R17 C;  4HRL A;  3MKQ A;  4FA6 A;  2MYO A;  3HVE B;  4FHJ A;  4G8L A;  3BU8 A;  2RKK A;  3ASN E;  2I2O A;  5AQ7 A;  4UWH A;  2X6J A;  1NZN A;  4DX7 D;  3W9G A;  1TN6 A;  1MJ0 A;  4CDN A;  1FT2 A;  5AJD A;  3ASD A;  3T9K A;  2Y69 E;  4HFG A;  4NQ0 A;  4KMO A;  3TGO A;  2I6H A;  4I6E A;  1A17 A;  4GTV A;  2BKG A;  1KLX A;  2VJ8 A;  3QAQ A;  4HOS A;  2LXM A;  3FFL A;  5BXU A;  4NUR A;  4B93 B;  3SFX A;  3ZEF A;  4GTS A;  4BY6 A;  3DPY A;  2UWJ G;  1XNF A;  1OT8 A;  3AS5 A;  3TWS A;  2LNI A;  1MYO A;  3ZYM A;  4GB9 A;  2XGM A;  1OWM A;  3CQG B;  5BUZ A;  3HYM B;  4KT6 B;  3CHR A;  3E33 A;  3FTW A;  2IJG X;  5ANL A;  2CHX A;  5LCW C;  1TNZ A;  3F6Q A;  4J8F A;  4AEZ C;  1HU3 A;  2BUG A;  4GYY A;  3MCX A;  2ZIR A;  1H19 A;  3EU5 A;  5AEN A;  2LSU A;  3DRA A;  4NIK A;  1N4Q A;  3TXM A;  4DUI A;  3PZ3 A;  3TWQ A;  4YND A;  1E8Y A;  3CHQ A;  4UQZ A;  4BES A;  2DIW A;  3RU0 A;  4WWO A;  3T8K A;  5IY5 E;  2IO2 C;  4HS2 A;  1NP7 A;  4WUY A;  2LAH A;  4G24 A;  1IHB A;  3S7F A;  2P2C P;  2GRN B;  2AWI A;  2J8S D;  2WXR A;  3B7B A;  1YCS B;  4L1B A;  3FU6 A;  1BI8 B;  3AU5 A;  3PZ4 A;  3URZ A;  1N94 A;  3UTM A;  1VDY A;  4HOQ A;  4ATZ D;  4PS3 A;  5B3S E;  3E4B A;  5CMW A;  2LXL A;  3PRE A;  3LKU A;  1N95 A;  4A3T A;  1KZP A;  3O4Z A;  4JHK A;  4RG6 A;  4XX5 A;  5HRY A;  4EBA G;  2WXJ A;  4G2V A;  5FQ4 A;  3FUN A;  1LTX A;  2WQH A;  3VTY A;  1NFI E;  1KT0 A;  1AWC B;  1OCR E;  4JHJ A;  2GRL A;  2WXN A;  4HI9 A;  4O1O A;  3S7D A;  3PRZ A;  3S7J A;  4DI3 A;  2X3M A;  1HXI A;  1BLX B;  2RG8 A;  4U0S A;  3AS4 A;  5DIZ A;  3RAU A;  1P5Q A;  4B8A A;  2DBA A;  3ASG A;  1OCC E;  2ION A;  5BW8 C;  4LUN U;  3TXN A;  4CT4 A;  3SFZ A;  3T5V A;  4G26 A;  4U8Y D;  3BG1 B;  4FC8 A;  5G55 A;  5CEA A;  3U4T A;  2AXU A;  1OCZ E;  5CBN A;  4JC8 A;  4N2Q A;  2OEV A;  2RD0 A;  4BSZ B;  1PC2 A;  3DWL G;  1OWN A;  3DST A;  2P9N G;  3EU9 A;  1IKN D;  5KJL A;  1LD8 A;  1FPP A;  1K8K G;  3CQC B;  5KBA A;  2CFU A;  1OY3 D;  4ACK A; 
#chains in the Genus database with same CATH homology
 4N3C A;  3MZL B;  1U3D A;  4UQY A;  4EZK A;  3G2V A;  3ESL A;  3QWW A;  3PE4 A;  3G2S A;  4D10 C;  4N2S A;  4CGW A;  1UN9 A;  4Q96 A;  2NC9 A;  2PL2 A;  3QB2 A;  4GYW A;  5ANR A;  2IQC A;  3HVE A;  3LY7 A;  5E76 A;  2VYI A;  2QFC A;  3G2W A;  3L17 A;  1UJK A;  4F7A A;  3SGH A;  1GW6 A;  4UWK A;  2X6K A;  3IHV A;  3FTY A;  4DPR A;  1L5J A;  3FUE A;  5DBK A;  3GZS A;  2J4B A;  2J07 A;  3JQ0 A;  4CEM A;  1SZA A;  4IYP A;  3FUI A;  4GMJ A;  4FU3 A;  4L2Y A;  3FUD A;  2HR2 A;  2IOS A;  4GCN A;  4GAA A;  2L0T B;  3ZIM A;  3LY8 A;  4MLP A;  4E85 A;  3FTS A;  3D9J A;  2EQX A;  3PVL A;  4A55 A;  5BV0 A;  3UT4 A;  5JHB A;  5FZS A;  1LF8 A;  3MKR A;  2I1J A;  3KAE A;  4GCO A;  3U66 A;  2GRM A;  4YVO A;  3PNT B;  3FEX A;  4JEU A;  4WWP A;  1YA0 A;  5JJ7 A;  3JYS A;  1PAQ A;  4YVQ C;  3B7U X;  1E90 A;  1OWO A;  5G04 J;  5CCM A;  3FDH A;  3ML9 A;  2CHZ A;  2L0I A;  4FLB A;  4HVB A;  3ZRH A;  3WXX A;  2NXP A;  3CVN A;  4I2Z A;  3PS6 A;  4EBA A;  4U8H A;  3NQP A;  4KBQ A;  3K9I A;  4MRU A;  1E7U A;  4PH4 B;  3CVU A;  3QK0 A;  1E7V A;  4H7X A;  4ANU A;  1HZ4 A;  4J0U A;  3PE3 A;  2OOE A;  3B7T A;  2PQR A;  4N39 A;  4KVO A;  2FUL A;  3MA5 A;  2FF4 A;  2Y4U A;  4G25 A;  4JEH A;  2X6H A;  3ASF A;  3U9W A;  4EEC A;  2R5S A;  4AM9 A;  4CT0 A;  5KJN A;  3D3M A;  4ANV A;  5KJM A;  2ILR A;  1H2T C;  4CCA A;  1EDU A;  4AOF A;  3APC A;  2PM6 A;  4UWG A;  3APF A;  4B0Z A;  3RRM B;  4AXH A;  3D9N A;  5FQ6 A;  4B89 A;  3FUK A;  2V5F A;  4J8S A;  4GML A;  4TV3 A;  1SQM A;  5G2N A;  3IV0 A;  3QNK A;  4FAD A;  4K03 A;  5BT1 A;  1TJC A;  1HF8 A;  3IEG A;  3FTV A;  4DLQ A;  4B94 A;  4N5C A;  4WNF A;  4EPZ A;  5KJK A;  3BG0 B;  3CVP A;  4LER A;  1Y8M A;  4W9R A;  3NZU A;  5G05 J;  2UY1 B;  3G2U A;  4Q69 A;  4JL0 A;  2FI7 A;  2CFZ A;  3L08 A;  3PEV B;  4IN3 B;  4CRW A;  4B8C B;  4I6G A;  3ZW3 A;  5J90 A;  3QDN A;  1E96 B;  2AXZ A;  3SF4 A;  2XCB A;  4KXK B;  3TJP A;  1NA3 A;  3LXU X;  4GYO A;  2IFU A;  4JA9 A;  4MS6 A;  3I4R B;  5BNW A;  3KS2 A;  3RO2 A;  4K0R A;  3PH0 C;  1ELK A;  2PZI A;  4OVV A;  3FH5 A;  4XKC A;  3RRN B;  3ZN3 A;  2WXK A;  3HIZ A;  4GU5 A;  4LEU A;  4FUL A;  4M3O A;  3CKC A;  3QOU A;  5M72 A;  3LVQ E;  4WND A;  1S0P A;  2LO6 A;  4WNE A;  2WXI A;  4KVM A;  1Z6T A;  4FJY A;  5EDS A;  1WY6 A;  3FU3 A;  4AV7 A;  4FJZ A;  3CVX A;  2KC7 A;  3CHM A;  3CLJ A;  5CMY A;  4BSX A;  3EHM A;  3S7B A;  3FY4 A;  1N52 A;  4G1T A;  4F53 A;  3ZYK A;  3PEU B;  1TEZ A;  3EIQ C;  2KAT A;  5T4Y A;  5AIJ A;  2V4L A;  2YIN A;  2AW6 A;  1Z3X A;  3RIB A;  3LJ3 A;  3CHO A;  4J6I A;  3QKY A;  1EPU A;  5FJY A;  3ESK A;  5JJ6 A;  2XGS A;  4XIF A;  3RKV A;  1IQR A;  1H2U A;  2XEV A;  4U04 A;  3TG4 A;  4HOR A;  5LP0 A;  1DVP A;  3MKQ B;  4G23 A;  3JUI A;  3OAW A;  4J8D A;  3CGH A;  2WMO A;  5JHA A;  3CKB A;  3RK6 A;  3CV0 A;  4KZC A;  3EDT B;  1B89 A;  3ZYL A;  3D9K A;  1OWP A;  4OYS A;  4ANW A;  2R17 C;  1BPO A;  3B7S A;  3MKQ A;  2J4D A;  5HQ8 A;  1IQU A;  2L9B A;  5CCL A;  3I4G A;  4FA6 A;  3HVE B;  3MGB A;  4FHJ A;  2FBN A;  2V8S E;  4P29 A;  2HO1 A;  2IF4 A;  4I9E A;  1QNF A;  5BPP A;  4RSY A;  5T3R A;  1INZ A;  2Y4T A;  3SI5 A;  2I2O A;  2LSV A;  4UWL A;  4F3V A;  4QFV A;  4UWH A;  3PUK A;  2X6J A;  5EX0 A;  1SZ9 A;  2VGX A;  4I17 A;  1NZN A;  3CVW A;  4N3A A;  3CR3 A;  4H7Y A;  4ATG A;  3GZ1 A;  1QQE A;  4IRU A;  4C0M A;  2C0L A;  4AVX A;  4CDN A;  3P1U A;  2QY7 A;  3GZ2 A;  3L16 A;  5AJD A;  2FEZ A;  4XKB A;  1ZBP A;  2VSO E;  3ASD A;  4ACL A;  1JUQ A;  1OUV A;  4A1G A;  3R7R A;  3Q47 B;  4HFG A;  3LYA A;  3FUJ A;  4NQ0 A;  4KMO A;  2GW1 A;  3L6A A;  3SZ7 A;  3UT8 A;  3TGO A;  2I6H A;  3FTX A;  5EX3 A;  2CG2 A;  4U0Z A;  2WXM A;  4I6E A;  3KD7 A;  2HYZ A;  4IUL A;  3ZXS A;  1A17 A;  3P2B A;  3ONK A;  3FWV A;  1QZ2 A;  2WQ7 A;  1KLX A;  4I1O B;  2VGY A;  3CK7 A;  2VJ8 A;  3IBE A;  1U3C A;  2WVI A;  3LPZ A;  1JWF A;  3FU0 A;  3QAQ A;  4Y6C A;  4HOS A;  3LCA A;  2KCV A;  2VQ2 A;  1JPL A;  2XPZ A;  4C0E A;  3C98 A;  4JXT A;  3FFL A;  2XRZ A;  4KYO B;  4TUU A;  4NUR A;  1UN8 A;  3SBT B;  3EJN A;  2AXV A;  3ZEF A;  3CVV A;  2J08 A;  4BY6 A;  2P58 C;  1E8X A;  4UI9 C;  1WAO 1;  4I1A A;  4WNG A;  4APF A;  3AS8 A;  3CHS A;  4UQX A;  2UWJ G;  3CVQ A;  2X38 A;  1XNF A;  4R7L A;  3AS5 A;  4ILG A;  1W3B A;  2LNI A;  3RO3 A;  2WMN A;  3ZYM A;  3ZHE B;  4EQF A;  4Y6W A;  2OV8 A;  3L22 A;  2V0P A;  4AY6 A;  4GB9 A;  4URK A;  1PY1 A;  5LX8 A;  2XGM A;  1OWM A;  3UPV A;  4FLH A;  3CQG B;  3NF1 A;  3VLD A;  3ZHE A;  2MRI A;  3FUL A;  2XPI A;  3LEW A;  5BUZ A;  4JA7 A;  3HYM B;  2WB2 A;  4KT6 B;  3CHR A;  3FUF A;  3O48 A;  2XCC A;  3IKO B;  2J9Q A;  4HOU A;  4HXI A;  1X5B A;  4I1M A;  4G11 A;  4CGV A;  2OVB A;  3ZGQ A;  1UJJ A;  4CDM A;  5ARF A;  1N54 A;  3ASH A;  3FTW A;  3D9M A;  3CVL A;  5FZR A;  4AIF A;  4F1S A;  4MKT A;  1H2V C;  5D0Q D;  2IJG X;  5ANL A;  3MJW A;  3L54 A;  4ANX A;  2CHX A;  5LCW C;  3EIJ A;  2C2L A;  2XQ0 A;  4J8F A;  2C0M A;  3CST A;  1HU3 A;  4AEZ C;  3BEE A;  3CIA A;  2BUG A;  4GYY A;  3IHY A;  3QC1 A;  1E8Z A;  4DLO A;  3MCX A;  2WXL A;  3ZFW A;  1H19 A;  1Y6I A;  4PS8 A;  2X6I A;  2XRY A;  4DI4 A;  2PM7 A;  4E6H A;  2I1K A;  2I9C A;  4BX8 A;  1H6K A;  1IYG A;  4JVS A;  4RVB A;  5FQ7 A;  1MHQ A;  2LSU A;  5AEN A;  3TG5 A;  2J49 A;  2E2E A;  1HO8 A;  4XI9 A;  2OVF A;  3TXM A;  4APO A;  4TRQ A;  5A23 A;  1ELW A;  4BT8 A;  4AY5 A;  5A6C A;  3I3N A;  1ELR A;  3ENE A;  4YND A;  3CK8 A;  1E8Y A;  4EZL A;  3FHE A;  4ME2 A;  2J09 A;  3AU4 A;  4LCT A;  5FQ8 A;  3FUH A;  4PDX A;  5AJL A;  3CHQ A;  4GZ6 A;  4UQZ A;  2DIW A;  3RU0 A;  4GA0 A;  4WWO A;  3PDN A;  3FH8 A;  5AYW D;  2WXF A;  4O6F A;  4XE0 A;  5KCM A;  2WM9 A;  4HLE A;  5CHE E;  3SHF A;  1HE8 A;  2VGX B;  1NP7 A;  3QJZ A;  4HS2 A;  4WUY A;  5A7D B;  2KZT A;  2LAH A;  3T8M A;  3ULQ A;  5T8I A;  4BWR A;  4G24 A;  2VTB A;  4FP7 A;  1HG2 A;  3N71 A;  3RJV A;  3CVY A;  2MOW A;  4NRH B;  3S7F A;  2IOL A;  2AWI A;  3DPD A;  3CSF A;  3R9A B;  4V3I A;  2WPV A;  2A4Z A;  2XGO A;  4BT9 A;  4RG9 A;  2WXP A;  3PZD A;  4ABN A;  4ILH B;  1EF1 C;  2WXR A;  3PUJ A;  4XI0 A;  5LFA A;  2JLB A;  2XHE A;  2NSZ A;  2VSY A;  2CG3 A;  4L1B A;  2YNQ A;  5D0O D;  3FEY A;  5FT9 A;  3FU6 A;  4GZD A;  3AU5 A;  3URZ A;  4PS7 A;  2WXG A;  1VDY A;  2KCL A;  2DCP A;  4L23 A;  5C2Y A;  3SBS A;  3UX4 A;  2BTD A;  2LAI A;  2YQ8 A;  4HOQ A;  4PS3 A;  3D9P A;  5CMW A;  3E4B A;  5G04 C;  2WXQ A;  5J08 A;  4U63 A;  3EHN A;  5BV1 A;  3PRE A;  3DBS A;  3LKU A;  5FZQ A;  3Q15 A;  4A3T A;  2A5U A;  4JW1 A;  2FO7 A;  3O4Z A;  4UWF A;  1OWL A;  3HDX A;  5C1D A;  3UUX A;  3OTN A;  3LDZ A;  4L7T A;  4JHK A;  2YHE A;  4BTA A;  4HOT A;  4I6J A;  4RG6 A;  2YHC A;  3FTU A;  3OXG A;  3TAX A;  4U07 A;  4UI9 K;  2HM8 A;  1FVH A;  4XX5 A;  3JQ1 A;  4AP2 A;  3PNL B;  5LOZ A;  1Z3Y A;  4BX9 A;  3LVR E;  3ZVV A;  1HFA A;  4XZ4 A;  3U3W A;  3B13 A;  4FHK A;  4EBA G;  4LRZ A;  4A1S A;  1WM5 A;  2L6J A;  2WXO A;  4GZ5 A;  2WXJ A;  2GGF A;  4G2V A;  3CHP A;  4U0U A;  3JCK C;  3QAR A;  5FQ4 A;  3FUN A;  4BFR A;  2WQH A;  2BF0 X;  4I43 A;  3MV3 B;  5JJT A;  4KZ0 A;  5G05 C;  3SD5 A;  3VTY A;  3Q4A B;  4BTB A;  1ZU2 A;  4WWN A;  4ILI A;  3NZS A;  1KT0 A;  3HHM A;  4UI9 J;  4C9B B;  3QWV A;  4OVU A;  3S2A A;  2WXH A;  4N3B A;  3RRU A;  3FH7 A;  5EKQ D;  1FCH A;  3MV2 B;  2KM4 A;  1HX8 A;  4JHJ A;  1EYH A;  2VSN A;  4GA1 A;  3LY9 A;  3Q49 B;  3T5X A;  2GRL A;  2WXN A;  4I2W A;  2WQ6 A;  2XPY A;  2M63 A;  3ZPJ A;  2PQN A;  3PRZ A;  3S7D A;  3S7J A;  1KT1 A;  2X6F A;  3I5P A;  4DI3 A;  4J8E A;  2X3M A;  2KCK A;  1HXI A;  3GYZ A;  4GPK A;  2RG8 A;  4GZC A;  4JZY A;  1NA0 A;  2MHK A;  4U0S A;  5FTP A;  2Q7F A;  4Q94 A;  3AS4 A;  5DIZ A;  4JPS A;  4I9C A;  2AVP A;  2UY1 A;  4PUC A;  1HS6 A;  1JWG A;  3U64 A;  4CDR A;  1P5Q A;  4B8A A;  3MEK A;  1IHG A;  2DBA A;  4EZJ A;  2JEK A;  4DJA A;  1TJF A;  3CK9 A;  3ASG A;  3FP3 A;  1XGW A;  3B7R L;  2ION A;  5BW8 C;  4LUN U;  5ARG A;  3TXN A;  5LCW J;  1MQS A;  2Y3A A;  4CT4 A;  3SFZ A;  3T5V A;  3OXF A;  4WAF A;  2E0I A;  4AJW A;  1FVF A;  4G26 A;  4DK5 A;  3BG1 B;  4FC8 A;  5G55 A;  1HG5 A;  2VSX E;  5FWQ A;  5HI7 A;  3L13 A;  3SNX A;  3G2T A;  3D9O A;  3U4T A;  3VTX A;  2ZU6 B;  3ONL A;  3MYV A;  2AXU A;  1H0A A;  3R7Q A;  3UT7 A;  3KEZ A;  3FU5 A;  2KZT B;  2CHW A;  4JC8 A;  2VTB B;  3FTZ A;  1HH8 A;  4N2Q A;  4GA2 A;  3CEQ A;  2RD0 A;  1PC2 A;  3OXL A;  3Q5M A;  1OWN A;  2IU1 A;  3TL5 A;  1DNP A;  3D9I A;  2OND A;  3D9L A;  5ENN A;  1UG3 A;  4JHR A;  3GW4 A;  4GZ3 A;  3ZYQ A;  4NAC A;  1UW4 B;  3VLE A;  3UQ3 A;  3UMV A;  3VLF A;  3MX3 A;  5KJL A;  3QWP A;  3FUM A;  3CQC B;  3APD A;  2R59 A;  1E8W A;  4L2L A;  4A3V A;  2CFU A;  3ML8 A;  5E75 A;  3LS8 A;  4ACK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...