3MA5A

Crystal structure of the tetratricopeptide repeat domain protein q2s6c5_salrd from salinibacter ruber. northeast structural genomics consortium target srr115c.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
EDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the tetratricopeptide repeat domain protein Q2S6C5_SALRD from Salinibacter ruber.
rcsb
source organism Salinibacter ruber
molecule tags Structural genomics, unknown function
molecule keywords Tetratricopeptide repeat domain protein
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ma5A00
1NZNA 3FWVA 2E2EA 2XGSA 4NQ0A 5BNWA 4HOTA 4CDRA 1HXIA 4A1SA 4G24A 2V5FA 3EDTB 2GW1A 2IF4A 2KCVA 5FJYA 5BW8C 4BTAA 4I17A 4JL0A 3UQ3A 3ZPJA 4APOA 4BT9A 4BWRA 3S7FA 3LYAA 1ZBPA 4U0ZA 4AY6A 4WNFA 1QZ2A 5C1DA 4ME2A 4GA2A 4HORA 2FO7A 2FEZA 1XNFA 3S7BA 2PQNA 3PE3A 3SF4A 2IFUA 4G25A 1PC2A 5EX0A 4CGWA 4WNEA 1QQEA 4YVQC 2YHCA 3CVNA 4O6FA 1WM5A 5DBKA 2LSVA 2XCBA 2VSYA 3AS8A 4HOUA 4WNDA 4BT8A 4HOSA 5BT1A 5FZRA 4UI9K 2FF4A 3QWVA 4N3AA 3S7DA 3S7JA 2BUGA 3TGOA 4B94A 3CVLA 2JLBA 5G04C 3GW4A 2Y4TA 3FP3A 3MV3B 2HR2A 4J8FA 4N3BA 2R5SA 5EKQD 5HI7A 1P5QA 3CK8A 2P58C 4WNGA 5JJ6A 3PDNA 4GA1A 4JA9A 4KXKB 3AS5A 3TG5A 4I2WA 4YVOA 3RU0A 4CGVA 4GYWA 3QDNA 1B89A 4AY5A 3R9AB 5CHEE 4KYOB 4GPKA 4GZ3A 2I6HA 4GA0A 4N39A 3AS4A 2UWJG 4U0UA 3ZN3A 2LSUA 3K9IA 2AVPA 3TAXA 3ASFA 3MV2B 4ABNA 2MHKA 2C0LA 2KATA 4GYYA 1ELWA 4WUYA 3GYZA 3CVQA 2VGXB 4XI0A 1NA3A 2PZIA 3OXFA 4I1AA 5A7DB 5KJMA 2C2LA 1FCHA 4N5CA 5ARFA 2PQRA 5DIZA 5ARGA 5FZQA 4G23A 5FZSA 4JHRA 5D0OD 5LCWC 4RG6A 1ZU2A 2XPIA 3OXGA 5G04J 1OUVA 3LPZA 4H7XA 4J0UA 3VTXA 3ASHA 3OXLA 5KJKA 4U07A 3KAEA 4UI9J 2Q7FA 4I9EA 1NA0A 5FT9A 2KCKA 4I9CA 4U04A 2XCCA 4H7YA 2VQ2A 4IN3B 3UPVA 1A17A 3GZ1A 4HOQA 2OOEA 3ZFWA 2HO1A 4GZ5A 4NRHB 1Y8MA 5EX3A 5JJTA 4GYOA 1KT0A 4UQXA 2YQ8A 2C0MA 1HZ4A 2J9QA 5G05J 3RO3A 3IEGA 3U3WA 4N2SA 1IHGA 3UUXA 3Q49B 3MA5A 3LY8A 1TJCA 5JJ7A 3LKUA 3ASGA 2UY1A 3GZ2A 1KLXA 3BEEA 3Q5MA 4G1TA 4GCNA 2XGOA 3RIBA 3WXXA 1IYGA 5HQ8A 3CKBA 3FFLA 3JYSA 3ZHEB 3RJVA 4F3VA 2FI7A 2WQHA 2LNIA 3Q4AB 3HYMB 3KS2A 5A6CA 3QKYA 3QWPA 2ONDA 4XI9A 1W3BA 2L6JA 3O48A 3Q47B 5D0QD 3CEQA 3Q15A 2XEVA 3LY9A 5G05C 1HH8A 2WPVA 5KJLA 4AIFA 5CCMA 5KJNA 3RKVA 4J8EA 3ESKA 4G2VA 2NC9A 3U4TA 5LCWJ 1WAO1 2VGYA 3MKRA 4I2ZA 3NF1A 4N3CA 3CK7A 3TG4A 3ULQA 3URZA 2KC7A 2KCLA 3RO2A 3VTYA 4G26A 3ZHEA 2QFCA 2PL2A 3KD7A 3ASDA 3MEKA 4UI9C 4JA7A 3SZ7A 4AM9A 3LCAA 4UQZA 3CKCA 4GZ6A 4J8DA 3CVPA 2UY1B 1YA0A 1ELRA 3ZGQA 3N71A 2VYIA 5CCLA 5M72A 4KBQA 4U0SA 5FTPA 3QWWA 4Y6WA 3CK9A 2VGXA 2XGMA 3CV0A 4RG9A 2VSNA 4LEUA 2Y4UA 3E4BA 4UQYA 2HYZA 4Y6CA 5AYWD 3QOUA 4YNDA 3LY7A 4XIFA 4EQFA 4N2QA 4W9RA 2FBNA 4BTBA 3PE4A 1KT1A 2DBAA 4GCOA 1E96B
chains in the Genus database with same CATH superfamily
2EIME 3L6AA 4E85A 1NL4A 4DK5A 4RSYA 1BD8A 2FF4A 4N3AA 2JLBA 2CHWA 1E8XA 3FDHA 2A5EA 4KYOB 3FU3A 2F8XK 2ILRA 2MRIA 1FCHA 1N0RA 4K5CA 4F1PA 4MS6A 3SQVA 2WXHA 3BUAA 3OXGA 5ENPD 5BXOA 3IHYA 1LD8A 5AENA 3SFYA 3L16A 4QQIA 2I1JA 3ZXSA 3FU0A 4TUUA 4WWNA 2OVBA 5EIDA 3IHVA 1MX6A 1INZA 3AG4E 2VTBB 4CEMA 3MKRA 3T9KA 2OVFA 4GZ6A 3PEUB 3QWWA 3CK9A 4I6JA 2Y4UA 4UQYA 4Y6CA 2X6KA 3Q79A 1DNPA 2A4ZA 1LF8A 2XEEA 4O1PA 2BKGA 1NZNA 3FWVA 4HOTA 2IEJA 5T3RA 2V5FA 5CMWA 3ONLA 1L5JA 1TN6A 2PQNA 5FQ8A 2FO1E 2LAIA 3FY4A 5AQ9A 3AS8A 3CIAA 3TWUA 3QWVA 3GW4A 2V4HC 4J8FA 4K0RA 4WNGA 3OAWA 2QYUA 4GTVA 4AY5A 3D9LA 4LNUD 2EIJE 4O60A 5ARFA 3APFA 1MX4A 2VGEA 4RG6A 4U95D 2XPIA 1HG5A 3JQ0A 3ASHA 4L2YA 1RZ4A 1NA0A 4GZDA 2VQ2A 2EQXA 4ZFHA 3ASNE 3RRMB 2C0MA 3AG1E 1WG0A 3CHOA 3B7TA 1H19A 3AG2E 3BEEA 1JWFA 4DX7D 3VLDA 4BSXA 3Q4AB 3QKYA 4WAFA 2WMOA 4U63A 5BUZA 4J6IA 4OAVB 3VTYA 4G26A 4FC8A 4AM9A 4GTOA 2P9KG 3UT8A 4GU5A 4GMRA 4KVOA 5AARA 4G11A 3LXUX 4B93B 3IKOB 4XZ4A 3PUKA 2PM7A 2J07A 4FLHA 3MKQB 2GGFA 5ENRD 4HI8A 4CGWA 1QQEA 3B95A 2WXQA 2BEDA 4A55A 2VSYA 3SD5A 3MJWA 4MRUA 5CCLA 1FPPA 4UUCA 2CHZA 2IOSA 5FWQA 4N39A 4U0UA 3KEZA 2P9IG 3Q9UC 1V55E 5ARGA 5H7PA 4JHRA 4PH4B 3HRAA 4PS8A 4I9EA 4I9CA 2R59A 2XCCA 2H6GA 4XKBA 5ENTD 1D9SA 4IULA 1N4SA 3NOCD 2UY1A 1KLXA 5AIJA 3D9KA 1SZ9A 5AJDA 3UINC 2XEVA 2AXUA 3C3QA 2X3MA 3JCKC 4HXIA 4FLBA 2IO2C 3UM3A 3DSXA 4AOFA 1U2VG 3FTSA 3Q7FA 4JZYA 5JHAA 4R7LA 1HU3A 2WM9A 5HKPA 4A1SA 4GTSA 4TXPA 5LP0A 2P9SG 3CLJA 2GW1A 4BTAA 5BV0A 3ULYA 3J5QB 3ULEG 4I6GA 1KZPA 2YHCA 4GTPA 1IXVA 4B94A 3IBEA 2F37A 4TXRA 5FQ4A 1TJFA 3RU0A 4GYWA 3PNTB 1QBQA 4WWPA 1YMPA 5CERB 1NA3A 4I1AA 2QZAA 1TNUA 2PQRA 2OEWA 2M63A 3APDA 2XS1A 3NZUA 2WXPA 1V54E 4GMLA 1N9AA 3OTNA 3UKUG 3ASOE 4YDYA 4MBGA 1X81A 5CMYA 1MHQA 1JCSA 5EILA 1N52A 4JVSA 1XGWA 4ATZD 2IY0C 5HQ8A 2J49A 3IV0A 3TL5A 3LY9A 4B89A 2WPVA 3PNLB 1TR4A 1Z5SC 4HQDA 3HXFA 2RG8A 4N3CA 1H6OA 4DLQA 4DRXE 3ASDA 4JA7A 4G8KA 4UQZA 1Y6IA 3ZGQA 3LS8A 5AQAA 3FUKA 2OCCE 2XHEA 1E8WA 4GTQA 1AWCB 2X6JA 2ZGGA 3V31A 3ZW3A 3CSTA 2VJ8A 3SBTB 2FEZA 3AU5A 3ZYLA 1Z6TA 1ELKA 1S63A 1AP7A 4O6FA 1WM5A 3LJ3A 5CEAA 4OYSA 4C0EA 5G04C 5J08A 1PAQA 4XX5A 2WXFA 4TRQA 4JA9A 3BU8A 3AS5A 3Q75A 3TWRA 5LFAA 3NBNB 3NZSA 1OT8A 2AXZA 4K03A 1EF1C 1H6PA 4KT6B 3CVQA 2VGXB 4JXTA 5A7DB 2MYOA 4HRMB 4RLYA 2R05A 1D8DA 4BSZB 3FUJA 4F7AA 4GYOA 4I6EA 4PS3A 2J9QA 3KSQA 4F1SA 2Y1LE 4L7TA 2CG3A 5CBNA 5KBAA 3EHMA 2LNIA 1O1RA 4ILGA 3EU5A 3G2VA 4TXQA 3RKVA 2DVWA 3VLEA 4HORA 3URZA 2PL2A 1EYHA 4EZKA 4FA6A 3Q9NC 3AAAC 3DBSA 5M72A 4KBQA 3FH5A 3B7RL 4LEUA 3FUFA 3UMVA 4DUIA 2HM8A 4U8HA 4EQFA 1YYHA 2AW6A 2KXPC 4BTBA 3PE4A 1BI8B 5FJYA 2KCVA 2WB2A 4MLPA 2RD0A 2MOWA 2ZISA 4RVBA 3Q78A 3UIPC 4ZHBA 3DPDA 3UX4A 4ACLA 1E7VA 5AQ7A 3RK6A 3ZNGA 2LXLA 4GYYA 5CBOA 4I1OB 3MZLB 2XS8A 3AU4A 3CSFA 3EU9A 1JUQA 1HE8A 2H6FA 5FT9A 5IY5E 3ONKA 1UJJA 3GZ1A 3PZ3A 4GZ5A 1IQUA 3P1UA 4L9PA 3T8KA 4K5BA 4JW1A 3UUXA 3R7RA 3FU6A 2I1KA 1Z3YA 5LX8A 2WXJA 3RIBA 3V30A 4F3VA 3CVWA 2HE0A 4XEIG 2ONDA 3QAQA 1W3BA 5D0QD 4HNAD 3FULA 4GTRA 3MCXA 2NSZA 1OWMA 3NF1A 3EIJA 3KD7A 4CT4A 3V2OA 4UWKA 2V0PA 3R9MA 4RG9A 3AJIA 2VSNA 3E4BA 5LOZA 2P9LG 3LEWA 2LXMA 4LRZA 1FVHA 4W9RA 3F6QA 3C72A 1K1AA 4GCOA 2E2EA 4KMOA 4M3OA 1D8EA 3R7QA 3RRNB 2P2CP 4JPSA 3UKRG 3PRZA 3L13A 3QK0A 2F8YA 2ETBA 3EHNA 5B1BE 1NI1A 3FUMA 5FZRA 3ABME 3U64A 2JEKA 2I9CA 2Y4TA 4N3BA 2R5SA 1P5QA 5JMND 2KM4A 4O1OA 4TV3A 1JPLA 4CCAA 3ASFA 3JQ1A 3DSVA 4U96D 1FVFA 4U8VD 3TWQA 1MQSA 4NURA 4LUNU 3DPYA 3EUVA 5G04J 1OCOE 2R17C 2RFMA 2RFAA 3OXLA 4D10C 4U07A 2FULA 3ZFWA 1HZ4A 3IEGA 1IHGA 3LY8A 2LUHA 4FJZA 3CKBA 2FI7A 2WQHA 3RAUA 4HB5A 3DXMG 2QYJA 3MYVA 1NFIE 5FQ6A 1Z3XA 4GMJA 4GB9A 3ZXPA 3TWSA 2KCLA 3I4RB 2WXLA 3LDZA 1LTXA 1U3CA 2WXGA 1HFAA 2YINA 5FTPA 5EDSA 4A63B 1TNBA 1WY6A 5HS0A 1ZB1A 3LY7A 4TUMA 1SW6A 4XIFA 1TYQG 4KZCA 3JUIA 2XEHA 1E96B 5E75A 3UT7A 2XGSA 5FIOA 1VDYA 4XKCA 2EINE 2L6BA 5C1DA 4PUCA 3SF4A 2ETAA 1FT2A 3CVNA 2P9NG 4JHJA 4LNGA 3FUIA 3CK8A 4DI3A 3TG5A 4CGVA 1N95A 5CHEE 2ZIRA 2J8SD 3E33A 2C0LA 3UT4A 4XI0A 3CVXA 3OXFA 3HVEA 2ZXWE 4G23A 3SFXA 1X5BA 3EHQA 5ENOD 2Q7FA 4EZLA 5A23A 4UQXA 4EHMA 3NAWA 4DX1A 5KWDA 5JA4D 3I4GA 4URKA 2R2LA 2GRNB 1N94A 3ZHEB 1N54A 3X2QE 2V5QC 2LO6A 3Q15A 5G05C 4J8EA 4KZ0A 2E0IA 3SGHA 3U4TA 4QFVA 4HI9A 3ML9A 5ANLA 4RQIA 3ZYKA 4J8DA 3UTMA 4OAUC 1YA0A 2KZTA 3DXKG 4UWLA 3T5XA 1DCEA 5EYLA 5CECB 3APCA 4NQ0A 5BNWA 2CG2A 3QNKA 1O1TA 1OWOA 2A5UA 3ABLE 3FUEA 3ZU7B 5BW8C 4LNBA 4C9BB 4I17A 3TJPA 1UG3A 1A5EA 4GTMA 3C3OA 4HLEA 2BF0X 4BT8A 3S7DA 4YDEA 1O1SA 3L22A 3E37A 4CYMD 1YCSB 3QDNA 4B8AA 2I6HA 3MKQA 3BG0B 2X6FA 2KATA 1NP7A 5CRVA 5T4YA 4CDMA 3I3NA 5LCWC 4ILHB 4JHKA 2X6HA 2IQCA 1JCQA 3C5RA 2YQ8A 4L23A 3PEVB 2PM6A 2H6HA 4HLLA 3ENEA 2NXPA 3TWVA 3HYMB 3Q47B 2P9PG 4OVUA 3DSSA 3FHEA 3EIQC 5T8IA 4ACKA 3FUNA 1K3ZD 1H0AA 3CKCA 1H6KA 2UY1B 3TWXA 2VYIA 4J7WA 4UWGA 3FU5A 2L0TB 4KVMA 1GW6A 2HYZA 1LD7A 3G2TA 3JXIA 3B7BA 3BG1B 4BT9A 4N2SA 3ZPJA 1N11A 1KZOA 4GZCA 4HFGA 3QARA 3D9OA 1H2VC 4HOSA 4HOUA 3CHMA 2GRPB 3FTYA 5EN5D 1DCQA 2P58C 3LVRE 1WDYA 1H2UA 2AVPA 3TAXA 1SVXA 2LAHA 3GYZA 4B8CB 4HS2A 3DEPA 2VSXE 2C2LA 3VLFA 4J8YA 5B3SE 5JHBA 1IQRA 3VTXA 3FH8A 2EIKE 1HO8A 1SA5A 5ENQD 3UPVA 2IONA 1OWPA 3PZ1A 3S2AA 3W9FA 3LKUA 4DX5D 1IYGA 2IO3C 1N4QA 3FUHA 3BQOA 2J4BA 5AN8A 4LCTA 4HBDA 4AIFA 2IOLA 4BEPA 3SO8A 3ULQA 3SZ7A 2EILE 1ELRA 3DWLG 2AWIA 2Y0BG 2WMNA 5KNHD 2WXKA 4AXHA 1HXIA 4G24A 5EIBE 3D9NA 1ZBPA 4AY6A 1MZCA 1RW2A 3S7BA 4HVBA 1E8ZA 3W9GA 2CHXA 4Q96A 2B6CA 5BT1A 5AAOA 3MV3B 4OVVA 3R9AB 2DIWA 5J90A 3MV2B 4UWHA 5KJMA 2ETCA 3FTXA 3MX3A 2IU1A 5DIZA 5KJKA 3PUJA 3CHPA 5FINA 2GRLA 5JJTA 2BTDA 3SFZA 1BPOA 3U3WA 4YDWA 4AEZC 3Q5MA 3G2SA 4GCNA 2OV8A 1OCCE 2XGOA 5HRYA 3CHSA 3FFLA 3JYSA 3ZKJA 2DYSE 1E90A 1E7UA 3L08A 2X38A 5CCMA 5KJNA 5BV1A 2IJGX 4BERA 4AP2A 4G2VA 3C3RA 3TG4A 3HHMA 4C48B 2X6IA 1JWGA 2OEVA 3CHRA 4X8QA 4JC8A 3CV0A 5AYWD 3ZYMA 3QOUA 4FHJA 2FBNA 4U7EB 2DBAA 4LERA 3CVVA 3ISMC 1KPSB 3EDTB 3CQCB 4BWRA 2AJAA 3D9JA 3DRAA 3HXCA 1DC2A 1MYOA 2FO7A 2IFUA 4EECA 4NIKA 1MJ0A 3UXGA 2LSVA 4K5AB 4UWFA 2L0IA 4DI4A 4CDNA 3CVLA 5C2YA 3FP3A 2HR2A 1QNFA 2YHEA 1OCZE 3PDNA 5JJ6A 2DZOA 1PY1A 5ANRA 5KCMA 4GA0A 3PREA 2R03A 5D66A 4PS7A 5FQ7A 3T8MA 2XPYA 4N5QA 3TXMA 3EHRA 2B0OE 4GAAA 5FZSA 3LPZA 2JABA 3KAEA 4NRHB 4FP7A 1TNOA 3C98A 1TJCA 4MKTA 4Z68A 4HRLA 3PZDA 3L9TA 2DYRE 1IKND 4A1GA 1HH8A 3WG7E 4V3IA 5LCWJ 2YNQA 1UW4B 3RO2A 2V8SE 2P9UG 4GPMA 3FTZA 2VGXA 2XGMA 3KSLA 1DVPA 3T5VA 4BX9A 4YNDA 3DSUA 2XRYA 1E8YA 4M7CA 4ANWA 3UM0A 2WQ7A 4CDRA 2H6IA 4FULA 4JD2G 4JL0A 3S7FA 4U0ZA 3SBSA 4LSZE 4ME2A 4DLOA 2WXRA 4G25A 1N4RA 3KEAA 3DSWA 4YVQC 5DBKA 4WNDA 3ZUVB 2Y3AA 4I1MA 4CRWA 4YDOA 4IYPA 3RSEG 5ENSD 3FEXA 3HVEB 3QC1A 4GA1A 3HDXA 2XQ0A 4GPKA 3AS4A 2XENA 4ABNA 5E76A 3ZRHA 1HX8A 4N5CA 2KBXA 2Y69E 1ZU2A 1G3NB 3L54A 3PH0C 5G55A 4BFRA 4BY6A 4U04A 4H7YA 3Q73A 1Y8MA 5EX3A 4BESA 4J8SA 3IXEA 2QY7A 4PDXA 2QC9A 4G1TA 3WXXA 3ML8A 1S64A 4BETA 1BU9A 3NQPA 4L2LA 3D9MA 1S0PA 3HIZA 4ATGA 2NC9A 1WAO1 2KC7A 5ENNA 3ZIMA 1TNYA 4JB8P 3CGHA 3EJNA 3ZVVA 3B13A 3U66A 1BLXB 2WXOA 1KT1A 4F53A 2WXIA 1SZAA 2CFUA 2J4DA 3D9IA 1EPUA 3UQ3A 3LYAA 2I2OA 1XNFA 1PC2A 3MGBA 3UM1A 3E30A 1UOHA 4JEUA 2WXMA 1TN7A 5HI7A 2ZU6B 1UJKA 4P29A 1N0QA 3G2UA 4A3TA 2UWJG 5CEDB 4WUYA 3B7SA 2PZIA 4G8LA 1MX2A 3ABKE 4H7XA 3FTWA 2KZTB 2L9BA 3FH7A 3GZSA 1U3DA 2OOEA 1UN9A 5B1AE 1KT0A 3TWTA 3I5PA 4FHKA 3FTVA 1O5MA 3ASGA 5G2NA 4BX8A 4I43A 4XI9A 5BPPA 1N4PA 3PZ2A 5KJLA 4I2ZA 5BXUA 3CK7A 1TEZA 5EYPF 3LCAA 1HG2A 3CQGB 2WXNA 3CVPA 3ESLA 3N71A 4U0SA 3QJZA 4ILIA 4FADA 3Q7AA 3JUEA 2BKKB 3SNXA 3LVQE 4Y6WA 3DEOA 4WNFA 4C0MA 1QZ2A 3UM2A 4GA2A 1K8KG 3PE3A 3V79K 4AVXA 5EX0A 4WNEA 1TN8A 4GTTA 4UI9K 2VSOE 3S7JA 2BUGA 3HXEA 4WWOA 2PNNA 4KXKB 3G2WA 4IRUA 4I2WA 3FTUA 3PZ4A 3LJNA 1UN8A 1Q2ZA 2CFZA 2LSUA 3K9IA 2MHKA 4ANUA 4DJAA 3P2BA 5AQBA 2V4LA 5KNGA 3D9HA 5D0OD 1HS6A 4L1BA 3L82A 4EPZA 1EDUA 1OY3D 4Q94A 1H2TC 2HO1A 1HF8A 3RO3A 4EZJA 5ITZF 2ZGDA 3ZEFA 3B7UX 3GZ2A 3RRUA 2R02A 4EBAG 3UIOC 5D2MC 1OWLA 1TNZA 4APFA 3ZYQA 2NYJA 3PS6A 3ESKA 4DX6D 3FUDA 2VGYA 3JXJA 2DWZA 1QYMA 5CRUA 3ZHEA 4U8YD 2QFCA 3MEKA 3UI2A 1IHBA 3FEYA 2GRQB 3TWWA 2XRZA 3E34A 3V2XA 1SA4A 1K1BA 5FZQA 2XPZA 3HXDA 3D3MA 1FT1A 2GROB 3QB2A 4AJWA 2IF4A 4APOA 3NOGD 4DPRA 3CR3A 2AXVA 3CHQA 2XCBA 3AG3E 4HRNA 3J5PA 4B0ZA 3CVYA 4FU3A 5EKQD 3TGOA 2F0YA 4YVOA 3SY2A 1B89A 3U9WA 3HXBA 2XZDG 4GZ3A 2RKKA 3ZN3A 3SHFA 1OCRE 2WVIA 3DSTA 1ELWA 3SI5A 3O4ZA 4AV7A 3PVLA 1JCRA 3E32A 3HG0D 4Q69A 3L17A 1OUVA 4J0UA 4UI9J 2KCKA 2GRMA 5AJLA 4IN3B 1A17A 4HOQA 4NACA 4XE0A 5G05J 2VTBA 4CZ2D 3Q49B 3MA5A 1S70B 1BI7B 4FJYA 5JJ7A 4CT0A 4JEHA 4A3VA 3RJVA 5A6CA 3KS2A 4F6RD 3QWPA 2J09A 2L6JA 3O48A 3CEQA 4EBAA 3D9PA 4ANXA 3CVUA 1OWNA 3NB2A 2J08A 2XZTG 4ANVA 3TXNA 4UI9C 4DX2A 4E6HA 4LG6A 2DCPA 2GRRB 2DZNA 1OXJA 2WQ6A 1SQMA 4N2QA
chains in the Genus database with same CATH topology
2WQ7A 4NQ0A 5BNWA 3L6AA 4E85A 2CG2A 4CDRA 3QNKA 1OWOA 2A5UA 2X6JA 3FUEA 5BW8C 3ZW3A 4C9BB 3CSTA 4FULA 2VJ8A 4I17A 4JL0A 3TJPA 4DK5A 1UG3A 4U0ZA 3S7FA 3SBSA 4ME2A 4RSYA 3SBTB 4DLOA 5KJNA 2FEZA 3AU5A 2WXRA 3ZYLA 1Z6TA 4G25A 1ELKA 4YVQC 4O6FA 1WM5A 5DBKA 3LJ3A 4HLEA 4WNDA 2BF0X 4BT8A 2Y3AA 4OYSA 4I1MA 2FF4A 4CRWA 4N3AA 3S7DA 4C0EA 3L22A 4IYPA 2JLBA 5G04C 5J08A 1PAQA 4XX5A 2WXFA 3FEXA 3HVEB 2CHWA 3QC1A 4TRQA 1E8XA 4GA1A 4JA9A 3HDXA 3FDHA 3AS5A 5LFAA 3QDNA 3NZSA 2XQ0A 4B8AA 4KYOB 4GPKA 3FU3A 2I6HA 2AXZA 3AS4A 3MKQA 3BG0B 4K03A 4ABNA 1EF1C 5E76A 4KT6B 2X6FA 2KATA 1NP7A 2ILRA 3ZRHA 3CVQA 2VGXB 4JXTA 5T4YA 5A7DB 4CDMA 1HX8A 2MRIA 1FCHA 4N5CA 3I3NA 5LCWC 4ILHB 4MS6A 1ZU2A 4JHKA 2WXHA 3L54A 3OXGA 3PH0C 3IHYA 5G55A 4BFRA 2X6HA 4BY6A 3FUJA 4F7AA 2IQCA 4U04A 5AENA 4H7YA 5JJ7A 3L16A 1Y8MA 5EX3A 4GYOA 4I6EA 4J8SA 4PS3A 2I1JA 2J9QA 2YQ8A 2QY7A 4PDXA 4L23A 3PEVB 2PM6A 4F1SA 3ZXSA 3FU0A 4TUUA 4L7TA 2CG3A 4G1TA 4WWNA 2OVBA 3WXXA 3ENEA 2NXPA 3EHMA 2LNIA 3ML8A 3HYMB 4ILGA 3G2VA 3IHVA 1INZA 3Q47B 3NQPA 4L2LA 2VTBB 3D9MA 1S0PA 4CEMA 3RKVA 3HIZA 4ATGA 2NC9A 3VLEA 1WAO1 3MKRA 4HORA 4OVUA 3URZA 2KC7A 5ENNA 2PL2A 3FHEA 3EIQC 1EYHA 5T8IA 4EZKA 4FA6A 4ACKA 3FUNA 3ZIMA 1H0AA 3CKCA 1H6KA 2OVFA 4GZ6A 3DBSA 2UY1B 3CGHA 2VYIA 3PEUB 5M72A 4KBQA 3FH5A 3QWWA 3EJNA 3CK9A 4UWGA 3B7RL 3FU5A 4I6JA 2L0TB 2Y4UA 3FUFA 1GW6A 4LEUA 4KVMA 3B13A 4UQYA 2HYZA 4Y6CA 3ZVVA 3U66A 2X6KA 3UMVA 2HM8A 2WXOA 1DNPA 4U8HA 4EQFA 2A4ZA 2AW6A 1LF8A 4BTBA 3PE4A 1KT1A 1NZNA 4F53A 2WXIA 1SZAA 3FWVA 3G2TA 4HOTA 2CFUA 2J4DA 3D9IA 5T3RA 2V5FA 5CMWA 3ONLA 5FJYA 3BG1B 2KCVA 1EPUA 4BT9A 4N2SA 3UQ3A 3ZPJA 2WB2A 3LYAA 4MLPA 1L5JA 2RD0A 2I2OA 4GZCA 1XNFA 2PQNA 4HFGA 5FQ8A 3QARA 3D9OA 1PC2A 2MOWA 3MGBA 2LAIA 1H2VC 4RVBA 3FY4A 4HOSA 3AS8A 3CIAA 4HOUA 4JEUA 3CHMA 2WXMA 3QWVA 3GW4A 3FTYA 4J8FA 3DPDA 4K0RA 5HI7A 2P58C 4WNGA 2ZU6B 3UX4A 3OAWA 1UJKA 3LVRE 4P29A 4ACLA 4AY5A 1E7VA 3D9LA 3G2UA 4A3TA 2UWJG 3RK6A 1H2UA 2AVPA 3TAXA 4GYYA 2LAHA 4WUYA 3GYZA 4I1OB 4B8CB 3B7SA 3MZLB 2PZIA 4HS2A 2VSXE 2C2LA 3VLFA 5ARFA 3AU4A 5JHBA 3APFA 1IQRA 4RG6A 2XPIA 1HG5A 3CSFA 3JQ0A 4H7XA 3FH8A 3VTXA 3ASHA 4L2YA 3FTWA 1JUQA 1HE8A 1NA0A 2KZTB 2L9BA 4GZDA 5FT9A 3FH7A 3GZSA 2VQ2A 1HO8A 1U3DA 1UJJA 2EQXA 1OWPA 2IONA 1UN9A 2OOEA 3GZ1A 4GZ5A 1IQUA 3P1UA 3RRMB 3S2AA 1KT0A 2C0MA 3I5PA 4FHKA 4JW1A 3UUXA 3R7RA 3CHOA 3FTVA 3FU6A 2I1KA 3LKUA 1Z3YA 3B7TA 3ASGA 1H19A 5LX8A 3BEEA 2WXJA 5G2NA 3RIBA 1JWFA 1IYGA 4BX8A 3VLDA 4F3VA 3CVWA 4BSXA 3Q4AB 3QKYA 4I43A 2ONDA 3FUHA 3QAQA 4XI9A 1W3BA 5D0QD 4WAFA 2J4BA 2WMOA 4U63A 4LCTA 3FULA 5BPPA 3ONKA 5BUZA 5KJLA 4AIFA 4J6IA 3MCXA 2IOLA 2NSZA 4I2ZA 1OWMA 3NF1A 3ULQA 3CK7A 3EIJA 3VTYA 1TEZA 4G26A 4FC8A 3KD7A 4AM9A 4CT4A 3SZ7A 3LCAA 1HG2A 3CQGB 3UT8A 2WXNA 3CVPA 1ELRA 3ESLA 4UWKA 3N71A 2V0PA 4GU5A 4U0SA 3QJZA 4RG9A 4ILIA 2AWIA 2VSNA 4FADA 3E4BA 4KVOA 5LOZA 3SNXA 2WMNA 3LEWA 3LVQE 4LRZA 1FVHA 4W9RA 4G11A 2WXKA 3LXUX 4Y6WA 4GCOA 4AXHA 2E2EA 4KMOA 3IKOB 4M3OA 4XZ4A 1HXIA 4G24A 3R7QA 3RRNB 4JPSA 3D9NA 3PUKA 2PM7A 2J07A 4FLHA 1ZBPA 4AY6A 4WNFA 4C0MA 1QZ2A 3MKQB 3PRZA 4GA2A 3S7BA 2GGFA 3L13A 3PE3A 3QK0A 4AVXA 4HVBA 1E8ZA 2CHXA 5EX0A 4CGWA 4Q96A 4WNEA 1QQEA 2WXQA 3EHNA 4A55A 2VSYA 3SD5A 3FUMA 5BT1A 5FZRA 4UI9K 2VSOE 3S7JA 2BUGA 2JEKA 3U64A 3MJWA 2I9CA 4MRUA 2Y4TA 3MV3B 4N3BA 2R5SA 4WWOA 1P5QA 5CCLA 2KM4A 4KXKB 3G2WA 2CHZA 4IRUA 4I2WA 2IOSA 3FTUA 4OVVA 1UN8A 4TV3A 5FWQA 3R9AB 2CFZA 4N39A 2DIWA 4U0UA 1JPLA 2LSUA 3K9IA 3KEZA 4CCAA 5J90A 3ASFA 3JQ1A 3MV2B 2MHKA 4ANUA 1FVFA 4UWHA 4DJAA 5KJMA 1MQSA 3P2BA 3FTXA 3MX3A 2IU1A 2V4LA 4LUNU 4NURA 5DIZA 5ARGA 4JHRA 5D0OD 4PH4B 1HS6A 4L1BA 5G04J 4PS8A 5KJKA 2R17C 3OXLA 4D10C 3PUJA 3CHPA 1EDUA 4U07A 4EPZA 4I9EA 2GRLA 4I9CA 2R59A 2XCCA 2FULA 4XKBA 3ZFWA 4Q94A 1H2TC 2HO1A 5JJTA 2BTDA 1HF8A 4IULA 3SFZA 3RO3A 1HZ4A 1BPOA 3U3WA 3IEGA 1IHGA 4EZJA 3ZEFA 3LY8A 4AEZC 3B7UX 2UY1A 3GZ2A 1KLXA 3Q5MA 3G2SA 4GCNA 2OV8A 2XGOA 4FJZA 3CHSA 3RRUA 5AIJA 3CKBA 3FFLA 3JYSA 2FI7A 2WQHA 4EBAG 1E90A 3D9KA 1OWLA 1SZ9A 1E7UA 4APFA 5AJDA 2XEVA 3MYVA 3L08A 3ZYQA 2X38A 5FQ6A 1Z3XA 2IJGX 3PS6A 4GMJA 5BV1A 3ESKA 2AXUA 4AP2A 5CCMA 4G2VA 3FUDA 2X3MA 4GB9A 3TG4A 2VGYA 2KCLA 3ZHEA 2QFCA 3MEKA 3I4RB 3HHMA 2WXLA 2X6IA 3LDZA 1U3CA 2WXGA 3FEYA 3JCKC 1JWGA 4HXIA 4FLBA 1HFAA 3CHRA 2YINA 4JC8A 5FTPA 5EDSA 4AOFA 3CV0A 3FTSA 2XRZA 5AYWD 3ZYMA 4JZYA 1WY6A 5JHAA 3QOUA 3LY7A 4R7LA 4XIFA 4FHJA 2FBNA 4KZCA 1HU3A 2WM9A 3JUIA 2DBAA 5FZQA 1E96B 4LERA 5E75A 3UT7A 3CVVA 2XPZA 2XGSA 3D3MA 3QB2A 4A1SA 1VDYA 4AJWA 5LP0A 3CLJA 3EDTB 2GW1A 2IF4A 4XKCA 4BTAA 3CQCB 4BWRA 5BV0A 4APOA 3D9JA 5C1DA 4PUCA 2FO7A 3SF4A 4DPRA 3CR3A 2IFUA 2AXVA 4EECA 3CHQA 4I6GA 2YHCA 3CVNA 2LSVA 2XCBA 4JHJA 4UWFA 2L0IA 4B94A 3FUIA 3CVLA 5C2YA 4B0ZA 4FU3A 3IBEA 4CDNA 4DI4A 3CVYA 3FP3A 5FQ4A 2HR2A 1TJFA 5EKQD 3TGOA 3CK8A 1QNFA 2YHEA 3PDNA 5JJ6A 3TG5A 4DI3A 4YVOA 3RU0A 4CGVA 4GYWA 1PY1A 5ANRA 5KCMA 1B89A 3U9WA 3PNTB 5CHEE 4GZ3A 4GA0A 3PREA 3ZN3A 4WWPA 3SHFA 2WVIA 4PS7A 2C0LA 5FQ7A 3T8MA 3UT4A 1ELWA 3SI5A 3O4ZA 4AV7A 2XPYA 3UPVA 4XI0A 1NA3A 3CVXA 3OXFA 4I1AA 3TXMA 3PVLA 3HVEA 4GAAA 2PQRA 4G23A 2M63A 3APDA 5FZSA 1X5BA 3NZUA 2WXPA 3L17A 1OUVA 3LPZA 4Q69A 4J0UA 4UI9J 3KAEA 4GMLA 2Q7FA 3OTNA 2GRMA 2KCKA 5AJLA 4IN3B 1A17A 4HOQA 4NACA 4XE0A 4NRHB 4FP7A 4EZLA 5CMYA 5A23A 4UQXA 1MHQA 5G05J 2VTBA 3Q49B 3MA5A 3C98A 4FJYA 3I4GA 1TJCA 1N52A 4URKA 4JVSA 4CT0A 1XGWA 4JEHA 4MKTA 4A3VA 5HQ8A 3ZHEB 3RJVA 3PZDA 1N54A 5A6CA 2J49A 3KS2A 3QWPA 2J09A 2L6JA 3O48A 2LO6A 3CEQA 3IV0A 3Q15A 4EBAA 3TL5A 3D9PA 3LY9A 5G05C 1HH8A 4A1GA 4B89A 2WPVA 4ANXA 3PNLB 3CVUA 1OWNA 4J8EA 4KZ0A 2E0IA 4V3IA 2J08A 3SGHA 4QFVA 3U4TA 2RG8A 2YNQA 5LCWJ 4N3CA 3ML9A 1UW4B 3RO2A 4ANVA 2V8SE 3TXNA 4UI9C 5ANLA 4DLQA 3ASDA 4JA7A 3ZYKA 4UQZA 4E6HA 4J8DA 1Y6IA 1YA0A 3ZGQA 2KZTA 4UWLA 3T5XA 2DCPA 3FTZA 3LS8A 2VGXA 2XGMA 1DVPA 3T5VA 3FUKA 4BX9A 4YNDA 2XRYA 2XHEA 2WQ6A 1SQMA 3APCA 1E8WA 1E8YA 4ANWA 4N2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZN A;  3FWV A;  2E2E A;  2XGS A;  4NQ0 A;  5BNW A;  4HOT A;  4CDR A;  1HXI A;  4A1S A;  4G24 A;  2V5F A;  3EDT B;  2GW1 A;  2IF4 A;  2KCV A;  5FJY A;  5BW8 C;  4BTA A;  4I17 A;  4JL0 A;  3UQ3 A;  3ZPJ A;  4APO A;  4BT9 A;  4BWR A;  3S7F A;  3LYA A;  1ZBP A;  4U0Z A;  4AY6 A;  4WNF A;  1QZ2 A;  5C1D A;  4ME2 A;  4GA2 A;  4HOR A;  2FO7 A;  2FEZ A;  1XNF A;  3S7B A;  2PQN A;  3PE3 A;  3SF4 A;  2IFU A;  4G25 A;  1PC2 A;  5EX0 A;  4CGW A;  4WNE A;  1QQE A;  4YVQ C;  2YHC A;  3CVN A;  4O6F A;  1WM5 A;  5DBK A;  2LSV A;  2XCB A;  2VSY A;  3AS8 A;  4HOU A;  4WND A;  4BT8 A;  4HOS A;  5BT1 A;  5FZR A;  4UI9 K;  2FF4 A;  3QWV A;  4N3A A;  3S7D A;  3S7J A;  2BUG A;  3TGO A;  4B94 A;  3CVL A;  2JLB A;  5G04 C;  3GW4 A;  2Y4T A;  3FP3 A;  3MV3 B;  2HR2 A;  4J8F A;  4N3B A;  2R5S A;  5EKQ D;  5HI7 A;  1P5Q A;  3CK8 A;  2P58 C;  4WNG A;  5JJ6 A;  3PDN A;  4GA1 A;  4JA9 A;  4KXK B;  3AS5 A;  3TG5 A;  4I2W A;  4YVO A;  3RU0 A;  4CGV A;  4GYW A;  3QDN A;  1B89 A;  4AY5 A;  3R9A B;  5CHE E;  4KYO B;  4GPK A;  4GZ3 A;  2I6H A;  4GA0 A;  4N39 A;  3AS4 A;  2UWJ G;  4U0U A;  3ZN3 A;  2LSU A;  3K9I A;  2AVP A;  3TAX A;  3ASF A;  3MV2 B;  4ABN A;  2MHK A;  2C0L A;  2KAT A;  4GYY A;  1ELW A;  4WUY A;  3GYZ A;  3CVQ A;  2VGX B;  4XI0 A;  1NA3 A;  2PZI A;  3OXF A;  4I1A A;  5A7D B;  5KJM A;  2C2L A;  1FCH A;  4N5C A;  5ARF A;  2PQR A;  5DIZ A;  5ARG A;  5FZQ A;  4G23 A;  5FZS A;  4JHR A;  5D0O D;  5LCW C;  4RG6 A;  1ZU2 A;  2XPI A;  3OXG A;  5G04 J;  1OUV A;  3LPZ A;  4H7X A;  4J0U A;  3VTX A;  3ASH A;  3OXL A;  5KJK A;  4U07 A;  3KAE A;  4UI9 J;  2Q7F A;  4I9E A;  1NA0 A;  5FT9 A;  2KCK A;  4I9C A;  4U04 A;  2XCC A;  4H7Y A;  2VQ2 A;  4IN3 B;  3UPV A;  1A17 A;  3GZ1 A;  4HOQ A;  2OOE A;  3ZFW A;  2HO1 A;  4GZ5 A;  4NRH B;  1Y8M A;  5EX3 A;  5JJT A;  4GYO A;  1KT0 A;  4UQX A;  2YQ8 A;  2C0M A;  1HZ4 A;  2J9Q A;  5G05 J;  3RO3 A;  3IEG A;  3U3W A;  4N2S A;  1IHG A;  3UUX A;  3Q49 B;  3MA5 A;  3LY8 A;  1TJC A;  5JJ7 A;  3LKU A;  3ASG A;  2UY1 A;  3GZ2 A;  1KLX A;  3BEE A;  3Q5M A;  4G1T A;  4GCN A;  2XGO A;  3RIB A;  3WXX A;  1IYG A;  5HQ8 A;  3CKB A;  3FFL A;  3JYS A;  3ZHE B;  3RJV A;  4F3V A;  2FI7 A;  2WQH A;  2LNI A;  3Q4A B;  3HYM B;  3KS2 A;  5A6C A;  3QKY A;  3QWP A;  2OND A;  4XI9 A;  1W3B A;  2L6J A;  3O48 A;  3Q47 B;  5D0Q D;  3CEQ A;  3Q15 A;  2XEV A;  3LY9 A;  5G05 C;  1HH8 A;  2WPV A;  5KJL A;  4AIF A;  5CCM A;  5KJN A;  3RKV A;  4J8E A;  3ESK A;  4G2V A;  2NC9 A;  3U4T A;  5LCW J;  1WAO 1;  2VGY A;  3MKR A;  4I2Z A;  3NF1 A;  4N3C A;  3CK7 A;  3TG4 A;  3ULQ A;  3URZ A;  2KC7 A;  2KCL A;  3RO2 A;  3VTY A;  4G26 A;  3ZHE A;  2QFC A;  2PL2 A;  3KD7 A;  3ASD A;  3MEK A;  4UI9 C;  4JA7 A;  3SZ7 A;  4AM9 A;  3LCA A;  4UQZ A;  3CKC A;  4GZ6 A;  4J8D A;  3CVP A;  2UY1 B;  1YA0 A;  1ELR A;  3ZGQ A;  3N71 A;  2VYI A;  5CCL A;  5M72 A;  4KBQ A;  4U0S A;  5FTP A;  3QWW A;  4Y6W A;  3CK9 A;  2VGX A;  2XGM A;  3CV0 A;  4RG9 A;  2VSN A;  4LEU A;  2Y4U A;  3E4B A;  4UQY A;  2HYZ A;  4Y6C A;  5AYW D;  3QOU A;  4YND A;  3LY7 A;  4XIF A;  4EQF A;  4N2Q A;  4W9R A;  2FBN A;  4BTB A;  3PE4 A;  1KT1 A;  2DBA A;  4GCO A;  1E96 B; 
#chains in the Genus database with same CATH topology
 2EIM E;  3L6A A;  4E85 A;  1NL4 A;  4DK5 A;  4RSY A;  1BD8 A;  2FF4 A;  4N3A A;  2JLB A;  2CHW A;  1E8X A;  3FDH A;  2A5E A;  4KYO B;  3FU3 A;  2F8X K;  2ILR A;  2MRI A;  1FCH A;  1N0R A;  4K5C A;  4F1P A;  4MS6 A;  3SQV A;  2WXH A;  3BUA A;  3OXG A;  5ENP D;  5BXO A;  3IHY A;  1LD8 A;  5AEN A;  3SFY A;  3L16 A;  4QQI A;  2I1J A;  3ZXS A;  3FU0 A;  4TUU A;  4WWN A;  2OVB A;  5EID A;  3IHV A;  1MX6 A;  1INZ A;  3AG4 E;  2VTB B;  4CEM A;  3MKR A;  3T9K A;  2OVF A;  4GZ6 A;  3PEU B;  3QWW A;  3CK9 A;  4I6J A;  2Y4U A;  4UQY A;  4Y6C A;  2X6K A;  3Q79 A;  1DNP A;  2A4Z A;  1LF8 A;  2XEE A;  4O1P A;  2BKG A;  1NZN A;  3FWV A;  4HOT A;  2IEJ A;  5T3R A;  2V5F A;  5CMW A;  3ONL A;  1L5J A;  1TN6 A;  2PQN A;  5FQ8 A;  2FO1 E;  2LAI A;  3FY4 A;  5AQ9 A;  3AS8 A;  3CIA A;  3TWU A;  3QWV A;  3GW4 A;  2V4H C;  4J8F A;  4K0R A;  4WNG A;  3OAW A;  2QYU A;  4GTV A;  4AY5 A;  3D9L A;  4LNU D;  2EIJ E;  4O60 A;  5ARF A;  3APF A;  1MX4 A;  2VGE A;  4RG6 A;  4U95 D;  2XPI A;  1HG5 A;  3JQ0 A;  3ASH A;  4L2Y A;  1RZ4 A;  1NA0 A;  4GZD A;  2VQ2 A;  2EQX A;  4ZFH A;  3ASN E;  3RRM B;  2C0M A;  3AG1 E;  1WG0 A;  3CHO A;  3B7T A;  1H19 A;  3AG2 E;  3BEE A;  1JWF A;  4DX7 D;  3VLD A;  4BSX A;  3Q4A B;  3QKY A;  4WAF A;  2WMO A;  4U63 A;  5BUZ A;  4J6I A;  4OAV B;  3VTY A;  4G26 A;  4FC8 A;  4AM9 A;  4GTO A;  2P9K G;  3UT8 A;  4GU5 A;  4GMR A;  4KVO A;  5AAR A;  4G11 A;  3LXU X;  4B93 B;  3IKO B;  4XZ4 A;  3PUK A;  2PM7 A;  2J07 A;  4FLH A;  3MKQ B;  2GGF A;  5ENR D;  4HI8 A;  4CGW A;  1QQE A;  3B95 A;  2WXQ A;  2BED A;  4A55 A;  2VSY A;  3SD5 A;  3MJW A;  4MRU A;  5CCL A;  1FPP A;  4UUC A;  2CHZ A;  2IOS A;  5FWQ A;  4N39 A;  4U0U A;  3KEZ A;  2P9I G;  3Q9U C;  1V55 E;  5ARG A;  5H7P A;  4JHR A;  4PH4 B;  3HRA A;  4PS8 A;  4I9E A;  4I9C A;  2R59 A;  2XCC A;  2H6G A;  4XKB A;  5ENT D;  1D9S A;  4IUL A;  1N4S A;  3NOC D;  2UY1 A;  1KLX A;  5AIJ A;  3D9K A;  1SZ9 A;  5AJD A;  3UIN C;  2XEV A;  2AXU A;  3C3Q A;  2X3M A;  3JCK C;  4HXI A;  4FLB A;  2IO2 C;  3UM3 A;  3DSX A;  4AOF A;  1U2V G;  3FTS A;  3Q7F A;  4JZY A;  5JHA A;  4R7L A;  1HU3 A;  2WM9 A;  5HKP A;  4A1S A;  4GTS A;  4TXP A;  5LP0 A;  2P9S G;  3CLJ A;  2GW1 A;  4BTA A;  5BV0 A;  3ULY A;  3J5Q B;  3ULE G;  4I6G A;  1KZP A;  2YHC A;  4GTP A;  1IXV A;  4B94 A;  3IBE A;  2F37 A;  4TXR A;  5FQ4 A;  1TJF A;  3RU0 A;  4GYW A;  3PNT B;  1QBQ A;  4WWP A;  1YMP A;  5CER B;  1NA3 A;  4I1A A;  2QZA A;  1TNU A;  2PQR A;  2OEW A;  2M63 A;  3APD A;  2XS1 A;  3NZU A;  2WXP A;  1V54 E;  4GML A;  1N9A A;  3OTN A;  3UKU G;  3ASO E;  4YDY A;  4MBG A;  1X81 A;  5CMY A;  1MHQ A;  1JCS A;  5EIL A;  1N52 A;  4JVS A;  1XGW A;  4ATZ D;  2IY0 C;  5HQ8 A;  2J49 A;  3IV0 A;  3TL5 A;  3LY9 A;  4B89 A;  2WPV A;  3PNL B;  1TR4 A;  1Z5S C;  4HQD A;  3HXF A;  2RG8 A;  4N3C A;  1H6O A;  4DLQ A;  4DRX E;  3ASD A;  4JA7 A;  4G8K A;  4UQZ A;  1Y6I A;  3ZGQ A;  3LS8 A;  5AQA A;  3FUK A;  2OCC E;  2XHE A;  1E8W A;  4GTQ A;  1AWC B;  2X6J A;  2ZGG A;  3V31 A;  3ZW3 A;  3CST A;  2VJ8 A;  3SBT B;  2FEZ A;  3AU5 A;  3ZYL A;  1Z6T A;  1ELK A;  1S63 A;  1AP7 A;  4O6F A;  1WM5 A;  3LJ3 A;  5CEA A;  4OYS A;  4C0E A;  5G04 C;  5J08 A;  1PAQ A;  4XX5 A;  2WXF A;  4TRQ A;  4JA9 A;  3BU8 A;  3AS5 A;  3Q75 A;  3TWR A;  5LFA A;  3NBN B;  3NZS A;  1OT8 A;  2AXZ A;  4K03 A;  1EF1 C;  1H6P A;  4KT6 B;  3CVQ A;  2VGX B;  4JXT A;  5A7D B;  2MYO A;  4HRM B;  4RLY A;  2R05 A;  1D8D A;  4BSZ B;  3FUJ A;  4F7A A;  4GYO A;  4I6E A;  4PS3 A;  2J9Q A;  3KSQ A;  4F1S A;  2Y1L E;  4L7T A;  2CG3 A;  5CBN A;  5KBA A;  3EHM A;  2LNI A;  1O1R A;  4ILG A;  3EU5 A;  3G2V A;  4TXQ A;  3RKV A;  2DVW A;  3VLE A;  4HOR A;  3URZ A;  2PL2 A;  1EYH A;  4EZK A;  4FA6 A;  3Q9N C;  3AAA C;  3DBS A;  5M72 A;  4KBQ A;  3FH5 A;  3B7R L;  4LEU A;  3FUF A;  3UMV A;  4DUI A;  2HM8 A;  4U8H A;  4EQF A;  1YYH A;  2AW6 A;  2KXP C;  4BTB A;  3PE4 A;  1BI8 B;  5FJY A;  2KCV A;  2WB2 A;  4MLP A;  2RD0 A;  2MOW A;  2ZIS A;  4RVB A;  3Q78 A;  3UIP C;  4ZHB A;  3DPD A;  3UX4 A;  4ACL A;  1E7V A;  5AQ7 A;  3RK6 A;  3ZNG A;  2LXL A;  4GYY A;  5CBO A;  4I1O B;  3MZL B;  2XS8 A;  3AU4 A;  3CSF A;  3EU9 A;  1JUQ A;  1HE8 A;  2H6F A;  5FT9 A;  5IY5 E;  3ONK A;  1UJJ A;  3GZ1 A;  3PZ3 A;  4GZ5 A;  1IQU A;  3P1U A;  4L9P A;  3T8K A;  4K5B A;  4JW1 A;  3UUX A;  3R7R A;  3FU6 A;  2I1K A;  1Z3Y A;  5LX8 A;  2WXJ A;  3RIB A;  3V30 A;  4F3V A;  3CVW A;  2HE0 A;  4XEI G;  2OND A;  3QAQ A;  1W3B A;  5D0Q D;  4HNA D;  3FUL A;  4GTR A;  3MCX A;  2NSZ A;  1OWM A;  3NF1 A;  3EIJ A;  3KD7 A;  4CT4 A;  3V2O A;  4UWK A;  2V0P A;  3R9M A;  4RG9 A;  3AJI A;  2VSN A;  3E4B A;  5LOZ A;  2P9L G;  3LEW A;  2LXM A;  4LRZ A;  1FVH A;  4W9R A;  3F6Q A;  3C72 A;  1K1A A;  4GCO A;  2E2E A;  4KMO A;  4M3O A;  1D8E A;  3R7Q A;  3RRN B;  2P2C P;  4JPS A;  3UKR G;  3PRZ A;  3L13 A;  3QK0 A;  2F8Y A;  2ETB A;  3EHN A;  5B1B E;  1NI1 A;  3FUM A;  5FZR A;  3ABM E;  3U64 A;  2JEK A;  2I9C A;  2Y4T A;  4N3B A;  2R5S A;  1P5Q A;  5JMN D;  2KM4 A;  4O1O A;  4TV3 A;  1JPL A;  4CCA A;  3ASF A;  3JQ1 A;  3DSV A;  4U96 D;  1FVF A;  4U8V D;  3TWQ A;  1MQS A;  4NUR A;  4LUN U;  3DPY A;  3EUV A;  5G04 J;  1OCO E;  2R17 C;  2RFM A;  2RFA A;  3OXL A;  4D10 C;  4U07 A;  2FUL A;  3ZFW A;  1HZ4 A;  3IEG A;  1IHG A;  3LY8 A;  2LUH A;  4FJZ A;  3CKB A;  2FI7 A;  2WQH A;  3RAU A;  4HB5 A;  3DXM G;  2QYJ A;  3MYV A;  1NFI E;  5FQ6 A;  1Z3X A;  4GMJ A;  4GB9 A;  3ZXP A;  3TWS A;  2KCL A;  3I4R B;  2WXL A;  3LDZ A;  1LTX A;  1U3C A;  2WXG A;  1HFA A;  2YIN A;  5FTP A;  5EDS A;  4A63 B;  1TNB A;  1WY6 A;  5HS0 A;  1ZB1 A;  3LY7 A;  4TUM A;  1SW6 A;  4XIF A;  1TYQ G;  4KZC A;  3JUI A;  2XEH A;  1E96 B;  5E75 A;  3UT7 A;  2XGS A;  5FIO A;  1VDY A;  4XKC A;  2EIN E;  2L6B A;  5C1D A;  4PUC A;  3SF4 A;  2ETA A;  1FT2 A;  3CVN A;  2P9N G;  4JHJ A;  4LNG A;  3FUI A;  3CK8 A;  4DI3 A;  3TG5 A;  4CGV A;  1N95 A;  5CHE E;  2ZIR A;  2J8S D;  3E33 A;  2C0L A;  3UT4 A;  4XI0 A;  3CVX A;  3OXF A;  3HVE A;  2ZXW E;  4G23 A;  3SFX A;  1X5B A;  3EHQ A;  5ENO D;  2Q7F A;  4EZL A;  5A23 A;  4UQX A;  4EHM A;  3NAW A;  4DX1 A;  5KWD A;  5JA4 D;  3I4G A;  4URK A;  2R2L A;  2GRN B;  1N94 A;  3ZHE B;  1N54 A;  3X2Q E;  2V5Q C;  2LO6 A;  3Q15 A;  5G05 C;  4J8E A;  4KZ0 A;  2E0I A;  3SGH A;  3U4T A;  4QFV A;  4HI9 A;  3ML9 A;  5ANL A;  4RQI A;  3ZYK A;  4J8D A;  3UTM A;  4OAU C;  1YA0 A;  2KZT A;  3DXK G;  4UWL A;  3T5X A;  1DCE A;  5EYL A;  5CEC B;  3APC A;  4NQ0 A;  5BNW A;  2CG2 A;  3QNK A;  1O1T A;  1OWO A;  2A5U A;  3ABL E;  3FUE A;  3ZU7 B;  5BW8 C;  4LNB A;  4C9B B;  4I17 A;  3TJP A;  1UG3 A;  1A5E A;  4GTM A;  3C3O A;  4HLE A;  2BF0 X;  4BT8 A;  3S7D A;  4YDE A;  1O1S A;  3L22 A;  3E37 A;  4CYM D;  1YCS B;  3QDN A;  4B8A A;  2I6H A;  3MKQ A;  3BG0 B;  2X6F A;  2KAT A;  1NP7 A;  5CRV A;  5T4Y A;  4CDM A;  3I3N A;  5LCW C;  4ILH B;  4JHK A;  2X6H A;  2IQC A;  1JCQ A;  3C5R A;  2YQ8 A;  4L23 A;  3PEV B;  2PM6 A;  2H6H A;  4HLL A;  3ENE A;  2NXP A;  3TWV A;  3HYM B;  3Q47 B;  2P9P G;  4OVU A;  3DSS A;  3FHE A;  3EIQ C;  5T8I A;  4ACK A;  3FUN A;  1K3Z D;  1H0A A;  3CKC A;  1H6K A;  2UY1 B;  3TWX A;  2VYI A;  4J7W A;  4UWG A;  3FU5 A;  2L0T B;  4KVM A;  1GW6 A;  2HYZ A;  1LD7 A;  3G2T A;  3JXI A;  3B7B A;  3BG1 B;  4BT9 A;  4N2S A;  3ZPJ A;  1N11 A;  1KZO A;  4GZC A;  4HFG A;  3QAR A;  3D9O A;  1H2V C;  4HOS A;  4HOU A;  3CHM A;  2GRP B;  3FTY A;  5EN5 D;  1DCQ A;  2P58 C;  3LVR E;  1WDY A;  1H2U A;  2AVP A;  3TAX A;  1SVX A;  2LAH A;  3GYZ A;  4B8C B;  4HS2 A;  3DEP A;  2VSX E;  2C2L A;  3VLF A;  4J8Y A;  5B3S E;  5JHB A;  1IQR A;  3VTX A;  3FH8 A;  2EIK E;  1HO8 A;  1SA5 A;  5ENQ D;  3UPV A;  2ION A;  1OWP A;  3PZ1 A;  3S2A A;  3W9F A;  3LKU A;  4DX5 D;  1IYG A;  2IO3 C;  1N4Q A;  3FUH A;  3BQO A;  2J4B A;  5AN8 A;  4LCT A;  4HBD A;  4AIF A;  2IOL A;  4BEP A;  3SO8 A;  3ULQ A;  3SZ7 A;  2EIL E;  1ELR A;  3DWL G;  2AWI A;  2Y0B G;  2WMN A;  5KNH D;  2WXK A;  4AXH A;  1HXI A;  4G24 A;  5EIB E;  3D9N A;  1ZBP A;  4AY6 A;  1MZC A;  1RW2 A;  3S7B A;  4HVB A;  1E8Z A;  3W9G A;  2CHX A;  4Q96 A;  2B6C A;  5BT1 A;  5AAO A;  3MV3 B;  4OVV A;  3R9A B;  2DIW A;  5J90 A;  3MV2 B;  4UWH A;  5KJM A;  2ETC A;  3FTX A;  3MX3 A;  2IU1 A;  5DIZ A;  5KJK A;  3PUJ A;  3CHP A;  5FIN A;  2GRL A;  5JJT A;  2BTD A;  3SFZ A;  1BPO A;  3U3W A;  4YDW A;  4AEZ C;  3Q5M A;  3G2S A;  4GCN A;  2OV8 A;  1OCC E;  2XGO A;  5HRY A;  3CHS A;  3FFL A;  3JYS A;  3ZKJ A;  2DYS E;  1E90 A;  1E7U A;  3L08 A;  2X38 A;  5CCM A;  5KJN A;  5BV1 A;  2IJG X;  4BER A;  4AP2 A;  4G2V A;  3C3R A;  3TG4 A;  3HHM A;  4C48 B;  2X6I A;  1JWG A;  2OEV A;  3CHR A;  4X8Q A;  4JC8 A;  3CV0 A;  5AYW D;  3ZYM A;  3QOU A;  4FHJ A;  2FBN A;  4U7E B;  2DBA A;  4LER A;  3CVV A;  3ISM C;  1KPS B;  3EDT B;  3CQC B;  4BWR A;  2AJA A;  3D9J A;  3DRA A;  3HXC A;  1DC2 A;  1MYO A;  2FO7 A;  2IFU A;  4EEC A;  4NIK A;  1MJ0 A;  3UXG A;  2LSV A;  4K5A B;  4UWF A;  2L0I A;  4DI4 A;  4CDN A;  3CVL A;  5C2Y A;  3FP3 A;  2HR2 A;  1QNF A;  2YHE A;  1OCZ E;  3PDN A;  5JJ6 A;  2DZO A;  1PY1 A;  5ANR A;  5KCM A;  4GA0 A;  3PRE A;  2R03 A;  5D66 A;  4PS7 A;  5FQ7 A;  3T8M A;  2XPY A;  4N5Q A;  3TXM A;  3EHR A;  2B0O E;  4GAA A;  5FZS A;  3LPZ A;  2JAB A;  3KAE A;  4NRH B;  4FP7 A;  1TNO A;  3C98 A;  1TJC A;  4MKT A;  4Z68 A;  4HRL A;  3PZD A;  3L9T A;  2DYR E;  1IKN D;  4A1G A;  1HH8 A;  3WG7 E;  4V3I A;  5LCW J;  2YNQ A;  1UW4 B;  3RO2 A;  2V8S E;  2P9U G;  4GPM A;  3FTZ A;  2VGX A;  2XGM A;  3KSL A;  1DVP A;  3T5V A;  4BX9 A;  4YND A;  3DSU A;  2XRY A;  1E8Y A;  4M7C A;  4ANW A;  3UM0 A;  2WQ7 A;  4CDR A;  2H6I A;  4FUL A;  4JD2 G;  4JL0 A;  3S7F A;  4U0Z A;  3SBS A;  4LSZ E;  4ME2 A;  4DLO A;  2WXR A;  4G25 A;  1N4R A;  3KEA A;  3DSW A;  4YVQ C;  5DBK A;  4WND A;  3ZUV B;  2Y3A A;  4I1M A;  4CRW A;  4YDO A;  4IYP A;  3RSE G;  5ENS D;  3FEX A;  3HVE B;  3QC1 A;  4GA1 A;  3HDX A;  2XQ0 A;  4GPK A;  3AS4 A;  2XEN A;  4ABN A;  5E76 A;  3ZRH A;  1HX8 A;  4N5C A;  2KBX A;  2Y69 E;  1ZU2 A;  1G3N B;  3L54 A;  3PH0 C;  5G55 A;  4BFR A;  4BY6 A;  4U04 A;  4H7Y A;  3Q73 A;  1Y8M A;  5EX3 A;  4BES A;  4J8S A;  3IXE A;  2QY7 A;  4PDX A;  2QC9 A;  4G1T A;  3WXX A;  3ML8 A;  1S64 A;  4BET A;  1BU9 A;  3NQP A;  4L2L A;  3D9M A;  1S0P A;  3HIZ A;  4ATG A;  2NC9 A;  1WAO 1;  2KC7 A;  5ENN A;  3ZIM A;  1TNY A;  4JB8 P;  3CGH A;  3EJN A;  3ZVV A;  3B13 A;  3U66 A;  1BLX B;  2WXO A;  1KT1 A;  4F53 A;  2WXI A;  1SZA A;  2CFU A;  2J4D A;  3D9I A;  1EPU A;  3UQ3 A;  3LYA A;  2I2O A;  1XNF A;  1PC2 A;  3MGB A;  3UM1 A;  3E30 A;  1UOH A;  4JEU A;  2WXM A;  1TN7 A;  5HI7 A;  2ZU6 B;  1UJK A;  4P29 A;  1N0Q A;  3G2U A;  4A3T A;  2UWJ G;  5CED B;  4WUY A;  3B7S A;  2PZI A;  4G8L A;  1MX2 A;  3ABK E;  4H7X A;  3FTW A;  2KZT B;  2L9B A;  3FH7 A;  3GZS A;  1U3D A;  2OOE A;  1UN9 A;  5B1A E;  1KT0 A;  3TWT A;  3I5P A;  4FHK A;  3FTV A;  1O5M A;  3ASG A;  5G2N A;  4BX8 A;  4I43 A;  4XI9 A;  5BPP A;  1N4P A;  3PZ2 A;  5KJL A;  4I2Z A;  5BXU A;  3CK7 A;  1TEZ A;  5EYP F;  3LCA A;  1HG2 A;  3CQG B;  2WXN A;  3CVP A;  3ESL A;  3N71 A;  4U0S A;  3QJZ A;  4ILI A;  4FAD A;  3Q7A A;  3JUE A;  2BKK B;  3SNX A;  3LVQ E;  4Y6W A;  3DEO A;  4WNF A;  4C0M A;  1QZ2 A;  3UM2 A;  4GA2 A;  1K8K G;  3PE3 A;  3V79 K;  4AVX A;  5EX0 A;  4WNE A;  1TN8 A;  4GTT A;  4UI9 K;  2VSO E;  3S7J A;  2BUG A;  3HXE A;  4WWO A;  2PNN A;  4KXK B;  3G2W A;  4IRU A;  4I2W A;  3FTU A;  3PZ4 A;  3LJN A;  1UN8 A;  1Q2Z A;  2CFZ A;  2LSU A;  3K9I A;  2MHK A;  4ANU A;  4DJA A;  3P2B A;  5AQB A;  2V4L A;  5KNG A;  3D9H A;  5D0O D;  1HS6 A;  4L1B A;  3L82 A;  4EPZ A;  1EDU A;  1OY3 D;  4Q94 A;  1H2T C;  2HO1 A;  1HF8 A;  3RO3 A;  4EZJ A;  5ITZ F;  2ZGD A;  3ZEF A;  3B7U X;  3GZ2 A;  3RRU A;  2R02 A;  4EBA G;  3UIO C;  5D2M C;  1OWL A;  1TNZ A;  4APF A;  3ZYQ A;  2NYJ A;  3PS6 A;  3ESK A;  4DX6 D;  3FUD A;  2VGY A;  3JXJ A;  2DWZ A;  1QYM A;  5CRU A;  3ZHE A;  4U8Y D;  2QFC A;  3MEK A;  3UI2 A;  1IHB A;  3FEY A;  2GRQ B;  3TWW A;  2XRZ A;  3E34 A;  3V2X A;  1SA4 A;  1K1B A;  5FZQ A;  2XPZ A;  3HXD A;  3D3M A;  1FT1 A;  2GRO B;  3QB2 A;  4AJW A;  2IF4 A;  4APO A;  3NOG D;  4DPR A;  3CR3 A;  2AXV A;  3CHQ A;  2XCB A;  3AG3 E;  4HRN A;  3J5P A;  4B0Z A;  3CVY A;  4FU3 A;  5EKQ D;  3TGO A;  2F0Y A;  4YVO A;  3SY2 A;  1B89 A;  3U9W A;  3HXB A;  2XZD G;  4GZ3 A;  2RKK A;  3ZN3 A;  3SHF A;  1OCR E;  2WVI A;  3DST A;  1ELW A;  3SI5 A;  3O4Z A;  4AV7 A;  3PVL A;  1JCR A;  3E32 A;  3HG0 D;  4Q69 A;  3L17 A;  1OUV A;  4J0U A;  4UI9 J;  2KCK A;  2GRM A;  5AJL A;  4IN3 B;  1A17 A;  4HOQ A;  4NAC A;  4XE0 A;  5G05 J;  2VTB A;  4CZ2 D;  3Q49 B;  3MA5 A;  1S70 B;  1BI7 B;  4FJY A;  5JJ7 A;  4CT0 A;  4JEH A;  4A3V A;  3RJV A;  5A6C A;  3KS2 A;  4F6R D;  3QWP A;  2J09 A;  2L6J A;  3O48 A;  3CEQ A;  4EBA A;  3D9P A;  4ANX A;  3CVU A;  1OWN A;  3NB2 A;  2J08 A;  2XZT G;  4ANV A;  3TXN A;  4UI9 C;  4DX2 A;  4E6H A;  4LG6 A;  2DCP A;  2GRR B;  2DZN A;  1OXJ A;  2WQ6 A;  1SQM A;  4N2Q A; 
#chains in the Genus database with same CATH homology
 2WQ7 A;  4NQ0 A;  5BNW A;  3L6A A;  4E85 A;  2CG2 A;  4CDR A;  3QNK A;  1OWO A;  2A5U A;  2X6J A;  3FUE A;  5BW8 C;  3ZW3 A;  4C9B B;  3CST A;  4FUL A;  2VJ8 A;  4I17 A;  4JL0 A;  3TJP A;  4DK5 A;  1UG3 A;  4U0Z A;  3S7F A;  3SBS A;  4ME2 A;  4RSY A;  3SBT B;  4DLO A;  5KJN A;  2FEZ A;  3AU5 A;  2WXR A;  3ZYL A;  1Z6T A;  4G25 A;  1ELK A;  4YVQ C;  4O6F A;  1WM5 A;  5DBK A;  3LJ3 A;  4HLE A;  4WND A;  2BF0 X;  4BT8 A;  2Y3A A;  4OYS A;  4I1M A;  2FF4 A;  4CRW A;  4N3A A;  3S7D A;  4C0E A;  3L22 A;  4IYP A;  2JLB A;  5G04 C;  5J08 A;  1PAQ A;  4XX5 A;  2WXF A;  3FEX A;  3HVE B;  2CHW A;  3QC1 A;  4TRQ A;  1E8X A;  4GA1 A;  4JA9 A;  3HDX A;  3FDH A;  3AS5 A;  5LFA A;  3QDN A;  3NZS A;  2XQ0 A;  4B8A A;  4KYO B;  4GPK A;  3FU3 A;  2I6H A;  2AXZ A;  3AS4 A;  3MKQ A;  3BG0 B;  4K03 A;  4ABN A;  1EF1 C;  5E76 A;  4KT6 B;  2X6F A;  2KAT A;  1NP7 A;  2ILR A;  3ZRH A;  3CVQ A;  2VGX B;  4JXT A;  5T4Y A;  5A7D B;  4CDM A;  1HX8 A;  2MRI A;  1FCH A;  4N5C A;  3I3N A;  5LCW C;  4ILH B;  4MS6 A;  1ZU2 A;  4JHK A;  2WXH A;  3L54 A;  3OXG A;  3PH0 C;  3IHY A;  5G55 A;  4BFR A;  2X6H A;  4BY6 A;  3FUJ A;  4F7A A;  2IQC A;  4U04 A;  5AEN A;  4H7Y A;  5JJ7 A;  3L16 A;  1Y8M A;  5EX3 A;  4GYO A;  4I6E A;  4J8S A;  4PS3 A;  2I1J A;  2J9Q A;  2YQ8 A;  2QY7 A;  4PDX A;  4L23 A;  3PEV B;  2PM6 A;  4F1S A;  3ZXS A;  3FU0 A;  4TUU A;  4L7T A;  2CG3 A;  4G1T A;  4WWN A;  2OVB A;  3WXX A;  3ENE A;  2NXP A;  3EHM A;  2LNI A;  3ML8 A;  3HYM B;  4ILG A;  3G2V A;  3IHV A;  1INZ A;  3Q47 B;  3NQP A;  4L2L A;  2VTB B;  3D9M A;  1S0P A;  4CEM A;  3RKV A;  3HIZ A;  4ATG A;  2NC9 A;  3VLE A;  1WAO 1;  3MKR A;  4HOR A;  4OVU A;  3URZ A;  2KC7 A;  5ENN A;  2PL2 A;  3FHE A;  3EIQ C;  1EYH A;  5T8I A;  4EZK A;  4FA6 A;  4ACK A;  3FUN A;  3ZIM A;  1H0A A;  3CKC A;  1H6K A;  2OVF A;  4GZ6 A;  3DBS A;  2UY1 B;  3CGH A;  2VYI A;  3PEU B;  5M72 A;  4KBQ A;  3FH5 A;  3QWW A;  3EJN A;  3CK9 A;  4UWG A;  3B7R L;  3FU5 A;  4I6J A;  2L0T B;  2Y4U A;  3FUF A;  1GW6 A;  4LEU A;  4KVM A;  3B13 A;  4UQY A;  2HYZ A;  4Y6C A;  3ZVV A;  3U66 A;  2X6K A;  3UMV A;  2HM8 A;  2WXO A;  1DNP A;  4U8H A;  4EQF A;  2A4Z A;  2AW6 A;  1LF8 A;  4BTB A;  3PE4 A;  1KT1 A;  1NZN A;  4F53 A;  2WXI A;  1SZA A;  3FWV A;  3G2T A;  4HOT A;  2CFU A;  2J4D A;  3D9I A;  5T3R A;  2V5F A;  5CMW A;  3ONL A;  5FJY A;  3BG1 B;  2KCV A;  1EPU A;  4BT9 A;  4N2S A;  3UQ3 A;  3ZPJ A;  2WB2 A;  3LYA A;  4MLP A;  1L5J A;  2RD0 A;  2I2O A;  4GZC A;  1XNF A;  2PQN A;  4HFG A;  5FQ8 A;  3QAR A;  3D9O A;  1PC2 A;  2MOW A;  3MGB A;  2LAI A;  1H2V C;  4RVB A;  3FY4 A;  4HOS A;  3AS8 A;  3CIA A;  4HOU A;  4JEU A;  3CHM A;  2WXM A;  3QWV A;  3GW4 A;  3FTY A;  4J8F A;  3DPD A;  4K0R A;  5HI7 A;  2P58 C;  4WNG A;  2ZU6 B;  3UX4 A;  3OAW A;  1UJK A;  3LVR E;  4P29 A;  4ACL A;  4AY5 A;  1E7V A;  3D9L A;  3G2U A;  4A3T A;  2UWJ G;  3RK6 A;  1H2U A;  2AVP A;  3TAX A;  4GYY A;  2LAH A;  4WUY A;  3GYZ A;  4I1O B;  4B8C B;  3B7S A;  3MZL B;  2PZI A;  4HS2 A;  2VSX E;  2C2L A;  3VLF A;  5ARF A;  3AU4 A;  5JHB A;  3APF A;  1IQR A;  4RG6 A;  2XPI A;  1HG5 A;  3CSF A;  3JQ0 A;  4H7X A;  3FH8 A;  3VTX A;  3ASH A;  4L2Y A;  3FTW A;  1JUQ A;  1HE8 A;  1NA0 A;  2KZT B;  2L9B A;  4GZD A;  5FT9 A;  3FH7 A;  3GZS A;  2VQ2 A;  1HO8 A;  1U3D A;  1UJJ A;  2EQX A;  1OWP A;  2ION A;  1UN9 A;  2OOE A;  3GZ1 A;  4GZ5 A;  1IQU A;  3P1U A;  3RRM B;  3S2A A;  1KT0 A;  2C0M A;  3I5P A;  4FHK A;  4JW1 A;  3UUX A;  3R7R A;  3CHO A;  3FTV A;  3FU6 A;  2I1K A;  3LKU A;  1Z3Y A;  3B7T A;  3ASG A;  1H19 A;  5LX8 A;  3BEE A;  2WXJ A;  5G2N A;  3RIB A;  1JWF A;  1IYG A;  4BX8 A;  3VLD A;  4F3V A;  3CVW A;  4BSX A;  3Q4A B;  3QKY A;  4I43 A;  2OND A;  3FUH A;  3QAQ A;  4XI9 A;  1W3B A;  5D0Q D;  4WAF A;  2J4B A;  2WMO A;  4U63 A;  4LCT A;  3FUL A;  5BPP A;  3ONK A;  5BUZ A;  5KJL A;  4AIF A;  4J6I A;  3MCX A;  2IOL A;  2NSZ A;  4I2Z A;  1OWM A;  3NF1 A;  3ULQ A;  3CK7 A;  3EIJ A;  3VTY A;  1TEZ A;  4G26 A;  4FC8 A;  3KD7 A;  4AM9 A;  4CT4 A;  3SZ7 A;  3LCA A;  1HG2 A;  3CQG B;  3UT8 A;  2WXN A;  3CVP A;  1ELR A;  3ESL A;  4UWK A;  3N71 A;  2V0P A;  4GU5 A;  4U0S A;  3QJZ A;  4RG9 A;  4ILI A;  2AWI A;  2VSN A;  4FAD A;  3E4B A;  4KVO A;  5LOZ A;  3SNX A;  2WMN A;  3LEW A;  3LVQ E;  4LRZ A;  1FVH A;  4W9R A;  4G11 A;  2WXK A;  3LXU X;  4Y6W A;  4GCO A;  4AXH A;  2E2E A;  4KMO A;  3IKO B;  4M3O A;  4XZ4 A;  1HXI A;  4G24 A;  3R7Q A;  3RRN B;  4JPS A;  3D9N A;  3PUK A;  2PM7 A;  2J07 A;  4FLH A;  1ZBP A;  4AY6 A;  4WNF A;  4C0M A;  1QZ2 A;  3MKQ B;  3PRZ A;  4GA2 A;  3S7B A;  2GGF A;  3L13 A;  3PE3 A;  3QK0 A;  4AVX A;  4HVB A;  1E8Z A;  2CHX A;  5EX0 A;  4CGW A;  4Q96 A;  4WNE A;  1QQE A;  2WXQ A;  3EHN A;  4A55 A;  2VSY A;  3SD5 A;  3FUM A;  5BT1 A;  5FZR A;  4UI9 K;  2VSO E;  3S7J A;  2BUG A;  2JEK A;  3U64 A;  3MJW A;  2I9C A;  4MRU A;  2Y4T A;  3MV3 B;  4N3B A;  2R5S A;  4WWO A;  1P5Q A;  5CCL A;  2KM4 A;  4KXK B;  3G2W A;  2CHZ A;  4IRU A;  4I2W A;  2IOS A;  3FTU A;  4OVV A;  1UN8 A;  4TV3 A;  5FWQ A;  3R9A B;  2CFZ A;  4N39 A;  2DIW A;  4U0U A;  1JPL A;  2LSU A;  3K9I A;  3KEZ A;  4CCA A;  5J90 A;  3ASF A;  3JQ1 A;  3MV2 B;  2MHK A;  4ANU A;  1FVF A;  4UWH A;  4DJA A;  5KJM A;  1MQS A;  3P2B A;  3FTX A;  3MX3 A;  2IU1 A;  2V4L A;  4LUN U;  4NUR A;  5DIZ A;  5ARG A;  4JHR A;  5D0O D;  4PH4 B;  1HS6 A;  4L1B A;  5G04 J;  4PS8 A;  5KJK A;  2R17 C;  3OXL A;  4D10 C;  3PUJ A;  3CHP A;  1EDU A;  4U07 A;  4EPZ A;  4I9E A;  2GRL A;  4I9C A;  2R59 A;  2XCC A;  2FUL A;  4XKB A;  3ZFW A;  4Q94 A;  1H2T C;  2HO1 A;  5JJT A;  2BTD A;  1HF8 A;  4IUL A;  3SFZ A;  3RO3 A;  1HZ4 A;  1BPO A;  3U3W A;  3IEG A;  1IHG A;  4EZJ A;  3ZEF A;  3LY8 A;  4AEZ C;  3B7U X;  2UY1 A;  3GZ2 A;  1KLX A;  3Q5M A;  3G2S A;  4GCN A;  2OV8 A;  2XGO A;  4FJZ A;  3CHS A;  3RRU A;  5AIJ A;  3CKB A;  3FFL A;  3JYS A;  2FI7 A;  2WQH A;  4EBA G;  1E90 A;  3D9K A;  1OWL A;  1SZ9 A;  1E7U A;  4APF A;  5AJD A;  2XEV A;  3MYV A;  3L08 A;  3ZYQ A;  2X38 A;  5FQ6 A;  1Z3X A;  2IJG X;  3PS6 A;  4GMJ A;  5BV1 A;  3ESK A;  2AXU A;  4AP2 A;  5CCM A;  4G2V A;  3FUD A;  2X3M A;  4GB9 A;  3TG4 A;  2VGY A;  2KCL A;  3ZHE A;  2QFC A;  3MEK A;  3I4R B;  3HHM A;  2WXL A;  2X6I A;  3LDZ A;  1U3C A;  2WXG A;  3FEY A;  3JCK C;  1JWG A;  4HXI A;  4FLB A;  1HFA A;  3CHR A;  2YIN A;  4JC8 A;  5FTP A;  5EDS A;  4AOF A;  3CV0 A;  3FTS A;  2XRZ A;  5AYW D;  3ZYM A;  4JZY A;  1WY6 A;  5JHA A;  3QOU A;  3LY7 A;  4R7L A;  4XIF A;  4FHJ A;  2FBN A;  4KZC A;  1HU3 A;  2WM9 A;  3JUI A;  2DBA A;  5FZQ A;  1E96 B;  4LER A;  5E75 A;  3UT7 A;  3CVV A;  2XPZ A;  2XGS A;  3D3M A;  3QB2 A;  4A1S A;  1VDY A;  4AJW A;  5LP0 A;  3CLJ A;  3EDT B;  2GW1 A;  2IF4 A;  4XKC A;  4BTA A;  3CQC B;  4BWR A;  5BV0 A;  4APO A;  3D9J A;  5C1D A;  4PUC A;  2FO7 A;  3SF4 A;  4DPR A;  3CR3 A;  2IFU A;  2AXV A;  4EEC A;  3CHQ A;  4I6G A;  2YHC A;  3CVN A;  2LSV A;  2XCB A;  4JHJ A;  4UWF A;  2L0I A;  4B94 A;  3FUI A;  3CVL A;  5C2Y A;  4B0Z A;  4FU3 A;  3IBE A;  4CDN A;  4DI4 A;  3CVY A;  3FP3 A;  5FQ4 A;  2HR2 A;  1TJF A;  5EKQ D;  3TGO A;  3CK8 A;  1QNF A;  2YHE A;  3PDN A;  5JJ6 A;  3TG5 A;  4DI3 A;  4YVO A;  3RU0 A;  4CGV A;  4GYW A;  1PY1 A;  5ANR A;  5KCM A;  1B89 A;  3U9W A;  3PNT B;  5CHE E;  4GZ3 A;  4GA0 A;  3PRE A;  3ZN3 A;  4WWP A;  3SHF A;  2WVI A;  4PS7 A;  2C0L A;  5FQ7 A;  3T8M A;  3UT4 A;  1ELW A;  3SI5 A;  3O4Z A;  4AV7 A;  2XPY A;  3UPV A;  4XI0 A;  1NA3 A;  3CVX A;  3OXF A;  4I1A A;  3TXM A;  3PVL A;  3HVE A;  4GAA A;  2PQR A;  4G23 A;  2M63 A;  3APD A;  5FZS A;  1X5B A;  3NZU A;  2WXP A;  3L17 A;  1OUV A;  3LPZ A;  4Q69 A;  4J0U A;  4UI9 J;  3KAE A;  4GML A;  2Q7F A;  3OTN A;  2GRM A;  2KCK A;  5AJL A;  4IN3 B;  1A17 A;  4HOQ A;  4NAC A;  4XE0 A;  4NRH B;  4FP7 A;  4EZL A;  5CMY A;  5A23 A;  4UQX A;  1MHQ A;  5G05 J;  2VTB A;  3Q49 B;  3MA5 A;  3C98 A;  4FJY A;  3I4G A;  1TJC A;  1N52 A;  4URK A;  4JVS A;  4CT0 A;  1XGW A;  4JEH A;  4MKT A;  4A3V A;  5HQ8 A;  3ZHE B;  3RJV A;  3PZD A;  1N54 A;  5A6C A;  2J49 A;  3KS2 A;  3QWP A;  2J09 A;  2L6J A;  3O48 A;  2LO6 A;  3CEQ A;  3IV0 A;  3Q15 A;  4EBA A;  3TL5 A;  3D9P A;  3LY9 A;  5G05 C;  1HH8 A;  4A1G A;  4B89 A;  2WPV A;  4ANX A;  3PNL B;  3CVU A;  1OWN A;  4J8E A;  4KZ0 A;  2E0I A;  4V3I A;  2J08 A;  3SGH A;  4QFV A;  3U4T A;  2RG8 A;  2YNQ A;  5LCW J;  4N3C A;  3ML9 A;  1UW4 B;  3RO2 A;  4ANV A;  2V8S E;  3TXN A;  4UI9 C;  5ANL A;  4DLQ A;  3ASD A;  4JA7 A;  3ZYK A;  4UQZ A;  4E6H A;  4J8D A;  1Y6I A;  1YA0 A;  3ZGQ A;  2KZT A;  4UWL A;  3T5X A;  2DCP A;  3FTZ A;  3LS8 A;  2VGX A;  2XGM A;  1DVP A;  3T5V A;  3FUK A;  4BX9 A;  4YND A;  2XRY A;  2XHE A;  2WQ6 A;  1SQM A;  3APC A;  1E8W A;  1E8Y A;  4ANW A;  4N2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...