3MA5A

Crystal structure of the tetratricopeptide repeat domain protein q2s6c5_salrd from salinibacter ruber. northeast structural genomics consortium target srr115c.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
EDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the tetratricopeptide repeat domain protein Q2S6C5_SALRD from Salinibacter ruber.
rcsb
source organism Salinibacter ruber
molecule tags Structural genomics, unknown function
molecule keywords Tetratricopeptide repeat domain protein
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ma5A00
5HI7A 4GCOA 4GZ6A 3R9AB 2UWJG 5G05C 4JL0A 3RKVA 2C0LA 4IN3B 4U0SA 3FFLA 3VTYA 5CCLA 4ABNA 3TG4A 3MV2B 3TG5A 3Q15A 3KAEA 4KXKB 4N3BA 5FT9A 4EQFA 2VYIA 3Q4AB 4G2VA 3S7JA 4O6FA 5FZRA 5JJTA 2UY1B 2YHCA 1YA0A 3CVQA 2UY1A 4I1AA 3CVPA 3QOUA 4HOQA 4U0ZA 4AM9A 5ARFA 2LNIA 4BT9A 2I6HA 3HYMB 4HOUA 1IYGA 2FF4A 2MHKA 2PQRA 3U3WA 3LCAA 3TAXA 3Q5MA 5A7DB 3BEEA 3ULQA 3ZPJA 2XGMA 3OXGA 4JA7A 5HQ8A 3FP3A 2LSVA 3Q47B 3U4TA 5A6CA 1ZU2A 4GA0A 4LEUA 5BT1A 3KD7A 4UI9K 2FO7A 2C0MA 4G25A 4GCNA 3URZA 1PC2A 3AS8A 2FI7A 2VGXB 4J8EA 4G23A 4GYWA 5M72A 3TGOA 4ME2A 3O48A 4BT8A 5KJKA 4H7YA 3CVNA 3QDNA 4I9CA 3ZHEB 2JLBA 3OXLA 4WNDA 1IHGA 2KCVA 5BW8C 4G1TA 5KJMA 2Y4TA 5KJLA 4A1SA 4NRHB 4Y6CA 3CV0A 3MV3B 2PL2A 1A17A 4N5CA 3RJVA 4BTBA 4CGVA 1W3BA 2L6JA 3ASGA 4J0UA 1ELRA 2Q7FA 1NA3A 4N3AA 4UI9C 4WUYA 3CVLA 5DBKA 3VTXA 5JJ6A 4HOTA 1ZBPA 4YNDA 3IEGA 2QFCA 4XIFA 5G04C 2HYZA 3QWWA 2OOEA 4UQZA 2VSYA 3RO3A 4W9RA 5FTPA 2HO1A 3MEKA 5FZSA 4APOA 5JJ7A 3LY8A 4J8DA 2IF4A 5ARGA 2HR2A 5EKQD 5LCWJ 4Y6WA 3QKYA 3CK9A 4H7XA 1Y8MA 3GW4A 3ZFWA 1E96B 4U0UA 3Q49B 4XI0A 3RU0A 4GZ3A 5D0QD 3SZ7A 3ASHA 2WPVA 1QZ2A 4GYYA 1XNFA 4I17A 4J8FA 3KS2A 2KCLA 2P58C 4RG9A 1KLXA 1TJCA 2C2LA 1P5QA 2KCKA 2XPIA 3GYZA 3LY7A 4F3VA 3CK7A 3NF1A 4JA9A 3QWPA 4N2SA 3SF4A 2BUGA 3CKBA 4U04A 4JHRA 5AYWD 1ELWA 4WNFA 4CGWA 3ASDA 5FZQA 2PQNA 3ZN3A 3LKUA 3MA5A 3PE3A 3JYSA 4UQYA 4N2QA 2VQ2A 4GA2A 4XI9A 4KBQA 3S7DA 3FWVA 3WXXA 3EDTB 5FJYA 4UI9J 2XGSA 3LPZA 2VSNA 2NC9A 4WNEA 2V5FA 4RG6A 4I2ZA 3CEQA 4G26A 4I9EA 5EX3A 1B89A 2WQHA 3AS5A 3CK8A 4N3CA 5DIZA 2PZIA 1FCHA 5G05J 1WAO1 2E2EA 3ASFA 4GZ5A 4B94A 5BNWA 4I2WA 3UPVA 1HZ4A 1QQEA 5CHEE 3ZGQA 4AY5A 1KT0A 1OUVA 2VGXA 4BTAA 1NA0A 3LYAA 4BWRA 2KATA 3CKCA 4KYOB 4GPKA 2KC7A 3RO2A 3ZHEA 3GZ2A 2GW1A 1HXIA 5CCMA 3S7FA 2FEZA 4HORA 3MKRA 2Y4UA 2IFUA 2LSUA 3OXFA 2XCCA 3S7BA 2XEVA 3LY9A 2AVPA 4UQXA 5D0OD 4YVQC 5C1DA 5LCWC 4AY6A 4U07A 1NZNA 4HOSA 3K9IA 2VGYA 4N39A 3E4BA 2FBNA 1KT1A 3ESKA 3N71A 4G24A 4GA1A 3RIBA 2YQ8A 4NQ0A 1HH8A 3PE4A 3UQ3A 5G04J 2XGOA 4CDRA 3GZ1A 5KJNA 1WM5A 3QWVA 2XCBA 2J9QA 4WNGA 3PDNA 4AIFA 4GYOA 3UUXA 5EX0A 2R5SA 4YVOA 2DBAA 3AS4A 2ONDA
chains in the Genus database with same CATH superfamily
5AARA 2KZTA 3PUKA 3TG5A 5KBAA 3R9MA 4GTMA 3L54A 5T8IA 2XRZA 4N5QA 1DCEA 2Y3AA 3SNXA 1LD7A 4F6RD 5KNGA 2I1KA 4G1TA 3ZIMA 4PDXA 4NRHB 3O4ZA 4HOTA 4TUMA 4HVBA 1E8XA 5FTPA 3DSTA 1E90A 2CHWA 4F7AA 3FUIA 4U04A 1K1AA 3HVEA 4TXQA 3PS6A 4L1BA 4NIKA 3SF4A 1FT2A 1OWNA 5BUZA 1ELWA 2L6BA 3D9NA 4WNFA 5LP0A 1KPSB 2AJAA 4GMLA 2MYOA 2LXLA 4KBQA 3UTMA 3V31A 4BETA 3C3OA 2XS1A 1N4PA 1B89A 4KVOA 4HRMB 4J7WA 1KT0A 2WXKA 4AVXA 2F37A 3QNKA 1N95A 2KC7A 3PREA 2RD0A 2QC9A 3QARA 5C2YA 2A5UA 5FQ8A 4N39A 1KT1A 1MX6A 2J9QA 3PDNA 4FJYA 3TWVA 3Q75A 4AIFA 4G8LA 4I6JA 3LVRE 2WMNA 4BSXA 3VTYA 1OWMA 2AXUA 2KM4A 1SZ9A 5HS0A 5A23A 1DVPA 1IYGA 2WB2A 3BG0B 2MRIA 2VTBB 1FVHA 3FUDA 4UI9K 3CIAA 2IU1A 4J8EA 4GYWA 3BQOA 4B89A 3V30A 1O1RA 4GZDA 4CGVA 1W3BA 2L6JA 2NSZA 1Q2ZA 1QBQA 3ZU7B 4OVUA 5ANLA 3DRAA 5JJ7A 4UUCA 3SHFA 3CHRA 1RW2A 4A3TA 1BI8B 2WXGA 4KMOA 1QYMA 2WXJA 5G2NA 3NF1A 3BUAA 2QYJA 4YDWA 3EHMA 3OTNA 4LERA 4UQYA 4RQIA 5FIOA 3CEQA 4CDMA 3AS5A 2PZIA 3ASFA 1G3NB 3UT4A 5IY5E 2V4LA 1NL4A 3IXEA 4ACLA 2X38A 3OXFA 4UQXA 3EU9A 1NZNA 3E37A 1TNYA 2XPYA 3W9GA 1Z6TA 2E0IA 2WMOA 5CRUA 1WM5A 3UUXA 1UG3A 2ONDA 4JL0A 1E8WA 2QYUA 4FC8A 4LUNU 4KXKB 4N3BA 4CYMD 5JJTA 4AM9A 1AP7A 1O1SA 1IQRA 5CEAA 4IULA 1LTXA 3BEEA 3V2OA 4GTRA 3D3MA 1OT8A 3TWUA 1OY3D 3ZHEB 5B1BE 4DRXE 3CVYA 1N4SA 3B7BA 4UQZA 5AQ7A 1ELKA 4OVVA 2H6FA 3IKOB 2KXPC 3QKYA 3ASOE 3RU0A 5LFAA 1Y6IA 3FH5A 3CHPA 5FZQA 3F6QA 4PUCA 2ZIRA 3FEYA 3NZUA 2ETBA 4I2ZA 4F1SA 2J8SD 3HIZA 3JCKC 2EINE 3FH7A 3L13A 5ENRD 4GB9A 3UKUG 5FQ4A 2VSOE 3DSXA 4ILIA 3ABKE 2ZGGA 2Y4UA 5KNHD 5T4YA 3ESKA 1IHBA 4XE0A 3DSUA 3LJ3A 5LX8A 5ENSD 4LCTA 1TN8A 4DUIA 2UWJG 1N0RA 1HG5A 3HXEA 3KSQA 5G55A 3PH0C 3MV2B 4GTVA 2EIME 4G2VA 3FTWA 5FZRA 4FULA 4A1GA 1SZAA 5H7PA 2ETAA 2MHKA 3QJZA 3LDZA 3OXGA 5HQ8A 3AG1E 1ZU2A 3B13A 4MRUA 1UJKA 2R05A 5AENA 3FUJA 4WNDA 3EHQA 4Y6CA 3CV0A 3CVXA 4NURA 4UI9C 2GRPB 4A63B 5G04C 4W9RA 2IF4A 3CVUA 4D10C 3T9KA 5D0QD 3DEPA 3KS2A 3U64A 3APFA 4HFGA 4DJAA 2BUGA 1BU9A 3LEWA 2VSXE 1D8DA 4GA2A 1TR4A 1O5MA 2LAHA 1X5BA 4BSZB 4GTSA 3ZYKA 3LYAA 4U8YD 2L0TB 3SQVA 4BWRA 4RSYA 3DSSA 1JWFA 2AXZA 1ZB1A 2XZTG 1OXJA 2B0OE 1FPPA 1TNUA 4AV7A 1A5EA 3EIJA 2DWZA 4GMJA 5B1AE 3CHQA 5KJNA 3NZSA 3QWVA 3ZNGA 2OEWA 3AS4A 4GCOA 4DLQA 2OCCE 3Q15A 4I1AA 4U8HA 2YNQA 1UN8A 5AN8A 3ULQA 1H19A 5ENTD 1N54A 4F53A 3Q9NC 5ENNA 2Y4TA 4JD2G 4DX1A 1MX4A 4JB8P 1EYHA 5BXUA 4WUYA 4FADA 5AQBA 4TXPA 1L5JA 3MEKA 3JXJA 3SI5A 3D9HA 5LCWJ 3CK9A 1XNFA 3KEZA 1DCQA 4JA9A 2EILE 2BTDA 4JXTA 3EDTB 1TEZA 2DZNA 2NC9A 3Q78A 3ZEFA 1WAO1 4GPKA 1S70B 3I4RB 3EHRA 2B6CA 3BG1B 3P2BA 5HRYA 3FUKA 3E4BA 3UQ3A 1AWCB 1UOHA 4WNGA 4HLLA 3FUNA 1NI1A 4ANWA 3MZLB 4U8VD 2YHEA 4ABNA 1H0AA 4EBAA 3Q4AB 5BV1A 2YHCA 3JQ1A 3KEAA 2A5EA 4MS6A 4ZFHA 1MYOA 3PZ2A 3VLFA 4Q96A 4GU5A 4M7CA 2WQ7A 2I9CA 1HX8A 1HE8A 3TL5A 2A4ZA 1A17A 3ML9A 1ELRA 4YNDA 1FT1A 3IBEA 5ARGA 2HR2A 4WWNA 4XI0A 4DLOA 4I17A 4RG9A 3X2QE 1N4QA 2EIKE 3CK7A 2X3MA 3UIOC 3RSEG 3MA5A 3J5QB 2DIWA 3S7DA 3ASNE 2DCPA 2XGSA 2V5FA 3CLJA 3SBTB 4B94A 2R03A 2OVFA 2VGXA 1NA0A 1OCRE 3CKCA 3C98A 3UM0A 3S7FA 5C1DA 4YVQC 3G2VA 3SO8A 4IRUA 3PZ1A 4GA1A 4GTTA 1HH8A 1DC2A 4ANVA 2GRQB 2ILRA 4YVOA 3UKRG 3RKVA 1INZA 5J08A 3MKQA 1YA0A 2UY1A 5ARFA 2LNIA 2P9SG 2FF4A 3FEXA 4IYPA 5A7DB 4ANXA 4OAUC 2LSVA 5KCMA 3KD7A 3AS8A 1N9AA 2PM6A 3CVNA 1D8EA 3LXUX 3QDNA 1UJJA 4JC8A 4BFRA 3CVWA 4ATGA 1HU3A 3S2AA 4HI9A 3I5PA 4AP2A 3PNLB 2WPVA 3CVVA 3UT8A 3TXMA 3TJPA 4XX5A 5CBNA 2P9UG 2PNNA 3EUVA 5AYWD 2ZXWE 2WXMA 4UWHA 2P2CP 1YYHA 2J4DA 4UI9J 4GMRA 3D9LA 3SGHA 3UPVA 4I2WA 4J8SA 2X6FA 4O60A 4MKTA 3ZHEA 4DX5D 3JUIA 3QAQA 3LY9A 3DBSA 3QK0A 3UMVA 4PS7A 1EDUA 4B8AA 1Z5SC 1RZ4A 2ZU6B 3L08A 2LAIA 4LNGA 3EU5A 4TRQA 4XZ4A 3UT7A 3JQ0A 4I1MA 4DI3A 3MGBA 3QOUA 5E75A 3TWXA 4EZLA 2HE0A 1UW4B 2IONA 3B7RL 1TNBA 2WM9A 3FP3A 3NB2A 3J5PA 2JLBA 4YDYA 3B95A 5KJLA 3ZXPA 1OCZE 1V55E 2ETCA 2OV8A 3EJNA 2WXLA 2QFCA 2HYZA 3PZDA 3Q7FA 3D9OA 2WXOA 3GW4A 3TWRA 3PZ4A 4X8QA 2LUHA 3D9IA 3RRNB 4A1SA 2XPIA 3HG0D 4KZCA 3LJNA 1BLXB 3PZ3A 5EYLA 2P9KG 4JHRA 2VTBA 2PQNA 4FU3A 2Y1LE 1JWGA 4PS8A 2XPZA 5CRVA 4Q94A 1WDYA 5CHEE 3FUEA 1HXIA 2RG8A 5LCWC 4FHJA 5JHBA 3AJIA 3T8MA 1HF8A 4DX7D 5CEDB 3SFXA 2FULA 1OWPA 4KT6B 4U95D 2WXNA 3U4TA 3MYVA 3FU0A 5CCLA 3E34A 2GRRB 4FHKA 4V3IA 5FT9A 1E7VA 3S7JA 1HS6A 4O1OA 3FTSA 1S63A 1U3DA 3MJWA 4I6EA 3IHYA 4HI8A 1TNZA 2CFUA 4LEUA 2XEEA 5FQ6A 2IOSA 2FI7A 4JHJA 3Q73A 5CMYA 2KCVA 4RLYA 2V8SE 5EN5D 1U3CA 3MCXA 4HLEA 4YDOA 3VTXA 3D9JA 3CGHA 4UWKA 4J8DA 5EKQD 4ACKA 3SBSA 4WAFA 3G2TA 2YINA 3UIPC 4C48B 1PY1A 2KCLA 1TJCA 1P5QA 3HVEB 4FA6A 1LF8A 2V5QC 3FH8A 1N94A 3CSFA 4HNAD 3CQGB 2CG2A 1D9SA 4N2QA 1TYQG 3JYSA 3APCA 2CHXA 4WNEA 4RG6A 4I9EA 1FCHA 2E2EA 4GZ5A 4LG6A 5BNWA 1QQEA 4BEPA 1TNOA 2IOLA 3FTXA 4R7LA 2FEZA 2RKKA 4A3VA 1JPLA 4U07A 3FU3A 3G2SA 2FBNA 3DPYA 5CMWA 3JXIA 3PE4A 5ENQD 1JUQA 3L6AA 2R5SA 4CCAA 3W9FA 4CDNA 5AJDA 4BY6A 4GTPA 4U0SA 2RFAA 3T5XA 2M63A 1OCCE 2OEVA 3HDXA 1S64A 3CQCB 5KJKA 2UY1B 2IY0C 4HOQA 1IXVA 4BT9A 2GROB 3P1UA 1N4RA 4JA7A 3TWQA 3JUEA 4L2LA 3SFZA 5T3RA 5M72A 4FJZA 4HQDA 4JHKA 3ZYMA 2X6JA 4CEMA 3OXLA 4E6HA 4J8YA 2XHEA 3MV3B 1K8KG 3FTYA 3U9WA 3C72A 4P29A 3NOCD 4LRZA 1SA5A 2IEJA 2P9IG 1X81A 3LY8A 1KZOA 3L9TA 4GZ3A 2AW6A 1K1BA 3G2UA 4HORA 5DBKA 3ABLE 3UX4A 3NBNB 3WG7E 3V79K 3FULA 3ULEG 5BPPA 3FU6A 3CR3A 1H2TC 2BF0X 3FWVA 2GRMA 2Y69E 4L7TA 2P9PG 5FJYA 5EDSA 1OWOA 5KWDA 3ISMC 5G05J 1JCSA 2NYJA 1HZ4A 4OYSA 1H2UA 4EPZA 3RO2A 2GW1A 3NAWA 1E8YA 2P9LG 3L22A 2VGYA 2FO1E 2GRLA 4DX6D 3D9MA 3LS8A 1DNPA 2PM7A 3R9AB 2XS8A 5CECB 5EYPF 4KVMA 3C3RA 3FTZA 3KAEA 4L2YA 2VYIA 2F0YA 4RVBA 2IO3C 3IV0A 3ESLA 3C3QA 2XENA 2PQRA 4GZCA 2GRNB 2R2LA 3E30A 2XGMA 4JEUA 5FWQA 5AJLA 1PC2A 3FHEA 3L16A 4HRNA 4JEHA 5FINA 5J90A 4L9PA 3SFYA 2VJ8A 4URKA 2LO6A 1XGWA 2OOEA 4EHMA 2HO1A 4EBAG 4HS2A 2ZGDA 1BPOA 1QZ2A 4ZHBA 3LY7A 2KZTB 3BU8A 4CRWA 2J4BA 3DEOA 2WQ6A 1E7UA 3PE3A 2WXFA 2ZISA 3LPZA 3PUJA 1Z3YA 2WQHA 3CK8A 2WXQA 3R7QA 2KBXA 4DX2A 4ANUA 5JHAA 4AY5A 5D66A 3I4GA 2J49A 4KYOB 1MX2A 3MKRA 3ZKJA 1IKND 1S0PA 2RFMA 3HXDA 4FLHA 4BTAA 4GTQA 3L17A 4LSZE 5G05C 3ZYQA 2C0LA 1HFAA 4QFVA 4B93B 3MKQB 5CBOA 3HRAA 1H2VC 4EZKA 2V4HC 3LCAA 3UXGA 1QNFA 5BT1A 4GCNA 3O48A 4CT4A 3AG4E 4N5CA 4JPSA 2Q7FA 2VGEA 3E32A 3CVLA 3UM2A 4YDEA 3IEGA 4XIFA 2VSYA 1HO8A 4FLBA 2CHZA 1Y8MA 4OAVB 3SZ7A 2AWIA 4J8FA 2P58C 3QWPA 3VLEA 4C9BB 4I43A 3RK6A 4I6GA 3ZYLA 3HHMA 3DWLG 3ASDA 3ZN3A 5AQAA 4XI9A 3QC1A 4G11A 4K5AB 2L9BA 3PNTB 2X6IA 3GZ2A 2DVWA 2EIJE 4I1OB 2XEVA 2AVPA 5BV0A 3ZUVB 2AXVA 3K9IA 3RIBA 4NQ0A 1N52A 5G04J 2GGFA 2DBAA 2WXHA 5LOZA 4TV3A 3TG4A 3FY4A 4A55A 4EZJA 1OCOE 3V2XA 2JEKA 4U0ZA 3ZVVA 1GW6A 4ATZD 3ABME 1H6OA 2DYRE 2HM8A 3KSLA 4G25A 2X6HA 4TXRA 2VGXB 1UN9A 4PS3A 4H7YA 5BW8C 2Y0BG 5HKPA 3ZXSA 3RJVA 1NP7A 3VLDA 1JCQA 1NA3A 3UI2A 2IJGX 4HRLA 1NFIE 3SD5A 3FTVA 2LXMA 4F1PA 4JZYA 2H6GA 1YCSB 3T8KA 5ITZF 1KLXA 2C2LA 3GYZA 1WY6A 3Q9UC 4GPMA 3EIQC 3FDHA 2OVBA 1FVFA 1YMPA 2H6IA 4AEZC 3B7SA 3ZW3A 2J08A 2J09A 1IQUA 3ONLA 3FTUA 1EF1C 3QB2A 3T5VA 5DIZA 3ZRHA 1TN7A 3LVQE 3B7UX 3ENEA 5D0OD 3TWSA 4BERA 4G8KA 4CDRA 5JA4D 2XGOA 3GZ1A 2WXIA 4NACA 5EIBE 5EX0A 3HXCA 3AU5A 4HXIA 4GZ6A 3PEUB 3HXBA 4WWPA 4O6FA 3OAWA 3PVLA 3CVPA 3TWTA 3UINC 2I6HA 4XEIG 3Q47B 1SA4A 5A6CA 2C0MA 4G23A 3DXMG 4B0ZA 5EIDA 4BT8A 1IHGA 4GAAA 1TN6A 4N3AA 2MOWA 4UWGA 1WG0A 1N0QA 3CHOA 4E85A 1TJFA 5FZSA 4UWFA 4U0UA 3Q49B 4GYYA 2KCKA 1U2VG 2F8YA 3D9PA 4J6IA 1OWLA 3CKBA 3AAAC 2I2OA 1H6PA 4DK5A 2WVIA 3DXKG 1MQSA 2VSNA 3CHMA 3CSTA 4G26A 4N3CA 1MJ0A 2EQXA 3G2WA 3ZGQA 3TWWA 1OUVA 4KZ0A 1MHQA 2KATA 5CCMA 4U7EB 4XKBA 3GZSA 3RRUA 4LNUD 3TXNA 3DSVA 2BKKB 5ENPD 4G24A 3APDA 3ULYA 4AOFA 5HI7A 3CHSA 5B3SE 4C0EA 2BKGA 2P9NG 2DZOA 3CVQA 3U66A 3U3WA 5AAOA 5BXOA 3NOGD 3C5RA 3L82A 2CG3A 3FUFA 2JABA 5FQ7A 3UM3A 2H6HA 4I9CA 4QQIA 3EHNA 4BTBA 2PL2A 3UM1A 3DSWA 4J0UA 2V0PA 1ZBPA 1O1TA 3QWWA 4MBGA 3RO3A 3AG2E 4APOA 1H6KA 3B7TA 4H7XA 1BI7B 2XZDG 3ZFWA 1E96B 3ASHA 5ENOD 4F3VA 4DI4A 4N2SA 1EPUA 4ILGA 4PH4B 4CGWA 3FU5A 2I1JA 4HBDA 2J07A 4WWOA 3WXXA 2X6KA 4JVSA 5CERB 4U96D 5EX3A 4TUUA 3FUMA 1JCRA 4O1PA 2L0IA 4K03A 1K3ZD 2R02A 2IFUA 3AU4A 2XCCA 2XQ0A 3DPDA 1SQMA 3MX3A 1SVXA 2XEHA 1KZPA 3NQPA 4FP7A 2WXPA 3PEVB 4AJWA 4GYOA 4K0RA 5JMND 4IN3B 4B8CB 4HB5A 3FFLA 5EILA 4LNBA 4BX8A 4AXHA 4EQFA 2WXRA 1N11A 4APFA 3Q7AA 3HYMB 4HOUA 4XKCA 3Q79A 3ZPJA 3TAXA 3Q5MA 2R17C 2QZAA 4GA0A 2FO7A 3AG3E 3URZA 3TGOA 4EECA 4ME2A 4CT0A 5KJMA 3SY2A 2NXPA 4BESA 1VDYA 3ASGA 4JW1A 1PAQA 4K5CA 1HG2A 5JJ6A 4GTOA 3RAUA 4UWLA 3RRMB 5ANRA 4Y6WA 1Z3XA 2XRYA 3FUHA 3I3NA 2CFZA 1LD8A 2IO2C 1E8ZA 4ILHB 1MZCA 3D9KA 4Z68A 5AQ9A 4K5BA 3LKUA 1SW6A 2VQ2A 3IHVA 4Q69A 2BEDA 3ML8A 3PRZA 1V54E 4L23A 5E76A 3ONKA 4M3OA 3HXFA 2F8XK 4U63A 1BD8A 4DPRA 4BX9A 2LSUA 3S7BA 4CZ2D 4AY6A 2DYSE 3E33A 4HOSA 2R59A 3R7RA 3N71A 2YQ8A 2QY7A 4C0MA 4MLPA 2XCBA 2IQCA 5AIJA 5D2MC
chains in the Genus database with same CATH topology
4GCOA 2KZTA 3FU0A 5LOZA 4DLQA 5CCLA 4TV3A 4FHKA 3TG4A 3PUKA 4V3IA 3TG5A 3Q15A 5FT9A 1E7VA 3FY4A 4A55A 4EZJA 3S7JA 4I1AA 2JEKA 3L54A 4U0ZA 1HS6A 4U8HA 5T8IA 3ZVVA 2XRZA 2YNQA 1UN8A 3FTSA 1GW6A 1U3DA 3MJWA 4I6EA 3IHYA 3ULQA 2CFUA 1H19A 2Y3AA 3SNXA 4LEUA 1N54A 5FQ6A 2IOSA 2HM8A 4G25A 2X6HA 4F53A 2FI7A 2VGXB 4JHJA 1UN9A 4PS3A 4H7YA 2I1KA 5CMYA 2KCVA 5ENNA 5BW8C 4G1TA 2V8SE 2Y4TA 3ZIMA 4PDXA 1U3CA 4NRHB 3ZXSA 3RJVA 1NP7A 3MCXA 1EYHA 3O4ZA 4WUYA 3VLDA 4FADA 4HLEA 1NA3A 3VTXA 3D9JA 3CGHA 2IJGX 4HOTA 4HVBA 1E8XA 4UWKA 3SD5A 3FTVA 5FTPA 1L5JA 3MEKA 4J8DA 5EKQD 4ACKA 3SBSA 4WAFA 3SI5A 5LCWJ 3CK9A 1E90A 3G2TA 2YINA 4JZYA 2CHWA 1PY1A 4F7AA 3FUIA 1XNFA 3KEZA 4U04A 2KCLA 1KLXA 1TJCA 2C2LA 1P5QA 3GYZA 3HVEB 3HVEA 1WY6A 1LF8A 4JA9A 3PS6A 4FA6A 4L1BA 2BTDA 3EIQC 3FDHA 2OVBA 3FH8A 3SF4A 4JXTA 1OWNA 5BUZA 1FVFA 3CSFA 1ELWA 3D9NA 4WNFA 3CQGB 2CG2A 5LP0A 4N2QA 3JYSA 4GMLA 4AEZC 3B7SA 3ZW3A 4KBQA 3APCA 2J08A 3EDTB 1TEZA 2CHXA 2J09A 1IQUA 2NC9A 3ONLA 4RG6A 3FTUA 1EF1C 4WNEA 3QB2A 4I9EA 1B89A 3T5VA 5DIZA 4KVOA 3ZEFA 3ZRHA 1FCHA 1WAO1 2E2EA 4GZ5A 5BNWA 3LVQE 1QQEA 3B7UX 1KT0A 2WXKA 4AVXA 2IOLA 3QNKA 4GPKA 3FTXA 2KC7A 3PREA 2RD0A 3I4RB 3ENEA 3QARA 2FEZA 4R7LA 5C2YA 3BG1B 4A3VA 3P2BA 1JPLA 5D0OD 2A5UA 4U07A 5FQ8A 3FU3A 3FUKA 4N39A 3E4BA 2FBNA 1KT1A 3G2SA 4CDRA 5CMWA 3PE4A 3UQ3A 2XGOA 3GZ1A 1JUQA 2WXIA 2J9QA 4WNGA 3PDNA 4FJYA 4NACA 3FUNA 3L6AA 5EX0A 2R5SA 4CCAA 4AIFA 3AU5A 4I6JA 3LVRE 2WMNA 4GZ6A 4HXIA 4CDNA 5AJDA 4BSXA 4BY6A 3MZLB 4U0SA 1OWMA 3T5XA 3PEUB 3VTYA 2AXUA 2YHEA 4ABNA 4ANWA 2M63A 3HDXA 4WWPA 1H0AA 4EBAA 3Q4AB 3CQCB 2KM4A 1SZ9A 3OAWA 2UY1B 2YHCA 3JQ1A 4O6FA 3PVLA 5BV1A 3CVPA 4HOQA 5KJKA 4BT9A 2I6HA 4MS6A 1DVPA 5A23A 1IYGA 2WB2A 3VLFA 3P1UA 3BG0B 2MRIA 4Q96A 2VTBB 4JA7A 4GU5A 3Q47B 1FVHA 5A6CA 2WQ7A 3FUDA 4UI9K 2C0MA 4L2LA 3CIAA 3SFZA 5T3RA 2IU1A 4J8EA 4FJZA 5M72A 4G23A 4GYWA 2I9CA 4B0ZA 4B89A 4JHKA 3ZYMA 4BT8A 2X6JA 4CEMA 1HX8A 3OXLA 4E6HA 1IHGA 1HE8A 4GAAA 2XHEA 3TL5A 4GZDA 3MV3B 2A4ZA 1A17A 3ML9A 4CGVA 3FTYA 1W3BA 2L6JA 2NSZA 2MOWA 1ELRA 4N3AA 3U9WA 4P29A 4UWGA 4YNDA 4LRZA 3CHOA 3IBEA 4E85A 1TJFA 4OVUA 5ANLA 5FZSA 5JJ7A 3LY8A 5ARGA 2HR2A 3SHFA 3CHRA 4WWNA 4UWFA 4U0UA 3Q49B 4XI0A 4A3TA 4GZ3A 4KMOA 2WXGA 4DLOA 2AW6A 4GYYA 3G2UA 4I17A 5DBKA 4RG9A 4HORA 2WXJA 2KCKA 5G2NA 3CK7A 3NF1A 2X3MA 3UX4A 3D9PA 4J6IA 3FULA 1OWLA 3CKBA 5BPPA 2I2OA 3FU6A 4DK5A 3EHMA 3MA5A 3OTNA 4LERA 4UQYA 3CR3A 1H2TC 2WVIA 2DIWA 2BF0X 3S7DA 3FWVA 2GRMA 4L7TA 5FJYA 2DCPA 2XGSA 1MQSA 2VSNA 3CHMA 1OWOA 5EDSA 2V5FA 3CSTA 3CEQA 4G26A 4CDMA 3AS5A 3CLJA 4N3CA 2PZIA 3SBTB 2EQXA 5G05J 4B94A 3ASFA 3G2WA 1HZ4A 3ZGQA 2OVFA 2VGXA 1OUVA 3UT4A 4OYSA 1NA0A 4KZ0A 1MHQA 1H2UA 2V4LA 4EPZA 2KATA 3CKCA 3C98A 3RO2A 2GW1A 5CCMA 3S7FA 4XKBA 4ACLA 3GZSA 2X38A 1E8YA 3OXFA 5C1DA 3L22A 4UQXA 4YVQC 3RRUA 3TXNA 1NZNA 3G2VA 2VGYA 4IRUA 4G24A 4GA1A 2XPYA 1Z6TA 1HH8A 2E0IA 2WMOA 2GRLA 3APDA 1WM5A 4ANVA 3UUXA 1UG3A 2ILRA 3D9MA 4YVOA 3LS8A 2ONDA 1DNPA 4AOFA 5HI7A 2PM7A 3CHSA 3R9AB 4JL0A 1E8WA 3RKVA 1INZA 4FC8A 4LUNU 4KVMA 4C0EA 4KXKB 3FTZA 3KAEA 4N3BA 4L2YA 2VYIA 5J08A 3MKQA 4RVBA 5JJTA 1YA0A 3CVQA 2UY1A 4AM9A 3IV0A 3ESLA 5ARFA 2LNIA 3U66A 1IQRA 2FF4A 3U3WA 2PQRA 3FEXA 4IULA 4GZCA 4IYPA 3BEEA 5A7DB 4ANXA 2XGMA 2LSVA 3D3MA 4JEUA 5FWQA 5KCMA 2CG3A 3KD7A 5AJLA 3FUFA 1PC2A 3AS8A 3FHEA 3L16A 5FQ7A 2PM6A 3CVNA 3LXUX 3QDNA 4I9CA 3ZHEB 3EHNA 1UJJA 4JEHA 4JC8A 5J90A 4BTBA 2PL2A 4J0UA 2VJ8A 3CVYA 2V0PA 4BFRA 4URKA 3CVWA 1ZBPA 2LO6A 4ATGA 1XGWA 3QWWA 2OOEA 4UQZA 3RO3A 1HU3A 3S2AA 2HO1A 1ELKA 1H6KA 3B7TA 4OVVA 4APOA 4EBAG 3IKOB 3QKYA 4H7XA 3ZFWA 4HS2A 1E96B 3I5PA 3RU0A 1BPOA 4AP2A 3ASHA 3PNLB 2WPVA 1QZ2A 3CVVA 3UT8A 3TXMA 5LFAA 1Y6IA 3LY7A 3FH5A 3CHPA 3TJPA 4F3VA 4XX5A 4DI4A 4N2SA 2KZTB 1EPUA 4CRWA 2J4BA 4ILGA 4PH4B 5AYWD 4CGWA 2WXMA 3FU5A 2WQ6A 5FZQA 1E7UA 4UWHA 3PE3A 2I1JA 4PUCA 2J07A 2J4DA 4WWOA 3WXXA 2X6KA 2WXFA 3FEYA 4JVSA 4UI9J 3LPZA 3PUJA 3NZUA 1Z3YA 4I2ZA 4F1SA 3D9LA 5EX3A 2WQHA 3CK8A 3SGHA 3HIZA 3JCKC 3UPVA 4TUUA 3FUMA 2WXQA 3FH7A 3L13A 4I2WA 3R7QA 4ANUA 5JHAA 4AY5A 4J8SA 2L0IA 3I4GA 2X6FA 2J49A 4KYOB 4MKTA 4GB9A 3ZHEA 5FQ4A 2VSOE 3JUIA 4ILIA 4K03A 3MKRA 2Y4UA 2IFUA 3QAQA 3AU4A 2XCCA 3LY9A 2XQ0A 1S0PA 3DBSA 1SQMA 3DPDA 3MX3A 5T4YA 3NQPA 3ESKA 3QK0A 3UMVA 4FP7A 2WXPA 4PS7A 1EDUA 4B8AA 3PEVB 4AJWA 4XE0A 3LJ3A 5LX8A 4GYOA 2ZU6B 4FLHA 4K0RA 4BTAA 3L08A 4LCTA 2LAIA 3L17A 2UWJG 5G05C 3ZYQA 4TRQA 1HG5A 2C0LA 4IN3B 5G55A 3FFLA 4XZ4A 4B8CB 3UT7A 1HFAA 3PH0C 3JQ0A 4I1MA 3MV2B 4QFVA 4BX8A 3MGBA 4AXHA 4DI3A 4EQFA 2WXRA 3MKQB 4G2VA 3FTWA 5FZRA 4FULA 4A1GA 3QOUA 1H2VC 5E75A 1SZAA 4APFA 4EZKA 4EZLA 3HYMB 4HOUA 4XKCA 1UW4B 2MHKA 3LCAA 3QJZA 2IONA 3LDZA 3Q5MA 3TAXA 2R17C 3B7RL 3OXGA 3ZPJA 5HQ8A 2WM9A 3FP3A 1QNFA 1ZU2A 4GA0A 5BT1A 2FO7A 3B13A 4GCNA 4MRUA 3URZA 3TGOA 4EECA 4ME2A 3O48A 1UJKA 5AENA 4CT0A 2JLBA 3FUJA 4WNDA 5KJMA 2NXPA 5KJLA 4CT4A 4Y6CA 3CV0A 4N5CA 3CVXA 4NURA 1VDYA 4JPSA 4UI9C 2OV8A 3ASGA 2Q7FA 4JW1A 1PAQA 3CVLA 1HG2A 5JJ6A 3EJNA 2WXLA 2QFCA 3IEGA 4XIFA 5G04C 2HYZA 3PZDA 2VSYA 1HO8A 4W9RA 4FLBA 4UWLA 3RRMB 5ANRA 2IF4A 3CVUA 3D9OA 2CHZA 4Y6WA 1Z3XA 4D10C 2WXOA 1Y8MA 2XRYA 3GW4A 3FUHA 5D0QD 3SZ7A 3I3NA 2AWIA 3D9IA 2CFZA 4J8FA 3RRNB 3KS2A 2P58C 3U64A 4A1SA 2XPIA 3QWPA 4KZCA 3APFA 4I43A 4HFGA 3RK6A 3VLEA 4C9BB 1E8ZA 4I6GA 3ZYLA 4ILHB 2BUGA 4DJAA 4JHRA 3D9KA 3HHMA 3ASDA 3LEWA 2VTBA 2PQNA 4FU3A 3LKUA 3ZN3A 2VQ2A 2VSXE 4GA2A 4XI9A 3IHVA 4Q69A 3ML8A 3PRZA 4L23A 2LAHA 5E76A 1JWGA 3ONKA 4PS8A 1X5BA 2XPZA 3QC1A 4G11A 4M3OA 4Q94A 3ZYKA 5CHEE 4U63A 3FUEA 3LYAA 2L0TB 4BWRA 4DPRA 2L9BA 3PNTB 4RSYA 2X6IA 3GZ2A 1HXIA 1JWFA 2RG8A 2AXZA 4BX9A 4I1OB 2LSUA 3S7BA 2XEVA 4AY6A 2AVPA 5BV0A 5LCWC 2AXVA 4HOSA 3K9IA 2R59A 4AV7A 3R7RA 3N71A 4FHJA 5JHBA 3RIBA 2YQ8A 1HF8A 4NQ0A 1N52A 2QY7A 3T8MA 5G04J 4MLPA 3EIJA 4GMJA 4C0MA 3CHQA 5KJNA 3NZSA 2FULA 2GGFA 2XCBA 1OWPA 2IQCA 3QWVA 5AIJA 4KT6B 2WXNA 3U4TA 2DBAA 3MYVA 3AS4A 2WXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HI7 A;  4GCO A;  4GZ6 A;  3R9A B;  2UWJ G;  5G05 C;  4JL0 A;  3RKV A;  2C0L A;  4IN3 B;  4U0S A;  3FFL A;  3VTY A;  5CCL A;  4ABN A;  3TG4 A;  3MV2 B;  3TG5 A;  3Q15 A;  3KAE A;  4KXK B;  4N3B A;  5FT9 A;  4EQF A;  2VYI A;  3Q4A B;  4G2V A;  3S7J A;  4O6F A;  5FZR A;  5JJT A;  2UY1 B;  2YHC A;  1YA0 A;  3CVQ A;  2UY1 A;  4I1A A;  3CVP A;  3QOU A;  4HOQ A;  4U0Z A;  4AM9 A;  5ARF A;  2LNI A;  4BT9 A;  2I6H A;  3HYM B;  4HOU A;  1IYG A;  2FF4 A;  2MHK A;  2PQR A;  3U3W A;  3LCA A;  3TAX A;  3Q5M A;  5A7D B;  3BEE A;  3ULQ A;  3ZPJ A;  2XGM A;  3OXG A;  4JA7 A;  5HQ8 A;  3FP3 A;  2LSV A;  3Q47 B;  3U4T A;  5A6C A;  1ZU2 A;  4GA0 A;  4LEU A;  5BT1 A;  3KD7 A;  4UI9 K;  2FO7 A;  2C0M A;  4G25 A;  4GCN A;  3URZ A;  1PC2 A;  3AS8 A;  2FI7 A;  2VGX B;  4J8E A;  4G23 A;  4GYW A;  5M72 A;  3TGO A;  4ME2 A;  3O48 A;  4BT8 A;  5KJK A;  4H7Y A;  3CVN A;  3QDN A;  4I9C A;  3ZHE B;  2JLB A;  3OXL A;  4WND A;  1IHG A;  2KCV A;  5BW8 C;  4G1T A;  5KJM A;  2Y4T A;  5KJL A;  4A1S A;  4NRH B;  4Y6C A;  3CV0 A;  3MV3 B;  2PL2 A;  1A17 A;  4N5C A;  3RJV A;  4BTB A;  4CGV A;  1W3B A;  2L6J A;  3ASG A;  4J0U A;  1ELR A;  2Q7F A;  1NA3 A;  4N3A A;  4UI9 C;  4WUY A;  3CVL A;  5DBK A;  3VTX A;  5JJ6 A;  4HOT A;  1ZBP A;  4YND A;  3IEG A;  2QFC A;  4XIF A;  5G04 C;  2HYZ A;  3QWW A;  2OOE A;  4UQZ A;  2VSY A;  3RO3 A;  4W9R A;  5FTP A;  2HO1 A;  3MEK A;  5FZS A;  4APO A;  5JJ7 A;  3LY8 A;  4J8D A;  2IF4 A;  5ARG A;  2HR2 A;  5EKQ D;  5LCW J;  4Y6W A;  3QKY A;  3CK9 A;  4H7X A;  1Y8M A;  3GW4 A;  3ZFW A;  1E96 B;  4U0U A;  3Q49 B;  4XI0 A;  3RU0 A;  4GZ3 A;  5D0Q D;  3SZ7 A;  3ASH A;  2WPV A;  1QZ2 A;  4GYY A;  1XNF A;  4I17 A;  4J8F A;  3KS2 A;  2KCL A;  2P58 C;  4RG9 A;  1KLX A;  1TJC A;  2C2L A;  1P5Q A;  2KCK A;  2XPI A;  3GYZ A;  3LY7 A;  4F3V A;  3CK7 A;  3NF1 A;  4JA9 A;  3QWP A;  4N2S A;  3SF4 A;  2BUG A;  3CKB A;  4U04 A;  4JHR A;  5AYW D;  1ELW A;  4WNF A;  4CGW A;  3ASD A;  5FZQ A;  2PQN A;  3ZN3 A;  3LKU A;  3MA5 A;  3PE3 A;  3JYS A;  4UQY A;  4N2Q A;  2VQ2 A;  4GA2 A;  4XI9 A;  4KBQ A;  3S7D A;  3FWV A;  3WXX A;  3EDT B;  5FJY A;  4UI9 J;  2XGS A;  3LPZ A;  2VSN A;  2NC9 A;  4WNE A;  2V5F A;  4RG6 A;  4I2Z A;  3CEQ A;  4G26 A;  4I9E A;  5EX3 A;  1B89 A;  2WQH A;  3AS5 A;  3CK8 A;  4N3C A;  5DIZ A;  2PZI A;  1FCH A;  5G05 J;  1WAO 1;  2E2E A;  3ASF A;  4GZ5 A;  4B94 A;  5BNW A;  4I2W A;  3UPV A;  1HZ4 A;  1QQE A;  5CHE E;  3ZGQ A;  4AY5 A;  1KT0 A;  1OUV A;  2VGX A;  4BTA A;  1NA0 A;  3LYA A;  4BWR A;  2KAT A;  3CKC A;  4KYO B;  4GPK A;  2KC7 A;  3RO2 A;  3ZHE A;  3GZ2 A;  2GW1 A;  1HXI A;  5CCM A;  3S7F A;  2FEZ A;  4HOR A;  3MKR A;  2Y4U A;  2IFU A;  2LSU A;  3OXF A;  2XCC A;  3S7B A;  2XEV A;  3LY9 A;  2AVP A;  4UQX A;  5D0O D;  4YVQ C;  5C1D A;  5LCW C;  4AY6 A;  4U07 A;  1NZN A;  4HOS A;  3K9I A;  2VGY A;  4N39 A;  3E4B A;  2FBN A;  1KT1 A;  3ESK A;  3N71 A;  4G24 A;  4GA1 A;  3RIB A;  2YQ8 A;  4NQ0 A;  1HH8 A;  3PE4 A;  3UQ3 A;  5G04 J;  2XGO A;  4CDR A;  3GZ1 A;  5KJN A;  1WM5 A;  3QWV A;  2XCB A;  2J9Q A;  4WNG A;  3PDN A;  4AIF A;  4GYO A;  3UUX A;  5EX0 A;  2R5S A;  4YVO A;  2DBA A;  3AS4 A;  2OND A; 
#chains in the Genus database with same CATH topology
 5AAR A;  2KZT A;  3PUK A;  3TG5 A;  5KBA A;  3R9M A;  4GTM A;  3L54 A;  5T8I A;  2XRZ A;  4N5Q A;  1DCE A;  2Y3A A;  3SNX A;  1LD7 A;  4F6R D;  5KNG A;  2I1K A;  4G1T A;  3ZIM A;  4PDX A;  4NRH B;  3O4Z A;  4HOT A;  4TUM A;  4HVB A;  1E8X A;  5FTP A;  3DST A;  1E90 A;  2CHW A;  4F7A A;  3FUI A;  4U04 A;  1K1A A;  3HVE A;  4TXQ A;  3PS6 A;  4L1B A;  4NIK A;  3SF4 A;  1FT2 A;  1OWN A;  5BUZ A;  1ELW A;  2L6B A;  3D9N A;  4WNF A;  5LP0 A;  1KPS B;  2AJA A;  4GML A;  2MYO A;  2LXL A;  4KBQ A;  3UTM A;  3V31 A;  4BET A;  3C3O A;  2XS1 A;  1N4P A;  1B89 A;  4KVO A;  4HRM B;  4J7W A;  1KT0 A;  2WXK A;  4AVX A;  2F37 A;  3QNK A;  1N95 A;  2KC7 A;  3PRE A;  2RD0 A;  2QC9 A;  3QAR A;  5C2Y A;  2A5U A;  5FQ8 A;  4N39 A;  1KT1 A;  1MX6 A;  2J9Q A;  3PDN A;  4FJY A;  3TWV A;  3Q75 A;  4AIF A;  4G8L A;  4I6J A;  3LVR E;  2WMN A;  4BSX A;  3VTY A;  1OWM A;  2AXU A;  2KM4 A;  1SZ9 A;  5HS0 A;  5A23 A;  1DVP A;  1IYG A;  2WB2 A;  3BG0 B;  2MRI A;  2VTB B;  1FVH A;  3FUD A;  4UI9 K;  3CIA A;  2IU1 A;  4J8E A;  4GYW A;  3BQO A;  4B89 A;  3V30 A;  1O1R A;  4GZD A;  4CGV A;  1W3B A;  2L6J A;  2NSZ A;  1Q2Z A;  1QBQ A;  3ZU7 B;  4OVU A;  5ANL A;  3DRA A;  5JJ7 A;  4UUC A;  3SHF A;  3CHR A;  1RW2 A;  4A3T A;  1BI8 B;  2WXG A;  4KMO A;  1QYM A;  2WXJ A;  5G2N A;  3NF1 A;  3BUA A;  2QYJ A;  4YDW A;  3EHM A;  3OTN A;  4LER A;  4UQY A;  4RQI A;  5FIO A;  3CEQ A;  4CDM A;  3AS5 A;  2PZI A;  3ASF A;  1G3N B;  3UT4 A;  5IY5 E;  2V4L A;  1NL4 A;  3IXE A;  4ACL A;  2X38 A;  3OXF A;  4UQX A;  3EU9 A;  1NZN A;  3E37 A;  1TNY A;  2XPY A;  3W9G A;  1Z6T A;  2E0I A;  2WMO A;  5CRU A;  1WM5 A;  3UUX A;  1UG3 A;  2OND A;  4JL0 A;  1E8W A;  2QYU A;  4FC8 A;  4LUN U;  4KXK B;  4N3B A;  4CYM D;  5JJT A;  4AM9 A;  1AP7 A;  1O1S A;  1IQR A;  5CEA A;  4IUL A;  1LTX A;  3BEE A;  3V2O A;  4GTR A;  3D3M A;  1OT8 A;  3TWU A;  1OY3 D;  3ZHE B;  5B1B E;  4DRX E;  3CVY A;  1N4S A;  3B7B A;  4UQZ A;  5AQ7 A;  1ELK A;  4OVV A;  2H6F A;  3IKO B;  2KXP C;  3QKY A;  3ASO E;  3RU0 A;  5LFA A;  1Y6I A;  3FH5 A;  3CHP A;  5FZQ A;  3F6Q A;  4PUC A;  2ZIR A;  3FEY A;  3NZU A;  2ETB A;  4I2Z A;  4F1S A;  2J8S D;  3HIZ A;  3JCK C;  2EIN E;  3FH7 A;  3L13 A;  5ENR D;  4GB9 A;  3UKU G;  5FQ4 A;  2VSO E;  3DSX A;  4ILI A;  3ABK E;  2ZGG A;  2Y4U A;  5KNH D;  5T4Y A;  3ESK A;  1IHB A;  4XE0 A;  3DSU A;  3LJ3 A;  5LX8 A;  5ENS D;  4LCT A;  1TN8 A;  4DUI A;  2UWJ G;  1N0R A;  1HG5 A;  3HXE A;  3KSQ A;  5G55 A;  3PH0 C;  3MV2 B;  4GTV A;  2EIM E;  4G2V A;  3FTW A;  5FZR A;  4FUL A;  4A1G A;  1SZA A;  5H7P A;  2ETA A;  2MHK A;  3QJZ A;  3LDZ A;  3OXG A;  5HQ8 A;  3AG1 E;  1ZU2 A;  3B13 A;  4MRU A;  1UJK A;  2R05 A;  5AEN A;  3FUJ A;  4WND A;  3EHQ A;  4Y6C A;  3CV0 A;  3CVX A;  4NUR A;  4UI9 C;  2GRP B;  4A63 B;  5G04 C;  4W9R A;  2IF4 A;  3CVU A;  4D10 C;  3T9K A;  5D0Q D;  3DEP A;  3KS2 A;  3U64 A;  3APF A;  4HFG A;  4DJA A;  2BUG A;  1BU9 A;  3LEW A;  2VSX E;  1D8D A;  4GA2 A;  1TR4 A;  1O5M A;  2LAH A;  1X5B A;  4BSZ B;  4GTS A;  3ZYK A;  3LYA A;  4U8Y D;  2L0T B;  3SQV A;  4BWR A;  4RSY A;  3DSS A;  1JWF A;  2AXZ A;  1ZB1 A;  2XZT G;  1OXJ A;  2B0O E;  1FPP A;  1TNU A;  4AV7 A;  1A5E A;  3EIJ A;  2DWZ A;  4GMJ A;  5B1A E;  3CHQ A;  5KJN A;  3NZS A;  3QWV A;  3ZNG A;  2OEW A;  3AS4 A;  4GCO A;  4DLQ A;  2OCC E;  3Q15 A;  4I1A A;  4U8H A;  2YNQ A;  1UN8 A;  5AN8 A;  3ULQ A;  1H19 A;  5ENT D;  1N54 A;  4F53 A;  3Q9N C;  5ENN A;  2Y4T A;  4JD2 G;  4DX1 A;  1MX4 A;  4JB8 P;  1EYH A;  5BXU A;  4WUY A;  4FAD A;  5AQB A;  4TXP A;  1L5J A;  3MEK A;  3JXJ A;  3SI5 A;  3D9H A;  5LCW J;  3CK9 A;  1XNF A;  3KEZ A;  1DCQ A;  4JA9 A;  2EIL E;  2BTD A;  4JXT A;  3EDT B;  1TEZ A;  2DZN A;  2NC9 A;  3Q78 A;  3ZEF A;  1WAO 1;  4GPK A;  1S70 B;  3I4R B;  3EHR A;  2B6C A;  3BG1 B;  3P2B A;  5HRY A;  3FUK A;  3E4B A;  3UQ3 A;  1AWC B;  1UOH A;  4WNG A;  4HLL A;  3FUN A;  1NI1 A;  4ANW A;  3MZL B;  4U8V D;  2YHE A;  4ABN A;  1H0A A;  4EBA A;  3Q4A B;  5BV1 A;  2YHC A;  3JQ1 A;  3KEA A;  2A5E A;  4MS6 A;  4ZFH A;  1MYO A;  3PZ2 A;  3VLF A;  4Q96 A;  4GU5 A;  4M7C A;  2WQ7 A;  2I9C A;  1HX8 A;  1HE8 A;  3TL5 A;  2A4Z A;  1A17 A;  3ML9 A;  1ELR A;  4YND A;  1FT1 A;  3IBE A;  5ARG A;  2HR2 A;  4WWN A;  4XI0 A;  4DLO A;  4I17 A;  4RG9 A;  3X2Q E;  1N4Q A;  2EIK E;  3CK7 A;  2X3M A;  3UIO C;  3RSE G;  3MA5 A;  3J5Q B;  2DIW A;  3S7D A;  3ASN E;  2DCP A;  2XGS A;  2V5F A;  3CLJ A;  3SBT B;  4B94 A;  2R03 A;  2OVF A;  2VGX A;  1NA0 A;  1OCR E;  3CKC A;  3C98 A;  3UM0 A;  3S7F A;  5C1D A;  4YVQ C;  3G2V A;  3SO8 A;  4IRU A;  3PZ1 A;  4GA1 A;  4GTT A;  1HH8 A;  1DC2 A;  4ANV A;  2GRQ B;  2ILR A;  4YVO A;  3UKR G;  3RKV A;  1INZ A;  5J08 A;  3MKQ A;  1YA0 A;  2UY1 A;  5ARF A;  2LNI A;  2P9S G;  2FF4 A;  3FEX A;  4IYP A;  5A7D B;  4ANX A;  4OAU C;  2LSV A;  5KCM A;  3KD7 A;  3AS8 A;  1N9A A;  2PM6 A;  3CVN A;  1D8E A;  3LXU X;  3QDN A;  1UJJ A;  4JC8 A;  4BFR A;  3CVW A;  4ATG A;  1HU3 A;  3S2A A;  4HI9 A;  3I5P A;  4AP2 A;  3PNL B;  2WPV A;  3CVV A;  3UT8 A;  3TXM A;  3TJP A;  4XX5 A;  5CBN A;  2P9U G;  2PNN A;  3EUV A;  5AYW D;  2ZXW E;  2WXM A;  4UWH A;  2P2C P;  1YYH A;  2J4D A;  4UI9 J;  4GMR A;  3D9L A;  3SGH A;  3UPV A;  4I2W A;  4J8S A;  2X6F A;  4O60 A;  4MKT A;  3ZHE A;  4DX5 D;  3JUI A;  3QAQ A;  3LY9 A;  3DBS A;  3QK0 A;  3UMV A;  4PS7 A;  1EDU A;  4B8A A;  1Z5S C;  1RZ4 A;  2ZU6 B;  3L08 A;  2LAI A;  4LNG A;  3EU5 A;  4TRQ A;  4XZ4 A;  3UT7 A;  3JQ0 A;  4I1M A;  4DI3 A;  3MGB A;  3QOU A;  5E75 A;  3TWX A;  4EZL A;  2HE0 A;  1UW4 B;  2ION A;  3B7R L;  1TNB A;  2WM9 A;  3FP3 A;  3NB2 A;  3J5P A;  2JLB A;  4YDY A;  3B95 A;  5KJL A;  3ZXP A;  1OCZ E;  1V55 E;  2ETC A;  2OV8 A;  3EJN A;  2WXL A;  2QFC A;  2HYZ A;  3PZD A;  3Q7F A;  3D9O A;  2WXO A;  3GW4 A;  3TWR A;  3PZ4 A;  4X8Q A;  2LUH A;  3D9I A;  3RRN B;  4A1S A;  2XPI A;  3HG0 D;  4KZC A;  3LJN A;  1BLX B;  3PZ3 A;  5EYL A;  2P9K G;  4JHR A;  2VTB A;  2PQN A;  4FU3 A;  2Y1L E;  1JWG A;  4PS8 A;  2XPZ A;  5CRV A;  4Q94 A;  1WDY A;  5CHE E;  3FUE A;  1HXI A;  2RG8 A;  5LCW C;  4FHJ A;  5JHB A;  3AJI A;  3T8M A;  1HF8 A;  4DX7 D;  5CED B;  3SFX A;  2FUL A;  1OWP A;  4KT6 B;  4U95 D;  2WXN A;  3U4T A;  3MYV A;  3FU0 A;  5CCL A;  3E34 A;  2GRR B;  4FHK A;  4V3I A;  5FT9 A;  1E7V A;  3S7J A;  1HS6 A;  4O1O A;  3FTS A;  1S63 A;  1U3D A;  3MJW A;  4I6E A;  3IHY A;  4HI8 A;  1TNZ A;  2CFU A;  4LEU A;  2XEE A;  5FQ6 A;  2IOS A;  2FI7 A;  4JHJ A;  3Q73 A;  5CMY A;  2KCV A;  4RLY A;  2V8S E;  5EN5 D;  1U3C A;  3MCX A;  4HLE A;  4YDO A;  3VTX A;  3D9J A;  3CGH A;  4UWK A;  4J8D A;  5EKQ D;  4ACK A;  3SBS A;  4WAF A;  3G2T A;  2YIN A;  3UIP C;  4C48 B;  1PY1 A;  2KCL A;  1TJC A;  1P5Q A;  3HVE B;  4FA6 A;  1LF8 A;  2V5Q C;  3FH8 A;  1N94 A;  3CSF A;  4HNA D;  3CQG B;  2CG2 A;  1D9S A;  4N2Q A;  1TYQ G;  3JYS A;  3APC A;  2CHX A;  4WNE A;  4RG6 A;  4I9E A;  1FCH A;  2E2E A;  4GZ5 A;  4LG6 A;  5BNW A;  1QQE A;  4BEP A;  1TNO A;  2IOL A;  3FTX A;  4R7L A;  2FEZ A;  2RKK A;  4A3V A;  1JPL A;  4U07 A;  3FU3 A;  3G2S A;  2FBN A;  3DPY A;  5CMW A;  3JXI A;  3PE4 A;  5ENQ D;  1JUQ A;  3L6A A;  2R5S A;  4CCA A;  3W9F A;  4CDN A;  5AJD A;  4BY6 A;  4GTP A;  4U0S A;  2RFA A;  3T5X A;  2M63 A;  1OCC E;  2OEV A;  3HDX A;  1S64 A;  3CQC B;  5KJK A;  2UY1 B;  2IY0 C;  4HOQ A;  1IXV A;  4BT9 A;  2GRO B;  3P1U A;  1N4R A;  4JA7 A;  3TWQ A;  3JUE A;  4L2L A;  3SFZ A;  5T3R A;  5M72 A;  4FJZ A;  4HQD A;  4JHK A;  3ZYM A;  2X6J A;  4CEM A;  3OXL A;  4E6H A;  4J8Y A;  2XHE A;  3MV3 B;  1K8K G;  3FTY A;  3U9W A;  3C72 A;  4P29 A;  3NOC D;  4LRZ A;  1SA5 A;  2IEJ A;  2P9I G;  1X81 A;  3LY8 A;  1KZO A;  3L9T A;  4GZ3 A;  2AW6 A;  1K1B A;  3G2U A;  4HOR A;  5DBK A;  3ABL E;  3UX4 A;  3NBN B;  3WG7 E;  3V79 K;  3FUL A;  3ULE G;  5BPP A;  3FU6 A;  3CR3 A;  1H2T C;  2BF0 X;  3FWV A;  2GRM A;  2Y69 E;  4L7T A;  2P9P G;  5FJY A;  5EDS A;  1OWO A;  5KWD A;  3ISM C;  5G05 J;  1JCS A;  2NYJ A;  1HZ4 A;  4OYS A;  1H2U A;  4EPZ A;  3RO2 A;  2GW1 A;  3NAW A;  1E8Y A;  2P9L G;  3L22 A;  2VGY A;  2FO1 E;  2GRL A;  4DX6 D;  3D9M A;  3LS8 A;  1DNP A;  2PM7 A;  3R9A B;  2XS8 A;  5CEC B;  5EYP F;  4KVM A;  3C3R A;  3FTZ A;  3KAE A;  4L2Y A;  2VYI A;  2F0Y A;  4RVB A;  2IO3 C;  3IV0 A;  3ESL A;  3C3Q A;  2XEN A;  2PQR A;  4GZC A;  2GRN B;  2R2L A;  3E30 A;  2XGM A;  4JEU A;  5FWQ A;  5AJL A;  1PC2 A;  3FHE A;  3L16 A;  4HRN A;  4JEH A;  5FIN A;  5J90 A;  4L9P A;  3SFY A;  2VJ8 A;  4URK A;  2LO6 A;  1XGW A;  2OOE A;  4EHM A;  2HO1 A;  4EBA G;  4HS2 A;  2ZGD A;  1BPO A;  1QZ2 A;  4ZHB A;  3LY7 A;  2KZT B;  3BU8 A;  4CRW A;  2J4B A;  3DEO A;  2WQ6 A;  1E7U A;  3PE3 A;  2WXF A;  2ZIS A;  3LPZ A;  3PUJ A;  1Z3Y A;  2WQH A;  3CK8 A;  2WXQ A;  3R7Q A;  2KBX A;  4DX2 A;  4ANU A;  5JHA A;  4AY5 A;  5D66 A;  3I4G A;  2J49 A;  4KYO B;  1MX2 A;  3MKR A;  3ZKJ A;  1IKN D;  1S0P A;  2RFM A;  3HXD A;  4FLH A;  4BTA A;  4GTQ A;  3L17 A;  4LSZ E;  5G05 C;  3ZYQ A;  2C0L A;  1HFA A;  4QFV A;  4B93 B;  3MKQ B;  5CBO A;  3HRA A;  1H2V C;  4EZK A;  2V4H C;  3LCA A;  3UXG A;  1QNF A;  5BT1 A;  4GCN A;  3O48 A;  4CT4 A;  3AG4 E;  4N5C A;  4JPS A;  2Q7F A;  2VGE A;  3E32 A;  3CVL A;  3UM2 A;  4YDE A;  3IEG A;  4XIF A;  2VSY A;  1HO8 A;  4FLB A;  2CHZ A;  1Y8M A;  4OAV B;  3SZ7 A;  2AWI A;  4J8F A;  2P58 C;  3QWP A;  3VLE A;  4C9B B;  4I43 A;  3RK6 A;  4I6G A;  3ZYL A;  3HHM A;  3DWL G;  3ASD A;  3ZN3 A;  5AQA A;  4XI9 A;  3QC1 A;  4G11 A;  4K5A B;  2L9B A;  3PNT B;  2X6I A;  3GZ2 A;  2DVW A;  2EIJ E;  4I1O B;  2XEV A;  2AVP A;  5BV0 A;  3ZUV B;  2AXV A;  3K9I A;  3RIB A;  4NQ0 A;  1N52 A;  5G04 J;  2GGF A;  2DBA A;  2WXH A;  5LOZ A;  4TV3 A;  3TG4 A;  3FY4 A;  4A55 A;  4EZJ A;  1OCO E;  3V2X A;  2JEK A;  4U0Z A;  3ZVV A;  1GW6 A;  4ATZ D;  3ABM E;  1H6O A;  2DYR E;  2HM8 A;  3KSL A;  4G25 A;  2X6H A;  4TXR A;  2VGX B;  1UN9 A;  4PS3 A;  4H7Y A;  5BW8 C;  2Y0B G;  5HKP A;  3ZXS A;  3RJV A;  1NP7 A;  3VLD A;  1JCQ A;  1NA3 A;  3UI2 A;  2IJG X;  4HRL A;  1NFI E;  3SD5 A;  3FTV A;  2LXM A;  4F1P A;  4JZY A;  2H6G A;  1YCS B;  3T8K A;  5ITZ F;  1KLX A;  2C2L A;  3GYZ A;  1WY6 A;  3Q9U C;  4GPM A;  3EIQ C;  3FDH A;  2OVB A;  1FVF A;  1YMP A;  2H6I A;  4AEZ C;  3B7S A;  3ZW3 A;  2J08 A;  2J09 A;  1IQU A;  3ONL A;  3FTU A;  1EF1 C;  3QB2 A;  3T5V A;  5DIZ A;  3ZRH A;  1TN7 A;  3LVQ E;  3B7U X;  3ENE A;  5D0O D;  3TWS A;  4BER A;  4G8K A;  4CDR A;  5JA4 D;  2XGO A;  3GZ1 A;  2WXI A;  4NAC A;  5EIB E;  5EX0 A;  3HXC A;  3AU5 A;  4HXI A;  4GZ6 A;  3PEU B;  3HXB A;  4WWP A;  4O6F A;  3OAW A;  3PVL A;  3CVP A;  3TWT A;  3UIN C;  2I6H A;  4XEI G;  3Q47 B;  1SA4 A;  5A6C A;  2C0M A;  4G23 A;  3DXM G;  4B0Z A;  5EID A;  4BT8 A;  1IHG A;  4GAA A;  1TN6 A;  4N3A A;  2MOW A;  4UWG A;  1WG0 A;  1N0Q A;  3CHO A;  4E85 A;  1TJF A;  5FZS A;  4UWF A;  4U0U A;  3Q49 B;  4GYY A;  2KCK A;  1U2V G;  2F8Y A;  3D9P A;  4J6I A;  1OWL A;  3CKB A;  3AAA C;  2I2O A;  1H6P A;  4DK5 A;  2WVI A;  3DXK G;  1MQS A;  2VSN A;  3CHM A;  3CST A;  4G26 A;  4N3C A;  1MJ0 A;  2EQX A;  3G2W A;  3ZGQ A;  3TWW A;  1OUV A;  4KZ0 A;  1MHQ A;  2KAT A;  5CCM A;  4U7E B;  4XKB A;  3GZS A;  3RRU A;  4LNU D;  3TXN A;  3DSV A;  2BKK B;  5ENP D;  4G24 A;  3APD A;  3ULY A;  4AOF A;  5HI7 A;  3CHS A;  5B3S E;  4C0E A;  2BKG A;  2P9N G;  2DZO A;  3CVQ A;  3U66 A;  3U3W A;  5AAO A;  5BXO A;  3NOG D;  3C5R A;  3L82 A;  2CG3 A;  3FUF A;  2JAB A;  5FQ7 A;  3UM3 A;  2H6H A;  4I9C A;  4QQI A;  3EHN A;  4BTB A;  2PL2 A;  3UM1 A;  3DSW A;  4J0U A;  2V0P A;  1ZBP A;  1O1T A;  3QWW A;  4MBG A;  3RO3 A;  3AG2 E;  4APO A;  1H6K A;  3B7T A;  4H7X A;  1BI7 B;  2XZD G;  3ZFW A;  1E96 B;  3ASH A;  5ENO D;  4F3V A;  4DI4 A;  4N2S A;  1EPU A;  4ILG A;  4PH4 B;  4CGW A;  3FU5 A;  2I1J A;  4HBD A;  2J07 A;  4WWO A;  3WXX A;  2X6K A;  4JVS A;  5CER B;  4U96 D;  5EX3 A;  4TUU A;  3FUM A;  1JCR A;  4O1P A;  2L0I A;  4K03 A;  1K3Z D;  2R02 A;  2IFU A;  3AU4 A;  2XCC A;  2XQ0 A;  3DPD A;  1SQM A;  3MX3 A;  1SVX A;  2XEH A;  1KZP A;  3NQP A;  4FP7 A;  2WXP A;  3PEV B;  4AJW A;  4GYO A;  4K0R A;  5JMN D;  4IN3 B;  4B8C B;  4HB5 A;  3FFL A;  5EIL A;  4LNB A;  4BX8 A;  4AXH A;  4EQF A;  2WXR A;  1N11 A;  4APF A;  3Q7A A;  3HYM B;  4HOU A;  4XKC A;  3Q79 A;  3ZPJ A;  3TAX A;  3Q5M A;  2R17 C;  2QZA A;  4GA0 A;  2FO7 A;  3AG3 E;  3URZ A;  3TGO A;  4EEC A;  4ME2 A;  4CT0 A;  5KJM A;  3SY2 A;  2NXP A;  4BES A;  1VDY A;  3ASG A;  4JW1 A;  1PAQ A;  4K5C A;  1HG2 A;  5JJ6 A;  4GTO A;  3RAU A;  4UWL A;  3RRM B;  5ANR A;  4Y6W A;  1Z3X A;  2XRY A;  3FUH A;  3I3N A;  2CFZ A;  1LD8 A;  2IO2 C;  1E8Z A;  4ILH B;  1MZC A;  3D9K A;  4Z68 A;  5AQ9 A;  4K5B A;  3LKU A;  1SW6 A;  2VQ2 A;  3IHV A;  4Q69 A;  2BED A;  3ML8 A;  3PRZ A;  1V54 E;  4L23 A;  5E76 A;  3ONK A;  4M3O A;  3HXF A;  2F8X K;  4U63 A;  1BD8 A;  4DPR A;  4BX9 A;  2LSU A;  3S7B A;  4CZ2 D;  4AY6 A;  2DYS E;  3E33 A;  4HOS A;  2R59 A;  3R7R A;  3N71 A;  2YQ8 A;  2QY7 A;  4C0M A;  4MLP A;  2XCB A;  2IQC A;  5AIJ A;  5D2M C; 
#chains in the Genus database with same CATH homology
 4GCO A;  2KZT A;  3FU0 A;  5LOZ A;  4DLQ A;  5CCL A;  4TV3 A;  4FHK A;  3TG4 A;  3PUK A;  4V3I A;  3TG5 A;  3Q15 A;  5FT9 A;  1E7V A;  3FY4 A;  4A55 A;  4EZJ A;  3S7J A;  4I1A A;  2JEK A;  3L54 A;  4U0Z A;  1HS6 A;  4U8H A;  5T8I A;  3ZVV A;  2XRZ A;  2YNQ A;  1UN8 A;  3FTS A;  1GW6 A;  1U3D A;  3MJW A;  4I6E A;  3IHY A;  3ULQ A;  2CFU A;  1H19 A;  2Y3A A;  3SNX A;  4LEU A;  1N54 A;  5FQ6 A;  2IOS A;  2HM8 A;  4G25 A;  2X6H A;  4F53 A;  2FI7 A;  2VGX B;  4JHJ A;  1UN9 A;  4PS3 A;  4H7Y A;  2I1K A;  5CMY A;  2KCV A;  5ENN A;  5BW8 C;  4G1T A;  2V8S E;  2Y4T A;  3ZIM A;  4PDX A;  1U3C A;  4NRH B;  3ZXS A;  3RJV A;  1NP7 A;  3MCX A;  1EYH A;  3O4Z A;  4WUY A;  3VLD A;  4FAD A;  4HLE A;  1NA3 A;  3VTX A;  3D9J A;  3CGH A;  2IJG X;  4HOT A;  4HVB A;  1E8X A;  4UWK A;  3SD5 A;  3FTV A;  5FTP A;  1L5J A;  3MEK A;  4J8D A;  5EKQ D;  4ACK A;  3SBS A;  4WAF A;  3SI5 A;  5LCW J;  3CK9 A;  1E90 A;  3G2T A;  2YIN A;  4JZY A;  2CHW A;  1PY1 A;  4F7A A;  3FUI A;  1XNF A;  3KEZ A;  4U04 A;  2KCL A;  1KLX A;  1TJC A;  2C2L A;  1P5Q A;  3GYZ A;  3HVE B;  3HVE A;  1WY6 A;  1LF8 A;  4JA9 A;  3PS6 A;  4FA6 A;  4L1B A;  2BTD A;  3EIQ C;  3FDH A;  2OVB A;  3FH8 A;  3SF4 A;  4JXT A;  1OWN A;  5BUZ A;  1FVF A;  3CSF A;  1ELW A;  3D9N A;  4WNF A;  3CQG B;  2CG2 A;  5LP0 A;  4N2Q A;  3JYS A;  4GML A;  4AEZ C;  3B7S A;  3ZW3 A;  4KBQ A;  3APC A;  2J08 A;  3EDT B;  1TEZ A;  2CHX A;  2J09 A;  1IQU A;  2NC9 A;  3ONL A;  4RG6 A;  3FTU A;  1EF1 C;  4WNE A;  3QB2 A;  4I9E A;  1B89 A;  3T5V A;  5DIZ A;  4KVO A;  3ZEF A;  3ZRH A;  1FCH A;  1WAO 1;  2E2E A;  4GZ5 A;  5BNW A;  3LVQ E;  1QQE A;  3B7U X;  1KT0 A;  2WXK A;  4AVX A;  2IOL A;  3QNK A;  4GPK A;  3FTX A;  2KC7 A;  3PRE A;  2RD0 A;  3I4R B;  3ENE A;  3QAR A;  2FEZ A;  4R7L A;  5C2Y A;  3BG1 B;  4A3V A;  3P2B A;  1JPL A;  5D0O D;  2A5U A;  4U07 A;  5FQ8 A;  3FU3 A;  3FUK A;  4N39 A;  3E4B A;  2FBN A;  1KT1 A;  3G2S A;  4CDR A;  5CMW A;  3PE4 A;  3UQ3 A;  2XGO A;  3GZ1 A;  1JUQ A;  2WXI A;  2J9Q A;  4WNG A;  3PDN A;  4FJY A;  4NAC A;  3FUN A;  3L6A A;  5EX0 A;  2R5S A;  4CCA A;  4AIF A;  3AU5 A;  4I6J A;  3LVR E;  2WMN A;  4GZ6 A;  4HXI A;  4CDN A;  5AJD A;  4BSX A;  4BY6 A;  3MZL B;  4U0S A;  1OWM A;  3T5X A;  3PEU B;  3VTY A;  2AXU A;  2YHE A;  4ABN A;  4ANW A;  2M63 A;  3HDX A;  4WWP A;  1H0A A;  4EBA A;  3Q4A B;  3CQC B;  2KM4 A;  1SZ9 A;  3OAW A;  2UY1 B;  2YHC A;  3JQ1 A;  4O6F A;  3PVL A;  5BV1 A;  3CVP A;  4HOQ A;  5KJK A;  4BT9 A;  2I6H A;  4MS6 A;  1DVP A;  5A23 A;  1IYG A;  2WB2 A;  3VLF A;  3P1U A;  3BG0 B;  2MRI A;  4Q96 A;  2VTB B;  4JA7 A;  4GU5 A;  3Q47 B;  1FVH A;  5A6C A;  2WQ7 A;  3FUD A;  4UI9 K;  2C0M A;  4L2L A;  3CIA A;  3SFZ A;  5T3R A;  2IU1 A;  4J8E A;  4FJZ A;  5M72 A;  4G23 A;  4GYW A;  2I9C A;  4B0Z A;  4B89 A;  4JHK A;  3ZYM A;  4BT8 A;  2X6J A;  4CEM A;  1HX8 A;  3OXL A;  4E6H A;  1IHG A;  1HE8 A;  4GAA A;  2XHE A;  3TL5 A;  4GZD A;  3MV3 B;  2A4Z A;  1A17 A;  3ML9 A;  4CGV A;  3FTY A;  1W3B A;  2L6J A;  2NSZ A;  2MOW A;  1ELR A;  4N3A A;  3U9W A;  4P29 A;  4UWG A;  4YND A;  4LRZ A;  3CHO A;  3IBE A;  4E85 A;  1TJF A;  4OVU A;  5ANL A;  5FZS A;  5JJ7 A;  3LY8 A;  5ARG A;  2HR2 A;  3SHF A;  3CHR A;  4WWN A;  4UWF A;  4U0U A;  3Q49 B;  4XI0 A;  4A3T A;  4GZ3 A;  4KMO A;  2WXG A;  4DLO A;  2AW6 A;  4GYY A;  3G2U A;  4I17 A;  5DBK A;  4RG9 A;  4HOR A;  2WXJ A;  2KCK A;  5G2N A;  3CK7 A;  3NF1 A;  2X3M A;  3UX4 A;  3D9P A;  4J6I A;  3FUL A;  1OWL A;  3CKB A;  5BPP A;  2I2O A;  3FU6 A;  4DK5 A;  3EHM A;  3MA5 A;  3OTN A;  4LER A;  4UQY A;  3CR3 A;  1H2T C;  2WVI A;  2DIW A;  2BF0 X;  3S7D A;  3FWV A;  2GRM A;  4L7T A;  5FJY A;  2DCP A;  2XGS A;  1MQS A;  2VSN A;  3CHM A;  1OWO A;  5EDS A;  2V5F A;  3CST A;  3CEQ A;  4G26 A;  4CDM A;  3AS5 A;  3CLJ A;  4N3C A;  2PZI A;  3SBT B;  2EQX A;  5G05 J;  4B94 A;  3ASF A;  3G2W A;  1HZ4 A;  3ZGQ A;  2OVF A;  2VGX A;  1OUV A;  3UT4 A;  4OYS A;  1NA0 A;  4KZ0 A;  1MHQ A;  1H2U A;  2V4L A;  4EPZ A;  2KAT A;  3CKC A;  3C98 A;  3RO2 A;  2GW1 A;  5CCM A;  3S7F A;  4XKB A;  4ACL A;  3GZS A;  2X38 A;  1E8Y A;  3OXF A;  5C1D A;  3L22 A;  4UQX A;  4YVQ C;  3RRU A;  3TXN A;  1NZN A;  3G2V A;  2VGY A;  4IRU A;  4G24 A;  4GA1 A;  2XPY A;  1Z6T A;  1HH8 A;  2E0I A;  2WMO A;  2GRL A;  3APD A;  1WM5 A;  4ANV A;  3UUX A;  1UG3 A;  2ILR A;  3D9M A;  4YVO A;  3LS8 A;  2OND A;  1DNP A;  4AOF A;  5HI7 A;  2PM7 A;  3CHS A;  3R9A B;  4JL0 A;  1E8W A;  3RKV A;  1INZ A;  4FC8 A;  4LUN U;  4KVM A;  4C0E A;  4KXK B;  3FTZ A;  3KAE A;  4N3B A;  4L2Y A;  2VYI A;  5J08 A;  3MKQ A;  4RVB A;  5JJT A;  1YA0 A;  3CVQ A;  2UY1 A;  4AM9 A;  3IV0 A;  3ESL A;  5ARF A;  2LNI A;  3U66 A;  1IQR A;  2FF4 A;  3U3W A;  2PQR A;  3FEX A;  4IUL A;  4GZC A;  4IYP A;  3BEE A;  5A7D B;  4ANX A;  2XGM A;  2LSV A;  3D3M A;  4JEU A;  5FWQ A;  5KCM A;  2CG3 A;  3KD7 A;  5AJL A;  3FUF A;  1PC2 A;  3AS8 A;  3FHE A;  3L16 A;  5FQ7 A;  2PM6 A;  3CVN A;  3LXU X;  3QDN A;  4I9C A;  3ZHE B;  3EHN A;  1UJJ A;  4JEH A;  4JC8 A;  5J90 A;  4BTB A;  2PL2 A;  4J0U A;  2VJ8 A;  3CVY A;  2V0P A;  4BFR A;  4URK A;  3CVW A;  1ZBP A;  2LO6 A;  4ATG A;  1XGW A;  3QWW A;  2OOE A;  4UQZ A;  3RO3 A;  1HU3 A;  3S2A A;  2HO1 A;  1ELK A;  1H6K A;  3B7T A;  4OVV A;  4APO A;  4EBA G;  3IKO B;  3QKY A;  4H7X A;  3ZFW A;  4HS2 A;  1E96 B;  3I5P A;  3RU0 A;  1BPO A;  4AP2 A;  3ASH A;  3PNL B;  2WPV A;  1QZ2 A;  3CVV A;  3UT8 A;  3TXM A;  5LFA A;  1Y6I A;  3LY7 A;  3FH5 A;  3CHP A;  3TJP A;  4F3V A;  4XX5 A;  4DI4 A;  4N2S A;  2KZT B;  1EPU A;  4CRW A;  2J4B A;  4ILG A;  4PH4 B;  5AYW D;  4CGW A;  2WXM A;  3FU5 A;  2WQ6 A;  5FZQ A;  1E7U A;  4UWH A;  3PE3 A;  2I1J A;  4PUC A;  2J07 A;  2J4D A;  4WWO A;  3WXX A;  2X6K A;  2WXF A;  3FEY A;  4JVS A;  4UI9 J;  3LPZ A;  3PUJ A;  3NZU A;  1Z3Y A;  4I2Z A;  4F1S A;  3D9L A;  5EX3 A;  2WQH A;  3CK8 A;  3SGH A;  3HIZ A;  3JCK C;  3UPV A;  4TUU A;  3FUM A;  2WXQ A;  3FH7 A;  3L13 A;  4I2W A;  3R7Q A;  4ANU A;  5JHA A;  4AY5 A;  4J8S A;  2L0I A;  3I4G A;  2X6F A;  2J49 A;  4KYO B;  4MKT A;  4GB9 A;  3ZHE A;  5FQ4 A;  2VSO E;  3JUI A;  4ILI A;  4K03 A;  3MKR A;  2Y4U A;  2IFU A;  3QAQ A;  3AU4 A;  2XCC A;  3LY9 A;  2XQ0 A;  1S0P A;  3DBS A;  1SQM A;  3DPD A;  3MX3 A;  5T4Y A;  3NQP A;  3ESK A;  3QK0 A;  3UMV A;  4FP7 A;  2WXP A;  4PS7 A;  1EDU A;  4B8A A;  3PEV B;  4AJW A;  4XE0 A;  3LJ3 A;  5LX8 A;  4GYO A;  2ZU6 B;  4FLH A;  4K0R A;  4BTA A;  3L08 A;  4LCT A;  2LAI A;  3L17 A;  2UWJ G;  5G05 C;  3ZYQ A;  4TRQ A;  1HG5 A;  2C0L A;  4IN3 B;  5G55 A;  3FFL A;  4XZ4 A;  4B8C B;  3UT7 A;  1HFA A;  3PH0 C;  3JQ0 A;  4I1M A;  3MV2 B;  4QFV A;  4BX8 A;  3MGB A;  4AXH A;  4DI3 A;  4EQF A;  2WXR A;  3MKQ B;  4G2V A;  3FTW A;  5FZR A;  4FUL A;  4A1G A;  3QOU A;  1H2V C;  5E75 A;  1SZA A;  4APF A;  4EZK A;  4EZL A;  3HYM B;  4HOU A;  4XKC A;  1UW4 B;  2MHK A;  3LCA A;  3QJZ A;  2ION A;  3LDZ A;  3Q5M A;  3TAX A;  2R17 C;  3B7R L;  3OXG A;  3ZPJ A;  5HQ8 A;  2WM9 A;  3FP3 A;  1QNF A;  1ZU2 A;  4GA0 A;  5BT1 A;  2FO7 A;  3B13 A;  4GCN A;  4MRU A;  3URZ A;  3TGO A;  4EEC A;  4ME2 A;  3O48 A;  1UJK A;  5AEN A;  4CT0 A;  2JLB A;  3FUJ A;  4WND A;  5KJM A;  2NXP A;  5KJL A;  4CT4 A;  4Y6C A;  3CV0 A;  4N5C A;  3CVX A;  4NUR A;  1VDY A;  4JPS A;  4UI9 C;  2OV8 A;  3ASG A;  2Q7F A;  4JW1 A;  1PAQ A;  3CVL A;  1HG2 A;  5JJ6 A;  3EJN A;  2WXL A;  2QFC A;  3IEG A;  4XIF A;  5G04 C;  2HYZ A;  3PZD A;  2VSY A;  1HO8 A;  4W9R A;  4FLB A;  4UWL A;  3RRM B;  5ANR A;  2IF4 A;  3CVU A;  3D9O A;  2CHZ A;  4Y6W A;  1Z3X A;  4D10 C;  2WXO A;  1Y8M A;  2XRY A;  3GW4 A;  3FUH A;  5D0Q D;  3SZ7 A;  3I3N A;  2AWI A;  3D9I A;  2CFZ A;  4J8F A;  3RRN B;  3KS2 A;  2P58 C;  3U64 A;  4A1S A;  2XPI A;  3QWP A;  4KZC A;  3APF A;  4I43 A;  4HFG A;  3RK6 A;  3VLE A;  4C9B B;  1E8Z A;  4I6G A;  3ZYL A;  4ILH B;  2BUG A;  4DJA A;  4JHR A;  3D9K A;  3HHM A;  3ASD A;  3LEW A;  2VTB A;  2PQN A;  4FU3 A;  3LKU A;  3ZN3 A;  2VQ2 A;  2VSX E;  4GA2 A;  4XI9 A;  3IHV A;  4Q69 A;  3ML8 A;  3PRZ A;  4L23 A;  2LAH A;  5E76 A;  1JWG A;  3ONK A;  4PS8 A;  1X5B A;  2XPZ A;  3QC1 A;  4G11 A;  4M3O A;  4Q94 A;  3ZYK A;  5CHE E;  4U63 A;  3FUE A;  3LYA A;  2L0T B;  4BWR A;  4DPR A;  2L9B A;  3PNT B;  4RSY A;  2X6I A;  3GZ2 A;  1HXI A;  1JWF A;  2RG8 A;  2AXZ A;  4BX9 A;  4I1O B;  2LSU A;  3S7B A;  2XEV A;  4AY6 A;  2AVP A;  5BV0 A;  5LCW C;  2AXV A;  4HOS A;  3K9I A;  2R59 A;  4AV7 A;  3R7R A;  3N71 A;  4FHJ A;  5JHB A;  3RIB A;  2YQ8 A;  1HF8 A;  4NQ0 A;  1N52 A;  2QY7 A;  3T8M A;  5G04 J;  4MLP A;  3EIJ A;  4GMJ A;  4C0M A;  3CHQ A;  5KJN A;  3NZS A;  2FUL A;  2GGF A;  2XCB A;  1OWP A;  2IQC A;  3QWV A;  5AIJ A;  4KT6 B;  2WXN A;  3U4T A;  2DBA A;  3MYV A;  3AS4 A;  2WXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...