2PQRA

Crystal structure of yeast fis1 complexed with a fragment of yeast caf4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
b'DFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondria fission 1 protein
publication title Structural basis for recruitment of mitochondrial fission complexes by Fis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Apoptosis
total genus 42
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pqrA01
4W9RA 5A6CA 4A1SA 1WM5A 3PDNA 3AS4A 4GYOA 4N3AA 2XGOA 5BT1A 3RO2A 5BW8C 4UQXA 2Y4TA 4CDRA 2KCKA 3MV3B 4JL0A 2E2EA 1KT0A 1IYGA 3TG4A 4N2QA 4JA9A 4GYYA 3CKCA 1PC2A 4U04A 5KJNA 3LKUA 3JYSA 2HO1A 4J8DA 3UQ3A 4U0UA 4F3VA 4O6FA 2XGSA 2BUGA 2PQRA 3S7JA 2Y4UA 3OXFA 3E4BA 3S7DA 4HOQA 2UWJG 2IFUA 3LY9A 2FEZA 5EX3A 3OXGA 1A17A 3GYZA 2I6HA 3LY7A 4YNDA 4CGWA 3LY8A 3Q49B 5FJYA 2YQ8A 4LEUA 4N2SA 3TGOA 4XIFA 3CVLA 3RIBA 4GCNA 3AS8A 4I2WA 2QFCA 4GA0A 2LSUA 3TAXA 4AY5A 3S7FA 1NA0A 3PE3A 4H7YA 4YVOA 3ZPJA 2L6JA 1FCHA 3ASDA 3CKBA 1QQEA 3SZ7A 2C0LA 4WNEA 3URZA 1Y8MA 3LCAA 4HOTA 3GZ2A 2VSYA 3VTYA 3QWWA 5HI7A 4Y6CA 5ARFA 3VTXA 4UQYA 5G05C 2VGYA 4BT8A 5HQ8A 1QZ2A 4N3BA 4GA2A 3ZFWA 4I9CA 3K9IA 3WXXA 4HORA 4J0UA 3IEGA 4HOUA 3QWPA 4KYOB 4UQZA 1HXIA 3SF4A 2KCVA 5LCWC 1B89A 4HOSA 4G2VA 2DBAA 5CCMA 3Q15A 3TG5A 4Y6WA 3QKYA 2P58C 3AS5A 4AIFA 3Q4AB 3KS2A 4GZ6A 4I2ZA 1KLXA 3Q5MA 5DIZA 4RG6A 5DBKA 4UI9J 4ABNA 4WNFA 2AVPA 4NQ0A 3OXLA 5M72A 5ARGA 5EX0A 2VQ2A 1NA3A 4G25A 3QOUA 3CVPA 3CV0A 5BNWA 2MHKA 3R9AB 4KXKB 2VGXB 3ASGA 3HYMB 1WAO1 2FO7A 2VSNA 5G04J 2KATA 4WUYA 2J9QA 3S7BA 3RU0A 2FBNA 5FZQA 2NC9A 4GZ5A 2LSVA 1ELWA 4BTAA 5FZRA 4YVQC 5G05J 2PL2A 5FZSA 3CVQA 2XEVA 3ESKA 4J8FA 3CK7A 3RJVA 2GW1A 3CEQA 4GCOA 2KC7A 4IN3B 2FI7A 3CK8A 3KAEA 2XPIA 4XI0A 4G26A 2Q7FA 5KJKA 3CK9A 4BWRA 4GZ3A 1HH8A 4APOA 4AY6A 3U3WA 3ASFA 4UI9K 4BTBA 3ZHEB 5CCLA 2VYIA 3LPZA 1P5QA 1XNFA 4WNDA 5JJ6A 4N39A 3U4TA 4B94A 4N3CA 2HR2A 2R5SA 3O48A 1KT1A 5CHEE 3ZGQA 5D0QD 1IHGA 3ZN3A 4U07A 4G24A 4U0ZA 2KCLA 2C2LA 4JA7A 2XGMA 1YA0A 2OOEA 2LNIA 3QWVA 5FTPA 4AM9A 3ULQA 4GA1A 3LYAA 4U0SA 1ZU2A 2XCCA 2HYZA 2VGXA 3NF1A 5KJLA 4BT9A 4WNGA 3UPVA 4G23A 3KD7A 3UUXA 4G1TA 3MA5A 3BEEA 4NRHB 1OUVA 3PE4A 4KBQA 2FF4A 4XI9A 1HZ4A 5D0OD 1W3BA 3CVNA 4I17A 3EDTB 3RKVA 2C0MA 1NZNA 3FFLA 3Q47B 4JHRA 2WQHA 1ZBPA 2PZIA 2UY1A 5JJTA 3ASHA 5EKQD 3FWVA 4UI9C 4GPKA 4H7XA 4I9EA 3MEKA 5FT9A 2UY1B 3MV2B 5C1DA 4GYWA 2JLBA 4ME2A 5KJMA 4CGVA 3RO3A 3FP3A 2XCBA 2WPVA 2ONDA 1ELRA 3ZHEA 2V5FA 2YHCA 3N71A 5A7DB 1E96B 5G04C 3MKRA 5AYWD 3QDNA 5JJ7A 3GW4A 1TJCA 4RG9A 2PQNA 4J8EA 4EQFA 5LCWJ 2IF4A 4I1AA 3GZ1A 4N5CA
chains in the Genus database with same CATH superfamily
3RRMB 2L6BA 3D9IA 2R02A 3UKRG 2I2OA 3PDNA 4FJZA 3NQPA 4GYOA 3NOGD 4IYPA 3UXGA 4B93B 2XGOA 4CDNA 3UM0A 1QNFA 4CDRA 1BU9A 5KBAA 1HS6A 3JUIA 3UM2A 4JL0A 1SW6A 1YYHA 3TG4A 4N2QA 3L6AA 2XPZA 3CKCA 4U04A 2PM6A 3LKUA 3JYSA 2HO1A 2H6HA 4F7AA 3FU3A 3PREA 4F3VA 2XGSA 2R03A 2BUGA 2E0IA 3C3QA 3DBSA 3HXBA 3ZYMA 2OEWA 5ANLA 1IXVA 2V5QC 2P2CP 4DLQA 3E4BA 4TUUA 2IFUA 1A17A 3FTUA 3IXEA 3L22A 3UT8A 4CGWA 1QYMA 5ITZF 5CMWA 1FPPA 4XE0A 1UOHA 1Y6IA 4CZ2D 5EYPF 5ENTD 4JD2G 2F8YA 4AY5A 3S7FA 2WQ7A 2DWZA 2RKKA 1U3DA 4WWPA 4GTRA 4H7YA 4AOFA 3ZPJA 2HE0A 1FCHA 1HO8A 1TN8A 2Y3AA 3ASDA 3CKBA 4HS2A 4JW1A 1QQEA 3EJNA 2L0IA 4TUMA 3AJIA 1Y8MA 3L13A 3OTNA 2ETCA 1H6PA 2WMOA 3E30A 3GZ2A 4Q94A 2VSYA 3JXIA 2QZAA 4U8HA 1HE8A 3AG1E 2EILE 3LEWA 3PZ3A 3HXEA 3Q7AA 5KNHD 1V54E 3TWSA 4K5CA 4NACA 1HG2A 3AG3E 4L2YA 3PUKA 2WXOA 5KWDA 4N3BA 5AQ7A 3HDXA 1FT1A 4HORA 4URKA 1HG5A 3CHRA 3DXKG 3FUHA 3TWWA 2R59A 1WG0A 5T4YA 3QWPA 4KYOB 5EIDA 1HXIA 4J7WA 4MKTA 3T9KA 4G2VA 5FIOA 4RLYA 4OVUA 4F6RD 2P9LG 3VLFA 1SA5A 4AIFA 3Q4AB 1VDYA 3DSXA 3IV0A 4PUCA 2X3MA 3MYVA 1IKND 1N0RA 3JCKC 3Q5MA 4I6JA 4IULA 5DBKA 4TXPA 4OAVB 5HKPA 5EX0A 2OEVA 5JHAA 4DLOA 1NA3A 3CV0A 4U7EB 1O1SA 3FTSA 1UN8A 3FU5A 4EZJA 4PDXA 3HYMB 1IHBA 2FO7A 2VSNA 1WY6A 3S7BA 4WUYA 4DX1A 1ELKA 3ONKA 3FH7A 3CHQA 3UX4A 4BTAA 4GTVA 3L17A 4XEIG 1U3CA 2PL2A 5FZSA 4JVSA 1A5EA 3B7UX 2LUHA 4K5BA 4U8VD 2P9KG 3CK8A 4F53A 1MQSA 2WXLA 1X81A 5D66A 3UM3A 3CVYA 3FTXA 1N54A 1MYOA 2H6IA 3QJZA 3V2XA 3ASFA 3DPDA 3FDHA 3DSVA 4B94A 3MGBA 4TRQA 2X6FA 3PNLB 3UMVA 3ML8A 4AVXA 3W9FA 3SQVA 3EIJA 1LF8A 4P29A 4LG6A 3ZN3A 4PS3A 2XRZA 3PRZA 3U64A 4G24A 3QAQA 3FHEA 2QC9A 2WXIA 4O1OA 1YA0A 3SNXA 3ABKE 3R7RA 4ZFHA 1UG3A 3AAAC 3LYAA 3ZXSA 4EBAA 4HLEA 1AWCB 5G55A 3TWQA 1ZB1A 3BG1B 2XCCA 5KJLA 5AQBA 4LERA 4BT9A 4WNGA 4FC8A 3KD7A 3UUXA 2WM9A 3ZYQA 2J8SD 1N4SA 1RZ4A 2V0PA 1S64A 3CVNA 4ANXA 3DXMG 5H7PA 1H19A 3Q47B 2BF0X 5A23A 1ZBPA 2PZIA 3KSQA 3ASHA 1IQRA 4UI9C 3HVEA 2L9BA 4GPKA 3MV2B 5C1DA 2NSZA 4GYWA 2JLBA 4DPRA 4ME2A 1TR4A 1TEZA 2WPVA 3D9PA 3ZHEA 2V5FA 1H6KA 1N4QA 3P1UA 2R05A 4DK5A 5JA4D 3SD5A 4E6HA 3G2TA 1TJCA 1N11A 3JUEA 3QARA 2GRNB 3LVQE 2IF4A 4I1OB 4BESA 4N5CA 4W9RA 4PS8A 3R9MA 3LDZA 1HFAA 3UTMA 4G8LA 4I6EA 3APDA 1TNOA 4N3AA 4BX9A 2IY0C 1OWMA 4J6IA 3RO2A 2MOWA 3PS6A 1SVXA 5BW8C 3NBNB 4D10C 4U8YD 2KCKA 2E2EA 4GU5A 4DJAA 3ULYA 2LAIA 4L7TA 4U95D 4IRUA 3JQ1A 5ENOD 5B3SE 3P2BA 5KJNA 3DSSA 4UWFA 1N94A 4BETA 1TNBA 3PH0C 3I5PA 4L9PA 3G2WA 3APCA 3IBEA 5EILA 4O6FA 2ZXWE 3Q9NC 1FVFA 4KMOA 5LOZA 2OCCE 1JCQA 3E32A 4DI3A 4WAFA 1EDUA 3ZYLA 2AXUA 2IONA 2R17C 4JXTA 1E8WA 2EINE 3E34A 4J8YA 3G2SA 4JC8A 3LY9A 2FEZA 5EX3A 1E8XA 3GYZA 2I6HA 4YNDA 3ZXPA 2BTDA 1BLXB 3SO8A 1E7UA 4XZ4A 3Q49B 5FJYA 2IJGX 1TYQG 4ANWA 4LEUA 4XIFA 4LNUD 3RIBA 4U63A 5LX8A 3SFXA 4GA0A 3FU6A 3OAWA 3ZEFA 4YDWA 2DCPA 1JCSA 4HBDA 4RSYA 3PZDA 2L6JA 4OYSA 3CVUA 3LVRE 3URZA 2RG8A 4C9BB 3VTYA 3DEOA 5HI7A 5KCMA 1NL4A 5ARFA 4UQYA 5G05C 4EPZA 4PH4B 4BT8A 3TWUA 4I43A 4APFA 2XZTG 2J4DA 2M63A 3ISMC 5HQ8A 4F1SA 3I3NA 3K9IA 3D9MA 3FUMA 2BKKB 1TJFA 3ZVVA 4K5AB 4B0ZA 4G11A 3IEGA 4CYMD 3TWRA 1UN9A 4QFVA 3U66A 3FUEA 4TV3A 3LXUX 3HXCA 4GZDA 5CCMA 3TJPA 2ETAA 1GW6A 2RFMA 4Y6WA 3CQCB 3AS5A 3EU5A 3KS2A 4I2ZA 5CECB 1SZAA 3SFZA 3ZIMA 1KLXA 3NB2A 5DIZA 1OCRE 5JMND 2AVPA 2WXNA 2OVBA 3OXLA 2XS1A 4JHKA 1H6OA 2IEJA 1SA4A 4WWNA 3EUVA 5CEAA 5FINA 5ENPD 3C3OA 4GZ5A 5ENQD 4YDYA 5FQ8A 4GTQA 3TWXA 5ENSD 4BX8A 3G2VA 3B95A 1LTXA 4CCAA 5G05J 3TL5A 2GRLA 3CVQA 2A5UA 4J8FA 3CK7A 2CG2A 5T8IA 2GW1A 4M3OA 3UM1A 2VGEA 3FTYA 5KJKA 5AJDA 4OAUC 4HXIA 3CK9A 4GZ3A 3FULA 1HH8A 4BSXA 3ENEA 4APOA 3U3WA 4UI9K 3NZUA 2VYIA 5CEDB 1P5QA 1XNFA 4WNDA 4N39A 3U4TA 4LUNU 1Z3XA 3Q79A 2CFUA 4QQIA 4A3VA 1TNYA 2HR2A 4N3CA 2R5SA 3O48A 4GB9A 1KT1A 5CHEE 4O60A 3CHPA 4GPMA 3FTVA 2ZIRA 2C2LA 3D9NA 1N9AA 4JA7A 2XGMA 1E7VA 4KVOA 3ULQA 2I9CA 3MZLB 4GA1A 3V31A 4U0SA 3CGHA 5ENNA 1KPSB 3NF1A 3D9KA 4GMLA 4MLPA 2X6KA 5D2MC 1OUVA 1OXJA 3U9WA 5J08A 4KBQA 2FF4A 5D0OD 3L08A 1W3BA 5JHBA 3EDTB 3TXNA 3CSTA 4EECA 2C0MA 5CBNA 4JHRA 4I6GA 2WQHA 4KT6B 2AW6A 1O5MA 5ANRA 4DX2A 1E8ZA 4X8QA 3UIOC 1E8YA 4MRUA 2XRYA 4FU3A 4B89A 3MEKA 5FT9A 1KZPA 3RAUA 1BI7B 1OWNA 5KJMA 4CGVA 5FQ4A 1LD7A 3T5XA 2J08A 3L9TA 5LP0A 3AU4A 3LS8A 2EIKE 4O1PA 4CT0A 2ZU6B 1E96B 5G04C 3T5VA 2QYJA 3HXFA 4UWLA 4L2LA 4AJWA 2Y69E 3QDNA 1H2UA 4J8EA 4EQFA 2GRPB 3TXMA 2RD0A 2P9PG 1TNUA 1EYHA 4HI8A 1YCSB 2B0OE 1WM5A 2GRMA 2EIME 2J09A 2WXMA 3Q73A 3HXDA 1N4RA 3HRAA 4UQXA 2Y4TA 4LSZE 2YNQA 2H6FA 3BUAA 3MV3B 1KT0A 2EIJE 2IOSA 4JA9A 5AJLA 1PC2A 2WMNA 3MKQB 4BY6A 3UQ3A 4FADA 3ASOE 3CLJA 1FT2A 2WXJA 4JZYA 4ACLA 4JEHA 2VTBA 3TWTA 1DCEA 3MCXA 2PQRA 4DRXE 2GRQB 3S7JA 2Y4UA 3OXFA 5BPPA 4HOQA 2VTBB 3FEYA 2DZNA 2XQ0A 3OXGA 5CRUA 1DNPA 3LY8A 2H6GA 5EDSA 1TN6A 3NOCD 4EHMA 2YQ8A 3IHVA 4N2SA 1TNZA 3D9HA 4C48B 3PEVB 3E33A 1FVHA 3TGOA 3FTZA 3CVLA 3RRUA 4GCNA 4HI9A 1O1TA 4I2WA 3L16A 2QFCA 1OCZE 4HRMB 4G8KA 2CHXA 2EQXA 1K3ZD 3PE3A 3FEXA 2XPYA 4Z68A 4N5QA 4LNBA 3S2AA 4WNEA 4JB8P 3LCAA 4HOTA 4ILIA 2X6JA 3EU9A 3Q78A 3CHMA 3D9LA 2I1JA 3C5RA 3LJNA 4GMRA 1QZ2A 3EHNA 5AQ9A 4GA2A 3SHFA 3J5QB 2I1KA 3NZSA 3CHSA 2X6IA 3V2OA 3C98A 4A3TA 3HG0D 4U96D 1HX8A 1O1RA 4HOUA 4Q69A 1OY3D 2VSXE 2FULA 4PS7A 4F1PA 3SF4A 2KCVA 2WXFA 5LCWC 1B89A 4GTSA 1UW4B 4HOSA 2JEKA 2HM8A 3QC1A 3BG0B 1OWPA 2DBAA 3FH5A 3AG4E 5CERB 3TG5A 3QKYA 2P58C 4WWOA 1E90A 4GZ6A 5ENRD 3B7TA 1UJJA 4HFGA 5BV0A 3B7BA 4RG6A 4TXQA 4UI9J 4ABNA 4WNFA 4NQ0A 2Y0BG 5CBOA 1JWGA 3T8KA 3FUNA 4G25A 3QOUA 2AWIA 2L0TB 3AG2E 2V4LA 4XKCA 1DCQA 4L23A 2VGXB 4AV7A 3SBTB 1WAO1 2P9IG 4CEMA 4HNAD 5BXOA 4ANUA 3FUKA 5E75A 3NAWA 2FBNA 5FZQA 4C0MA 4YDOA 3DSTA 1S0PA 2X6HA 3FUJA 1MX2A 5AARA 5AENA 4JHJA 5FZRA 5CRVA 4YVQC 3FU0A 2OV8A 3QNKA 4LRZA 5B1AE 4ILHB 1K1AA 3CEQA 2LXMA 2KC7A 5G2NA 4EBAG 3T8MA 1N52A 1PY1A 2Y1LE 4G26A 4K03A 3ZYKA 5BXUA 3EHQA 1SZ9A 2KZTB 4HLLA 4AY6A 1UJKA 5HS0A 4CRWA 4RQIA 2QYUA 5JJ6A 1S63A 2ZISA 1MHQA 2P9SG 4LCTA 2YHEA 4GMJA 2MRIA 2J07A 1WDYA 1D8EA 1U2VG 3ZGQA 5D0QD 4YDEA 3SGHA 2DZOA 2LO6A 1IHGA 1V55E 4U07A 1MZCA 1PAQA 5C2YA 3UIPC 4UWKA 3CHOA 2KCLA 2A4ZA 3KEAA 3KSLA 3UKUG 2OOEA 2LNIA 3QWVA 1XGWA 2WXHA 3D9JA 4B8CB 4AXHA 3ZU7B 1IQUA 3V79K 3DPYA 4OVVA 2IO3C 4UUCA 3ZUVB 3WG7E 3L54A 2CFZA 3B7RL 3MA5A 4NRHB 3UT4A 5AN8A 3Q75A 4MBGA 4A63B 2XEHA 3DWLG 4XI9A 2PNNA 1NZNA 4ILGA 4EZLA 1BI8B 2WXQA 4KZCA 1D8DA 4AEZC 2BKGA 1D9SA 5JJTA 3FWVA 3SI5A 2VJ8A 1NI1A 4H7XA 2ETBA 3PZ2A 3FUDA 2WQ6A 3FP3A 3Q7FA 2ONDA 1ELRA 3SY2A 3CSFA 3N71A 2F8XK 5A7DB 1EF1C 2XZDG 3PNTB 5KNGA 4DI4A 3ASNE 3CVWA 5LFAA 4XKBA 2WXGA 4RG9A 4I1AA 3SBSA 1LD8A 4NIKA 5A6CA 4A1SA 2IQCA 5BUZA 3VLDA 2LAHA 3AS4A 3VLEA 1L5JA 3E37A 1JPLA 2F37A 4M7CA 5BT1A 3EHMA 2DYSE 4JEUA 4JPSA 3LJ3A 3QK0A 1K8KG 4AP2A 4HVBA 4HB5A 2XS8A 1MJ0A 1IYGA 3CVVA 4GYYA 1EPUA 1QBQA 2ZGDA 5FQ6A 1SQMA 1BD8A 1H0AA 2P9NG 3R7QA 4J8DA 1HF8A 4BFRA 3C72A 4FULA 4U0UA 2XHEA 1YMPA 3V30A 1OCCE 2KM4A 2YINA 3IHYA 3D9OA 4UWGA 1NP7A 1RW2A 2P9UG 3S7DA 3RRNB 2UWJG 2WXPA 3ZW3A 1OCOE 3SFYA 1S70B 2KXPC 4GTPA 3LY7A 1MX4A 5EN5D 3JQ0A 5E76A 4TXRA 3ABLE 1Z5SC 2GRRB 3I4RB 4DX6D 4FP7A 3AS8A 4I1MA 2LSUA 3TAXA 1G3NB 2IOLA 1NA0A 3RK6A 3AU5A 4YVOA 5HRYA 1DC2A 5BV1A 3MX3A 3DEPA 4KZ0A 3SZ7A 2C0LA 1H2TC 2F0YA 3W9GA 3QWWA 2OVFA 3CQGB 4Y6CA 4DX7D 3VTXA 3QB2A 4BEPA 2VGYA 2PM7A 2V8SE 4GTOA 2XENA 2XEEA 4R7LA 3ZFWA 4I9CA 3DRAA 3WXXA 4FHJA 3ESLA 3MKQA 3RSEG 4J0UA 2KBXA 5EIBE 4UQZA 3UT7A 1Z6TA 4HQDA 3ZRHA 2CHWA 3FUIA 2IU1A 2WXKA 3KEZA 2B6CA 3UINC 1OT8A 5AIJA 2R2LA 3Q15A 4FJYA 3FTWA 2WB2A 2MYOA 4CDMA 4K0RA 1N95A 5CMYA 5FWQA 1JUQA 2GGFA 3PZ1A 4V3IA 2DYRE 3PUJA 3PEUB 4ANVA 3O4ZA 1Z3YA 3APFA 4UWHA 5M72A 5ARGA 4GTMA 5EYLA 2VQ2A 2J4BA 3CVPA 5BNWA 2DIWA 2MHKA 4FLHA 3R9AB 4KXKB 3CIAA 2RFAA 3G2UA 3ASGA 3GZSA 3D3MA 5G04J 2KATA 2J9QA 4ATZD 1HU3A 3RU0A 5T3RA 2NC9A 2LSVA 3HIZA 2ZGGA 1BPOA 1ELWA 3IKOB 4GAAA 1OWLA 2BEDA 4E85A 1TN7A 4DX5D 1H2VC 2XEVA 3HHMA 5B1BE 1INZA 3B7SA 1OWOA 3ESKA 4EZKA 2WXRA 4GZCA 3RJVA 3MJWA 4KVMA 3HVEB 4GCOA 4IN3B 2FI7A 3KAEA 2XPIA 3EIQC 3UI2A 1MX6A 4XI0A 2Q7FA 3FH8A 4BWRA 3BQOA 3PZ4A 2CG3A 2A5EA 2ILRA 4BTBA 3ZHEB 5CCLA 3ZNGA 3CR3A 3LPZA 4MS6A 5AQAA 2QY7A 1DVPA 3J5PA 2X38A 4ATGA 1K1BA 1Q2ZA 2V4HC 3ULEG 5FQ7A 4FHKA 4L1BA 4U0ZA 3I4GA 4HRNA 1X5BA 4A55A 3Q9UC 5FTPA 4AM9A 2JABA 3TWVA 1KZOA 3CVXA 4NURA 2NXPA 1ZU2A 2HYZA 2VGXA 3ZKJA 3L82A 4GTTA 4ACKA 3F6QA 3UPVA 1NFIE 4G23A 3FY4A 4C0EA 4G1TA 3BEEA 1N0QA 2NYJA 2FO1E 3PE4A 1HZ4A 4A1GA 3X2QE 4FLBA 4I17A 3RKVA 1AP7A 4FA6A 4LNGA 3FUFA 4ZHBA 2DVWA 3FFLA 4XX5A 2CHZA 2UY1A 2WVIA 2AXZA 1N4PA 3DSWA 2VSOE 5EKQD 3ML9A 4I9EA 3ABME 2UY1B 4BERA 1JWFA 3ONLA 3RO3A 2J49A 3EHRA 2KZTA 4DUIA 5IY5E 2XCBA 4RVBA 5J90A 4Q96A 4HRLA 2YHCA 2AJAA 4J8SA 3MKRA 5AYWD 3BU8A 1JCRA 5JJ7A 2GROB 2AXVA 3GW4A 3C3RA 4CT4A 4B8AA 4BSZB 5AAOA 2PQNA 2LXLA 3B13A 2IO2C 5LCWJ 3DSUA 3GZ1A 3PVLA 3JXJA
chains in the Genus database with same CATH topology
1EYHA 4W9RA 3RRMB 4PS8A 5A6CA 3LDZA 4A1SA 2IQCA 1HFAA 5BUZA 3D9IA 3VLDA 2I2OA 1WM5A 2GRMA 2LAHA 3AS4A 3NQPA 3PDNA 4FJZA 4GYOA 3VLEA 1L5JA 4I6EA 1JPLA 3APDA 4IYPA 2J09A 4N3AA 2WXMA 2XGOA 4CDNA 4BX9A 1OWMA 5BT1A 4J6IA 3EHMA 3RO2A 2MOWA 3PS6A 5BW8C 4JEUA 4UQXA 1QNFA 2Y4TA 4JPSA 4D10C 3LJ3A 3QK0A 4CDRA 2YNQA 2KCKA 4AP2A 1HS6A 3JUIA 3MV3B 4JL0A 4HVBA 2E2EA 4GU5A 4DJAA 1KT0A 1IYGA 2LAIA 3TG4A 4C0EA 4L7TA 4N2QA 2IOSA 4IRUA 3L6AA 3CVVA 4JA9A 4GYYA 2XPZA 5AJLA 3CKCA 1PC2A 4U04A 1EPUA 3JQ1A 5FQ6A 1SQMA 3P2BA 5KJNA 2PM6A 2WMNA 4UWFA 3LKUA 1H0AA 3JYSA 2HO1A 3R7QA 3MKQB 4BY6A 4J8DA 3PH0C 3I5PA 1HF8A 3UQ3A 4FADA 4F7AA 4BFRA 3FU3A 3CLJA 4FULA 3G2WA 3APCA 3IBEA 4U0UA 3PREA 2XHEA 4F3VA 4O6FA 2WXJA 4JZYA 4ACLA 2XGSA 4JEHA 2BUGA 2VTBA 2KM4A 1FVFA 2YINA 2PQRA 3IHYA 3MCXA 2E0IA 4KMOA 3DBSA 5LOZA 3D9OA 3ZYMA 4UWGA 3S7JA 2Y4UA 1NP7A 5ANLA 4WAFA 4DI3A 1EDUA 3OXFA 3ZYLA 3E4BA 4DLQA 3S7DA 2AXUA 2IONA 2R17C 4HOQA 4JXTA 3RRNB 1E8WA 5BPPA 2UWJG 2WXPA 3ZW3A 4TUUA 2VTBB 2IFUA 3FEYA 3G2SA 4JC8A 3LY9A 2FEZA 5EX3A 2XQ0A 3OXGA 1E8XA 1A17A 3GYZA 2I6HA 3LY7A 3FTUA 1DNPA 3L22A 3JQ0A 4YNDA 5E76A 3UT8A 4CGWA 2BTDA 3LY8A 5EDSA 5CMWA 4XE0A 1E7UA 4XZ4A 3Q49B 5FJYA 3I4RB 2IJGX 4FP7A 2YQ8A 3IHVA 4ANWA 4LEUA 4N2SA 1Y6IA 3PEVB 3TGOA 1FVHA 4XIFA 3FTZA 3CVLA 3RIBA 3RRUA 4GCNA 4U63A 3AS8A 4I2WA 5LX8A 3L16A 2QFCA 4GA0A 3FU6A 4I1MA 2LSUA 3TAXA 4AY5A 2CHXA 2EQXA 2IOLA 3OAWA 3S7FA 2WQ7A 1NA0A 1U3DA 3FEXA 3PE3A 3ZEFA 2DCPA 4WWPA 3RK6A 3AU5A 2XPYA 4H7YA 4YVOA 4AOFA 4RSYA 3PZDA 3ZPJA 2L6JA 4OYSA 1FCHA 1HO8A 2Y3AA 3S2AA 3ASDA 3MX3A 3CKBA 5BV1A 3CVUA 3LVRE 4HS2A 4JW1A 1QQEA 3EJNA 2L0IA 4KZ0A 3SZ7A 2C0LA 1H2TC 4WNEA 3URZA 1Y8MA 3L13A 2RG8A 3LCAA 3OTNA 2WMOA 4Q94A 3GZ2A 4C9BB 4HOTA 2VSYA 3QWWA 2OVFA 3VTYA 3CQGB 4ILIA 4U8HA 5HI7A 4Y6CA 5KCMA 1HE8A 2X6JA 5ARFA 3VTXA 3LEWA 3QB2A 4UQYA 3CHMA 3D9LA 5G05C 4EPZA 2I1JA 4PH4B 2VGYA 4BT8A 2PM7A 2V8SE 4I43A 4NACA 4APFA 5HQ8A 2J4DA 1HG2A 2M63A 4L2YA 1QZ2A 3EHNA 3PUKA 2WXOA 4N3BA 4GA2A 4R7LA 3ZFWA 4F1SA 3I3NA 4I9CA 3SHFA 2I1KA 3HDXA 3K9IA 3NZSA 3CHSA 3D9MA 3WXXA 2X6IA 4FHJA 3FUMA 1HG5A 3CHRA 3ESLA 4URKA 4HORA 3FUHA 3C98A 1TJFA 3MKQA 3ZVVA 2R59A 4J0UA 4B0ZA 4A3TA 4G11A 5T4YA 1HX8A 3IEGA 4HOUA 3QWPA 4KYOB 4Q69A 4UQZA 1UN9A 4QFVA 2VSXE 3UT7A 1HXIA 1Z6TA 3U66A 2FULA 2CHWA 3FUIA 2IU1A 4PS7A 3SF4A 2WXKA 3ZRHA 2KCVA 3FUEA 3KEZA 2WXFA 4TV3A 3LXUX 1B89A 5LCWC 1UW4B 4MKTA 2HM8A 2JEKA 4HOSA 3QC1A 3BG0B 1OWPA 4G2VA 2DBAA 4GZDA 5CCMA 3TJPA 5AIJA 3FH5A 4OVUA 1GW6A 3Q15A 3TG5A 3VLFA 4FJYA 3FTWA 4Y6WA 2WB2A 3QKYA 3CQCB 2P58C 3AS5A 4AIFA 4WWOA 1E90A 3Q4AB 1VDYA 3KS2A 4GZ6A 3IV0A 4CDMA 4PUCA 2X3MA 4K0RA 4I2ZA 1SZAA 3SFZA 3ZIMA 3MYVA 5CMYA 3B7TA 5FWQA 1UJJA 1JUQA 1KLXA 3JCKC 4HFGA 5BV0A 3Q5MA 2GGFA 4I6JA 4IULA 4V3IA 5DIZA 4RG6A 5DBKA 4UI9J 4ABNA 4WNFA 3PUJA 3PEUB 2AVPA 4NQ0A 4ANVA 1JWGA 3O4ZA 1Z3YA 2OVBA 2WXNA 3APFA 3OXLA 4UWHA 5M72A 5ARGA 5EX0A 3FUNA 2VQ2A 2J4BA 4DLOA 5JHAA 1NA3A 4G25A 3QOUA 2AWIA 4JHKA 3CVPA 3CV0A 2L0TB 5BNWA 2DIWA 2MHKA 4FLHA 3FTSA 1UN8A 3FU5A 4EZJA 2V4LA 4WWNA 3R9AB 4XKCA 4KXKB 3CIAA 3G2UA 4L23A 2VGXB 3ASGA 3GZSA 4AV7A 4PDXA 3D3MA 3HYMB 3SBTB 1WAO1 2FO7A 2VSNA 1WY6A 5G04J 2KATA 4WUYA 2J9QA 3S7BA 4CEMA 1HU3A 1ELKA 4ANUA 3RU0A 3FUKA 5E75A 3ONKA 5T3RA 2FBNA 3FH7A 2NC9A 5FZQA 4GZ5A 2LSVA 4C0MA 3HIZA 5FQ8A 1BPOA 3CHQA 1ELWA 3IKOB 1S0PA 2X6HA 3FUJA 3UX4A 4BTAA 4BX8A 4GAAA 5AENA 3G2VA 4JHJA 1OWLA 5FZRA 4CCAA 3L17A 4YVQC 5G05J 4E85A 3TL5A 1U3CA 3FU0A 2GRLA 2PL2A 5FZSA 3CVQA 1H2VC 2A5UA 2XEVA 3HHMA 4JVSA 1INZA 2OV8A 3B7SA 1OWOA 3B7UX 3ESKA 3CK7A 4J8FA 2WXRA 3QNKA 4LRZA 4EZKA 2CG2A 4ILHB 5T8IA 4GZCA 3RJVA 2GW1A 3MJWA 3CEQA 4KVMA 3HVEB 2KC7A 4GCOA 4IN3B 4M3OA 5G2NA 2FI7A 4EBAG 3CK8A 3KAEA 2XPIA 3EIQC 4F53A 1MQSA 3T8MA 3FTYA 1N52A 4XI0A 1PY1A 2WXLA 4G26A 2Q7FA 4K03A 5AJDA 3FH8A 5KJKA 3ZYKA 4HXIA 3CK9A 4BWRA 4GZ3A 3CVYA 1SZ9A 1HH8A 2KZTB 3FULA 4BSXA 3FTXA 3ENEA 1N54A 4APOA 4AY6A 2CG3A 2ILRA 3QJZA 1UJKA 3ASFA 4UI9K 4BTBA 4CRWA 3ZHEB 3U3WA 3NZUA 5CCLA 3CR3A 2VYIA 3DPDA 3LPZA 4MS6A 1P5QA 1XNFA 2QY7A 3FDHA 4WNDA 5JJ6A 4N39A 3U4TA 4LUNU 4B94A 3MGBA 1Z3XA 4TRQA 1MHQA 2CFUA 4LCTA 4A3VA 4N3CA 1DVPA 2HR2A 2R5SA 2X6FA 3O48A 4GB9A 2YHEA 4GMJA 2MRIA 1KT1A 2J07A 2X38A 3PNLB 3UMVA 5CHEE 4ATGA 3ZGQA 3ML8A 5D0QD 4AVXA 3SGHA 2LO6A 3EIJA 1IHGA 1LF8A 4P29A 3ZN3A 4U07A 5FQ7A 4PS3A 2XRZA 1PAQA 3PRZA 4FHKA 4L1BA 3CHPA 3U64A 4G24A 4U0ZA 5C2YA 3FTVA 3QAQA 4UWKA 3CHOA 2KCLA 3FHEA 2C2LA 3D9NA 2A4ZA 2WXIA 3I4GA 4JA7A 2XGMA 1X5BA 1E7VA 1YA0A 2OOEA 4KVOA 2LNIA 3QWVA 3SNXA 4A55A 3R7RA 5FTPA 4AM9A 3ULQA 1UG3A 2I9CA 1XGWA 3MZLB 4GA1A 2WXHA 3LYAA 3ZXSA 3D9JA 4EBAA 3CVXA 4NURA 4B8CB 4U0SA 4HLEA 2NXPA 4AXHA 3CGHA 1IQUA 5ENNA 5G55A 1ZU2A 3BG1B 2XCCA 4OVVA 2HYZA 2VGXA 3D9KA 3NF1A 5KJLA 4BT9A 4LERA 4GMLA 4WNGA 4FC8A 4ACKA 3UPVA 4G23A 3FY4A 3KD7A 2CFZA 3L54A 2WM9A 4G1TA 4MLPA 3UUXA 3B7RL 3BEEA 3MA5A 4NRHB 3UT4A 2X6KA 1OUVA 3U9WA 3PE4A 3ZYQA 5J08A 4KBQA 2FF4A 4XI9A 1HZ4A 5D0OD 4A1GA 3L08A 1W3BA 2V0PA 5JHBA 3CVNA 4ANXA 4FLBA 4I17A 3EDTB 3RKVA 3TXNA 3CSTA 4EECA 4FA6A 2C0MA 1H19A 3FUFA 1NZNA 4ILGA 4EZLA 3FFLA 3Q47B 2BF0X 2WXQA 4JHRA 4XX5A 4KZCA 4I6GA 2CHZA 2WQHA 4KT6B 1ZBPA 5A23A 2PZIA 2UY1A 2AW6A 2WVIA 4AEZC 2AXZA 5JJTA 3ASHA 2VSOE 5ANRA 5EKQD 1IQRA 3FWVA 3ML9A 4UI9C 1E8ZA 1E8YA 4MRUA 3SI5A 3HVEA 2VJ8A 2L9BA 4GPKA 2XRYA 4H7XA 4I9EA 4FU3A 4B89A 3MEKA 5FT9A 2UY1B 3MV2B 5C1DA 2NSZA 4GYWA 1OWNA 2JLBA 4DPRA 1JWFA 4ME2A 5KJMA 3ONLA 4CGVA 3FUDA 3RO3A 2J49A 5FQ4A 2KZTA 3FP3A 2WQ6A 1TEZA 3T5XA 2XCBA 4RVBA 2J08A 5J90A 2WPVA 4Q96A 3D9PA 2ONDA 3AU4A 1ELRA 3LS8A 3ZHEA 5LP0A 2V5FA 1H6KA 3CSFA 2YHCA 3N71A 4CT0A 3P1UA 2ZU6B 1EF1C 4J8SA 3PNTB 1E96B 5G04C 5A7DB 4DK5A 3MKRA 5AYWD 3SD5A 4DI4A 4E6HA 3T5VA 4UWLA 4L2LA 4AJWA 3CVWA 3QDNA 5LFAA 5JJ7A 3GW4A 2AXVA 3G2TA 1H2UA 1TJCA 4XKBA 2WXGA 4B8AA 4CT4A 4RG9A 2PQNA 3QARA 3B13A 4J8EA 3TXMA 4EQFA 3LVQE 2IF4A 5LCWJ 2RD0A 4I1OB 4I1AA 3GZ1A 3SBSA 3PVLA 4N5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9R A;  5A6C A;  4A1S A;  1WM5 A;  3PDN A;  3AS4 A;  4GYO A;  4N3A A;  2XGO A;  5BT1 A;  3RO2 A;  5BW8 C;  4UQX A;  2Y4T A;  4CDR A;  2KCK A;  3MV3 B;  4JL0 A;  2E2E A;  1KT0 A;  1IYG A;  3TG4 A;  4N2Q A;  4JA9 A;  4GYY A;  3CKC A;  1PC2 A;  4U04 A;  5KJN A;  3LKU A;  3JYS A;  2HO1 A;  4J8D A;  3UQ3 A;  4U0U A;  4F3V A;  4O6F A;  2XGS A;  2BUG A;  2PQR A;  3S7J A;  2Y4U A;  3OXF A;  3E4B A;  3S7D A;  4HOQ A;  2UWJ G;  2IFU A;  3LY9 A;  2FEZ A;  5EX3 A;  3OXG A;  1A17 A;  3GYZ A;  2I6H A;  3LY7 A;  4YND A;  4CGW A;  3LY8 A;  3Q49 B;  5FJY A;  2YQ8 A;  4LEU A;  4N2S A;  3TGO A;  4XIF A;  3CVL A;  3RIB A;  4GCN A;  3AS8 A;  4I2W A;  2QFC A;  4GA0 A;  2LSU A;  3TAX A;  4AY5 A;  3S7F A;  1NA0 A;  3PE3 A;  4H7Y A;  4YVO A;  3ZPJ A;  2L6J A;  1FCH A;  3ASD A;  3CKB A;  1QQE A;  3SZ7 A;  2C0L A;  4WNE A;  3URZ A;  1Y8M A;  3LCA A;  4HOT A;  3GZ2 A;  2VSY A;  3VTY A;  3QWW A;  5HI7 A;  4Y6C A;  5ARF A;  3VTX A;  4UQY A;  5G05 C;  2VGY A;  4BT8 A;  5HQ8 A;  1QZ2 A;  4N3B A;  4GA2 A;  3ZFW A;  4I9C A;  3K9I A;  3WXX A;  4HOR A;  4J0U A;  3IEG A;  4HOU A;  3QWP A;  4KYO B;  4UQZ A;  1HXI A;  3SF4 A;  2KCV A;  5LCW C;  1B89 A;  4HOS A;  4G2V A;  2DBA A;  5CCM A;  3Q15 A;  3TG5 A;  4Y6W A;  3QKY A;  2P58 C;  3AS5 A;  4AIF A;  3Q4A B;  3KS2 A;  4GZ6 A;  4I2Z A;  1KLX A;  3Q5M A;  5DIZ A;  4RG6 A;  5DBK A;  4UI9 J;  4ABN A;  4WNF A;  2AVP A;  4NQ0 A;  3OXL A;  5M72 A;  5ARG A;  5EX0 A;  2VQ2 A;  1NA3 A;  4G25 A;  3QOU A;  3CVP A;  3CV0 A;  5BNW A;  2MHK A;  3R9A B;  4KXK B;  2VGX B;  3ASG A;  3HYM B;  1WAO 1;  2FO7 A;  2VSN A;  5G04 J;  2KAT A;  4WUY A;  2J9Q A;  3S7B A;  3RU0 A;  2FBN A;  5FZQ A;  2NC9 A;  4GZ5 A;  2LSV A;  1ELW A;  4BTA A;  5FZR A;  4YVQ C;  5G05 J;  2PL2 A;  5FZS A;  3CVQ A;  2XEV A;  3ESK A;  4J8F A;  3CK7 A;  3RJV A;  2GW1 A;  3CEQ A;  4GCO A;  2KC7 A;  4IN3 B;  2FI7 A;  3CK8 A;  3KAE A;  2XPI A;  4XI0 A;  4G26 A;  2Q7F A;  5KJK A;  3CK9 A;  4BWR A;  4GZ3 A;  1HH8 A;  4APO A;  4AY6 A;  3U3W A;  3ASF A;  4UI9 K;  4BTB A;  3ZHE B;  5CCL A;  2VYI A;  3LPZ A;  1P5Q A;  1XNF A;  4WND A;  5JJ6 A;  4N39 A;  3U4T A;  4B94 A;  4N3C A;  2HR2 A;  2R5S A;  3O48 A;  1KT1 A;  5CHE E;  3ZGQ A;  5D0Q D;  1IHG A;  3ZN3 A;  4U07 A;  4G24 A;  4U0Z A;  2KCL A;  2C2L A;  4JA7 A;  2XGM A;  1YA0 A;  2OOE A;  2LNI A;  3QWV A;  5FTP A;  4AM9 A;  3ULQ A;  4GA1 A;  3LYA A;  4U0S A;  1ZU2 A;  2XCC A;  2HYZ A;  2VGX A;  3NF1 A;  5KJL A;  4BT9 A;  4WNG A;  3UPV A;  4G23 A;  3KD7 A;  3UUX A;  4G1T A;  3MA5 A;  3BEE A;  4NRH B;  1OUV A;  3PE4 A;  4KBQ A;  2FF4 A;  4XI9 A;  1HZ4 A;  5D0O D;  1W3B A;  3CVN A;  4I17 A;  3EDT B;  3RKV A;  2C0M A;  1NZN A;  3FFL A;  3Q47 B;  4JHR A;  2WQH A;  1ZBP A;  2PZI A;  2UY1 A;  5JJT A;  3ASH A;  5EKQ D;  3FWV A;  4UI9 C;  4GPK A;  4H7X A;  4I9E A;  3MEK A;  5FT9 A;  2UY1 B;  3MV2 B;  5C1D A;  4GYW A;  2JLB A;  4ME2 A;  5KJM A;  4CGV A;  3RO3 A;  3FP3 A;  2XCB A;  2WPV A;  2OND A;  1ELR A;  3ZHE A;  2V5F A;  2YHC A;  3N71 A;  5A7D B;  1E96 B;  5G04 C;  3MKR A;  5AYW D;  3QDN A;  5JJ7 A;  3GW4 A;  1TJC A;  4RG9 A;  2PQN A;  4J8E A;  4EQF A;  5LCW J;  2IF4 A;  4I1A A;  3GZ1 A;  4N5C A; 
#chains in the Genus database with same CATH topology
 3RRM B;  2L6B A;  3D9I A;  2R02 A;  3UKR G;  2I2O A;  3PDN A;  4FJZ A;  3NQP A;  4GYO A;  3NOG D;  4IYP A;  3UXG A;  4B93 B;  2XGO A;  4CDN A;  3UM0 A;  1QNF A;  4CDR A;  1BU9 A;  5KBA A;  1HS6 A;  3JUI A;  3UM2 A;  4JL0 A;  1SW6 A;  1YYH A;  3TG4 A;  4N2Q A;  3L6A A;  2XPZ A;  3CKC A;  4U04 A;  2PM6 A;  3LKU A;  3JYS A;  2HO1 A;  2H6H A;  4F7A A;  3FU3 A;  3PRE A;  4F3V A;  2XGS A;  2R03 A;  2BUG A;  2E0I A;  3C3Q A;  3DBS A;  3HXB A;  3ZYM A;  2OEW A;  5ANL A;  1IXV A;  2V5Q C;  2P2C P;  4DLQ A;  3E4B A;  4TUU A;  2IFU A;  1A17 A;  3FTU A;  3IXE A;  3L22 A;  3UT8 A;  4CGW A;  1QYM A;  5ITZ F;  5CMW A;  1FPP A;  4XE0 A;  1UOH A;  1Y6I A;  4CZ2 D;  5EYP F;  5ENT D;  4JD2 G;  2F8Y A;  4AY5 A;  3S7F A;  2WQ7 A;  2DWZ A;  2RKK A;  1U3D A;  4WWP A;  4GTR A;  4H7Y A;  4AOF A;  3ZPJ A;  2HE0 A;  1FCH A;  1HO8 A;  1TN8 A;  2Y3A A;  3ASD A;  3CKB A;  4HS2 A;  4JW1 A;  1QQE A;  3EJN A;  2L0I A;  4TUM A;  3AJI A;  1Y8M A;  3L13 A;  3OTN A;  2ETC A;  1H6P A;  2WMO A;  3E30 A;  3GZ2 A;  4Q94 A;  2VSY A;  3JXI A;  2QZA A;  4U8H A;  1HE8 A;  3AG1 E;  2EIL E;  3LEW A;  3PZ3 A;  3HXE A;  3Q7A A;  5KNH D;  1V54 E;  3TWS A;  4K5C A;  4NAC A;  1HG2 A;  3AG3 E;  4L2Y A;  3PUK A;  2WXO A;  5KWD A;  4N3B A;  5AQ7 A;  3HDX A;  1FT1 A;  4HOR A;  4URK A;  1HG5 A;  3CHR A;  3DXK G;  3FUH A;  3TWW A;  2R59 A;  1WG0 A;  5T4Y A;  3QWP A;  4KYO B;  5EID A;  1HXI A;  4J7W A;  4MKT A;  3T9K A;  4G2V A;  5FIO A;  4RLY A;  4OVU A;  4F6R D;  2P9L G;  3VLF A;  1SA5 A;  4AIF A;  3Q4A B;  1VDY A;  3DSX A;  3IV0 A;  4PUC A;  2X3M A;  3MYV A;  1IKN D;  1N0R A;  3JCK C;  3Q5M A;  4I6J A;  4IUL A;  5DBK A;  4TXP A;  4OAV B;  5HKP A;  5EX0 A;  2OEV A;  5JHA A;  4DLO A;  1NA3 A;  3CV0 A;  4U7E B;  1O1S A;  3FTS A;  1UN8 A;  3FU5 A;  4EZJ A;  4PDX A;  3HYM B;  1IHB A;  2FO7 A;  2VSN A;  1WY6 A;  3S7B A;  4WUY A;  4DX1 A;  1ELK A;  3ONK A;  3FH7 A;  3CHQ A;  3UX4 A;  4BTA A;  4GTV A;  3L17 A;  4XEI G;  1U3C A;  2PL2 A;  5FZS A;  4JVS A;  1A5E A;  3B7U X;  2LUH A;  4K5B A;  4U8V D;  2P9K G;  3CK8 A;  4F53 A;  1MQS A;  2WXL A;  1X81 A;  5D66 A;  3UM3 A;  3CVY A;  3FTX A;  1N54 A;  1MYO A;  2H6I A;  3QJZ A;  3V2X A;  3ASF A;  3DPD A;  3FDH A;  3DSV A;  4B94 A;  3MGB A;  4TRQ A;  2X6F A;  3PNL B;  3UMV A;  3ML8 A;  4AVX A;  3W9F A;  3SQV A;  3EIJ A;  1LF8 A;  4P29 A;  4LG6 A;  3ZN3 A;  4PS3 A;  2XRZ A;  3PRZ A;  3U64 A;  4G24 A;  3QAQ A;  3FHE A;  2QC9 A;  2WXI A;  4O1O A;  1YA0 A;  3SNX A;  3ABK E;  3R7R A;  4ZFH A;  1UG3 A;  3AAA C;  3LYA A;  3ZXS A;  4EBA A;  4HLE A;  1AWC B;  5G55 A;  3TWQ A;  1ZB1 A;  3BG1 B;  2XCC A;  5KJL A;  5AQB A;  4LER A;  4BT9 A;  4WNG A;  4FC8 A;  3KD7 A;  3UUX A;  2WM9 A;  3ZYQ A;  2J8S D;  1N4S A;  1RZ4 A;  2V0P A;  1S64 A;  3CVN A;  4ANX A;  3DXM G;  5H7P A;  1H19 A;  3Q47 B;  2BF0 X;  5A23 A;  1ZBP A;  2PZI A;  3KSQ A;  3ASH A;  1IQR A;  4UI9 C;  3HVE A;  2L9B A;  4GPK A;  3MV2 B;  5C1D A;  2NSZ A;  4GYW A;  2JLB A;  4DPR A;  4ME2 A;  1TR4 A;  1TEZ A;  2WPV A;  3D9P A;  3ZHE A;  2V5F A;  1H6K A;  1N4Q A;  3P1U A;  2R05 A;  4DK5 A;  5JA4 D;  3SD5 A;  4E6H A;  3G2T A;  1TJC A;  1N11 A;  3JUE A;  3QAR A;  2GRN B;  3LVQ E;  2IF4 A;  4I1O B;  4BES A;  4N5C A;  4W9R A;  4PS8 A;  3R9M A;  3LDZ A;  1HFA A;  3UTM A;  4G8L A;  4I6E A;  3APD A;  1TNO A;  4N3A A;  4BX9 A;  2IY0 C;  1OWM A;  4J6I A;  3RO2 A;  2MOW A;  3PS6 A;  1SVX A;  5BW8 C;  3NBN B;  4D10 C;  4U8Y D;  2KCK A;  2E2E A;  4GU5 A;  4DJA A;  3ULY A;  2LAI A;  4L7T A;  4U95 D;  4IRU A;  3JQ1 A;  5ENO D;  5B3S E;  3P2B A;  5KJN A;  3DSS A;  4UWF A;  1N94 A;  4BET A;  1TNB A;  3PH0 C;  3I5P A;  4L9P A;  3G2W A;  3APC A;  3IBE A;  5EIL A;  4O6F A;  2ZXW E;  3Q9N C;  1FVF A;  4KMO A;  5LOZ A;  2OCC E;  1JCQ A;  3E32 A;  4DI3 A;  4WAF A;  1EDU A;  3ZYL A;  2AXU A;  2ION A;  2R17 C;  4JXT A;  1E8W A;  2EIN E;  3E34 A;  4J8Y A;  3G2S A;  4JC8 A;  3LY9 A;  2FEZ A;  5EX3 A;  1E8X A;  3GYZ A;  2I6H A;  4YND A;  3ZXP A;  2BTD A;  1BLX B;  3SO8 A;  1E7U A;  4XZ4 A;  3Q49 B;  5FJY A;  2IJG X;  1TYQ G;  4ANW A;  4LEU A;  4XIF A;  4LNU D;  3RIB A;  4U63 A;  5LX8 A;  3SFX A;  4GA0 A;  3FU6 A;  3OAW A;  3ZEF A;  4YDW A;  2DCP A;  1JCS A;  4HBD A;  4RSY A;  3PZD A;  2L6J A;  4OYS A;  3CVU A;  3LVR E;  3URZ A;  2RG8 A;  4C9B B;  3VTY A;  3DEO A;  5HI7 A;  5KCM A;  1NL4 A;  5ARF A;  4UQY A;  5G05 C;  4EPZ A;  4PH4 B;  4BT8 A;  3TWU A;  4I43 A;  4APF A;  2XZT G;  2J4D A;  2M63 A;  3ISM C;  5HQ8 A;  4F1S A;  3I3N A;  3K9I A;  3D9M A;  3FUM A;  2BKK B;  1TJF A;  3ZVV A;  4K5A B;  4B0Z A;  4G11 A;  3IEG A;  4CYM D;  3TWR A;  1UN9 A;  4QFV A;  3U66 A;  3FUE A;  4TV3 A;  3LXU X;  3HXC A;  4GZD A;  5CCM A;  3TJP A;  2ETA A;  1GW6 A;  2RFM A;  4Y6W A;  3CQC B;  3AS5 A;  3EU5 A;  3KS2 A;  4I2Z A;  5CEC B;  1SZA A;  3SFZ A;  3ZIM A;  1KLX A;  3NB2 A;  5DIZ A;  1OCR E;  5JMN D;  2AVP A;  2WXN A;  2OVB A;  3OXL A;  2XS1 A;  4JHK A;  1H6O A;  2IEJ A;  1SA4 A;  4WWN A;  3EUV A;  5CEA A;  5FIN A;  5ENP D;  3C3O A;  4GZ5 A;  5ENQ D;  4YDY A;  5FQ8 A;  4GTQ A;  3TWX A;  5ENS D;  4BX8 A;  3G2V A;  3B95 A;  1LTX A;  4CCA A;  5G05 J;  3TL5 A;  2GRL A;  3CVQ A;  2A5U A;  4J8F A;  3CK7 A;  2CG2 A;  5T8I A;  2GW1 A;  4M3O A;  3UM1 A;  2VGE A;  3FTY A;  5KJK A;  5AJD A;  4OAU C;  4HXI A;  3CK9 A;  4GZ3 A;  3FUL A;  1HH8 A;  4BSX A;  3ENE A;  4APO A;  3U3W A;  4UI9 K;  3NZU A;  2VYI A;  5CED B;  1P5Q A;  1XNF A;  4WND A;  4N39 A;  3U4T A;  4LUN U;  1Z3X A;  3Q79 A;  2CFU A;  4QQI A;  4A3V A;  1TNY A;  2HR2 A;  4N3C A;  2R5S A;  3O48 A;  4GB9 A;  1KT1 A;  5CHE E;  4O60 A;  3CHP A;  4GPM A;  3FTV A;  2ZIR A;  2C2L A;  3D9N A;  1N9A A;  4JA7 A;  2XGM A;  1E7V A;  4KVO A;  3ULQ A;  2I9C A;  3MZL B;  4GA1 A;  3V31 A;  4U0S A;  3CGH A;  5ENN A;  1KPS B;  3NF1 A;  3D9K A;  4GML A;  4MLP A;  2X6K A;  5D2M C;  1OUV A;  1OXJ A;  3U9W A;  5J08 A;  4KBQ A;  2FF4 A;  5D0O D;  3L08 A;  1W3B A;  5JHB A;  3EDT B;  3TXN A;  3CST A;  4EEC A;  2C0M A;  5CBN A;  4JHR A;  4I6G A;  2WQH A;  4KT6 B;  2AW6 A;  1O5M A;  5ANR A;  4DX2 A;  1E8Z A;  4X8Q A;  3UIO C;  1E8Y A;  4MRU A;  2XRY A;  4FU3 A;  4B89 A;  3MEK A;  5FT9 A;  1KZP A;  3RAU A;  1BI7 B;  1OWN A;  5KJM A;  4CGV A;  5FQ4 A;  1LD7 A;  3T5X A;  2J08 A;  3L9T A;  5LP0 A;  3AU4 A;  3LS8 A;  2EIK E;  4O1P A;  4CT0 A;  2ZU6 B;  1E96 B;  5G04 C;  3T5V A;  2QYJ A;  3HXF A;  4UWL A;  4L2L A;  4AJW A;  2Y69 E;  3QDN A;  1H2U A;  4J8E A;  4EQF A;  2GRP B;  3TXM A;  2RD0 A;  2P9P G;  1TNU A;  1EYH A;  4HI8 A;  1YCS B;  2B0O E;  1WM5 A;  2GRM A;  2EIM E;  2J09 A;  2WXM A;  3Q73 A;  3HXD A;  1N4R A;  3HRA A;  4UQX A;  2Y4T A;  4LSZ E;  2YNQ A;  2H6F A;  3BUA A;  3MV3 B;  1KT0 A;  2EIJ E;  2IOS A;  4JA9 A;  5AJL A;  1PC2 A;  2WMN A;  3MKQ B;  4BY6 A;  3UQ3 A;  4FAD A;  3ASO E;  3CLJ A;  1FT2 A;  2WXJ A;  4JZY A;  4ACL A;  4JEH A;  2VTB A;  3TWT A;  1DCE A;  3MCX A;  2PQR A;  4DRX E;  2GRQ B;  3S7J A;  2Y4U A;  3OXF A;  5BPP A;  4HOQ A;  2VTB B;  3FEY A;  2DZN A;  2XQ0 A;  3OXG A;  5CRU A;  1DNP A;  3LY8 A;  2H6G A;  5EDS A;  1TN6 A;  3NOC D;  4EHM A;  2YQ8 A;  3IHV A;  4N2S A;  1TNZ A;  3D9H A;  4C48 B;  3PEV B;  3E33 A;  1FVH A;  3TGO A;  3FTZ A;  3CVL A;  3RRU A;  4GCN A;  4HI9 A;  1O1T A;  4I2W A;  3L16 A;  2QFC A;  1OCZ E;  4HRM B;  4G8K A;  2CHX A;  2EQX A;  1K3Z D;  3PE3 A;  3FEX A;  2XPY A;  4Z68 A;  4N5Q A;  4LNB A;  3S2A A;  4WNE A;  4JB8 P;  3LCA A;  4HOT A;  4ILI A;  2X6J A;  3EU9 A;  3Q78 A;  3CHM A;  3D9L A;  2I1J A;  3C5R A;  3LJN A;  4GMR A;  1QZ2 A;  3EHN A;  5AQ9 A;  4GA2 A;  3SHF A;  3J5Q B;  2I1K A;  3NZS A;  3CHS A;  2X6I A;  3V2O A;  3C98 A;  4A3T A;  3HG0 D;  4U96 D;  1HX8 A;  1O1R A;  4HOU A;  4Q69 A;  1OY3 D;  2VSX E;  2FUL A;  4PS7 A;  4F1P A;  3SF4 A;  2KCV A;  2WXF A;  5LCW C;  1B89 A;  4GTS A;  1UW4 B;  4HOS A;  2JEK A;  2HM8 A;  3QC1 A;  3BG0 B;  1OWP A;  2DBA A;  3FH5 A;  3AG4 E;  5CER B;  3TG5 A;  3QKY A;  2P58 C;  4WWO A;  1E90 A;  4GZ6 A;  5ENR D;  3B7T A;  1UJJ A;  4HFG A;  5BV0 A;  3B7B A;  4RG6 A;  4TXQ A;  4UI9 J;  4ABN A;  4WNF A;  4NQ0 A;  2Y0B G;  5CBO A;  1JWG A;  3T8K A;  3FUN A;  4G25 A;  3QOU A;  2AWI A;  2L0T B;  3AG2 E;  2V4L A;  4XKC A;  1DCQ A;  4L23 A;  2VGX B;  4AV7 A;  3SBT B;  1WAO 1;  2P9I G;  4CEM A;  4HNA D;  5BXO A;  4ANU A;  3FUK A;  5E75 A;  3NAW A;  2FBN A;  5FZQ A;  4C0M A;  4YDO A;  3DST A;  1S0P A;  2X6H A;  3FUJ A;  1MX2 A;  5AAR A;  5AEN A;  4JHJ A;  5FZR A;  5CRV A;  4YVQ C;  3FU0 A;  2OV8 A;  3QNK A;  4LRZ A;  5B1A E;  4ILH B;  1K1A A;  3CEQ A;  2LXM A;  2KC7 A;  5G2N A;  4EBA G;  3T8M A;  1N52 A;  1PY1 A;  2Y1L E;  4G26 A;  4K03 A;  3ZYK A;  5BXU A;  3EHQ A;  1SZ9 A;  2KZT B;  4HLL A;  4AY6 A;  1UJK A;  5HS0 A;  4CRW A;  4RQI A;  2QYU A;  5JJ6 A;  1S63 A;  2ZIS A;  1MHQ A;  2P9S G;  4LCT A;  2YHE A;  4GMJ A;  2MRI A;  2J07 A;  1WDY A;  1D8E A;  1U2V G;  3ZGQ A;  5D0Q D;  4YDE A;  3SGH A;  2DZO A;  2LO6 A;  1IHG A;  1V55 E;  4U07 A;  1MZC A;  1PAQ A;  5C2Y A;  3UIP C;  4UWK A;  3CHO A;  2KCL A;  2A4Z A;  3KEA A;  3KSL A;  3UKU G;  2OOE A;  2LNI A;  3QWV A;  1XGW A;  2WXH A;  3D9J A;  4B8C B;  4AXH A;  3ZU7 B;  1IQU A;  3V79 K;  3DPY A;  4OVV A;  2IO3 C;  4UUC A;  3ZUV B;  3WG7 E;  3L54 A;  2CFZ A;  3B7R L;  3MA5 A;  4NRH B;  3UT4 A;  5AN8 A;  3Q75 A;  4MBG A;  4A63 B;  2XEH A;  3DWL G;  4XI9 A;  2PNN A;  1NZN A;  4ILG A;  4EZL A;  1BI8 B;  2WXQ A;  4KZC A;  1D8D A;  4AEZ C;  2BKG A;  1D9S A;  5JJT A;  3FWV A;  3SI5 A;  2VJ8 A;  1NI1 A;  4H7X A;  2ETB A;  3PZ2 A;  3FUD A;  2WQ6 A;  3FP3 A;  3Q7F A;  2OND A;  1ELR A;  3SY2 A;  3CSF A;  3N71 A;  2F8X K;  5A7D B;  1EF1 C;  2XZD G;  3PNT B;  5KNG A;  4DI4 A;  3ASN E;  3CVW A;  5LFA A;  4XKB A;  2WXG A;  4RG9 A;  4I1A A;  3SBS A;  1LD8 A;  4NIK A;  5A6C A;  4A1S A;  2IQC A;  5BUZ A;  3VLD A;  2LAH A;  3AS4 A;  3VLE A;  1L5J A;  3E37 A;  1JPL A;  2F37 A;  4M7C A;  5BT1 A;  3EHM A;  2DYS E;  4JEU A;  4JPS A;  3LJ3 A;  3QK0 A;  1K8K G;  4AP2 A;  4HVB A;  4HB5 A;  2XS8 A;  1MJ0 A;  1IYG A;  3CVV A;  4GYY A;  1EPU A;  1QBQ A;  2ZGD A;  5FQ6 A;  1SQM A;  1BD8 A;  1H0A A;  2P9N G;  3R7Q A;  4J8D A;  1HF8 A;  4BFR A;  3C72 A;  4FUL A;  4U0U A;  2XHE A;  1YMP A;  3V30 A;  1OCC E;  2KM4 A;  2YIN A;  3IHY A;  3D9O A;  4UWG A;  1NP7 A;  1RW2 A;  2P9U G;  3S7D A;  3RRN B;  2UWJ G;  2WXP A;  3ZW3 A;  1OCO E;  3SFY A;  1S70 B;  2KXP C;  4GTP A;  3LY7 A;  1MX4 A;  5EN5 D;  3JQ0 A;  5E76 A;  4TXR A;  3ABL E;  1Z5S C;  2GRR B;  3I4R B;  4DX6 D;  4FP7 A;  3AS8 A;  4I1M A;  2LSU A;  3TAX A;  1G3N B;  2IOL A;  1NA0 A;  3RK6 A;  3AU5 A;  4YVO A;  5HRY A;  1DC2 A;  5BV1 A;  3MX3 A;  3DEP A;  4KZ0 A;  3SZ7 A;  2C0L A;  1H2T C;  2F0Y A;  3W9G A;  3QWW A;  2OVF A;  3CQG B;  4Y6C A;  4DX7 D;  3VTX A;  3QB2 A;  4BEP A;  2VGY A;  2PM7 A;  2V8S E;  4GTO A;  2XEN A;  2XEE A;  4R7L A;  3ZFW A;  4I9C A;  3DRA A;  3WXX A;  4FHJ A;  3ESL A;  3MKQ A;  3RSE G;  4J0U A;  2KBX A;  5EIB E;  4UQZ A;  3UT7 A;  1Z6T A;  4HQD A;  3ZRH A;  2CHW A;  3FUI A;  2IU1 A;  2WXK A;  3KEZ A;  2B6C A;  3UIN C;  1OT8 A;  5AIJ A;  2R2L A;  3Q15 A;  4FJY A;  3FTW A;  2WB2 A;  2MYO A;  4CDM A;  4K0R A;  1N95 A;  5CMY A;  5FWQ A;  1JUQ A;  2GGF A;  3PZ1 A;  4V3I A;  2DYR E;  3PUJ A;  3PEU B;  4ANV A;  3O4Z A;  1Z3Y A;  3APF A;  4UWH A;  5M72 A;  5ARG A;  4GTM A;  5EYL A;  2VQ2 A;  2J4B A;  3CVP A;  5BNW A;  2DIW A;  2MHK A;  4FLH A;  3R9A B;  4KXK B;  3CIA A;  2RFA A;  3G2U A;  3ASG A;  3GZS A;  3D3M A;  5G04 J;  2KAT A;  2J9Q A;  4ATZ D;  1HU3 A;  3RU0 A;  5T3R A;  2NC9 A;  2LSV A;  3HIZ A;  2ZGG A;  1BPO A;  1ELW A;  3IKO B;  4GAA A;  1OWL A;  2BED A;  4E85 A;  1TN7 A;  4DX5 D;  1H2V C;  2XEV A;  3HHM A;  5B1B E;  1INZ A;  3B7S A;  1OWO A;  3ESK A;  4EZK A;  2WXR A;  4GZC A;  3RJV A;  3MJW A;  4KVM A;  3HVE B;  4GCO A;  4IN3 B;  2FI7 A;  3KAE A;  2XPI A;  3EIQ C;  3UI2 A;  1MX6 A;  4XI0 A;  2Q7F A;  3FH8 A;  4BWR A;  3BQO A;  3PZ4 A;  2CG3 A;  2A5E A;  2ILR A;  4BTB A;  3ZHE B;  5CCL A;  3ZNG A;  3CR3 A;  3LPZ A;  4MS6 A;  5AQA A;  2QY7 A;  1DVP A;  3J5P A;  2X38 A;  4ATG A;  1K1B A;  1Q2Z A;  2V4H C;  3ULE G;  5FQ7 A;  4FHK A;  4L1B A;  4U0Z A;  3I4G A;  4HRN A;  1X5B A;  4A55 A;  3Q9U C;  5FTP A;  4AM9 A;  2JAB A;  3TWV A;  1KZO A;  3CVX A;  4NUR A;  2NXP A;  1ZU2 A;  2HYZ A;  2VGX A;  3ZKJ A;  3L82 A;  4GTT A;  4ACK A;  3F6Q A;  3UPV A;  1NFI E;  4G23 A;  3FY4 A;  4C0E A;  4G1T A;  3BEE A;  1N0Q A;  2NYJ A;  2FO1 E;  3PE4 A;  1HZ4 A;  4A1G A;  3X2Q E;  4FLB A;  4I17 A;  3RKV A;  1AP7 A;  4FA6 A;  4LNG A;  3FUF A;  4ZHB A;  2DVW A;  3FFL A;  4XX5 A;  2CHZ A;  2UY1 A;  2WVI A;  2AXZ A;  1N4P A;  3DSW A;  2VSO E;  5EKQ D;  3ML9 A;  4I9E A;  3ABM E;  2UY1 B;  4BER A;  1JWF A;  3ONL A;  3RO3 A;  2J49 A;  3EHR A;  2KZT A;  4DUI A;  5IY5 E;  2XCB A;  4RVB A;  5J90 A;  4Q96 A;  4HRL A;  2YHC A;  2AJA A;  4J8S A;  3MKR A;  5AYW D;  3BU8 A;  1JCR A;  5JJ7 A;  2GRO B;  2AXV A;  3GW4 A;  3C3R A;  4CT4 A;  4B8A A;  4BSZ B;  5AAO A;  2PQN A;  2LXL A;  3B13 A;  2IO2 C;  5LCW J;  3DSU A;  3GZ1 A;  3PVL A;  3JXJ A; 
#chains in the Genus database with same CATH homology
 1EYH A;  4W9R A;  3RRM B;  4PS8 A;  5A6C A;  3LDZ A;  4A1S A;  2IQC A;  1HFA A;  5BUZ A;  3D9I A;  3VLD A;  2I2O A;  1WM5 A;  2GRM A;  2LAH A;  3AS4 A;  3NQP A;  3PDN A;  4FJZ A;  4GYO A;  3VLE A;  1L5J A;  4I6E A;  1JPL A;  3APD A;  4IYP A;  2J09 A;  4N3A A;  2WXM A;  2XGO A;  4CDN A;  4BX9 A;  1OWM A;  5BT1 A;  4J6I A;  3EHM A;  3RO2 A;  2MOW A;  3PS6 A;  5BW8 C;  4JEU A;  4UQX A;  1QNF A;  2Y4T A;  4JPS A;  4D10 C;  3LJ3 A;  3QK0 A;  4CDR A;  2YNQ A;  2KCK A;  4AP2 A;  1HS6 A;  3JUI A;  3MV3 B;  4JL0 A;  4HVB A;  2E2E A;  4GU5 A;  4DJA A;  1KT0 A;  1IYG A;  2LAI A;  3TG4 A;  4C0E A;  4L7T A;  4N2Q A;  2IOS A;  4IRU A;  3L6A A;  3CVV A;  4JA9 A;  4GYY A;  2XPZ A;  5AJL A;  3CKC A;  1PC2 A;  4U04 A;  1EPU A;  3JQ1 A;  5FQ6 A;  1SQM A;  3P2B A;  5KJN A;  2PM6 A;  2WMN A;  4UWF A;  3LKU A;  1H0A A;  3JYS A;  2HO1 A;  3R7Q A;  3MKQ B;  4BY6 A;  4J8D A;  3PH0 C;  3I5P A;  1HF8 A;  3UQ3 A;  4FAD A;  4F7A A;  4BFR A;  3FU3 A;  3CLJ A;  4FUL A;  3G2W A;  3APC A;  3IBE A;  4U0U A;  3PRE A;  2XHE A;  4F3V A;  4O6F A;  2WXJ A;  4JZY A;  4ACL A;  2XGS A;  4JEH A;  2BUG A;  2VTB A;  2KM4 A;  1FVF A;  2YIN A;  2PQR A;  3IHY A;  3MCX A;  2E0I A;  4KMO A;  3DBS A;  5LOZ A;  3D9O A;  3ZYM A;  4UWG A;  3S7J A;  2Y4U A;  1NP7 A;  5ANL A;  4WAF A;  4DI3 A;  1EDU A;  3OXF A;  3ZYL A;  3E4B A;  4DLQ A;  3S7D A;  2AXU A;  2ION A;  2R17 C;  4HOQ A;  4JXT A;  3RRN B;  1E8W A;  5BPP A;  2UWJ G;  2WXP A;  3ZW3 A;  4TUU A;  2VTB B;  2IFU A;  3FEY A;  3G2S A;  4JC8 A;  3LY9 A;  2FEZ A;  5EX3 A;  2XQ0 A;  3OXG A;  1E8X A;  1A17 A;  3GYZ A;  2I6H A;  3LY7 A;  3FTU A;  1DNP A;  3L22 A;  3JQ0 A;  4YND A;  5E76 A;  3UT8 A;  4CGW A;  2BTD A;  3LY8 A;  5EDS A;  5CMW A;  4XE0 A;  1E7U A;  4XZ4 A;  3Q49 B;  5FJY A;  3I4R B;  2IJG X;  4FP7 A;  2YQ8 A;  3IHV A;  4ANW A;  4LEU A;  4N2S A;  1Y6I A;  3PEV B;  3TGO A;  1FVH A;  4XIF A;  3FTZ A;  3CVL A;  3RIB A;  3RRU A;  4GCN A;  4U63 A;  3AS8 A;  4I2W A;  5LX8 A;  3L16 A;  2QFC A;  4GA0 A;  3FU6 A;  4I1M A;  2LSU A;  3TAX A;  4AY5 A;  2CHX A;  2EQX A;  2IOL A;  3OAW A;  3S7F A;  2WQ7 A;  1NA0 A;  1U3D A;  3FEX A;  3PE3 A;  3ZEF A;  2DCP A;  4WWP A;  3RK6 A;  3AU5 A;  2XPY A;  4H7Y A;  4YVO A;  4AOF A;  4RSY A;  3PZD A;  3ZPJ A;  2L6J A;  4OYS A;  1FCH A;  1HO8 A;  2Y3A A;  3S2A A;  3ASD A;  3MX3 A;  3CKB A;  5BV1 A;  3CVU A;  3LVR E;  4HS2 A;  4JW1 A;  1QQE A;  3EJN A;  2L0I A;  4KZ0 A;  3SZ7 A;  2C0L A;  1H2T C;  4WNE A;  3URZ A;  1Y8M A;  3L13 A;  2RG8 A;  3LCA A;  3OTN A;  2WMO A;  4Q94 A;  3GZ2 A;  4C9B B;  4HOT A;  2VSY A;  3QWW A;  2OVF A;  3VTY A;  3CQG B;  4ILI A;  4U8H A;  5HI7 A;  4Y6C A;  5KCM A;  1HE8 A;  2X6J A;  5ARF A;  3VTX A;  3LEW A;  3QB2 A;  4UQY A;  3CHM A;  3D9L A;  5G05 C;  4EPZ A;  2I1J A;  4PH4 B;  2VGY A;  4BT8 A;  2PM7 A;  2V8S E;  4I43 A;  4NAC A;  4APF A;  5HQ8 A;  2J4D A;  1HG2 A;  2M63 A;  4L2Y A;  1QZ2 A;  3EHN A;  3PUK A;  2WXO A;  4N3B A;  4GA2 A;  4R7L A;  3ZFW A;  4F1S A;  3I3N A;  4I9C A;  3SHF A;  2I1K A;  3HDX A;  3K9I A;  3NZS A;  3CHS A;  3D9M A;  3WXX A;  2X6I A;  4FHJ A;  3FUM A;  1HG5 A;  3CHR A;  3ESL A;  4URK A;  4HOR A;  3FUH A;  3C98 A;  1TJF A;  3MKQ A;  3ZVV A;  2R59 A;  4J0U A;  4B0Z A;  4A3T A;  4G11 A;  5T4Y A;  1HX8 A;  3IEG A;  4HOU A;  3QWP A;  4KYO B;  4Q69 A;  4UQZ A;  1UN9 A;  4QFV A;  2VSX E;  3UT7 A;  1HXI A;  1Z6T A;  3U66 A;  2FUL A;  2CHW A;  3FUI A;  2IU1 A;  4PS7 A;  3SF4 A;  2WXK A;  3ZRH A;  2KCV A;  3FUE A;  3KEZ A;  2WXF A;  4TV3 A;  3LXU X;  1B89 A;  5LCW C;  1UW4 B;  4MKT A;  2HM8 A;  2JEK A;  4HOS A;  3QC1 A;  3BG0 B;  1OWP A;  4G2V A;  2DBA A;  4GZD A;  5CCM A;  3TJP A;  5AIJ A;  3FH5 A;  4OVU A;  1GW6 A;  3Q15 A;  3TG5 A;  3VLF A;  4FJY A;  3FTW A;  4Y6W A;  2WB2 A;  3QKY A;  3CQC B;  2P58 C;  3AS5 A;  4AIF A;  4WWO A;  1E90 A;  3Q4A B;  1VDY A;  3KS2 A;  4GZ6 A;  3IV0 A;  4CDM A;  4PUC A;  2X3M A;  4K0R A;  4I2Z A;  1SZA A;  3SFZ A;  3ZIM A;  3MYV A;  5CMY A;  3B7T A;  5FWQ A;  1UJJ A;  1JUQ A;  1KLX A;  3JCK C;  4HFG A;  5BV0 A;  3Q5M A;  2GGF A;  4I6J A;  4IUL A;  4V3I A;  5DIZ A;  4RG6 A;  5DBK A;  4UI9 J;  4ABN A;  4WNF A;  3PUJ A;  3PEU B;  2AVP A;  4NQ0 A;  4ANV A;  1JWG A;  3O4Z A;  1Z3Y A;  2OVB A;  2WXN A;  3APF A;  3OXL A;  4UWH A;  5M72 A;  5ARG A;  5EX0 A;  3FUN A;  2VQ2 A;  2J4B A;  4DLO A;  5JHA A;  1NA3 A;  4G25 A;  3QOU A;  2AWI A;  4JHK A;  3CVP A;  3CV0 A;  2L0T B;  5BNW A;  2DIW A;  2MHK A;  4FLH A;  3FTS A;  1UN8 A;  3FU5 A;  4EZJ A;  2V4L A;  4WWN A;  3R9A B;  4XKC A;  4KXK B;  3CIA A;  3G2U A;  4L23 A;  2VGX B;  3ASG A;  3GZS A;  4AV7 A;  4PDX A;  3D3M A;  3HYM B;  3SBT B;  1WAO 1;  2FO7 A;  2VSN A;  1WY6 A;  5G04 J;  2KAT A;  4WUY A;  2J9Q A;  3S7B A;  4CEM A;  1HU3 A;  1ELK A;  4ANU A;  3RU0 A;  3FUK A;  5E75 A;  3ONK A;  5T3R A;  2FBN A;  3FH7 A;  2NC9 A;  5FZQ A;  4GZ5 A;  2LSV A;  4C0M A;  3HIZ A;  5FQ8 A;  1BPO A;  3CHQ A;  1ELW A;  3IKO B;  1S0P A;  2X6H A;  3FUJ A;  3UX4 A;  4BTA A;  4BX8 A;  4GAA A;  5AEN A;  3G2V A;  4JHJ A;  1OWL A;  5FZR A;  4CCA A;  3L17 A;  4YVQ C;  5G05 J;  4E85 A;  3TL5 A;  1U3C A;  3FU0 A;  2GRL A;  2PL2 A;  5FZS A;  3CVQ A;  1H2V C;  2A5U A;  2XEV A;  3HHM A;  4JVS A;  1INZ A;  2OV8 A;  3B7S A;  1OWO A;  3B7U X;  3ESK A;  3CK7 A;  4J8F A;  2WXR A;  3QNK A;  4LRZ A;  4EZK A;  2CG2 A;  4ILH B;  5T8I A;  4GZC A;  3RJV A;  2GW1 A;  3MJW A;  3CEQ A;  4KVM A;  3HVE B;  2KC7 A;  4GCO A;  4IN3 B;  4M3O A;  5G2N A;  2FI7 A;  4EBA G;  3CK8 A;  3KAE A;  2XPI A;  3EIQ C;  4F53 A;  1MQS A;  3T8M A;  3FTY A;  1N52 A;  4XI0 A;  1PY1 A;  2WXL A;  4G26 A;  2Q7F A;  4K03 A;  5AJD A;  3FH8 A;  5KJK A;  3ZYK A;  4HXI A;  3CK9 A;  4BWR A;  4GZ3 A;  3CVY A;  1SZ9 A;  1HH8 A;  2KZT B;  3FUL A;  4BSX A;  3FTX A;  3ENE A;  1N54 A;  4APO A;  4AY6 A;  2CG3 A;  2ILR A;  3QJZ A;  1UJK A;  3ASF A;  4UI9 K;  4BTB A;  4CRW A;  3ZHE B;  3U3W A;  3NZU A;  5CCL A;  3CR3 A;  2VYI A;  3DPD A;  3LPZ A;  4MS6 A;  1P5Q A;  1XNF A;  2QY7 A;  3FDH A;  4WND A;  5JJ6 A;  4N39 A;  3U4T A;  4LUN U;  4B94 A;  3MGB A;  1Z3X A;  4TRQ A;  1MHQ A;  2CFU A;  4LCT A;  4A3V A;  4N3C A;  1DVP A;  2HR2 A;  2R5S A;  2X6F A;  3O48 A;  4GB9 A;  2YHE A;  4GMJ A;  2MRI A;  1KT1 A;  2J07 A;  2X38 A;  3PNL B;  3UMV A;  5CHE E;  4ATG A;  3ZGQ A;  3ML8 A;  5D0Q D;  4AVX A;  3SGH A;  2LO6 A;  3EIJ A;  1IHG A;  1LF8 A;  4P29 A;  3ZN3 A;  4U07 A;  5FQ7 A;  4PS3 A;  2XRZ A;  1PAQ A;  3PRZ A;  4FHK A;  4L1B A;  3CHP A;  3U64 A;  4G24 A;  4U0Z A;  5C2Y A;  3FTV A;  3QAQ A;  4UWK A;  3CHO A;  2KCL A;  3FHE A;  2C2L A;  3D9N A;  2A4Z A;  2WXI A;  3I4G A;  4JA7 A;  2XGM A;  1X5B A;  1E7V A;  1YA0 A;  2OOE A;  4KVO A;  2LNI A;  3QWV A;  3SNX A;  4A55 A;  3R7R A;  5FTP A;  4AM9 A;  3ULQ A;  1UG3 A;  2I9C A;  1XGW A;  3MZL B;  4GA1 A;  2WXH A;  3LYA A;  3ZXS A;  3D9J A;  4EBA A;  3CVX A;  4NUR A;  4B8C B;  4U0S A;  4HLE A;  2NXP A;  4AXH A;  3CGH A;  1IQU A;  5ENN A;  5G55 A;  1ZU2 A;  3BG1 B;  2XCC A;  4OVV A;  2HYZ A;  2VGX A;  3D9K A;  3NF1 A;  5KJL A;  4BT9 A;  4LER A;  4GML A;  4WNG A;  4FC8 A;  4ACK A;  3UPV A;  4G23 A;  3FY4 A;  3KD7 A;  2CFZ A;  3L54 A;  2WM9 A;  4G1T A;  4MLP A;  3UUX A;  3B7R L;  3BEE A;  3MA5 A;  4NRH B;  3UT4 A;  2X6K A;  1OUV A;  3U9W A;  3PE4 A;  3ZYQ A;  5J08 A;  4KBQ A;  2FF4 A;  4XI9 A;  1HZ4 A;  5D0O D;  4A1G A;  3L08 A;  1W3B A;  2V0P A;  5JHB A;  3CVN A;  4ANX A;  4FLB A;  4I17 A;  3EDT B;  3RKV A;  3TXN A;  3CST A;  4EEC A;  4FA6 A;  2C0M A;  1H19 A;  3FUF A;  1NZN A;  4ILG A;  4EZL A;  3FFL A;  3Q47 B;  2BF0 X;  2WXQ A;  4JHR A;  4XX5 A;  4KZC A;  4I6G A;  2CHZ A;  2WQH A;  4KT6 B;  1ZBP A;  5A23 A;  2PZI A;  2UY1 A;  2AW6 A;  2WVI A;  4AEZ C;  2AXZ A;  5JJT A;  3ASH A;  2VSO E;  5ANR A;  5EKQ D;  1IQR A;  3FWV A;  3ML9 A;  4UI9 C;  1E8Z A;  1E8Y A;  4MRU A;  3SI5 A;  3HVE A;  2VJ8 A;  2L9B A;  4GPK A;  2XRY A;  4H7X A;  4I9E A;  4FU3 A;  4B89 A;  3MEK A;  5FT9 A;  2UY1 B;  3MV2 B;  5C1D A;  2NSZ A;  4GYW A;  1OWN A;  2JLB A;  4DPR A;  1JWF A;  4ME2 A;  5KJM A;  3ONL A;  4CGV A;  3FUD A;  3RO3 A;  2J49 A;  5FQ4 A;  2KZT A;  3FP3 A;  2WQ6 A;  1TEZ A;  3T5X A;  2XCB A;  4RVB A;  2J08 A;  5J90 A;  2WPV A;  4Q96 A;  3D9P A;  2OND A;  3AU4 A;  1ELR A;  3LS8 A;  3ZHE A;  5LP0 A;  2V5F A;  1H6K A;  3CSF A;  2YHC A;  3N71 A;  4CT0 A;  3P1U A;  2ZU6 B;  1EF1 C;  4J8S A;  3PNT B;  1E96 B;  5G04 C;  5A7D B;  4DK5 A;  3MKR A;  5AYW D;  3SD5 A;  4DI4 A;  4E6H A;  3T5V A;  4UWL A;  4L2L A;  4AJW A;  3CVW A;  3QDN A;  5LFA A;  5JJ7 A;  3GW4 A;  2AXV A;  3G2T A;  1H2U A;  1TJC A;  4XKB A;  2WXG A;  4B8A A;  4CT4 A;  4RG9 A;  2PQN A;  3QAR A;  3B13 A;  4J8E A;  3TXM A;  4EQF A;  3LVQ E;  2IF4 A;  5LCW J;  2RD0 A;  4I1O B;  4I1A A;  3GZ1 A;  3SBS A;  3PVL A;  4N5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...