2PQRA

Crystal structure of yeast fis1 complexed with a fragment of yeast caf4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
DFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondria fission 1 protein
publication title Structural basis for recruitment of mitochondrial fission complexes by Fis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Apoptosis
total genus 42
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pqrA01
4N5CA 1OUVA 2KCLA 4HOQA 3CVLA 5BT1A 5KJNA 5ARFA 4GYOA 3K9IA 2E2EA 4YVQC 3N71A 3S7FA 2HYZA 4HORA 5D0OD 2UWJG 3CK7A 4YNDA 3RU0A 2I6HA 3RKVA 3ZN3A 2GW1A 3U3WA 4EQFA 3LKUA 3PE4A 5CCLA 4NQ0A 4BTBA 4O6FA 2R5SA 4N39A 2LSUA 2KCKA 4U04A 4I2ZA 4UQXA 3LY7A 4B94A 3VTXA 3PDNA 2XPIA 3FFLA 4KXKB 1WAO1 2AVPA 3IEGA 4J8DA 2HR2A 5EKQD 3MEKA 3HYMB 3GW4A 3ESKA 3LY9A 3QWPA 2VGXA 5JJTA 3ULQA 4KYOB 3LY8A 2VSNA 5M72A 3Q4AB 2C0MA 4GZ6A 2UY1B 2XGMA 2VYIA 4HOSA 5C1DA 3AS4A 5ARGA 1KLXA 5CHEE 4UI9J 3MV2B 1HZ4A 1HXIA 4UI9C 5A7DB 4I9EA 2NC9A 3KAEA 5A6CA 5FT9A 5G05J 2VSYA 5HQ8A 2IF4A 4GPKA 1PC2A 2PL2A 4APOA 3FWVA 3CKBA 4AM9A 2XCCA 2VGYA 1B89A 3LPZA 3MA5A 3QOUA 2KC7A 3GYZA 3SF4A 3MV3B 1NA3A 3QWWA 1XNFA 2LSVA 4UI9K 3MKRA 3TG4A 2FF4A 2C0LA 5FZQA 3S7DA 2Y4TA 3RO3A 1TJCA 3CEQA 3QDNA 5EX0A 3OXFA 4UQZA 4W9RA 4WUYA 1IYGA 3UPVA 1Y8MA 3CVQA 2PQNA 4AIFA 5BNWA 4I9CA 3GZ2A 3ASGA 2WQHA 5DBKA 5EX3A 4WNGA 2P58C 4XI9A 3PE3A 2QFCA 4BTAA 3TGOA 5DIZA 3BEEA 4AY5A 3R9AB 4BT9A 4J8FA 3S7BA 2UY1A 3EDTB 3Q47B 5G04C 4Y6CA 5D0QD 3ZHEA 2LNIA 3Q5MA 3LYAA 5KJLA 2JLBA 3S7JA 4N2QA 4U0ZA 3WXXA 3GZ1A 4I2WA 3UQ3A 2Y4UA 2FEZA 4IN3B 1E96B 1A17A 2ONDA 3CV0A 3QWVA 3QKYA 3CK9A 4WNDA 2VGXB 3Q49B 5CCMA 5LCWJ 4YVOA 3FP3A 3CK8A 2FI7A 4H7XA 4XIFA 5LCWC 4I17A 4J0UA 3ZFWA 3AS8A 2XGSA 4GCNA 3ASFA 4BWRA 4CDRA 2KATA 3KD7A 1P5QA 2XGOA 4GA2A 3E4BA 2HO1A 3TG5A 1NZNA 2V5FA 2L6JA 3ASDA 5JJ6A 3ZPJA 3ZGQA 2FBNA 2XCBA 2MHKA 5HI7A 4N3CA 5BW8C 4G24A 3ASHA 3CVNA 2Q7FA 3SZ7A 4ME2A 4JHRA 4JA9A 4G23A 5AYWD 3Q15A 5FZSA 4U07A 1ZU2A 3AS5A 2YHCA 5KJMA 3NF1A 4RG6A 1ZBPA 1HH8A 4Y6WA 4UQYA 2PZIA 4A1SA 4BT8A 3UUXA 1IHGA 4KBQA 4CGVA 4J8EA 3JYSA 4HOTA 2OOEA 4GCOA 1ELRA 2PQRA 4U0UA 2YQ8A 4G25A 4GZ3A 4N3BA 3OXGA 3CKCA 4GYYA 3KS2A 4GA0A 5G04J 4AY6A 4GA1A 4HOUA 4N3AA 3URZA 4H7YA 5FZRA 3U4TA 4JL0A 3VTYA 3CVPA 4WNEA 4XI0A 1W3BA 1ELWA 3TAXA 1KT1A 4CGWA 2XEVA 1NA0A 4G26A 5FTPA 2C2LA 3O48A 4WNFA 2KCVA 3ZHEB 5FJYA 4LEUA 4ABNA 3RJVA 1YA0A 4N2SA 4JA7A 1WM5A 2J9QA 4GZ5A 4GYWA 2VQ2A 1QZ2A 2DBAA 1KT0A 4G2VA 3LCAA 4RG9A 3RIBA 4U0SA 5JJ7A 4NRHB 5G05C 3RO2A 4F3VA 2BUGA 2FO7A 2WPVA 2IFUA 4G1TA 1QQEA 5KJKA 3OXLA 4I1AA 1FCHA
chains in the Genus database with same CATH superfamily
4GTVA 1N52A 4N5CA 3FH5A 5ANRA 4L1BA 4ATZD 1TN7A 3CVLA 2AJAA 5KJNA 2QC9A 3CHRA 4PS7A 5A23A 1UN9A 3ZXSA 2E2EA 3AU4A 4GTSA 2HYZA 3B13A 2UWJG 2IONA 2I6HA 4LSZE 2EQXA 3RKVA 3UI2A 1DC2A 3PE4A 3APDA 5CCLA 4FJYA 4NQ0A 3UIOC 1SZAA 3VTXA 3E37A 1WAO1 3IV0A 4K03A 3ABKE 3IEGA 4DLOA 3AAAC 4FC8A 4OVUA 3U9WA 3L16A 3CHPA 3ONKA 5AQ7A 2XRZA 3EHRA 5FQ4A 3LY8A 1UW4B 3FEYA 5M72A 4V3IA 3JUIA 4ANUA 3Q4AB 3SBTB 4K5CA 3AG1E 2XGMA 3QC1A 4FLHA 1MZCA 3AS4A 5ARGA 4WWOA 2PNNA 5JMND 4DX5D 3B7TA 1TNUA 3FTZA 4B89A 2BEDA 5HKPA 3FTYA 1HZ4A 5LFAA 4EBAG 5B1AE 5A7DB 3JQ1A 2RKKA 4ACLA 2L9BA 1Z3XA 1HG2A 5BUZA 4HRNA 4BX8A 1UOHA 1PC2A 3LS8A 3FU6A 3CVUA 2R17C 4EECA 1DCEA 4LRZA 1TNBA 4LNUD 3JCKC 4HNAD 3QOUA 5E76A 3GYZA 3L54A 3Q9NC 3SF4A 3BQOA 3QWWA 5AAOA 4BX9A 4MRUA 3TWSA 2EIME 4UWFA 5FZQA 3S7DA 5CEDB 2Y4TA 1PAQA 5B3SE 2F8YA 3BG1B 3LVQE 5ENSD 3CVXA 4Q94A 4YDWA 5CBNA 1UN8A 3UPVA 2GRQB 1TNZA 1V54E 1Y8MA 3ASNE 3FY4A 4AIFA 1HX8A 5EX3A 4LUNU 4XI9A 2WXRA 3QARA 3PE3A 2QFCA 4TXRA 1K3ZD 2ZGGA 4AVXA 2R03A 1Z5SC 4AY5A 4BT9A 2XRYA 4GPMA 3ZRHA 1JCQA 2UY1A 4U8VD 3FTVA 4QFVA 5G04C 3OAWA 1K1BA 1EPUA 2QZAA 4N2QA 3LJ3A 1LF8A 5HS0A 2AXVA 4IN3B 1E96B 3RK6A 2CG3A 2PM6A 3E33A 3QWVA 3QKYA 1HG5A 2VGXB 3Q49B 1N95A 4IULA 4OVVA 1ZB1A 4U7EB 2WXHA 4URKA 4ILGA 4EZJA 3AJIA 4BERA 4H7XA 4XIFA 4I17A 4TXQA 3D9MA 4XZ4A 2MOWA 1BD8A 4RSYA 3RRMB 2DIWA 4BWRA 1YMPA 3ZVVA 2KATA 2JEKA 4A1GA 2HO1A 3TG5A 2XS1A 2FBNA 3G2VA 4BSXA 2DZNA 3UM2A 5CEAA 4IRUA 5KNHD 3ASHA 1K1AA 2X6KA 3Q15A 3NOGD 3PVLA 2IY0C 3NF1A 4YDYA 2WVIA 2QYJA 3V2XA 3EIJA 3IXEA 3HHMA 1OWNA 1OWMA 3I4GA 4A1SA 4CYMD 3UUXA 1IHGA 4U63A 1DCQA 1KPSB 5ENPD 3CVYA 4J8EA 2XS8A 2OOEA 5ANLA 2YQ8A 3NBNB 4G25A 4JEUA 5JHBA 1AP7A 3L9TA 3MYVA 2GRPB 4GZCA 3FUMA 4AY6A 2WB2A 2H6HA 2J09A 1GW6A 2XHEA 3CHSA 4RQIA 3EU5A 1TJFA 3UKRG 2BTDA 5EDSA 3HRAA 4XEIG 3TWTA 2GRMA 1N94A 2WXGA 2GRLA 4F1PA 2GRNB 4WNEA 3J5PA 4CCAA 4PS8A 5CMWA 1FVFA 3TXNA 4ATGA 3Q9UC 5EILA 4GMLA 4AEZC 2XEVA 2KCVA 3DSVA 3F6QA 3UMVA 3EUVA 3RJVA 4F7AA 1SW6A 4IYPA 4F53A 2WXQA 4AV7A 1K8KG 4BETA 4GZ5A 3B7RL 3MKQB 3PUJA 4RG9A 4GZDA 1MYOA 2CFUA 1E8XA 5G05C 5ENQD 1NI1A 2FO7A 1BLXB 1QQEA 5KJKA 1FCHA 4FU3A 3SY2A 2M63A 3CR3A 3CGHA 4XE0A 4GYOA 4NACA 4L2LA 2A4ZA 3FU5A 3QB2A 4HVBA 1N4RA 4L23A 3RU0A 3IKOB 2XZTG 3SGHA 2J08A 4GTMA 1X81A 3L08A 1U2VG 1SA5A 4EQFA 3VLFA 4UWLA 3QNKA 4GTTA 4N39A 1FVHA 3D9HA 1D8DA 2P9IG 4KXKB 2AVPA 4FJZA 1S64A 1IHBA 3FUEA 5EKQD 4Q96A 1EDUA 4K5BA 4HXIA 3G2SA 3GW4A 1TR4A 3L6AA 5CECB 5J90A 3ESKA 3LY9A 2VGXA 5JJTA 2WQ7A 2H6GA 3ULQA 3UM1A 5EYPF 1IQUA 2C0MA 1OWPA 4LERA 2UY1B 1QYMA 1DVPA 4JB8P 3DSSA 1KLXA 3AG3E 2VSOE 3V30A 3Q75A 2WXPA 3MV2B 3ASOE 3EJNA 3DBSA 1E7UA 4L2YA 1HXIA 5FIOA 4F6RD 3O4ZA 3IHYA 3KAEA 5A6CA 2L0IA 5FT9A 3ZW3A 5EIDA 2F8XK 1UJJA 2IF4A 2PL2A 4AM9A 2XEHA 4B93B 2XCCA 2VGYA 2VSXE 2WQ6A 1B89A 3FUHA 1N4PA 4EBAA 3MA5A 4DI4A 3HXCA 4C9BB 4U8YD 3MV3B 1NA3A 3UIPC 2LSVA 3MKRA 3CHMA 3C72A 5BV0A 4UWKA 1OWOA 2MYOA 3TXMA 3TWVA 1IXVA 3MZLB 2KBXA 4I43A 3RO3A 1TJCA 3QDNA 5EX0A 3ZYQA 1N0QA 4UQZA 4GTOA 3TWQA 3C3RA 5H7PA 2PQNA 4LNGA 3EU9A 1OCZE 2WQHA 4B8AA 1L5JA 4EPZA 1TEZA 4DLQA 3ZU7B 5DIZA 3SQVA 4HI8A 4FA6A 4O1PA 3DPYA 3S7BA 3D9PA 3LJNA 1FPPA 4TUMA 3EDTB 4Y6CA 5D0QD 5KJLA 1HU3A 2WXIA 2YHEA 1MX2A 4U0ZA 1RZ4A 2B0OE 3UQ3A 2RFMA 3P2BA 2Y4UA 1A17A 4GAAA 3D9JA 3BUAA 2IO3C 4HQDA 3MKQA 1OCOE 3CK9A 3PEUB 3FP3A 3CK8A 2FI7A 3Q73A 3UM0A 2I9CA 4HI9A 4JVSA 4FADA 1OCRE 3ZFWA 3AS8A 3KSQA 2XGSA 3JXIA 3EHMA 1JWFA 3SBSA 3NOCD 1YCSB 1MQSA 2P2CP 5AARA 3ZGQA 3ZPJA 2ILRA 5T3RA 2XZDG 4HRMB 3PUKA 5BW8C 4TXPA 2ZISA 3SHFA 2Q7FA 3FTUA 4DX2A 3T5XA 1JUQA 4JZYA 5ENRD 4JD2G 4M3OA 4C0MA 2I2OA 2Y0BG 2ETBA 3ISMC 5FZSA 1OY3D 4E6HA 1ZU2A 3AS5A 2YHCA 2DYRE 1FT1A 3C98A 1WG0A 1ZBPA 1HH8A 5AJLA 4Y6WA 3TWUA 4UQYA 2VTBA 3DEOA 3QAQA 2ZIRA 4O60A 4BT8A 3FDHA 4JPSA 1E90A 2AXUA 2OVBA 3JYSA 4GCOA 3FUDA 2PQRA 3E30A 4TV3A 1E8ZA 5C2YA 4GZ3A 3OXGA 3ZYKA 2DWZA 3PEVB 3FU3A 4J7WA 5LOZA 5G04J 4YDOA 1N9AA 2JABA 4EZKA 3ML8A 4OYSA 3CLJA 5BXUA 4YDEA 3Q79A 3ABLE 4JL0A 3WG7E 4EHMA 4G11A 1Z3YA 3SI5A 3PZ4A 1KT1A 4CGWA 4G26A 5FTPA 2AWIA 2C2LA 1TN6A 3AG2E 4BSZB 2X6HA 3DXMG 4JW1A 4N2SA 3B7SA 4JA7A 3FEXA 1WM5A 2F0YA 2KZTA 3CQGB 2J4BA 1JWGA 4GYWA 5ENOD 2WM9A 4E85A 4A55A 1SA4A 2XQ0A 3P1UA 3LCAA 3RIBA 3SD5A 4NRHB 3PZ1A 2CG2A 2ZU6B 2WPVA 4GTRA 4AXHA 5AENA 1HS6A 4I6GA 1S0PA 4I1AA 1KZPA 4K5AB 5AQ9A 4FHJA 2R02A 2QYUA 2OEVA 2KCLA 3D9IA 5BT1A 5ENNA 4JC8A 3RAUA 5ARFA 3K9IA 3APFA 4YVQC 3N71A 3S7FA 3LDZA 4Q69A 4HORA 3CK7A 4YNDA 4JEHA 1N4QA 1E7VA 2GW1A 4LG6A 3FU0A 4ILIA 2NXPA 3U3WA 5ITZF 4Z68A 4N5QA 4BTBA 4O6FA 1H6OA 2R5SA 2LSUA 2KCKA 4U04A 4I2ZA 3LY7A 4BEPA 2E0IA 1HO8A 3PDNA 2XPIA 3FFLA 4UWGA 4KZCA 2J4DA 3B7BA 1PY1A 4J8DA 3Q78A 3G2WA 4PS3A 3RRUA 3DPDA 3MEKA 3PZ2A 4DX1A 1EYHA 2WXOA 3TJPA 3UT8A 1N4SA 2PM7A 1NFIE 2L0TB 3U64A 1AWCB 4KZ0A 3TWWA 4HS2A 2EILE 4CT4A 4GZ6A 3UT7A 5C1DA 4HBDA 4P29A 5AIJA 3ML9A 4I6EA 1U3DA 2P9LG 4UI9J 4U8HA 2LO6A 2OVFA 2WXMA 2V8SE 4UI9C 3PS6A 4I9EA 2NC9A 1N11A 4ZHBA 2XENA 5G05J 4MS6A 1UG3A 5HQ8A 4GPKA 2IOSA 2WXJA 3D9NA 4APOA 4ACKA 3FWVA 1OCCE 3E32A 3PZ3A 4O1OA 2CHXA 3NZSA 3LPZA 4U96D 4CDNA 2KC7A 2XPYA 2P9UG 4GMRA 3SFXA 4BESA 2DZOA 3CSTA 4XX5A 4UI9K 4FULA 2IO2C 3C3OA 3CVVA 3TG4A 1O5MA 4DX6D 1G3NB 5D66A 5EYLA 5D2MC 5BXOA 3FULA 2C0LA 4CEMA 4JHJA 3L22A 3ULEG 3FUKA 2V4LA 5CMYA 3UTMA 2DYSE 3PNLB 3OXFA 3PRZA 3ZNGA 4QQIA 4G8KA 4UUCA 4W9RA 1S63A 5CERB 4WUYA 1H6KA 5LP0A 1WDYA 2VTBB 2EINE 3E34A 1JPLA 3BG0B 5E75A 3CVQA 3UX4A 5BNWA 4I9CA 3ASGA 3CSFA 4WNGA 2IEJA 2P58C 3PH0C 5EIBE 4APFA 2WXFA 1Q2ZA 3TGOA 3FH8A 4GMJA 1QBQA 3EHNA 3FTWA 4X8QA 4JHKA 4DPRA 4J8FA 3CQCB 2RG8A 1H6PA 2BF0X 1H2TC 2LNIA 4MBGA 4FP7A 4XKCA 2ZGDA 2YINA 1VDYA 3GZ1A 3ZIMA 3HXDA 5CRUA 4I2WA 1RW2A 5BPPA 4ZFHA 2FEZA 3UT4A 2YNQA 3PREA 3NAWA 5FINA 3TL5A 2J49A 4WNDA 3RSEG 5AQBA 5LCWJ 3D9LA 2GROB 5LCWC 4EZLA 4GCNA 5AQAA 3SNXA 1BU9A 3VLDA 2QY7A 4CDRA 3KD7A 1P5QA 2XGOA 4GA2A 3E4BA 4PDXA 1NZNA 5JJ6A 3G2TA 4RVBA 3APCA 2XCBA 2MHKA 1IKND 2Y1LE 1MHQA 5HI7A 2KZTB 2P9SG 3C5RA 4G24A 3CVNA 4MLPA 4FLBA 3OTNA 3SZ7A 4ME2A 2BKKB 4JHRA 4JA9A 3D9KA 4G23A 5AYWD 4ANWA 4OAUC 4J8YA 4A63B 1E8WA 1N0RA 5KJMA 3ZYLA 1KZOA 1V55E 2I1KA 2OEWA 1DNPA 2XEEA 3ENEA 2PZIA 1H19A 2LAIA 3ULYA 4KBQA 3S2AA 1TNOA 4HOTA 1XGWA 4DJAA 2P9KG 1OXJA 4I1MA 3I3NA 5LX8A 4FHKA 4GYYA 4AJWA 3KEZA 4BY6A 2R59A 2B6CA 3JQ0A 2XPZA 4DI3A 2L6BA 4KVOA 3UXGA 3L82A 4DRXE 1NP7A 3CVWA 4PUCA 5FZRA 4DUIA 2CHZA 5G55A 3GZSA 2KXPC 2RFAA 4RLYA 4A3TA 3U4TA 3LVRE 2F37A 2IQCA 2CFZA 1MX4A 3CVPA 4U95D 1H2UA 4UWHA 3TAXA 1BI8B 4ANXA 3ZHEB 5FJYA 2NYJA 4D10C 3HG0D 1UJKA 1Z6TA 2J8SD 1TNYA 4K0RA 3FHEA 2VQ2A 1QZ2A 1KT0A 4G2VA 2I1JA 2X3MA 4U0SA 4GB9A 2ETAA 3JXJA 5JHAA 3V31A 3X2QE 3RO2A 3HDXA 4F3VA 2BUGA 4C0EA 3L13A 2IFUA 4KT6B 3L17A 4G1TA 1OWLA 3HXEA 4XKBA 2R2LA 1OUVA 3T9KA 2WMNA 4HOQA 1SVXA 2Y69E 1QNFA 3DRAA 1O1RA 2EIKE 2IOLA 4HB5A 3ZXPA 2AXZA 3DSWA 2WXKA 5D0OD 3ZN3A 4BFRA 3HXFA 3LKUA 3FUNA 1OT8A 3DSTA 3I4RB 4J6IA 4UQXA 1H2VC 4B94A 3HVEA 5CBOA 2KM4A 1YYHA 4CDMA 3ZUVB 3DSXA 2X6IA 2LXMA 1HF8A 3MJWA 2HR2A 5ENTD 3TWRA 5HRYA 4HLEA 3SO8A 3HYMB 3B7UX 2H6FA 4ILHB 1LTXA 4NIKA 3ZEFA 3QWPA 1LD7A 1SZ9A 4JXTA 4KYOB 4CZ2D 2P9PG 3D3MA 2IU1A 2VSNA 3UKUG 3AU5A 2BKGA 2VYIA 4HOSA 2AW6A 4TUUA 2OCCE 3ABME 3U66A 1TYQG 5FQ7A 2LXLA 3IBEA 5CHEE 3SFZA 3T5VA 3DXKG 4KMOA 3Q7AA 5T8IA 3HIZA 5CRVA 4GTPA 3FUFA 3ZYMA 3R9MA 2VSYA 5FQ8A 3CKBA 2IJGX 3LXUX 1MJ0A 1IQRA 4WWPA 1D8EA 2WXNA 4CT0A 1XNFA 3MCXA 2X6FA 3IHVA 3Q7FA 3T8MA 3KSLA 5G2NA 2FF4A 2X38A 3CIAA 4I6JA 5IY5E 1O1SA 3D9OA 3CEQA 3FUJA 2P9NG 4B8CB 3QK0A 1Y6IA 1NL4A 1IYGA 5BV1A 3W9GA 2J07A 2ZXWE 3EIQC 1A5EA 5EN5D 4L7TA 4MKTA 3CHOA 3PZDA 3GZ2A 2VGEA 5DBKA 4BTAA 2EIJE 2CHWA 3JUEA 3BEEA 4ANVA 3PNTB 3R9AB 5AN8A 3HXBA 2HE0A 5FWQA 3MX3A 1MX6A 2FO1E 2LAHA 3Q47B 3FTSA 3ZHEA 5KCMA 4PH4B 1S70B 3Q5MA 3LYAA 2JLBA 2OV8A 1WY6A 3S7JA 2A5EA 3WXXA 3C3QA 5KWDA 3V79K 4F1SA 2ONDA 3CV0A 4WAFA 1E8YA 4L9PA 3EHQA 3TWXA 5CCMA 1EF1C 3LEWA 4YVOA 2V4HC 4I1OB 4J0UA 3NB2A 3DSUA 5B1BE 3UM3A 3W9FA 1U3CA 5T4YA 3ASFA 3G2UA 3BU8A 3DEPA 4M7CA 1JCSA 3ASDA 2V5FA 1H0AA 2L6JA 1X5BA 2V5QC 4A3VA 4N3CA 4AOFA 2ETCA 1HE8A 1D9SA 2HM8A 3T8KA 4GU5A 3DWLG 4GTQA 4U07A 1HFAA 4RG6A 4DX7D 4OAVB 3QJZA 2WXLA 1O1TA 3ZKJA 3NZUA 1FT2A 2V0PA 4CGVA 1N54A 4KVMA 1ELRA 4G8LA 2NSZA 2VJ8A 2X6JA 4U0UA 4LNBA 2GGFA 3KEAA 4C48B 4N3BA 3FH7A 4TRQA 1SQMA 5KNGA 3AG4E 3CKCA 3RRNB 3KS2A 4GA0A 2RD0A 2GRRB 3HVEB 3UINC 4GA1A 4HFGA 4HOUA 4N3AA 3MGBA 4NURA 1LD8A 3ONLA 1BPOA 2WMOA 4J8SA 2H6IA 3URZA 2R05A 3V2OA 3R7QA 4WWNA 4H7YA 1BI7B 5J08A 3R7RA 5KBAA 3VTYA 4XI0A 1W3BA 1ELWA 1ELKA 4DK5A 4HRLA 1NA0A 3CHQA 3J5QB 3O48A 4WNFA 5FQ6A 4AP2A 4LEUA 4ABNA 5AJDA 1JCRA 4B0ZA 4CRWA 1YA0A 4HLLA 2LUHA 2Y3AA 4LCTA 3B95A 2DVWA 2J9QA 2DBAA 3I5PA 2A5UA 2FULA 1INZA 4R7LA 3ESLA 5JJ7A 3FTXA 3SFYA 1TN8A 3FUIA 3NQPA 3VLEA 5JA4D 3OXLA 2DCPA 2MRIA
chains in the Genus database with same CATH topology
1N52A 4N5CA 2M63A 3FH5A 5ANRA 4L1BA 4FHJA 1OUVA 2KCLA 2WMNA 3D9IA 4HOQA 3CVLA 3CR3A 1QNFA 2IOLA 5BT1A 5KJNA 5ENNA 3CGHA 4JC8A 3CHRA 4PS7A 4XE0A 2AXZA 5ARFA 4GYOA 1UN9A 3K9IA 5A23A 3ZXSA 2E2EA 3AU4A 3APFA 2A4ZA 4L2LA 3N71A 3FU5A 4NACA 2WXKA 3LDZA 3QB2A 2HYZA 3S7FA 4Q69A 3B13A 5D0OD 4HVBA 2UWJG 3CK7A 4L23A 4HORA 4YNDA 3RU0A 2IONA 3IKOB 4JEHA 3SGHA 2I6HA 2J08A 1E7VA 2EQXA 3RKVA 3ZN3A 2GW1A 4BFRA 3L08A 3FU0A 4ILIA 2NXPA 3U3WA 4EQFA 3LKUA 3FUNA 3PE4A 3VLFA 4UWLA 3APDA 3QNKA 5CCLA 4FJYA 4NQ0A 4BTBA 4O6FA 2R5SA 4N39A 1FVHA 3I4RB 1SZAA 2LSUA 2KCKA 4J6IA 4U04A 4I2ZA 4UQXA 1H2VC 3LY7A 4B94A 2E0IA 3VTXA 1HO8A 3HVEA 3PDNA 2XPIA 3FFLA 4KXKB 2KM4A 1WAO1 4UWGA 2AVPA 3IV0A 4KZCA 4K03A 4CDMA 2X6IA 4FJZA 3IEGA 4DLOA 2J4DA 1PY1A 1HF8A 4J8DA 3MJWA 4FC8A 3FUEA 3G2WA 2HR2A 4PS3A 4OVUA 5EKQD 3RRUA 3U9WA 3DPDA 4Q96A 1EDUA 3MEKA 4HXIA 4HLEA 3L16A 3G2SA 3HYMB 3B7UX 3GW4A 4ILHB 1EYHA 3CHPA 3L6AA 5J90A 2WXOA 3TJPA 3ESKA 3ONKA 3UT8A 3ZEFA 3LY9A 3QWPA 2VGXA 5JJTA 2WQ7A 1SZ9A 3ULQA 2XRZA 4JXTA 4KYOB 3LY8A 5FQ4A 2PM7A 1UW4B 3D3MA 2L0TB 3FEYA 3U64A 1IQUA 2IU1A 2VSNA 4V3IA 5M72A 3JUIA 4KZ0A 4ANUA 3Q4AB 4HS2A 3SBTB 4CT4A 2C0MA 1OWPA 3AU5A 4GZ6A 4LERA 2UY1B 2XGMA 2VYIA 3QC1A 3UT7A 4HOSA 1DVPA 4FLHA 5C1DA 3AS4A 2AW6A 5ARGA 1KLXA 4P29A 4WWOA 2VSOE 5AIJA 3ML9A 4TUUA 3U66A 4I6EA 1U3DA 5FQ7A 2WXPA 3B7TA 3IBEA 5CHEE 3SFZA 3T5VA 4UI9J 3FTZA 3MV2B 4U8HA 2LO6A 3EJNA 4B89A 2OVFA 3DBSA 1E7UA 1HZ4A 2WXMA 3FTYA 4L2YA 4KMOA 5T8IA 2V8SE 1HXIA 3HIZA 4UI9C 4EBAG 3PS6A 5LFAA 5A7DB 3JQ1A 3O4ZA 4I9EA 2NC9A 4ACLA 3IHYA 3KAEA 5A6CA 2L9BA 2L0IA 3FUFA 5FT9A 3ZYMA 3ZW3A 1Z3XA 5G05J 1HG2A 4MS6A 5BUZA 4BX8A 2VSYA 1UG3A 5FQ8A 1UJJA 2IF4A 5HQ8A 4GPKA 1PC2A 2PL2A 3LS8A 2IOSA 2WXJA 3D9NA 4APOA 3FU6A 4ACKA 3CVUA 3FWVA 2R17C 3CKBA 4EECA 4AM9A 2IJGX 3LXUX 2XCCA 2VGYA 2VSXE 2CHXA 4LRZA 3JCKC 1IQRA 2WQ6A 1B89A 3FUHA 3NZSA 3LPZA 4EBAA 3MA5A 4WWPA 4CDNA 3QOUA 2KC7A 2XPYA 5E76A 3GYZA 4DI4A 4C9BB 3L54A 3SF4A 2WXNA 3MV3B 4CT0A 1NA3A 3CSTA 3QWWA 1XNFA 3MCXA 2LSVA 2X6FA 4XX5A 3IHVA 4BX9A 4UI9K 4FULA 3T8MA 3MKRA 3CVVA 3TG4A 5G2NA 3CHMA 4MRUA 2FF4A 5BV0A 4UWFA 2X38A 3FULA 3CIAA 2C0LA 4UWKA 5FZQA 1OWOA 4I6JA 4CEMA 4JHJA 3TXMA 3S7DA 3L22A 3MZLB 3FUKA 2V4LA 2Y4TA 1PAQA 4I43A 5CMYA 1TJCA 3D9OA 3RO3A 3CEQA 3FUJA 3QDNA 5EX0A 3BG1B 3OXFA 3PNLB 3PRZA 3LVQE 4B8CB 3ZYQA 3QK0A 1FCHA 4FU3A 4UQZA 4W9RA 3CVXA 1Y6IA 4Q94A 4WUYA 1IYGA 5BV1A 1H6KA 5LP0A 2J07A 1UN8A 3UPVA 2VTBB 3EIQC 1Y8MA 1JPLA 3BG0B 5E75A 3CVQA 3UX4A 4L7TA 2PQNA 3CHOA 4MKTA 3FY4A 3PZDA 4AIFA 4I9CA 5BNWA 3GZ2A 1HX8A 3ASGA 2WQHA 4B8AA 5DBKA 3CSFA 4LUNU 5EX3A 4WNGA 2P58C 4XI9A 2WXRA 3QARA 3PE3A 3PH0C 2QFCA 4BTAA 4APFA 1L5JA 4EPZA 2WXFA 2CHWA 1TEZA 3TGOA 4DLQA 3FH8A 4AVXA 4GMJA 5DIZA 3BEEA 4ANVA 4AY5A 3EHNA 4FA6A 3PNTB 3R9AB 4BT9A 2XRYA 3FTWA 4JHKA 4DPRA 4J8FA 5FWQA 3MX3A 3S7BA 3CQCB 3D9PA 2RG8A 3ZRHA 2BF0X 2UY1A 2LAHA 1H2TC 3EDTB 3FTSA 3Q47B 3FTVA 4QFVA 4Y6CA 5G04C 5D0QD 3ZHEA 2LNIA 5KCMA 4PH4B 4FP7A 3Q5MA 3LYAA 5KJLA 2JLBA 3OAWA 2OV8A 1EPUA 1WY6A 3S7JA 1HU3A 2WXIA 4XKCA 2YHEA 4N2QA 3LJ3A 1LF8A 1VDYA 2YINA 3GZ1A 4U0ZA 3WXXA 3ZIMA 2AXVA 4I2WA 3UQ3A 5BPPA 3P2BA 2Y4UA 2FEZA 4IN3B 1E96B 3RK6A 3UT4A 2YNQA 3PREA 1A17A 4GAAA 3D9JA 4F1SA 2CG3A 2ONDA 3MKQA 2PM6A 3CV0A 2J49A 3TL5A 4WAFA 1E8YA 3QWVA 3QKYA 3CK9A 4WNDA 1HG5A 2VGXB 3Q49B 3PEUB 4IULA 4OVVA 5CCMA 5LCWJ 1EF1C 3LEWA 4YVOA 2WXHA 3D9LA 3FP3A 4URKA 4ILGA 4EZJA 3CK8A 2FI7A 4H7XA 4XIFA 5LCWC 4I17A 4I1OB 2I9CA 4JVSA 4FADA 3D9MA 4J0UA 3ZFWA 4XZ4A 2MOWA 3AS8A 4RSYA 4EZLA 2XGSA 4GCNA 1U3CA 5T4YA 3SNXA 3EHMA 3ASFA 3G2UA 1JWFA 3RRMB 2DIWA 3VLDA 2QY7A 4BWRA 3SBSA 3ZVVA 2KATA 3KD7A 4CDRA 1P5QA 2XGOA 2JEKA 4GA2A 3E4BA 4A1GA 4PDXA 1MQSA 2HO1A 3TG5A 1NZNA 2V5FA 1H0AA 2L6JA 3ASDA 3G2TA 4RVBA 5JJ6A 3ZGQA 3ZPJA 2FBNA 1X5BA 3APCA 3G2VA 4YVQC 4BSXA 2ILRA 2XCBA 5T3RA 3PUKA 2MHKA 1MHQA 5HI7A 4A3VA 2KZTB 4N3CA 5BW8C 4AOFA 4IRUA 4G24A 3ASHA 3CVNA 1HE8A 4MLPA 2Q7FA 3FTUA 4FLBA 3OTNA 3SZ7A 4ME2A 3SHFA 3T5XA 1JUQA 4JZYA 2X6KA 4JHRA 2HM8A 4M3OA 4C0MA 4GU5A 4JA9A 2I2OA 3D9KA 4G23A 5AYWD 4ANWA 3Q15A 5FZSA 1E8WA 4U07A 4E6HA 1ZU2A 3AS5A 2YHCA 5KJMA 3PVLA 1HFAA 3NF1A 3ZYLA 3C98A 4RG6A 1ZBPA 2WVIA 1HH8A 5AJLA 4Y6WA 2I1KA 3QJZA 4UQYA 2VTBA 1DNPA 3EIJA 3HHMA 3QAQA 3ENEA 1OWNA 2PZIA 1H19A 2WXLA 1OWMA 2LAIA 3I4GA 3NZUA 4A1SA 4BT8A 3UUXA 1IHGA 4KBQA 4U63A 3FDHA 3S2AA 2V0PA 1E90A 4JPSA 2AXUA 2OVBA 4CGVA 3CVYA 4J8EA 1N54A 3JYSA 4HOTA 2OOEA 4KVMA 4GCOA 3FUDA 1ELRA 2PQRA 2NSZA 2VJ8A 1XGWA 2X6JA 4TV3A 4DJAA 4U0UA 5ANLA 2YQ8A 2GGFA 1E8ZA 5C2YA 4G25A 4GZ3A 4I1MA 4N3BA 3FH7A 3OXGA 4TRQA 1SQMA 3I3NA 3ZYKA 3CKCA 4JEUA 3PEVB 3RRNB 3FU3A 4FHKA 4GYYA 5JHBA 5LX8A 3KS2A 3MYVA 4GA0A 4GZCA 5LOZA 2RD0A 3FUMA 5G04J 4AJWA 4AY6A 2WB2A 3KEZA 4BY6A 3HVEB 4GA1A 4HFGA 4HOUA 2J09A 2R59A 1GW6A 2XHEA 3CHSA 3JQ0A 4N3AA 2XPZA 4EZKA 3MGBA 3ML8A 4NURA 4DI3A 3ONLA 4KVOA 1BPOA 1TJFA 2WMOA 4J8SA 3URZA 2BTDA 4OYSA 1NP7A 3CVWA 5EDSA 3R7QA 4PUCA 4WWNA 4H7YA 5FZRA 2CHZA 3CLJA 5G55A 5J08A 3GZSA 2GRMA 4A3TA 3U4TA 2WXGA 4JL0A 2GRLA 3LVRE 3R7RA 2IQCA 2CFZA 3VTYA 3CVPA 4WNEA 4XI0A 4CCAA 4PS8A 5CMWA 1FVFA 1W3BA 3TXNA 4G11A 1Z3YA 1H2UA 1ELWA 1ELKA 4UWHA 3SI5A 3TAXA 4ATGA 4DK5A 1KT1A 1INZA 4GMLA 4AEZC 2XEVA 1NA0A 4CGWA 4G26A 3CHQA 5FTPA 2AWIA 2C2LA 4ANXA 3O48A 4WNFA 5FQ6A 2KCVA 3ZHEB 5FJYA 4AP2A 4LEUA 4ABNA 2X6HA 4D10C 3UMVA 5AJDA 3RJVA 4F7AA 4JW1A 4B0ZA 4CRWA 1YA0A 4N2SA 3B7SA 4IYPA 4JA7A 4F53A 3FEXA 1WM5A 1UJKA 2WXQA 2Y3AA 4AV7A 2KZTA 3CQGB 1Z6TA 4LCTA 4K0RA 2J4BA 3FHEA 2J9QA 1JWGA 4GZ5A 4GYWA 2VQ2A 1QZ2A 2DBAA 2WM9A 3I5PA 4E85A 1KT0A 3B7RL 4A55A 2A5UA 2FULA 3MKQB 3PUJA 2XQ0A 2I1JA 2X3MA 3LCAA 3P1UA 4G2VA 4RG9A 4R7LA 3ESLA 4GZDA 4U0SA 3RIBA 5JJ7A 3SD5A 3FTXA 4NRHB 4GB9A 2CFUA 5JHAA 1E8XA 5G05C 3RO2A 3HDXA 4F3VA 2BUGA 2FO7A 2CG2A 4C0EA 2ZU6B 2WPVA 4AXHA 3L13A 3FUIA 2IFUA 4KT6B 3L17A 1HS6A 5AENA 4G1TA 1OWLA 4I6GA 1S0PA 4XKBA 1QQEA 5KJKA 3NQPA 3VLEA 3OXLA 4I1AA 2DCPA 2MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N5C A;  1OUV A;  2KCL A;  4HOQ A;  3CVL A;  5BT1 A;  5KJN A;  5ARF A;  4GYO A;  3K9I A;  2E2E A;  4YVQ C;  3N71 A;  3S7F A;  2HYZ A;  4HOR A;  5D0O D;  2UWJ G;  3CK7 A;  4YND A;  3RU0 A;  2I6H A;  3RKV A;  3ZN3 A;  2GW1 A;  3U3W A;  4EQF A;  3LKU A;  3PE4 A;  5CCL A;  4NQ0 A;  4BTB A;  4O6F A;  2R5S A;  4N39 A;  2LSU A;  2KCK A;  4U04 A;  4I2Z A;  4UQX A;  3LY7 A;  4B94 A;  3VTX A;  3PDN A;  2XPI A;  3FFL A;  4KXK B;  1WAO 1;  2AVP A;  3IEG A;  4J8D A;  2HR2 A;  5EKQ D;  3MEK A;  3HYM B;  3GW4 A;  3ESK A;  3LY9 A;  3QWP A;  2VGX A;  5JJT A;  3ULQ A;  4KYO B;  3LY8 A;  2VSN A;  5M72 A;  3Q4A B;  2C0M A;  4GZ6 A;  2UY1 B;  2XGM A;  2VYI A;  4HOS A;  5C1D A;  3AS4 A;  5ARG A;  1KLX A;  5CHE E;  4UI9 J;  3MV2 B;  1HZ4 A;  1HXI A;  4UI9 C;  5A7D B;  4I9E A;  2NC9 A;  3KAE A;  5A6C A;  5FT9 A;  5G05 J;  2VSY A;  5HQ8 A;  2IF4 A;  4GPK A;  1PC2 A;  2PL2 A;  4APO A;  3FWV A;  3CKB A;  4AM9 A;  2XCC A;  2VGY A;  1B89 A;  3LPZ A;  3MA5 A;  3QOU A;  2KC7 A;  3GYZ A;  3SF4 A;  3MV3 B;  1NA3 A;  3QWW A;  1XNF A;  2LSV A;  4UI9 K;  3MKR A;  3TG4 A;  2FF4 A;  2C0L A;  5FZQ A;  3S7D A;  2Y4T A;  3RO3 A;  1TJC A;  3CEQ A;  3QDN A;  5EX0 A;  3OXF A;  4UQZ A;  4W9R A;  4WUY A;  1IYG A;  3UPV A;  1Y8M A;  3CVQ A;  2PQN A;  4AIF A;  5BNW A;  4I9C A;  3GZ2 A;  3ASG A;  2WQH A;  5DBK A;  5EX3 A;  4WNG A;  2P58 C;  4XI9 A;  3PE3 A;  2QFC A;  4BTA A;  3TGO A;  5DIZ A;  3BEE A;  4AY5 A;  3R9A B;  4BT9 A;  4J8F A;  3S7B A;  2UY1 A;  3EDT B;  3Q47 B;  5G04 C;  4Y6C A;  5D0Q D;  3ZHE A;  2LNI A;  3Q5M A;  3LYA A;  5KJL A;  2JLB A;  3S7J A;  4N2Q A;  4U0Z A;  3WXX A;  3GZ1 A;  4I2W A;  3UQ3 A;  2Y4U A;  2FEZ A;  4IN3 B;  1E96 B;  1A17 A;  2OND A;  3CV0 A;  3QWV A;  3QKY A;  3CK9 A;  4WND A;  2VGX B;  3Q49 B;  5CCM A;  5LCW J;  4YVO A;  3FP3 A;  3CK8 A;  2FI7 A;  4H7X A;  4XIF A;  5LCW C;  4I17 A;  4J0U A;  3ZFW A;  3AS8 A;  2XGS A;  4GCN A;  3ASF A;  4BWR A;  4CDR A;  2KAT A;  3KD7 A;  1P5Q A;  2XGO A;  4GA2 A;  3E4B A;  2HO1 A;  3TG5 A;  1NZN A;  2V5F A;  2L6J A;  3ASD A;  5JJ6 A;  3ZPJ A;  3ZGQ A;  2FBN A;  2XCB A;  2MHK A;  5HI7 A;  4N3C A;  5BW8 C;  4G24 A;  3ASH A;  3CVN A;  2Q7F A;  3SZ7 A;  4ME2 A;  4JHR A;  4JA9 A;  4G23 A;  5AYW D;  3Q15 A;  5FZS A;  4U07 A;  1ZU2 A;  3AS5 A;  2YHC A;  5KJM A;  3NF1 A;  4RG6 A;  1ZBP A;  1HH8 A;  4Y6W A;  4UQY A;  2PZI A;  4A1S A;  4BT8 A;  3UUX A;  1IHG A;  4KBQ A;  4CGV A;  4J8E A;  3JYS A;  4HOT A;  2OOE A;  4GCO A;  1ELR A;  2PQR A;  4U0U A;  2YQ8 A;  4G25 A;  4GZ3 A;  4N3B A;  3OXG A;  3CKC A;  4GYY A;  3KS2 A;  4GA0 A;  5G04 J;  4AY6 A;  4GA1 A;  4HOU A;  4N3A A;  3URZ A;  4H7Y A;  5FZR A;  3U4T A;  4JL0 A;  3VTY A;  3CVP A;  4WNE A;  4XI0 A;  1W3B A;  1ELW A;  3TAX A;  1KT1 A;  4CGW A;  2XEV A;  1NA0 A;  4G26 A;  5FTP A;  2C2L A;  3O48 A;  4WNF A;  2KCV A;  3ZHE B;  5FJY A;  4LEU A;  4ABN A;  3RJV A;  1YA0 A;  4N2S A;  4JA7 A;  1WM5 A;  2J9Q A;  4GZ5 A;  4GYW A;  2VQ2 A;  1QZ2 A;  2DBA A;  1KT0 A;  4G2V A;  3LCA A;  4RG9 A;  3RIB A;  4U0S A;  5JJ7 A;  4NRH B;  5G05 C;  3RO2 A;  4F3V A;  2BUG A;  2FO7 A;  2WPV A;  2IFU A;  4G1T A;  1QQE A;  5KJK A;  3OXL A;  4I1A A;  1FCH A; 
#chains in the Genus database with same CATH topology
 4GTV A;  1N52 A;  4N5C A;  3FH5 A;  5ANR A;  4L1B A;  4ATZ D;  1TN7 A;  3CVL A;  2AJA A;  5KJN A;  2QC9 A;  3CHR A;  4PS7 A;  5A23 A;  1UN9 A;  3ZXS A;  2E2E A;  3AU4 A;  4GTS A;  2HYZ A;  3B13 A;  2UWJ G;  2ION A;  2I6H A;  4LSZ E;  2EQX A;  3RKV A;  3UI2 A;  1DC2 A;  3PE4 A;  3APD A;  5CCL A;  4FJY A;  4NQ0 A;  3UIO C;  1SZA A;  3VTX A;  3E37 A;  1WAO 1;  3IV0 A;  4K03 A;  3ABK E;  3IEG A;  4DLO A;  3AAA C;  4FC8 A;  4OVU A;  3U9W A;  3L16 A;  3CHP A;  3ONK A;  5AQ7 A;  2XRZ A;  3EHR A;  5FQ4 A;  3LY8 A;  1UW4 B;  3FEY A;  5M72 A;  4V3I A;  3JUI A;  4ANU A;  3Q4A B;  3SBT B;  4K5C A;  3AG1 E;  2XGM A;  3QC1 A;  4FLH A;  1MZC A;  3AS4 A;  5ARG A;  4WWO A;  2PNN A;  5JMN D;  4DX5 D;  3B7T A;  1TNU A;  3FTZ A;  4B89 A;  2BED A;  5HKP A;  3FTY A;  1HZ4 A;  5LFA A;  4EBA G;  5B1A E;  5A7D B;  3JQ1 A;  2RKK A;  4ACL A;  2L9B A;  1Z3X A;  1HG2 A;  5BUZ A;  4HRN A;  4BX8 A;  1UOH A;  1PC2 A;  3LS8 A;  3FU6 A;  3CVU A;  2R17 C;  4EEC A;  1DCE A;  4LRZ A;  1TNB A;  4LNU D;  3JCK C;  4HNA D;  3QOU A;  5E76 A;  3GYZ A;  3L54 A;  3Q9N C;  3SF4 A;  3BQO A;  3QWW A;  5AAO A;  4BX9 A;  4MRU A;  3TWS A;  2EIM E;  4UWF A;  5FZQ A;  3S7D A;  5CED B;  2Y4T A;  1PAQ A;  5B3S E;  2F8Y A;  3BG1 B;  3LVQ E;  5ENS D;  3CVX A;  4Q94 A;  4YDW A;  5CBN A;  1UN8 A;  3UPV A;  2GRQ B;  1TNZ A;  1V54 E;  1Y8M A;  3ASN E;  3FY4 A;  4AIF A;  1HX8 A;  5EX3 A;  4LUN U;  4XI9 A;  2WXR A;  3QAR A;  3PE3 A;  2QFC A;  4TXR A;  1K3Z D;  2ZGG A;  4AVX A;  2R03 A;  1Z5S C;  4AY5 A;  4BT9 A;  2XRY A;  4GPM A;  3ZRH A;  1JCQ A;  2UY1 A;  4U8V D;  3FTV A;  4QFV A;  5G04 C;  3OAW A;  1K1B A;  1EPU A;  2QZA A;  4N2Q A;  3LJ3 A;  1LF8 A;  5HS0 A;  2AXV A;  4IN3 B;  1E96 B;  3RK6 A;  2CG3 A;  2PM6 A;  3E33 A;  3QWV A;  3QKY A;  1HG5 A;  2VGX B;  3Q49 B;  1N95 A;  4IUL A;  4OVV A;  1ZB1 A;  4U7E B;  2WXH A;  4URK A;  4ILG A;  4EZJ A;  3AJI A;  4BER A;  4H7X A;  4XIF A;  4I17 A;  4TXQ A;  3D9M A;  4XZ4 A;  2MOW A;  1BD8 A;  4RSY A;  3RRM B;  2DIW A;  4BWR A;  1YMP A;  3ZVV A;  2KAT A;  2JEK A;  4A1G A;  2HO1 A;  3TG5 A;  2XS1 A;  2FBN A;  3G2V A;  4BSX A;  2DZN A;  3UM2 A;  5CEA A;  4IRU A;  5KNH D;  3ASH A;  1K1A A;  2X6K A;  3Q15 A;  3NOG D;  3PVL A;  2IY0 C;  3NF1 A;  4YDY A;  2WVI A;  2QYJ A;  3V2X A;  3EIJ A;  3IXE A;  3HHM A;  1OWN A;  1OWM A;  3I4G A;  4A1S A;  4CYM D;  3UUX A;  1IHG A;  4U63 A;  1DCQ A;  1KPS B;  5ENP D;  3CVY A;  4J8E A;  2XS8 A;  2OOE A;  5ANL A;  2YQ8 A;  3NBN B;  4G25 A;  4JEU A;  5JHB A;  1AP7 A;  3L9T A;  3MYV A;  2GRP B;  4GZC A;  3FUM A;  4AY6 A;  2WB2 A;  2H6H A;  2J09 A;  1GW6 A;  2XHE A;  3CHS A;  4RQI A;  3EU5 A;  1TJF A;  3UKR G;  2BTD A;  5EDS A;  3HRA A;  4XEI G;  3TWT A;  2GRM A;  1N94 A;  2WXG A;  2GRL A;  4F1P A;  2GRN B;  4WNE A;  3J5P A;  4CCA A;  4PS8 A;  5CMW A;  1FVF A;  3TXN A;  4ATG A;  3Q9U C;  5EIL A;  4GML A;  4AEZ C;  2XEV A;  2KCV A;  3DSV A;  3F6Q A;  3UMV A;  3EUV A;  3RJV A;  4F7A A;  1SW6 A;  4IYP A;  4F53 A;  2WXQ A;  4AV7 A;  1K8K G;  4BET A;  4GZ5 A;  3B7R L;  3MKQ B;  3PUJ A;  4RG9 A;  4GZD A;  1MYO A;  2CFU A;  1E8X A;  5G05 C;  5ENQ D;  1NI1 A;  2FO7 A;  1BLX B;  1QQE A;  5KJK A;  1FCH A;  4FU3 A;  3SY2 A;  2M63 A;  3CR3 A;  3CGH A;  4XE0 A;  4GYO A;  4NAC A;  4L2L A;  2A4Z A;  3FU5 A;  3QB2 A;  4HVB A;  1N4R A;  4L23 A;  3RU0 A;  3IKO B;  2XZT G;  3SGH A;  2J08 A;  4GTM A;  1X81 A;  3L08 A;  1U2V G;  1SA5 A;  4EQF A;  3VLF A;  4UWL A;  3QNK A;  4GTT A;  4N39 A;  1FVH A;  3D9H A;  1D8D A;  2P9I G;  4KXK B;  2AVP A;  4FJZ A;  1S64 A;  1IHB A;  3FUE A;  5EKQ D;  4Q96 A;  1EDU A;  4K5B A;  4HXI A;  3G2S A;  3GW4 A;  1TR4 A;  3L6A A;  5CEC B;  5J90 A;  3ESK A;  3LY9 A;  2VGX A;  5JJT A;  2WQ7 A;  2H6G A;  3ULQ A;  3UM1 A;  5EYP F;  1IQU A;  2C0M A;  1OWP A;  4LER A;  2UY1 B;  1QYM A;  1DVP A;  4JB8 P;  3DSS A;  1KLX A;  3AG3 E;  2VSO E;  3V30 A;  3Q75 A;  2WXP A;  3MV2 B;  3ASO E;  3EJN A;  3DBS A;  1E7U A;  4L2Y A;  1HXI A;  5FIO A;  4F6R D;  3O4Z A;  3IHY A;  3KAE A;  5A6C A;  2L0I A;  5FT9 A;  3ZW3 A;  5EID A;  2F8X K;  1UJJ A;  2IF4 A;  2PL2 A;  4AM9 A;  2XEH A;  4B93 B;  2XCC A;  2VGY A;  2VSX E;  2WQ6 A;  1B89 A;  3FUH A;  1N4P A;  4EBA A;  3MA5 A;  4DI4 A;  3HXC A;  4C9B B;  4U8Y D;  3MV3 B;  1NA3 A;  3UIP C;  2LSV A;  3MKR A;  3CHM A;  3C72 A;  5BV0 A;  4UWK A;  1OWO A;  2MYO A;  3TXM A;  3TWV A;  1IXV A;  3MZL B;  2KBX A;  4I43 A;  3RO3 A;  1TJC A;  3QDN A;  5EX0 A;  3ZYQ A;  1N0Q A;  4UQZ A;  4GTO A;  3TWQ A;  3C3R A;  5H7P A;  2PQN A;  4LNG A;  3EU9 A;  1OCZ E;  2WQH A;  4B8A A;  1L5J A;  4EPZ A;  1TEZ A;  4DLQ A;  3ZU7 B;  5DIZ A;  3SQV A;  4HI8 A;  4FA6 A;  4O1P A;  3DPY A;  3S7B A;  3D9P A;  3LJN A;  1FPP A;  4TUM A;  3EDT B;  4Y6C A;  5D0Q D;  5KJL A;  1HU3 A;  2WXI A;  2YHE A;  1MX2 A;  4U0Z A;  1RZ4 A;  2B0O E;  3UQ3 A;  2RFM A;  3P2B A;  2Y4U A;  1A17 A;  4GAA A;  3D9J A;  3BUA A;  2IO3 C;  4HQD A;  3MKQ A;  1OCO E;  3CK9 A;  3PEU B;  3FP3 A;  3CK8 A;  2FI7 A;  3Q73 A;  3UM0 A;  2I9C A;  4HI9 A;  4JVS A;  4FAD A;  1OCR E;  3ZFW A;  3AS8 A;  3KSQ A;  2XGS A;  3JXI A;  3EHM A;  1JWF A;  3SBS A;  3NOC D;  1YCS B;  1MQS A;  2P2C P;  5AAR A;  3ZGQ A;  3ZPJ A;  2ILR A;  5T3R A;  2XZD G;  4HRM B;  3PUK A;  5BW8 C;  4TXP A;  2ZIS A;  3SHF A;  2Q7F A;  3FTU A;  4DX2 A;  3T5X A;  1JUQ A;  4JZY A;  5ENR D;  4JD2 G;  4M3O A;  4C0M A;  2I2O A;  2Y0B G;  2ETB A;  3ISM C;  5FZS A;  1OY3 D;  4E6H A;  1ZU2 A;  3AS5 A;  2YHC A;  2DYR E;  1FT1 A;  3C98 A;  1WG0 A;  1ZBP A;  1HH8 A;  5AJL A;  4Y6W A;  3TWU A;  4UQY A;  2VTB A;  3DEO A;  3QAQ A;  2ZIR A;  4O60 A;  4BT8 A;  3FDH A;  4JPS A;  1E90 A;  2AXU A;  2OVB A;  3JYS A;  4GCO A;  3FUD A;  2PQR A;  3E30 A;  4TV3 A;  1E8Z A;  5C2Y A;  4GZ3 A;  3OXG A;  3ZYK A;  2DWZ A;  3PEV B;  3FU3 A;  4J7W A;  5LOZ A;  5G04 J;  4YDO A;  1N9A A;  2JAB A;  4EZK A;  3ML8 A;  4OYS A;  3CLJ A;  5BXU A;  4YDE A;  3Q79 A;  3ABL E;  4JL0 A;  3WG7 E;  4EHM A;  4G11 A;  1Z3Y A;  3SI5 A;  3PZ4 A;  1KT1 A;  4CGW A;  4G26 A;  5FTP A;  2AWI A;  2C2L A;  1TN6 A;  3AG2 E;  4BSZ B;  2X6H A;  3DXM G;  4JW1 A;  4N2S A;  3B7S A;  4JA7 A;  3FEX A;  1WM5 A;  2F0Y A;  2KZT A;  3CQG B;  2J4B A;  1JWG A;  4GYW A;  5ENO D;  2WM9 A;  4E85 A;  4A55 A;  1SA4 A;  2XQ0 A;  3P1U A;  3LCA A;  3RIB A;  3SD5 A;  4NRH B;  3PZ1 A;  2CG2 A;  2ZU6 B;  2WPV A;  4GTR A;  4AXH A;  5AEN A;  1HS6 A;  4I6G A;  1S0P A;  4I1A A;  1KZP A;  4K5A B;  5AQ9 A;  4FHJ A;  2R02 A;  2QYU A;  2OEV A;  2KCL A;  3D9I A;  5BT1 A;  5ENN A;  4JC8 A;  3RAU A;  5ARF A;  3K9I A;  3APF A;  4YVQ C;  3N71 A;  3S7F A;  3LDZ A;  4Q69 A;  4HOR A;  3CK7 A;  4YND A;  4JEH A;  1N4Q A;  1E7V A;  2GW1 A;  4LG6 A;  3FU0 A;  4ILI A;  2NXP A;  3U3W A;  5ITZ F;  4Z68 A;  4N5Q A;  4BTB A;  4O6F A;  1H6O A;  2R5S A;  2LSU A;  2KCK A;  4U04 A;  4I2Z A;  3LY7 A;  4BEP A;  2E0I A;  1HO8 A;  3PDN A;  2XPI A;  3FFL A;  4UWG A;  4KZC A;  2J4D A;  3B7B A;  1PY1 A;  4J8D A;  3Q78 A;  3G2W A;  4PS3 A;  3RRU A;  3DPD A;  3MEK A;  3PZ2 A;  4DX1 A;  1EYH A;  2WXO A;  3TJP A;  3UT8 A;  1N4S A;  2PM7 A;  1NFI E;  2L0T B;  3U64 A;  1AWC B;  4KZ0 A;  3TWW A;  4HS2 A;  2EIL E;  4CT4 A;  4GZ6 A;  3UT7 A;  5C1D A;  4HBD A;  4P29 A;  5AIJ A;  3ML9 A;  4I6E A;  1U3D A;  2P9L G;  4UI9 J;  4U8H A;  2LO6 A;  2OVF A;  2WXM A;  2V8S E;  4UI9 C;  3PS6 A;  4I9E A;  2NC9 A;  1N11 A;  4ZHB A;  2XEN A;  5G05 J;  4MS6 A;  1UG3 A;  5HQ8 A;  4GPK A;  2IOS A;  2WXJ A;  3D9N A;  4APO A;  4ACK A;  3FWV A;  1OCC E;  3E32 A;  3PZ3 A;  4O1O A;  2CHX A;  3NZS A;  3LPZ A;  4U96 D;  4CDN A;  2KC7 A;  2XPY A;  2P9U G;  4GMR A;  3SFX A;  4BES A;  2DZO A;  3CST A;  4XX5 A;  4UI9 K;  4FUL A;  2IO2 C;  3C3O A;  3CVV A;  3TG4 A;  1O5M A;  4DX6 D;  1G3N B;  5D66 A;  5EYL A;  5D2M C;  5BXO A;  3FUL A;  2C0L A;  4CEM A;  4JHJ A;  3L22 A;  3ULE G;  3FUK A;  2V4L A;  5CMY A;  3UTM A;  2DYS E;  3PNL B;  3OXF A;  3PRZ A;  3ZNG A;  4QQI A;  4G8K A;  4UUC A;  4W9R A;  1S63 A;  5CER B;  4WUY A;  1H6K A;  5LP0 A;  1WDY A;  2VTB B;  2EIN E;  3E34 A;  1JPL A;  3BG0 B;  5E75 A;  3CVQ A;  3UX4 A;  5BNW A;  4I9C A;  3ASG A;  3CSF A;  4WNG A;  2IEJ A;  2P58 C;  3PH0 C;  5EIB E;  4APF A;  2WXF A;  1Q2Z A;  3TGO A;  3FH8 A;  4GMJ A;  1QBQ A;  3EHN A;  3FTW A;  4X8Q A;  4JHK A;  4DPR A;  4J8F A;  3CQC B;  2RG8 A;  1H6P A;  2BF0 X;  1H2T C;  2LNI A;  4MBG A;  4FP7 A;  4XKC A;  2ZGD A;  2YIN A;  1VDY A;  3GZ1 A;  3ZIM A;  3HXD A;  5CRU A;  4I2W A;  1RW2 A;  5BPP A;  4ZFH A;  2FEZ A;  3UT4 A;  2YNQ A;  3PRE A;  3NAW A;  5FIN A;  3TL5 A;  2J49 A;  4WND A;  3RSE G;  5AQB A;  5LCW J;  3D9L A;  2GRO B;  5LCW C;  4EZL A;  4GCN A;  5AQA A;  3SNX A;  1BU9 A;  3VLD A;  2QY7 A;  4CDR A;  3KD7 A;  1P5Q A;  2XGO A;  4GA2 A;  3E4B A;  4PDX A;  1NZN A;  5JJ6 A;  3G2T A;  4RVB A;  3APC A;  2XCB A;  2MHK A;  1IKN D;  2Y1L E;  1MHQ A;  5HI7 A;  2KZT B;  2P9S G;  3C5R A;  4G24 A;  3CVN A;  4MLP A;  4FLB A;  3OTN A;  3SZ7 A;  4ME2 A;  2BKK B;  4JHR A;  4JA9 A;  3D9K A;  4G23 A;  5AYW D;  4ANW A;  4OAU C;  4J8Y A;  4A63 B;  1E8W A;  1N0R A;  5KJM A;  3ZYL A;  1KZO A;  1V55 E;  2I1K A;  2OEW A;  1DNP A;  2XEE A;  3ENE A;  2PZI A;  1H19 A;  2LAI A;  3ULY A;  4KBQ A;  3S2A A;  1TNO A;  4HOT A;  1XGW A;  4DJA A;  2P9K G;  1OXJ A;  4I1M A;  3I3N A;  5LX8 A;  4FHK A;  4GYY A;  4AJW A;  3KEZ A;  4BY6 A;  2R59 A;  2B6C A;  3JQ0 A;  2XPZ A;  4DI3 A;  2L6B A;  4KVO A;  3UXG A;  3L82 A;  4DRX E;  1NP7 A;  3CVW A;  4PUC A;  5FZR A;  4DUI A;  2CHZ A;  5G55 A;  3GZS A;  2KXP C;  2RFA A;  4RLY A;  4A3T A;  3U4T A;  3LVR E;  2F37 A;  2IQC A;  2CFZ A;  1MX4 A;  3CVP A;  4U95 D;  1H2U A;  4UWH A;  3TAX A;  1BI8 B;  4ANX A;  3ZHE B;  5FJY A;  2NYJ A;  4D10 C;  3HG0 D;  1UJK A;  1Z6T A;  2J8S D;  1TNY A;  4K0R A;  3FHE A;  2VQ2 A;  1QZ2 A;  1KT0 A;  4G2V A;  2I1J A;  2X3M A;  4U0S A;  4GB9 A;  2ETA A;  3JXJ A;  5JHA A;  3V31 A;  3X2Q E;  3RO2 A;  3HDX A;  4F3V A;  2BUG A;  4C0E A;  3L13 A;  2IFU A;  4KT6 B;  3L17 A;  4G1T A;  1OWL A;  3HXE A;  4XKB A;  2R2L A;  1OUV A;  3T9K A;  2WMN A;  4HOQ A;  1SVX A;  2Y69 E;  1QNF A;  3DRA A;  1O1R A;  2EIK E;  2IOL A;  4HB5 A;  3ZXP A;  2AXZ A;  3DSW A;  2WXK A;  5D0O D;  3ZN3 A;  4BFR A;  3HXF A;  3LKU A;  3FUN A;  1OT8 A;  3DST A;  3I4R B;  4J6I A;  4UQX A;  1H2V C;  4B94 A;  3HVE A;  5CBO A;  2KM4 A;  1YYH A;  4CDM A;  3ZUV B;  3DSX A;  2X6I A;  2LXM A;  1HF8 A;  3MJW A;  2HR2 A;  5ENT D;  3TWR A;  5HRY A;  4HLE A;  3SO8 A;  3HYM B;  3B7U X;  2H6F A;  4ILH B;  1LTX A;  4NIK A;  3ZEF A;  3QWP A;  1LD7 A;  1SZ9 A;  4JXT A;  4KYO B;  4CZ2 D;  2P9P G;  3D3M A;  2IU1 A;  2VSN A;  3UKU G;  3AU5 A;  2BKG A;  2VYI A;  4HOS A;  2AW6 A;  4TUU A;  2OCC E;  3ABM E;  3U66 A;  1TYQ G;  5FQ7 A;  2LXL A;  3IBE A;  5CHE E;  3SFZ A;  3T5V A;  3DXK G;  4KMO A;  3Q7A A;  5T8I A;  3HIZ A;  5CRV A;  4GTP A;  3FUF A;  3ZYM A;  3R9M A;  2VSY A;  5FQ8 A;  3CKB A;  2IJG X;  3LXU X;  1MJ0 A;  1IQR A;  4WWP A;  1D8E A;  2WXN A;  4CT0 A;  1XNF A;  3MCX A;  2X6F A;  3IHV A;  3Q7F A;  3T8M A;  3KSL A;  5G2N A;  2FF4 A;  2X38 A;  3CIA A;  4I6J A;  5IY5 E;  1O1S A;  3D9O A;  3CEQ A;  3FUJ A;  2P9N G;  4B8C B;  3QK0 A;  1Y6I A;  1NL4 A;  1IYG A;  5BV1 A;  3W9G A;  2J07 A;  2ZXW E;  3EIQ C;  1A5E A;  5EN5 D;  4L7T A;  4MKT A;  3CHO A;  3PZD A;  3GZ2 A;  2VGE A;  5DBK A;  4BTA A;  2EIJ E;  2CHW A;  3JUE A;  3BEE A;  4ANV A;  3PNT B;  3R9A B;  5AN8 A;  3HXB A;  2HE0 A;  5FWQ A;  3MX3 A;  1MX6 A;  2FO1 E;  2LAH A;  3Q47 B;  3FTS A;  3ZHE A;  5KCM A;  4PH4 B;  1S70 B;  3Q5M A;  3LYA A;  2JLB A;  2OV8 A;  1WY6 A;  3S7J A;  2A5E A;  3WXX A;  3C3Q A;  5KWD A;  3V79 K;  4F1S A;  2OND A;  3CV0 A;  4WAF A;  1E8Y A;  4L9P A;  3EHQ A;  3TWX A;  5CCM A;  1EF1 C;  3LEW A;  4YVO A;  2V4H C;  4I1O B;  4J0U A;  3NB2 A;  3DSU A;  5B1B E;  3UM3 A;  3W9F A;  1U3C A;  5T4Y A;  3ASF A;  3G2U A;  3BU8 A;  3DEP A;  4M7C A;  1JCS A;  3ASD A;  2V5F A;  1H0A A;  2L6J A;  1X5B A;  2V5Q C;  4A3V A;  4N3C A;  4AOF A;  2ETC A;  1HE8 A;  1D9S A;  2HM8 A;  3T8K A;  4GU5 A;  3DWL G;  4GTQ A;  4U07 A;  1HFA A;  4RG6 A;  4DX7 D;  4OAV B;  3QJZ A;  2WXL A;  1O1T A;  3ZKJ A;  3NZU A;  1FT2 A;  2V0P A;  4CGV A;  1N54 A;  4KVM A;  1ELR A;  4G8L A;  2NSZ A;  2VJ8 A;  2X6J A;  4U0U A;  4LNB A;  2GGF A;  3KEA A;  4C48 B;  4N3B A;  3FH7 A;  4TRQ A;  1SQM A;  5KNG A;  3AG4 E;  3CKC A;  3RRN B;  3KS2 A;  4GA0 A;  2RD0 A;  2GRR B;  3HVE B;  3UIN C;  4GA1 A;  4HFG A;  4HOU A;  4N3A A;  3MGB A;  4NUR A;  1LD8 A;  3ONL A;  1BPO A;  2WMO A;  4J8S A;  2H6I A;  3URZ A;  2R05 A;  3V2O A;  3R7Q A;  4WWN A;  4H7Y A;  1BI7 B;  5J08 A;  3R7R A;  5KBA A;  3VTY A;  4XI0 A;  1W3B A;  1ELW A;  1ELK A;  4DK5 A;  4HRL A;  1NA0 A;  3CHQ A;  3J5Q B;  3O48 A;  4WNF A;  5FQ6 A;  4AP2 A;  4LEU A;  4ABN A;  5AJD A;  1JCR A;  4B0Z A;  4CRW A;  1YA0 A;  4HLL A;  2LUH A;  2Y3A A;  4LCT A;  3B95 A;  2DVW A;  2J9Q A;  2DBA A;  3I5P A;  2A5U A;  2FUL A;  1INZ A;  4R7L A;  3ESL A;  5JJ7 A;  3FTX A;  3SFY A;  1TN8 A;  3FUI A;  3NQP A;  3VLE A;  5JA4 D;  3OXL A;  2DCP A;  2MRI A; 
#chains in the Genus database with same CATH homology
 1N52 A;  4N5C A;  2M63 A;  3FH5 A;  5ANR A;  4L1B A;  4FHJ A;  1OUV A;  2KCL A;  2WMN A;  3D9I A;  4HOQ A;  3CVL A;  3CR3 A;  1QNF A;  2IOL A;  5BT1 A;  5KJN A;  5ENN A;  3CGH A;  4JC8 A;  3CHR A;  4PS7 A;  4XE0 A;  2AXZ A;  5ARF A;  4GYO A;  1UN9 A;  3K9I A;  5A23 A;  3ZXS A;  2E2E A;  3AU4 A;  3APF A;  2A4Z A;  4L2L A;  3N71 A;  3FU5 A;  4NAC A;  2WXK A;  3LDZ A;  3QB2 A;  2HYZ A;  3S7F A;  4Q69 A;  3B13 A;  5D0O D;  4HVB A;  2UWJ G;  3CK7 A;  4L23 A;  4HOR A;  4YND A;  3RU0 A;  2ION A;  3IKO B;  4JEH A;  3SGH A;  2I6H A;  2J08 A;  1E7V A;  2EQX A;  3RKV A;  3ZN3 A;  2GW1 A;  4BFR A;  3L08 A;  3FU0 A;  4ILI A;  2NXP A;  3U3W A;  4EQF A;  3LKU A;  3FUN A;  3PE4 A;  3VLF A;  4UWL A;  3APD A;  3QNK A;  5CCL A;  4FJY A;  4NQ0 A;  4BTB A;  4O6F A;  2R5S A;  4N39 A;  1FVH A;  3I4R B;  1SZA A;  2LSU A;  2KCK A;  4J6I A;  4U04 A;  4I2Z A;  4UQX A;  1H2V C;  3LY7 A;  4B94 A;  2E0I A;  3VTX A;  1HO8 A;  3HVE A;  3PDN A;  2XPI A;  3FFL A;  4KXK B;  2KM4 A;  1WAO 1;  4UWG A;  2AVP A;  3IV0 A;  4KZC A;  4K03 A;  4CDM A;  2X6I A;  4FJZ A;  3IEG A;  4DLO A;  2J4D A;  1PY1 A;  1HF8 A;  4J8D A;  3MJW A;  4FC8 A;  3FUE A;  3G2W A;  2HR2 A;  4PS3 A;  4OVU A;  5EKQ D;  3RRU A;  3U9W A;  3DPD A;  4Q96 A;  1EDU A;  3MEK A;  4HXI A;  4HLE A;  3L16 A;  3G2S A;  3HYM B;  3B7U X;  3GW4 A;  4ILH B;  1EYH A;  3CHP A;  3L6A A;  5J90 A;  2WXO A;  3TJP A;  3ESK A;  3ONK A;  3UT8 A;  3ZEF A;  3LY9 A;  3QWP A;  2VGX A;  5JJT A;  2WQ7 A;  1SZ9 A;  3ULQ A;  2XRZ A;  4JXT A;  4KYO B;  3LY8 A;  5FQ4 A;  2PM7 A;  1UW4 B;  3D3M A;  2L0T B;  3FEY A;  3U64 A;  1IQU A;  2IU1 A;  2VSN A;  4V3I A;  5M72 A;  3JUI A;  4KZ0 A;  4ANU A;  3Q4A B;  4HS2 A;  3SBT B;  4CT4 A;  2C0M A;  1OWP A;  3AU5 A;  4GZ6 A;  4LER A;  2UY1 B;  2XGM A;  2VYI A;  3QC1 A;  3UT7 A;  4HOS A;  1DVP A;  4FLH A;  5C1D A;  3AS4 A;  2AW6 A;  5ARG A;  1KLX A;  4P29 A;  4WWO A;  2VSO E;  5AIJ A;  3ML9 A;  4TUU A;  3U66 A;  4I6E A;  1U3D A;  5FQ7 A;  2WXP A;  3B7T A;  3IBE A;  5CHE E;  3SFZ A;  3T5V A;  4UI9 J;  3FTZ A;  3MV2 B;  4U8H A;  2LO6 A;  3EJN A;  4B89 A;  2OVF A;  3DBS A;  1E7U A;  1HZ4 A;  2WXM A;  3FTY A;  4L2Y A;  4KMO A;  5T8I A;  2V8S E;  1HXI A;  3HIZ A;  4UI9 C;  4EBA G;  3PS6 A;  5LFA A;  5A7D B;  3JQ1 A;  3O4Z A;  4I9E A;  2NC9 A;  4ACL A;  3IHY A;  3KAE A;  5A6C A;  2L9B A;  2L0I A;  3FUF A;  5FT9 A;  3ZYM A;  3ZW3 A;  1Z3X A;  5G05 J;  1HG2 A;  4MS6 A;  5BUZ A;  4BX8 A;  2VSY A;  1UG3 A;  5FQ8 A;  1UJJ A;  2IF4 A;  5HQ8 A;  4GPK A;  1PC2 A;  2PL2 A;  3LS8 A;  2IOS A;  2WXJ A;  3D9N A;  4APO A;  3FU6 A;  4ACK A;  3CVU A;  3FWV A;  2R17 C;  3CKB A;  4EEC A;  4AM9 A;  2IJG X;  3LXU X;  2XCC A;  2VGY A;  2VSX E;  2CHX A;  4LRZ A;  3JCK C;  1IQR A;  2WQ6 A;  1B89 A;  3FUH A;  3NZS A;  3LPZ A;  4EBA A;  3MA5 A;  4WWP A;  4CDN A;  3QOU A;  2KC7 A;  2XPY A;  5E76 A;  3GYZ A;  4DI4 A;  4C9B B;  3L54 A;  3SF4 A;  2WXN A;  3MV3 B;  4CT0 A;  1NA3 A;  3CST A;  3QWW A;  1XNF A;  3MCX A;  2LSV A;  2X6F A;  4XX5 A;  3IHV A;  4BX9 A;  4UI9 K;  4FUL A;  3T8M A;  3MKR A;  3CVV A;  3TG4 A;  5G2N A;  3CHM A;  4MRU A;  2FF4 A;  5BV0 A;  4UWF A;  2X38 A;  3FUL A;  3CIA A;  2C0L A;  4UWK A;  5FZQ A;  1OWO A;  4I6J A;  4CEM A;  4JHJ A;  3TXM A;  3S7D A;  3L22 A;  3MZL B;  3FUK A;  2V4L A;  2Y4T A;  1PAQ A;  4I43 A;  5CMY A;  1TJC A;  3D9O A;  3RO3 A;  3CEQ A;  3FUJ A;  3QDN A;  5EX0 A;  3BG1 B;  3OXF A;  3PNL B;  3PRZ A;  3LVQ E;  4B8C B;  3ZYQ A;  3QK0 A;  1FCH A;  4FU3 A;  4UQZ A;  4W9R A;  3CVX A;  1Y6I A;  4Q94 A;  4WUY A;  1IYG A;  5BV1 A;  1H6K A;  5LP0 A;  2J07 A;  1UN8 A;  3UPV A;  2VTB B;  3EIQ C;  1Y8M A;  1JPL A;  3BG0 B;  5E75 A;  3CVQ A;  3UX4 A;  4L7T A;  2PQN A;  3CHO A;  4MKT A;  3FY4 A;  3PZD A;  4AIF A;  4I9C A;  5BNW A;  3GZ2 A;  1HX8 A;  3ASG A;  2WQH A;  4B8A A;  5DBK A;  3CSF A;  4LUN U;  5EX3 A;  4WNG A;  2P58 C;  4XI9 A;  2WXR A;  3QAR A;  3PE3 A;  3PH0 C;  2QFC A;  4BTA A;  4APF A;  1L5J A;  4EPZ A;  2WXF A;  2CHW A;  1TEZ A;  3TGO A;  4DLQ A;  3FH8 A;  4AVX A;  4GMJ A;  5DIZ A;  3BEE A;  4ANV A;  4AY5 A;  3EHN A;  4FA6 A;  3PNT B;  3R9A B;  4BT9 A;  2XRY A;  3FTW A;  4JHK A;  4DPR A;  4J8F A;  5FWQ A;  3MX3 A;  3S7B A;  3CQC B;  3D9P A;  2RG8 A;  3ZRH A;  2BF0 X;  2UY1 A;  2LAH A;  1H2T C;  3EDT B;  3FTS A;  3Q47 B;  3FTV A;  4QFV A;  4Y6C A;  5G04 C;  5D0Q D;  3ZHE A;  2LNI A;  5KCM A;  4PH4 B;  4FP7 A;  3Q5M A;  3LYA A;  5KJL A;  2JLB A;  3OAW A;  2OV8 A;  1EPU A;  1WY6 A;  3S7J A;  1HU3 A;  2WXI A;  4XKC A;  2YHE A;  4N2Q A;  3LJ3 A;  1LF8 A;  1VDY A;  2YIN A;  3GZ1 A;  4U0Z A;  3WXX A;  3ZIM A;  2AXV A;  4I2W A;  3UQ3 A;  5BPP A;  3P2B A;  2Y4U A;  2FEZ A;  4IN3 B;  1E96 B;  3RK6 A;  3UT4 A;  2YNQ A;  3PRE A;  1A17 A;  4GAA A;  3D9J A;  4F1S A;  2CG3 A;  2OND A;  3MKQ A;  2PM6 A;  3CV0 A;  2J49 A;  3TL5 A;  4WAF A;  1E8Y A;  3QWV A;  3QKY A;  3CK9 A;  4WND A;  1HG5 A;  2VGX B;  3Q49 B;  3PEU B;  4IUL A;  4OVV A;  5CCM A;  5LCW J;  1EF1 C;  3LEW A;  4YVO A;  2WXH A;  3D9L A;  3FP3 A;  4URK A;  4ILG A;  4EZJ A;  3CK8 A;  2FI7 A;  4H7X A;  4XIF A;  5LCW C;  4I17 A;  4I1O B;  2I9C A;  4JVS A;  4FAD A;  3D9M A;  4J0U A;  3ZFW A;  4XZ4 A;  2MOW A;  3AS8 A;  4RSY A;  4EZL A;  2XGS A;  4GCN A;  1U3C A;  5T4Y A;  3SNX A;  3EHM A;  3ASF A;  3G2U A;  1JWF A;  3RRM B;  2DIW A;  3VLD A;  2QY7 A;  4BWR A;  3SBS A;  3ZVV A;  2KAT A;  3KD7 A;  4CDR A;  1P5Q A;  2XGO A;  2JEK A;  4GA2 A;  3E4B A;  4A1G A;  4PDX A;  1MQS A;  2HO1 A;  3TG5 A;  1NZN A;  2V5F A;  1H0A A;  2L6J A;  3ASD A;  3G2T A;  4RVB A;  5JJ6 A;  3ZGQ A;  3ZPJ A;  2FBN A;  1X5B A;  3APC A;  3G2V A;  4YVQ C;  4BSX A;  2ILR A;  2XCB A;  5T3R A;  3PUK A;  2MHK A;  1MHQ A;  5HI7 A;  4A3V A;  2KZT B;  4N3C A;  5BW8 C;  4AOF A;  4IRU A;  4G24 A;  3ASH A;  3CVN A;  1HE8 A;  4MLP A;  2Q7F A;  3FTU A;  4FLB A;  3OTN A;  3SZ7 A;  4ME2 A;  3SHF A;  3T5X A;  1JUQ A;  4JZY A;  2X6K A;  4JHR A;  2HM8 A;  4M3O A;  4C0M A;  4GU5 A;  4JA9 A;  2I2O A;  3D9K A;  4G23 A;  5AYW D;  4ANW A;  3Q15 A;  5FZS A;  1E8W A;  4U07 A;  4E6H A;  1ZU2 A;  3AS5 A;  2YHC A;  5KJM A;  3PVL A;  1HFA A;  3NF1 A;  3ZYL A;  3C98 A;  4RG6 A;  1ZBP A;  2WVI A;  1HH8 A;  5AJL A;  4Y6W A;  2I1K A;  3QJZ A;  4UQY A;  2VTB A;  1DNP A;  3EIJ A;  3HHM A;  3QAQ A;  3ENE A;  1OWN A;  2PZI A;  1H19 A;  2WXL A;  1OWM A;  2LAI A;  3I4G A;  3NZU A;  4A1S A;  4BT8 A;  3UUX A;  1IHG A;  4KBQ A;  4U63 A;  3FDH A;  3S2A A;  2V0P A;  1E90 A;  4JPS A;  2AXU A;  2OVB A;  4CGV A;  3CVY A;  4J8E A;  1N54 A;  3JYS A;  4HOT A;  2OOE A;  4KVM A;  4GCO A;  3FUD A;  1ELR A;  2PQR A;  2NSZ A;  2VJ8 A;  1XGW A;  2X6J A;  4TV3 A;  4DJA A;  4U0U A;  5ANL A;  2YQ8 A;  2GGF A;  1E8Z A;  5C2Y A;  4G25 A;  4GZ3 A;  4I1M A;  4N3B A;  3FH7 A;  3OXG A;  4TRQ A;  1SQM A;  3I3N A;  3ZYK A;  3CKC A;  4JEU A;  3PEV B;  3RRN B;  3FU3 A;  4FHK A;  4GYY A;  5JHB A;  5LX8 A;  3KS2 A;  3MYV A;  4GA0 A;  4GZC A;  5LOZ A;  2RD0 A;  3FUM A;  5G04 J;  4AJW A;  4AY6 A;  2WB2 A;  3KEZ A;  4BY6 A;  3HVE B;  4GA1 A;  4HFG A;  4HOU A;  2J09 A;  2R59 A;  1GW6 A;  2XHE A;  3CHS A;  3JQ0 A;  4N3A A;  2XPZ A;  4EZK A;  3MGB A;  3ML8 A;  4NUR A;  4DI3 A;  3ONL A;  4KVO A;  1BPO A;  1TJF A;  2WMO A;  4J8S A;  3URZ A;  2BTD A;  4OYS A;  1NP7 A;  3CVW A;  5EDS A;  3R7Q A;  4PUC A;  4WWN A;  4H7Y A;  5FZR A;  2CHZ A;  3CLJ A;  5G55 A;  5J08 A;  3GZS A;  2GRM A;  4A3T A;  3U4T A;  2WXG A;  4JL0 A;  2GRL A;  3LVR E;  3R7R A;  2IQC A;  2CFZ A;  3VTY A;  3CVP A;  4WNE A;  4XI0 A;  4CCA A;  4PS8 A;  5CMW A;  1FVF A;  1W3B A;  3TXN A;  4G11 A;  1Z3Y A;  1H2U A;  1ELW A;  1ELK A;  4UWH A;  3SI5 A;  3TAX A;  4ATG A;  4DK5 A;  1KT1 A;  1INZ A;  4GML A;  4AEZ C;  2XEV A;  1NA0 A;  4CGW A;  4G26 A;  3CHQ A;  5FTP A;  2AWI A;  2C2L A;  4ANX A;  3O48 A;  4WNF A;  5FQ6 A;  2KCV A;  3ZHE B;  5FJY A;  4AP2 A;  4LEU A;  4ABN A;  2X6H A;  4D10 C;  3UMV A;  5AJD A;  3RJV A;  4F7A A;  4JW1 A;  4B0Z A;  4CRW A;  1YA0 A;  4N2S A;  3B7S A;  4IYP A;  4JA7 A;  4F53 A;  3FEX A;  1WM5 A;  1UJK A;  2WXQ A;  2Y3A A;  4AV7 A;  2KZT A;  3CQG B;  1Z6T A;  4LCT A;  4K0R A;  2J4B A;  3FHE A;  2J9Q A;  1JWG A;  4GZ5 A;  4GYW A;  2VQ2 A;  1QZ2 A;  2DBA A;  2WM9 A;  3I5P A;  4E85 A;  1KT0 A;  3B7R L;  4A55 A;  2A5U A;  2FUL A;  3MKQ B;  3PUJ A;  2XQ0 A;  2I1J A;  2X3M A;  3LCA A;  3P1U A;  4G2V A;  4RG9 A;  4R7L A;  3ESL A;  4GZD A;  4U0S A;  3RIB A;  5JJ7 A;  3SD5 A;  3FTX A;  4NRH B;  4GB9 A;  2CFU A;  5JHA A;  1E8X A;  5G05 C;  3RO2 A;  3HDX A;  4F3V A;  2BUG A;  2FO7 A;  2CG2 A;  4C0E A;  2ZU6 B;  2WPV A;  4AXH A;  3L13 A;  3FUI A;  2IFU A;  4KT6 B;  3L17 A;  1HS6 A;  5AEN A;  4G1T A;  1OWL A;  4I6G A;  1S0P A;  4XKB A;  1QQE A;  5KJK A;  3NQP A;  3VLE A;  3OXL A;  4I1A A;  2DCP A;  2MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...