2PQRA

Crystal structure of yeast fis1 complexed with a fragment of yeast caf4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
DFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Mitochondria fission 1 protein
publication title Structural basis for recruitment of mitochondrial fission complexes by Fis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 42
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pqrA01
3Q5MA 3Q4AB 1KT0A 5G04J 2KCLA 4GYWA 4A1SA 4GZ5A 5ARFA 3LY9A 2FEZA 4ME2A 4JA9A 5EKQD 4WNGA 3Q49B 3S7DA 3ASHA 4JHRA 2XGSA 1HZ4A 2Q7FA 1HH8A 3AS5A 4HOTA 5C1DA 4G25A 2XPIA 3GZ2A 2E2EA 4N39A 4J8DA 3MV2B 4G26A 5JJ6A 3NF1A 5FZQA 3ASGA 5HI7A 2UY1B 4RG9A 4HOUA 3QWPA 2VSYA 2VGXA 2KC7A 4H7XA 3FWVA 3CEQA 3RO3A 4LEUA 3RKVA 5BW8C 2LSVA 3K9IA 3BEEA 4EQFA 2WQHA 4JL0A 4G24A 3ZHEA 3VTYA 3LCAA 3CVNA 5D0OD 4NRHB 2C0MA 3TAXA 4UI9J 2GW1A 1WAO1 3KS2A 3ZHEB 4HORA 4I2ZA 1ELWA 3MV3B 3MA5A 2WPVA 5G05C 2FF4A 1OUVA 4IN3B 2C0LA 5JJ7A 3TG5A 3U3WA 2YHCA 2PQNA 3QWVA 3ESKA 3QKYA 4YVOA 4I9CA 4I9EA 4O6FA 3ZFWA 4U04A 2HO1A 4AIFA 2Y4UA 1TJCA 2Y4TA 4GCNA 2ONDA 2C2LA 3ASFA 3TGOA 4W9RA 4Y6CA 3S7BA 1XNFA 5A7DB 3AS4A 2FO7A 3CK9A 4GA0A 4G1TA 3S7JA 3R9AB 3CVLA 4Y6WA 4BTAA 2J9QA 3CK8A 5EX3A 2UY1A 2KATA 4YNDA 3UPVA 2XGOA 5LCWJ 4XI9A 1YA0A 1Y8MA 4H7YA 5DBKA 1QZ2A 2FI7A 1ZU2A 5CCLA 1QQEA 5EX0A 2OOEA 4WNEA 2JLBA 3CKBA 5KJKA 5HQ8A 2LSUA 2AVPA 3ZPJA 4WNDA 2FBNA 5A6CA 3HYMB 1A17A 3SZ7A 3GW4A 4AY5A 5KJLA 5FZRA 4U0UA 3OXFA 3URZA 3LY7A 3CKCA 2XCBA 1FCHA 2PQRA 4GZ6A 3RIBA 4GA2A 4APOA 2IF4A 4BTBA 5KJMA 4GA1A 1IYGA 3RJVA 4J0UA 5BT1A 3IEGA 3Q47B 4YVQC 4N3AA 5G04C 1E96B 3FFLA 3QOUA 4N3CA 3LKUA 2HYZA 4RG6A 4WUYA 2XEVA 4XIFA 4CDRA 1ZBPA 4HOSA 3UUXA 2LNIA 4N3BA 2VSNA 3LPZA 1P5QA 1HXIA 2BUGA 4KXKB 5DIZA 3AS8A 4GYYA 2L6JA 4B94A 5FTPA 2XCCA 4I17A 5KJNA 4AY6A 4ABNA 3QDNA 5JJTA 3RO2A 2KCKA 2R5SA 5CHEE 4J8EA 2MHKA 5G05J 2P58C 2V5FA 2PZIA 3CVPA 3O48A 3CV0A 3PE4A 5ARGA 2UWJG 3OXGA 3UQ3A 4GCOA 4BWRA 4HOQA 1IHGA 4F3VA 1WM5A 4GZ3A 4WNFA 3CK7A 1KT1A 4KBQA 2QFCA 3GYZA 5FZSA 5FJYA 4UI9C 4U0SA 4J8FA 1ELRA 3KD7A 4JA7A 3RU0A 5FT9A 3E4BA 4G23A 1B89A 2KCVA 4I2WA 3JYSA 3S7FA 4UQXA 5D0QD 3ZGQA 4GYOA 3ZN3A 3U4TA 2XGMA 5AYWD 4AM9A 3VTXA 2VGYA 4GPKA 3N71A 5BNWA 1NA0A 4N5CA 3TG4A 3LYAA 3SF4A 3PE3A 2NC9A 2VGXB 3ASDA 4U07A 2HR2A 3ULQA 4NQ0A 3QWWA 4N2SA 1W3BA 2IFUA 3LY8A 2PL2A 3OXLA 4UI9K 3MKRA 3Q15A 4XI0A 1PC2A 2I6HA 2VYIA 3MEKA 4UQZA 4UQYA 3EDTB 4BT8A 4KYOB 1NZNA 4BT9A 5M72A 5CCMA 4G2VA 1NA3A 3FP3A 3GZ1A 4CGVA 4I1AA 3CVQA 4U0ZA 2DBAA 2VQ2A 4CGWA 3PDNA 2YQ8A 4N2QA 1KLXA 3WXXA 3KAEA 5LCWC
chains in the Genus database with same CATH superfamily
3LXUX 3Q79A 3FTYA 3FTWA 3UT7A 3UT8A 5FQ7A 5FINA 4GYWA 2Y1LE 1UOHA 3LY9A 4ACKA 4ME2A 1BLXB 2A5UA 3SD5A 1FT2A 3ZNGA 2DYRE 4JHRA 4K5BA 3CHRA 3UKUG 4U8HA 5E75A 2Q7FA 2XEEA 3TWVA 3OAWA 1TN7A 3PNTB 3GZ2A 2DZNA 4I6JA 3U66A 1N11A 4TXQA 4EZJA 5D2MC 5JJ6A 2RG8A 5T3RA 1K1AA 2JABA 3FU3A 1DNPA 3IBEA 2OV8A 2VGXA 2J49A 5ENTD 4H7XA 4B89A 4B93B 3FWVA 3CEQA 4LEUA 3V31A 5HS0A 4DX5D 3ONKA 4U8YD 5BW8C 1K8KG 2QC9A 3EHNA 3HXCA 3Q75A 4NRHB 3V2OA 3MCXA 5ENQD 4UI9J 2GW1A 1SA4A 3CGHA 4GTSA 4JW1A 4XX5A 5JA4D 4HORA 1ELWA 4I2ZA 2CHXA 2WPVA 3MA5A 5FQ6A 2WXMA 1OUVA 4TUMA 3GZSA 5JJ7A 3JCKC 3KEZA 2DVWA 5B3SE 4PS3A 4U04A 2B6CA 2MOWA 2OVBA 2YINA 1TNOA 3EHQA 4R7LA 3DXMG 1S0PA 1N54A 3CLJA 3Q7FA 4YDYA 3TGOA 1N94A 1PAQA 2P9PG 3S7BA 2FO7A 2BTDA 3CK9A 3Q9UC 1ELKA 3MZLB 1N0QA 5D66A 2WM9A 1EDUA 4BTAA 3UKRG 1VDYA 2R59A 1V54E 4DLOA 1D8DA 4CZ2D 3UPVA 3E33A 3RAUA 2J4DA 1NP7A 1E8XA 4I6EA 3DPYA 5EX0A 1HX8A 4WNEA 4BERA 4LG6A 4RVBA 5KJKA 5H7PA 3EHRA 4GMLA 1FVFA 4WNDA 4F1SA 2FBNA 2HE0A 3GW4A 4AY5A 4CRWA 5KJLA 4K5AB 3LY7A 3CKCA 2CFZA 2YHEA 1UJJA 2PQRA 1RZ4A 5AAOA 5CECB 1S70B 4BEPA 4K03A 4ATGA 1GW6A 1IYGA 4I1MA 4U63A 3C98A 4J0UA 2IJGX 4YVQC 1U3CA 4GTRA 4N3AA 1E96B 1N4PA 4BY6A 3NQPA 1DCQA 3LS8A 2XEVA 1MX6A 3G2TA 3FH8A 2LNIA 3UT4A 1E7VA 1EF1C 4HBDA 3AS8A 2L6JA 4B94A 4LRZA 5FTPA 2XCCA 4UWKA 3CVXA 3B7RL 3C3RA 1UJKA 2NXPA 1ZB1A 2PM6A 4F1PA 2KCKA 2P2CP 3CHPA 3EU5A 1O5MA 1QYMA 5AQAA 3EIQC 4B0ZA 3J5PA 2MRIA 3WG7E 4A55A 1LD8A 3L9TA 4PH4B 3MJWA 3R7QA 1D9SA 4DX2A 2WB2A 2BEDA 5AQBA 3G2SA 3CHMA 4F3VA 3D9IA 1LD7A 5KNHD 3B7SA 3JUIA 1KT1A 4KBQA 5ANLA 1BI7B 1OCRE 1MYOA 1HFAA 3IHYA 3FULA 4RLYA 1ELRA 4YDWA 4GTOA 3ABLE 4A3VA 4G23A 1JCRA 1B89A 2Y69E 3U9WA 4U96D 3LJ3A 2R05A 5BV1A 4CDNA 3VTXA 3QJZA 4GPKA 4N5CA 3FY4A 3SF4A 3AAAC 3PE3A 3R7RA 3FEYA 5AARA 3AJIA 1H6PA 4KZCA 1W3BA 2IO3C 2NSZA 2H6FA 4APFA 3NZSA 5AENA 4FP7A 3MKRA 3ZYMA 5FWQA 3PZ2A 2VYIA 3MEKA 1E8YA 2JEKA 4UQYA 2DIWA 4BT8A 1U3DA 1JUQA 1O1RA 1WG0A 2GROB 2X6IA 4DK5A 2GRMA 5CCMA 3UM1A 4FLBA 4I1AA 4U0ZA 5FQ4A 3EU9A 4IULA 1HU3A 3UM0A 2VQ2A 4CGWA 2GGFA 2YQ8A 4BX9A 3DSTA 4XZ4A 1KLXA 3WXXA 3AG4E 3Q7AA 1IHBA 3KAEA 3L08A 1SZ9A 3Q5MA 4FLHA 4HLEA 3C72A 1IQUA 5G04J 1Z3YA 2RKKA 2GRQB 4FJYA 4A3TA 2DCPA 4ACLA 1OCCE 4U8VD 2ETAA 2DZOA 3V30A 5EKQD 3D3MA 5CEAA 2L0IA 2AXUA 3QK0A 4TXRA 3SNXA 4B8CB 2RFMA 2F37A 3FTUA 4HOTA 3ABKE 5C1DA 4G25A 2CFUA 4EPZA 2R2LA 3D9KA 3APDA 4JZYA 1UN9A 5E76A 3PS6A 2CHWA 5CMWA 4ILGA 5CMYA 2ILRA 2RFAA 3NF1A 5FZQA 3ASGA 5HI7A 5AQ7A 1E7UA 5JHAA 1N4SA 4HOUA 3QWPA 1IXVA 4EBAA 3HXBA 2ZISA 2XEHA 3PZ3A 3RKVA 3K9IA 3BEEA 4XE0A 4HNAD 2A4ZA 3PZDA 4K5CA 3QAQA 3L13A 4KT6B 2J07A 4MRUA 3RRNB 4KVOA 1WAO1 3EJNA 4WWPA 1H2TC 2EIME 5G05C 3OTNA 5EDSA 3W9GA 1X5BA 4I1OB 3TWWA 5EILA 3TG5A 3U3WA 3FH7A 2YHCA 3ZRHA 3ESKA 3S2AA 3QKYA 2XS8A 4J8YA 4MKTA 4GAAA 2XPZA 4I9CA 3B7UX 2R17C 3UIOC 2GRNB 2XQ0A 3UM2A 3L16A 3TWUA 2Y4UA 5LP0A 2PM7A 2FO1E 2Y4TA 3ZXSA 2I1KA 3D9LA 2ETBA 3ASFA 3Q78A 3R9MA 4OAVB 4DRXE 2QY7A 2B0OE 1KPSB 1XNFA 3C3QA 3J5QB 3ONLA 4G1TA 2P9NG 2F8XK 2V8SE 4O60A 4Y6WA 3CQCB 5CBOA 1DCEA 3L22A 3CHOA 2F8YA 3JXJA 5J90A 2VSOE 3PNLB 4YNDA 5LCWJ 4XI9A 4WAFA 1Z6TA 1QZ2A 5LOZA 4KZ0A 4G8KA 2LXLA 2OOEA 4GZDA 3ML8A 3CKBA 2XZTG 4A1GA 5CEDB 2ZU6B 3ZPJA 5A6CA 1OWLA 2WMNA 4Z68A 4MLPA 2WXGA 3D9NA 5FZRA 4L9PA 3OXFA 2XCBA 1FCHA 1AWCB 3FUKA 1TNYA 2IF4A 4JEUA 4BTBA 5G2NA 3RRUA 4PS7A 3DSWA 3NOGD 3ABME 3O4ZA 4HVBA 3IEGA 3FEXA 1Z3XA 4AOFA 3FFLA 2L6BA 3QOUA 2RD0A 4NURA 3B7TA 3SBTB 4RG6A 5ANRA 4XIFA 1ZBPA 4HOSA 2VSNA 2OCCE 5HRYA 2ZGGA 1HXIA 2QYJA 4GYYA 1FPPA 5EIBE 4I17A 2WXFA 4ABNA 4F6RD 1IKND 1PY1A 4TV3A 2R5SA 3ZEFA 3FUNA 3HXEA 2MHKA 2V5FA 3MYVA 2PZIA 3CVPA 3PE4A 4ANUA 5ARGA 1O1SA 3G2UA 1SA5A 1LF8A 3ZU7B 4LSZE 3T8MA 4GCOA 4J7WA 1TNBA 5AN8A 1DC2A 3AG1E 4MBGA 2IOSA 4GZ3A 1WY6A 1N0RA 3HVEA 2QFCA 2XPYA 5FZSA 4UWGA 5FJYA 2IO2C 4UI9C 3AG2E 2WXRA 3QNKA 4J8FA 1A5EA 4BESA 4JA7A 3AU5A 2ETCA 4P29A 2KCVA 3I4RB 4GTMA 3JYSA 4FJZA 3DBSA 3ZGQA 2R03A 4UWFA 5AYWD 3I5PA 4K0RA 3C5RA 4HFGA 3IV0A 1YYHA 3FUFA 3N71A 2AW6A 4FU3A 3DWLG 2EINE 4GMRA 3LYAA 3ZYLA 2HR2A 1H19A 5AQ9A 3QWWA 4N2SA 2P9KG 3FH5A 2CG2A 3RSEG 2X6JA 1EPUA 5IY5E 3OXLA 5KWDA 3RRMB 4I43A 3F6QA 5BXUA 3Q15A 4XI0A 1PC2A 3CQGB 4FA6A 2X6KA 2LAHA 3LJNA 4OVVA 3EDTB 5C2YA 4C48B 2QYUA 4E85A 4DPRA 4HQDA 1OWMA 4L1BA 3Q9NC 1NA3A 3JQ1A 3PEUB 5KBAA 2AJAA 3BU8A 1KZPA 1IQRA 3CHSA 4JHJA 3PEVB 4AV7A 4JHKA 4QFVA 1RW2A 4DI4A 3ZIMA 4G8LA 2VSXE 4U7EB 1HE8A 1OCOE 3PVLA 1OWOA 4J6IA 4LCTA 4Q69A 4J8SA 3Q73A 4JA9A 3TWQA 1L5JA 3FU5A 4HB5A 3TWSA 3VLEA 2X6FA 3APCA 2NYJA 1HZ4A 4EZKA 3ZUVB 4PS8A 4LUNU 2XPIA 2XS1A 1E8ZA 1NL4A 4BSZB 4AXHA 4J8DA 1WDYA 4E6HA 3MKQA 3EUVA 4G26A 4M7CA 3SO8A 4JVSA 5B1BE 2UY1B 4RG9A 4OYSA 2Y0BG 2WXNA 4DJAA 3RK6A 3I4GA 3FUMA 2IQCA 2KC7A 3KSLA 3RO3A 4GMJA 3HG0D 4ANXA 2R02A 4ILIA 2LSVA 3DEOA 4EQFA 3APFA 1N52A 3B13A 4JEHA 3ZHEA 4LNGA 3D9HA 3VTYA 2LXMA 3LCAA 3CVNA 5EYPF 2C0MA 2V4HC 3TAXA 3KS2A 3C3OA 3CVYA 4XKCA 1H2UA 2FF4A 4JB8P 2ZGDA 4IN3B 2C0LA 2YNQA 3U64A 3FUDA 3LVRE 3QARA 3AU4A 1MQSA 3QWVA 3DSXA 3FHEA 4HXIA 2WXHA 5CRUA 4YVOA 3BG0B 4CYMD 4O6FA 2HO1A 2E0IA 2WXJA 3ZKJA 3E37A 3FU0A 1H0AA 3PH0C 5CRVA 1TJCA 4LNBA 4TRQA 2LO6A 1JPLA 4BFRA 1FVHA 4BETA 5ITZF 4ANWA 3NBNB 2HM8A 3DXKG 5A7DB 2IY0C 3AS4A 2J4BA 1N95A 1NI1A 3G2WA 2XZDG 3S7JA 3R9AB 3CVLA 4X8QA 4ZFHA 3B7BA 3ZW3A 3CR3A 3ZVVA 2UY1A 5B1AE 2P9UG 2KATA 2XGOA 1BD8A 1N4RA 1YA0A 3ML9A 1Y8MA 3FTVA 2FI7A 1ZU2A 3NZUA 4CDMA 5CCLA 3W9FA 4GTQA 2H6HA 3UM3A 2JLBA 4FULA 4FHJA 2LSUA 4HRLA 3CHQA 4N5QA 1O1TA 3HYMB 2GRLA 3HRAA 4YDOA 1A17A 3SZ7A 3ENEA 2WXQA 3URZA 2J09A 3DPDA 4PDXA 1MZCA 4G11A 2A5EA 3VLFA 3DRAA 3HHMA 4UWLA 2P9SG 5KJMA 3RJVA 1Q2ZA 2J08A 1TN8A 3ESLA 3LEWA 4XKBA 5BT1A 3I3NA 2I9CA 1MX4A 5ENRD 2ZIRA 5G04C 4L7TA 1LTXA 1XGWA 2WMOA 1H2VC 2HYZA 3PZ1A 3T5XA 4CDRA 3CSTA 3SFXA 4URKA 3LPZA 3SQVA 5DIZA 2KZTB 1JWFA 3IHVA 3TXMA 2VJ8A 5FQ8A 2L9BA 3AG3E 3ASNE 5T8IA 5KJNA 1MJ0A 2AXZA 4AY6A 3KEAA 3QDNA 2EIJE 3SBSA 3L54A 3V2XA 5CHEE 1V55E 3CIAA 2X3MA 2ZXWE 3CV0A 5BXOA 1TNUA 5BV0A 1JWGA 2UWJG 3ULEG 2V0PA 3ISMC 1H6KA 1QNFA 2F0YA 4HOQA 1HG2A 5LX8A 3SFYA 3ZYQA 2WXLA 1UN8A 1HG5A 2Y3AA 4LERA 4WNFA 1K1BA 3CK7A 4KVMA 4HS2A 4AP2A 1OXJA 3VLDA 4U0SA 3SGHA 3TWTA 3NAWA 3KD7A 3DSVA 4D10C 1JCQA 1S64A 1TJFA 4O1OA 3HVEB 3TL5A 4ZHBA 1HS6A 4I2WA 1TYQG 4QQIA 5D0QD 5LFAA 4GYOA 2BKGA 3SI5A 5KCMA 2KBXA 3U4TA 3D9MA 1D8EA 3UIPC 3FDHA 5EN5D 4Q96A 1KZOA 1BU9A 1MHQA 3UMVA 1HF8A 2NC9A 3ASDA 3ULQA 4NQ0A 3UXGA 2IU1A 2IFUA 3LY8A 2PL2A 2X6HA 2L0TB 5BPPA 2KZTA 2QZAA 2GRRB 3DEPA 4UQZA 1OCZE 3PUJA 2IONA 1QBQA 2H6GA 1NZNA 3HXDA 4CT4A 1S63A 3GZ1A 3LVQE 4UWHA 3CVQA 5ENSD 1INZA 2P9IG 1E8WA 1H6OA 4HRNA 4ANVA 5LCWC 5KNGA 4CT0A 4ATZD 3Q4AB 3IXEA 2XHEA 1KT0A 3E34A 2KCLA 4B8AA 3LDZA 4I6GA 4A1SA 4GZ5A 3MX3A 3CVWA 3DSSA 2DYSE 5ARFA 2FEZA 3SFZA 1SVXA 4WNGA 3FTZA 3Q49B 3S7DA 3ASHA 4GTPA 2XGSA 1NFIE 1HH8A 2I2OA 3AS5A 1Y6IA 3DSUA 4YDEA 1UW4B 5HKPA 2E2EA 4N39A 4MS6A 4TXPA 3MV2B 4NIKA 5ENOD 3P1UA 3QB2A 2M63A 3QC1A 2BKKB 2J8SD 2WVIA 4EZLA 2VSYA 1TN6A 3MKQB 1TNZA 1MX2A 3PZ4A 1G3NB 5A23A 2WQHA 5G55A 4CEMA 4JL0A 4G24A 3NB2A 4A63B 5D0OD 1YMPA 4DX7D 5T4YA 2KXPC 4EECA 3FUIA 4WWNA 1OT8A 1SZAA 3FU6A 1DVPA 4AEZC 3ZHEB 3FUHA 3CVVA 1SQMA 3MV3B 4EBAG 5JMND 2X38A 1UG3A 3SY2A 3UINC 4DX6D 3B95A 3FUEA 2PQNA 4HRMB 2WXIA 4I9EA 2XENA 3ZFWA 3L17A 4HLLA 4AIFA 3UI2A 1OY3D 1TR4A 4L2LA 4FHKA 4DUIA 2MYOA 5CBNA 2WXOA 1U2VG 4GCNA 2ONDA 2WQ6A 5CERB 2C2LA 3X2QE 4GTVA 3HXFA 4W9RA 4Y6CA 4GA0A 4GZCA 3HDXA 5EYLA 4U95D 3BG1B 4ILHB 4RQIA 2IEJA 4DX1A 5AJLA 2GRPB 1E90A 2J9QA 3P2BA 3CK8A 5EX3A 3TXNA 4F7AA 3D9OA 2EILE 1OWPA 5J08A 4GTTA 3JUEA 4H7YA 2EQXA 5DBKA 1Z5SC 4JPSA 4L2YA 1K3ZD 2FULA 2IOLA 1QQEA 2WQ7A 5BUZA 2V5QC 5HQ8A 3ULYA 3ZYKA 4AVXA 1N9AA 2AVPA 4F53A 4BX8A 4O1PA 3EHMA 2PNNA 3ZXPA 4U0UA 4C0MA 4HI9A 2P9LG 1N4QA 3G2VA 2CHZA 4GZ6A 4FC8A 3ASOE 3RIBA 4GA2A 4DLQA 4APOA 4KMOA 4GA1A 5JHBA 3IKOB 3Q47B 1AP7A 1OWNA 4NACA 4N3CA 2CG3A 2V4LA 3LKUA 4GPMA 4WUYA 4XEIG 4IYPA 4OAUC 3UUXA 4N3BA 3D9JA 1P5QA 4AJWA 2BUGA 4KXKB 3L6AA 4DI3A 4FADA 4Q94A 2VTBB 2WXPA 3D9PA 3HIZA 3E30A 3BQOA 5ENNA 3UTMA 3UX4A 5JJTA 3NOCD 1YCSB 3RO2A 4GB9A 2LUHA 4J8EA 5AJDA 5G05J 4WWOA 2P58C 2OVFA 3O48A 1HO8A 2KM4A 4LNUD 1JCSA 3TJPA 3JXIA 2AXVA 3OXGA 4BSXA 4TUUA 3UQ3A 2OEWA 4BWRA 2LAIA 5FIOA 1SW6A 1IHGA 4HI8A 3CVUA 4CCAA 1WM5A 4UUCA 3PREA 2EIKE 3L82A 2WXKA 3GYZA 4V3IA 4RSYA 3SHFA 3PRZA 4M3OA 3RU0A 5FT9A 1BPOA 3E4BA 3S7FA 4UQXA 3FTXA 4JXTA 4OVUA 3ZN3A 4EHMA 2XGMA 2VGEA 3TWXA 4AM9A 3JQ0A 4C9BB 2VGYA 5ENPD 1EYHA 5BNWA 1NA0A 3T9KA 2XRZA 3TG4A 2VGXB 5AIJA 4U07A 4JC8A 2OEVA 3CSFA 3FTSA 5EIDA 4C0EA 3FUJA 4UI9K 2H6IA 2VTBA 4JD2G 2I6HA 3KSQA 3TWRA 2XRYA 2DWZA 3MGBA 1FT1A 3T5VA 2I1JA 4KYOB 2AWIA 4BT9A 5M72A 3EIJA 3BUAA 4G2VA 3FP3A 4PUCA 4CGVA 1X81A 1BI8B 4IRUA 2BF0X 3PUKA 3T8KA 2DBAA 3PDNA 4L23A 4N2QA 3V79K 1TEZA 4GU5A 3E32A
chains in the Genus database with same CATH topology
3LXUX 1SZ9A 3Q5MA 4DI4A 4FLHA 4CT0A 4HLEA 3Q4AB 3ZIMA 2XHEA 1KT0A 1IQUA 5G04J 2VSXE 1Z3YA 2KCLA 3FTYA 3FTWA 3UT7A 3UT8A 4B8AA 5FQ7A 1HE8A 3LDZA 4I6GA 4GYWA 4A1SA 4GZ5A 3MX3A 3PVLA 3CVWA 4FJYA 1OWOA 4A3TA 4J6IA 4LCTA 2DCPA 3LY9A 5ARFA 4ACLA 4ACKA 4Q69A 2FEZA 4J8SA 4ME2A 4JA9A 3SFZA 5EKQD 3D3MA 1L5JA 3FU5A 2A5UA 3VLEA 4WNGA 3FTZA 3Q49B 3S7DA 2L0IA 3ASHA 2AXUA 2X6FA 3QK0A 3SD5A 4JHRA 2XGSA 3SNXA 4B8CB 3APCA 3CHRA 1HZ4A 4EZKA 4U8HA 3FTUA 5E75A 2Q7FA 1HH8A 2I2OA 3AS5A 1Y6IA 4HOTA 4PS8A 5C1DA 4LUNU 4G25A 2CFUA 2XPIA 3OAWA 4EPZA 1UW4B 1E8ZA 3PNTB 3GZ2A 2E2EA 4N39A 3D9KA 4AXHA 3APDA 4I6JA 4JZYA 1UN9A 3U66A 4EZJA 4J8DA 5E76A 3PS6A 4MS6A 4N2SA 4E6HA 3MV2B 3MKQA 2CHWA 5CMWA 4G26A 3P1UA 2RG8A 4ILGA 5CMYA 5JJ6A 2ILRA 3NF1A 3QB2A 5FZQA 3ASGA 5T3RA 4JVSA 3FU3A 5HI7A 1DNPA 1E7UA 2UY1B 4RG9A 5JHAA 4OYSA 2M63A 3IBEA 4HOUA 2WXNA 3QWPA 3QC1A 3RK6A 3I4GA 4DJAA 3FUMA 4EZLA 2WVIA 2OV8A 2VSYA 2VGXA 2J49A 3MKQB 4EBAA 2IQCA 2KC7A 4H7XA 4B89A 3FWVA 3CEQA 3RO3A 4GMJA 4LEUA 4ANXA 5A23A 3ONKA 3RKVA 4ILIA 5BW8C 2LSVA 3K9IA 3BEEA 4XE0A 4EQFA 2WQHA 5G55A 3APFA 4CEMA 1N52A 3B13A 4JL0A 4G24A 3EHNA 4JEHA 3ZHEA 2A4ZA 3PZDA 3VTYA 3QAQA 3L13A 4KT6B 3LCAA 3CVNA 5D0OD 4NRHB 3MCXA 2C0MA 2J07A 4MRUA 3TAXA 3RRNB 4UI9J 4KVOA 5T4YA 4EECA 3FUIA 2GW1A 4WWNA 1WAO1 3EJNA 3CGHA 1SZAA 3FU6A 1DVPA 1H2TC 3KS2A 4WWPA 3ZHEB 4JW1A 4XX5A 4AEZC 3FUHA 3CVVA 1SQMA 4HORA 3CVYA 1ELWA 4I2ZA 3MV3B 2WPVA 2CHXA 1H2UA 3MA5A 4XKCA 4EBAG 5FQ6A 5G05C 2FF4A 2WXMA 1OUVA 3OTNA 5EDSA 4IN3B 2C0LA 2YNQA 1X5BA 2X38A 3U64A 3FUDA 1UG3A 3GZSA 3LVRE 4I1OB 5JJ7A 3QARA 3AU4A 3JCKC 3TG5A 3KEZA 3FUEA 1MQSA 3FH7A 3U3WA 2YHCA 2PQNA 3QWVA 3FHEA 3ZRHA 3ESKA 3S2AA 3QKYA 4HXIA 2WXHA 4MKTA 4YVOA 2WXIA 2XPZA 4GAAA 4I9CA 4I9EA 3B7UX 3BG0B 2R17C 4O6FA 4PS3A 4U04A 3ZFWA 3L17A 2HO1A 2E0IA 2MOWA 2WXJA 2XQ0A 3L16A 4AIFA 2Y4UA 2OVBA 5LP0A 3FU0A 2PM7A 4L2LA 2YINA 4FHKA 1H0AA 2WXOA 3PH0C 1TJCA 2Y4TA 4GCNA 2ONDA 4R7LA 3ZXSA 2I1KA 2LO6A 3D9LA 4TRQA 1JPLA 1S0PA 2WQ6A 1N54A 2C2LA 3CLJA 3ASFA 4BFRA 1FVHA 3TGOA 2QY7A 4W9RA 4Y6CA 4ANWA 2HM8A 1PAQA 3S7BA 1XNFA 5A7DB 3AS4A 2FO7A 2BTDA 2J4BA 3CK9A 4GA0A 1ELKA 3G2WA 3ONLA 4GZCA 3HDXA 4G1TA 3S7JA 2V8SE 3BG1B 3R9AB 4ILHB 3CVLA 3MZLB 4Y6WA 3CQCB 5AJLA 1E90A 2WM9A 1EDUA 3ZW3A 4BTAA 3L22A 3CHOA 1VDYA 5J90A 2J9QA 3CR3A 3P2BA 3ZVVA 3CK8A 5EX3A 2VSOE 3TXNA 4F7AA 2R59A 3D9OA 1OWPA 2UY1A 3PNLB 4DLOA 5J08A 2KATA 4YNDA 3UPVA 2XGOA 5LCWJ 4XI9A 4WAFA 1YA0A 3ML9A 1Y8MA 2J4DA 3FTVA 1Z6TA 4H7YA 2EQXA 5DBKA 1QZ2A 2FI7A 4KZ0A 1ZU2A 5LOZA 3NZUA 4JPSA 4L2YA 1NP7A 2FULA 4ANVA 4CDMA 1E8XA 2IOLA 4I6EA 5CCLA 1QQEA 2WQ7A 5BUZA 5EX0A 1HX8A 2OOEA 4WNEA 4GZDA 2JLBA 3ML8A 3CKBA 4A1GA 4RVBA 5KJKA 5HQ8A 4FULA 4GMLA 3ZYKA 4FHJA 2LSUA 4AVXA 2ZU6B 2AVPA 3CHQA 4BX8A 1FVFA 4WNDA 3ZPJA 4F1SA 2FBNA 5A6CA 1OWLA 3HYMB 2GRLA 3EHMA 1A17A 2WMNA 3GW4A 3SZ7A 4AY5A 4MLPA 4CRWA 3ENEA 2WXGA 5KJLA 3D9NA 5FZRA 2WXQA 4U0UA 3OXFA 3URZA 3LY7A 4C0MA 3CKCA 2CFZA 2XCBA 2YHEA 3G2VA 1FCHA 1UJJA 2CHZA 2PQRA 3FUKA 2J09A 3DPDA 4GZ6A 4PDXA 4FC8A 3RIBA 4G11A 4GA2A 4DLQA 3VLFA 4APOA 2IF4A 4JEUA 4KMOA 3HHMA 4UWLA 4BTBA 4K03A 5G2NA 5KJMA 4ATGA 3RRUA 4PS7A 4GA1A 1GW6A 1IYGA 3RJVA 4I1MA 3C98A 2J08A 3O4ZA 3ESLA 3LEWA 4J0UA 4U63A 4XKBA 3IKOB 3I3NA 4HVBA 3IEGA 5BT1A 2I9CA 3Q47B 2IJGX 4YVQC 3FEXA 1U3CA 4N3AA 5G04C 1E96B 1Z3XA 3FFLA 4AOFA 1OWNA 3QOUA 2RD0A 4NACA 4N3CA 3B7TA 4NURA 2CG3A 4BY6A 3NQPA 4L7TA 2V4LA 1XGWA 2WMOA 3LKUA 1H2VC 3LS8A 2HYZA 4RG6A 3SBTB 4WUYA 5ANRA 5LFAA 2XEVA 4IYPA 4XIFA 3T5XA 4CDRA 1ZBPA 3CSTA 3G2TA 4HOSA 3FH8A 3UUXA 2LNIA 4N3BA 3UT4A 2VSNA 4URKA 1E7VA 3LPZA 3D9JA 1P5QA 1EF1C 4AJWA 1HXIA 2BUGA 4KXKB 5DIZA 3L6AA 4DI3A 3AS8A 2KZTB 4FADA 1JWFA 3IHVA 3TXMA 2VJ8A 4GYYA 4Q94A 2L6JA 5FQ8A 2L9BA 4B94A 4LRZA 2VTBB 5FTPA 2XCCA 4UWKA 3CVXA 4I17A 2WXPA 5T8IA 5KJNA 2WXFA 3D9PA 3B7RL 2AXZA 4AY6A 4ABNA 3HIZA 3QDNA 1UJKA 5ENNA 3UX4A 2NXPA 1PY1A 5JJTA 2PM6A 4TV3A 3RO2A 2KCKA 3SBSA 2R5SA 4GB9A 3CHPA 3L54A 3ZEFA 3FUNA 5CHEE 4J8EA 5AJDA 2MHKA 5G05J 4WWOA 3CIAA 2P58C 2V5FA 2X3MA 2OVFA 3EIQC 3MYVA 4B0ZA 2MRIA 2PZIA 3CVPA 3O48A 1HO8A 2KM4A 3CV0A 3PE4A 4A55A 4ANUA 5ARGA 3TJPA 5BV0A 1JWGA 2UWJG 3G2UA 2V0PA 2AXVA 3OXGA 1LF8A 1H6KA 4PH4B 4BSXA 4TUUA 1QNFA 3UQ3A 3T8MA 4GCOA 3MJWA 3R7QA 4HOQA 2LAIA 4BWRA 1HG2A 5LX8A 2WB2A 3G2SA 3ZYQA 1IHGA 3CHMA 4F3VA 2WXLA 3D9IA 1UN8A 3CVUA 1HG5A 2Y3AA 4CCAA 1WM5A 2IOSA 4GZ3A 4LERA 3PREA 1WY6A 4WNFA 3B7SA 3CK7A 3JUIA 4KVMA 1KT1A 3HVEA 4KBQA 2QFCA 5ANLA 2WXKA 2XPYA 3GYZA 4V3IA 4HS2A 4UWGA 5FZSA 4RSYA 4AP2A 1HFAA 3VLDA 5FJYA 3IHYA 4UI9C 3FULA 4U0SA 2WXRA 3QNKA 4J8FA 3SGHA 1ELRA 3SHFA 3KD7A 4D10C 3PRZA 4M3OA 1TJFA 4JA7A 3RU0A 3HVEB 1BPOA 5FT9A 3TL5A 3AU5A 4A3VA 3E4BA 4G23A 4P29A 1B89A 2KCVA 3I4RB 1HS6A 4I2WA 3JYSA 5JHBA 3S7FA 4UQXA 4FJZA 3FTXA 5D0QD 3DBSA 4JXTA 4OVUA 3U9WA 4GYOA 4UWFA 3SI5A 3LJ3A 5KCMA 3ZN3A 3ZGQA 3U4TA 2XGMA 3D9MA 5AYWD 3I5PA 5BV1A 4AM9A 3JQ0A 4K0RA 3FDHA 4CDNA 4HFGA 3IV0A 3VTXA 2VGYA 4C9BB 3QJZA 4Q96A 4GPKA 3FUFA 3N71A 2AW6A 4FU3A 1EYHA 5BNWA 1NA0A 2XRZA 1MHQA 4N5CA 3UMVA 3TG4A 3LYAA 3FY4A 3ZYLA 3SF4A 1HF8A 3PE3A 2NC9A 2VGXB 3ASDA 4U07A 2HR2A 3FEYA 1H19A 4JC8A 3R7RA 4NQ0A 3ULQA 5AIJA 3QWWA 2IU1A 3FH5A 4KZCA 1W3BA 2IFUA 3CSFA 3FTSA 3LY8A 2NSZA 2PL2A 2CG2A 4C0EA 2X6JA 4APFA 1EPUA 2X6HA 3NZSA 3OXLA 3RRMB 5AENA 3FUJA 4I43A 4UI9K 2L0TB 4FP7A 5BPPA 2KZTA 3MKRA 3ZYMA 3Q15A 4XI0A 1PC2A 5FWQA 2VTBA 3CQGB 4FA6A 2X6KA 2I6HA 2VYIA 3MEKA 1E8YA 4UQZA 2LAHA 2JEKA 4OVVA 2XRYA 3PUJA 4UQYA 3MGBA 3EDTB 5C2YA 2DIWA 2IONA 1U3DA 4BT8A 1JUQA 3T5VA 2I1JA 4KYOB 4E85A 2AWIA 1NZNA 4BT9A 4DPRA 5M72A 1OWMA 4DK5A 2X6IA 3EIJA 4L1BA 2GRMA 4CT4A 5CCMA 4G2VA 1NA3A 3FP3A 3GZ1A 3LVQE 4FLBA 4I1AA 4PUCA 3CVQA 4U0ZA 4UWHA 4CGVA 3JQ1A 4IRUA 5FQ4A 1INZA 3PEUB 4IULA 2BF0X 1HU3A 3PUKA 1E8WA 2DBAA 2VQ2A 4CGWA 2GGFA 2YQ8A 3PDNA 4L23A 4BX9A 1IQRA 4XZ4A 4N2QA 1KLXA 3WXXA 3CHSA 4JHJA 3PEVB 4AV7A 4JHKA 3KAEA 4QFVA 1TEZA 4GU5A 4F53A 3L08A 5LCWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5M A;  3Q4A B;  1KT0 A;  5G04 J;  2KCL A;  4GYW A;  4A1S A;  4GZ5 A;  5ARF A;  3LY9 A;  2FEZ A;  4ME2 A;  4JA9 A;  5EKQ D;  4WNG A;  3Q49 B;  3S7D A;  3ASH A;  4JHR A;  2XGS A;  1HZ4 A;  2Q7F A;  1HH8 A;  3AS5 A;  4HOT A;  5C1D A;  4G25 A;  2XPI A;  3GZ2 A;  2E2E A;  4N39 A;  4J8D A;  3MV2 B;  4G26 A;  5JJ6 A;  3NF1 A;  5FZQ A;  3ASG A;  5HI7 A;  2UY1 B;  4RG9 A;  4HOU A;  3QWP A;  2VSY A;  2VGX A;  2KC7 A;  4H7X A;  3FWV A;  3CEQ A;  3RO3 A;  4LEU A;  3RKV A;  5BW8 C;  2LSV A;  3K9I A;  3BEE A;  4EQF A;  2WQH A;  4JL0 A;  4G24 A;  3ZHE A;  3VTY A;  3LCA A;  3CVN A;  5D0O D;  4NRH B;  2C0M A;  3TAX A;  4UI9 J;  2GW1 A;  1WAO 1;  3KS2 A;  3ZHE B;  4HOR A;  4I2Z A;  1ELW A;  3MV3 B;  3MA5 A;  2WPV A;  5G05 C;  2FF4 A;  1OUV A;  4IN3 B;  2C0L A;  5JJ7 A;  3TG5 A;  3U3W A;  2YHC A;  2PQN A;  3QWV A;  3ESK A;  3QKY A;  4YVO A;  4I9C A;  4I9E A;  4O6F A;  3ZFW A;  4U04 A;  2HO1 A;  4AIF A;  2Y4U A;  1TJC A;  2Y4T A;  4GCN A;  2OND A;  2C2L A;  3ASF A;  3TGO A;  4W9R A;  4Y6C A;  3S7B A;  1XNF A;  5A7D B;  3AS4 A;  2FO7 A;  3CK9 A;  4GA0 A;  4G1T A;  3S7J A;  3R9A B;  3CVL A;  4Y6W A;  4BTA A;  2J9Q A;  3CK8 A;  5EX3 A;  2UY1 A;  2KAT A;  4YND A;  3UPV A;  2XGO A;  5LCW J;  4XI9 A;  1YA0 A;  1Y8M A;  4H7Y A;  5DBK A;  1QZ2 A;  2FI7 A;  1ZU2 A;  5CCL A;  1QQE A;  5EX0 A;  2OOE A;  4WNE A;  2JLB A;  3CKB A;  5KJK A;  5HQ8 A;  2LSU A;  2AVP A;  3ZPJ A;  4WND A;  2FBN A;  5A6C A;  3HYM B;  1A17 A;  3SZ7 A;  3GW4 A;  4AY5 A;  5KJL A;  5FZR A;  4U0U A;  3OXF A;  3URZ A;  3LY7 A;  3CKC A;  2XCB A;  1FCH A;  2PQR A;  4GZ6 A;  3RIB A;  4GA2 A;  4APO A;  2IF4 A;  4BTB A;  5KJM A;  4GA1 A;  1IYG A;  3RJV A;  4J0U A;  5BT1 A;  3IEG A;  3Q47 B;  4YVQ C;  4N3A A;  5G04 C;  1E96 B;  3FFL A;  3QOU A;  4N3C A;  3LKU A;  2HYZ A;  4RG6 A;  4WUY A;  2XEV A;  4XIF A;  4CDR A;  1ZBP A;  4HOS A;  3UUX A;  2LNI A;  4N3B A;  2VSN A;  3LPZ A;  1P5Q A;  1HXI A;  2BUG A;  4KXK B;  5DIZ A;  3AS8 A;  4GYY A;  2L6J A;  4B94 A;  5FTP A;  2XCC A;  4I17 A;  5KJN A;  4AY6 A;  4ABN A;  3QDN A;  5JJT A;  3RO2 A;  2KCK A;  2R5S A;  5CHE E;  4J8E A;  2MHK A;  5G05 J;  2P58 C;  2V5F A;  2PZI A;  3CVP A;  3O48 A;  3CV0 A;  3PE4 A;  5ARG A;  2UWJ G;  3OXG A;  3UQ3 A;  4GCO A;  4BWR A;  4HOQ A;  1IHG A;  4F3V A;  1WM5 A;  4GZ3 A;  4WNF A;  3CK7 A;  1KT1 A;  4KBQ A;  2QFC A;  3GYZ A;  5FZS A;  5FJY A;  4UI9 C;  4U0S A;  4J8F A;  1ELR A;  3KD7 A;  4JA7 A;  3RU0 A;  5FT9 A;  3E4B A;  4G23 A;  1B89 A;  2KCV A;  4I2W A;  3JYS A;  3S7F A;  4UQX A;  5D0Q D;  3ZGQ A;  4GYO A;  3ZN3 A;  3U4T A;  2XGM A;  5AYW D;  4AM9 A;  3VTX A;  2VGY A;  4GPK A;  3N71 A;  5BNW A;  1NA0 A;  4N5C A;  3TG4 A;  3LYA A;  3SF4 A;  3PE3 A;  2NC9 A;  2VGX B;  3ASD A;  4U07 A;  2HR2 A;  3ULQ A;  4NQ0 A;  3QWW A;  4N2S A;  1W3B A;  2IFU A;  3LY8 A;  2PL2 A;  3OXL A;  4UI9 K;  3MKR A;  3Q15 A;  4XI0 A;  1PC2 A;  2I6H A;  2VYI A;  3MEK A;  4UQZ A;  4UQY A;  3EDT B;  4BT8 A;  4KYO B;  1NZN A;  4BT9 A;  5M72 A;  5CCM A;  4G2V A;  1NA3 A;  3FP3 A;  3GZ1 A;  4CGV A;  4I1A A;  3CVQ A;  4U0Z A;  2DBA A;  2VQ2 A;  4CGW A;  3PDN A;  2YQ8 A;  4N2Q A;  1KLX A;  3WXX A;  3KAE A;  5LCW C; 
#chains in the Genus database with same CATH topology
 3LXU X;  3Q79 A;  3FTY A;  3FTW A;  3UT7 A;  3UT8 A;  5FQ7 A;  5FIN A;  4GYW A;  2Y1L E;  1UOH A;  3LY9 A;  4ACK A;  4ME2 A;  1BLX B;  2A5U A;  3SD5 A;  1FT2 A;  3ZNG A;  2DYR E;  4JHR A;  4K5B A;  3CHR A;  3UKU G;  4U8H A;  5E75 A;  2Q7F A;  2XEE A;  3TWV A;  3OAW A;  1TN7 A;  3PNT B;  3GZ2 A;  2DZN A;  4I6J A;  3U66 A;  1N11 A;  4TXQ A;  4EZJ A;  5D2M C;  5JJ6 A;  2RG8 A;  5T3R A;  1K1A A;  2JAB A;  3FU3 A;  1DNP A;  3IBE A;  2OV8 A;  2VGX A;  2J49 A;  5ENT D;  4H7X A;  4B89 A;  4B93 B;  3FWV A;  3CEQ A;  4LEU A;  3V31 A;  5HS0 A;  4DX5 D;  3ONK A;  4U8Y D;  5BW8 C;  1K8K G;  2QC9 A;  3EHN A;  3HXC A;  3Q75 A;  4NRH B;  3V2O A;  3MCX A;  5ENQ D;  4UI9 J;  2GW1 A;  1SA4 A;  3CGH A;  4GTS A;  4JW1 A;  4XX5 A;  5JA4 D;  4HOR A;  1ELW A;  4I2Z A;  2CHX A;  2WPV A;  3MA5 A;  5FQ6 A;  2WXM A;  1OUV A;  4TUM A;  3GZS A;  5JJ7 A;  3JCK C;  3KEZ A;  2DVW A;  5B3S E;  4PS3 A;  4U04 A;  2B6C A;  2MOW A;  2OVB A;  2YIN A;  1TNO A;  3EHQ A;  4R7L A;  3DXM G;  1S0P A;  1N54 A;  3CLJ A;  3Q7F A;  4YDY A;  3TGO A;  1N94 A;  1PAQ A;  2P9P G;  3S7B A;  2FO7 A;  2BTD A;  3CK9 A;  3Q9U C;  1ELK A;  3MZL B;  1N0Q A;  5D66 A;  2WM9 A;  1EDU A;  4BTA A;  3UKR G;  1VDY A;  2R59 A;  1V54 E;  4DLO A;  1D8D A;  4CZ2 D;  3UPV A;  3E33 A;  3RAU A;  2J4D A;  1NP7 A;  1E8X A;  4I6E A;  3DPY A;  5EX0 A;  1HX8 A;  4WNE A;  4BER A;  4LG6 A;  4RVB A;  5KJK A;  5H7P A;  3EHR A;  4GML A;  1FVF A;  4WND A;  4F1S A;  2FBN A;  2HE0 A;  3GW4 A;  4AY5 A;  4CRW A;  5KJL A;  4K5A B;  3LY7 A;  3CKC A;  2CFZ A;  2YHE A;  1UJJ A;  2PQR A;  1RZ4 A;  5AAO A;  5CEC B;  1S70 B;  4BEP A;  4K03 A;  4ATG A;  1GW6 A;  1IYG A;  4I1M A;  4U63 A;  3C98 A;  4J0U A;  2IJG X;  4YVQ C;  1U3C A;  4GTR A;  4N3A A;  1E96 B;  1N4P A;  4BY6 A;  3NQP A;  1DCQ A;  3LS8 A;  2XEV A;  1MX6 A;  3G2T A;  3FH8 A;  2LNI A;  3UT4 A;  1E7V A;  1EF1 C;  4HBD A;  3AS8 A;  2L6J A;  4B94 A;  4LRZ A;  5FTP A;  2XCC A;  4UWK A;  3CVX A;  3B7R L;  3C3R A;  1UJK A;  2NXP A;  1ZB1 A;  2PM6 A;  4F1P A;  2KCK A;  2P2C P;  3CHP A;  3EU5 A;  1O5M A;  1QYM A;  5AQA A;  3EIQ C;  4B0Z A;  3J5P A;  2MRI A;  3WG7 E;  4A55 A;  1LD8 A;  3L9T A;  4PH4 B;  3MJW A;  3R7Q A;  1D9S A;  4DX2 A;  2WB2 A;  2BED A;  5AQB A;  3G2S A;  3CHM A;  4F3V A;  3D9I A;  1LD7 A;  5KNH D;  3B7S A;  3JUI A;  1KT1 A;  4KBQ A;  5ANL A;  1BI7 B;  1OCR E;  1MYO A;  1HFA A;  3IHY A;  3FUL A;  4RLY A;  1ELR A;  4YDW A;  4GTO A;  3ABL E;  4A3V A;  4G23 A;  1JCR A;  1B89 A;  2Y69 E;  3U9W A;  4U96 D;  3LJ3 A;  2R05 A;  5BV1 A;  4CDN A;  3VTX A;  3QJZ A;  4GPK A;  4N5C A;  3FY4 A;  3SF4 A;  3AAA C;  3PE3 A;  3R7R A;  3FEY A;  5AAR A;  3AJI A;  1H6P A;  4KZC A;  1W3B A;  2IO3 C;  2NSZ A;  2H6F A;  4APF A;  3NZS A;  5AEN A;  4FP7 A;  3MKR A;  3ZYM A;  5FWQ A;  3PZ2 A;  2VYI A;  3MEK A;  1E8Y A;  2JEK A;  4UQY A;  2DIW A;  4BT8 A;  1U3D A;  1JUQ A;  1O1R A;  1WG0 A;  2GRO B;  2X6I A;  4DK5 A;  2GRM A;  5CCM A;  3UM1 A;  4FLB A;  4I1A A;  4U0Z A;  5FQ4 A;  3EU9 A;  4IUL A;  1HU3 A;  3UM0 A;  2VQ2 A;  4CGW A;  2GGF A;  2YQ8 A;  4BX9 A;  3DST A;  4XZ4 A;  1KLX A;  3WXX A;  3AG4 E;  3Q7A A;  1IHB A;  3KAE A;  3L08 A;  1SZ9 A;  3Q5M A;  4FLH A;  4HLE A;  3C72 A;  1IQU A;  5G04 J;  1Z3Y A;  2RKK A;  2GRQ B;  4FJY A;  4A3T A;  2DCP A;  4ACL A;  1OCC E;  4U8V D;  2ETA A;  2DZO A;  3V30 A;  5EKQ D;  3D3M A;  5CEA A;  2L0I A;  2AXU A;  3QK0 A;  4TXR A;  3SNX A;  4B8C B;  2RFM A;  2F37 A;  3FTU A;  4HOT A;  3ABK E;  5C1D A;  4G25 A;  2CFU A;  4EPZ A;  2R2L A;  3D9K A;  3APD A;  4JZY A;  1UN9 A;  5E76 A;  3PS6 A;  2CHW A;  5CMW A;  4ILG A;  5CMY A;  2ILR A;  2RFA A;  3NF1 A;  5FZQ A;  3ASG A;  5HI7 A;  5AQ7 A;  1E7U A;  5JHA A;  1N4S A;  4HOU A;  3QWP A;  1IXV A;  4EBA A;  3HXB A;  2ZIS A;  2XEH A;  3PZ3 A;  3RKV A;  3K9I A;  3BEE A;  4XE0 A;  4HNA D;  2A4Z A;  3PZD A;  4K5C A;  3QAQ A;  3L13 A;  4KT6 B;  2J07 A;  4MRU A;  3RRN B;  4KVO A;  1WAO 1;  3EJN A;  4WWP A;  1H2T C;  2EIM E;  5G05 C;  3OTN A;  5EDS A;  3W9G A;  1X5B A;  4I1O B;  3TWW A;  5EIL A;  3TG5 A;  3U3W A;  3FH7 A;  2YHC A;  3ZRH A;  3ESK A;  3S2A A;  3QKY A;  2XS8 A;  4J8Y A;  4MKT A;  4GAA A;  2XPZ A;  4I9C A;  3B7U X;  2R17 C;  3UIO C;  2GRN B;  2XQ0 A;  3UM2 A;  3L16 A;  3TWU A;  2Y4U A;  5LP0 A;  2PM7 A;  2FO1 E;  2Y4T A;  3ZXS A;  2I1K A;  3D9L A;  2ETB A;  3ASF A;  3Q78 A;  3R9M A;  4OAV B;  4DRX E;  2QY7 A;  2B0O E;  1KPS B;  1XNF A;  3C3Q A;  3J5Q B;  3ONL A;  4G1T A;  2P9N G;  2F8X K;  2V8S E;  4O60 A;  4Y6W A;  3CQC B;  5CBO A;  1DCE A;  3L22 A;  3CHO A;  2F8Y A;  3JXJ A;  5J90 A;  2VSO E;  3PNL B;  4YND A;  5LCW J;  4XI9 A;  4WAF A;  1Z6T A;  1QZ2 A;  5LOZ A;  4KZ0 A;  4G8K A;  2LXL A;  2OOE A;  4GZD A;  3ML8 A;  3CKB A;  2XZT G;  4A1G A;  5CED B;  2ZU6 B;  3ZPJ A;  5A6C A;  1OWL A;  2WMN A;  4Z68 A;  4MLP A;  2WXG A;  3D9N A;  5FZR A;  4L9P A;  3OXF A;  2XCB A;  1FCH A;  1AWC B;  3FUK A;  1TNY A;  2IF4 A;  4JEU A;  4BTB A;  5G2N A;  3RRU A;  4PS7 A;  3DSW A;  3NOG D;  3ABM E;  3O4Z A;  4HVB A;  3IEG A;  3FEX A;  1Z3X A;  4AOF A;  3FFL A;  2L6B A;  3QOU A;  2RD0 A;  4NUR A;  3B7T A;  3SBT B;  4RG6 A;  5ANR A;  4XIF A;  1ZBP A;  4HOS A;  2VSN A;  2OCC E;  5HRY A;  2ZGG A;  1HXI A;  2QYJ A;  4GYY A;  1FPP A;  5EIB E;  4I17 A;  2WXF A;  4ABN A;  4F6R D;  1IKN D;  1PY1 A;  4TV3 A;  2R5S A;  3ZEF A;  3FUN A;  3HXE A;  2MHK A;  2V5F A;  3MYV A;  2PZI A;  3CVP A;  3PE4 A;  4ANU A;  5ARG A;  1O1S A;  3G2U A;  1SA5 A;  1LF8 A;  3ZU7 B;  4LSZ E;  3T8M A;  4GCO A;  4J7W A;  1TNB A;  5AN8 A;  1DC2 A;  3AG1 E;  4MBG A;  2IOS A;  4GZ3 A;  1WY6 A;  1N0R A;  3HVE A;  2QFC A;  2XPY A;  5FZS A;  4UWG A;  5FJY A;  2IO2 C;  4UI9 C;  3AG2 E;  2WXR A;  3QNK A;  4J8F A;  1A5E A;  4BES A;  4JA7 A;  3AU5 A;  2ETC A;  4P29 A;  2KCV A;  3I4R B;  4GTM A;  3JYS A;  4FJZ A;  3DBS A;  3ZGQ A;  2R03 A;  4UWF A;  5AYW D;  3I5P A;  4K0R A;  3C5R A;  4HFG A;  3IV0 A;  1YYH A;  3FUF A;  3N71 A;  2AW6 A;  4FU3 A;  3DWL G;  2EIN E;  4GMR A;  3LYA A;  3ZYL A;  2HR2 A;  1H19 A;  5AQ9 A;  3QWW A;  4N2S A;  2P9K G;  3FH5 A;  2CG2 A;  3RSE G;  2X6J A;  1EPU A;  5IY5 E;  3OXL A;  5KWD A;  3RRM B;  4I43 A;  3F6Q A;  5BXU A;  3Q15 A;  4XI0 A;  1PC2 A;  3CQG B;  4FA6 A;  2X6K A;  2LAH A;  3LJN A;  4OVV A;  3EDT B;  5C2Y A;  4C48 B;  2QYU A;  4E85 A;  4DPR A;  4HQD A;  1OWM A;  4L1B A;  3Q9N C;  1NA3 A;  3JQ1 A;  3PEU B;  5KBA A;  2AJA A;  3BU8 A;  1KZP A;  1IQR A;  3CHS A;  4JHJ A;  3PEV B;  4AV7 A;  4JHK A;  4QFV A;  1RW2 A;  4DI4 A;  3ZIM A;  4G8L A;  2VSX E;  4U7E B;  1HE8 A;  1OCO E;  3PVL A;  1OWO A;  4J6I A;  4LCT A;  4Q69 A;  4J8S A;  3Q73 A;  4JA9 A;  3TWQ A;  1L5J A;  3FU5 A;  4HB5 A;  3TWS A;  3VLE A;  2X6F A;  3APC A;  2NYJ A;  1HZ4 A;  4EZK A;  3ZUV B;  4PS8 A;  4LUN U;  2XPI A;  2XS1 A;  1E8Z A;  1NL4 A;  4BSZ B;  4AXH A;  4J8D A;  1WDY A;  4E6H A;  3MKQ A;  3EUV A;  4G26 A;  4M7C A;  3SO8 A;  4JVS A;  5B1B E;  2UY1 B;  4RG9 A;  4OYS A;  2Y0B G;  2WXN A;  4DJA A;  3RK6 A;  3I4G A;  3FUM A;  2IQC A;  2KC7 A;  3KSL A;  3RO3 A;  4GMJ A;  3HG0 D;  4ANX A;  2R02 A;  4ILI A;  2LSV A;  3DEO A;  4EQF A;  3APF A;  1N52 A;  3B13 A;  4JEH A;  3ZHE A;  4LNG A;  3D9H A;  3VTY A;  2LXM A;  3LCA A;  3CVN A;  5EYP F;  2C0M A;  2V4H C;  3TAX A;  3KS2 A;  3C3O A;  3CVY A;  4XKC A;  1H2U A;  2FF4 A;  4JB8 P;  2ZGD A;  4IN3 B;  2C0L A;  2YNQ A;  3U64 A;  3FUD A;  3LVR E;  3QAR A;  3AU4 A;  1MQS A;  3QWV A;  3DSX A;  3FHE A;  4HXI A;  2WXH A;  5CRU A;  4YVO A;  3BG0 B;  4CYM D;  4O6F A;  2HO1 A;  2E0I A;  2WXJ A;  3ZKJ A;  3E37 A;  3FU0 A;  1H0A A;  3PH0 C;  5CRV A;  1TJC A;  4LNB A;  4TRQ A;  2LO6 A;  1JPL A;  4BFR A;  1FVH A;  4BET A;  5ITZ F;  4ANW A;  3NBN B;  2HM8 A;  3DXK G;  5A7D B;  2IY0 C;  3AS4 A;  2J4B A;  1N95 A;  1NI1 A;  3G2W A;  2XZD G;  3S7J A;  3R9A B;  3CVL A;  4X8Q A;  4ZFH A;  3B7B A;  3ZW3 A;  3CR3 A;  3ZVV A;  2UY1 A;  5B1A E;  2P9U G;  2KAT A;  2XGO A;  1BD8 A;  1N4R A;  1YA0 A;  3ML9 A;  1Y8M A;  3FTV A;  2FI7 A;  1ZU2 A;  3NZU A;  4CDM A;  5CCL A;  3W9F A;  4GTQ A;  2H6H A;  3UM3 A;  2JLB A;  4FUL A;  4FHJ A;  2LSU A;  4HRL A;  3CHQ A;  4N5Q A;  1O1T A;  3HYM B;  2GRL A;  3HRA A;  4YDO A;  1A17 A;  3SZ7 A;  3ENE A;  2WXQ A;  3URZ A;  2J09 A;  3DPD A;  4PDX A;  1MZC A;  4G11 A;  2A5E A;  3VLF A;  3DRA A;  3HHM A;  4UWL A;  2P9S G;  5KJM A;  3RJV A;  1Q2Z A;  2J08 A;  1TN8 A;  3ESL A;  3LEW A;  4XKB A;  5BT1 A;  3I3N A;  2I9C A;  1MX4 A;  5ENR D;  2ZIR A;  5G04 C;  4L7T A;  1LTX A;  1XGW A;  2WMO A;  1H2V C;  2HYZ A;  3PZ1 A;  3T5X A;  4CDR A;  3CST A;  3SFX A;  4URK A;  3LPZ A;  3SQV A;  5DIZ A;  2KZT B;  1JWF A;  3IHV A;  3TXM A;  2VJ8 A;  5FQ8 A;  2L9B A;  3AG3 E;  3ASN E;  5T8I A;  5KJN A;  1MJ0 A;  2AXZ A;  4AY6 A;  3KEA A;  3QDN A;  2EIJ E;  3SBS A;  3L54 A;  3V2X A;  5CHE E;  1V55 E;  3CIA A;  2X3M A;  2ZXW E;  3CV0 A;  5BXO A;  1TNU A;  5BV0 A;  1JWG A;  2UWJ G;  3ULE G;  2V0P A;  3ISM C;  1H6K A;  1QNF A;  2F0Y A;  4HOQ A;  1HG2 A;  5LX8 A;  3SFY A;  3ZYQ A;  2WXL A;  1UN8 A;  1HG5 A;  2Y3A A;  4LER A;  4WNF A;  1K1B A;  3CK7 A;  4KVM A;  4HS2 A;  4AP2 A;  1OXJ A;  3VLD A;  4U0S A;  3SGH A;  3TWT A;  3NAW A;  3KD7 A;  3DSV A;  4D10 C;  1JCQ A;  1S64 A;  1TJF A;  4O1O A;  3HVE B;  3TL5 A;  4ZHB A;  1HS6 A;  4I2W A;  1TYQ G;  4QQI A;  5D0Q D;  5LFA A;  4GYO A;  2BKG A;  3SI5 A;  5KCM A;  2KBX A;  3U4T A;  3D9M A;  1D8E A;  3UIP C;  3FDH A;  5EN5 D;  4Q96 A;  1KZO A;  1BU9 A;  1MHQ A;  3UMV A;  1HF8 A;  2NC9 A;  3ASD A;  3ULQ A;  4NQ0 A;  3UXG A;  2IU1 A;  2IFU A;  3LY8 A;  2PL2 A;  2X6H A;  2L0T B;  5BPP A;  2KZT A;  2QZA A;  2GRR B;  3DEP A;  4UQZ A;  1OCZ E;  3PUJ A;  2ION A;  1QBQ A;  2H6G A;  1NZN A;  3HXD A;  4CT4 A;  1S63 A;  3GZ1 A;  3LVQ E;  4UWH A;  3CVQ A;  5ENS D;  1INZ A;  2P9I G;  1E8W A;  1H6O A;  4HRN A;  4ANV A;  5LCW C;  5KNG A;  4CT0 A;  4ATZ D;  3Q4A B;  3IXE A;  2XHE A;  1KT0 A;  3E34 A;  2KCL A;  4B8A A;  3LDZ A;  4I6G A;  4A1S A;  4GZ5 A;  3MX3 A;  3CVW A;  3DSS A;  2DYS E;  5ARF A;  2FEZ A;  3SFZ A;  1SVX A;  4WNG A;  3FTZ A;  3Q49 B;  3S7D A;  3ASH A;  4GTP A;  2XGS A;  1NFI E;  1HH8 A;  2I2O A;  3AS5 A;  1Y6I A;  3DSU A;  4YDE A;  1UW4 B;  5HKP A;  2E2E A;  4N39 A;  4MS6 A;  4TXP A;  3MV2 B;  4NIK A;  5ENO D;  3P1U A;  3QB2 A;  2M63 A;  3QC1 A;  2BKK B;  2J8S D;  2WVI A;  4EZL A;  2VSY A;  1TN6 A;  3MKQ B;  1TNZ A;  1MX2 A;  3PZ4 A;  1G3N B;  5A23 A;  2WQH A;  5G55 A;  4CEM A;  4JL0 A;  4G24 A;  3NB2 A;  4A63 B;  5D0O D;  1YMP A;  4DX7 D;  5T4Y A;  2KXP C;  4EEC A;  3FUI A;  4WWN A;  1OT8 A;  1SZA A;  3FU6 A;  1DVP A;  4AEZ C;  3ZHE B;  3FUH A;  3CVV A;  1SQM A;  3MV3 B;  4EBA G;  5JMN D;  2X38 A;  1UG3 A;  3SY2 A;  3UIN C;  4DX6 D;  3B95 A;  3FUE A;  2PQN A;  4HRM B;  2WXI A;  4I9E A;  2XEN A;  3ZFW A;  3L17 A;  4HLL A;  4AIF A;  3UI2 A;  1OY3 D;  1TR4 A;  4L2L A;  4FHK A;  4DUI A;  2MYO A;  5CBN A;  2WXO A;  1U2V G;  4GCN A;  2OND A;  2WQ6 A;  5CER B;  2C2L A;  3X2Q E;  4GTV A;  3HXF A;  4W9R A;  4Y6C A;  4GA0 A;  4GZC A;  3HDX A;  5EYL A;  4U95 D;  3BG1 B;  4ILH B;  4RQI A;  2IEJ A;  4DX1 A;  5AJL A;  2GRP B;  1E90 A;  2J9Q A;  3P2B A;  3CK8 A;  5EX3 A;  3TXN A;  4F7A A;  3D9O A;  2EIL E;  1OWP A;  5J08 A;  4GTT A;  3JUE A;  4H7Y A;  2EQX A;  5DBK A;  1Z5S C;  4JPS A;  4L2Y A;  1K3Z D;  2FUL A;  2IOL A;  1QQE A;  2WQ7 A;  5BUZ A;  2V5Q C;  5HQ8 A;  3ULY A;  3ZYK A;  4AVX A;  1N9A A;  2AVP A;  4F53 A;  4BX8 A;  4O1P A;  3EHM A;  2PNN A;  3ZXP A;  4U0U A;  4C0M A;  4HI9 A;  2P9L G;  1N4Q A;  3G2V A;  2CHZ A;  4GZ6 A;  4FC8 A;  3ASO E;  3RIB A;  4GA2 A;  4DLQ A;  4APO A;  4KMO A;  4GA1 A;  5JHB A;  3IKO B;  3Q47 B;  1AP7 A;  1OWN A;  4NAC A;  4N3C A;  2CG3 A;  2V4L A;  3LKU A;  4GPM A;  4WUY A;  4XEI G;  4IYP A;  4OAU C;  3UUX A;  4N3B A;  3D9J A;  1P5Q A;  4AJW A;  2BUG A;  4KXK B;  3L6A A;  4DI3 A;  4FAD A;  4Q94 A;  2VTB B;  2WXP A;  3D9P A;  3HIZ A;  3E30 A;  3BQO A;  5ENN A;  3UTM A;  3UX4 A;  5JJT A;  3NOC D;  1YCS B;  3RO2 A;  4GB9 A;  2LUH A;  4J8E A;  5AJD A;  5G05 J;  4WWO A;  2P58 C;  2OVF A;  3O48 A;  1HO8 A;  2KM4 A;  4LNU D;  1JCS A;  3TJP A;  3JXI A;  2AXV A;  3OXG A;  4BSX A;  4TUU A;  3UQ3 A;  2OEW A;  4BWR A;  2LAI A;  5FIO A;  1SW6 A;  1IHG A;  4HI8 A;  3CVU A;  4CCA A;  1WM5 A;  4UUC A;  3PRE A;  2EIK E;  3L82 A;  2WXK A;  3GYZ A;  4V3I A;  4RSY A;  3SHF A;  3PRZ A;  4M3O A;  3RU0 A;  5FT9 A;  1BPO A;  3E4B A;  3S7F A;  4UQX A;  3FTX A;  4JXT A;  4OVU A;  3ZN3 A;  4EHM A;  2XGM A;  2VGE A;  3TWX A;  4AM9 A;  3JQ0 A;  4C9B B;  2VGY A;  5ENP D;  1EYH A;  5BNW A;  1NA0 A;  3T9K A;  2XRZ A;  3TG4 A;  2VGX B;  5AIJ A;  4U07 A;  4JC8 A;  2OEV A;  3CSF A;  3FTS A;  5EID A;  4C0E A;  3FUJ A;  4UI9 K;  2H6I A;  2VTB A;  4JD2 G;  2I6H A;  3KSQ A;  3TWR A;  2XRY A;  2DWZ A;  3MGB A;  1FT1 A;  3T5V A;  2I1J A;  4KYO B;  2AWI A;  4BT9 A;  5M72 A;  3EIJ A;  3BUA A;  4G2V A;  3FP3 A;  4PUC A;  4CGV A;  1X81 A;  1BI8 B;  4IRU A;  2BF0 X;  3PUK A;  3T8K A;  2DBA A;  3PDN A;  4L23 A;  4N2Q A;  3V79 K;  1TEZ A;  4GU5 A;  3E32 A; 
#chains in the Genus database with same CATH homology
 3LXU X;  1SZ9 A;  3Q5M A;  4DI4 A;  4FLH A;  4CT0 A;  4HLE A;  3Q4A B;  3ZIM A;  2XHE A;  1KT0 A;  1IQU A;  5G04 J;  2VSX E;  1Z3Y A;  2KCL A;  3FTY A;  3FTW A;  3UT7 A;  3UT8 A;  4B8A A;  5FQ7 A;  1HE8 A;  3LDZ A;  4I6G A;  4GYW A;  4A1S A;  4GZ5 A;  3MX3 A;  3PVL A;  3CVW A;  4FJY A;  1OWO A;  4A3T A;  4J6I A;  4LCT A;  2DCP A;  3LY9 A;  5ARF A;  4ACL A;  4ACK A;  4Q69 A;  2FEZ A;  4J8S A;  4ME2 A;  4JA9 A;  3SFZ A;  5EKQ D;  3D3M A;  1L5J A;  3FU5 A;  2A5U A;  3VLE A;  4WNG A;  3FTZ A;  3Q49 B;  3S7D A;  2L0I A;  3ASH A;  2AXU A;  2X6F A;  3QK0 A;  3SD5 A;  4JHR A;  2XGS A;  3SNX A;  4B8C B;  3APC A;  3CHR A;  1HZ4 A;  4EZK A;  4U8H A;  3FTU A;  5E75 A;  2Q7F A;  1HH8 A;  2I2O A;  3AS5 A;  1Y6I A;  4HOT A;  4PS8 A;  5C1D A;  4LUN U;  4G25 A;  2CFU A;  2XPI A;  3OAW A;  4EPZ A;  1UW4 B;  1E8Z A;  3PNT B;  3GZ2 A;  2E2E A;  4N39 A;  3D9K A;  4AXH A;  3APD A;  4I6J A;  4JZY A;  1UN9 A;  3U66 A;  4EZJ A;  4J8D A;  5E76 A;  3PS6 A;  4MS6 A;  4N2S A;  4E6H A;  3MV2 B;  3MKQ A;  2CHW A;  5CMW A;  4G26 A;  3P1U A;  2RG8 A;  4ILG A;  5CMY A;  5JJ6 A;  2ILR A;  3NF1 A;  3QB2 A;  5FZQ A;  3ASG A;  5T3R A;  4JVS A;  3FU3 A;  5HI7 A;  1DNP A;  1E7U A;  2UY1 B;  4RG9 A;  5JHA A;  4OYS A;  2M63 A;  3IBE A;  4HOU A;  2WXN A;  3QWP A;  3QC1 A;  3RK6 A;  3I4G A;  4DJA A;  3FUM A;  4EZL A;  2WVI A;  2OV8 A;  2VSY A;  2VGX A;  2J49 A;  3MKQ B;  4EBA A;  2IQC A;  2KC7 A;  4H7X A;  4B89 A;  3FWV A;  3CEQ A;  3RO3 A;  4GMJ A;  4LEU A;  4ANX A;  5A23 A;  3ONK A;  3RKV A;  4ILI A;  5BW8 C;  2LSV A;  3K9I A;  3BEE A;  4XE0 A;  4EQF A;  2WQH A;  5G55 A;  3APF A;  4CEM A;  1N52 A;  3B13 A;  4JL0 A;  4G24 A;  3EHN A;  4JEH A;  3ZHE A;  2A4Z A;  3PZD A;  3VTY A;  3QAQ A;  3L13 A;  4KT6 B;  3LCA A;  3CVN A;  5D0O D;  4NRH B;  3MCX A;  2C0M A;  2J07 A;  4MRU A;  3TAX A;  3RRN B;  4UI9 J;  4KVO A;  5T4Y A;  4EEC A;  3FUI A;  2GW1 A;  4WWN A;  1WAO 1;  3EJN A;  3CGH A;  1SZA A;  3FU6 A;  1DVP A;  1H2T C;  3KS2 A;  4WWP A;  3ZHE B;  4JW1 A;  4XX5 A;  4AEZ C;  3FUH A;  3CVV A;  1SQM A;  4HOR A;  3CVY A;  1ELW A;  4I2Z A;  3MV3 B;  2WPV A;  2CHX A;  1H2U A;  3MA5 A;  4XKC A;  4EBA G;  5FQ6 A;  5G05 C;  2FF4 A;  2WXM A;  1OUV A;  3OTN A;  5EDS A;  4IN3 B;  2C0L A;  2YNQ A;  1X5B A;  2X38 A;  3U64 A;  3FUD A;  1UG3 A;  3GZS A;  3LVR E;  4I1O B;  5JJ7 A;  3QAR A;  3AU4 A;  3JCK C;  3TG5 A;  3KEZ A;  3FUE A;  1MQS A;  3FH7 A;  3U3W A;  2YHC A;  2PQN A;  3QWV A;  3FHE A;  3ZRH A;  3ESK A;  3S2A A;  3QKY A;  4HXI A;  2WXH A;  4MKT A;  4YVO A;  2WXI A;  2XPZ A;  4GAA A;  4I9C A;  4I9E A;  3B7U X;  3BG0 B;  2R17 C;  4O6F A;  4PS3 A;  4U04 A;  3ZFW A;  3L17 A;  2HO1 A;  2E0I A;  2MOW A;  2WXJ A;  2XQ0 A;  3L16 A;  4AIF A;  2Y4U A;  2OVB A;  5LP0 A;  3FU0 A;  2PM7 A;  4L2L A;  2YIN A;  4FHK A;  1H0A A;  2WXO A;  3PH0 C;  1TJC A;  2Y4T A;  4GCN A;  2OND A;  4R7L A;  3ZXS A;  2I1K A;  2LO6 A;  3D9L A;  4TRQ A;  1JPL A;  1S0P A;  2WQ6 A;  1N54 A;  2C2L A;  3CLJ A;  3ASF A;  4BFR A;  1FVH A;  3TGO A;  2QY7 A;  4W9R A;  4Y6C A;  4ANW A;  2HM8 A;  1PAQ A;  3S7B A;  1XNF A;  5A7D B;  3AS4 A;  2FO7 A;  2BTD A;  2J4B A;  3CK9 A;  4GA0 A;  1ELK A;  3G2W A;  3ONL A;  4GZC A;  3HDX A;  4G1T A;  3S7J A;  2V8S E;  3BG1 B;  3R9A B;  4ILH B;  3CVL A;  3MZL B;  4Y6W A;  3CQC B;  5AJL A;  1E90 A;  2WM9 A;  1EDU A;  3ZW3 A;  4BTA A;  3L22 A;  3CHO A;  1VDY A;  5J90 A;  2J9Q A;  3CR3 A;  3P2B A;  3ZVV A;  3CK8 A;  5EX3 A;  2VSO E;  3TXN A;  4F7A A;  2R59 A;  3D9O A;  1OWP A;  2UY1 A;  3PNL B;  4DLO A;  5J08 A;  2KAT A;  4YND A;  3UPV A;  2XGO A;  5LCW J;  4XI9 A;  4WAF A;  1YA0 A;  3ML9 A;  1Y8M A;  2J4D A;  3FTV A;  1Z6T A;  4H7Y A;  2EQX A;  5DBK A;  1QZ2 A;  2FI7 A;  4KZ0 A;  1ZU2 A;  5LOZ A;  3NZU A;  4JPS A;  4L2Y A;  1NP7 A;  2FUL A;  4ANV A;  4CDM A;  1E8X A;  2IOL A;  4I6E A;  5CCL A;  1QQE A;  2WQ7 A;  5BUZ A;  5EX0 A;  1HX8 A;  2OOE A;  4WNE A;  4GZD A;  2JLB A;  3ML8 A;  3CKB A;  4A1G A;  4RVB A;  5KJK A;  5HQ8 A;  4FUL A;  4GML A;  3ZYK A;  4FHJ A;  2LSU A;  4AVX A;  2ZU6 B;  2AVP A;  3CHQ A;  4BX8 A;  1FVF A;  4WND A;  3ZPJ A;  4F1S A;  2FBN A;  5A6C A;  1OWL A;  3HYM B;  2GRL A;  3EHM A;  1A17 A;  2WMN A;  3GW4 A;  3SZ7 A;  4AY5 A;  4MLP A;  4CRW A;  3ENE A;  2WXG A;  5KJL A;  3D9N A;  5FZR A;  2WXQ A;  4U0U A;  3OXF A;  3URZ A;  3LY7 A;  4C0M A;  3CKC A;  2CFZ A;  2XCB A;  2YHE A;  3G2V A;  1FCH A;  1UJJ A;  2CHZ A;  2PQR A;  3FUK A;  2J09 A;  3DPD A;  4GZ6 A;  4PDX A;  4FC8 A;  3RIB A;  4G11 A;  4GA2 A;  4DLQ A;  3VLF A;  4APO A;  2IF4 A;  4JEU A;  4KMO A;  3HHM A;  4UWL A;  4BTB A;  4K03 A;  5G2N A;  5KJM A;  4ATG A;  3RRU A;  4PS7 A;  4GA1 A;  1GW6 A;  1IYG A;  3RJV A;  4I1M A;  3C98 A;  2J08 A;  3O4Z A;  3ESL A;  3LEW A;  4J0U A;  4U63 A;  4XKB A;  3IKO B;  3I3N A;  4HVB A;  3IEG A;  5BT1 A;  2I9C A;  3Q47 B;  2IJG X;  4YVQ C;  3FEX A;  1U3C A;  4N3A A;  5G04 C;  1E96 B;  1Z3X A;  3FFL A;  4AOF A;  1OWN A;  3QOU A;  2RD0 A;  4NAC A;  4N3C A;  3B7T A;  4NUR A;  2CG3 A;  4BY6 A;  3NQP A;  4L7T A;  2V4L A;  1XGW A;  2WMO A;  3LKU A;  1H2V C;  3LS8 A;  2HYZ A;  4RG6 A;  3SBT B;  4WUY A;  5ANR A;  5LFA A;  2XEV A;  4IYP A;  4XIF A;  3T5X A;  4CDR A;  1ZBP A;  3CST A;  3G2T A;  4HOS A;  3FH8 A;  3UUX A;  2LNI A;  4N3B A;  3UT4 A;  2VSN A;  4URK A;  1E7V A;  3LPZ A;  3D9J A;  1P5Q A;  1EF1 C;  4AJW A;  1HXI A;  2BUG A;  4KXK B;  5DIZ A;  3L6A A;  4DI3 A;  3AS8 A;  2KZT B;  4FAD A;  1JWF A;  3IHV A;  3TXM A;  2VJ8 A;  4GYY A;  4Q94 A;  2L6J A;  5FQ8 A;  2L9B A;  4B94 A;  4LRZ A;  2VTB B;  5FTP A;  2XCC A;  4UWK A;  3CVX A;  4I17 A;  2WXP A;  5T8I A;  5KJN A;  2WXF A;  3D9P A;  3B7R L;  2AXZ A;  4AY6 A;  4ABN A;  3HIZ A;  3QDN A;  1UJK A;  5ENN A;  3UX4 A;  2NXP A;  1PY1 A;  5JJT A;  2PM6 A;  4TV3 A;  3RO2 A;  2KCK A;  3SBS A;  2R5S A;  4GB9 A;  3CHP A;  3L54 A;  3ZEF A;  3FUN A;  5CHE E;  4J8E A;  5AJD A;  2MHK A;  5G05 J;  4WWO A;  3CIA A;  2P58 C;  2V5F A;  2X3M A;  2OVF A;  3EIQ C;  3MYV A;  4B0Z A;  2MRI A;  2PZI A;  3CVP A;  3O48 A;  1HO8 A;  2KM4 A;  3CV0 A;  3PE4 A;  4A55 A;  4ANU A;  5ARG A;  3TJP A;  5BV0 A;  1JWG A;  2UWJ G;  3G2U A;  2V0P A;  2AXV A;  3OXG A;  1LF8 A;  1H6K A;  4PH4 B;  4BSX A;  4TUU A;  1QNF A;  3UQ3 A;  3T8M A;  4GCO A;  3MJW A;  3R7Q A;  4HOQ A;  2LAI A;  4BWR A;  1HG2 A;  5LX8 A;  2WB2 A;  3G2S A;  3ZYQ A;  1IHG A;  3CHM A;  4F3V A;  2WXL A;  3D9I A;  1UN8 A;  3CVU A;  1HG5 A;  2Y3A A;  4CCA A;  1WM5 A;  2IOS A;  4GZ3 A;  4LER A;  3PRE A;  1WY6 A;  4WNF A;  3B7S A;  3CK7 A;  3JUI A;  4KVM A;  1KT1 A;  3HVE A;  4KBQ A;  2QFC A;  5ANL A;  2WXK A;  2XPY A;  3GYZ A;  4V3I A;  4HS2 A;  4UWG A;  5FZS A;  4RSY A;  4AP2 A;  1HFA A;  3VLD A;  5FJY A;  3IHY A;  4UI9 C;  3FUL A;  4U0S A;  2WXR A;  3QNK A;  4J8F A;  3SGH A;  1ELR A;  3SHF A;  3KD7 A;  4D10 C;  3PRZ A;  4M3O A;  1TJF A;  4JA7 A;  3RU0 A;  3HVE B;  1BPO A;  5FT9 A;  3TL5 A;  3AU5 A;  4A3V A;  3E4B A;  4G23 A;  4P29 A;  1B89 A;  2KCV A;  3I4R B;  1HS6 A;  4I2W A;  3JYS A;  5JHB A;  3S7F A;  4UQX A;  4FJZ A;  3FTX A;  5D0Q D;  3DBS A;  4JXT A;  4OVU A;  3U9W A;  4GYO A;  4UWF A;  3SI5 A;  3LJ3 A;  5KCM A;  3ZN3 A;  3ZGQ A;  3U4T A;  2XGM A;  3D9M A;  5AYW D;  3I5P A;  5BV1 A;  4AM9 A;  3JQ0 A;  4K0R A;  3FDH A;  4CDN A;  4HFG A;  3IV0 A;  3VTX A;  2VGY A;  4C9B B;  3QJZ A;  4Q96 A;  4GPK A;  3FUF A;  3N71 A;  2AW6 A;  4FU3 A;  1EYH A;  5BNW A;  1NA0 A;  2XRZ A;  1MHQ A;  4N5C A;  3UMV A;  3TG4 A;  3LYA A;  3FY4 A;  3ZYL A;  3SF4 A;  1HF8 A;  3PE3 A;  2NC9 A;  2VGX B;  3ASD A;  4U07 A;  2HR2 A;  3FEY A;  1H19 A;  4JC8 A;  3R7R A;  4NQ0 A;  3ULQ A;  5AIJ A;  3QWW A;  2IU1 A;  3FH5 A;  4KZC A;  1W3B A;  2IFU A;  3CSF A;  3FTS A;  3LY8 A;  2NSZ A;  2PL2 A;  2CG2 A;  4C0E A;  2X6J A;  4APF A;  1EPU A;  2X6H A;  3NZS A;  3OXL A;  3RRM B;  5AEN A;  3FUJ A;  4I43 A;  4UI9 K;  2L0T B;  4FP7 A;  5BPP A;  2KZT A;  3MKR A;  3ZYM A;  3Q15 A;  4XI0 A;  1PC2 A;  5FWQ A;  2VTB A;  3CQG B;  4FA6 A;  2X6K A;  2I6H A;  2VYI A;  3MEK A;  1E8Y A;  4UQZ A;  2LAH A;  2JEK A;  4OVV A;  2XRY A;  3PUJ A;  4UQY A;  3MGB A;  3EDT B;  5C2Y A;  2DIW A;  2ION A;  1U3D A;  4BT8 A;  1JUQ A;  3T5V A;  2I1J A;  4KYO B;  4E85 A;  2AWI A;  1NZN A;  4BT9 A;  4DPR A;  5M72 A;  1OWM A;  4DK5 A;  2X6I A;  3EIJ A;  4L1B A;  2GRM A;  4CT4 A;  5CCM A;  4G2V A;  1NA3 A;  3FP3 A;  3GZ1 A;  3LVQ E;  4FLB A;  4I1A A;  4PUC A;  3CVQ A;  4U0Z A;  4UWH A;  4CGV A;  3JQ1 A;  4IRU A;  5FQ4 A;  1INZ A;  3PEU B;  4IUL A;  2BF0 X;  1HU3 A;  3PUK A;  1E8W A;  2DBA A;  2VQ2 A;  4CGW A;  2GGF A;  2YQ8 A;  3PDN A;  4L23 A;  4BX9 A;  1IQR A;  4XZ4 A;  4N2Q A;  1KLX A;  3WXX A;  3CHS A;  4JHJ A;  3PEV B;  4AV7 A;  4JHK A;  3KAE A;  4QFV A;  1TEZ A;  4GU5 A;  4F53 A;  3L08 A;  5LCW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...