2XGMA

Substrate and product analogues as human o-glcnac transferase inhibitors.
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
512
structure length
512
Chain Sequence
PEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 190
structure length 512
sequence length 512
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgmA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgmA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgmA02
4LEUA 3MEKA 4N39A 3E3LA 2G9UA 3CUTA 3Q3HA 4J0UA 1E96B 1AHPA 5LCWC 4M60A 4HOSA 3Q15A 2FEZA 1NZFA 2G9VA 1HH8A 2FFRA 5CHEE 3KS2A 3E4BA 3Q4AB 5JJ6A 4J8FA 1FS4A 4M7PA 5HI7A 1WW3A 3NP9A 3IA7A 5D00A 4EL0A 1FU8A 2MHKA 2QRQA 3H4TA 3MS2A 3OTGA 4RBNA 4YVOA 2PYIA 1L7XA 4MRAA 3RKVA 2QZSA 5I45A 1YA6A 3CVNA 4N3CA 1EM6A 4YI3A 2QFCA 2HR2A 1WAO1 2IF4A 3MTAA 4MHOA 2C4MA 4Y6WA 3S7JA 1E4OA 5AYWD 3CK8A 3PE4A 4QLBA 1P4HA 2Q7FA 1WV0A 2PYDA 1A8IA 3UPVA 4U0ZA 4WUYA 1XKXA 4HWGA 3NPAA 3UUXA 3TG5A 4I2ZA 3QWWA 3CEJA 2ACWA 2ATIA 4FKZA 1C3JA 3GW4A 3OKPA 4EJ2A 4GA2A 2VGXA 3RO3A 1ABBA 2XCCA 3FWVA 2DBAA 4I9CA 1L5SA 4GCOA 5IKPA 3MV2B 2Y4TA 4J8EA 5D01A 3L01A 2IFUA 3BD7A 4KXKB 4KYOB 2X6QA 5BNWA 1UZUA 2JZCA 2C0MA 3S7DA 2OFFA 2P58C 5D0QD 1Z62A 3BDAA 2IEIA 4G23A 1EXVA 1YGPA 3SYMA 1A17A 5A7DB 1WUYA 5FJYA 1BX3A 2VSYA 3CV0A 3SYRA 2BFWA 3JYSA 2C2LA 3R9AB 5KJKA 4BQFA 2WPVA 3H4IA 3MT9A 3TSAA 3FROA 3CEMA 1P29A 3NB0A 1KTIA 1P2DA 2QRGA 1IHGA 2XCUA 3S7FA 4HOUA 1ELWA 5C1DA 2FBNA 4X6LA 3RSCA 3BCSA 1XC7A 1FU4A 2WQHA 4XI0A 1M5RA 3CUVA 2XGOA 3WC4A 1WUTA 2ACVA 2Y4UA 2VCHA 2P6PA 3Q47B 1P4JA 3CEHA 1IXYA 3MBOA 3LPZA 3OT5A 4RIHA 2ECPA 1V4VA 4GYOA 4G26A 4XI9A 4U0UA 4REMA 2FO7A 4KQMA 5JTTA 3VDMA 4M83A 4WACA 2R60A 4U04A 4GA0A 4GYWA 3ULQA 1C8KA 2IEGA 6GPBA 4APOA 3GUHA 3QHPA 3RSZA 3DZCA 3ZCTA 3CK7A 5FT9A 5EX0A 3PDNA 3D0RA 3OY7A 4X7MA 2O6LA 3AMVA 3OTIA 3URZA 2HO1A 3LKUA 3UYKA 4Z5XA 3S29A 5D0OD 2E2EA 4AY6A 1LWOA 1XL1A 3EBOA 3QKWA 4WNDA 5TVGA 5ENZA 4N5CA 3LY8A 2YHCA 1Z8DA 4UI9J 3Q49B 4NRHB 3U4TA 1NLMA 4GZ3A 1WV1A 5BW8C 4EKYA 2X6RA 2IW1A 3NP7A 1JIVA 3HBFA 3LY7A 2VQ2A 4I17A 4NESA 3BCUA 2ONDA 4A1SA 3D1JA 4JA7A 2QRHA 3QOUA 2Q6VA 4WNGA 5G04J 1L5RA 4BQIA 3OXGA 4PQGA 3ZCPA 3VUEA 3L7DA 3UQ3A 2ASVA 4WHMA 4N9WA 3D0QA 2UY1B 4I1AA 4KQ1A 1NA3A 4GZ6A 1Y8MA 3ZFWA 4GPBA 3S27A 2FF4A 5TMEA 9GPBA 2QLNA 2YJNA 4RG9A 2C9ZA 1B89A 4ABNA 1FTYA 5TMBA 3RHZA 2H1FA 1GGNA 2VCEA 3E3OA 3S7BA 3MV3B 1HLFA 1VGVA 5KJMA 1K06A 3DDWA 3DD1A 4CTNA 1ZU2A 5DU2A 3MTDA 4HORA 1C8LA 3SZ7A 1XOIA 3EBPA 4AN4A 1NA0A 1P2BA 4HOQA 3AS4A 2KATA 4AIFA 2IUYA 2BISA 1UQUA 1ELRA 1Y6GA 5JJTA 4BTAA 1L6IA 2QLMA 3Q3IA 5BT1A 3ASDA 4N2QA 4NEQA 3T3HA 4Y6CA 3BD8A 3S28A 2VYIA 4YUAA 2PQNA 1LWNA 4AMBA 4G24A 2C0LA 5GPBA 1Y6FA 4N2SA 3ZPJA 3CKBA 5KJNA 1NVKA 1NZNA 2PZIA 3VUFA 2X0FA 2XPIA 1HZ4A 2R68A 5DXFA 5FTPA 3GZ1A 3RO2A 3L79A 5TMDA 1FTQA 1Y8ZA 4JHRA 2QN2A 2XA9A 3Q3EA 3G2KA 2GEJA 4MI6A 3HYMB 3CVPA 4IN3B 2OOEA 3ZN3A 3ZCSA 2R66A 4RIIA 3O48A 2C1XA 4GCNA 2GPAA 5KJLA 4GA1A 5FZRA 2IV3A 2BGUA 4UQYA 2JLBA 2L6JA 3RU0A 4CTOA 3LYAA 4X7PA 4GZ5A 3ZHEB 3C4VA 4LDPA 3AS8A 2F3PA 1Z6PA 1JIXA 1RZVA 2G9RA 2LSVA 3T7DA 4N3AA 1GFZA 3BEOA 3CX4A 4I9EA 2V5FA 2QRPA 4J8DA 1GZ5A 1SXQA 2UY1A 3HBNA 4EKEA 3G2HA 4W9RA 4AM9A 4RG6A 3CVLA 3MA5A 2KCLA 2PRJA 2R5SA 2F9FA 3MT8A 2QN1A 3IEGA 2AV6A 3T3EA 5EKQD 3G2NA 3SF4A 1FCHA 1WW2A 4FZRA 1H5UA 3CUUA 3MRTA 3MSCA 2GM9A 2XMPA 4N3BA 4F96A 2NC9A 2SKEA 1OUVA 2XA2A 2C1ZA 3EDTB 2PQ6A 3ZCQA 1FC0A 2KC7A 2PQRA 2IV7A 3LY9A 3T5TA 4UI9C 5M72A 1SXPA 1KLXA 3WADA 4AMGA 1QKJA 1GG8A 4WADA 5FZSA 2FF5A 2HY7A 3BCRA 3MRVA 4X7RA 3TAXA 4MICA 4BFCA 3CUYA 2GPBA 3E3NA 1XNFA 3HBJA 3ZCRA 3IAAA 5JJ7A 3CEQA 5G04C 1B4DA 3CUWA 2XGSA 1L5VA 3MT7A 1WM5A 3N71A 8GPBA 4KQ2A 4RIGA 5G05C 5CCLA 2IYAA 4CDRA 1PN3A 3NC4A 5DBKA 5G05J 3PE3A 4MI9A 5DLDA 3FFLA 4RENA 2LNIA 5CCMA 4EQFA 2FI7A 1GPBA 3OTHA 5LCWJ 2H1HA 2JJMA 4LEIA 2AW3A 4F97A 3RJVA 4MHSA 5HXAA 4H7YA 3QWVA 5DIZA 5HQ8A 1AXRA 2QLLA 2XCIA 2R4UA 3CKCA 1GPAA 1P2GA 2ZB2A 3NAZA 3QWPA 3VTXA 4UI9K 2WTXA 3KD7A 3MKRA 2VG8A 3ZCUA 2BUGA 4MI3A 3UYLA 3LCAA 1HXIA 2I6HA 3S0JA 4YI5A 2BGTA 4CTMA 2YQ8A 4WNEA 3BD6A 4KBQA 5IKOA 4CGVA 3T3DA 1KT0A 3CVQA 2QNBA 3O3CA 3MRXA 4B94A 4RIEA 4G25A 2F3QA 2QN3A 4ME2A 4BT8A 2UWJG 3ZHEA 3DDSA 4RELA 1J39A 4JA9A 1L5QA 3OXLA 1FA9A 1F0KA 4BTBA 4YVQC 1RZUA 7GPBA 4AY5A 1XV5A 1JG7A 1JIUA 3OKAA 3HBMA 3G2LA 4F9FA 4U0SA 3QKYA 3MTBA 2VGYA 4I2WA 3G2JA 2SKCA 3MS4A 1NOJA 3ASFA 5ARGA 3TGOA 3ZGQA 2XA1A 1QM5A 4GPKA 2GPNA 3RT1A 4HOTA 1KT1A 3RIBA 1RRVA 3OKCA 2AMVA 2KCVA 4G2VA 2F3UA 3ZCVA 4GYYA 3MS7A 4EL5A 1P4GA 2QRMA 3G2IA 1K08A 2AZDA 1PC2A 4F3VA 3AS5A 3QDNA 3NF1A 3NCHA 1QZ2A 4BT9A 1FU7A 1YA0A 2VSNA 4YNDA 1P5QA 4HLNA 5ARFA 5FZQA 2KCKA 2QN8A 4W6QA 3VTYA 1PNVA 2XEVA 1QQEA 3ASHA 2HYZA 1L5WA 3Q5MA 1UQTA 1GPYA 2PL2A 2GEKA 1NZDA 1C50A 2AVPA 3L7CA 3KAEA 3U3WA 3GPBA 2GT1A 4UQXA 2XCBA 4WNFA 3CK9A 4RIFA 1PYGA 4XIFA 1NOKA 3T3GA 1TJCA 3BEEA 3ESKA 4G1TA 1PSWA 1IYGA 1IIRA 1XL0A 2X0EA 4L22A 2SKDA 4BQEA 2GJ4A 1O6CA 1NOIA 3C48A 3OXFA 4NQ0A 3MQFA 3C4QA 5EX3A 4UQZA 2VGXB 3WAGA 1JEJA 4O6FA 4CGWA 4H7XA 3CV3A 2X0DA 2J9QA 2FETA 3FP3A 3L7AA 1F6DA 2LSUA 3GZ2A 4G2TA 1Z6QA 3TG4A 2XGMA 5A6CA 3T3IA 3WXXA 1FTWA 2PRIA 2QN9A 2GW1A 4JL0A 2R4TA 3COPA 2KS6A 1JG6A 3OY2A 3TOVA 1W3BA 3GYZA 4U07A 3L7BA 5JTUA 2G9QA 3S2UA 5LQDA 4NC9A 3VDNB 1E1YA 4BWRA 1ZBPA 2QN7A 3K9IA 2F3SA 3ASGA 2IYFA
chains in the Genus database with same CATH superfamily
4UVGA 4G0WA 5AW5A 2O6HA 1ENOA 2O2HA 2W6IA 4O33A 1Z16A 2YMLA 4QDJA 4YXWA 2TMDA 1D2GA 4D46A 5HTOA 3ICVA 1UP6A 4BDTA 4N6NA 1DBPA 2PJUA 1MB0A 2BUBA 1KMNA 2RHBA 1GV0A 4Q1VA 1UP4A 4O4JA 1PJSA 1U9ZA 4J0JA 4I6JA 1UDCA 4NX2A 1L7PA 2ZS7A 5T3RA 3KDAA 1NKSA 4YPFA 3BGVA 4DSAA 2VZ0A 2B1QA 1FRVA 2ATIA 3BF7A 3AVXA 4LRUA 1NVGA 1JYEA 4K03A 2Q1TA 2QP3A 2IUSA 3OX3A 4ZAVA 4DDHA 1J06A 1AUOA 3WYBA 5KSOA 1K2VN 1RWKA 4YRSA 3B1KA 1F7VA 2GJ8A 4L7VA 1HZZA 1VL0A 3H4IA 3INTA 1GAEO 3NB0A 1I3NA 4IICA 1FYWA 2QMYA 2YN0A 3H18A 3ELUA 1X7HA 3U40A 5C1DA 2P11A 4RK6A 1C5KA 2VCHA 2R05A 1BVYF 4UUQA 4RJ2A 4REMA 4Y2VA 1TNOA 4M83A 2VF4X 5BV7A 3DSSA 3N05A 4R69A 1T9HA 4KKVA 3BCHA 1TLTA 5FOWA 5TVGA 3QKSB 1ZJ5A 2QW1A 4XGQA 2H7CA 2V4UA 2ZJ1A 1DUSA 3KU4A 3RVLA 4E2ZA 1O4VA 1DTEA 4BV2A 4WNIA 3V48A 1TVCA 3IAXA 5P21A 4EOGA 5LQCA 3BEDA 4BQSA 4EMTA 5AKHA 1X7ZB 5CVJA 1Z4KA 3KTDA 5JUWA 3AJ9A 4RQIA 2QD1A 4PF1A 2FQXA 3GL9A 3QHAA 1DC3A 2R8YA 1KJ8A 2IVZA 3QVVA 1D0VA 3D64A 1T4GA 3IR6A 3R77A 4JJKA 5G0WA 2VA8A 3KXIA 2EJWA 4Z4FA 1U1EA 2C4HA 7MDHA 2CNWD 4E33A 4P83A 2I62A 4A10A 2EFJA 5EJGA 1Y9JA 4MVYA 3TXYA 3MQ2A 1ZM2A 1R8JA 3CH5A 2IDJA 2B9VA 4NU8X 3A3PA 3FBTA 2ORED 3HWWA 4W1RA 1UKYA 3AEUB 3VYTB 5CLFA 5CFQA 1AF7A 1BDMA 4GWLA 4ROTA 2J4DA 1ODJA 2G06A 2GRRB 2P67A 4DT1B 1XFAA 1G291 2DSNA 5L7YA 3ACBA 5EHQA 1K6EA 1SIOA 4A1GA 5FUWA 1DXOA 3OOYA 5KTPA 3M49A 1MIOB 1TA4A 4ZK2A 3E15A 2AFHA 5F98A 1Q3KA 2ZGDA 2GPBA 4URZR 4EK9A 2NSYA 1J7KA 3ONDA 3T4UA 2B7BA 1WKCA 1U8ZA 3DKKA 1E1NA 4NJEA 2Z98A 3EQ2A 5I8PA 3KDPA 3ONNA 4BBPA 1BHO1 4KL8S 5FPQA 1Y3IA 1XMVA 3CLSD 2VF2A 2GLTA 121PA 3AUAA 2AQIA 1E5DA 3R23A 2NM0A 3B13B 4X7BA 2B78A 1F0KA 2UXDB 4A0HA 2EU8A 4LDJA 4RYLA 3E9NA 3ELWA 2I6UA 5DP1A 4C2BA 1OX4B 4JQSA 3FU3A 1SUDA 3W9FA 4BX9A 1ZD9A 3RYHA 2O3SA 3FM9A 1TJNA 2YIDA 3F2IA 4YUWA 1OI3A 3DFZA 4WESB 2DFTA 1XNHA 3O8OA 4PXAA 5C3MA 1DEHA 5IF3A 2XTAA 3QF4B 3LT0A 4BNTA 2IRWA 4YBZA 2YHIB 3OJWA 2VGXB 2I91A 4AJOA 3EZFA 4LF7B 2RHMA 4MV9A 4HDOB 3NOQA 1EDOA 2JIDA 2G70A 3RFVA 4IRUA 2FW7A 1N0IA 4EO4A 3LLMA 4H7EA 4QEKA 1UN8A 2PX0A 1TYQG 3EZ6A 3DXKG 4RQBA 3GJZA 1WZ2A 3PX2A 4M6WB 1G21A 4U9IS 1A4IA 1Y6JA 3UUFA 4CG3A 1E6EA 4CTKA 2MSEB 2WJGA 3H9CA 5BSFA 2L0IA 3LCCA 5KYGA 2ZWOA 2JAUA 3Q4AB 2MMCA 3SHQA 2XF2A 3MJWA 4R2IA 4GRIA 2W2LD 4Y2YA 4CEMA 3I09A 5GV8A 5CFLA 1E7QA 4RY9A 2QROA 5F78A 1B2LA 4U5QA 4E31A 3JRXA 1G8FA 1J0EA 2Y1KA 4B45A 3DO6A 5LKAA 4FYMA 2FUNB 4O3MA 2JI8A 4EZIA 4YA6A 1AKTA 2V7WA 4A16A 1FBTA 3RIGA 3ZZNA 5FJYA 4S05A 5E9WA 1DVRA 2OB2A 5J4LA 3PREA 5HMMA 4LNUD 5B4UA 1NI4A 1RXCA 3HYCA 4DQXA 4TXRA 2QRGA 3MCWA 1JYFA 1CYDA 4JYBA 3X1YA 3I0ZA 1RJDA 2PDAA 1FYEA 4V0QA 3AZQA 3ZNNA 1QXSA 3IT0A 4JL8A 4U0UA 2WIDA 3TR6A 1IUPA 2PKRA 2IH2A 1U3UA 3Q0TA 1GADO 4CMBA 2QVXX 3H0EA 1ZI6A 1YL7A 3RV3A 4CRWB 3GLUA 3BJIC 5A62A 4O5OA 3TPCA 4YGYA 4JUDX 1M0EA 1AQYA 5TVKA 2EF1A 3HA3A 2I3AA 2DHEA 1ZKDA 3J7AC 1QVRA 4HDSA 3CH7A 4OXNA 1BGVA 1KK0A 5B4TA 2AW5A 1RI2A 1JGTA 4UXIA 1VJGA 4ZEXA 3G2PA 1M1YA 2WZBA 4LYAA 5HUHA 4Z0PA 4AY2A 4WZBA 2CNLA 1UBKS 2AOTA 2OCYC 3FB4A 3IDAA 1MR3F 3D6NB 3ZWXA 4CIWA 2P5YA 3PUWA 2JS7A 4FILA 4KRFA 4ALIA 4CGYA 2Z5VA 4ZMBA 1PCXA 3LECA 1V8ZA 4E5VA 1KEKA 2YIJA 4DARA 5YASA 4FDTA 5CUQA 3GRUA 2TSYB 1PR3A 2KB0A 3HCBA 1CUGA 2NTYC 3BWDD 3FLAA 4KSBA 4YQFA 1LD3A 3PDJA 4XAQA 4N3AA 1C9JA 4CKCA 4MVJE 1TM7E 3LT2A 4LSZA 2VAPA 1GVNB 4BMCA 3I72A 4KNYA 2PUJA 4RFSA 4RVDA 3IVAA 1NY5A 2WXFA 3MRTA 1DDOA 1OXMA 2EZTA 2H8GA 1O5IA 3HI4A 3BRQA 2R86A 3I8XA 2ZJZA 1USGA 1QJCA 3CUWA 3IKTA 1E99A 4LTNA 3RIHA 1RW2A 3OPMA 4MGIR 3DDNA 1FUYB 3UENA 2UVQA 3WK9A 1QRUA 2JZNA 2JHGA 1DEAA 3N39C 3LDFA 2PRKA 4KNVA 3THRA 2BUGA 4H4DA 4FFRA 1QC5A 1UADA 4G36A 2WUDA 2J9FB 2ZWPA 4BZQA 1OH8A 1XU9A 1AQ6A 5DZSA 3GU3A 4YR9A 1RKBA 2QV7A 5F4ZA 3RK1A 4GPKA 1ODKA 4CXMA 2P4EA 3LJKA 1J07A 5EN4A 2ZWAA 1J09A 2PH7A 4LY9A 4DCGA 3I92A 2N0SA 1C14A 1ZD3A 4JP1A 4KQWA 1HKUA 1AE1A 1UQTA 3L1VA 3T1OA 1Z6GA 5HKBA 2V1UA 2CJXA 4I8IA 1UF9A 2YQZA 1W0KA 4U6NA 3IBEA 1JL3A 1KYTA 1I2BA 1R7RA 3LY5A 1P7VA 2KBXA 2D2EA 1I4DD 1X9GA 2XSZA 2C1EA 2VHVA 3S2IA 4ZN6A 1X1CA 5IYZF 4EY8A 1JFTA 3IMKA 3ZVLA 3JSAA 4FYJA 4ZQEA 5IUKC 4KR3A 3E8MA 5IT5A 4EJSC 4HRMB 2H6FA 4IZHA 4DR3B 1Y1SA 1H0RA 3MEKA 4ZD6A 4YJ2B 3VR6D 2GCGA 3KXKA 4QARA 1BI8B 4BKRA 1FQJA 1VL2A 1X1AA 3D9NA 2B98A 3QXGA 4NKRA 1ATIA 5IK2D 2GEFA 5BPFA 3ZQ4A 3WWEA 1YULA 4YAOA 4ZYUA 3K0FB 3SEZA 4OF4A 1WXWA 1P4HA 1N0UA 2O3JA 1LW6E 3LPCA 1RW4A 2EATA 3AKCA 3PD0A 4FLBA 5BQ5A 2XKKA 4D8WA 3MV2B 3SEAA 5CD1A 5G4KA 1RC8A 2V8OA 1GZ4A 1JDUA 4PS7A 4UEKA 1KYXA 1XZIA 3IFSA 2VT3A 1TCCA 1NJFA 2LKDA 4GGPA 2V5AA 3C74A 2ISSD 2D00A 2J7KA 3LU1A 2GEDA 3R8FA 4D25A 1QTRA 2HNBA 3HACA 4DI4A 1FDOA 5BV0A 3MWLA 1HQYE 4UHJA 2V9CA 4AYTA 4A15A 1YIAA 3PDIB 2VH2A 2IEYA 1JQAA 3QHPA 1AKRA 3TXAA 4NOLA 1BZYA 3WK4A 2ST1A 1RQ2A 3HIZA 2NQTA 3QKWA 1V1MA 2G25A 2QAGC 5KC8A 3LY8A 1PEKE 1YSCA 3BFPA 3GAZA 1RLJA 4CU5A 3STYA 3M0EA 3IPCA 5C7YA 5EE9A 5FA6A 5GVRA 1QO0A 1OPRA 3V42A 3HMQA 5BN3A 3HO1A 3SVTA 4AKIA 1QP7A 1RLOA 4MS4B 3B8HA 1Q0QA 5AHRA 4M8IA 2Y3IA 4ZCIA 3RYFB 1VE1A 3RC2A 3VGJA 2IHVA 4HPJB 3TUIC 2G63A 1E94E 4KQKA 3BUSA 5E38A 4RHYA 2I9CA 3I1JA 3T7IA 1CKEA 1XQXA 1FDRA 1C0LA 3C39A 4HZIA 5KTRA 3FULA 5E95A 3ITNA 3I9LA 3ECSA 3V8BA 4G81A 2OUKA 1O1TA 5BT8A 2Q4BA 2HPAA 3AILA 3CPEA 1F17A 1TIBA 4UPDA 2ILRA 2C2BA 1N57A 1GU0A 3B6MA 3PC2A 5FI0B 1HT0A 1MVNA 1YVRA 4B7XA 2O7NA 3LKZA 3SF0A 2EFHB 5EJ8A 4C1BA 4OMUA 3ZV7A 1V45E 1IQUA 4V0KA 3LYAA 1ZRMA 1E9SA 1DWOA 4CKZA 3MZ0A 4P53A 2VQDA 1F5SA 1G3UA 1EGAA 4CJXA 3AG1E 1UWCA 2ZREA 1X38A 1U2EA 1CE8B 5MGNA 1XMSA 5DGHA 2IOQA 5J63A 1NLYA 5FPTA 3RS8A 4OXQA 4RJLA 3HY3A 4CUKA 1OI7A 3KB8A 2ZITA 1J00A 4ZZ3A 1NQAO 3QQ5A 4HPWA 5HG0A 2D5AA 3WQRA 4D0RA 1VI2A 3JAWA 4L7TA 1EVKA 4RD3A 1U7DA 2QL9A 4OJMX 5ECDA 4YN3A 4KWEA 2X0RA 5K05A 4J75A 5DKFA 4GPIB 4AXBA 2AFIA 1Y48E 1BN7A 4MQLA 2WICA 1YNSA 3MKRA 1Z5WA 3D59A 1DIRA 4Y2QA 4FXOA 2D2XA 2XDAA 4KV9A 4EG6A 4QYIA 4M7CA 2FZLA 1KVQA 3ESXA 3E22A 5H9VA 1G8PA 2EBWA 5HW0A 3PRZA 1MJ5A 3TW0A 3O8CA 4S0ZA 1SRRA 1CY8A 1N2CE 3MUFA 1P39A 4DYVA 2JARA 3TB4A 4S1WA 3I5XA 2AJTA 2FP3A 3U80A 3PE6A 4N5IX 4MV8A 1VFNA 2XCBA 4RPIA 3DEOA 2EJVA 1IYGA 4X3CA 1JI0A 3CHRA 1BAPA 3U26A 2AQHA 4IDGA 3FHLA 5SZJA 1H2UA 1DX4A 4YAIA 3HP7A 3FLEA 2HJWA 2XUQA 3EF3A 2C82A 3TCKA 2C4NA 5E9AA 4EFLA 3PNSA 3SLRA 5FTKA 3TNYA 1PL7A 4YJ3B 4IX9A 3VDNB 3CSFA 2WXGA 3DKVA 4FXPA 5LP0A 3D8TA 1I2DA 3OVMA 5IUJC 3W4JA 2AIRA 3WB9A 5JHAA 1NSTA 4C7XA 4EX7A 2MHKA 5T4YA 1W4ZA 3GWZA 3I04M 4RTKA 2RKOA 1XJWA 4Y6WA 4I0WB 4LMPA 2ZAGA 2Q7FA 4EF5A 2ZJ8A 3PXEA 5ENVA 2VJLA 2QG6A 2OOSA 1VYUA 4JJ6A 3TQFA 3C2QA 4BZPA 1LPNA 2Y4TA 2QW8A 3EMDA 1YRHA 3SC6A 1JSLA 2OWDA 2XRYA 4LDZA 4MIOA 3NTVA 3OTWA 1N78A 2P2LA 1CW2B 3ZDQA 1LUAA 3F9CA 4OB8A 3ULKA 1PEDA 2GCEA 3WC4A 1J2TA 5EYPB 3ZH2A 5KPJA 3CEHA 4NRDA 4RIHA 4I6EA 4UC0A 3GP3A 5BSUA 1PJLA 1V3VA 4LDRA 2FJUA 1EDBA 3LZCA 2QTVB 1YU6A 2Y1LA 2NNWB 4ARCA 4YDEA 3U44B 2VEDA 4M9RA 3AV0B 3ZHRA 1F3OA 3HKDB 2DKFA 4GYKA 2IQIA 1RPTA 1T0HB 3F7OA 1YDWA 4BTEA 2DYRE 1EFLA 1VKNA 3CMCO 2X6RA 5J23A 4Q21A 3UM0A 3G0DA 2PMFA 1YDFA 3KOMA 5ELLA 3SBOA 2GBFA 2XNSA 2B25A 2AWIA 4U7FA 3EQ7A 3W2HA 5AKEA 3KLPX 1DIAA 2Q7XA 2DBVO 4ON9A 4O4LA 1MHPA 1XLUA 3VLFA 1V5IA 1NJ5A 2BFMA 2OGZA 2VATA 2FQYA 1R4MA 3W78A 5DHUA 1JAIA 2Y3AA 4Z7JA 4B7CA 2V4LA 4R71A 5SY4A 3EGCA 2KWIA 4IDQA 1C9KA 4JHRA 5E76A 5EWLA 4I2VA 3QWBA 4IUYA 3ZVRA 3UMBA 3EVEA 4CZ2D 5LQRA 1EZ1A 2E4AA 4B2LA 2P9KG 1A95A 1Z4JA 5FI1B 3BRCA 3PG5A 4B7UA 2CL5A 1NC1A 3USCS 2DQ4A 4LWPA 1EE9A 3ROTA 1DKPA 4L2IA 4QECA 3N2YA 2VHYA 3QZUA 3CNNA 4ZQGA 4AJIA 2NQ8A 4NAVA 2JBAA 2KXPC 1INLA 5A5DA 4RJJA 1CCWA 3ZI0A 1E1QA 3PA8A 3AKDA 3LHSA 8GPBA 1IRIA 4U6SA 4MCIA 2N9UA 3VGPA 3DLIA 1IHDA 4Y1RB 3ZQJA 3DXFA 2Q5HA 5CCMA 4MQBA 1H2AS 1SG6A 4BQQA 1ZR4A 2LXLA 3HVRA 3UK0A 1Z0KA 4Z7QB 5AR1A 2CL0X 3WMXA 1Y4UA 5AVJA 4ZOAA 4MKGA 1KWGA 4E1VA 1ZNQO 1JI3A 5IDYA 4B84A 3WB1A 2V97A 5HDBB 2V1XA 3K7EA 4F6RD 1JS1X 2Q6OA 3IXMA 2A1TR 1R37A 4BUCA 4LW8A 1EFTA 4YCSA 3RC8A 3NTQA 5JSYA 5IH7A 3MWKA 2OZEA 2V6IA 4R6WA 1G5IA 3W2EA 4UD6A 5EWJA 1A97A 4HQDA 3TNLA 2KCVA 1TLLA 1FZQA 1B8NA 2CXRA 1O54A 1P0FA 4L0QA 4F0JA 4QGSA 3LHFA 3H5RA 1YI8A 2ERXA 5BURA 4MWTA 2G72A 2CXPA 2GEKA 4RF3A 1OCZE 1MA0A 3Q3GE 4TT3A 3B1VA 2JH8A 5EJ4A 3FDJA 1NRIA 4DUGD 3FPCA 5EQDA 4F6LA 1JEDA 2JLCA 1A9OA 3V2OA 4KPUA 1W29A 4TLBA 2ZJ0A 2VXYA 3GH3A 3PNMA 1AZLA 2FK7A 3COPA 4DEVA 2H1VA 1SC6A 3AHHA 2QU7A 1VJRA 2R11A 1O95A 1W88B 3ASNE 5A6SA 3MINA 2PLAA 4IIFA 3TEJA 1QNFA 3ORFA 3R3VA 4IJ5A 2BKAA 4GI5A 2YYSA 2H5EA 4J0EA 5ANRB 1FS4A 5DE3A 1EFCA 2YMQA 5K8IA 3A9VA 4IFEA 2OQRA 3RREA 4BY9E 2ZU6B 3D7LA 4NZPA 2RKKA 4KQFA 4V02A 1I4WA 4UARA 2K7FA 3D3WA 1J8QA 1GQQA 2RGDA 2GBIA 4EHMA 2H51A 4QLOA 2ZUFA 1XD8A 1A2KC 2FRDA 5KYVA 1KH3A 1K68A 2QTWB 4OFXA 1UDBA 1E59A 3SOPA 3BXOA 1CDOA 4BAUA 2ZK7A 1TGYA 2HN9A 1GQSA 2CDRA 1LZLA 1FMLA 1LTKA 4CI9A 4E6PA 4AX8A 4NCBA 4UTZA 3SM3A 4QG3A 1K3ZD 2ZI7A 4QGGA 3ROPA 4IHJA 3GG9A 2VZLA 2BF7A 4OMDA 3HR8A 3ZHBA 2PAAA 4E46A 5AIJA 3PEWA 2OCBA 5EPEA 3LUPA 3AVOA 4MR8A 5K8CA 2FKAA 2DHQA 5J90A 2GZDA 2PV7A 3JSXA 2CKMA 4ZGWA 1ZITA 3D0QA 5KYXB 4DAEA 3E4CA 3ZGLA 1GPMA 1WZEA 3TLBA 3RHZA 2FF7A 1KIMA 2QYHA 1IJBA 3OEHD 1IM8A 1JHOA 4ND8A 1MFPA 1UWVA 1G8JA 2I2FA 3EVBA 4LXHA 1ZEJA 3O1HB 3ICPA 2RCYA 2JBWA 4LNGA 3TD2A 1EWKA 4C48B 1FUEA 2RG7A 4XKCA 4FOTA 1DG1G 1QP4A 2J7PD 3DZFA 3DE1X 1EEXB 1L7NA 2OV4A 2ZPUA 5BVGA 4I4TB 4ACAA 4I5GA 1E60A 1AOXA 3ZCSA 1ZJ4A 1K5GA 3Q3JB 5TEWA 4IJWA 4YCMA 1PY1A 2VA9A 1FMTA 3CO5A 3N07A 1K8QA 3EG5A 5BRNA 3ZHZA 1QE5A 3GW8A 1UBLS 2PZMA 4HRNA 3KCQA 5TC4A 5F7OA 2PVSA 2Q29A 1QX4A 4Q4JB 2RAVA 3LUFA 4G5QA 2NO7A 1YBAA 2CDAA 4D42A 4HEA6 1NASA 2B2NA 3DL4A 4QDZA 2LXNA 1D8DA 1SKQA 1NBAA 2M6RA 5JHGB 1V1JA 1YS4A 4J0KA 1R27A 2F6RA 2EJTA 3KAJA 3G2MA 2G5TA 2I7TA 2Q5QA 3TKAA 4A0GA 4QXMA 1KI3A 3WRXC 4XCXA 3G49A 2H65A 4BHTA 2DQKA 4FMBB 1K63A 3VR1A 1M5UA 3AUTA 4RZXA 3R4CA 3U31A 4EY3A 4CGZA 3K70D 2IYRA 5LZ8A 5E7JA 3DWLG 4KAFA 1SQFA 4XYEA 2P7IA 4O08A 4OQXA 3ZQKA 2XZTA 3BE8A 3K9NA 1KT1A 4S24A 1YDMA 1W4RA 3T95A 4G4SP 1UJ2A 4IILA 5D7BA 5T8KC 3RPEA 1E9FA 5CCBA 4UWFA 4O4JB 1B7GO 4DJJA 1PT7A 1A82A 2RGCA 3R9XA 5CH3A 1THGA 4D1YA 2O8FA 1CDZA 2GBPA 4A27A 3HN7A 1BOFA 1LPMA 1SOWA 3I30X 4L9PA 3H8JA 2YNMC 2X0DA 3CNLA 4PR3A 2OD7A 2QHXA 5HK8A 1MDFA 2AQKA 1O5MA 4A8PA 1TM1E 2YVLA 2C2WA 3C6YA 4KGZA 2R7AA 1R3DA 5K0FA 2ATCA 1Z47A 2QLFA 4YUVA 2P9PG 2BFDA 4LHWA 1XDBA 5C81A 2ETAA 3CIAA 1L7MA 3BXFA 3SIPA 2IYFA 2AEEA 3FGZA 2AJCA 5D6NA 3X43A 4ZYZA 1L3BA 2GMWA 2QZJA 1WBJB 3ZXIA 4INJA 1ZNXA 5FBRB 4AZWA 2VAMA 2FUG6 4JC8A 5JT1A 2B69A 2XNCA 1E1LA 3VR2A 3EGVA 2F8MA 2AH5A 4GHWA 3LQ1A 3C3QA 2I3ZA 4FKZA 3DYVA 5ITZA 1HYHA 2MSLA 3GO4A 1EIWA 1IBMB 4IP0A 2DR2A 2I99A 3RSOA 1W30A 1CF9A 3DQZA 4GEGA 4ZRMA 5COBA 4JHKA 3PHJA 3SYRA 2AHOA 4RE5A 2IOYA 4GTMA 4MI1A 4HOUA 1SUIA 2ZUCA 1B0UA 1B0PA 3EAQA 1OWOA 2NTEA 5EKXA 2ECKA 1Z26A 2J0UA 2B61A 3UJAA 2G1UA 3H6KA 1S7GA 1YR7A 3G2VA 4XI9A 1Y5IA 1ZS9A 1N36B 1P4AA 1MAUA 3GLIE 1WSDA 2VQSA 5IW8A 1HDOA 2BR3A 1G4HA 4H6WA 1WY7A 2C9MA 2L2QA 2R9VA 1XPRA 3BTOA 1IN6A 1DBIA 2VSFA 3TTUA 2HSGA 3M3HA 3U4TA 2HZBA 5AHXA 4DDMA 4B4KA 3PYXA 1CJKC 3U5ZB 3A6DA 2X2FA 2DFLA 2BDUA 4JUIA 3NM5A 2HM8A 4OSEA 1BH2A 4Q3LA 4ZPXA 3A32A 3Q72A 1KZ4A 3UAOA 1U2DA 1STOA 2LGJA 5DU2A 1L4EA 5HK9A 1UXHA 2AFHB 3EXHC 2FWPA 1ECGA 2XAAA 1OOEA 2X7XA 3E3AA 1OBVA 3DOUA 4Y6CA 4EJFA 1V5FA 3OZRA 1L4YA 1CPYA 1R88A 4IAOA 4NJEB 4FOOA 5EHIA 1N1MA 5IMBA 4EPVA 5TMPA 2LCIA 2ZRDA 1SEPA 2ODPA 2ZRLA 3FDFA 5C4MA 3PNKA 3H19A 1TPYA 4Y1GA 4NMXB 3NG1A 4BX0A 2M6KA 2GCNA 2FRVA 4KKXB 2H0AA 1RM3A 4X8QA 1FW6A 2OFPA 3Q9UA 3R20A 1OPXA 1MH1A 1E2GA 5JAQA 1VKJA 1QRDA 4PW0A 3RYHB 2G77B 4W82A 5JXWA 1AV6A 2Z3WA 4PONA 4Y6QA 5I9SA 4X7RA 1ZINA 3VAYA 2ZIZA 3O8OB 1L5VA 1RE0A 3NPMA 4IGIA 3RABA 1XUOA 4LHZA 4UHFA 4LHVA 4DE5A 3P45A 4LFAB 5CG1A 1QGYA 2GN4A 4RD4A 3OHSX 4EDFA 1E7MA 1Z2CA 2PZBA 4IRUB 4DLQA 1SU4A 3LCAA 1HXIA 5L9AA 3PQEA 3T3DA 1H3NA 2QRKA 1MTZA 4ME2A 4J43A 3UIEA 7GPBA 1GOTA 1ADJA 5T3UA 2IGTA 1G21B 3M70A 1NNEA 4NCHA 3Q40A 4OQ4A 2YINA 4Q16A 2PX6A 1NURA 1PQYA 4PG5A 1C3EA 1U3GA 1ZRNA 3VHRA 5BXYA 2ZM5A 3VJLA 2D3TA 3VTYA 3O8DA 5HOQA 1WMDA 1MB3A 5AXBA 2A5EA 4KZCA 5CDHA 1M0SA 4YWJA 4FMCB 1CU1A 3W8EA 4JB8A 1XJ0A 3N8DA 2VFAA 4PZLA 4LISA 3JR3A 3IT2A 2CFZA 1EYZA 1D2EA 3M6WA 4AG3A 2YXNA 3LUBA 1AB6A 4MYHA 2B0CA 2QYTA 1JAXA 4J4TA 2H6GA 1NI4B 2WJZB 4ER5A 3F5QA 4TMZA 1SBIA 3DNMA 3Q0IA 3AU5A 3MEQA 5EP1A 4M89A 3PSAA 3P0RA 1OAOC 1EK5A 2YS6A 1OBFO 5A7GA 4D45A 4DREA 4V2IA 4DNQA 3ICQB 2GH1A 3BGOS 2UVDA 3R6DA 1ISSA 3SJBA 2ZETA 2O2DA 3K6KA 3L16A 1YMVA 3T9DA 1XTZA 1ID8A 3W5BA 4TQUS 2EFYA 1EB9A 1PKXA 1UFVA 2PS3A 2QW0X 2EBHX 3T8YA 3URMA 4BJ1A 1WB5A 2HMVA 4BKOA 2XT0A 4A5OA 2P5TB 4QGHA 4OH1A 4BRSA 5D0QD 1TIPA 5BYKA 3HCDA 5ECWA 4HDSB 1NNLA 4JFRA 1UOEA 2BEKA 3FOEC 3T8MA 1II8A 1XNGA 1MRZA 2EINE 1M1YB 3QA9A 1GKIA 2JC3A 1N5DA 3U3RA 4WZBB 4YPVA 2AOTB 1GTZA 2BGNA 2Z9CA 4BLTA 2O7SA 2HMUA 2Y92A 1E3EA 2Q5EA 1MW9X 4TROA 4MO9A 3CH6A 1Y89A 4YASA 2HCTA 3D9JA 1IBRA 4YDSA 1DO2A 1FRZA 2GVZC 3UWPA 4IWYA 5BQ3A 1HF8A 1F8YA 1D9XA 1VHJA 2WAXA 3E9ZA 3L7KA 3WAKA 2M1ZA 2C99A 3RWMB 1KMHA 1QHGA 2R7LA 1P1IA 2WI8A 2ZI6A 4CKCB 1JQ3A 5MN4A 3L1JA 4OAQA 3KK0A 3M6IA 3PZRA 4RFSB 4NHEA 3QU7A 1SK9A 2QM7A 3BREA 3PI6A 4C0AC 4HNQA 3NBKA 4AF7A 4DBLC 1O6BA 4CQMD 3RG2A 3TUJC 3UTDA 1M10A 3BHJA 4YRAA 3H7IA 4BMZA 4KPGA 3N3BC 1ELRA 2QRUA 2XZDA 1Y6GA 1QB7A 3PIIA 4A26A 1R6TA 2VYIA 4I3FA 2VT6A 4EB8A 2P2SA 5KJNA 1G8HA 3ROQA 4WA7A 3T1TA 5EIHA 3RB8A 3A3OA 5F2EA 1QC5B 3NWOA 3RJMA 4J94A 3EGWA 1Z29A 5K5EA 2QPOA 5AM2A 1Z6PA 4CEIA 1RAHA 3UKDA 2OBFA 3TZLA 4YH1A 2QRJA 2OHOA 4RG6A 4D79A 3P9IA 4NQRA 5H02A 3COVA 4ZC1A 1SWWA 3R5HA 4B2PA 3CKMA 4COOA 4FKMA 3V00A 4JS0A 1NYLA 4P3PA 2Y77A 5KOJA 5DISB 2CDBA 4CBVA 2AN4A 2C2HA 3N71A 1JSXA 1NVVQ 1OGJA 3N0TA 4RIGA 3AM4A 3H9BA 3OF3A 1VLVA 1X0XA 1H2XA 4MUXA 2LWIA 3F71A 4FFLA 4M9SA 3TXNA 2J09A 2VG8A 1S7CA 4YI5A 4TWJA 3WJ1A 3ADDA 4LY6A 5AK0A 4BNLA 2B35A 1RZUA 2CFSA 3SJCA 5FUXA 1G4UR 4GG1A 3ADCA 5IDWA 3OMXA 5K8UA 5A3SA 2F3UA 2H16A 5JXGA 1TRHA 3W9UA 3I9V6 2ZRKA 2IF0A 4RABA 2IXGA 3ZBUA 1CS0A 2YN4A 3WL5A 4EATA 1C4WA 3UNXA 2B30A 3FZEA 2GA8A 2Z09A 3BHIA 4MKTA 1IIRA 1J2EA 1HDGO 4P7GA 1D07A 2Z8YA 1AXEA 4D96A 1OYWA 5G4KB 3CWCA 4RPGA 3DL0A 2VYVA 3NORA 4YK7A 3W5IA 1L3IA 2KS6A 3ACCA 1QV7A 8MHTA 3WYDA 3UATA 3CEAA 4NCKA 4IDFA 4P1ZA 2W4IA 1F20A 3HJUA 2WNSA 1I0IA 2DMRA 4CF5A 5I7WA 2WXJA 5DNAA 3RSGA 4XFKA 4R51A 1N5KA 1G3QA 5T4BA 3NTRA 1KAHA 3BL6A 1DIGA 3MCAA 1F7UA 1GTMA 1V1MB 1L5ZA 2ZYTX 3QEBZ 1QDLB 3IIMA 1OILA 2I2OA 1A96A 3QOFA 4UTOA 3RYTC 1FP1D 3AY0A 3DTVD 3KTOA 2B5WA 2VI5A 2O8DA 2GFIA 5KVQA 2G7MC 3IRVA 2I34A 5BN3B 2AXUA 2CLFB 4MGKR 1G7SA 4HLLA 1OGYA 1RC0A 3NOCD 1X80A 1ONPA 4GBMA 3ORRA 2PWAA 3HZZA 1XEFA 1RYFA 2HA5A 3R7BA 3R3ZA 2G4VA 2HDNB 1F5NA 3UT0A 1QV6A 1SIUA 3E7PA 1QVAA 5AVUA 3CBQA 4TVSA 2X0IA 3JRWA 3ZVNA 1QRTA 1G5FA 2CHFA 4FJYA 3CRZA 4HN2A 3HJGA 1V6SA 5JCJA 1TNZA 4HQRA 1HWYA 2FW8A 3GUVA 1VIAA 4K3UA 1NI1A 1NVUQ 4LJ9A 3VU8A 2WXIA 2V3WA 4X62B 1WG8A 4IF4A 2R87A 3PF8A 3VJMA 3TMAA 4AU1A 4JYZA 5F1YA 3DZGA 5H16A 1M6VA 4A2CA 4EB6A 1QIIA 4BBZA 3RKRA 2XZLA 1O4WA 3IEKA 3HE3A 2JJQA 4WOBA 3TD9A 1IOZA 5HKLA 4KGXA 4RH1A 3T3HA 3W3ZB 3JAWB 5M7EA 2ORVA 4H9GA 3ZWBA 2VDUE 2DPLA 5FWXA 4A2WA 2QI9C 4JZYA 3TECE 5SYAA 2B8TA 1EXMA 2QN2A 3F3YA 1ENZA 2AFIB 2SHKA 4GECA 1JVSA 3BXGA 1AHNA 4FSDA 2WTNA 1GTL1 3L7LA 2YZ7A 4V3CA 1BWPA 4NURA 4AN0A 1G63A 3GPCA 1OT5A 3L7OA 5DHTA 2B37A 4E03A 1BYIA 1QHEA 3T7DA 4OFZA 4OSOA 4Q3AA 4QYIB 2RE8A 1DQYA 1NAHA 3E22B 5BPPA 5ERXA 2IHZA 3RRMA 1S96A 1Q12A 2KCLA 3L13A 4ZODA 2P9HA 1Q7CA 2ZIUB 1Y4DE 2HK9A 3IERA 4NEGA 4PO3X 3DEHA 1CJTC 2HJSA 1TN8A 1Z4IA 4FOSA 2IYPA 2V7UA 3UK1A 2JKVA 2FZEA 1ID1A 4QEDA 4B3SB 3ME5A 3CF0A 2RHJA 2CG3A 2VK1A 5DLDA 3FNEA 2YL2A 5BV2P 3D4OA 1BROA 3DDCA 2VDPB 1TJ5A 3HV0A 4WKNA 1U63A 1N92A 1HS6A 4MI3A 3KSDO 4B9EA 5CYGA 4QRDA 2MYTA 2JL1A 3F7MA 3FXAA 3EC2A 1ESEA 2P41A 1HNZB 1S9DA 3I34X 4UMEA 1KF0A 3C6ZA 5BMVF 2OPBA 3I42A 3RTEA 1DQSA 1UOQA 1GTSA 4ZZ1A 2RGAA 3G7NA 1AMNA 3DT9A 3VNVA 2ZLBA 5CYFA 1N3YA 3BORA 2PFGA 2OLEA 2EYQA 1AUXA 3P94A 4F3KA 4B3BA 1KK3A 3BE4A 4L4ZA 3TW4A 1H6AA 1SXJD 1VHDA 3E9EA 4GPD1 2JHFA 4L7QA 1Z8NA 5C3UA 1MC4A 3K0KA 2QSUA 4P7FA 2CNBA 1ZMTA 3JVUA 4EGCB 4P0PB 5JSQA 3T0GA 4RTMA 2ZR9A 1QS0A 1NPTO 4QRIA 3ZDBA 2IYEA 3GFGA 4GWKA 3IJPA 5EXXA 3OQ6A 1TQ8A 2X77A 5FAXA 3OLXA 1OW3B 2QM3A 1V25A 4ZYLA 3RG8A 1J5PA 2DR3A 3FUEA 3CUTA 2PKEA 1QFSA 4J0UA 2ATVA 1VIYA 5DHPA 5HTKA 2ZB4A 3MMZA 1W35A 5CJPA 4KBYA 2VTVA 3G0GA 3H0KA 1PD0A 4FBGA 5IVKA 4S2EA 4EO9A 4OOEA 4RGYA 2PXHA 1CB7A 3R0IA 1J0XO 3IBSA 3UPVA 3BE6A 1C3JA 4A6EA 3KEQA 2ETVA 5E4YA 2DYSE 4G97A 3GVXA 1PG5A 1Z33A 3FHTA 4GPTA 4MRNA 2PCLA 3R3YA 1TCVA 2C7RA 2JD1A 2JIMA 4JLWA 4H1HA 2NAPA 5B4VA 3WX0A 3FROA 1P29A 3EPPA 3PH0C 4LJ6A 2H1IA 4O0LA 2WMDA 4LXTA 4IDBA 1Z3IX 2D0DA 4O4LB 2I6FA 2R59A 2R5NA 5AK6A 3E05A 3RVRA 4ZIRA 4PHTA 1PS9A 2WJJA 1R4MB 4Q15A 2E4VA 1X1SA 3WP0A 4RZ2A 5CDYA 1E6MA 5EWLB 1YBMA 3D4PA 4FU3A 3LBAA 2PJZA 2VHZA 3BK7A 9MHTA 3AWDA 3GUUA 3KJHA 1BU8A 3SJUA 3L6CA 4BMYA 5HIAA 3ZCPA 4J0HA 3LBHA 2AR9A 1VIMA 3FUFA 3L9XA 2CHVA 4L2IB 3MJSA 1FDUA 1ZOLA 1CT9A 4PTZA 2JBAB 4DR7B 2V7PA 1TZ2A 2AF4C 3UXMA 3BERA 1FFHA 1L6RA 3Q3IA 4AMBA 4A0SA 4JQCA 1H2ZA 5DCWA 1FTQA 2DVMA 1XCOA 3I9NA 1ZCAA 1O77A 1DKUA 5EZYF 1NW9B 3NQPA 3LXMA 4RVOA 1GQFA 2AS0A 2YZNA 3K1ZA 1Z5VA 3EASA 3BDVA 3R7LA 5CBKA 2YZMA 4V38A 5KC9A 1MX4A 3LVFO 4KLZA 5AQ7A 4KRXA 2KZTB 1KEZA 4J1NA 3OM0A 4DSUA 1GFZA 1FLVA 5LMUB 1CNFA 3DEIA 3QYJA 2AOUA 5EWJB 2JCVA 1OMOA 4NY1A 3KT0A 2XUFA 2YZ2A 1Z7YA 1JDSA 1ZONA 2FSGA 5DPMA 3KL2A 2KC7A 1J56A 1UBOS 3F5FA 3QSYA 4EFNA 5HJ5A 4XCQA 1X1QA 3C87A 4BJ6A 2J4BA 3ZYQA 1P0QA 4DLKA 4UPVA 5CA0F 4D57A 1W34A 1AN0A 1F6WA 4DM4A 4KPUB 5B7QA 4KDEA 1E8MA 4XEHA 3QARA 3H4MA 3H2IA 1RQRA 4BEBA 3ZWYA 5KYKA 3NHYA 2E3JA 2Z5LA 4BTBA 4DN6A 2JEKA 2J46A 3DZBA 3LCRA 1Z38A 3I0MA 2ZTLA 2OFOA 3C5VA 3IO3A 3EE6A 3AFOA 5A6SB 3MINB 4PIVA 5BSVA 4PPFA 2R5FA 1KVSA 3GLQA 4XE5A 2MSWA 2WILA 5G4LA 1PYDA 2QD5A 5HHTA 3AEKA 5AW1A 4Q7KA 3P4YA 1U4NA 2XEVA 4HOYA 5TJHA 3DFIA 3IVGA 4XGKA 2J85A 3WNCA 5SZIA 1G64A 2W2TA 4LWZA 3RHFA 4EENA 4J9VA 4KQ6A 3GT7A 4F3CA 3X2EA 4BKMA 3ZLBA 3D3WB 4P2GA 3S8YA 1UC4B 5P8WA 1R4NA 3BKWA 3DLBA 4H7XA 1HYBA 3SX0A 4LX0A 4RANA 4DB4A 4H18A 4AY4A 4LN1A 5KTOA 2ARKA 1SCAA 2Q8QA 2H2HA 4KAXA 1GRCA 3GR6A 5I3CA 1A5SB 3PFIA 3DO5A 1IDN1 4QIHA 2R2GA 2C4TA 4R1PA 4MVJH 4KE7A 4LNHA 3A9CA 4L1BA 3DDUA 1IXRC 3G0OA 1F2TA 1T1GA 2H11A 1W9MA 2CNWA 4IHJB 3W9BA 3KZVA 4Z0TA 1Z7BA 3M83A 3CVNA 3PUXA 3QVXA 3NDRA 3ZDRA 2IPMA 3B1FA 1N5OX 3W5VA 3SEQA 1XKXA 4C1NA 4DPRA 3KWLA 4MR8B 3ZV6A 3CEJA 2GKSA 2RGUA 5JJIA 2PS0A 3CNOA 5DRYA 2R6R1 3GBVA 1N3BA 3UT7A 5B58C 4KFCA 3CQ9A 1FCJA 3QLJA 1H9CA 4IEIA 3IV7A 1SURA 1FNMA 1T0PA 1BXKA 2J6HA 3EWIA 2AEMA 4IWXA 4FYXA 4EKGA 4ND8B 1Q6ZA 4YCLA 2H4ZA 2A0WA 1W85A 1DMRA 2HLDA 4EI7A 2WMYA 4HDNA 4M86A 1EPUA 1QRRA 2CXQA 4ZHQA 4TWBA 3OT5A 3K9CA 1YONA 4LOLA 5A4JA 3H1FA 3H5WA 5BVGB 2I4LA 4XOUA 4U7TB 3FKQA 4DMMA 2RC5A 2QV0A 4TLEA 3UHJA 3KB2A 4N8DA 3QVMA 3CLUC 1SFRA 3ZYLA 3ZWWA 2XWJI 1XU4A 3ORQA 1D4OA 1XRMA 2OCPA 1LK5A 4QM7A 3K5WA 2GI4A 2PZAA 1YTLA 4W99A 2ACEA 2RH8A 1J97A 2Z8XA 3DE7X 3DD1A 5DM1A 4RZUA 1C8LA 1S2NA 3SIWA 1D9SA 4N7MA 3MNFA 1NIPA 4RZ3A 5BW8A 2VBCA 4BNDA 4O1IA 2VT7A 2ZKLA 4GGOA 4TL8A 3FNRA 2IP1A 4YIKA 5I7FA 3ENWA 2B3DA 2EGHA 3UAYA 1SQ0A 2FCAA 4FZ5A 4JLOA 2A0XA 5JDCC 2QTGA 4G0OA 1KH2A 2OOEA 5B7NA 4R05A 1Z63A 3TFQA 2Z6VA 2I4OA 2EP7A 2QBYA 2EOAA 1CVRA 4WDRA 1VG1A 1Z17A 3EXFA 3R5TA 1WQ4A 2B82A 3CX4A 4IDHA 2FPSA 5C8DA 1DAPA 3RC9A 4RSRA 3D6VA 3NBAA 3WWYA 2PRSA 2W2LA 2N75A 1PW5A 2YJ5A 5I47A 3GFBA 2XJ9A 4WI1A 4P6VF 2HPZA 3WIDA 4U1RA 5DGDA 1L7OA 2JLWA 3R9XB 1AG9A 2O8FB 2JDID 3QP9A 4QGAA 2I1KA 4ANXA 3F49S 3HXBA 4LYEA 4P7JA 4WVFA 5KTSA 2AUMA 3IQWA 2IS6A 2X42A 4B32A 3NWPA 2V96A 3JX9A 5T8IA 4K3VA 3IAS1 5DW0A 3JYOA 3UT5A 1UUFA 2A5YB 4LNUA 4X91A 2XTJA 1EIZA 1Q0UA 1XRNA 3OJEA 3VDRA 4JA9A 3KKOA 5A05A 4GUAA 1BCSA 2BFDB 2QL7A 4TRRA 3DS8A 1QLJA 2FW6A 2GPNA 3G9UA 3ZXXA 1T6ZA 1M66A 5I7HA 2D2FA 5EIFA 3F6CA 1HEIA 3AJ8A 4F3VA 4HO1X 1GGKA 2AJLI 2ZCJA 4ZCPA 1U28C 3L04A 1J42A 2AXQA 3A10A 1SOMA 2EIXA 4MJ3A 4DXAA 3OO1A 3HXDA 5ITZB 2H4WA 4DDKA 3RASA 3OTNA 4O6FA 1ULAA 4AUNA 2MOKA 4JGBA 1GRVA 1T3TA 2YJTD 4MPRA 1LJLA 5CX1A 3S55A 4DPMA 1J33A 4GTRA 2WB4A 3O2SB 2QTCA 5J2TA 3C41J 4HNRA 3ML9A 3LJ3A 3BH7A 1RM4A 5LDGA 4PFQA 2H6HA 4YCJA 1N6NA 3K09C 2B20A 5ALDA 1QHSA 3N87A 4IL5A 1SZPA 2J0UB 2R5WA 2C03A 3HSSA 2HJ9A 4L5YA 4L95C 4LY3A 4PHFA 3WB2A 2B4KA 3HVHA 1GG2A 3EXEA 2YY7A 4XD7D 3E2PA 1K7YA 3O8QA 5A71A 3TI7A 4QBHA 1QCYA 4RY8A 2E87A 1W25A 1JR3D 4QHSA 4I9CA 4IGFA 4LQ4A 1CP2A 5G40A 3RH0A 4PLPA 3I28A 5E7MA 1N2IA 3KQKA 1FSSA 4OIFA 2O8VA 4MO2A 3PEFA 1P2DA 2P9SG 2O5EA 1Z6AA 2E4WA 1AX9A 3GOQA 3BIOA 1ND5A 5LX8A 2RSLA 3D9IA 4FUTA 5C4GB 1PTJA 4QAQA 1KXJA 4XYMA 2XXBA 1A5ZA 2WB2A 4LXYA 3OZBA 3GUHA 3HYRA 1N4QA 3EF1A 5ESRA 1N6HA 1ATZA 1I9CA 2V9PA 3RNOA 5COAA 2R8PA 3AIMA 3CU5A 3R7RA 5JAHA 2DQYA 4U9HS 1YA4A 3BCUA 2P9TA 4C43A 4QPNA 4TLCA 3RK0A 1L5RA 4UBLA 3TBKA 1NA3A 1AGRA 4NAHA 9ABPA 3SNHA 2A9VA 1UG3A 2JCYA 1XJQA 2VHJA 5JFTA 3OCWA 1GTVA 3ZWNA 4UNRA 1AUPA 1R0YA 1XVIA 1IVSA 3REGA 1W36B 3NU1A 1KYZA 4PYMA 1XX6A 2KATA 4XKBA 1D5CA 3BGSA 5B2ZA 1UQUA 1XTIA 2J3QA 3VYWA 2VSXE 2KZTA 2ID9A 4XSHA 1QK3A 2BSQA 3PGA1 3NWEA 4LXUA 2I78A 2Q41A 1ZCBA 4DG9A 5CERB 3APCA 1NFFA 2D6FA 2XYVA 2F7SA 2Z58A 1VL5A 4J76A 5IKEA 2PS1A 4QKQA 1NVDA 1KC3A 4N9QA 4WBNF 1YI0A 4N7JA 3AP1A 3IEMA 3STHA 3LTNC 4FGWA 3USES 4BL5A 2LRHA 3VR6A 4S1TA 5DHQA 3U4AA 3PTZA 1PBTA 2QORA 3QB2A 1FUKA 5HKAA 2WDPA 3NGLA 3DSTA 3M6MD 3NT5A 4NPHA 5IK2A 3SF4A 1RHRA 2VS1A 3QPUA 7AT1A 5CIYA 2V6FA 3N1UA 5LNK1 1UDRA 1SJ9A 3QWAA 1DEKA 4Y18A 4AYXA 2NU8A 4R2WA 4I1OA 5FEUA 2HO5A 3V2IA 3MM4A 1VSTA 4N12A 3MJFA 3RJ9A 2I54A 3ENKA 3CKCA 4U4AA 4F8EA 4UFNA 1YZKA 4XA8A 2EZ9A 4K6OA 4K9NA 3UYLA 4ABYA 1FUUA 4M76B 4JXXA 5H7XA 1QOZA 2RH4A 2JFXA 4Y2HA 1HX8A 3QKYA 1XNRB 4BGVA 4CCYA 3KEAA 2LP4Y 3LUHA 2RG1A 3RS9A 1MOQA 3DF9A 1G6KA 5ILOA 1Z75A 4WY5A 1UC9A 1ZXLA 5KBAA 1DT3A 2EFCB 2E1RA 2Q6LA 1L4LA 4FEEA 5TV2A 3HK2A 1GRNA 3VHLB 4NYJR 2FNAA 1B16A 1YS1X 4L0DA 1N0VC 3FMGA 4K87A 5KIAA 3CR7A 1A98A 1F9AA 5FFNA 3EHRA 2VL7A 1X77A 4WNAA 1CJBA 1SOAA 4GT1A 5H7PA 2FWMX 4QPJC 4JSTA 3RUIA 4AIRA 2ONYA 2HF8A 3M4XA 3QX7A 4P7BA 3JD2A 4ENTA 1II8B 2IBTA 1CUZA 5AOCA 5EIAA 3CRMA 1VP3A 3JQQA 1SVLA 5SY6A 4LWQA 1CTQA 2ENUA 1YU9A 3EFEA 2ZBFA 1Q0PA 2FEZA 1I30A 1UKBA 3BS4A 3HYLA 1U11A 2PEZA 5AP9A 3E1KA 1UBFA 4J6FA 3IMGA 4QOGA 3JYQA 5JSFA 3A3KA 4TXQA 1YB1A 3L0IB 4Q48A 4CM8A 1FVFA 4HTFA 3EODA 3PRKE 4Y0AA 3LIPA 4DCNA 4HWGA 3TKYA 4IYPA 3VSDA 1NN0A 4GA2A 2ZQYA 1EQ2A 2ZYUX 1KMHB 3TWXA 4IOLA 1KXZA 2JZCA 2QRVA 3PHLA 1MHTA 3GDOA 4U63A 5SZHB 1XN4A 5GOTA 1WY6A 3ENZA 2CE7A 3D3EA 3NNNA 1W87A 2ERYA 4U5XA 1UKVY 3I3OA 2H06A 3GHYA 4YDOA 1ENYA 1EG7A 4WZ6A 4KR9A 2R6DA 3BCSA 4F4CA 3DDZX 2GN0A 3TFOA 1MX9A 3HZRA 4CM4A 2ZROA 3RVPA 2WXLA 1WLSA 1Z25A 1G7CA 2UYQA 3T9AA 2XUZA 3DXZA 1JT9A 4JWTA 5HS4A 4OU5A 1C4OA 2HQSA 5EX0A 3HXKA 3GT4A 4W7SA 4PC1A 4CIVA 4HN9A 4MB6A 2RAPA 1XVUA 1IZZA 2YHCA 1WCIA 2KLBA 5B1IA 4CEIB 3RSHA 4BNYA 1U2RA 3UMVA 2EJCA 1ZVVA 1W7AA 3VNSA 4JOQA 4QWMA 2E2WA 1ZB1A 1NV8A 2HRZA 3S7BA 4EYOA 10MHA 3AM5A 4F5YA 4B6GA 4FGLA 5KOJB 3RDPA 3I5MA 1N5IA 5KX5A 3H6HA 4TGLA 3T1HB 4V1CI 3GVPA 3FFAA 3FBWA 3VR4H 1I5OA 4UM9D 2HC9A 1QAOA 2L42A 4ZU3A 2F00A 3KSRA 1HKHA 1E90A 2NVUA 4CCWA 3QYAA 1X74A 3ZEAA 2A0UA 2EVWX 4K6KA 4QUAA 3NZEA 1RR6A 3UJCA 2A78A 1I6LA 2DTXA 1W0CA 3T7RA 4KGDA 5B3KA 4ZVOA 2NU9A 2AV6A 2WWXA 1CR0A 5A5VA 4GKKB 2Q28A 1CS0B 3RLIA 3NETA 2PLRA 1FFAA 3MRVA 3U1TA 5LU9A 1UFKA 2BMWA 4BGIA 2PT6A 1CQPA 4NIKA 3F4KA 3NATA 2UDPA 3G5AA 2RI0A 2IW3A 3TLAA 1B14A 2JLSA 2W98A 1EESA 3QEJA 4LYFA 3R7FA 3AL3A 3VO1A 1YQUA 3N6XA 3A2NA 4AX4A 2KBFA 1WRBA 3SSAA 1PV2A 2RGXA 2Z6AA 3O2NA 2RH5A 1YR6A 1W94A 3D1VA 2ZJ2A 4L9RA 4KQXA 3JQAD 2H3HA 4UJ3A 3AG5A 5KNCH 1TN6A 3GLFA 4LTDA 4HFRA 2QJTA 1SK8A 1RRVA 4KLNA 3DJYA 2ECQA 3KQHA 2IT1A 1PG0A 2DXIA 3PL5A 2X7JA 2IONA 5D2MC 5FUQA 2QXTA 2ZKIA 3ASHA 3JWPA 5J59A 3C3CA 3FPLA 4O29A 5H70A 4WASA 3FFTA 2JBHA 5CHYA 5BORA 5TIIA 4AB1A 4WFQA 3L7IA 4LE0A 2YQ5A 1T8SA 3NGXA 3DEZA 1DC5A 3AOEC 4ZCQA 1Y4ZA 4KXXA 1P5HA 2O8DB 1A5TA 3HBAA 5KQMA 3TJZA 5B2EA 1VJTA 2RG8A 2B9EA 4OG2A 2F67A 1X80B 1XZEA 1U0EA 5BQPA 4R7ZA 2NT4A 5CW2A 3U66A 1DLIA 3WRVA 1KQPA 1VKRA 1SBZA 2BD0A 4EP1A 3K0EA 1GPJA 1KR2A 1X86B 3RKVA 2YWHA 4ZQCB 3R9MA 1PNQA 2IZ1A 4DK5A 2EWVA 2QVGA 3VR0A 3ONEA 4RGVA 2EL9A 2ZUTA 3DV9A 4CZ2A 2DHDA 1V39A 3IAM1 1GGVA 2H85A 5L3QA 2FFJA 5ALVA 2FSVC 5INTA 1XAHA 1B6GA 5HCNA 4F56A 5JZBA 3SNKA 3L01A 2PQMA 2Z3VA 4JA0A 2BEDA 4LZWA 4RXTA 2H1WA 2D7JA 5B7GA 3FJYA 4QUKA 5HF6A 1HE8A 3T1NA 1M6VB 1QH8A 3UKRG 1W5BA 3GRFA 4EB6B 1ISGA 1WZUA 1CUDA 1E96A 3K9WA 5EGSA 3L8ZA 2CJWA 4KIWA 2A59A 3SS7X 4CCAA 3KZKA 5C8ZA 1IC6A 3ZGZA 5FWNA 4EYSA 4F2GA 4NL4H 2Y1CA 4IGAA 3W3AD 2CLKB 5FWXB 3RRYA 3KBOA 5DEOA 2OQ2A 3HG0D 4GFDA 4MMYB 1WHSA 4K5BA 5B64A 1H23A 3JUEA 3EUFA 3B9QA 2CMHA 1EYHA 3R5XA 2I3BA 3RODA 3U48A 4G07A 5AXAA 3G6KA 3GGCA 1R0CA 3UC9A 4NAUA 1DGQA 4J90A 1YS9A 4ZOLF 5J5AA 3G0HA 3RRMB 3LQQA 2LW7A 2Y6VA 4MXDA 1XTUA 4Z6KA 1ZD4A 2X15A 1DJLA 3SZ7A 4HRVA 1N9AA 2NO4A 1DKRA 2VAXA 3L92A 2FMUA 3EYWA 1WXEA 1XHEA 1Q95A 4DUGA 2FOIA 3ZZMA 2H08A 1NIJA 2ZE5A 3Q7SA 3B7BA 2NUBA 5EXSA 4M37A 3ZN3A 5HJ7A 4RIIA 1TR4A 4AP2A 3QLEA 2H9YA 1G19A 3GRRA 4HRYA 3NHAA 4R5MA 5FHRA 4GPEA 2F62A 2W11A 2HDWA 2I67A 2ODEA 2IDMA 1IY9A 4C7KA 3FR8A 1ZJWA 4DNOA 3CJRA 4OV6B 3DVLA 4R2XA 4EZKA 3NVAA 4ENRA 4RX1A 2CMFA 1FPMA 3CT6A 1IEXA 4ZDWA 1E9DA 3HUFA 1D8AA 1GTRA 2IIBA 1WMAA 1YIDA 4FMDF 4Y1FA 4FSHA 5LXTA 2BHLA 5AJDA 3HB1A 1JWGA 1L7RA 3FMVA 4HWOA 4XWTA 3CLVA 3U7HB 2IKQA 1JDBC 4JC0A 2CHQA 1OFHA 2VF5X 1U0GA 3FOWA 4MUJA 1W0JD 1XT6A 4N5DA 2JJ8A 1YTUA 1QS0B 4F46A 3GELA 3TI9A 4YAUA 5KAPA 3CVQA 1J2JA 2X6JA 1Z12A 1RYNA 3R9KA 4RSMA 4N0EA 4Q9LA 3HBMA 4DV2B 3S5UA 4DOMA 2YY6A 2G40A 1PZXA 4B3DA 4I9FA 4LRZA 1XPOA 3ZCVA 1GU1A 1ILEA 1K08A 1USIA 3B60A 4UNIA 1JLKA 2AI2A 3SFVA 3N8IA 2PGJA 5GGYA 1Q83A 2X22A 1Q1AA 4ANFA 5H5JA 1QLWA 4CQJA 3I23A 3CVXA 3PNQA 3U4QA 1UBRS 3KPWA 4D3XA 3RJZA 2W6OA 1Z56C 2XXJA 1NKVA 2BMVA 3ASYA 1KL7A 4D43A 3IURA 3AB7A 1SBCA 2AX3A 4DJFC 4M3NA 4QHYA 2J9QA 5FUBA 2DLCX 4ODIA 3RS0A 3COSA 4MDEA 2A9FA 5ANLA 4QULA 1B8UA 3OEHA 2F64A 1E3DA 1PQPA 3UM1A 4P9NA 2FAXA 3I39X 5A02A 3D8NA 3VKGA 3D9HA 1VLHA 3OOJA 3Q8XB 1KP9A 1JRLA 2WWWA 3VU0A 4ZIRB 5BN5A 2J7PA 2P9GA 3T0FA 4RHEA 3RK6A 3T61A 4B6SA 1SC9A 3MYVA 1LPAB 3ZZTA 5EPUA 3UJBA 5JNUA 4G0QA 3KVOA 4QLBA 2QJWA 3WGYA 3LQKA 4JCCA 3HLTA 3ZJUA 3KQWA 3FYUA 2X4GA 3WLQA 1AZSC 4OJYA 5FBZA 2QT9A 3DO8A 1X7DA 1CZRA 3BDAA 3ANSA 3CGGA 3CWQA 4OBXA 4FHEA 4NATA 2OZPA 5ALPA 2ZCUA 5KSZA 1R0BA 2JGKA 2P5UA 1DAKA 1XKLA 3JQPA 1XC7A 1GNQA 4BFZA 4JJAA 4HS2A 4WZAA 4NXNB 2I29A 2E4YA 2H54A 1XDDA 2VTDA 1QFMA 1Q2XA 2OGTA 3N28A 1UFOA 1RS0A 2BDEA 3OPVA 1KY5A 5FPPA 3VVCA 2P91A 1P9OA 2CLOB 4UTPA 4QPDA 4ALLA 4QUBA 3TZKA 1VMEA 3R8CA 3IALA 2MDTA 3PJRA 1G55A 1TO2E 3IIIA 5C8YF 1RQPA 2X58A 5CMLA 1KC1A 4V0SA 2AOUB 1Q1ZA 1C7IA 1B23P 1DCQA 1QWOA 5JNRA 3H87A 4M1TA 1J23A 1WKVA 3WOHA 1DC7A 1RYHA 4B4DA 4PRYA 1NW7A 5IARA 4MYUA 4BLUA 1ZHFA 4LY0A 4LDQA 4ZQFA 3WNBA 1E1KA 3BILA 1I1NA 3URKA 2BFPA 3UMCA 3DA8A 1ZGGA 4OVKA 2QE7A 1JHVA 3PHBE 1QHIA 1RXUA 5HMLA 1C7FA 3Q11A 1E6CA 2QYJA 1W1IA 3W8DA 1PR6A 4BATA 1WHTA 2B34A 2GBLC 4IVRA 3L6UA 3VU1A 2J5BA 5EJ9A 4REOA 4H7KA 3IE2A 4ALMA 1VOTA 4UQYA 4B8WA 1HLPA 2H5LA 4MHTA 5JE8A 3ILXA 3C3AA 5BUCA 1RZVA 1EB8A 3DV0A 3V4RA 4HLDA 3UXYA 1QR6A 5LIPA 4JW1A 2ZVJA 2ADOA 3JD3A 4B85A 1MGOA 3AEKB 3L8EA 4DLWA 4XJXA 3QJYA 5EMNA 3HVUA 3F73A 2ZXWE 3ENVA 2DKOA 1VL8A 3DYIA 1R4NB 2V55B 3P2IA 1YJXA 3WP1B 1V35A 3UHFA 1CD5A 4MW4A 3C43A 3VTXA 3FMFA 1DWUA 3L4BA 3UB2A 4IMIB 1Q7EA 2IHBA 2D1TA 4O2AF 1GCGA 2VJDA 3VM6A 4BFXA 4MP3A 4AUEA 4L02A 1W5TA 4EHDA 3ZHEA 2ZSKA 4RPJA 5AWFC 3C8MA 2F9LA 4MW2A 1CB0A 5GZ6A 2TMYA 5EZQA 2YDXA 1F2TB 1DKMA 4MMZB 1QUFA 1KGDA 5KJ1A 1UCFA 4W5OA 1PW7A 1LGYA 4ENUA 1GPYA 4LQCA 4P86A 1ICEA 2X6HA 3GJ0A 3NCTA 2YWGA 5K3FA 3UKOA 1QG4A 5DTEA 2M6LA 1U7TA 4Q9HA 5A3RA 2GKOA 4HH4A 4R40A 2ADMA 4E12A 2Z2IA 1SKYB 4NK4A 3D2LA 4MB0A 3VI4B 4RY0A 5BRAA 2BKXA 4I36A 5BXUA 1M74A 3IIKA 4HRXA 4KPEC 1JFLA 2PQ0A 1W46A 4MS6A 4W4TA 3M89A 5JJBA 2B8NA 2XVXA 3GGSA 5CEEA 1HDXA 4GXQA 4CIBA 3T5XA 1W85B 5ICEA 5JH7F 1RBYA 3PDUA 4HDNB 3MWGA 3ZU5A 4ZHQB 1NBIA 3NJ4A 1D0SA 4Z9AA 4BC0A 4NF2A 3CEPB 4L9WA 4Z9XA 1ORHA 4JX8A 3S99A 1RAGA 2G4CA 3DKRA 2H9AA 1WAO1 3KD3A 1CUUA 1CUBA 2IP4A 4RF4A 1JLHA 2DUNA 3KQNA 1FFSA 5JEEA 5H3CA 4GTOA 1BU9A 1XYVA 4JSRA 4RKWA 1U8FO 2XCCA 5FADA 3FWVA 1ABFA 5IDXA 4IXTA 4WT7A 3PKZA 3AI3A 1B6RA 3QLUC 5CB4A 3IOYA 4KQHA 2XCUA 2B7LA 4R7TA 3BWBA 3OTOB 2VWPA 1Z2EA 5KVVA 1BIFA 4ILEA 4BNDB 1GGEA 3WA7A 1FZTA 4LWOA 1A9YA 4WFKA 2YFQA 1N33B 2I1QA 4KVAA 1OXJA 5C35A 3DMTA 1ETHA 4I46A 1AHHA 4F7DA 5CVEA 1DC2A 4FBLA 2XODA 3ACDA 4LHYA 4LCEA 1W6UA 2GFHA 3PGLA 3SBXA 3HO8A 3NOXA 1GFIA 1R0KA 2VNKA 4QOHA 1WXXA 4E5NA 2QBYB 3FU6A 4F72A 2VF7A 3HCCA 1NPYA 2EL7A 1PYOA 1BNCA 3EXFB 4H3VA 5TS3A 2IU3A 1E89A 5KSWB 2QY9A 4JR2A 1XTBA 1VDMA 1S0UA 5DSXA 2JCXA 3AESA 1O1YA 1CQIA 2LDBA 4FVTA 1RWXA 2F43A 4H3HB 1E7UA 3CVYA 2RAFA 1K4MA 1PL6A 1Z83A 1ZX1A 1ZIXA 3ZKJA 1KS2A 4POOA 1R8YA 5F2KA 3BZWA 4LXXA 1ZM4A 4B80A 1I51A 3WGKA 3T99A 4Y0NA 4ATZD 1YFJA 3BG5A 4BQNA 1EMDA 1RCUA 5T6MA 2XA9A 3Q3EA 4N01A 3HYMB 2WWTA 3UWKA 5M34A 5DN6D 4IS3A 1T8UA 5A3JA 3UT5B 4WLVA 4KITB 4LNUB 2PJDA 1A2BA 2VLBA 2HA4A 2P6MA 1EGHA 3UXHA 2VHTA 1BCSB 1M2GA 1D2NA 5ICMA 4HVCA 1KY4A 3MVEA 3MOGA 4TZKA 3BWXA 2X3MA 2EG9A 1IMJA 5JMND 1DJMA 2HBZA 5LLSA 3IEGA 3ABSB 4X60A 3R6LA 3ZPXA 4ZJZA 1A04A 1DAEA 1NVAA 2XMPA 1BQ3A 4I2NA 1G98A 3DPYA 1S2GA 4Y3UA 3B2QA 3JYLA 2I9KA 1ZCZA 2CHZA 3GLHA 4DQVA 1MPXA 4JVMA 3DLHA 2QTMA 3OPYI 1Z5SC 4O4HA 4B6JA 3IUBA 3BJRA 4IIXA 4KE9A 2W90A 5BQOA 3CX6A 4ILKA 3ADOA 3JQBC 2GYWA 2X6KA 4BKUA 3W1VA 2VUSA 5D1HA 5CX1B 4OUKX 3DBIA 2H8KA 3SX4A 4YJGA 5J2TB 4I8XA 2XE4A 4LYJA 2MWMA 2NXNA 2YV2A 2D7CA 4M1SA 3G2JA 6ABPA 3TGOA 2DGDA 4XTRA 2IDZA 3NXKA 3LCJA 5GGXA 4OOFA 1GAWA 2FZ5A 5DK6A 1XTJA 1QZ2A 3IMFA 1FU7A 5KQGA 5K1ZA 1MYOA 2PLNA 1ETUA 3W5DA 3FUJA 3T5DA 2C7VA 5HP4A 3EXEB 2AZ4A 3PGXA 3KAQA 2VO1A 4Y6OA 1PDVA 3O8QB 5LWHA 4KH1A 3DONA 4PZCA 2A9RA 4X1KA 1EQUA 1GZUA 1D2CA 4DUZB 1HSOA 1VSVA 1NI3A 3ZNOA 2ZAMA 3P71T 3N75A 1O96A 1MO3A 4JL0A 3NUZA 3QJZA 3KZMA 4M87A 1NMSA 2CD9A 4MYCA 3WOVA 4IMPA 3FNIA 3RVBA 2VAWA 3P9CA 4URKA 4IFTA 3AIIA 4EBAG 5LOVF 1B41A 5KMGA 3J81A 3DZKA 1OY1A 3THOA 5LBIA 5AI9A 1C1XA 2BI4A 4LRSB 2ZYIA 1LS1A 4E6EA 1GA1A 4DVJA 3HHEA 1JIQA 4DX2A 5HOEA 4IIEA 521PA 4J16C 2J30A 4REQA 2HLHA 4UU0A 5BNZA 1Y3CE 5CDFE 3HCNA 4I1RA 5LA6A 4C7VA 4BQPA 3LFHA 3I61A 5I8WA 3VLEA 1ZVMA 2HEIA 4PLZA 3PV0A 1SBTA 2UXBB 4PYOA 4XEIG 4KXKB 3G5MA 2FG6C 2XX3A 2Z3ZA 4RZHA 3IP8A 2XWSA 4DJEC 1XD9A 1DOAA 1NL3A 1X1TA 4PWZA 3AGPA 3JYSA 3S6JA 1LLFA 4L51A 3LBFA 1AGYA 2XDYA 3OZTA 1ZU5A 1Z74A 4INAA 1I14A 1VP9A 1FRQA 5JMWA 4AO6A 3LC1O 3CB2A 3NYWA 3DAHA 3GJ7A 3R7WA 2HWWA 4OHFA 5DNWA 1FB5A 5IVIA 3DBVO 8ATCA 3KLBA 3HXQA 4AFNA 1DARA 3IDQA 2HXSA 5EMMA 1DFHA 3A6GA 4JBNA 1QFYA 2PSJA 2X1MA 2WV9A 3EYAA 5CGZA 3HBFA 1E8ZA 3V7NA 5KPDA 1XEWY 4R7LA 1ZMOA 2HA3A 3BUAA 221PA 2AG5A 5E7IA 1ZGJA 5TMEA 1QBQA 1N11A 1FTYA 4XD2A 5ULLA 2PPVA 4BVEA 2GYUA 4PSVA 4NZOA 1BE0A 4XM2A 5KVSA 1LD8A 4BO3A 2IYQA 4RTSA 4M98A 4KZPA 1KI8A 2IKSA 4YGXB 5B1EA 3F2VA 1BKYA 4RV5A 5LQNA 1D2MA 4FGZA 2NU8B 4I1OB 2PUEA 4IKPA 3U3JA 2Y05A 3PNBA 4OGLA 3VTZA 2DFNA 3ULYA 3GX1A 1RJWA 3ORSA 4B1FA 5J4VA 2YRXA 3O4IA 2ZIWB 2WUEA 2EQBA 4FEAA 4UATA 5BN4A 4LUCA 3AF5A 1L5LA 4CCYB 2IY0C 4IH4A 3SK0A 3K1AA 1C0PA 3D6FA 3D81A 2YH2A 2E82A 1JAZA 1NN5A 1UEJA 3EFOA 2GM9A 2FOLA 5T7BA 1MC1A 3DR5A 3ILYA 1TCBA 4WLOA 4RS4A 4WCDA 5KKCA 5B7PA 1EA5A 2B5VA 2Q7DA 2QE6A 3FCYA 4MDFA 3ZW7A 4OL9A 2V8BA 4UULA 4C0BA 1GCUA 4B4WA 2VJCA 4WNAB 4ANUA 1FSFA 3L05A 2QRLA 1JR4A 4L85A 2HE0A 4B3MB 5CLJA 3HGTA 1AM4D 3AUUA 1E79D 4GMGA 1K7FB 2VPYA 2IVFA 5LBTA 3KHTA 3CZMA 1XG5A 4MUNA 1OFGA 3LPMA 3FLBA 16PKA 1NDHA 3KPYA 4MVJF 5A4MS 3UMGA 3B51X 2A88A 4ENWA 3ABZA 4MGZR 2Z56A 2RC6A 4CM8B 4HTFB 4H1TA 2YJZA 4ZT6A 4H7FA 1D0IA 1N0QA 4P3NA 3WJ2A 4ZA2A 4FWIB 4JP5A 2G4LA 4EM6A 4DDUA 2VRBA 5KS2A 4AQYB 2QRVB 1TKBA 4QQ8A 3QVWA 4OMFG 2EHDA 3IESA 4RTNA 2XQVA 4MV6A 4YB8A 4WJLA 1T2CA 4PAWA 2P1RA 4TXPA 5LLTA 4EA7A 1IHUA 1TK9A 5F64A 4CM4B 4NZZA 2JVIA 1I01A 1LLDA 1A8UA 1Z37A 1EI9A 1TMYA 3P9ZA 1PIWA 5DWDA 3MTAA 1AC5A 3A14A 4PO9A 3CRVA 3RBAA 4NS1A 5AD1A 4QHTA 3F5SA 4HAUA 4FWTA 2UUOA 3OZCA 2NUAA 1WCIB 2WOOA 2ZJ6A 4OXRA 5K45A 2WT8A 3UG6A 1ZWKA 4ZRNA 3ZWAA 2O07A 4AAYA 1UK9A 1HYEA 4PYIA 2HFKA 4BNKA 3WTBA 2WFAA 2DSTA 3PZ1A 4LJ5A 2XTNA 3OFSA 1FTSA 1HOXA 2O8EA 2P2NA 3TSAA 1Q57A 2VP2A 4L8WB 2XMCA 3TDNA 3G59A 4HEHA 1X1BA 4A0FA 1II0A 4W1SA 2H1LA 2ZEJA 3X0DA 5TPWA 3RFCA 5KX5B 3O4FA 1U4SA 3IR7A 1EFUA 1MT3A 3PR2B 2JI9A 4WUTA 3BMNA 3KOYA 4KYIB 1UKEA 3MTGA 4X7MA 3OTIA 1XR3A 4AIIA 1OLOA 2D4HA 2ZAOA 1PL8A 2WYUA 2JGDA 2NVUB 4NDAA 2O8CA 4TTSA 1Z5OA 1H4QA 3FUCA 1YS6A 1P2SA 1IEVA 1KA9H 1NQVA 3VUEA 2YUTA 2JFFA 1C41A 2ASVA 1POXA 4RV9A 2WHRA 1X7WA 4AQDA 1Y42X 3DULA 2NU9B 3INNA 3WLEA 5K20A 1RI3A 4JJZA 2O7VA 4M9XA 4G37A 4B73A 2IEZA 1NXPA 3CF6R 3TL3A 3MMXA 2BFEA 5ECYA 2IV2X 3DCYA 1U2SA 4D4JA 1GGMA 3O4VA 3B5IA 1S4MA 4J4BA 4QBTA 4XVRA 3WNQA 1ODLA 2GN9A 3AUYA 2CLCX 2ZM6B 2H4HA 2F37A 5GONA 3GXBA 5LU8A 5ITVA 4YRIA 3DVQX 4CTOA 4J29A 3B5EA 5FDFA 1ZH4A 1D4AA 5ED0A 2H6IA 3FWNA 2HZ7A 4BQRA 1EA7A 3GLFB 1E9BA 3N0XA 2FR1A 1H4TA 4BVFA 4ZU1X 3U37A 2E55A 2SKEA 4I5FA 4BGDA 1NZJA 3KJFA 1AHIA 4AMGA 4WADA 2WU1A 4YYZA 1N6LA 1H4SA 3L8DA 5TGTA 3H8WA 1AH2A 1OXTA 4X44A 1YZGA 2ZUVA 1I94B 1IYZA 4DYDA 2E5LB 4KO4S 8OHMA 3E18A 5AO9A 3UQYS 3NBQA 4XQGA 2HRRA 2OXCA 5E3IA 2FH5B 2VZ8A 4OK5A 1FQOA 4TXLA 3VR3D 2B4YA 4AJ1A 4E70A 2JIPA 1B8OA 2YWXA 1J24A 2NTJA 1XSEA 1H05A 1Q19A 4I1YA 5K51A 4C29A 1E1MA 1V43A 1U8EA 2CMDA 2OB1A 4WLNA 4YRPA 3CRRA 4TSRA 3TXXA 1S9HA 4EL5A 2BRUC 1G3RA 3Q41A 2CYBA 3WK7A 4G0XA 5ARFA 2M2IA 1V6CA 5DSZA 5EMHA 2G0AA 3T4PA 1CR4A 2WIGA 3A9WA 4DGSA 1T9GR 2RGEA 5L3QB 2WIJA 4MYSA 3WYFA 1C0IA 2DUJA 3JQRA 1WD5A 3IO5A 1XQYA 3X3HA 3FNQA 1H22A 1P7CA 1RTTA 4MPPA 1P2TA 3WLLA 2PA0A 2FI1A 1XQ9A 2AVDA 4AJNA 3P9XA 4EY6A 4D44A 3C45A 4Q18A 2CG2A 3ITEA 1IBLB 3H13A 1O9BA 1QIFA 1HE8B 2JFZA 5DWQA 1QH8B 3T34A 1YVPA 1DINA 3KE9A 1E96B 1CK4A 4QDXA 4DA7A 2CJWB 1PK7A 5K8JB 3UXGA 3IA7A 4J0FA 2FLKA 3TMYA 4YAWA 1KDZA 3PGKA 2VUUA 1F2UA 1IN1A 4TWRA 4I55F 3S7JA 4F45A 4JB8P 4OQNA 4F4IA 1PQ4A 3GJ6A 1WHSB 3HZOA 1GLNA 1T3ZA 1NSFA 4WMLA 3W5AA 3OCZA 3ZXPA 3T8KA 4FFNA 1HX7A 4RMHA 2WWFA 3X2SA 5IKPA 2C0CA 4BO8A 2PIDA 1FYFA 4IDDA 4QSMA 1ZJJA 1IAQA 1ACJA 1S2LA 3F6RA 2X7HA 4QOJA 2E18A 2EFEB 3VTKA 4C6RA 3C14C 1HURA 1P74A 3O74A 4IX1A 3WICA 5DHFA 3SD5A 3WGIA 5JYDA 1Z2DA 1YF3A 1D2AA 2L0TB 2OL4A 4FTWA 2QTAA 1JSZA 4IDEA 2AZTA 2X8JA 2IEDA 4LCBA 1QIGA 4Z2YA 4WWHA 4NYMR 1M0WA 5CFMA 2YV5A 1VJDA 3K05A 4C0QC 5HYVA 5B36A 3U7GA 4AVXA 2AT1A 2JPDA 3BIFA 2WVIA 4E4YA 2MRIA 3O8NA 4H77A 3TOXA 3DPUA 4EA8A 4XRRA 2WP0A 4EUSA 3BK1A 1PE0A 4B3XA 3E70C 4CM9D 5IKXA 4RG9A 1JALA 4ZJPA 4QYSA 3LGSA 5C2YA 3ZJ5A 2LUOA 4EX6A 2Z8ZA 3F98A 5ARCA 2ISCA 1TQ2A 4JWKA 3ODGA 3DLPX 3ZDFA 4YROA 4K1LA 2Q5JA 5LXTB 3L6RA 2J9ZB 1UPUA 3INGA 3CY6A 1J8VA 1D1SA 3F97A 1A7UA 4QATA 1GQOA 5KCZA 1T9DA 2PGXA 1W9HA 3QMPA 1XDUA 4MI6A 3WMRA 4F3TA 3UZUA 4BSXA 1U7UA 2PX4A