2XGMA

Substrate and product analogues as human o-glcnac transferase inhibitors.
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
512
structure length
512
Chain Sequence
PEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
total genus 190
structure length 512
sequence length 512
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgmA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgmA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgmA02
2QRMA 4WNFA 2PRJA 3OXGA 1K08A 4G24A 1P29A 4M83A 4HLNA 1Y8ZA 3D0QA 3MQFA 2PYDA 3RKVA 2QLLA 2BFWA 3LYAA 3S27A 4MRAA 3UPVA 3BD8A 1L5RA 4YVOA 2VYIA 3EDTB 4YUAA 2Q6VA 3ULQA 3SZ7A 4HOTA 2C9ZA 5HXAA 4I2ZA 3T3GA 4N3CA 3TAXA 3RSCA 1GG8A 3ZCQA 5FZSA 1H5UA 1ELWA 2IV3A 3T3EA 3CUUA 1L5QA 5KJNA 3GZ1A 3AMVA 3IAAA 4BWRA 2JZCA 4GYWA 4KBQA 2QN1A 2PRIA 1FCHA 4BTBA 4GYOA 4J8DA 2JLBA 4U0ZA 2J9QA 1KT0A 1IIRA 2F9FA 4U0SA 2PL2A 1GPAA 3QDNA 2DBAA 4H7XA 2VCEA 4BTAA 5FZRA 1FU8A 1OUVA 3NB0A 3IEGA 2HY7A 4EL0A 1KT1A 3WADA 2PQ6A 3L01A 3Q15A 3G2IA 4I9CA 3CEQA 2GT1A 1EM6A 2YJNA 4AIFA 5LCWJ 3L7CA 2HO1A 3ASHA 1FU4A 4G25A 4Y6WA 2LSVA 3UQ3A 1XV5A 2C1ZA 4GPKA 1YA0A 3MBOA 4UQYA 4Y6CA 1IXYA 1GFZA 3TSAA 3ZGQA 4GCNA 3CVLA 3L79A 1L5VA 4BQIA 1A8IA 1V4VA 4GCOA 2R4UA 3FROA 4GA2A 2VCHA 2IF4A 3Q4AB 3DDSA 3RO3A 4NEQA 1L5WA 2C0MA 3KD7A 4EKYA 3MA5A 1B4DA 5C1DA 3G2JA 2FF4A 1XL0A 3Q3EA 2ACWA 2O6LA 5TVGA 2NC9A 2F3SA 3HBNA 4F96A 1NZNA 1GGNA 1HZ4A 4APOA 1RRVA 2R60A 1Y6FA 4NESA 5DXFA 3UUXA 4U04A 1NOKA 4GA1A 3MS2A 4X7MA 1SXQA 4UQXA 5TMEA 1Y8MA 2IEIA 1EXVA 2R4TA 2XA9A 4N2QA 2IFUA 2VGYA 3OKCA 2KATA 2V5FA 3S7BA 1NOIA 1WV1A 3CX4A 2QN3A 3DD1A 1SXPA 4N39A 1JG6A 3LY8A 3KS2A 3MT7A 3OXFA 2MHKA 2P6PA 3FP3A 1L5SA 3PE4A 4NRHB 4B94A 2IYFA 4FZRA 4X7RA 4WUYA 3AS4A 4I1AA 3NCHA 3S7JA 4X7PA 5BW8C 4HOSA 1PYGA 4HOUA 3VTYA 1GPBA 2IUYA 4N9WA 2X0DA 1ABBA 1XC7A 2UY1A 5A6CA 4WNGA 3RJVA 2XEVA 1PNVA 5ARFA 1UQUA 2GPAA 3BCSA 5EKQD 2G9RA 2XGMA 3MTAA 3CV0A 5D0QD 1Z62A 4RG6A 4ME2A 2IV7A 5JJTA 8GPBA 3CUTA 7GPBA 5G05J 2UY1B 1HXIA 2IYAA 2SKDA 1KTIA 2R5SA 3CKCA 3C4VA 4AMBA 2YHCA 1XL1A 2AW3A 3DZCA 4M60A 1NLMA 2ACVA 4RBNA 2XCIA 4YNDA 1LWNA 3T3DA 4KYOB 2XCBA 3T7DA 2FFRA 3SYMA 3OT5A 1QKJA 2X0EA 4J0UA 1RZUA 2SKCA 2WQHA 1ZBPA 5G05C 3OKAA 3NPAA 2IEGA 3NP9A 2QN2A 1P5QA 5TMDA 3TG4A 4XI0A 3H4TA 3FWVA 2X6QA 3GPBA 3GUHA 4KQMA 2C0LA 3MTDA 4N3AA 1QM5A 2FBNA 4U07A 1WV0A 4RENA 4G2VA 1P4JA 2PQNA 2F3PA 3CV3A 2KCVA 2LNIA 4I2WA 3E3LA 4MI6A 2WTXA 2E2EA 1P4HA 4WNDA 4F97A 2F3QA 4REMA 1WUYA 3ESKA 4EKEA 2XGSA 2VSNA 4BT8A 1IYGA 1BX3A 3LKUA 3Q49B 1VGVA 2GJ4A 4EL5A 2JJMA 1QQEA 3BEOA 3ASGA 4BT9A 5CCLA 3COPA 3OXLA 3RU0A 1C8LA 3OTHA 4XIFA 5FJYA 3ZCRA 1P2GA 5D0OD 3BCUA 2QN9A 4ABNA 2AMVA 2GPNA 3OTGA 4MHSA 3DDWA 1Z6PA 1IHGA 2VGXA 1FTWA 3BD6A 4W9RA 1UQTA 2BGUA 3OKPA 5LCWC 1K06A 5AYWD 4F3VA 1O6CA 1GPYA 3QWWA 3L7BA 3MTBA 2FETA 4YVQC 3MSCA 3PDNA 5ARGA 2QN8A 5LQDA 1Z8DA 2GM9A 2H1HA 3CUYA 2G9QA 4CTOA 3PE3A 2XCUA 3CKBA 3C4QA 1E1YA 1P2BA 1Z6QA 2ONDA 3QWPA 3ASFA 2VGXB 3MRXA 3Q3IA 3G2LA 3N71A 1RZVA 2GEKA 3MT9A 2BUGA 3S28A 1PN3A 3G2KA 5KJKA 4J8EA 4HOQA 3EBPA 3CUWA 3D1JA 3RT1A 2HYZA 2KCLA 3MV3B 3VUFA 4RELA 4H7YA 3BCRA 5IKPA 2QFCA 4JA9A 1LWOA 1Y6GA 1C8KA 3O3CA 3HBMA 5BT1A 1WW2A 1FTYA 1GZ5A 3EBOA 1NZDA 3S7DA 4WNEA 4CGVA 5DLDA 3ZCSA 3G2NA 2QZSA 4AN4A 3QKWA 3ZCPA 3QHPA 4G23A 3L7DA 3Q5MA 2C1XA 4UI9J 4N2SA 3MKRA 4LDPA 3CEMA 4Z5XA 4GZ3A 3AS8A 3CEJA 5G04J 5D00A 2XGOA 4JL0A 2QN7A 5TMBA 3QOUA 5JJ6A 3U4TA 4WHMA 5JJ7A 4G1TA 3SF4A 2QLMA 3T3HA 1UZUA 5JTUA 4KXKB 4MICA 9GPBA 1F6DA 2PYIA 4NQ0A 1J39A 5HQ8A 2ASVA 4UI9C 2KS6A 3VDNB 1PSWA 4YI5A 1WAO1 4MI9A 2QNBA 2OOEA 5G04C 1FA9A 3GZ2A 2QRGA 4KQ1A 3T3IA 3OY2A 4J8FA 3RO2A 5HI7A 3MT8A 1TJCA 2OFFA 4WADA 5CHEE 3WC4A 2AVPA 3LY7A 2HR2A 5DU2A 2BGTA 2R68A 3UYLA 3CVPA 5GPBA 3TG5A 1XKXA 1WM5A 3BEEA 5JTTA 4YI3A 3G2HA 4CGWA 4BFCA 4U0UA 2BISA 5KJMA 1YA6A 5EX3A 4NC9A 3E3OA 1WW3A 3D0RA 2QRHA 4IN3B 2FF5A 2GPBA 4X6LA 2FI7A 4AY6A 3NC4A 3TGOA 3E4BA 3JYSA 3S7FA 4CDRA 5A7DB 2VSYA 3RIBA 1L7XA 4RIEA 2X0FA 1FC0A 2ATIA 2XCCA 3QWVA 2Y4TA 4A1SA 2LSUA 3E3NA 2QRPA 2KC7A 3BDAA 4W6QA 1JIUA 3ZCVA 4G2TA 3CVQA 4LEUA 3CK7A 3ASDA 3ZN3A 2L6JA 5M72A 1ZU2A 1WUTA 2P58C 3URZA 2PQRA 5BNWA 1A17A 3VUEA 5EX0A 2FEZA 3GYZA 3HBFA 3R9AB 4PQGA 2XMPA 3CVNA 4RIFA 4QLBA 2ECPA 1ELRA 4I9EA 2H1FA 3VTXA 3OTIA 3H4IA 5ENZA 3WXXA 3MRTA 3O48A 2X6RA 4M7PA 2C2LA 3NP7A 1L6IA 4BQFA 4MI3A 3HYMB 3S29A 1NVKA 1AXRA 2G9VA 1QZ2A 3OY7A 1YGPA 4GPBA 3Q47B 4RIIA 4AMGA 1JIVA 2ZB2A 4RIHA 3MS4A 2IW1A 5FT9A 4I17A 3WAGA 1NZFA 4FKZA 3LPZA 2VQ2A 2GEJA 2VG8A 1XNFA 3S2UA 4EJ2A 1E96B 3CUVA 4GZ6A 3C48A 3NAZA 3FFLA 5DBKA 1F0KA 4JA7A 5DIZA 1C3JA 4GZ5A 3CK8A 2G9UA 2QRQA 3RHZA 1W3BA 1PC2A 1E4OA 2XPIA 1JG7A 3MEKA 4CTNA 4AM9A 2C4MA 1B89A 1NA0A 4XI9A 4UI9K 5CCMA 1JIXA 3VDMA 4AY5A 3MS7A 1HLFA 4HORA 1FTQA 4LEIA 3LCAA 4CTMA 4MHOA 2Q7FA 3HBJA 2R66A 4UQZA 4F9FA 1FS4A 2WPVA 1AHPA 2GW1A 3ZHEA 4N5CA 5IKOA 3IA7A 1KLXA 1JEJA 4HWGA 3GW4A 3CEHA 5D01A 2XA1A 1NA3A 2QLNA 4KQ2A 3SYRA 2FO7A 1C50A 1NOJA 2SKEA 2XA2A 2KCKA 2YQ8A 3T5TA 4BQEA 4RIGA 3Q3HA 4G26A 2Y4UA 3ZHEB 4RG9A 3KAEA 3ZFWA 3K9IA 1FU7A 5KJLA 3TOVA 6GPBA 2AZDA 3ZCUA 5I45A 2PZIA 4GA0A 1P4GA 2AV6A 3CK9A 3LY9A 3L7AA 3RSZA 1M5RA 3BD7A 1P2DA 1HH8A 3U3WA 1XOIA 2F3UA 4WACA 2UWJG 3AS5A 4GYYA 4JHRA 3QKYA 4N3BA 5FZQA 4O6FA 4L22A 2I6HA 3NF1A 3MV2B 4EQFA 3ZPJA 3MRVA 5FTPA 3UYKA 3ZCTA 3S0JA
chains in the Genus database with same CATH superfamily
2AOWA 5CLLA 5BOVA 3D9PA 3PUJA 3H11B 1L7BA 4EAAA 4WESB 4UBKA 1TTTA 3M6IA 4NIMA 2BM0A 4BO6A 4L9SA 2PS3A 1D4AA 4DIFA 4PNHA 4R05A 5CDHA 1SXHA 2AOXA 1L5YA 1PT8A 2C8JA 4W5WA 2V03A 2YWEA 4QD3A 3DDUA 2PBZA 1WF3A 1ESNA 4XUGB 3OCJA 4AIFA 3BB1A 3VYSB 2VBIA 3GX1A 4X3CA 2W6QA 3SQOA 1JBKA 5CNIA 4GTVA 2HTFA 2J31A 2B5WA 1D4FA 2GJSA 1V95A 2B21A 3IAS1 3QPVA 5JYCA 3PUWA 4AQYB 3P20A 1I33A 2QT9A 1X7YA 1WSBA 3P0JA 4F1WA 1FYFA 3U09A 3AUXA 4AT1A 2PUTA 5K8JB 2JFYA 1G1AA 5DW3A 1XCJA 1Y89A 5CGQB 2Q5IA 2V97A 2G63A 1NNSA 5LBIA 5JPCA 5D51S 3ANYB 5A6CA 3QXSA 3DE1X 1JB1A 1V41E 4M9QA 4UARA 2VZEA 5D2MC 2XOEA 4PBSA 1YDWA 2XZTG 1XL1A 1WUHS 1FP2A 3GLKA 3HBLA 4HVCA 2ZRJA 3QAQA 2FUNB 1PG5A 1DB3A 4WZBA 4KAJA 5EGNA 1O8BA 2LZ0A 5TMDA 1XJQA 1T9DA 3EC2A 1KZ6A 4WGGA 2M63A 2Q3FA 1EFCA 5JZOA 3UANA 4N48A 3KZNA 1NVTA 1DRVA 5JS7A 4LPSA 2IHKA 3D6UA 3PKJA 2GJ4A 2ZM6B 1NJ5A 8MHTA 1FDWA 4GXNA 4ZJPA 3R7DA 4D92A 3O91A 4PVCA 1MRSA 4ZTZB 5FI5A 5I4CA 3HUFA 5JMWA 4HQKA 2XXJA 1KZYC 2BLNA 1N9AA 5AVJA 4IDCA 1IBMB 1I3NA 3DR5A 4YRFA 4RHUA 4F2DA 3FNRA 4IJQA 2FCAA 5LA6F 1WHSB 1XYVA 2BWJA 4PWYA 4LF8B 5BVHB 4JH0A 1XD2B 2C1XA 3V79K 3W78A 4LDPA 5F5NA 3D1LA 4D4MA 4JL0A 4K9NA 1JAXA 3KZCA 4LI3X 1F2TA 4QJIA 3ZDAA 2Z09A 4U2BA 1VJ1A 2VUHB 3B3QA 2D0PB 2WFLA 2IBTA 1J90A 3RJMA 1A9TA 1TKRA 4ZEVA 2QTAA 4XQEA 1U2EA 2XS8A 4MKFA 1UMBB 3HU1A 1CUHA 4KXYA 1UCFA 4P3XA 1RYMA 1RAFA 3AM5A 1BN7A 5CDYA 1CNFA 3GEDA 1GXSA 3C7CB 1QCYA 2I1LA 4A1SA 1FW8A 3WJAA 4X1IB 4BFLA 4ZEWA 1F8YA 1TW2A 4QJ3A 2HV9A 2J1LA 1J2YA 3DZDA 4OP2A 3NMUF 4D9HA 5KYNA 4K9QA 2BZSA 3J7TA 4UMDA 2WXJA 4M7PA 5C52B 1L6IA 4ZWNA 1XSEA 3WK4A 4H6WA 2AZ4A 2BHTA 2H6HA 1T2DA 2VXOA 5A6SA 4HNUA 2FW7A 3MTQA 4D99A 3ABSB 1N5OX 3IOBA 1AH2A 2GBFA 1JEYB 5ENOD 5KOIA 4D44A 4KPYA 3A9VA 5LNK1 1S8OA 4GOJA 3VNSA 5LCXA 1IMJA 4ZGGA 3GJ0A 4KNVA 2XRMA 3OT1A 3KJHA 4IQ4A 2IUSA 3ND8A 2RAFA 1PTJC 2OSBA 4A3SA 1J5PA 1EFTA 1N3BA 1QFZA 3DC2A 3Q15C 5ARDA 4EQFA 5SZKB 2NTYC 1U1GA 1UDAA 2PGDA 1VCHA 3R6GA 4RO0A 2BKUA 1GDDA 3GNSA 5HF8A 2Z1DA 2FMIA 3AL0C 4I9FA 2XZLA 1HGXA 1C4OA 4JUBA 4B3HA 2OFWA 1P2SA 4R54A 1OXUA 3P9YA 5EMKA 1PTJA 2NYVA 4A0QA 1OZHA 2JFWA 2DWZA 3Q15A 2JFBA 5CGZA 1MIOB 4K9LA 4QATA 4KKXB 3ASHA 4IFIA 1WWKA 4GPKA 1VJ0A 3C1OA 4Y7DA 5T3UA 3HY3A 4Z8YA 3GLRA 2SCUA 4NCIA 3G2PA 4D2IA 2ZQZA 1P7PA 2VCHA 4OU4A 4ACAA 1UBGA 3HV2A 4O4IF 1CIPA 3DSSA 5KAPA 3WTBA 4QICA 4ARVA 4Q3NA 4U7DA 1SCNE 4QPJC 1JDBB 1WXWA 3N6XA 4H18A 1MORA 4JYZA 3KALA 1OPXA 3DW3X 3RRXA 1ZU5A 3QV2A 3L0CA 4BX8A 3DD1A 5EMJA 5JVDA 3H2ZA 3O7WA 4O2AB 4K0KB 2PWZA 5I9MA 3IMKA 2Y3IA 2FWPA 4KWHA 4DV0B 5AIJA 1R66A 1BN6A 1F3OA 5IAJA 3RJVA 3FHEA 3GAAA 2BDUA 1BDMA 4CI9A 4YRIA 3RIGA 3T12A 2R05A 1ZHFA 4OREX 2YNMC 3RG2A 5KTSA 4RQIA 3SKYA 3I34X 3RM3A 3MKQB 3SZMA 5A4IS 2OLKA 5KINB 3H5TA 3B52X 1F9EA 4JU8A 2JBAA 4Y6OA 4OHWA 3AFNA 4U3JA 5EPEA 3FKQA 3HXLA 2FZ5A 1I4DD 4OIMA 1OH6A 5A0FA 4QNMA 1K6JA 2A3NA 1Q20A 2YNMA 2IKQA 2BFEA 2ZB7A 4DT1A 4NXNB 5G0UA 2Y4OA 2O07A 1TMYA 2GBLC 4DVGA 2R6R1 1NDUA 4ZEOA 3LA6A 1UK7A 2YC4C 3ZVKA 5IJ9B 2C2XA 3U1BA 2XCUA 1J9ZA 4CL3A 5FYDA 4GTRA 3OF2A 3CT4A 5FRDA 2PGJA 1XRNA 3AVQA 1TQ4A 1P5RA 4QU8A 1JE0A 1M7HA 4L5BA 1N2GA 3DBLB 2F37A 4MVJA 4BNIA 3CRMA 4OK3A 4JYBA 1T9HA 4CYMA 3FUUA 2GCGA 2QSJA 1LRLA 4EI7A 1SXJB 2XKBA 3RYCB 3T1QA 4UQLA 2XWPA 2JJ1D 2W71A 3STWA 2G76A 1PGPA 3TE6A 4L5YA 1PGQA 2Z58A 3CZPA 4K0RA 3UWSA 4N5QA 3ZU7B 1TCAA 4XWTA 4UM9D 4P7BA 1DKPA 2PUCA 5E2IA 1ORWA 2CXNA 3KB1A 1R0BA 1ZICA 1GT91 1NE7A 4QHTA 4YDQA 5HUQA 2IHUA 3F46A 1P6UA 1EPUA 4YROA 4Z4FA 3PFCA 5HNKA 4QTUB 2VSYA 4AI6A 4M53A 1O0SA 1AMOA 1X3LA 4DCJA 2O7NA 4LSZE 1DEKA 3R7WA 3T5GA 3R9AB 1QMGA 1PT7A 5CEAA 2HIHA 4IWXA 2Q5FA 4IZIA 3AVVA 4F72A 3K5HA 2I4OA 4FQ5A 5JDIA 3NC1C 4OUDA 3WIUA 3ZGOA 5AKYA 1RHMA 3FNIA 4CU5A 3CZMA 3WNBA 1SVOA 4CGZA 4GKVA 5TQ0A 3CNLA 3C2QA 3RVSA 1WW8A 2VNJA 4BY6A 3CZCA 3PV0A 3N2GB 1Y4DE 3JTEA 1N4DA 2QTNA 2HTEA 4AN1A 3MJHA 3O0DA 4PO9A 4YA6A 2EBUA 2M98A 1JHYA 2LPMA 1EGQA 3FGOA 1C50A 2GK3A 5J2TA 3PPYA 5C80A 3GRUA 1SVXA 3I3NA 3KAEA 4BAUA 4GKBA 1DWUA 4KRFA 4TVSA 5FWXB 2AV6A 3I28A 3IE1A 3RV3A 3ZS9A 4ZQIA 1WZCA 4GYYA 4DW8A 1HUQA 3QUQA 3NRBA 1M8GA 3B2EA 1K08A 3TLAA 3F8TA 1Z8FA 4L3OA 1C1YA 1T2FA 4V38A 4HLQB 3AP1A 1NASA 1YASA 3JQAD 2C9ZA 3L6UA 4W8OA 4QDXA 1T8TA 3GGGA 3IPYA 4U9IS 3GWZA 5C8YA 4LNUB 3KJIA 5E8JA 2DM6A 4YK7A 4LWZA 2DTDA 3OPNA 3I9V6 2D1QA 3H8VA 3PEEA 1A8UA 2GUGA 1H8ED 2AN4A 4MWOA 2LCFA 1XGKA 1VMDA 2X40A 1KY3A 1J25A 4LGVA 1ZA1A 1RRCA 1EFRA 5L51A 5ULLA 1RHUA 1HA3A 4TWJA 3MJFA 4XE0A 5EERA 3ASVA 4ZVQA 4AYXA 2AG5A 1O1YA 1AQYA 4RS4A 4K26A 1L5JA 2WPNA 2E55A 3VISA 5AI4A 1ADGA 3OXFA 4EZJA 1E6EA 4Q4HA 4KVOA 3PLAE 2YOFA 3VKUA 1GTVA 1FX0B 3P2JA 1T4BA 1VA4A 1BWQA 4C2UA 1GU7A 3QFHA 4JCOA 3PPWA 3SYKA 3B7PA 4M7OA 2AKAB 4HDNB 4CHTA 3WXMA 4IRUA 4IV0A 3PNYA 5T3RA 1NLYA 7GPBA 2HDOA 3FXAA 4M1ZA 2I2DA 4M9XA 4PBTA 4J0UA 4JEHA 4OA8A 3MCWA 1T9ZA 1WNFA 3H6KA 4PO3X 3M6MD 4WPGA 3CF2A 2M2IA 3IIIA 4OTZA 1AV7A 1U7OA 2Q5CA 3LX4A 4P6VF 3ANXA 3QELB 2HHLA 1U94A 3SJUA 4OHRA 3QPAA 3H8JA 4TLAA 1ESZA 2ZBRA 4MIYA 2VL7A 1O95A 2B98A 4RTNA 3PQ2A 3OD5A 3DOCA 2O57A 2JIOA 1EVEA 3K9GA 4HI8A 1N78A 1JUQA 5JSHA 2XNCA 2IU1A 4PS1A 1DC8A 1Y1TA 1PNRA 2VGXB 1YAHA 1KAOA 5AVXA 4FFOA 2Q1XA 2H2DA 3AB3A 2YWXA 2HYZA 1OLUB 2IVZA 3F6PA 3ZZ0A 2QY6A 2A5GA 2OCPA 1LQTA 2R96A 5DLDA 5HQ3B 2GAAA 4GC5A 1N4PA 3BJEA 2GN2A 4RZUA 2DG2A 4L9AA 5EOVA 5JHHB 1M2VB 5ETJA 3AVUA 1XCOA 2RG7A 1LFDB 2BZ1A 1BCRB 2P65A 4L57A 4WXMA 2QR5A 1YR7A 3U39A 1MP0A 4HS4A 3ZOZA 3P9XA 1OQAA 1XJCA 5BWBA 1R6DA 5B1YA 2VT7A 3CTMA 3C3MA 2VJNA 4TWRA 2YY5A 2G25A 3V42A 3ZJ4A 1YCGA 3N6VA 3RTDA 4Z8XA 1UPTA 1YC5A 3PDCA 3UA4A 1GQYA 2QN6A 4I55A 3NVMB 3T4XA 3ZIUA 2D1FA 2D7JA 2FPLA 4ZVUA 1YCFA 2Z83A 3AFHA 4RHCA 3MOSA 4HUQA 3R5JA 4D4LA 4WIAA 4A36A 3R7QA 3DMTC 3HYMB 5FPTA 2BM9A 1PP4A 1NW5A 1BA2A 4OXNA 4LFCB 3MS4A 3KQVA 5FT9A 4RJTA 3TFOA 1J33A 3EGCA 2XB4A 4GZ6A 1E9SA 4GOOD 2Y2VA 1UDCA 4PPQA 4CXMA 2Q46A 4CTNA 1JHQA 4HORA 4RAOA 1Y8AA 5IAEA 4C4OA 1R2QA 4UQZA 4F9FA 1C29B 4TL7A 5L3VA 5B7QA 2PSFA 5CMLA 4DIOA 4PAGA 4D9FA 1VHTA 2VRBA 2ZB8A 3ZHEB 3HXPA 1GZUA 2C2HA 1GJRA 1N0IA 2AX4A 3ZCUA 1BU8A 2IT1A 1BI8B 2YBEA 4HB3A 1K5PA 4HRAA 1AQ6A 1SCBA 2JC3A 2HPAA 3LW7A 2HNAA 4CM6A 3R76A 2Q6VA 2QVYX 1AKVA 3TJRA 4ZA2A 2CCKA 3GFPA 1REQA 1N4AA 4CV1A 4DQDA 4B5LA 1YB2A 1YV9A 3B13A 4NWIA 1VTKA 1QZXA 1U99A 3B6EA 2HQ1A 1XALA 3ZI7A 3ZUPA 4UEJA 3OETA 4IX1A 1L3BA 4X9XA 4FW9A 4I9CA 3OKFA 1NQAO 3A70A 5I9NA 3GDHA 3W5CA 1N5LA 3SHWA 5IZ4A 5AKEA 1RYYA 3S2FA 4K1LA 3DE6X 3RS5A 4WJLA 4Q3AA 1PDVA 3U9LA 4DCPA 5ALQA 1XZNA 2J30A 4I3FA 4LNGA 1MZPA 4HDCA 4EMBA 2OCIA 4CL0A 1ZOSA 3E9ZA 3SHOA 3BULA 1YI1A 3E1GA 4EY8A 2GO7A 2ZRDA 4L15A 5BWNA 1SKBA 3AU4A 1T5TA 1N9ZA 2XYQA 2X4GA 2QYJA 2JD0A 1ZXLA 1AQNA 3GLFB 1R0KA 3PC8C 1M7BA 4ZVNA 1GPWB 5H5JA 3VR4H 4DKJA 4EEZA 2O2YA 4G01B 3EE6A 2P2DA 1RAAA 1G5TA 4ENSA 2HK9A 1C9DB 1OKKA 2J3EA 5AM0A 4O2LA 4GX2A 5FLKA 1UM9A 3GFVA 2YWCA 2R1UA 1RW4A 4OH1A 1DUSA 4BUZA 2P9UG 1M6VA 5MN5A 2CJYA 1Y9EA 1FT2A 4CQMA 1U2DC 2J3HA 3PC8A 3E3MA 1QH1B 4JJ7A 2WWIA 2X77A 3GPBA 4QBGB 3IVXA 5DHTA 4RPHA 2CJFA 3ZVMA 3UT6A 5DCLA 1SVNA 3P52A 1P4HA 4XB1A 4RSYA 4FA6A 1J0XO 1GU1A 4PAQA 2B0JA 3EX7C 4DPKA 1HZJA 4L6CA 3GHHA 3LVFO 3UXMA 3QWHA 4YMUA 3UJ9A 2HFJA 4FWIB 1IHGA 1UEJA 4ILIA 2REQA 3QKTA 3OWHA 1MGPA 1U2DA 2R7NA 3QNUA 4C78A 3GLTA 5ALYA 2PNNA 5JD3A 2AVDA 1EGHA 2VP5A 3NU1A 3SX2A 3DPIA 1A8PA 2YVAA 1MJ0A 2AVNA 3MV3B 4JDUA 1DG3A 4ZHSA 2VI5A 4QBKA 4Q7EA 2CZQA 3F5DA 2ODBA 2WILA 1JYFA 1SVKA 4ZYTA 2W6NA 1IM5A 4LTNA 3K0SA 1E5XA 3VU8A 2VBFA 3WLTA 4BBJA 1RWXA 3WFZA 4PXYA 2A58A 3WGUA 1LC0A 5B2FA 1EB9A 2J4BA 3TSYA 3AC0A 3DEFA 1XZQA 2ZB3A 1XVUA 2ZRHA 3JR7A 4MUAA 1BYIA 3G0OA 1UM8A 1T5LA 4RQTA 1NC3A 3UQZA 4S2EA 3SZOA 1FLAA 1R7RA 1PWHA 3VXKA 1L3IA 1U3DA 1W47A 3RUHA 3IPCA 3K15A 1PD0A 4X6LA 4J0QA 3OQPA 3FCYA 2VJMB 1Z82A 4HGPA 3ESCA 3MINA 5FLYA 3GBPA 1F8FA 3NHFA 1QGYA 5A05A 1ZOPA 5JMTA 4PQGA 2Q21A 2WOJA 1P8AA 4HDKB 3DPUA 3W77A 1D1QA 4CCWA 3QB2A 3TPZA 4I4TA 4Z0TA 4RV5A 2PKRA 3NNNA 3PHCA 3HGQA 3G9UA 1GAWA 4F04A 1PEYA 4V0LA 3SJZA 2RFMA 4GMRA 3C48A 1QOZA 1CQWA 1FFSA 1L9XA 1DJOA 3QEMB 3A11A 3GJ7A 2V54A 1ZIXA 1N2ZA 1IY8A 3CZ5A 5CB4B 2DBQA 2D74A 4RY2A 2Q7FA 1SQ5A 2ZYUX 1QORA 3HKCB 2LUOA 3WO1A 1MZVA 3SYRA 3TTSA 4U2EA 3HCOA 3B6JA 2XGJA 4IVQA 1EXNA 2DWOA 3QPWA 3COYA 2RFLA 4MW0A 4LQDA 3W9YA 4Q96A 5K05A 3JQGB 4I3HA 3FA2A 3UGQA 3KHKA 3QU7A 4UVDA 3D9MA 3ESYA 5DHSA 1IH8A 2ZIVB 4ZTUB 5LBUA 2GHTA 3ZPJA 2JI6A 2XX3A 4C20A 2BEVA 4RMHA 3MQFA 3LUBA 3D8BA 1WPRA 3R41A 4HNHA 1BROA 2X0IA 3OM8A 3JARA 4RVNA 2OV8A 5JS6A 2C7PA 5EIBD 2L19A 3KP1A 2R7LA 1GVHA 1RQPA 4YAGA 1LI5A 5BWLA 1GZ6A 3I72A 5C35A 1WXIA 4MPRA 4IM7A 1SN7A 1V4VA 1XRRA 1RZRD 2FPGB 4D3YA 3SCZA 2IXAA 4IXDA 1O7JA 2XAUA 2R2LA 1B4DA 1UBJS 2IHTA 2VHJA 4GH5A 3HLTA 2PWAA 4M76B 3U7JA 3JQ6A 1QKIA 4DLRA 2Z2JA 5ALGA 1E9FA 5D84A 3ZHCA 2GM4A 4L9RA 1G98A 1TEVA 2H4WA 4LHWA 3AS4A 1KZOA 1JI0A 1NTRA 1U2PA 3TKAA 1Y6RA 1TYQG 2HLDA 3ZLUA 2CVHA 4CCAA 1M8JA 4JHJA 2FHSA 1JAYA 3PNMA 1FMFA 1KI4A 3VHXA 5EJAA 1A7UA 5KNDA 4K6FA 3PR3A 4G86A 3Q5EA 1I0ZA 3GG2A 2NYRA 2RHLA 4FEYA 3K9BA 1LWNA 3SIWA 4JMPA 3PC3A 1L7VC 2HF8A 3DFFA 1LBIA 1JFFB 1DRUA 3GT0A 4MUXA 4XEUA 1OYYA 2CEAA 3TWRA 1RQXA 3MTDA 1FRFS 4ZDKA 2PUGA 3E81A 5LPNA 1K63A 1WY5A 3CX7A 2MYTA 3EQZA 2WKPA 4KFRA 3SZ3A 3UM9A 2DERA 1QFJA 2PMBA 1J70A 1E2IA 3DDWA 1FTWA 4MLPA 1XMVA 3S5UA 3AIKA 2H08A 2AHRA 2C5SA 2NAFA 2H1HA 2QAGB 2IYSA 4JVNA 4K03A 2QJWA 2Y0CA 2ONDA 3KUUA 2ZU6A 4CDNA 3LX5A 4ZJYA 1H6CA 3ICPA 1DFIA 3KT8A 3VZSA 3BMCA 3UENA 4JSYA 2J3IA 5DX1A 3HDYA 2VTBA 1FXUA 2RSLA 3DCNA 4DYDA 4UNNA 3LC2O 3TFQA 1GLGA 1QZUA 5CEEA 2JGIA 2P91A 2RHDA 3THWB 4M0LA 5EJ6A 3OG9A 2FFAA 3RT9A 1NBAA 1W581 4LSZA 1LDBA 5JTUA 2X1MA 3QNWA 3W8DA 1CZLA 4XVRA 5FDFA 4J0EA 3JXJA 2HRDA 5CG2A 1NQOA 1YZGA 3IR5A 4EI8A 2D00A 2FVYA 3C1TA 1VJCA 1NFRA 1YS1X 5AJYA 4H7FA 2YL2A 2MINA 4J90A 3PQCA 2NIPA 3QI7A 4BBZA 1ELKA 1IHDA 2P1RA 1KPSB 3LT2A 3CTPA 4OXYA 1X8XA 1NY5A 2FRVA 3T7KA 4OHPA 4TV9F 2VXCA 1ZNXA 4H7EA 1ISMA 4AS3A 3IIEA 2EKDA 4PGAA 3WNVA 1V16A 1RIFA 1S6YA 1TYAE 1ODSA 1OD6A 3ETDA 1IXZA 4LDRA 4HSEA 1XQXA 4W1SA 2F2TA 1PDOA 4HPJB 3WZ2A 4C03A 3S2AA 2IY0C 1ZM3A 4TXRA 3GNLA 3OQ1A 6LDHA 3TG8A 1FBNA 1ADBA 3TUJC 4ZVOA 1FW6A 2DPLA 3GNTA 1SHZA 1C3OB 3TAHA 3L46A 2QMHA 4QQRA 5FO0A 4FYHA 3BIXA 1HDXA 5CH3A 3VR4A 4GFDA 5AVWA 1HLGA 2WIBA 4Z7OB 4ZAZA 3JYHA 1QFSA 2PSEA 4Z6KA 1YL6A 2ZSJA 1YQTA 2CCJA 2JZOA 1LPNA 4US0R 2W9XA 1RYNA 4WJZA 3FHTA 4MS1B 5DO9A 4MBGA 2HWUA 3AUFA 3T1TA 3ZE8A 2ZUUA 1ZC4A 3LYAA 4MRAA 4ZO9A 4OLAA 4QNRA 3SZ7A 1RLIA 2AUMA 4O3MA 4L8YA 2EJTA 4CEHA 1E6CA 2R8BA 3EHMA 2FP4A 3KSDO 1FCHA 4BTBA 3V9PA 2AQHA 3C3QA 1GO2A 4HG2A 4Q69A 5EJ4A 1G8FA 1ZCAA 3ZWBA 3VGPA 5CTAA 1T0IA 1E2DA 3LDAA 1TRKA 3QF4A 2GAOA 1A2KC 3K96A 3QFTA 1BDBA 3IEIA 2JAPA 3ZGQA 3DLBA 2LXLA 2OG1A 7AT1A 2V65A 2IWRA 1K3TA 1SA0A 5C1DA 3L6DA 4MVXA 2ZS7A 2W0MA 1SVLA 5F77A 1ZH6A 2M6SA 3DT8A 4F5ZA 1VGQA 2ONZA 2XUGA 4KPUA 3JS5A 4JR0A 1QZ3A 3OJLA 5KWIA 4B94A 4DUGD 1DT3A 4QZVA 3FGPA 4ZDIA 1KSJA 1PYGA 3T0GA 3PX2A 4Q1DA 1L5HA 2XTNA 4PHTA 2I1JA 4PYOA 3W06A 4O1MA 4RG6A 1Q92A 4CIAA 3A4VA 2JVJA 4MP3A 3WKAA 4WLUA 3E22B 4JYCA 4D80A 4WNAA 4IH9A 4ADSG 2XQFA 4D9GA 1N5KA 4PX9A 2BDTA 4YPFA 4FZ3A 3P1JA 4HDAA 2EX0A 4G65A 4PC7A 2XUDA 4C89A 2UYCA 4RTSA 3WSVA 1J8QA 1TGVA 2RGEA 1NVWQ 3UH0A 1OASA 2V7BA 4CVNA 2I3BA 2WJVA 1EZZA 5HIAA 4LJLA 5DTMA 5INTA 4F3VA 3RBZA 3IBSA 3PLRA 2GM9A 1T8UA 1NMYA 4E2YA 4EYKA 2YRFA 3UBTA 3CR8A 3FZNA 4JL8A 3HU5A 5EIOA 3F5SA 3MMPA 2VRWA 2C0PA 3MA0A 1FYEA 1ZD4A 5ALVA 4QYIB 4J0KA 3N8KA 4WA8A 1IOWA 4Z9AA 4E2WA 4AMUA 2X6HA 4ES6A 3B20A 4BQQA 2P2YA 2AT1A 3B1YA 3M1LA 2QPLA 1O5TA 2R8YA 4MGEA 5EYPA 1C7QA 1L5OA 5F5XA 1JFVA 2UDPA 1SA4A 5EKDA 3PNBA 3B38A 2B9EA 4G5HA 4KQ1A 2JKVA 1E63A 2RI0A 2G5CA 1XP8A 2XE6A 3WJ7A 2ZETA 4CPDA 2BV3A 1OY1A 4MVYA 1DCTA 1JDVA 5ITZB 1VECA 3FYSA 3G2HA 3SFVA 4TUYF 3F5FA 3HXMA 2FZEA 1IRXA 3LRXA 2F8SA 2X6KA 4KOAA 4P82A 1YIOA 4LCTA 4OKIA 2IE8A 2Q0SA 2P4HX 3EFEA 4MV6A 4R81A 3KT6A 5CT5A 2XT6A 4PRKA 4FZ5A 1EQUA 5AK6A 3TNFA 1H2XA 3LTNC 1VE6A 4UEOA 4AK9A 1DNPA 3OPQA 1VA5A 1ZZEA 4DMHA 5C1IA 3ESRA 1GDTA 3HHEA 4P4SB 1TVEA 1XLUA 3S68A 3BE8A 3R77A 4PLPA 2BIFA 3DLPX 1QIDA 3B5EA 2E82A 5FBRB 3LJ3A 3L8MA 4B6SA 3UUGA 3R2JA 1RU3A 4QYXA 3GEGA 4UTZA 4IPTA 2F43A 4CKEB 1IUPA 4OK5A 3FFWA 2DECA 4Z7JA 2ZIXB 5H80A 2J3MA 3B1ZA 2ZJ5A 1YRHA 5ER6A 2OHXA 5EJ7A 5JZ9A 1IAQA 3TW8B 4RMIA 2A0KA 1E1QD 4P53A 3ZBTA 4U7EB 3PRYA 1A04A 1OTHA 3VYTB 4K86A 5DTRA 4YV1A 4O6FA 1W0CA 2DWUA 4R2WA 3S0JA 4YUVA 3WL5A 1Y8ZA 1UXKA 4R7GA 3WWPA 3GRYA 5IF3A 1I6KA 2H51A 3G13A 3VFDA 2B94A 1Y3BE 4TKZA 5AKHA 4LN1A 2EVWX 3IT1A 2B37A 5FI0B 2XUFA 2V7VA 4ETMA 4GQBA 2P41A 4YJ2F 2NZJA 2CJPA 1RJFA 1I36A 3RARA 4EL0A 3VAZA 2COKA 2VJBA 5C2YA 1WSWA 3GD7A 1ICEA 3AVOA 4EFNA 2Q4RA 1E5LA 2XCOA 5L6LB 1YZKA 2I5PO 3MERA 4LY9A 3PP8A 2O06A 3A3PA 3BRQA 2C0MA 4BLUA 4JLSA 2R8EA 1CXZA 4I1UA 5FQ4A 1KI7A 1KI8A 5AI0A 4DBLC 3HVRA 3QARA 3LXMA 1J2RA 1CE8B 3JCKC 3S2ZA 5JE8A 5JWHA 5AW2A 4D8WA 3TOCA 2QK4A 5BN4A 1ZGZA 1ZG3A 3IUNA 4S24A 2A5YB 4TQUS 1SOUA 1QFYA 4DSUA 4OMUA 2QQFA 1UFRA 4BWVA 3I2FA 2WSIA 3AL2A 2WD7B 1Z17A 1R0LA 1UJCA 4JI6B 3TF5A 5EN5D 5JADA 4WFJA 2BAGA 4IV8A 1XG5A 1ZNQO 2Y99A 3JD0A 5CD1A 4WCDA 2QRVB 2ERCA 4GE0A 3R7BA 1N8TA 5EWLA 1D07A 4FNOA 2Y68A 1U4SA 1IUKA 3IMEA 4MUNA 3RUIA 5LP6A 3UAXA 5TSDA 1MC1A 1DKQA 1GPNA 2FMFA 3PXCX 4H08A 2WHXA 4F97A 4LK3A 2YCLA 1AUXA 1TN8A 1N11A 2GERA 4ZYXA 3M3HA 1JJAA 1I7LA 4YMTA 2Y0DA 3WRYC 3RVOA 3I3SR 2EV9A 2RH9B 5EJ9A 3SZUA 2BGUA 4BX3A 4IQ8A 2OC4A 1A3CA 2PEZA 4GNRA 3MSCA 1MBZA 3RANA 5JPDA 2JAUA 2BGLA 3R7FA 3O0TA 3VJKA 3I4CA 3KX2A 5BV7A 1MO2A 5A23A 3O8OB 3D9OA 1P81A 4B7XA 2BFCA 4OOFA 1H1LA 4CQNA 3R24A 3V7UA 4QGGA 4QFMA 5CM8B 3HCDA 3UK1A 4BEVA 3C3OA 2FWAA 2HU5A 2QYHA 1O5IA 5DULA 3WRYA 2Y1WA 4MDHA 1A27A 2QZJA 4NDAA 2K4MA 2G36A 2I87A 1U8CB 5CLHA 1SKYB 4XM1A 2I78A 4QEKA 1NRIA 3L82A 3UAOA 1B41A 1IXSB 4KXKB 4E70A 1YBFA 3ROGA 3WZMA 4Q3CA 4AJ2A 2XYGA 3ETCA 3OQOA 1TUGA 5JXJA 3EAQA 1B43A 3PEVA 4EGCB 5IUKC 2H29A 4UBOA 3GAFA 1K68A 2R68A 3R0QA 2WKSA 5FJIA 3PZ1A 1Q0ZA 2DKNA 3RRMB 2W6PA 421PA 1FUKA 3IUQA 3ZQUA 1SXJD 5KUTA 3UXYA 1OVMA 3QPBA 3FTNA 3R0IA 3Q6NA 5LQCA 1MOZA 1ZD9A 3K6SA 2FH5B 1M1YB 3G8AA 3OQHA 3BHIA 5BV2P 5ICMA 2W2NA 4WH0A 4M0PA 2R00C 3W7AA 3D1VA 2YHAA 3EF1A 1I13A 4DDMA 4Q7LA 4GLBA 1GEEA 2EFHB 4E12A 3E15A 3EXG2 4RACA 3ORYA 1E2BA 1QHEA 3IP9A 4YX9A 3PJRA 2CN1A 5KX5F 4RE6A 1HXHA 1V4BA 3DZFA 3O75A 1T6ZA 4WX2B 5K0BA 3RHZA 2GAFA 4HLUA 4WXRA 3Q72A 2GOYA 4C14A 2WMOB 3C3CA 2B30A 4GAEA 2R00A 1ID1A 1V9LA 1DXHA 1EZ4A 5SY4A 1I7SB 1DC3A 1KEWA 2G5PA 1VHJA 4NOMA 2OM6A 3TXNA 2YQ8A 3PT5A 4ZK2A 2AC7A 4P5EA 3AG1E 1WULS 3PJEA 3KRTA 2QU7A 5T7BA 1YBAA 2DAPA 2H17A 3A32A 3UKRG 5BVGA 1XP5A 2NSLA 3NHKA 1YSCA 5HS4A 5FB3A 4ZHBA 3D9NA 5EIHA 4X6YA 1GG8A 1P2FA 3FLBA 3WWDA 1QZTA 1MX2A 3ZHTA 1UXIA 4E51A 1HYHA 3QDNA 4HQNA 2IPXA 3SR4A 3WAKA 3RC3A 1BXRA 1UJ4A 3RFXA 5THQA 2WKWA 1EGVB 3CW2A 4NNOA 1SC6A 3RSHA 4U1RA 5SZJA 4E33A 3RYIA 4G5SA 2YFKA 2I8AA 4MDFA 3FH0A 3AKDA 4ZJZA 4YBZA 1R6UA 2ZXWE 3ET5A 5KAMA 2CXTA 2AEFA 4BNVA 4UU8A 1D7AA 4LNUD 4Q16A 2CL6X 5H82A 2NVUB 3U37A 1A77A 4APOA 3LQRA 2YMQA 5KQGA 4IIJA 3O8LA 3ZI0A 3UIOC 3AUYA 4BN4A 2QL9A 3UJ3X 4P7JA 4YONB 3F98A 2XNSA 3IILA 2X8JA 4TL8A 2IZOA 4MRUA 3HCEA 1CRZA 3D9QX 3K1ZA 5JO9A 2ZYGA 3ER9A 3ZW3A 1JNXX 2ZWVA 4B8WA 3KQHA 1DAOA 1E61A 3TECE 1XU4A 3UNXA 2FG5A 3DZCA 1PY1A 1A9SA 4B74A 3FDHA 3EYWA 4FFDA 1XKLA 4JB2A 4UBMA 3AXTA 5I4IA 4L73A 2V8OA 4JBNA 4MW9A 3M70A 2BVNA 1J24A 3EEBA 5HBGA 2X1VA 4IYPA 4BJ5A 4O5AA 3L2OB 3OX4A 3ASGA 2NTEA 2FLKA 2Z1NA 4CT4A 2BFBA 4TTSA 5FQ8A 4WKGA 3E70C 5A9RA 4HXGA 2FK7A 4ZCIA 2HIMA 2QN8A 1OVGA 2AJBA 4P5DA 1X1EA 2CE7A 2NADA 5EUBA 4NV3A 4P80A 1PT5A 3BXEA 2J5QA 3V7YA 2CDRA 3QVJA 2AK2A 4KBFA 3UUEA 4Y0VA 3D5EA 3E33A 2PZGA 4MQEA 1NBMD 1JWLA 1GYPA 1LRKA 2XUAA 4UTXA 2WMDA 1ZCFA 3F6RA 2MSCB 2CBZA 4JHKA 1Q3KA 5DCUA 1JLLB 3OBBA 4PLHA 3RAGA 5MDHA 1THMA 1RRGA 1JDNA 4R8KA 1Q7BA 3ORFA 1WPXA 5HQ8A 1TIBA 5GVSA 4M98A 2DGDA 1K7FB 5HKPA 3E8SA 2GCNA 5G0VA 5CH5A 3N8GA 1ZHOA 2A9KA 4ND5A 2ZJ7A 2ZI6A 1UDBA 2C4UA 4NCJA 4MDEA 5E1DA 3NDRA 3PQ6A 3R3UA 1DAEA 3KPUA 4MARA 3DUFB 2XUOA 2IH4A 1X87A 3EHDA 4OMFG 5FR1A 2CFSA 3AUTA 4ZYYA 5BQFA 5TF0A 3CVQA 4KAXA 3SEQA 4RHEA 3ZDDA 1RAEA 4F91B 4TWBA 3AFIA 5CFOA 2FPKA 2XTJA 3DTNA 2KBFA 4Q3LA 3V2UA 1JPLA 2ISQA 1RLOA 2PZAA 4HFJA 1CRPA 1P1RA 5AVKA 1GD1O 2KHZA 2VQ2A 1BI7B 1N6IA 1C3JA 2GYUA 4RZ3A 1CFZA 3D5QA 4X91A 4C0EA 5ENPD 5JAPA 2HWXA 4NBRA 4MHOA 3BH6A 3LP8A 3SR0A 4MKXA 4ODIA 4QECA 2JA1A 3NATA 1FSGA 1GCUA 2NSDA 2RD2A 3L16A 1YR6A 4IMIB 4Y2SA 5DYGA 3NAGA 4ZHQB 2ZI5A 1PDWA 5P8WA 3DSUA 5K4GA 4Y0NA 4YRGA 3E5RA 4MW7A 3EA0A 1N2HA 1RQGA 3GUVA 3H1BA 3U3RA 3MNFA 4UCXA 4L22A 4JODA 4YP6A 4ZVPA 4XDGA 1NF9A 5GTDA 1L5RA 2HBRA 2QNIA 3KAJA 4L5CA 1N5JA 4DLAA 4DRXB 2IUTA 1ELWA 4H4EA 2Q50A 2F8XK 9LDBA 5FBLB 1CVLA 1O58A 4KE9A 4X1OA 3GLIB 3ONWA 3DGFC 5KYWA 2V0NA 5L3QA 2HY7A 4Z4QA 1RPJA 3WADA 2HA4A 2IOQA 1EM6A 4CI0B 1EVZA 3F4LA 4G25A 4BPBA 4RVHA 5AARA 5CXXA 4TWIA 4EPXA 4XM2A 4GWLA 4TS3A 4ZAVA 1B76A 3QU4A 4GGMX 3OJCA 1L7DA 1W4ZA 4N6OA 2VK8A 1ZVJA 1UN9A 3HUEA 1NVVR 1GSHA 4IHJB 2IW3A 3NOQA 4GZLA 2GX6A 1TQ6A 1PI3A 2H7CA 3ZY6A 1K97A 1Z29A 2IYEA 4II7A 4KGVA 2VUUA 2EQAA 3AEXA 2CGEA 3KJNA 2GRNB 1VPDA 5E7QA 4YUXA 4LJKA 3HYNA 1W5TA 3MWKA 2CE2X 3K92A 1QYDA 4P3PA 4JVLA 3C45A 3PH0C 4P34A 3IEXA 3BL5A 2WI8A 4N5HX 1D8TA 3LC1O 3DEZA 4KRGA 4ND8B 3H9BA 4FGJA 3LAWA 3RUAA 4LXYA 2PT5A 3FTSA 2YW2A 4G1CA 2HIGA 4L4SA 3L7IA 2XCQA 1G2OA 3W5BA 4ZO8A 4LHYA 5EZQA 5JDIC 2CYCA 4FYKA 2GTHA 1R64A 2FUG1 4RENA 5DRYA 3PIRA 2MR5A 5FHQA 3G5LA 4E32A 3TZCA 2P90A 2A5JA 5CLFA 4ACKA 1Z39A 2NP6A 2FWMX 3HJBA 1SY7A 4UMVA 3JPWA 3TTYA 4PAOA 4EG3A 1O6CA 2GCIA 3MQ2A 4G6ZA 1MB9A 4GMKA 3BAZA 4CLHA 2G83A 4EA8A 5DPMA 1CULC 1SCUA 3Q11A 3D8RA 2WVHA 1RC0A 2P7HA 3W4IA 4PRZA 5PGMA 3EBOA 3O4JA 4LYJA 1THZA 1Y1RA 5B1DA 3KV3O 5J4HA 2OV6A 3NEAA 3SE0A 1H2VC 1RQ2A 2QN7A 4ER3A 3QBVA 3OICA 1SIUA 2HH9A 2WM2A 1W19A 3VPSA 4MUEA 1AK2A 1U4NA 3PRKE 4HH4A 1CEQA 3CLSC 2JI9A 4JJ8A 1Q0QA 3UOGA 3PEYA 3SVLA 4PZCA 5LSAA 4N8SA 2I1KA 3FB1A 1WNTA 4EA7A 1PJ2A 3IOMA 4HO1X 4M1WA 1AG9A 2X0FA 4Z4IA 3K9CA 1IN6A 4EZLA 1TM3E 3FZGA 5GJWC 4LEUA 1K1BA 3KO8A 1KZ4A 1E9VA 2NO9A 3PS9A 3S2YA 3FTCA 4F6RA 1WB9A 4MGIR 5G1OA 2OHIA 3M34A 2Z04A 4O1OA 4PR0A 4I5IA 3I2JA 1ZRSA 2JBHA 5CNMA 4J1SA 2CMKA 1K5DA 2GZDA 1HQCA 3PEWA 3I6IA 2CXXA 1SD5A 1TQHA 3EPJA 2I91A 1F9AA 1W48A 3PPIA 2C4MA 3U4DA 2AN9A 2JGFA 3QG5A 4IY1A 4N3NA 3FH5A 1FLNA 3AZOA 5REQA 3UJ7A 4R7LA 1L8OA 3G59A 2FEXA 4FQ8A 1QIEA 4K6CA 1EESA 2XA2A 5GZ1A 1N7GA 3CB4A 4XWKA 3K9FC 4Q4AB 2EBHX 4E2FA 3F9CA 4D9KA 2JK1A 4CM3A 4DQ0A 1T0HB 2HSEA 2WXNA 4ROSA 4WY8A 1IN5A 4H6XA 3LF1A 1AP7A 1O95C 3NUQA 4FYPA 2XADA 4B4VA 4AJWA 2Y1EA 3AF5A 5EZYF 3AR8A 4HI9A 1FFEA 3IAAA 4Y9TA 3DF7A 3NBFA 3CVVA 1KEZA 3H97A 2WUGA 1V7QA 5CNKA 1T13A 3ORSA 3HR8A 5B7NA 1TMOA 3IBTA 3D6TB 2A1UA 2ODQA 2QQ5A 3KBOA 3O8DA 1A5BB 3JZDA 5KYTA 4YXWA 3SICE 3LDHA 3R6LA 4AJ4A 1K3ZD 5K0SA 1X9HA 3E58A 1YT5A 4YCAA 3FM9A 4OVKA 4YJ3B 3EOZA 1IRIA 2EDAA 2OKGA 3HCBA 3NWBA 1Z6GA 5E6RA 4LA4A 5LB2A 1U9ZA 1LZLA 4LJ7A 5AIBA 2IL1A 2DHCA 4KOEC 4O4HB 3USES 4OHBA 4KUGA 4JL5A 3ZD6A 2N42A 2AKEA 4KAAA 4ERXA 4OXRA 4OJYA 2P6PA 1Y3CE 4A5OA 1U7XA 1IQUA 3VR3D 3TLEA 4DQXA 1K8YB 4EBAG 3CSTA 4RUKA 1KC1A 5EKQD 4W7IA 2VT6A 1GL6A 1DTSA 4FGZA 2HQOA 1HXIA 1P1KA 3QKSB 1PV1A 3PDUA 2E89A 2X7JA 4Q9DA 2IUUA 2G17A 3Q5DA 3BGVA 5ECGC 5KNDH 4NICA 4TGLA 2XUKA 3SQXA 2ARKA 3A06A 3BF8A 3VU1A 4FX5A 1N6LA 2VHEA 5LIPA 3CZ9A 1I4EB 1A9XB 1GTSA 4KQGA 3CNQS 4B9AA 2V4HC 2KQUA 1WUYA 3BZUA 4TL9A 4N65A 3VKGA 4QPPA 1Q7TA 2Q29A 4HOYA 3OP4A 1OCZE 1KZHA 4JP1A 1WCWA 2ZUWA 4Q34A 1VKRA 5K4AA 1I5OA 4YAFA 3SS7X 4MYTA 3ANTA 1EA7A 1SELA 2W42A 3X1MA 2D3WA 2WXMA 2HJRA 1DDGA 4MS4A 4GI3A 4IDNA 1F4PA 4RTPA 2JLVA 5KSPA 2X9QA 1Q16A 2BMFA 3CT6A 3W4KA 3QX3A 4Y6SA 3DSRA 5DBEX 1Z0FA 2WP8J 5JG7A 2XAAA 2IY9A 5BW5A 1NJ1A 1KORA 4PICA 1XK6A 4EI9A 5ICSA 2CL0X 5B55A 2NO5A 1YDFA 4HRMB 1J8DA 1TO6A 1NKTA 4F3NA 4ITRC 4BVGA 4YECA 3CVWA 2L17A 1I01A 3H2IA 5JS1A 1U8UA 4FS3A 2RHCA 3C5EA 5LYYA 2OCCE 4DA6A 4J8PA 1G64A 1JSLA 3AM3A 1EFAA 2A33A 2QQGA 2J87A 1KGDA 4AVXA 1P62B 1XNHA 1AB5A 5JAUA 1AZLA 1V3VA 4KZPA 4IN3B 3E4BA 4M0KA 1GPLA 3D8UA 4GBED 3QM1A 4O2BF 1U1DA 2R9VA 3QVXA 3CVNA 1NU8A 1X1BA 2QRKA 1MAHA 3SS8A 3LSTA 2XB6A 5HPYB 2IS6A 3ECCA 1IMOA 2NU6A 5IM5A 3ZG6A 1CUEA 3Q3VA 3EC1A 2C20A 1QAQA 4XCXA 1XWIA 3ENEA 3D4OA 5CFMA 3WVNA 4HPXB 5E2AA 1CFJA 1ZI8A 2IZ6A 2ZBEA 1DAPA 2ZULA 1W4LA 1D6SA 2WKQA 2P9QA 3C97A 2G88A 2RIRA 3VC7A 3VTKA 2BEUA 3KQKA 3M5WA 3SSOA 4EPWA 4BNLA 1KQNA 3OPXA 2CV0A 1ZKMA 1NVXQ 3ZEFA 4JOQA 5DGXA 1NGSA 2V5UA 3FB4A 3NIDB 4OQZA 4G24A 3AU5A 4A1OA 3HFJA 1L4NA 4HQDA 4ZI7F 4F2HA 3NT4A 3RS3A 1Y8QA 4KDEA 1YHZA 3CHSA 4AUMA 2BPOA 1FZQA 4C0QC 4RF2A 3K4HA 1M1ZA 3CEQA 1IPFA 4LBWA 1OILA 3HVIA 5CITA 4OJKA 1SEVA 3H8WA 3K8OE 1T8YA 4RVCA 4F3YA 4BU0A 1QNFA 1E3LA 2P9PG 4D9IA 4YMSA 2Y1GA 2G4VA 4JXXA 3UJ6A 5EI5A 1RLJA 2ECQA 4DRYA 5FNZA 4OD0A 4ZVVA 1I80A 1KH3A 4RD2A 4AJOA 4U04A 5E7MA 4PX5A 1NX6A 2GAIA 5KQSA 3BMNB 1NR1A 1QH8A 2C04A 4U0JA 1KJ8A 1UBNA 2NUPA 4FZRA 2OBYA 1S1MA 4I1AA 1SZAA 1Y9DA 4RXMA 4X44A 5BSHA 1R4NB 4YMWA 5DVZA 3MJRA 2A5UA 1UQUA 3WOVA 1YZQA 5J3JA 3D6VA 1SOVA 4GR4A 4CKCB 4GL2A 3K1AA 3OE7A 3SGHA 1UKYA 1FSPA 3OE5A 1BXZA 2R79A 4R2XA 3KVOA 2ENWA 3TSWA 4E1VA 3FBGA 4H2DA 1ORRA 3BJIC 3O73A 4K6OA 5COBA 5CBKA 1CUIA 1NMXA 1MUUA 4IEIA 3TCNA 1ZM2A 4FPXA 3MZLB 1WCYA 5CA0B 3T4PA 3RYFA 2ZUSA 2QA5A 1AZSC 1YI0A 3QKRB 1RHJA 1G2IA 5U1PA 1ARZA 5BYBA 2O2CA 5A3QA 1H4SA 1NDQA 3ZBQA 3FE2A 4HGRA 3ZJUA 1ONSA 1G6KA 4UE6A 4RFSB 1XXHB 3W2GA 1C8LA 4EAQA 1YJAA 1P2GA 5BN1A 3RPEA 3TQHA 4ZZ1A 2HCFA 1QHYA 4QYWA 1LI4A 3M83A 4Z4GA 2YVUA 4DSAA 3RC2A 1AA6A 3HL4A 1Z22A 4D81A 4HNAB 5J9FA 3N8HA 1TNBA 2OCXA 2J8SD 1QDEA 4AFNA 5COAA 1E3WA 2BTQA 1WSDA 1E1CA 1XMOB 3FTZA 1VSTA 1UBLS 1KAEA 1S0UA 2MMGA 4CZ2D 1UZUA 2O8CA 4MICA 1F6DA 4BFXA 3TMYA 3U31A 1MJGM 3TX2A 1DRWA 2OBXA 1QU3A 5A62A 2PV0A 2JJ2A 4A1FA 2HBZA 3A31A 3PC6A 4KN6A 3L04A 3A6EA 4C0JA 3QVGB 3EISA 4ATZD 1BJKA 4IXNA 5JDCA 3HY6A 1YHYA 5CG1A 1XT6A 4UDXX 3F3YA 3LPMA 4ARCA 2FQXA 1MOQA 1ZW6A 1V6AA 4JC5A 3OM9A 2A0UA 4MRRA 4C4ZA 3V31A 2YYYA 3E35A 1U3UA 4HR7A 1S89A 4MR8A 4IJUA 3EC7A 2FEZA 4B76A 4P3OA 1I9CA 2QM7A 5A3VA 1X80B 1H8HD 2QROA 2QTTA 3FUVA 2WG0A 3V80A 5KWSA 3JY6A 1Q0TA 1CNMA 2HBQA 3TIVA 4FI3C 3IMCA 1WZNA 3PS6A 1UC5B 4MH0R 2ZVQX 1HDOA 1SXGA 2YKGA 1S96A 1D03A 4HNVA 3EVDA 1BEZA 4IIFA 3TBFA 3U3KA 5HF5A 1GFIA 3E84A 4FMDB 3L0ZA 4Q3BA 3AL3A 2JVKA 4MKGA 4DA0A 4G26A 2I1WA 1E4EB 4WOCA 1BLXB 4B0ZA 1PTKA 4MYHA 4X6UA 3NGLA 2AEMA 1D2AA 4QXQA 2YV1A 6REQB 2NV0A 1T0UA 2PU7A 1VL1A 1MYOA 2OCDA 2FDCA 4Q4JA 4CUJA 3ZZUA 2QC9A 3HB5X 2D54A 4K5QA 1GFSA 3M2PA 5JSZA 1UPCA 2O05A 1CV2A 4LHZA 3K2IA 4G0ZA 3OU7A 3JQEA 2Y9PB 4X20A 5J40A 5DTQA 1J8FA 1E7QA 3ZDQA 4OSPA 1B0AA 3ZYLA 4DLVA 1MJNA 1U6KA 5FIUA 4P81A 5CMYA 4UE3S 2GKGA 2H6EA 3MUEA 2PFSA 5H68A 3HXDA 1S9DA 3BE4A 4A8JB 3EBLA 4IJMA 3ROQA 2AYYA 2JEZA 1OFUX 4F93B 3DW1X 3RO3A 5JZMA 5GONF 3L8ZA 4DDVA 4IDQA 4D79A 2H6FA 4TTTS 2G0AA 1KVUA 2NC9A 2Y0BG 4JP5A 1WY6A 3KQPA 5FO1A 4YC7A 1VCMA 2Q7OE 4F9GA 4TKVA 5CBPB 3EWSA 4UAGA 2EKPA 3GPIA 2AX3A 2VPIA 5HYVA 2Q6LA 2CHFA 1GITA 2W2XA 2C0QA 4WUYA 2A67A 4QDZA 1J9EA 3NC0C 3MXOA 4DLLA 2AJAA 2HE0A 2ZRAA 4MV3A 3DOOA 2X1LA 4N8DA 4MR7A 4O33A 1NG9A 2WWYA 4UBJA 3G5AA 3WMRA 1OX4A 1IN8A 3N59A 4DDWA 1HYQA 2R5SA 1EVLA 2RGBA 2FLVA 3BZBA 3I8XA 1EVJA 5L4LA 1PKXA 3PNSA 3DL4A 3FPGA 3PNOA 2X3YA 1A50B 5G05C 3NPAA 3ONEA 3Q12A 5B1IA 2CXHA 2VAPA 1UBRS 5LBTA 1NW4A 4MJLA 1V0JA 1DELA 4RK4A 1SZPA 2QYOA 1U9CA 2DFVA 4XYLA 4C3UA 4YIHA 4KHZA 3HCCA 2BJVA 3JQDA 1EM8A 4BAZA 1QPBA 3P9RA 2QMUA 3TLGB 4JL6A 4CU2A 2E4UA 4MV9A 1YB6A 3GA5A 3L5OA 3SHTA 1HQKA 3MFYA 5IKXA 2I2FA 2N3ZA 3H0CA 4HRXA 1P61B 3ZZNA 3UFXA 4WN9A 1P0FA 2AXZA 4MUMA 4PZDA 3L0PA 4XSGA 3ZK9A 2JHCA 5D00A 3FNGA 1S2OA 1GNVA 4LJAA 3CLTD 3R5FA 3AR2A 3UOWA 2AEJA 2ASVA 4FR0A 1G60A 4WADA 5HJ2A 1BJRE 1LPOA 3I45A 3ER8A 4R3WA 1Q3TA 1GAQA 1JR3D 2QUJA 2ZVDA 2BISA 3LGSA 4GTQA 5E6SA 3GUCA 2GK4A 3CH6A 3WMWA 2O2HA 1S63A 3C85A 5IAGA 5A7DB 3RFUA 2A9PA 3MYVA 4TXQA 3N7TA 3UIPC 4B7CA 2WU1A 4XTCS 3ORQA 1W85B 3RUDA 4XD7A 3BORA 2VDJA 3CBGA 5TQ2A 4IDDA 3C6QA 4JQCA 1G6HA 5CDSA 1KEPA 3CVYA 3HRIA 4AMGA 4BNXA 3RW9A 4Z1MD 1NU6A 5M5BA 1OCCE 3DV2A 1Q2UA 2FQ1A 1VL5A 3QEKA 2COUA 3PZ3A 3JASA 1XCLA 2P2ZA 3WLNA 1U5BA 1ZMBA 1U98A 4FFNA 2E4WA 4RX1A 3WYAA 3OEHD 4OLFA 4QOIA 3ENVA 4FGLA 1Z34A 2VPXA 2C95A 4ZFHA 1RYEA 5BRNA 2H2IA 3KUDA 4KIFA 3NWOA 4B35A 1SUEA 4Z7QB 3INRA 3T7RA 2VZLA 4DLBA 3RTCA 2V96A 1A9OA 3OCWA 1PLJA 3ZCTA 4XTRA 1NF8A 5IUJC 1SD2A 3RAPR 2PYDA 2Q27A 2P9TA 3H18A 4C6TA 4PDXA 4LYYA 4Y1RB 4WBNF 4NBSA 1KGSA 3BRWD 4W63A 2G09A 2E49A 1MT3A 2IV3A 4WWOA 1U1CA 3DG9A 1W4AA 4KZ0A 2IRWA 5JFTA 2G07A 4O1IA 5I8WA 1MV5A 2WM8A 1RI1A 2QZPA 4UZSA 2FFBA 1EDEA 4AULA 2E37A 5IEBA 4RY8A 4XJVA 5H7XA 4FHZA 4FZVA 4FSDA 1IEQA 3ROTA 3WK5A 3LKVA 2JIZA 1X1AA 4RSMA 2V8BA 4YEDA 4ID9A 4D43A 3GLUA 3GZ4A 1DTWB 3DKKA 3AYXB 3JWPA 1VLJA 3QU2A 1ZEMA 1KBZA 3IXQA 1XPJA 3WDKA 2C3OA 1BIFA 1KHHA 4IJWA 5L3SA 3ABRB 5T4BA 2C5HA 3WDSA 3Q7AA 4U39A 1LBEA 3ANNA 3GFGA 3NTXA 4JOCA 1H6PA 1M3SA 1GKLA 1WV1A 2JH8A 3S1AB 4GX1A 3GJ4A 4YV0A 4TT3A 3GWGA 2CLOB 3TK1A 5F2EA 3B85A 2YHSA 4RA6A 4RF5A 1V8OA 4LHVA 4N5DA 3FJOA 4OSEA 3A6DA 3TPCA 1PNVA 4B32A 3SYNA 2FG7C 3AESA 2QVXX 3LPNA 3GR6A 3H1FA 4K2HA 2PLNA 4TV8B 1HBJA 1INLA 2JANA 1COWD 4I46A 3NORA 2GCOB 2FPOA 3C8UA 2P2CA 5E9AA 1TM7E 2Z43A 5F9FA 3CU5A 2M6RA 2ZRPA 5KYVA 1SUSA 3UT5A 1R5NA 2X6QA 1UODA 1BE8A 1OT3A 1GLNA 2ZR7A 3E34A 3BK7A 4AROA 4J1NA 3WJ2A 3DPSA 3DAHA 4QGFA 1SBNE 4JEMA 1Q0SA 3WK8A 3E9EA 3IUBA 3W2TA 2XNJA 2XH8A 1OYVA 4MHSA 2GRQB 3BMOA 4TVBA 3FVVA 1FP1D 2BCEA 1MO4A 2IUEA 2IYOA 5IN4A 3GCXA 3QVKA 3AR7A 4DYVA 4US2R 1FYXA 3Q3CA 3L8CA 4NE7A 1E5VA 4BLTA 1E9EA 2ZG6A 3W9BA 4E0BA 5C5IA 1EWKA 4GG1A 4LOKA 1DCKA 3GEHA 3PPXA 5KVQA 4P4TA 2FZKA 4DA4A 4UAVA 2V74B 4EEKA 4DC0A 3U4TA 1MC4A 4ETWA 5BMVA 3A58B 3G7SA 5J90A 1N6OA 2ACEA 4BZPA 4IDPA 1Q1BA 1EGMB 5B3SE 2XB8A 3H9CA 1JXQA 3EZYA 3Q0EA 1Z4MA 4XCQA 1XPUA 4A3TA 2VLBA 4GZCA 4YRRA 1RXEA 2YJ4A 4YP0A 1PR1A 4BQNA 4LSMA 3LY7A 4N5IX 1W93A 3M6VA 2BGTA 1WM5A 3SQMA 4KIGA 2CNLA 1U63A 3OFNA 4NE9A 4V1CB 4UCWA 3A2KA 3KU4A 4ILGA 4N0DA 4IGEA 4UNPA 3EHEA 3QLJA 1CQZA 3C24A 4MZDA 2FWRA 4CM8A 1C1HA 1SBTA 1GKKA 3BIWA 1PR6A 4FDUA 1NKVA 4IVRA 1AN0A 3JD4A 3N0RA 4U2KA 4LECA 4MRMB 5L4SA 4J3FA 4F45A 5A1JA 2HDWA 1V43A 2GCEA 3ULYA 3NHAA 1CJKC 1TNZA 1TVCA 4Q9LA 1TJ3A 4X54A 2YXNA 3CJQA 4HAIA 4JGGA 2PZKA 4YP5A 3IQHX 3IX7A 2PQ0A 3L43A 5K8CA 3T3OA 4F46A 3A1UA 1KETA 1URPA 1Y1QA 4FU3A 1QXSA 4N41A 4AO7A 4KV7A 4R8VA 2GEFA 3NRCA 5LXTB 4W6ZA 2IS2A 1Z56C 1E8DA 1RP7A 4Q15A 2QVBA 2DZOA 4KDRA 1MX9A 1KY2A 3E2IA 3FWZA 3G6KA 4HGOA 2G08A 3GMTA 1C3LA 2PR7A 4RVDA 1PK7A 5LP6C 4QUJA 3NCTA 3IP3A 2JGDA 2EFCB 4ZD6A 1JQKA 3U5TA 1XZLA 1FQOA 2P69A 1T1RA 3S27A 3APDA 1CERA 2YCBA 1NX9A 2W6JA 1N7HA 3HO6A 4TVOA 2WHPB 2DPYA 3W2IA 2C3PA 2V0PA 4TMKA 5L95A 1XRPA 4X8MA 2G28A 5DN9A 5DXJA 4G0UA 2BUAA 2JATA 2DBAA 4PE5B 3IC5A 4EHAA 2POCA 3VKVA 1O4WA 1J49A 3A37A 2ECKA 4FS8A 1I24A 1SULA 2XLBA 4ZZ2A 4HEJA 4CN9A 3QHQA 4DJDC 2Q4BA 3H7AA 2PLAA 3WBKA 3FJ1A 1VMAA 5BORA 4XAQA 3M4YA 3MWFA 5TVGA 2WB4A 1QFXA 4E5VA 1HZ4A 1M2KA 3D2BA 2HJWA 4P4LA 1GILA 4RMNA 1KO5A 1P44A 1JJFA 4Y67A 2P3SA 3ZHYA 1KP9A 2AYZA 3NCHA 5BYJA 1VI2A 2P5SA 5KU7A 3SP1A 4JI5B 2YINC 5BSUA 4YNBA 4ND7A 1F7UA 1B8OA 3CV0A 2QW1A 3WKDA 4ZT7A 2OV2A 1NVUQ 2PQMA 4R1PA 1XRJA 2O8EB 4KNYA 3FYUB 2IU4A 2INGX 1U1EA 4O4LA 4TLCA 4BLRA 5CIWA 4E7OA 2YUIA 4ZOLA 5LZ2A 2YINA 1LU9A 4LOJA 2AJTA 3RJ9A 3FUXA 1R0SA 5EJ8A 1JDPA 1ADFA 4R3UC 3JYLA 4KQKA 3R0JA 3R9XA 2Q41A 4HLUC 4JUAA 3OXLA 5LR6A 4G84A 3A1FA 3SHQA 1N25A 1RXSA 1L7RA 4OL0A 1U02A 1MX6A 5ANRB 4G85A 4AY3A 4LERA 1Y34E 2JLSA 4M0EA 3WA7A 2H11A 3I04A 3LKZA 1QZZA 4DNXA 3EQ9A 4FOPA 3EDQA 4MYSA 3WYGA 3NOOA 3HEMA 2QV0A 1ZUNA 1DPGA 2YMLA 3S6JA 3EGDB 4L4ZA 3EW7A 3FWYA 2MSNA 3HXEA 4IRXA 2XGOA 4A1GA 1MXHA 4GR9A 3D7RA 4TZKA 3UKDA 3O6VA 4DB4A 4RH1A 2O6HA 2QAJA 5ERGB 1A4XA 4WKCA 5FTKA 5JW6A 3EOBI 5F1KA 1TM4E 3PG5A 4PYNA 1O0BA 3GQBA 3UV6A 2BP7B 4ZVKA 2Q5OA 1QX3A 4YY3B 4TMXA 1EGAA 1NXWA 3DWGA 2ZDGA 4DAOA 1NWCA 4GTMA 3CLUD 3VYRB 2W2KB 2J3LA 4JUCA 3R5KA 3N9IA 3TQRA 4R68A 5ECDA 4F2WA 2AJCA 2X5NA 2ETXA 1XZGA 3TW4A 1MU0A 2IF2A 3DE0X 1JILA 2B34A 3N3AC 2O2SA 2Z2ZA 2ZR0A 3FF4A 5KVAA 4QLBA 3Q8XB 1JKMA 2OQIA 4ZZ0A 4L9PA 2BSAA 3NDPA 1SAYA 2DQ4A 4U7JA 4ZO4A 3FX2A 3DT6A 4RIIA 1JQAA 1QVVA 3HVEB 3WKEA 5F98A 3EXEA 4KPEC 3L93A 2QUZA 3NBAA 5MFPA 2BFDB 4RD3A 4WFQA 3EZ7A 2DUJA 1YUBA 2RI1A 5TGDA 4DCVA 4DX5D 4S3MA 4NZ9A 4OATA 2ZYSA 1H9CA 3A1WA 3OZRA 2Z6AA 3LZCA 4BLSA 2XB9A 3TD6A 4R2IA 4OYHA 3FU6A 3E8XA 3RK1A 2AN1A 3GLHB 2OD9A 3E7XA 4JGBA 2B4RO 1UMKA 5DWQA 1X3SA 4QOHA 1O0CA 5FUMA 1R0RE 5SY9A 1ZNZA 4H1WA 5FPSA 4NK5A 2AD1A 3EVFA 2VAXA 1D0VA 5GJVC 1I7NA 1C30B 2IU6A 2VBGA 5JAMA 5D5QA 1XAJA 4BB9A 4S05A 3SLRA 2QXTA 4BNHA 3QXCA 4I2ZA 1SU8A 4DMLA 1TQ2A 2O3RA 3Q75A 3HXBA 1MVLA 1P3DA 4G5QA 3B1JA 5K3CA 2RMKA 2AOUB 1NQ5A 3RSGA 4L0CA 2CV1A 1LLCA 4B33A 2VHTA 2R1ZA 3UINC 4XH9B 5IDWA 2P0AA 5EYLA 4PQYA 1M6WA 2CJWB 2AK3A 3GP3A 2TMKA 2OKCA 2LNDA 3S8YA 4WOBA 4OI4A 5FIOA 2FFHA 4KU4A 5K3OA 1GTZA 4GMGA 4JXZA 1DPFA 2BRUA 4WLEA 3HBNA 4B3RB 3MWEB 4FVTA 4ZU6X 3UTMA 1EDDA 3OKCA 3B7UX 1I2BA 5FWYB 2V5FA 3S7BA 3KAQA 5IYZA 3OIFA 1DG9A 5G2OA 4B46A 2R1VA 3ZU6A 1P9OA 4Z4EA 3C6ZA 1PJQA 1SBZA 2WXRA 2XEVA 1YQXA 2Z0MA 2NU7A 3DOUA 4ZT6A 2VF4X 5D0QD 1T4CB 5DM1A 4B81A 1QFMA 3ND9A 1V1MA 3O74A 4ZALA 5ED0A 5IF9A 1ZCBA 1RNLA 3C3DA 2DHDA 2P9IG 3QQ5A 1M6NA 3T3PB 3FTEA 4XI0A 3ZWKA 5IM4A 2FWIA 1GNLA 1IATA 3UGKA 3EASA 1SURA 2C7RA 1G0OA 3I8SA 1RI5A 3FCXA 3DV0B 2F3QA 1L4KA 4UWHA 3NHWA 2J0VA 3EEOA 1YIAA 4KV9A 3LGAA 3KUXA 2IU3A 3DFIA 2IP2A 3HYRA 1EEXB 4NG5A 3KKEA 1GEGA 4OF4A 2I76A 5AW5A 3V34A 2R7AA 1MO6A 2HRZA 2G1PA 4DG9A 1OC2A 2QL5A 3VNRA 1D2HA 3F78A 1Q84A 1NZDA 3M1AA 3QA9A 4FHDA 5JQGB 2XUZA 4LCBA 2ZJ1A 5LQJA 5J2UB 4ATNA 1KYYA 3AEKB 3H2JA 3QOUA 2ZS8A 3WYDA 4I8XA 5CYOA 4ZU1X 3U7IA 4LG1A 2P6MA 1T25A 4RQBA 4R71A 1TZBA 8OHMA 5LFAA 5D3KA 3ZRHA 3U13A 4MDYA 5JBQA 1Z2DA 1QYRA 4KBGA 2YY7A 3ZHBA 2RK4A 2ZIZA 2KBXA 4D96A 4HADA 4DR3B 4YI3A 1GCGA 5I7OA 3M6UA 3UXHA 1JCSA 4H0CA 3LYUA 1BAPA 3B6MA 3VHQA 1WU7A 1RLMA 1Q19A 4KEAA 1K8KG 4PHGA 2HEGA 2ZWPA 1LF8A 1BXGA 4G4JA 1V25A 1FXSA 4L0DA 3QWVA 2PMFA 4CETA 2MIIA 3JQ9A 2VH5R 3ET4A 3R7SA 1AX9A 3F96A 1TOAA 1P45A 2ECPA 3FOEC 3CZQA 2X14A 1DDIA 4YJFA 3GGJA 1STOA 4KACA 4EVIA 2O7RA 3PTZA 1Z4IA 1QBQA 2IXFA 1YE3A 1JXOA 2L0XA 4B8ZA 3CUVA 3ZXSA 2Y0PA 1P19A 4H3SA 2VJDA 1GTMA 1H6BA 1JPVA 1P73A 1SUWA 4H6PA 2HA2A 3I9V1 3MS7A 5KC9A 4CTMA 3OD1A 4WNYA 2H63A 1TXGA 1E7MA 1FNBA 1VI5A 4CNQA 3SEAA 3W8FA 1AGXA 3T7IA 1CQIB 5TS3A 4P7GA 1KY5A 2QLNA 4JJAA 1V7PC 4UU7A 2GETA 3DXMG 3CUKA 1BVHA 4NMLA 4JA0A 1YK1A 4DTCA 4AJJA 2RH5A 4HLEA 2GHQA 1JW9B 1QOQB 2ONCA 1YR2A 2C5GA 3RC9A 2DWQA 5H0IA 3U7RA 2HNKA 3THYA 3T3GA 5AJLA 2OHVA 2CLLB 4O0LA 5I9BA 4NIKA 3BFJA 1ZLYA 4HDOB 3Q8LA 3WXBA 4HYEA 3FWPA 1SU4A 4KVAA 5LOVA 3WV5A 2QENA 2VF8A 3TD9A 1K66A 3ZH9B 4R1UA 2H65A 4NYIQ 3D3WB 4H3HB 4M99A 4LQLA 4NRDA 2GBGA 5AENA 4O25A 1OBFO 1H0RA 1ZR4A 4YO7A 4BEPA 1C7IA 3P9PA 3N05A 4F96A 1RRVA 4GD3Q 4JENA 2CK3A 5CCDA 4JI1B 5FNVB 3LBHA 2EQXA 1SQSA 4ZAGA 3Q87B 1OX6A 3FPEA 4NRHB 4E5MA 3K35A 3DDNA 2JLZA 2DCMA 4NMMA 1QH9A 3U19A 2FOLA 3EIXA 3RF6A 1T5DX 1KZGB 1LK0A 2WHEA 2AJDA 4JKIA 1EUYA 4YAWA 1Z28A 3UEOA 1HG1A 3L07A 1N5MA 1OXMA 3CKCA 5BXQC 1QO0A 4WDQA 4Z54A 4LS3A 2FZVA 3KXDA 3HYLA 1GGJA 1TYZA 4DEVA 2VA8A 4GOLD 5HZMA 4QDTA 4XB2A 5DBFA 4N82A 4ZPXA 2GFHA 1IHPA 2QXYA 1FPPA 1EVQA 2FMHA 5EZ5A 3MLEA 1DAKA 1PZEA 4BFZA 2JH3A 2IUFA 3APCA 1ZNWA 1JU4A 4REQA 1B1CA 3T5MA 1GUDA 1Z6AA 4V39A 1ZVKA 1AUPA 4CIBA 2DJ5A 4EKGA 1ZIYA 4FADA 1JMYA 4FDTA 4MWZA 3HUUA 3AP2A 4Z49A 5FL3A 3EHQA 1Z6QA 2XEXA 5JATA 2BUGA 4HKTA 4QWWA 3QWFA 3O1HB 2PAFA 3U3MA 1TNDA 2C8KA 3LUGA 3B3JA 4J0HA 4G23A 3NJ4A 3FOBA 4BO4A 5ADHA 3IP7A 5H4HA 3DMNA 3ROKA 2WT4A 3G0BA 4I5DA 3H99A 4HNAD 4A8PA 1C2YA 2HA5A 2FPMA 2RC5A 3UKOA 2UVPB 5A3RA 3QX8A 3O2SB 3PGKA 3M9WA 5C1OA 1C14A 1UZNA 1TA4A 3DFMA 3ECAA 2BYTA 1YZLA 4UZEA 3OPYB 3AFOA 1QQ5A 1NVEA 4YRLA 3A3KA 4CMIA 4GTSA 2P67A 4A3VA 5LKAA 4JBGA 3EHRA 3G7UA 1ZIDA 3C8MA 3TGOA 2ID9A 3DEOA 5HUJA 3FKSD 5CFNA 3MJDA 2HSZA 1KF0A 4IQ0A 4XLTA 1H4VB 2RC6A 1AO3A 2BMWA 5AJTA 4DLNA 1T2AA 1M2EA 2WHRA 4LSWA 4X84A 1IQPA 1OGYA 5FEUA 1QC5B 1KO4A 2GJ9A 4G3XA 1ONNA 1Z8HA 2DY0A 2GGSA 1NVKA 3NEYA 4GSLA 2DYKA 4OGFA 2AXVA 1K7SN 1PS8A 2R1TB 4EELA 1G9SA 5LQMA 4O4JB 3PC7A 4EQ6B 3L0IB 5BR1A 1LBTA 3KSLA 3KZXA 1PR5A 1X1TA 4PAMA 1KWKA 1AKEA 3KSUA 3O38A 3NHLA 1DEHA 4QGAA 2OZEA 3HJGA 3VSCA 4U95D 2Q8NA 4FC8A 4BNWA 1RKUA 1U2ZA 4M9RA 3VA7A 3GJSA 1I4TD 1MGOA 2PY6A 3OZ7A 3LY9A 3RSZA 3U44A 1EBUA 2UWJG 4AZ3A 3E23A 1T9GR 3TL3A 1OU4A 1H23A 1Y5RA 2WW8A 4OQMA 2IFTA 1U8XX 9MHTA 4KL8S 4RZ2A 3WIDA 3PHHA 4G41A 1LPSA 2ECFA 1AO0A 3VSAA 1GCOA 3T9FA 3RB8A 4TYNA 2DXIA 4BDSA 1GN9A 3U56A 3DZHA 1H5UA 3PWSA 1TU3A 3ND6A 5HJ5A 1GUBA 2BKLA 4GXTA 3IJRA 4NONA 2OXIA 2VP9A 2JHGA 4ME6A 6ABPA 1N92A 3OSZA 1X38A 1L7QA 3VC2A 2N1BA 4AQ7A 2UZ4A 4JPSA 1N9GA 2YIMA 2O3SA 3IQGX 2Q3BA 2QWXA 3FPKA 4Q1VA 1N7IA 4DMRA 4YQYA 4OHXA 1E3IA 1EVKA 1V3TA 4KIJA 1AWCB 2WXFA 4BWFB 5K8IA 4FDMA 4L6IA 1TZMA 5D85A 2G1KA 2IYNA 1Y3HA 3N0TA 2Y1LE 3ZXIA 4Z1OA 4CMCA 2OG2A 4KI0A 4LQCA 1LW7A 2C0CA 3SJ7A 2XQJA 3M81A 1XMSA 2J49A 2ZZNA 1X0XA 4ID3A 5TQJA 4D8XA 4OU5A 1L7NA 3EMVA 3NTOA 4FN5A 5DNDA 5TGTA 3NP9A 1HKUA 2W00A 2L0IA 3IBGA 4J0IA 5JBNA 3WIEA 1QYMA 1G66A 3T0IA 3NHRA 1KZ9A 1ZCZA 4DV4B 1U3FA 4FFMA 4J8SA 4G0PA 1MDBA 3T8MA 1SOAA 2FHPA 2ISCA 2XPZA 4XVHA 3UCEA 3FNFA 1AHIA 1GCIA 1JCRA 3KR0A 1R9GA 4FNMA 2QUIA 1BRMA 4QTXA 3PX3A 3Q9LA 3GN2A 5G0WA 3C3BA 5DI9A 1KYIA 3OTNA 1X77A 2UKDA 1N0QA 3LT0A 1PUXA 3X1YA 2ZIRA 4CRWA 1M72A 3B2QA 4IHKA 2Z1MA 3MBKA 1T5SA 3PZBA 3QC1A 3WBFA 2O5CA 4UXJA 2QZ4A 4R41A 3FYTA 5JEDA 2YFYA 4R8SA 3AK4A 2W0SA 1UZLA 2EYUA 5CRVA 5TS2A 4KMRA 1SQ6A 2QE7A 3AUUA 4FR5A 5IN5A 3RVPA 2V45A 1C1XA 3BFKA 3RS2A 4UI9C 1DUIA 4MV7A 2ZCUA 4RPIA 1V8PA 3TL5A 4L76A 1LSJA 4DBZA 3CH7A 1CHDA 4AP5A 1LY1A 1ZH8A 4ER5A 1R5JA 2FSGA 4WDRA 2FTKE 3AY6A 4IICA 1DQYA 3G2UA 4FINA 2ATIA 5EQFA 2I4RA 3IBCA 4GRIA 1KH2A 4BXOA 4Y7CA 1OB2A 3EXAA 5J5VA 3DBHB 2ZJ3A 2OCAA 1ZVVA 3KXLA 3BBPA 3VDXA 4BFYA 3EUEA 4BC0A 4ZYZA 3C74A 2CYAA 5EE9A 2XDQA 1IXVA 3ROXA 4QPNA 3TIFA 2NMVA 4M0CA 3OQNA 3HK2A 4UAUA 5F7JA 2PPLA 3DMPA 4Z3DA 1IB0A 5B4UA 1IXKA 4W8GA 4OMDA 1E4OA 4QUEA 1S70B 1VSQA 4DLOA 3WRWA 3F49S 2JEOA 1EWTA 1J5XA 4QQIA 5M7EA 2X15A 4FYWA 1NWHA 1WOMA 5KWDA 2F17A 4HNRA 3FOWA 4OFWA 2D7DA 2PANA 2KCKA 4XE5A 5HCIA 4UC0A 4AVYA 5BQPA 2VSOA 4HH0A 4EHHA 3GMDA 3QMMA 4MV8A 3HKDA 3KVVA 3I76A 1QUEA 2CBXA 3QMWA 3OIVA 3U3WA 1QYCA 4M1QA 4G4IA 2H06A 3WGHA 3TBHA 4X62B 5I7SA 2AR7A 3EQ8A 2P2NA 5AVQA 4G1FA 2EIXA 2VJCA 5DM70 2WXQA 3CKKA 4G0NA 2VRCA 3GLQA 4URYR 4RVBA 3ABZA 1E5TA 4HQLA 4ABYA 2GK7A 3CN7A 1YL5A 4BIIA 1I32A 1NLZA 2N75A 3LVRE 3V1LA 3STTA 4TLMB 3N8DA 3TSAA 4BQOA 4E3ZA 2LD4A 4L2YA 1DADA 3FRJA 1YRBA 1GNTA 4CCYA 4EYQA 3ZZ1A 2UYQA 4KZKA 3WTCA 5E4JA 2O20A 1W30A 3OCUA 2I8LA 2ONKA 1EK2A 3OBIA 4R7TA 5FCDA 5JAHA 2FEOA 3D4NA 1KDOA 4UUAA 4YFVA 2FPIA 4DA9A 1GT6A 1C2TA 1LLUA 1GPDG 4MWCA 4B3JA 5DBHX 3DONA 3ZDFA 4ENTA 3CRZA 3SC2B 4Q24A 3SS9X 2BHNA 5HFAA 2L2QA 3ILSA 1E9CA 2CHQA 2P40A 5JDCC 2ECOA 5JLJA 1EKXA 1JB9A