2XGMA

Substrate and product analogues as human o-glcnac transferase inhibitors.
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
512
structure length
512
Chain Sequence
PEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 190
structure length 512
sequence length 512
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgmA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgmA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgmA02
2QRMA 5TVGA 2FI7A 2SKEA 3OY7A 2YQ8A 2H1HA 4J8DA 3QHPA 5JTTA 2OOEA 3MTBA 3DZCA 1IIRA 3BEEA 4JA9A 3ZN3A 3G2HA 3WAGA 1E1YA 5D0OD 2IW1A 4EL5A 2XA1A 5TMEA 3K9IA 3LYAA 3MSCA 4RIFA 1NA3A 4Y6CA 5I45A 1AXRA 2P6PA 2G9VA 1HLFA 3C48A 3HBJA 2VQ2A 1JEJA 3VUEA 4YNDA 1L5RA 2QRPA 3R9AB 1EM6A 1P4HA 4CTOA 1P2DA 2R60A 1KLXA 2ACWA 2QN8A 2QZSA 4G1TA 4I2WA 4YI3A 4HORA 1JG6A 2X6RA 4BT8A 1E4OA 2YJNA 3FP3A 3FWVA 5LQDA 4XI9A 3CEJA 4HOUA 3QOUA 2XPIA 1XV5A 3OT5A 4HOQA 2PQNA 4F9FA 3Q4AB 2IV3A 2XCIA 3JYSA 2GEKA 2PZIA 3Q3HA 3LY9A 2C0MA 3C4QA 5FZRA 3RKVA 2PQ6A 4I2ZA 4GCNA 1ELWA 5JJ6A 5D01A 2X6QA 3BD7A 4RIGA 1XKXA 2WTXA 4JL0A 1P29A 3OTHA 4MHOA 5DXFA 3L7CA 3BCSA 1Z8DA 1NA0A 1H5UA 1FU8A 3D1JA 2AZDA 4CGWA 2KATA 2C1XA 1GPYA 4U0ZA 1PYGA 5KJKA 3T7DA 1WUTA 3VUFA 4WUYA 3ZCPA 1IHGA 4RG9A 1C8LA 1WAO1 3AS4A 1Z6PA 4FKZA 1L6IA 1WV1A 4WNGA 2IUYA 4GPKA 4MICA 4X7RA 1ZBPA 4NQ0A 2IEIA 1PN3A 3HBMA 3EBOA 4Y6WA 4YVQC 4NC9A 3BCUA 2UY1A 3ZCQA 5IKPA 1C3JA 5TMDA 4RIEA 4H7XA 4RG6A 2UY1B 2ACVA 3OXFA 3NP9A 2DBAA 3S27A 4GYOA 4G24A 1O6CA 2Y4UA 3CV0A 1XL1A 1JIVA 2FFRA 5EX0A 2FEZA 5FJYA 3HYMB 2IEGA 1KT1A 3BCRA 5BW8C 1HH8A 3Q3EA 5BT1A 4J8FA 3CVPA 3CK7A 4WACA 3VTXA 2FF4A 4KBQA 4M60A 4JHRA 2QN7A 3RIBA 2F3QA 2Y4TA 2QLNA 3L7DA 1XL0A 4RIIA 3ULQA 3MS7A 3URZA 5IKOA 2C2LA 5LCWC 3L7BA 3G2KA 2J9QA 4YI5A 1RZVA 1VGVA 2R4TA 3WADA 3VTYA 4LEUA 1E96B 3PE4A 4GZ3A 3ASFA 4UQXA 3DDWA 2XEVA 3LY7A 3T3DA 2GPNA 5KJLA 2R5SA 5CHEE 4GA1A 3SZ7A 4F3VA 4EKYA 5G05J 1NZDA 4M83A 3IA7A 3CVLA 3T3HA 1LWOA 3Q3IA 4WNDA 1WUYA 4G2VA 2E2EA 3MQFA 4BQFA 1WW3A 3MT9A 4N3BA 3QDNA 4I9EA 4GA2A 1L5SA 2PYDA 3TG4A 5KJNA 2SKDA 2AW3A 3SYRA 2G9UA 3UQ3A 3E3LA 3G2JA 2PYIA 3QKWA 4MI3A 3O48A 1IYGA 3BDAA 3RU0A 2GPAA 3ZCVA 3NC4A 1YGPA 4LEIA 1L7XA 1NVKA 2GEJA 4BTAA 5DLDA 2BFWA 4J8EA 3D0QA 3TOVA 1KTIA 3MV3B 3ZFWA 5BNWA 4ME2A 4XI0A 2BGTA 2VSYA 3L7AA 1A17A 3Q5MA 4U0UA 2IF4A 1JG7A 2XGMA 2KS6A 3EBPA 3NP7A 2C0LA 4EQFA 4REMA 2F3PA 4BQIA 3L79A 3ZCRA 3E4BA 3L01A 4F96A 1EXVA 2XGSA 1RZUA 3GZ1A 3QWVA 5D0QD 3ASHA 2VGXB 3U3WA 2PQRA 2VCEA 3CEMA 3EDTB 5ENZA 3O3CA 4MRAA 4EL0A 4H7YA 2NC9A 1FTYA 3RSCA 3SYMA 2AV6A 4I17A 3LY8A 3OXGA 3OKAA 3OKCA 4YUAA 4HOSA 2FF5A 3ASDA 3NPAA 2VSNA 5C1DA 2P58C 3GZ2A 3WC4A 4GZ5A 2X0FA 3CUVA 1F6DA 3H4IA 4UI9K 3GUHA 1YA6A 5FTPA 2R66A 2PRJA 2QRQA 4N3AA 4FZRA 3CV3A 2IV7A 2QN3A 4B94A 1L5VA 4XIFA 3G2IA 4YVOA 3CUTA 2AMVA 4WADA 2JLBA 3NF1A 5FZQA 2VCHA 3BEOA 4CTNA 2C4MA 4AMGA 3MT7A 1Y8MA 3OTGA 4GPBA 1C50A 1TJCA 5GPBA 3LCAA 5FZSA 5HXAA 2XA2A 3QWPA 2BISA 3NB0A 1HXIA 3S2UA 2IYAA 3N71A 3MRXA 2KCKA 3GW4A 1XNFA 1F0KA 1SXQA 1UZUA 4O6FA 8GPBA 3MTAA 3KD7A 3Q15A 4F97A 4N9WA 3GPBA 3IEGA 4Z5XA 1YA0A 4UI9J 4WHMA 3E3OA 3QWWA 3RT1A 1NOKA 3CKCA 2F3SA 3HBNA 1NOIA 4L22A 1FC0A 1GPAA 1W3BA 3Q49B 3RJVA 4WNFA 3AMVA 4N2QA 4KQMA 2PL2A 1P5QA 2ASVA 2G9QA 1NZNA 2ZB2A 2V5FA 1M5RA 2GPBA 3CK8A 1K06A 6GPBA 4PQGA 4UI9C 2WQHA 2XMPA 4MHSA 1SXPA 3G2LA 4JA7A 2QN9A 5FT9A 3UYKA 2VGYA 3CEQA 3HBFA 1B89A 3CVQA 2KC7A 4I1AA 3TGOA 1NOJA 4BQEA 4GA0A 4UQZA 3G2NA 5M72A 4GCOA 3ESKA 3MKRA 4G25A 4N3CA 1Y6GA 4WNEA 3OY2A 1ZU2A 1P4GA 2X0DA 5KJMA 2X0EA 3ZGQA 1FA9A 1PNVA 2XCBA 2QN1A 3CEHA 5A7DB 4CDRA 2QRGA 4I9CA 4AN4A 2ECPA 5ARFA 2ATIA 2YHCA 1WV0A 3ZCTA 4W6QA 2R4UA 2GT1A 4BFCA 2C1ZA 2FO7A 5JTUA 3SF4A 2JZCA 4U07A 1IXYA 3T3IA 3OTIA 3CKBA 4N2SA 3MS2A 2AVPA 1BX3A 4RENA 4AM9A 4GZ6A 1QQEA 2BUGA 2G9RA 2QNBA 2XA9A 4KQ1A 3QKYA 4G26A 2HYZA 5EX3A 3U4TA 2F3UA 1AHPA 4X6LA 3Q47B 2C9ZA 4UQYA 2Q7FA 2GM9A 3MA5A 3ZCUA 1OUVA 1JIXA 3MBOA 5DU2A 2KCVA 5G04J 4ABNA 3MS4A 4EKEA 2XGOA 1HZ4A 2XCUA 4GYWA 3DD1A 1K08A 2QFCA 1NZFA 3S7BA 3AS5A 1Z62A 3BD6A 3OKPA 3RHZA 4W9RA 1RRVA 3DDSA 3RO3A 3CUWA 1P2BA 3WXXA 5CCMA 2QLLA 1KT0A 4HOTA 5EKQD 2UWJG 5JJ7A 3TG5A 1QKJA 4CTMA 4IN3B 1FTQA 4N5CA 3AS8A 1FCHA 3UYLA 2R68A 3CK9A 4N39A 1GG8A 4BTBA 3MV2B 3T3EA 3TAXA 3VDMA 1UQTA 3ZHEA 4RELA 3MEKA 3IAAA 1FU4A 2FBNA 3MTDA 4NESA 1FTWA 2Q6VA 1XOIA 4MI9A 2HO1A 5HQ8A 3T3GA 5DIZA 2ONDA 1WM5A 2VGXA 1V4VA 2VG8A 4MI6A 5A6CA 2HR2A 5G04C 5G05C 1GPBA 3S7FA 5HI7A 3CVNA 4U0SA 4AY6A 1FS4A 3GYZA 2IFUA 3LPZA 4KYOB 4CGVA 2WPVA 2OFFA 3S29A 2GW1A 1Z6QA 3FFLA 5D00A 5TMBA 4LDPA 3UPVA 3PE3A 5LCWJ 4HLNA 1Y8ZA 2SKCA 3MRTA 2GJ4A 1L5QA 1FU7A 3NAZA 4NRHB 1P4JA 4J0UA 1C8KA 4QLBA 4GYYA 3E3NA 2IYFA 3CUUA 3KAEA 3MT8A 5JJTA 1QM5A 1GFZA 5AYWD 1ABBA 4HWGA 4BT9A 3COPA 4RIHA 4EJ2A 4AIFA 1GGNA 3ZCSA 2FETA 7GPBA 4X7PA 3UUXA 2BGUA 1PC2A 2XCCA 3S7DA 2O6LA 2JJMA 4X7MA 3RSZA 2H1FA 3KS2A 3VDNB 1ELRA 3ZHEB 3PDNA 4G23A 1GZ5A 1XC7A 4M7PA 2LSVA 1QZ2A 3S0JA 1P2GA 3ASGA 3LKUA 2KCLA 1PSWA 2F9FA 9GPBA 3NCHA 2I6HA 3CX4A 3H4TA 2QLMA 3MRVA 4KXKB 1Y6FA 1WW2A 2LSUA 2PRIA 2QN2A 5DBKA 2HY7A 3CUYA 4BWRA 4G2TA 1B4DA 3T5TA 3FROA 4NEQA 1A8IA 3D0RA 4AY5A 1NLMA 3BD8A 2QRHA 1LWNA 4RBNA 2L6JA 2LNIA 4A1SA 5CCLA 3OXLA 3RO2A 1JIUA 3C4VA 4AMBA 4APOA 4KQ2A 3S28A 2MHKA 2VYIA 4U04A 5ARGA 3S7JA 1UQUA 3TSAA 3ZPJA 1J39A 1L5WA
chains in the Genus database with same CATH superfamily
3I73A 2BTQA 2OC9A 4IS2A 4AKTA 4U3JB 2D1RA 3NHLA 4LNGA 2OOEA 3MPOA 3MTBA 4GRAA 5IVKA 1YDWA 4OA5A 4I55F 3DGEC 4DIUA 2MYOA 4G5FA 1PD1A 1NFIE 1QX3A 2XQJA 3IP8A 2J6HA 1O0CA 4TPKA 4GP6A 3UHPA 1EVYA 1IXRC 1JT2A 4D42A 3RIYA 3EIFA 3H2BA 3JWGA 5TMEA 4WESA 4ZQGA 1JHUA 3OHPA 2CMDA 2JIBA 3LBAA 3UMCA 2C8JA 1FDRA 3TOCA 5TPZD 1NI4A 3FPHA 4M21A 1AS0A 4P36A 2B9VA 3BWBA 1H5QA 3FUKA 1YRYE 2PE5A 3EXAA 4M98A 1TTHA 4DT1B 5DT2A 4F4FA 1QH8B 1KERA 1W94A 3O2QB 3M49A 2D5AA 1Z0DA 3B2EA 2AH5A 2OEPA 1EA5A 1RXEA 4NU5A 1E0KA 4I8XA 3F96A 2JIRA 2NZ8A 2J5KA 4TZ6A 4LCBA 3A1SA 3W5JA 4L57A 4WLFA 3D8BA 4B3TB 4CEIB 4QQIA 2HXYA 1N7JA 3OM8A 13PKA 1GXSA 1N0HA 2WD9A 2PKYX 4A7PA 4FQ5A 4UQLA 3KSRA 1L4EA 1O96A 2QD5A 1YKGA 3F9RA 3LY9A 2AOTB 5FOVA 2C95A 5I7FA 1RXSA 9ATCA 1IY2A 3P2YA 5I3CA 1V7ZA 2PU5A 2WD7A 2XMBA 5CEAA 4PHGA 4A8PA 2B69A 5AKEA 2YHUA 3O4ZA 4TLBA 4ZT3A 2XCTB 2BDUA 3H8WA 4B7AA 4ZFNA 4AZ0A 3W9GA 2AWOA 1ECPA 4DQXA 4LF6B 4Q4CA 2AS0A 3S8YA 1IM5A 3MW8A 5I7WA 2WHXA 2KMLA 2PDAA 3K9BA 5DXFA 3T9BA 4PO8A 3SPXA 3WYGA 3ZQ6A 3C3CA 4JBIA 2RBGA 4CM9A 1ID1A 1W4RA 3FKJA 1KZ6A 4G9EA 3UM1A 4CGWA 1YC5A 4NDNE 3GI1A 1Y3BE 4WUYA 3WTCA 1YOVB 4LYGA 1QPZA 1AB6A 1B7GO 3DBHA 3R3XA 5AHWA 4FEEA 4D0RA 2ZYVX 4RF5A 3JTMA 2G5PA 3D3KA 2VJKA 3H2GA 5AK5A 4PRLA 5K2OA 3N8GA 4OAPA 1XD8A 5JNTA 3BMCB 4HVTA 1T9AA 1JQLB 1P1CA 3UM2A 1G9TA 1RWNA 4IJ5A 3KEGA 4LXIA 2PX5A 3B7GA 1AX9A 2QIOA 2W2VA 2ZTLA 3R7WB 1BC5A 2CCGA 1CQPA 2OOSA 3JRWA 1WSDA 1J9ZA 1V8OA 1T24A 3UQYS 2QUAA 3TKLA 2HF7A 1Y7TA 4X8OA 3T15A 1IQ0A 3GLTA 3P4UA 4ZGGA 5AVVA 5FV4A 3OCYA 4MVJA 3UJPA 4BRSA 3KOWA 4XARA 5B6JA 4IDAA 3CF4G 1NGSA 3PCRB 4URKA 4JJAA 4DCMA 4GBGA 3NH9A 4LVUA 1P9NA 3RSLA 1L4YA 4LKOA 5E1DA 3U4IA 1TKBA 2IU1A 4ER7A 4RD6A 3QJZA 4BFLA 2PR2A 1XQ9A 1VKNA 1UDBA 3UT7A 3TL3A 5FEMA 5HJ2A 1YBFA 3TS1A 3ZZNA 3BE8A 4LFAB 1TAQA 1EE9A 1HQYE 2C5FA 1RSZA 3A6KA 4MYHA 5G55A 3G17A 4R3UC 3ZD7A 3QLVA 2OHVA 1ZK3A 2DWUA 3L7MA 4JEMA 4O4JF 1MEJA 4W63A 1MF7A 1FFWA 3X1JA 3AU9A 2I1QA 4H6WA 2OC4A 5DVZA 4GICA 2BKVA 1REQA 5CIQA 3C0KA 5AI0A 5AK0A 2NSJA 4QO7A 1YZQA 3ULQA 5H81A 1RHJA 1EDEA 2SCUB 4D10C 2I2AA 3AESB 4K9QA 1NC3A 1R0SA 3P2KA 4ZALA 4GL4A 4PAGA 4M6WB 4RKQA 4RMHA 3GWZA 3BDVA 2AEJA 4JXKA 5AUPB 5CM2Z 3U31A 4B6OA 3ZWNA 5AD1A 4DR4B 1PQ4A 4LEUA 3PE4A 1XALA 2N46A 4YFVA 4UQXA 4ZVKA 1WUJS 2V54A 3ESAA 2YZ2A 1Q2ZA 2ST1A 5CX1B 4EG5A 4RGQA 1NVAA 3FNBA 4CR6A 2ZKIA 1DG1G 1HT3A 2SNIE 4ZO4A 1N4RA 1OLXB 4CM5A 1UZNA 3AR4A 3OD5A 2XRZA 4RPCA 2OXFA 3P0RA 5EIWA 1JR3A 2PR7A 3MUNA 5G4KA 4DR1B 4IDNA 1UMKA 2FWIA 1A4XA 1PFVA 4YECA 4Q1CA 9MHTA 3PXCX 1YK1A 3JASA 3HG0D 2PX6A 3QVXA 3Q79A 1CP2A 3UXEA 3CIOA 2RD0A 1DUVG 2W0SA 3IERA 4L0CA 1LI5A 3CC8A 4CBVA 1RC8A 1JA1A 2B4QA 2WJJA 1DFHA 3A26A 3U09A 4M38A 1NUQA 3U60B 2HE0A 5EESA 2HZBA 1NVDA 1YR6A 3PRJA 5ENPD 4UBOA 4WLOA 4DDUA 1FJGB 1C9DB 1N1GA 4EG6A 4KNVA 4ZVLA 1U2VG 3M6UA 3STWA 2AFHB 2OD2A 4W8HA 5F7XA 1P6XA 1IUKA 4WLEA 3J7AC 2TMDA 3TNYA 5DT9A 1S2MA 3H2HA 1W59A 4NMLA 3FYTA 4JI5B 4JYBA 2YIDA 3FNIA 5CUQA 3LKVA 4XI0A 3C3PA 4BGUA 4M1KA 4HQFA 4LWZA 1W0CA 3E1SA 1X1RA 3NJ8A 5CEFA 4U0UA 4M1EA 1XAJA 4OHMA 2K2WA 4F96A 4GI2A 1F38A 3LCJA 2R8EA 2WWIA 4DX7D 1SR8A 1V43A 2V6FA 3FTQA 4ENUA 3BKWA 2VF5X 2ZB7A 4O6VA 2WY2D 4QOFA 2DVWA 3V8QA 1B2RA 1GYRA 2AFIE 4LPSA 4O1HA 1RMTA 3GCXA 1EBUA 3O3CA 4MRAA 4X91A 1Z6ZA 1GY8A 3KFLA 5AT1A 3FDHA 2IYEA 2Q5FA 4EHLA 3I6BA 2VZEA 2PH3A 3SYMA 4RULA 3LGAA 2NG1A 4KHZA 3OXGA 3M7IA 5D3ZA 1AQ6A 3LP6A 3OKAA 5LDGA 3ZI7A 3DEPA 4C48B 2Q0SA 3ED5A 1A4UA 4HBDA 3DCNA 3MJCA 4DLPA 3GEHA 1R4AA 2MHCA 2AG6A 2VSNA 1SVWA 4MQEB 5DJ5A 5EKTA 2NUTA 3GZ2A 2DFTA 1IWPB 4OYHA 2EKQA 5AKLA 3ONWA 1SZPA 3EPRA 4HUQB 3PXEA 3ST7A 1Y33E 1E8MA 1BS2A 2O3QA 2PRJA 4GI1A 4PGGA 5IM4F 4JB2A 3RAGA 1IH8A 3WMXA 5ENOD 1DCTA 4OGFA 3T95A 2VN8A 3DTVB 3IHWA 2XCRB 4TXMA 2WXMA 2WMNB 1UKBA 1HQCA 4S1VA 2QN3A 3CX8A 1FQOA 4YVOA 1W2GA 1WZIA 3NT5A 4K8RB 1U0RA 4R84A 5AR1A 2LR0A 2C2WA 4JL5A 3WGMA 1RWWA 4BO9A 1C80A 3JVUA 1G3RA 2WP0A 4FBGA 4HDMA 3ZE7A 4BNWA 3AUYA 1JKIA 2QJFA 2ZM6B 5G2OA 1OGYA 1MX4A 1D8DA 5CHYA 2TMGA 3PX7A 1Z8FA 1PUJA 1DE0A 4FC6A 3FG9A 4BFSA 2ZI5A 2JIPA 4X85A 2UVDA 4KHPB 1VC2A 5CDHA 3MRXA 1NXSA 2I4OA 3SD5A 3ILSA 2YHIB 2WJAA 2NMVA 3Q12A 5JSUA 1M9NA 1ULSA 3KSMA 5F51A 2KM1A 4HH0A 1ZP6A 2I87A 4OXYA 3SHTA 4AS3A 4S1OA 3ZWMA 3ANMA 4LVCA 3DR3A 3AV0B 6YASA 3G5AA 4EHAA 1I2AA 4EFLA 1GDTA 3KHSA 4ZFHA 4CLDA 1UAAA 1COWD 1A9ZA 4MS3A 2V45A 4WD3A 3U4DA 3EVZA 2JCXA 2GPWA 2DE0X 4V0NA 4BO5A 2WWXA 3FCXA 3KR0A 1C9NA 1CR0A 3DMGA 2EKZA 3CHOA 2O0HA 3PGXA 1VIMA 4PSUA 4N2QA 4UATA 4XTRA 4YP9A 2KBXA 4R51A 5GWXA 3BL6A 1H8HA 5EJEA 1LZLA 4IMRA 4PYMA 3VVMA 1Z7WA 4HN4B 5B53A 3NHPA 1MORA 3M0EA 1ZI6A 4BB6A 1EFDN 2NUAA 2DPGA 1CU1A 2VRCA 4X1YB 1EUDB 1LSSA 2F55A 1E59A 5CFZA 3CLVA 3CZMA 2XQVA 4O63O 5FT9A 3UYKA 1PK8A 2JLSA 1B89A 1TUGA 1XVVA 3UW3A 4QGFA 5BOSB 5JHHB 5D5PA 4URWR 4JBGA 1L9XA 2VKQA 5M72A 3V2OA 1BKDR 1V8ZA 2P2YA 3RYFB 3ESKA 3QJYA 2O8EA 4N3CA 1D0IA 1RLOA 1C1XB 1K1AA 5A9SB 3MWJA 5JAQA 1JDJA 2JFHA 3CRRA 2Q5IA 3G9ZA 4UVGA 5J2TB 3FKQA 1ML4A 1QUEA 4K9MA 1E92A 4TUYB 5DXJA 4CV2A 1T6NA 1UOHA 1U0EA 3G1UA 3ONEA 2QN1A 4V1CB 1BDIA 1GCIA 2AJLI 2A58A 3T8YA 1E9SA 3KQMA 5FNVF 5BN3B 3TZEA 3SR3A 1XE3A 3UA3A 4UUAA 2ZS9A 1Y9DA 1PYOA 4AJKA 5F5XA 2XVYA 2FGKA 3FUWA 1OH5A 3WK5A 1I2CA 2OESA 3QPWA 3UMSA 1GDDA 3AY7A 3SF4A 3TD6A 4ZI7A 1C7RA 3GUCA 5HIJA 1V5EA 2JJ1D 3W2IA 4GTQA 3ZIAD 9ABPA 4NZOA 2ZUBA 1EWRA 4JXTA 5DNAA 1A8HA 3REOA 1QF6A 4AM9A 4HQNA 4JVMA 3HJHA 1KY5A 4C4YA 1IDN1 4LXUA 1OZ0A 1V8BA 2ERYA 4FIDA 3KEQA 4OB8A 2P9KG 2HYZA 1BQEA 3Q72A 3CZQA 3E9ZA 2QE7D 4MQEA 1X0VA 1X7GA 1UXGA 4KYIB 3GLQA 4KAFA 2F3UA 2H7CA 1RZRD 2DB3A 3Q47B 1VKJA 2IOYA 1UZAA 2C9ZA 3B6ZA 3FX2A 1YB7A 2AI3A 1YOBA 2B8JA 2X8WA 2PZEA 2ZYIA 3GLRA 4KAXA 4F2GA 1Y4UA 4B93B 4TMWA 3ZGXA 1QQBA 3MINA 1RPJA 5HFJA 3CZ5A 2OGSA 1L7PA 3R7SA 4C0SA 3AF0A 1OT5A 3DF9A 3GDOA 1V55E 3HU2A 3JD1A 3QY0A 3BFKA 3T7SA 2JK1A 3OX1A 3R1IA 4HQRA 2J9ZB 4WXMA 4Q5IA 1SC6A 2PV7A 5DP1A 5H8WA 2VAWA 1H9CA 1RBYA 3W6UA 1NWHA 3I01A 1HLDA 1RDFA 2C2ZA 1S8OA 3AVOA 4H7KA 2UWJG 3G13A 4EMBA 2ADOA 3SR0A 1TPZA 5CNIA 2BGGA 3G2SA 2X41A 3DYVA 3GXBA 3PG5A 4N3GA 1RAEA 3WQSB 1NI5A 3BGOS 3K32A 4JZKA 1OZHA 1SUPA 2ZP1A 4UTPA 5JBQA 3PZ2A 4BTBA 1N2XA 5JAOA 3T3EA 1Z2PX 1Q19A 1FMTA 4U96D 5KQRA 2XE8A 4TQUS 3BXOA 3EJNA 1H23A 3SR4A 4EJ0A 3C3QA 1PKEA 3VTKA 2NSLA 1U8XX 1W0JD 3TZHA 3FTUA 3DO8A 1FTWA 4E07A 4A15A 3MWKA 4OHFA 1SHLA 4XGQA 1WZUA 4QTZA 1M1YB 3VR2A 3W6PA 3B7UX 2GROB 3G88A 4L7TA 1DAPA 3UT4A 1A0OA 2XB8A 3BFVA 4PYNA 5ABPA 2D2VA 1AO0A 3ZVMA 3BFXA 3ZNQA 2DUJA 4RJTA 2WJIA 4WZBA 1QDLB 2ZUFA 2J3DA 2C54A 2P9YA 5G04C 3HUTA 1UDAA 6NULA 1Z5WA 2O3RA 5HI7A 4RACA 2FUCA 2WBLC 3FFWA 2YXNA 1YD7A 1CYEA 3L9TA 2PKRA 1VMKA 1RTKA 1U7WA 4CGZA 3PDHA 1NLZA 1RHKA 3HVHA 3S29A 1K8KG 1YK0A 3K20A 2EG9A 3OECA 4M0EA 3EVTA 5A71A 4LGMA 4O4IA 1TJ4A 5DHPA 1V3VA 1N6KA 2JCVA 2BGLA 2V7BA 3AFIA 3DT9A 5CPBA 5F7JA 3HBAA 4BPRA 4DSOA 2OYRA 5IAAA 3RODA 1NBIA 1UC8A 4DM4A 4FUTA 4ONEA 1AKEA 4QSHA 3JQRA 4YAFA 2I3GA 3GGJA 3MRTA 4G63A 1JZQA 1ULZA 2YVKA 1WEHA 4NBLA 2GR9A 2CJFA 4QLBA 2GNPA 2NYJA 4PLFA 2KM4A 4D99A 2HRBA 3FJ1A 2VT6A 3EGIA 1GUBA 1RWXA 3NWPA 3H42B 4I8DA 1V96A 4HRXA 4DMKA 1H4VB 5JANA 3O83A 4A23A 1CR6A 1IULA 2X6TA 1UIMA 3FTNA 1IMOA 1U2RA 5A5GA 3V6LA 1V39A 1RBMA 2UYGA 1Z0UA 2OZEA 2PGJA 3CW9A 1NWCA 2FETA 2ZRPA 3O74A 4NFYA 1U0SY 4MHTA 3AHDA 4P80A 1V4NA 2PKWA 4CNBA 4LV6A 4NXNB 1NXVA 2J0UA 2I1VB 5KC9A 4HX5A 3KS2A 1Q0TA 2Z3ZA 3AHIA 1WU8A 2XXAA 1NIPA 4P4SA 4ZJZA 1UJKA 3R3SA 4XIGS 4F7WA 1W581 3HYLA 3IRUA 3WWYA 4AQYB 2DQZA 4L9SA 2HM7A 1K8RA 2A0KA 3T1NA 3NWEA 3R7NA 4EKIA 2HA6A 1NF2A 1M2KA 2C98A 2VK4A 1KOGA 1QU3A 3FZYA 4LA4A 1OMOA 1VIDA 3QWFA 4GZMA 3DHNA 3AFNA 3GLSA 5LLDA 2ZSBA 1YJCA 3WSWA 4P92A 5HHTA 3CX4A 3JARB 3D6HA 2FMTA 2IS2A 3J5PA 1HPLA 3WLOA 5L3SB 4C2UA 1JA0A 3RD5A 2C0PA 4QJBA 1VBNA 2JGDA 1Z4IA 3RYHA 4FILA 3QE4A 3U1VA 1ISRA 4IMIB 3WLSA 3HEAA 3WLKX 1K5DA 4NEQA 1EB8A 4EVQA 3WWZA 5JXIA 5CCDA 1K1BA 5I9LA 5JMTA 1SC1A 1ILEA 3NOVA 2J45A 1AQIA 3NQPA 1Q0HA 2ZRHA 4NZ9A 1XF9A 1GCAA 1ODJA 4HMOA 4EG4A 2B2NA 3OF5A 3VSBA 3GNTA 3KAKA 4UUNA 1MJFA 2I66A 3NKVA 2H2AA 4EKDA 3GBVA 1FMCA 3W05A 4J6EA 5HQ3A 3CO0S 3IIKA 3IUBA 3JSAA 3E70C 4YVFA 1KNXA 5IZCA 1ZY2A 5L45A 3M6MD 1AS2A 3UGQA 4LF5B 5EJFA 3EA5A 3EXFB 2IP2A 2QT1A 3H2JA 3SOPA 4EZBA 3IL2A 2UYYA 3MFQA 1BDBA 4RS4A 1FSPA 4J7WA 3MHPA 1PR3A 4JVSA 3PXUA 3T7TA 1N9AA 5DH9A 3HXBA 4IIFA 4U9HS 4DDWA 2CD9A 3B9RA 3OWOA 1E1YA 2FFBA 3PRYA 1KBOA 3HXDA 4A6PA 3FCAA 2GRPB 2WIKA 3ICCA 4QUEA 4BMVA 5K4HA 1NR1A 3KR2A 4IDDA 4RE6A 1T1EA 1V3QE 5LSAA 1BX1A 2VJPA 3PRKE 3HQ4O 3REQB 5A0TA 1JEJA 3H1EA 4B7UA 2WJVA 4O3MA 2OD7A 5J9FA 1P4HA 4AWAA 1SCIA 3IB3A 4RKEA 4Y2YA 4OX9B 1J7JA 3TQQA 3EISA 3PHCA 4PZ0A 1Y7PA 1SXJE 4L4XA 2JIMA 4RF2A 1EM8A 2HLNA 4HORA 4L4YA 3R9KA 2HJRA 2DSTA 4QUJA 4QYSA 1MO2A 1PW5A 2C42A 3BYZA 4P81A 3T9DA 3V4SA 5SZKB 1PK9A 3NGMA 3CVWA 3FWVA 1COWA 1ADBA 1FDUA 4UZSA 3SHOA 1I3OA 3IJPA 2Q2QA 4HOUA 1Q5PA 2H4JA 1I4TD 1TM2A 2ZU0C 1O6ZA 3U3DA 1EXNA 2R11A 3X1DA 3H2YA 1ZN9A 3T9AA 4LOKA 3D4LA 2QTAA 4ZT7A 5EHXA 1K75A 5KBAA 2O1XA 4LOIA 5REQA 1ETHA 4W5JA 3RC2A 3WB2A 3M2TA 4FN4A 1AQYA 3FDXA 3G7NA 4X1KB 4DMUB 4LY3A 5HS4A 2E48A 5BPFA 2WE7A 1PQPA 3NX4A 3PUXA 2YXEA 3UZUA 2NUBA 1AS3A 3CM0A 3KJZA 4QNMA 5G53C 4E4RA 4K28A 4FHDA 3QWHA 1F7VA 2IYUA 1Y3FE 2MYTA 1SB8A 3CJRA 1RYBA 4QQFA 4XQGA 4R9UC 3ZWYA 1KS9A 2DT5A 3LC0A 1JSXA 4PIVA 4QDJA 3Q7AA 3RAPR 2I34A 1U3FA 4NLLA 3GGDA 3PSHA 3EPLA 3THWA 2ZTSA 4LX0A 4HB0A 4XWOA 1JQ3A 1QQTA 3G8DA 4TWZA 5CRIA 1ZC4A 3U4HA 1IM2A 1X94A 2VZ0A 1Z4PX 2GGFA 1QO9A 3LP5A 2WUVA 2WKWA 4QDKA 1IWBB 1PEKE 4GMFA 3HCPA 3W9UA 4EO7A 5D3KA 3PKJA 4YDQA 2VH5R 5IJ9B 4ABTA 3VSCA 3IEIA 4BJHB 2PT7A 5EE5B 1GNSA 5JFGA 1YRLA 3H6HA 3PQEA 1IHDA 3N3BC 1IN7A 3Q88A 4UM9D 5AOAA 5AVJA 5C1PA 1G2IA 1PFUA 4Z53A 4KYUA 4OJQA 1OU4A 2UY1B 3PPYA 3TMAA 3T5XA 2XNKA 4O33A 3EHNA 1N57A 1U9ZA 4AN1A 3C3EA 4Y30A 2WXRA 1V0JA 4KZPA 1NNSA 3PGMA 4O4JA 3X1ZA 2HHHB 2FPOA 2VHEA 3M1AA 2FEKA 1KO7A 1T4GA 3CA8A 3I2HA 1S2OA 3EQZA 4FMCF 4MUXA 3QZUA 4C4TA 4D4JA 2IOFA 4WDQA 4B6GA 3NDBB 3T7RA 1LBTA 2EGUA 1Z29A 2N42A 1NFFA 4ZMSA 4FCVA 4RTLA 4LJRA 4YA6A 4ZI5A 2OSBA 3DKPA 1CB7A 5MDHA 4HWKA 1NPYA 3UAOA 2HRRA 4RAOA 5CIYA 3GVPA 2OFWA 1NVVQ 3QPBA 4M60A 1AKYA 4TKUA 2QN7A 3WISA 4WJZA 2NYRA 3IAM6 1QGOA 1UCFA 4F6RD 2GAAA 2K6GA 4RIIA 5KJEA 3ROXA 3LWNA 1L4BA 5LCWC 3PLRA 1YS2X 1C0KA 4Q6BA 5FWAA 1FFSA 2FEXA 4W5TA 2I99A 1ZKMA 3ZG6A 3WA6A 4MW4A 2QT9A 3C6QA 3EFOA 3FMPB 3D0KA 5H3LA 1OF1A 5EIOA 5KYYB 3JATA 4D8WA 4UM7A 1FJHA 2B2CA 2E4ZA 3G9XA 4ZXPA 1SXJC 1MQAA 4Q00A 1YHZA 5KJLA 1NQVA 1X9IA 1U3VA 5F1YA 1L5MA 1GRNA 4MBGA 3OFKA 3PNKA 1XD2A 4QPZA 4EKYA 2IODA 2OPBA 3K70B 4M7WA 4Y1EA 4MKXA 4E5PA 3R8FA 3IIEA 4PS3A 2QLFA 1WUYA 3F5FA 3GAMA 4C0HA 4EQ6B 1KOLA 4XM0A 3MT9A 3IAXA 2ZIRA 4I4CA 4FOSA 3OE7A 3RU7A 4PZEA 4HAZA 4TMZA 5EI5A 3E1KA 1JW9B 4J4BA 4FT4A 4YMHA 3VNUA 2HLPA 2JEZA 2RHOA 2ZT6A 1CF2O 2JI8A 1TM5E 4FJ1A 1SU6A 3DNPA 4ACKA 1T8PA 2JKYA 2NTNA 4JU8A 4IJUA 3OAWA 4M9RA 1GGMA 1KQOA 3O03A 1UDRA 3GAFA 4HGOA 4ALJA 3A4TA 4D9EA 3B78A 4EPTA 1U8TA 2O7QA 4MI3A 2H4WA 3TYXA 4M0CA 3OPQA 4ETIA 1RXVA 1D04A 1ZHFA 2RFLA 1EGVB 3F47A 1FMFA 3OPXA 2J9GA 1YGPA 2ZBFA 5AOVA 4RORA 3EH1A 1P39A 1XXHE 1U8YA 2EQ5A 3STHA 2YYAA 3TTUA 1KTIA 2RH9B 5BMOA 4B9AA 1CRZA 4GBMA 1Z3CA 3LG2A 1T3SA 3B1JA 2AT1A 1VXOA 3HY4A 5EG5A 2NACA 3DVAB 4MJLA 1ATIA 2Z9CA 4CRWA 1RQNA 4XUDA 1IBCA 4ARCA 2JFYA 2QQEA 5AVUA 4KR9A 4HD8A 1M2JA 3DL7A 3JYNA 1SRQA 3O9VA 4Y6SA 4NARA 3JWHA 1KI3A 2J3EA 3EVEA 3U3WA 4QAJA 4AJJA 2EAUA 1YJ8A 1F4LA 2C9DA 2I3AA 3FLMA 4IP0A 4JLSA 4PRZA 4DR3B 3CHQA 1MAHA 3ESCA 3PGJA 4GE0A 4OSEA 1MBZA 4GOMD 5B1HA 1J97A 2SECE 1S8FA 1VG1A 4CL2A 1JEYA 1QP4A 3H1FA 1I2MA 2CHXA 1E2NA 3INGA 3IT1A 1BLXB 3L0YA 1F9AA 2V7XA 3EZYA 4HAUA 2Z5VA 3EIWA 2W2MA 4JBHA 1G7CA 3DLPX 2A9KA 4CT4A 3CVYA 2H9AA 5B58C 1VMIA 2ZSFA 121PA 3L5OA 5DTJA 4BNDB 3EX7C 3DZHA 5EQTA 4CM7A 3AVXA 4NV0A 1EGAA 3CHPA 3I0ZA 4DNPA 1YMUA 2BSAA 4JB8P 5KCMA 5LQJA 1MD9A 3ORRA 3OTQA 4L3OA 5EYLA 1AXGA 1G9XA 3FRHA 4OA8A 4DJFC 3GEEA 1PV4A 3O3MB 3CPJB 4NE7A 5CLHA 1GNTA 1UBTS 1A72A 3AGQA 1Z4QA 1I30A 1L5VA 2CJYA 5DTMA 3CUTA 3KQYA 1U3WA 1O5TA 1IKND 1BOOA 4L3VA 1HFAA 2JH8A 4U7WA 3N6XA 4CR7A 1IOWA 1EDBA 5CBKA 4G0WA 1QK5A 3UFXB 1OXKB 2DULA 4U00A 1U1CA 4PZCA 5AQ1A 4B6QA 1SIBE 3AEUB 3H5RA 2QE7A 4EB6B 1I7LA 4L16A 5DLEA 3CNLA 3EQ9A 3EG9B 1Q1GA 4KQ9A 1IPEA 3SIXA 3SS7X 3QOYA 4Q7EA 4YNBA 4BNXA 3C1TA 1NVBA 3A25A 2MSNA 3FZQA 1OWMA 4RDXA 1DP4A 2KCKA 2HT1A 2RHDA 1BE8A 1NP7A 4CYMD 4XD7A 4WXHA 3L0CA 3FH7A 4EY7A 3CNHA 3GZJA 3MTAA 5K0JA 2ECKA 1IONA 4DPKA 5I5GA 3UHAA 2RG8A 1GUZA 3FHJA 4V38A 4WH0A 4IVNA 4I9NA 5JAHA 1JLHA 2ZYTX 4BNGA 3LDUA 4K81B 2OCDA 2BP7A 2KBFA 1G63A 3GJ4A 1EK1A 1M34B 3JXEA 3K5WA 3N6RA 2OZVA 4NQZA 4OI4A 1DC7A 4QYIA 2H5IA 3U7EB 3EGXA 3LUGA 3K73O 1J33A 1AK9A 1JFLA 4ZVMA 1SU7A 5BWCA 1UPUA 1I0IA 2H2HA 1NQAO 3AOGA 4U6NA 4A6XA 2TECE 3DEOA 3N2LA 4E13A 1UP7A 1FK8A 1CIPA 4OGKA 3DDHA 5A7GA 2VP5A 1K27A 1TM3E 3EDQA 5AUQA 1DAKA 2MSWA 1MZVA 3DVRX 3ETEA 3KALA 4FNAA 1KVUA 4L51A 4OK3A 4E51A 3AWDA 5P8WA 5TS2A 3C8DA 4FYIA 3RFCA 1ZITA 3WL3A 4BLUA 4BN5A 4DA7A 1JWLA 2VWPA 3QVLA 1OH6A 1U28A 3KEZA 2VGYA 2JEYA 3G2OA 3G8AA 3S5JA 3EA4A 3FPJA 3PYLA 2FZKA 3VAZA 3QA3E 4FZVA 1OWOA 4D80A 5AIBA 2HQBA 4CG3A 2XLBA 4R9SA 3JCKC 4JGIA 3FOCA 3LDHA 3BFJA 3NGXA 3OUTA 3THYB 2VDRB 3W34A 1V26A 1X19A 3BHMA 4E7OA 1FEZA 2ZUCA 5AI9A 4BZWA 3DBRA 5ULLA 4GAAA 3TN7A 3F97A 2XCBA 1H3NA 5A7DB 3CZ4A 3HCEA 4CDMA 1JHQA 4G9GA 1XNJA 2YZMA 1W76A 4OQ4A 1JIQA 2IHKA 4XLLA 4XYMA 2PEYA 2Z6QA 3V4ZA 4LNUB 4GR5A 3ASOE 1G3MA 4WDRA 1N2ZA 3T99A 5A5DA 4F1SA 2BY4A 1KU0A 4MPDA 1G5IA 1E0AA 3ZCTA 4YMTA 3A1NA 4O4HB 5D5QA 3Q7QA 3K1ZA 5E4TA 1WPGA 2R84A 1CQIB 1D9ZA 2QNIA 3O26A 1IHUA 4LJ5A 5G1PA 4GSLA 3U7QA 2G25A 3UEOA 4ZK6A 3RU9A 3EIQA 1ZI8A 5K6RA 1I9GA 1QG0A 1ZGBA 5FLEX 1V8FA 1T5IA 1SG6A 1H05A 2FEMA 3ZUVB 4R8VA 2Y9PB 3ZOKA 1NL3A 1P2FA 1XMVA 1CR2A 2CUNA 2GX6A 4X41A 2CSUA 2EBFX 5H4HA 2A33A 3A4YA 4N8SA 3R74A 1GKYA 1P9LA 5B6IA 4D46A 1ITZA 2CLOB 1CZHA 2W2NA 3PF9A 4N9QA 3IO5A 4PS7A 3KEFA 4W4TA 4X6LA 4JBYA 4YAEA 1T3LA 5EHNA 5FBVB 5MFZA 5IX8A 1YRQA 2H2DA 1FMLA 3KOUA 3NWJA 1DX4A 1PR2A 1TN7A 2Q7FA 1KJWA 2I9PA 2GM9A 3FB4A 1JIXA 3AR9A 3EEYA 3NT2A 2VXOA 1X3LA 4FS3A 3MS4A 1LDBA 1ONNA 1ZQ9A 3AGPA 4IIBA 4MW7A 5HTKA 1BVHA 1ODTC 2BLNA 1GPKA 4KXYA 1VE9A 5JDCA 3LC1O 4Z8YA 2F8XK 1DKRA 1YIAA 2HF8A 2R751 3C1OA 3HE3A 3CBGA 3HB9A 3O47A 5K2MA 5GOZA 4H15A 4ANVA 2GJSA 4WZAB 4IXMA 1ST2A 1T4MA 2QJRA 1AO3A 3EIEA 4HNAA 2QG4A 1MG0A 1G60A 2QLLA 4QZVA 8ATCA 3HK2A 5KYXB 2J4BA 5JJ7A 2GESA 4OHOA 3KXKA 3Q9UA 4OHWA 3H1TA 3BJRA 2I0FA 3PNLA 4AUKA 4BIIA 2QRVB 2WHRA 4ZGBA 4M1SA 4NULA 1QRDA 2G08A 3LX4A 5F64A 3FGZA 3FTPA 5KTYA 3L46A 4R6WA 4F56A 4QVIA 3ZXPA 2YTZA 1K92A 3L40A 4PNPA 4R9VA 5J1TB 3KEAA 5K3FB 4TXQA 1L8LA 2FQYA 1VZ3A 2XRFA 3FPBA 3MGCA 3N39C 5E9WA 2O7SA 4JBLA 2E3JA 3CY6A 2BP7B 4QUHA 3DQQA 5HQ8A 2V59A 3GJRA 5C18A 3U1BA 2I29A 2GBFA 3F6YA 4GDMA 5JS6A 4W1SA 5M2QA 1U99A 4JEUA 2ONDA 4DV5B 1T2EA 1VLVA 3DT6A 4BE4A 5AJUA 2YKGA 2QOEA 2VG8A 3TE6A 3BSWA 2PQMA 3EC1A 3U6BA 1YFZA 4CT0A 2WSMA 4QICA 3T12A 3UT5B 1LK0A 2XCOA 3IPXA 1USWA 4FP9A 1IYZA 4OSPA 4RABA 4ARBA 4OLBA 1XZLA 4URVR 4KYOB 3FYCA 4X1YA 1YZYA 3RASA 1Z4MA 3I23A 2DUNA 4MWBA 1UOEA 5ENTD 4B34A 3BJEA 3ON5A 1W0KA 5TMBA 2J3IA 4BWVA 3UPVA 3K53A 1NQ5A 4CWAA 3LLUA 1KI8A 1JL3A 1EP3B 1OWLA 1U9JA 3G8YA 3H97A 3L7YA 5BQOA 4MQ5A 4YREA 3AI7A 2JF0A 4X92A 3MKQB 3W1VA 5IYZB 1KEKA 4BL5A 4DY4A 2VT2A 2EW2A 3K4HA 5DM0A 2IRWA 2HPVA 4FYHA 3L8EA 2FJUA 3GAAA 3QTBA 4J1TC 1UN9A 3VZRA 5DCUA 1W7AA 2EQBA 1B0AA 1C4OA 3HS3A 5LOVB 1X1QA 4YJGA 4ZAYA 3BRSA 3CE6A 1T0BA 3EZXA 4FKMA 4G89A 3E23A 3SN6A 2NPOA 3OE1A 4DR6B 3TX2A 5A5FA 2I1KA 3V8MA 5AI4A 3FFXA 2EKLA 5IJ0A 3BCHA 1C7JA 1R8SA 2JFGA 5K03A 1PC2A 1ST3A 2YIVX 4X7MA 5AW9A 1MG5A 2MWMA 3CRNA 4F5ZA 4Z0PA 3PDNA 2AI2A 1F2DA 4UD6A 2CWWA 4MQ4A 4Z86A 4IUBS 4L15A 5HR5A 1KA9H 5JT1A 2WWRA 3K0AB 2LDXA 5J63A 3M1YA 3HR7A 5LP6B 4RTRA 1C0IA 3PDCA 4Z6KA 5JJBA 4AJNA 2J3LA 1E1MA 4D98A 1E61A 5CBPA 3LKUA 3LM8A 1LTKA 2BZ1A 3WWPA 2ZRKA 3CCBA 4OUDA 1KO8A 4I5DA 2EGHA 3CONA 4Q3OA 4MA5A 1GXSB 2YV5A 4KXKB 4A3VA 4AP9A 1TMKA 4CKEB 4FHJA 2AN5A 1VCNA 3IBGA 3NLLA 2ZT5A 4YMUA 5L3VA 1YRHA 2P3QA 4GMGA 5AN8A 3DUFB 1W29A 2X2EA 1EINA 2SICE 4KXXA 1DGQA 4EFDA 4LG1A 1E60A 2W4MA 5BR8B 4JI1B 4M3NA 1HYHA 1M0TA 1LWNA 1N11A 2OQ2A 3F7MA 1WG8A 2D1FA 3G2QA 3GRKA 4AMBA 4D9MA 5ESDA 1KC1A 3TINA 1CQJA 1JFTA 4PX3A 4FC7A 4U04A 2YN4A 5A3QA 5ARGA 3S7JA 3IEUA 5JCOA 3TXYA 2FI7A 2ENWA 4FNGA 2XNSA 1RAFA 3CT4A 1L4GA 1SCNE 2XHZA 2HMSA 3BICA 1WRBA 3QX8A 4Y7CA 3U1TA 5EJ7A 3K71B 1WB9A 4P7JA 1IIRA 3QX9A 4RYLA 5C80A 3FYUC 3JQQA 1G17A 5F5NA 4ESOA 1TZKA 4XCVA 5ER9A 3L0PA 3PCTA 4DCPA 2ZB8A 4AF8A 2B78A 1XAIA 1I6WA 4W1RA 1JSZA 3FTCA 1ZEMA 1ESDA 5IZCC 1ZAYA 1R6TA 3U80A 1QIEA 1CF9A 3LZCA 4OTZA 1AQLA 1RAAA 4K1LA 1JNYA 4LI0A 1NA3A 3R5FA 5JBNA 2YHSA 4M99A 4AJHA 3AVVA 3C48A 3D6UA 2VJ8A 1Y34E 2X9NA 2AXNA 3EOAI 4NJMA 5FBQB 3RVJA 1G291 2ATEA 2Q9CA 2WIAA 4FFLA 4J03A 4BCDA 5JNUA 2ZB4A 1ADYA 2QRPA 1D9XA 4HDAA 1EM6A 3VBEA 2NVWA 1H8ED 2YOGA 1UOOA 3FWPA 3NTVA 4HLUA 4MH0R 7AT1A 3WYCA 1MJ5A 2OAQ1 4INOA 1ZICA 1D8EA 3MK31 1I1QB 5D1HA 4QJ3A 3PXDA 4B85A 4G07A 1Z5PA 3MGGA 5IF3A 4XWYA 5K3DA 5CH5A 3VYVA 2BFFA 3HIZA 1O97C 1QR6A 2YDYA 4OQZA 1WZCA 3UKUG 4WLUA 1UR5A 3GFRA 2ZAGA 2GO7A 1XHFA 1Y0BA 3EHQA 2VKTA 1JQAA 2ON6A 3SFZA 1DEXA 3W2GA 2XVXA 2OY0A 2PQNA 3WNQA 1MO5A 3H11B 1DBSA 2GLTA 4HK4A 4YTEA 2V98A 1NR7A 2X4LA 2H11A 2R1ZA 5IVDA 1QHFA 2Q8QA 4ZICA 3CRW1 5BT9A 1KOJA 1MR3F 3EARA 3OSUA 5FTNA 3F67A 3EHEA 1MGOA 1XHEA 4IIDA 5M3BA 4AEZC 1LS6A 3UPDA 4JA0A 4OB6A 5FWQA 4RUKA 2D8AA 3LL7A 2PGNA 3M4JA 1AGRA 1QOPB 2DCUA 3OTHA 4G0OA 4K46A 2L18A 4TQAA 2VPTA 3K09C 3WKCA 3L7CA 1HKHA 1RLJA 3DE5X 3BCSA 5CITA 1NA0A 1UBMS 3UGTA 5HRCA 3D1JA 5ELMA 1RCUA 2BV3A 2AZDA 3C5EA 2NIPA 1CULC 1TTPB 3FPCA 1EB9A 4MZXA 5AIJA 1PYGA 2I6GA 5L51A 1QPGA 4N5QA 3E9QA 1DQPA 1U6IA 4L9RA 3ZCPA 1X7XB 4F38A 4D4MA 2BONA 2D5LA 2VDWB 5F73A 1M2GA 4ZZ3A 2CXHA 4U39A 3B6JA 4N7RA 4GPKA 1RJWA 4V0ME 5EHGA 3S44A 1OTHA 1QDEA 4KI0A 1CY1A 4EYQA 3ZXIA 2I2BA 2Q4TA 4QYXA 4E11A 1BMDA 1NI4B 1D2EA 4IDOA 2IJGX 2Y1DA 2ZJFA 5I8ZA 3ZJTA 3WGZA 1U7TA 3TLEA 4QQNA 1Y8RA 4H7XA 5K8TA 2WIFA 3GNSA 5B4UA 1SXHA 2L2QA 2O50A 3ICWA 2C2HA 3OXFA 3DUFA 3IMEA 2DBAA 2WFAA 2NOAA 3QITA 4G1UC 3TUIC 4C0KA 1WCIA 1CZKA 2WA1A 5C5IA 1WQ1R 3H5IA 2WF5A 1XL1A 3BS4A 5EYPB 1JIVA 1YB5A 4C4XA 4BMXA 1NI3A 1AZSC 2EVWX 1GILA 2XDAA 2ZPUA 3PHBE 4DWJA 3OZIA 3RRJA 1PR1A 2BM0A 3HYMB 1AV6A 1YU6A 1ARZA 1SKYE 3IHTA 4I4NA 3QYAA 3CURA 5FDFA 1SKAA 2IUFA 4YWHA 3ZGYA 1HG0A 3QEBZ 3AEQB 1OBFO 4AJLA 3D4BA 3M9XA 3EHRA 3A9WA 1G5PA 2RK4A 3GRFA 3C14C 1A9SA 3JRXA 4KT6B 4HAIA 2QU8A 3VTXA 4G0YA 1R7RA 3AP3A 3DAHA 3LIIA 3O38A 4MV9A 4OJKA 4P86A 4Q02A 4IIEA 5LD2B 1JBEA 2BGWA 2ZSKA 3MS7A 4JX8A 4MQLA 3L7BA 3L0BA 2VHXA 1CUBA 2JAUA 4IYJA 2OQRA 4Q19A 3SOZA 3Q11A 5JH7A 2A5EA 4C6SA 1QIDA 4LQDA 1G1MA 2MOKA 4INJA 4YROA 5JNSA 4CF5A 1E96B 2YJTD 2IO2C 4BDTA 3FY4A 5DOZA 2OORC 2VQEB 3KYDA 3WGLA 4F91B 3TL5A 3B5IA 3GJ8A 1SXJD 4YJ3B 4ZV9A 5BNIA 2F43A 5T64A 5AVWA 1GOTA 3CCFA 4M55A 4V02A 1BW9A 1N1MA 4UUBA 5D84A 2XOKD 3SEAA 4M83A 4P29A 2K4MA 2X0KA 3CKMA 4INPA 5IJZA 3NYQA 2CDBA 2CFZA 2JJ2A 3H1PA 2WRZA 1AGYA 4EJSB 1ECLA 1WW3A 5AW0A 3D5EA 4B89A 1OWNA 1LPOA 2PYDA 9LDBA 4RVUA 1IY0A 3FNRA 5EVJA 1F2TB 2Y71A 3S2IA 3O1IC 2H07A 2IZZA 3SYRA 3OZVA 4C7OB 2M6RA 2GD2A 3H86A 3MWGA 5FOSA 1G5HA 4EF5A 3WBBA 3CR3A 3KWFA 3G2WA 1GZHB 4W99A 3U3JA 3WNVA 1NJGA 1C3XA 3RU0A 5ENVA 2ID4A 3C5VA 3AJRA 1EFPB 4HAXA 3UA4A 5CMYA 2A6PA 3Q7FA 4QVKA 2FI1A 2V5UA 3A36A 4KLRA 3LHIA 2WTEA 1QNLA 3P0FA 4LBZA 4MV8A 5D51S 4DX5D 3ZHYA 2ZJ7A 4OK5A 4AQ7A 2P30A 4MUAA 1GQOA 4OQXA 5BNWA 2PKQO 3N2ZB 1PWXA 2OZLA 1IOLA 1OFIA 4FC8A 2RJOA 4HEA1 4Z1MA 3ZKAA 4Y98A 4B6JA 5JYDA 3B7RL 5EJ8A 5IW8A 3E37A 1XK6A 4FFWA 1U9IA 1C8VB 1QYWA 1V5FA 3A0RB 4QELA 4MDFA 2QLBA 2VC2B 1YMPA 3MMPA 1L4LA 1OX5A 4GXNA 5IASA 4YJFB 1X7WB 5K01A 3OZRA 5DZSA 2VCEA 3RKUA 2Q7DA 4LYEA 1TEXA 2QRKA 2FN9A 2GAFA 5GONB 2WF7A 1YULA 4O2AA 4EGFA 1NYTA 1UJNA 2FZ4A 3RFTA 3UM0A 1BG6A 4TRQA 1W4LA 2G63A 3M8KA 4IZOA 3RSCA 4F6RA 3LL4A 3P0HA 1Y1TA 3HA5A 3IUEA 3UHJA 3ASNE 2C5EA 4G0UA 2ZIXB 3CVVA 4LYHA 4TMFA 2XSZA 4YUAA 3FD8A 1A8SA 3DOUA 4BMNA 4MP6A 3ASDA 3GLKA 4ARAA 3K1AA 1JV2B 3LJNA 1IDOA 1T3GA 2YOHA 3WS7A 1A9XA 1VMDA 5ALVA 1XVTA 4RPLA 2GJ8A 1YA6A 3G02A 1J5PA 1UQRA 1VFNA 2WSBA 2ZE6A 1YCDA 4G81A 2OV8A 4GHWA 1P1HA 3E8MA 2DKNA 2F1IA 2R03A 1M8PA 5CYPA 5LUBA 5TSDA 2X2PA 1XN4A 1TAGA 4B94A 2CYAA 4XIFA 2JD1A 3G2IA 4PH4B 2ZULA 3FI9A 1Y4SA 2AMVA 3L4EA 3P2JA 4TXJA 1XZIA 3I6YA 4BX9A 2P1DA 3NXSA 2PYZA 3ONNA 1BH2A 2AG1A 1D9SA 4LHXA 3T1TA 1U4SA 1NE2A 2FGJA 1TIKA 4TROA 1FDTA 1TEHA 3MN1A 1ECBA 2QV0A 2DBRA 5FZSA 1K5GA 3IUSA 1OC4A 3DP9A 3WGJA 4NFSA 5CM8B 4YGXB 3TJRA 2BISA 1ZH4A 5KUTA 2VZ8A 3WZLA 3ZZ0A 2FLWA 2DLDA 3OC0A 3QXGA 3D9OA 2PMFA 2XYPA 3WRXA 1P44A 1DCKA 4ZREA 1JP7A 3OG9A 1LNQA 4Q7QA 3I04M 1BXGB 5ARDA 4G9BA 2ZCUA 3U81A 2C7QA 2Q4EA 2PRYA 3HJTA 1E3EA 1O4WA 3G0BA 5CDUA 2X5XA 2DLNA 5IT5A 3VR5H 3KU4A 5CJJA 1RU3A 1UJ5A 3CLTD 2V5AA 5EUCA 3ZE6A 1SWWA 3ZVVA 2ZR0A 1MT3A 2AE1A 1GKIA 3DC2A 2F59A 3M6AA 3A1EA 3DNFA 2QK4A 3HBNA 2I71A 4Y7DA 3WYDA 5E6UB 5LOZA 4E5YA 1XQ6A 1HO8A 5DBFA 4WNFA 1UXOA 4G5RA 3D9IA 1STOA 4XD7D 3H6KA 1YUNA 4L5JA 3VA7A 3BJIC 4P83A 4A5OA 4JLMA 3OQPA 3ORYA 5FFNA 4EYEA 3FKSA 4ZOEA 1TUBA 2FU5C 3B3AA 1UAGA 3LDZA 5JXJA 1OLUB 1P31A 1POWA 4WINA 2QVZX 5BOSA 1EYZA 1GRCA 3DPSA 4NATA 2EP5A 1RM4A 1FXUA 2BELA 1OHHA 2OBYA 3HBFA 4DV2B 4JP1A 2AEMA 2V1XA 1ZVMA 2NXNA 2ZGVA 3ESLA 3MWEA 4W5WA 3ZWWA 5CCBA 5A9SA 1JLLA 4MWOA 2QRVA 2D8MA 5FQ8A 4GPAA 1H0KA 5C5DA 2YN2A 3G0IA 3MJEA 1VL2A 1ZU2A 1YR2A 2P9NG 2HL6A 1E0DA 1LF5A 3DV0B 3S2SA 3Q75A 1ZNZA 2QA5A 3OIGA 3K5HA 5FUQA 4DR5B 2I1WA 3EVGA 5KJMA 1RI3A 5FOUA 1YS6A 4A9AA 2QUIA 1FP7A 1MXFA 2FP4A 2OZLB 4E0BA 3VR4H 1F2UA 3UB2A 3COVA 4I9CA 2Q6LA 1YTUA 4QXRA 1QE5A 3ZYMA 1CFZA 1R6VA 1E6EA 3MUEA 3SS9X 2XPCA 5BVGA 5FINA 1M5TA 3KUUA 4TTJA 5B1DA 2DECA 3APCA 3KKNA 4XB2A 1E2UA 4GU5A 4R68A 4BFCA 3RHSA 3L0ZA 3PFGA 5EY5B 3DE1X 4CG2A 5JTUA 2HNAA 2JZCA 3HXMA 3HA7A 1BU5A 3CWQA 3KJEA 2BKUA 3KTFA 1J2EA 2R6DA 1VPDA 1XCMA 1JJAA 2HWYA 3FSJX 5C32A 4N2SA 4MRUA 3MS2A 4LRYA 1S2LA 3VFDA 1KU6A 1SBZA 1HGXA 1NJFA 4AS2A 3ICQB 1HDCA 2YJGA 1GU0A 3TFQA 2CEKA 3UIEA 3DPDA 1Q92A 1O94D 4MVCA 4ZK2A 3SC2B 3F3YA 4MQUA 1BHSA 3ZW3A 2XVAA 4C7KA 3E2IA 1UEXC 3QUQA 3ZQKA 1AHPA 5SZHB 1QRRA 4YT4A 1NPDA 4JQCA 3FXAA 2JAQA 4RCVA 3WJ1A 1FFDA 5CVEA 4IRUA 3MTJA 1UKZA 4QA9A 1A9QA 3EU5A 4Q69A 4JBWA 2I6XA 2XCUA 1M1UA 1R18A 4JJ4A 3TCKA 4JODA 3UK6A 4BC1A 3SHFA 4A3TA 2Y99A 4NE2A 4BGEA 2R8YA 2RKKA 3AS5A 4TVSA 1IFXA 4MYTA 1QVWA 2RKOA 3R6LA 4C4RA 3OKPA 1T2DA 2WC1A 3KZ1E 1H42A 2GEBA 3FIJA 4FMCB 1Y8QA 4N47A 2OBBA 4RA6B 5FAXA 1BIFA 2ZYAA 1R9NA 1BFKA 1K2VN 2CVZA 2W22A 4FLBA 2DPHA 4F9GA 4NS4A 5AKJA 5C1BA 4GTOA 3OD1A 2HCFA 2R6HA 2VF7A 4KV9A 4UAGA 4UEWA 3FHTA 4IYRA 1EQAA 4L9AA 2ZZNA 2O2DA 3RVRA 4XCXA 2HLDD 2ADMA 2PVSA 3B3GA 3THWB 4MR8A 1K8XB 1TUEA 4C6HA 5JASA 3D3NA 2QZAA 2B82A 4D74A 3E84A 4H1UA 3UXYA 3EOZA 3ILVA 1JCRA 2OCAA 4LNAA 5JZOA 1Q1AA 2IXEA 3D64A 3EXHA 3B9BA 4ARUA 2P2CP 1ZOSA 4XZ3A 1H2RS 3C1UA 4OCZA 1CETA 5HW0A 5EJ4A 2EWVA 2QQ5A 3DFKA 2ISSD 2ZYWX 1P18A 4ARZB 1W9HA 5HRYA 1KDOA 3B7BA 2B83A 2VATA 3N1UA 4KXFB 4YCAA 1NUPA 1RAGA 1VJCA 5CX1A 4HQKA 2E6UX 3T5CA 1GPBA 1WCWA 2P0YA 3AERA 3S7FA 3GDHA 4RPIA 5JNLA 4HC4A 4YS6A 1FFAA 5CYGA 5BWLA 2IEDA 1VIYA 1RXYA 4XCQA 3AF4A 3QENA 3E5RA 5F1KA 4Z7NB 2F1RA 1JUQA 1BGXT 1JQDA 2UZ0A 3GJYA 1AKWA 1XRLA 2V7EA 3BDIA 3FFLA 2DBYA 1E3DA 1ORHA 2JIZD 4WVFA 5GIPE 3ZHCA 1JLLB 1VA4A 3ESRA 3NYIA 4X8HA 3PWKA 3SE7A 5L6MB 4E2FA 2P5SA 4I5EA 2SKCA 2QAIA 1R00A 4TOIA 4HXIA 2FEAA 3WNDA 4BQPA 1O7JA 1GPUA 1PT6A 3DTVA 2GMWA 4J0HA 4XPIB 1JEDA 1PLKA 4R9NA 4WOPA 2G9ZA 4B3XA 3Q7IA 4GYYA 2ZKLA 4HS4A 5CFRA 3JQ7A 3EDOA 1MW9X 2RG1A 4YIHA 1FP4A 4LFBB 5FO0A 1QTRA 4FJYA 1MC5A 4DSNA 3COPA 3WG7E 1GZUA 4U7TB 2RGDA 2MINB 4ZRMA 5TXGA 1T9HA 5KOHA 5CVVA 2YS7A 3MC1A 4Y2UA 2ENUA 4H4EA 4ATZD 4RHCA 3G0OA 4RVCA 1MX2A 4WY8A 4WUVA 4A0QA 3UUXA 4XA8A 5JHBA 3KQWA 1ELRA 1ODCA 4RMIA 2G72A 1YE5A 3ENNA 1AV7A 3CHSA 1GSOA 3Q4GA 2O23A 4YCNA 3LQ4A 4WOJA 3GCZA 1GT91 5AKYA 3QVGA 4O4IF 5CBPB 1JKJA 1NT2A 3O1HB 4REQB 3X1WA 3PQ3A 4MGKR 2YZNA 4HTAA 3ZYLA 2DHRA 2RD2A 2VI5A 5BW6B 4X97A 2OO7A 3FB1A 4UM5A 4DVGA 4PX2A 4C01A 4TS9A 1J0CA 1C14A 1RIFA 5A1TA 3BA1A 2Y0DA 2O2SA 3EY4A 1G2QA 3UH0A 2FZCA 4F11A 2G83A 1CJKC 3JQAA 2J9XB 2ZEJA 4G2TA 2YJZA 5C3UA 4DIFA 5DDIP 4IQ8A 4ENQA 5J47A 1YQQA 1YNOA 2RHTA 4NNOA 3B5EA 4UUOA 4DXHA 1WP4A 2IX9A 4CI9A 4C0BA 3R9IA 2YICA 1B6RA 1Y3HA 1DC4A 1RRFA 2D1SA 1K86A 2IQIA 4J0FA 3MMZA 1XZDA 5AKKA 3P9PA 2J4FA 1YZNA 2PBLA 3HUEA 2PUBA 1UOPA 4A8TA 3SZOA 3TCXB 3AUJB 2GTPA 1NAIA 2IYQA 1JGTA 2X9VA 3KKMA 3NANA 1T3ZA 521PA 3RK0A 1VPTA 2B25A 1SZJG 2NXWA 3ZU7B 1G8PA 1MN6A 4KGZA 3BEEA 4JA9A 2W37A 3C3RA 1GAWA 1PHPA 3HGQA 3OEHD 5EUMA 5LUAA 5LZ2A 4NCXA 3CRZA 4RFVA 5AFSA 3O21A 3L6RA 3E35A 4KIWA 2JATA 3V97A 1LRKA 2IDMA 3VPHA 1T25A 4JC0A 3RSSA 5A4DA 1JLMA 2XXBA 4NABA 2ZZMA 4PW0A 1ZJ6A 1KC3A 4H1TA 1OILA 4JSYA 4LZJA 3BZBA 1HLFA 3SLGA 2QE6A 3LYUA 3AR2A 2ODAA 5TGTA 3ZGOA 4V1CI 4XKJA 1JX6A 2VJNA 2ZIEA 4R69A 5JXWA 1Y5LA 4MPPA 3V1YA 3RS4A 4IO0A 2QY6A 4NU0A 4TRNA 1KPIA 1Q20A 1KGSA 1KXJA 3ELBA 3K5IA 3O93A 3PNVA 4LSWA 5E9JA 5SY6A 4AP5A 5CLJA 1AKMA 1X9HA 2BN4A 2GLXA 4FEYA 1ZRMA 2WSSA 4Q3EA 1FTSA 2XMQA 3DHVA 3JVVA 2YH2A 1K6JA 3GBSA 4S1PA 4ZQHA 2IEZA 3MJFA 4W1QA 1AY0A 1BZYA 3H11A 5DWVA 5HJ7A 2WQ7A 4CEIA 3GCGA 4PYLA 1MB0A 5D1NA 3QV1A 3JS5A 3BFPA 4EKNB 3AEZA 4MI1A 2J87A 2ASEA 4HDOB 1RKBA 3FAZA 5E1MA 4AICA 4DLYA 4ZI7F 5JARA 1XMQB 4BVKA 1RHRA 2JBAA 2P5UA 3U2QA 1P8AA 2GCIA 1F8XA 3FOWA 2HWWA 3F3KA 3K0HA 3LF1A 5B12A 2FKAA 2O1SA 1SXIA 3W5SA 4CMCA 4RZIA 2O0LA 3FDJA 4B48A 4JL0A 4TSFD 4UFNA 4FB4A 3AX6A 2DBQA 2J67A 4HGZA 4LTDA 5B37A 3KVVA 1ZR2A 5LP6F 1CDEA 4ILHB 5E2IA 2XY4A 3JQ9C 3DMDA 2AJBA 4AQDA 3LY5A 1H2YA 4PAOA 1VL8A 3ZBPA 4FK8A 5KDDA 6CHYA 5SYNA 4F93B 3AT1A 3JQ8B 3BHJA 3QI7A 4FDVA 4RG9A 4NZZA 4CFYA 5IRCD 2X4GA 1IVYA 1CUXA 3IV9A 2D2FA 2WFZA 3KTDA 1U02A 2WXQA 2PUFA 2KHZA 1ISJA 2ECFA 4LMBA 4JC8A 3HZHA 3PSAA 3T7EA 3H9QA 1WV1A 4I0WB 4EFMA 3F71A 1PK7A 4B4OA 2OXCA 2Q3JA 3ZTYA 2V5VA 3HUFA 3SM3A 4A03A 4C5BA 3O8CA 1MFZA 1CY0A 1GD1O 1P1FA 3EBOA 3B82A 1P61B 2XE6A 4IXTA 4R2KA 3IODA 4B32A 1Y1QA 5LZ7A 2JJQA 3ZWBA 5EJGA 1MGPA 2EFGA 4ZCSA 1AC5A 1ANKA 1KQ3A 4FE7A 4PFSA 4YC7A 3CFYA 3ZHXA 2QVCA 4CF4A 5DNUA 1WEKA 1U0TA 2IY8A 3L07A 4L07A 5JZ9A 4CYMA 2BMWA 4DR2B 2ZROA 2DY1A 3QSGA 4WKPA 1VLLA 1UF9A 4G85A 5IPFA 2C5AA 3G23A 5AJZA 4YRPA 3N2GB 1QQAA 1C7FA 1PX2A 2CLDX 5FJYA 1JIKA 1KBZA 4R54A 2CDAA 4ZQEA 1MC8A 3DLHA 2J9FA 5EYPA 1T6YA 1Q21A 2R1VA 2Z4SA 1L5FA 3ZI0A 2GJAA 3DSSA 4YH1A 3S4YA 3D8SA 4TKUB 4YJHB 4U5QA 3OPYB 5IYZF 2P2NA 2HIHA 4J8PA 3DVLA 1R15A 1D09A 1VBKA 1DEHA 3L1HA 3I05A 3BH0A 1JVNA 1XL0A 1QMPA 3DL4A 2QUKA 2V7GA 4GG1A 4Z7OB 5KHOC 3JQAD 1SD5A 1NXWA 2Y8EA 3A3NA 4RZ3A 2A5LA 3K30A 4YONB 4W5RA 2A4MA 4FMDF 4N6GA 4ODIA 3M6WA 3UMFA 2WUFA 4GZ3A 3AQIA 1VSUA 3PHLA 4WZBE 2QT0A 5EPUA 2JIOA 4ND2A 3MRSA 3VHXA 1R10A 3DDWA 5CYFA 3OQ6A 2BJWA 1UFKA 2NYAA 3HJGA 4QXMA 4KR6A 4OVVA 1ZIYA 1HDOA 4C0WA 2GS9A 4HDNA 3PNQA 1Y9EA 2DYRE 4M3OA 5K8VA 3K6SB 3FF4A 2VPZA 3ZR4B 1WNFA 2IY7A 3B7TA 2A35A 1K4MA 1K7SN 2DPXA 2D62A 5HFAA 5BQ3A 1M3SA 3MQFA 5IJ9A 3L0SA 1USIA 1XROA 1K7EB 4EQ6A 5AKIA 1FSSA 4U6QA 3SSAA 4JL8A 4IQFA 4PTLA 3WDLA 4CGYA 2VO1A 2AW3A 1YJQA 1A77A 4Q94A 1BFUA 1W6UA 1BNCA 1QHHB 3UY4A 1KR2A 1Q17A 3CS3A 4F0JA 1TNDA 1YQEA 2HA0A 1G0OA 4BX3A 3PU6A 4E2ZA 1NVUQ 3IALA 3MWYW 2W4QA 2XT6A 3UJ8A 3V80A 3F6SA 3THRA 3R4VA 1OROA 4NHEA 3AP2A 2RBKA 1VDZA 3ABME 1UJCA 5DCYA 1QHSA 1DWPA 3RNLA 2YMMA 1V8DA 4UAJA 1N5LA 4NONA 3WGUA 3ROEA 2HLDA 4NFHA 1EESA 3UW1A 4FNMA 4HEQA 4PC2A 2GCOA 5BVHB 4D0NA 1WOYA 1SNYA 1Z34A 3IUPA 5TLSA 1JG7A 2P3LA 4RV9A 2FMKA 4E12A 2C2GA 4EQFA 2PAFA 3O3OB 4G0ZA 3L79A 5FPSA 1K2WA 4XZ4A 4QBHA 3ZCRA 4CUJA 2WQ6A 3H8JA 3FPGA 3LNCA 1XNHA 4Z54A 2QYTA 1MTOA 4MYRA 4CKWB 5FWDA 4W9NA 4AK9A 1WL8A 3ZHQA 2XADA 2XWPA 2BCJQ 1D2HA 3G1WA 4OYYA 3RREA 3ZHVA 4DSAA 4WKCA 1LD7A 1FJXA 3E9MA 1DC8A 1JPUA 1GTL1 5EKXA 5JJKA 1TM1E 2JGNA 5DGHA 2L19A 3QLEA 3UMGA 1QHYA 4AW9A 5I7AA 1FDOA 2DFDA 3NAGA 2ZSUA 4LK3A 1Y8RB 3NUGA 4MVWA 4PLZA 3FCYA 2RHGB 4YUZA 3KSUA 3O9MA 5DHSA 2O0JA 2R8BA 1P0MA 2NVBA 4K3UA 3CH6A 4UI9K 4LVOA 4QDUA 1F5NA 1KY2A 1GHTA 3MJHA 3W5IA 5FOWA 4I43A 1YYHA 3SQWA 3HNPA 1JB1A 4LYAA 3LE8A 1QIKA 4UHEA 4P3KA 2Y1OA 5C31A 3QF4B 3KNZA 5FFFA 3O95A 4JI4B 5CXXA 3A05A 3OJOA 4BV3A 4B84A 4RTPA 4CMKA 3S3TA 2H48A 1U04A 3BA6A 3V32A 1E2GA 1GTG1 3I1YA 4KMRA 3ABKE 4RZQA 3MT7A 1Y8MA 5K0GA 3KSLA 3C15C 5GZ1A 4Q7KA 4D9NA 1U8CB 2VP9A 3FPAA 3WB0A 5F33A 4XQCA 3RARA 2EL7A 2W00A 1M2EA 3EXG2 1G9SA 3A7DA 1R0RE 3DOJA 3GOHA 3LV8A 3U7RA 3S2UA 3WGHA 2AQIA 4I1RA 2RAVA 3A6JA 4XOIA 1EAMA 4BU1A 1M6YA 2EFJA 4D8YA 4NL4H 3HO6A 2P7HA 1X74A 2OGZA 3GPBA 5J40A 4QWWA 2IEBA 3E3OA 4XD2A 4I08A 4KTTE 3NBZC 1CJCA 5C2YA 1DRUA 1NMSA 1L1EA 1ZOLA 2VQ3A 3GVHA 3IHLA 4WN3A 3UKDA 2JLZA 4XX0B 3VV3A 4LY0A 3JARA 4ZCPA 1ECCA 2OO5C 3N2YA 5BNZA 2QJWA 3JUIA 1W3BA 4GRIA 5D86A 4HUTA 1QB8A 1TZCA 2CY0A 2ZB2A 1F4VA 2H0RA 1K98A 3ZWAA 3N58A 2Q4OA 1E1CB 5E95A 1YS9A 2IDZA 5SV2A 1XLVA 2OLEA 3LS8A 4YWJA 5A3VA 3NKFA 5BSKA 2FRVA 2OENG 2XB6A 3HDHA 3L6EA 4BRUA 1S64A 1DAEA 3JYHA 1GG9A 5JAIA 3FOFC 3GT7A 2JS7A 5C8VA 2VF8A 2G82A 4RH3A 3TBHA 2GAJA 2WA2A 4YUWA 4BNMA 1H0AA 2WG1A 1VPWA 2IH5A 3ZDAA 4M0MA 2G9NA 2D2EA 4Y6GB 1WCIB 4KXLA 4D45A 3ASVA 1MB4A 3PP8A 2ZBDA 4ZU6X 1E3TA 1DAGA 1AUQA 5AI6A 3AHFA 5E3HA 1Z4OA 2RHRA 1YVPA 4QOJA 4I4IA 2F4NA 1ZIXA 3I4RB 3EGOA 4QGAA 5B7QA 2C2MA 2QVYX 3DLBA 2QW1A 1LQUA 1Z56C 5AHOA 4OKSA 3R7FA 4RK7A 4PYJA 3UHOA 3KJNA 3HHEA 5BOVA 5LA6A 1YDHA 4M1ZA 3E82A 4DGSA 1JDUA 1GNVA 2ZT7A 4HPWA 3UH1A 2NU8B 3VZCA 4EKGA 1E8YA 1IAQA 3ABSB 4Q82A 1DXYA 5EXTA 2QI9C 1WXDA 2LAIA 1T35A 5GONF 3WL4A 1MIOA 2DC1A 4Q7JB 5T57A 3NTRA 5B1YA 4K9NA 4EZLA 3Q41A 1OFTA 4CQNA 4D43A 4UFOA 2XYGA 4RENA 4YRAA 2CLEB 4Z3KA 4FZ5A 5EJAA 4QUBA 2BPOA 2JLRA 2QNBA 4Q7MB 4EZKA 1SFRA 3LBFA 2R8ZA 4RD3A 5DULA 5DGIA 4ZAVA 4CL0A 4G5OA 1TVKA 1AU9A 4C3OB 5D8DA 4BFXA 1W36C 4L5YA 4EI2A 2JIQA 1D7OA 3WR5A 1IXSB 4ZDKA 1CHDA 2RKBA 1OUVA 1N94A 5EPEA 4ABNA 1JU4A 1GU1A 1U2DA 1NYQA 2Z5FA 4I1YA 1DO8A 2GA8A 2IZOA 4HFNA 1GLVA 1K08A 2W71A 4Y2QA 5DEOA 4F5YA 4WZAA 1JVBA 1XDZA 3UT8A 4E22A 4O0MA 1XFDA 2LKDA 2NO1A 2H18A 2CDCA 2Z2JA 1E9CA 4OVKA 3ZX5A 3RRBA 5JAMA 2FN8A 1ZD4A 3KRTA 1TF2A 4J43A 4IN3B 3PLAE 4YCDA 5I48A 1NL4A 1TTTA 5AKZA 4M37A 3ITDA 1CRLA 1RJFA 3L17A 3EUWA 5TEWA 3S40A 3WMEA 3ZZ1A 2ZJ4A 3NXKA 4KVMA 4FR0A 2VP0A 4BMCA 2YYYA 3G2PA 2BMJA 4RE5A 4F3TA 3KQLA 4OQEA 4CUKA 4WMLA 1U5AA 1ZJ4A 3MTDA 2P79A 5JSYA 4M76B 3B9PA 4JUDX 3VR6D 3W8RA 4F4DA 4CIAA 1AQUA 1WMDA 3T3GA 2IH2A 5L6LB 2HM8A 5FL3A 3TRHA 3B12A 1HOXA 3KM0A 3KT0A 1Q7TA 4LJ8A 3VNAA 5CEDB 5TF4A 3B51X 1YRWA 3PEYA 2ZVJA 4C1NA 1U2DC 2FA9A 1GZ3A 2XV1A 1HE1C 1JH9A 1W75A 1WMAA 4H7PA 4KVOA 2O8DA 5A6SB 2WHYA 3NOGD 3CX3A 3FVVA 3WJ2A 2OECA 3I5UA 3NTXA 2H4HA 3PFIA 2AFHE 3G7SA 4KQHA 1TEZA 4C21A 3EGVA 2IE8A 3VC3A 2I33A 4YRKA 2OK7A 3VPSA 1E0SA 3KQHA 4RADA 5KNBA 3MYVA 3KD3A 4BBAA 1JECA 1ZK0A 3JQ9A 3PEEA 2BI8A 2FF7A 4F3RA 2Z1MA 1DAMA 1KO5A 4EUEA 2WJ3A 1SHZA 2IEAA 5GZ3A 1YF3A 3IP9A 2W6JD 2XEHA 2FY8A 3G2MA 3K31A 5JATA 2LE0A 2JGJA 1C8KA 2Q62A 3CQGB 2BEWA 4LAFA 3NC0C 5FHRA 3OAAA 1W88B 4I4TF 4DIMA 1E2IA 1KYIA 4NNPA 4LZZA 4TMXA 3RYIB 3W78A 5LZ9A 1A9OA 1GFZA 1POXA 3LUHA 4TTAA 3VYRB 5HIKA 4RIHA 4EJ2A 1CV2A 2FWBA 3R5TA 4R7ZA 5F2EA 1D0VA 2PSDA 2NZYA 4H16A 4ZYUA 4Y6QA 2QTVB 3IS3A 3NW9A 1WMBA 3IAEA 5IEBA 4B5LA 1SBHA 1WVGA 3CGGA 1PI3A 3MPUA 2IHJA 4LKRA 1WBBA 1H6CA 1XRRA 2FMIA 4RZHA 4TYMA 4C14A 3T7JA 3BF7A 3A28A 2I55A 3ER8A 3GZ4A 4L8FA 4ZTBA 1L7BA 4P6VF 2VTVA 2YQZA 4MPJA 1Y3CE 2HYDA 2QUJA 3PC7A 1IEXA 1RYYA 2DQYA 4KVFA 4RKRA 4UREA 4E5NA 1XEXA 2QU7A 3ZHRA 3NHKA 1M7GA 4O25A 4NURA 1TUIA 2IYOA 3HCAA 4RD2A 5AUNB 1FYDA 1QWSA 4EAQA 3ZJUA 2ZR7A 3ZY3A 4EWLA 2XMZA 1FUUA 2KPOA 5ALSA 2JDIA 4G6ZA 2V4MA 3H4TA 4LV5B 5HDQA 2X8BA 1L4FA 5HGXA 5B1BE 2AW6A 2ATVA 2Z5GA 1S8AA 1WW2A 2LSUA 2AJCA 3A6GA 4WXPA 3IQGX 1RQXA 4MCAA 4ZOLF 3FNEA 3BWEA 4QPJC 1T2AA 3IC5A 3S2ZA 3HCDA 5CFOA 2C8VA 3GMDA 4IDEA 3IE2A 4QVGA 2E5LB 2D7JA 2B8EA 4DE5A 4O2LA 2R7AA 4XDGA 3SM9A 5G0UA 2BGMA 3KT6A 3SIPA 1EGQA 2ETCA 1G21B 3INNA 3U37A 2ISCA 2KE5A 4M88A 4AECA 3NWOA 3S81A 2PQ6A 1ODFA 3I6QA 3KO8A 3S1AA 3ID6C 4LWQA 1RYZA 3WLNA 2AC4A 3UAYA 1N4AA 1UKEA 1JJVA 3D3WB 1E3JA 3ORSA 1QYVA 2NWQA 4TTIA 4ILGA 4COKA 1ENPA 1YFKA 1YDGA 2X19A 3LXMA 5IAGA 1PS9A 2EHJA 4GLLA 1N9ZA 4RPJA 3CWZA 3RV3A 1FYXA 5L7TA 5CDYA 2BGJA 1C1HA 4HI0E 4X24A 4QXAA 1I5OA 2HGZA 3COYA 4EY6A 1JEYB 2R6FA 4EB3A 4LZLA 4LNUA 3DZKA 3HNOA 4YDHB 4MUFA 1R50A 3FGPA 1Z8HA 2P11A 1BDHA 1DVRA 4HSEA 2J08A 3OFNA 4XWAA 2IQCA 1SQMA 3ZH9B 3PQ6A 3DFMA 1Z63A 1H0HA 1L5HA 4C03A 1NUHA 4W1PA 4E6PA 1OXUA 1FB5A 4OV6B 3RC1A 1Q7GA 1XZBA 2J46A 3RT7A 3LUJA 1R0CA 4WKBA 3SY8A 1LPMA 1U65A 1NJSA 1ZWLA 3ZIAA 4G1TA 1TRKA 4ZYYA 1G0NA 4NG5A 1NMXA 1TFRA 3NC1C 5LB4A 3F3MA 4BNIA 4HQDA 2XVZA 2MSDB 3QMPA 1KI9A 1OXXK 3ILYA 1EZ1A 4IMPA 1NXQA 3PIRA 3KYIB 4G5YA 4ND1A 3GLIA 1B3RA 2NSZA 1GU7A 3KG2A 3LFHA 4R2IA 4EH1A 3WG9A 3BIWA 2AZXA 3V1NA 2JGDB 3DZDA 4PYKA 3GFSA 4Y9TA 1ZVQA 4FFMA 4RTSA 1TKCA 3F4BA 4LDAA 3FUUA 2CCJA 2I03A 1RLTA 2Q8PA 4F9FA 1DOAA 1GPJA 2PJRA 1TO2E 3GA5A 3RRUA 4M46A 4MDHA 4KQWA 4ALKA 3C4QA 4HVAA 4KR2A 4GCNA 1ELWA 1DFIA 4UBNA 1ZD3A 3SJZA 1JHMA 4KU4A 5AQAA 1TEVA 1KP9A 1ORTA 2ZUUA 3K6KA 3OCCA 5AWFC 3AFHA 5TQ0B 5KU7A 4K5CA 1LC3A 1NFQA 1Z13A 3QUTA 2NSHA 4W7IA 5ANLA 1LRLA 1OU0A 2LKCA 4Q47A 5HZGA 1H4SA 3I9V1 3NAWA 3RS0A 2YINA 2FN3A 3ZVLA 4L50A 2G8LA 2QZ9A 4C88A 1NRWA 3UJHA 4DS3A 4YJ3A 1HYEA 3FUFA 3V8EA 1PJAA 4IWXA 3QKRB 5FI3A 3E6AA 2Y9MB 2RGEA 2JGRA 2TMKA 1YL7A 1OBHA 4DMHA 4Q9AA 3OBIA 4ERNA 2CLSA 4F2DA 3I64A 2X1MA 3NAQA 3GMIA 2GI4A 4HLQB 821PA 1JAXA 5JY6A 1A96A 3O3NB 3RWOA 5JVDB 4G01B 4N8DA 6Q21A 3K9CA 4MICA 1J70A 1ZW6A 1ZBPA 3II6X 3WK4A 1VLHA 4QU0A 1Z5SC 4E4YA 2OHOA 1ZIDA 3E03A 4H4CA 4BE9A 1GN9A 1FLAA 3FWNA 2BFDA 3EC7A 1QE3A 3ZCQA 2YV2A 5TMDA 1D1SA 5A3JA 4J3FA 5AXDA 2PGLA 3I04A 1QYXA 4MNTA 1ZGZA 4JBXA 2IHUA 3U56A 4UHCA 1FNNA 3A10A 2J6CA 2Q1SA 4QU8A 2ADFA 4CPDA 3ZQUA 3UX4A 3KZKA 2AKYA 3HN6A 5H0IA 3NTQA 4R2MA 2ISQA 2FXVA 3FWZA 2AD1A 2JGLA 2YY6A 4XGRA 4DLRA 4ZEVA 4HDRB 3MWDB 3RQSA 1EWTA 4GVLA 4K5QA 1LW7A 2YY5A 4GM4A 1U0NA 5ECGC 2VK1A 1CEXA 1RQPA 2D0OB 3MFYA 3HL0A 5GV7A 3ZE0B 3KBBA 1M1YE 4JSRA 3C16C 4JWKA 5ALEA 5HCUA 3JXIA 1ZH0A 3NUQA 4J16C 1FFHA 4HQOA 4K6KA 2W70A 1H85A 4C2AA 5TR9A 5ELXA 3A3YA 4CM1A 3N28A 4UXIA 1PT5A 2EBHX 3V3KA 2PLRA 3GUYA 3KSZO 1KJYA 4Z4CA 2PQ0A 4QTYA 5FIUA 1P1BA 1QE0A 1SWVA 3PI7A 4UTZA 5AM4A 3ZIDA 2QB5A 4P53A 4RV5A 2J4DA 1QQ5A 4GO1A 4UHDA 4LQ4A 5G1OA 2E7ZA 3N2EA 2ZAIA 3S2EA 3Q0TA 5LMZA 5BMVA 3I61A 2J0QA 4P34A 5CHEE 3DUWA 1P7YA 3IXEA 3B36A 3KYDB 5ECDA 5TF0A 4DT1A 3I58A 4JCOA 4ZCIA 1FW6A 2EYUA 5IHXA 1Z08A 1M2WA 5M7EA 3IA7A 3EQ2A 2IYNA 1IY8A 4MS3B 4U8YD 2ZZKA 3Q9NA 3FHLA 4TUYF 3GY0A 3AHHA 4KZKA 5BSWA 4JBNA 4MYUA 1GAEO 5H3HA 1KY3A 1Y1KE 3PC3A 3OLZA 4GP7A 3SNXA 5C8ZA 1K6IA 2G7ZA 5JZSA 5DRYA 5EKUA 1B0PA 2I2CA 1TT5A 2R65A 2WDZA 1Z2NX 3TNDA 1QHHA 2G9UA 1J1UA 1XMPA 5ANRA 3E30A 3G0DA 1QS0A 2O06A 3PFFA 4LK2A 4BZXA 3BGSA 4RLYA 4RESA 3GRUA 4WERA 5HCNA 4HCJA 4YN3A 3R7DA 3DAFA 4WASA