2XGMA

Substrate and product analogues as human o-glcnac transferase inhibitors.
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
512
structure length
512
Chain Sequence
PEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 190
structure length 512
sequence length 512
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgmA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgmA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgmA02
2IW1A 3G2LA 4X6LA 1B4DA 3H4TA 3TOVA 3TSAA 3SF4A 2ACVA 2HYZA 3LCAA 4KYOB 2QLMA 1KT1A 3L7BA 3T3EA 2YQ8A 1NZNA 2VSNA 3TG4A 2PQ6A 3VDNB 5HI7A 4N2SA 4BFCA 1L5QA 3QDNA 2IFUA 1RRVA 4GYYA 3CUTA 3S7DA 5FZRA 3S28A 3CEMA 4G23A 1FS4A 1QKJA 2FBNA 4WHMA 1P4JA 1KT0A 3BD6A 2QLNA 3EDTB 1P2GA 4BQFA 4Z5XA 3IEGA 3NCHA 5M72A 3CK8A 1JG6A 2QRHA 4FZRA 5FZSA 3AS8A 4G2TA 5C1DA 1C50A 4GPBA 4YI3A 1WW3A 5I45A 5HQ8A 1GPAA 3OKPA 3ZHEB 1NA3A 3KS2A 3Q47B 3FWVA 4U0UA 3T3GA 3LPZA 5BNWA 1GG8A 5IKPA 3MS2A 4JA7A 4N39A 2LSUA 1WUYA 4MI9A 4REMA 4GZ3A 2R68A 3ESKA 4A1SA 4CDRA 3WAGA 4BTAA 2XGOA 5EKQD 4X7RA 4CGWA 2VCEA 3T7DA 3OTIA 3E3OA 1PN3A 4RIEA 3GW4A 4YVOA 2PRIA 3PE4A 4MHSA 4BTBA 4YVQC 3T5TA 4U04A 2PZIA 2Y4TA 1GFZA 3ULQA 4B94A 5ENZA 5LQDA 1FTWA 2XGSA 1A17A 1NVKA 3LYAA 1P4GA 3CEHA 4BQIA 4YNDA 4BT8A 2ASVA 2P58C 2QFCA 1Z8DA 2VYIA 3T3IA 4RIIA 4WADA 3JYSA 4AM9A 3CK9A 5FJYA 1UZUA 3FFLA 2Q6VA 2IV3A 3S27A 1H5UA 5D00A 4WNFA 5D01A 2F3UA 5EX0A 3HBNA 3FP3A 3FROA 2NC9A 2ONDA 5G05C 2PYDA 4KBQA 2SKCA 4RENA 2QLLA 3C48A 4BQEA 2AVPA 2UY1B 3OY2A 1VGVA 2XPIA 4G24A 1RZVA 1KLXA 2XEVA 2VG8A 3NB0A 2VGXB 2X0EA 3CEQA 1V4VA 1FTQA 2WPVA 3Q15A 1O6CA 2C0MA 2VCHA 4MI3A 1F0KA 4M60A 1NA0A 2FEZA 2YJNA 4F3VA 4WACA 3ZCVA 3GPBA 1QQEA 4UQZA 1XOIA 3VUFA 2X0FA 1NOIA 1Z6QA 3CVPA 2GT1A 5BT1A 5JJ7A 1P29A 3RO2A 3ASHA 5DU2A 3AMVA 4N9WA 1TJCA 4UI9J 2WTXA 2R4UA 2VGXA 5BW8C 2O6LA 1XV5A 1PSWA 3RU0A 3QOUA 1FU7A 3COPA 1P5QA 2QN2A 3OTGA 1Y6FA 3RSCA 2UY1A 4AN4A 4KXKB 1YA0A 4G25A 4LEUA 4U07A 5DIZA 4I2ZA 3BDAA 2FETA 3MTBA 2KS6A 2YHCA 3KD7A 2GEJA 3LY8A 4HORA 4YI5A 4KQ2A 1C3JA 1NOKA 2C9ZA 3G2IA 3L7DA 4HLNA 3BEOA 5JTUA 2G9QA 4NQ0A 4MRAA 2IF4A 2QN1A 3BCUA 3DD1A 4F9FA 2FI7A 1JIUA 4NEQA 1P4HA 4N5CA 5G04C 3CVLA 3ZCTA 1ABBA 2PQNA 3NF1A 4N3BA 3E3NA 1A8IA 2V5FA 5G05J 1UQTA 4LDPA 5GPBA 2XA2A 3L7CA 2R5SA 4H7YA 3Q49B 4HOTA 2I6HA 4GPKA 4U0SA 2R4TA 3CV0A 5ARGA 1WAO1 3TAXA 3ZPJA 3VTXA 3ASFA 1XL0A 2UWJG 1AHPA 2GW1A 3ZCSA 1L6IA 3IA7A 4JL0A 3UYKA 3ZCUA 1P2BA 4WNGA 2KATA 4I2WA 1JG7A 2VSYA 2L6JA 2XGMA 1XC7A 2QNBA 5JTTA 3OXFA 5CCMA 1Y6GA 4WUYA 3BCSA 4EL0A 1IYGA 5KJLA 3R9AB 1LWOA 2P6PA 4LEIA 1PC2A 2F3SA 2G9UA 1EXVA 2R66A 2VGYA 4X7MA 1E4OA 1HLFA 5DLDA 4MICA 2QN3A 3E3LA 4M7PA 8GPBA 4CGVA 2G9VA 1IHGA 4W9RA 4MHOA 3L7AA 3OKCA 1FU4A 4QLBA 5EX3A 1NLMA 2IYFA 2DBAA 5G04J 2FF5A 3O3CA 1NZFA 2E2EA 3QWPA 2G9RA 5KJKA 2AV6A 3Q5MA 4HWGA 4I9EA 1PYGA 4Y6WA 3NPAA 4NESA 3D0RA 3HBJA 3DZCA 4I9CA 2XCIA 3OXGA 2QN7A 5JJTA 1IIRA 2C1XA 1FCHA 3QWVA 2WQHA 5TMBA 2JZCA 3Q3EA 6GPBA 1ELRA 3UPVA 4J8DA 3Q4AB 3AS4A 1K08A 3SZ7A 2OFFA 4UQYA 1L5VA 3PDNA 2ACWA 2AW3A 3IAAA 5LCWC 4BT9A 5ARFA 3NC4A 4J0UA 2KCLA 2GEKA 2PL2A 3CKCA 3RIBA 4RBNA 3C4QA 5HXAA 3OT5A 1RZUA 4GA0A 4UQXA 3BCRA 5JJ6A 4NC9A 3MTAA 2LNIA 1L5SA 4G1TA 3CUYA 2C0LA 3LKUA 3BD8A 1KTIA 3Q3HA 2IUYA 3HBMA 1L5WA 3VUEA 2VQ2A 2XCUA 1B89A 3S7JA 2Y4UA 3NP7A 3Q3IA 3CKBA 3OKAA 1WV0A 3ZCQA 2LSVA 3D1JA 3ASGA 1C8LA 1NZDA 4BWRA 3MV3B 3LY9A 1NOJA 2GJ4A 4F96A 1SXQA 3CK7A 1WW2A 3MBOA 1UQUA 2X0DA 3HBFA 2ECPA 5FZQA 2F9FA 4ABNA 3CX4A 3OXLA 2GPAA 3KAEA 3BEEA 2X6QA 3T3DA 1WUTA 1FTYA 4RIFA 1E1YA 3EBPA 4M83A 2XCCA 2HR2A 3QWWA 4KQ1A 3RT1A 3ZN3A 2BGTA 3UQ3A 3MT7A 3MSCA 3MKRA 2XCBA 4I1AA 1L5RA 2QRGA 3QKYA 3URZA 1XKXA 5TMEA 2C2LA 4WNDA 2KCKA 2QRMA 4ME2A 1C8KA 3LY7A 4GA2A 3PE3A 4RIGA 3U4TA 1GZ5A 3QKWA 4XIFA 2XA1A 4XI0A 3ZHEA 4JHRA 3T3HA 4AY5A 1Z6PA 4EL5A 1YA6A 3K9IA 4J8EA 3WXXA 3U3WA 2PYIA 4G2VA 3GYZA 2OOEA 1FU8A 1FC0A 2BUGA 3MRXA 4W6QA 4EJ2A 1L7XA 3MT8A 3UYLA 5TMDA 2XA9A 3HYMB 2GPBA 4AIFA 2SKEA 3CUVA 4EQFA 5D0QD 3AS5A 2QN8A 3CVQA 1GPYA 1QZ2A 4PQGA 1QM5A 2MHKA 1J39A 3L79A 2BFWA 2ATIA 1ZBPA 2GM9A 3H4IA 3G2HA 3OTHA 1XNFA 4RELA 5CCLA 2R60A 4GA1A 2C1ZA 5A6CA 3ZCRA 4NRHB 2PQRA 7GPBA 3MEKA 1JIVA 3ZFWA 5DXFA 2QRPA 3VDMA 4N2QA 2J9QA 4EKYA 4H7XA 3ZCPA 2JJMA 3CUUA 2KCVA 1BX3A 3OY7A 4AY6A 2IV7A 1Y8ZA 3S2UA 2HO1A 3S7BA 3G2KA 1EM6A 4XI9A 3TG5A 1WV1A 3MS4A 2F3PA 4MI6A 3N71A 1AXRA 4GYOA 2H1FA 2QZSA 3NP9A 3GZ2A 4GYWA 1F6DA 2F3QA 5KJMA 2SKDA 3G2JA 4N3CA 1JIXA 4N3AA 3TGOA 5TVGA 1JEJA 2IYAA 1ELWA 3ZGQA 1Z62A 4APOA 3MS7A 3ASDA 5D0OD 4AMBA 2FO7A 2BISA 3S7FA 3DDWA 3GUHA 4GCOA 3WC4A 4CTOA 1E96B 4YUAA 1P2DA 3MQFA 2XMPA 3MA5A 4JA9A 2FF4A 1HH8A 4UI9C 4I17A 4UI9K 3G2NA 3EBOA 3E4BA 2C4MA 3MT9A 2X6RA 1Y8MA 3D0QA 3L01A 2IEGA 3NAZA 1IXYA 5AYWD 1HXIA 2BGUA 2AMVA 5FTPA 4X7PA 2QN9A 4KQMA 2ZB2A 9GPBA 5A7DB 3RO3A 1ZU2A 4CTNA 3QHPA 2JLBA 5KJNA 4GCNA 1YGPA 3MRTA 1XL1A 4GZ6A 2QRQA 3CEJA 4RG6A 1GPBA 1M5RA 3C4VA 3WADA 4EKEA 1OUVA 4AMGA 3CUWA 3SYMA 3UUXA 4GZ5A 3MV2B 1W3BA 3RSZA 5DBKA 5LCWJ 4F97A 2H1HA 4FKZA 1SXPA 1GGNA 2PRJA 4RIHA 4CTMA 3BD7A 1K06A 4HOQA 2AZDA 3S0JA 1LWNA 2KC7A 4U0ZA 3RHZA 3VTYA 2HY7A 3CVNA 3DDSA 5CHEE 3GZ1A 1PNVA 3S29A 3RJVA 2FFRA 3SYRA 4HOSA 3O48A 1FA9A 3MTDA 3RKVA 4WNEA 1HZ4A 1WM5A 4RG9A 5FT9A 3CV3A 4L22A 5IKOA 4J8FA 4IN3B 2Q7FA 4O6FA 2GPNA 2IEIA 4Y6CA 3MRVA 4HOUA 4G26A
chains in the Genus database with same CATH superfamily
1Y1TA 2IUSA 3AHIA 3GLFE 3TFWA 1RACA 3HJNA 2EBWA 1C4WA 4UM7A 3HDGA 5EZSA 5ITZB 2E2WA 1OWNA 1BVYF 1D7OA 2AE1A 2QX9A 4YRPA 4XWOA 5FPHA 4RMNA 5KWSA 2HOQA 2JK1A 3GRUA 3NVKI 5CT6A 4FYPA 1Z36A 2VEDA 3ZQ6A 2DCPA 1US8A 4H4EA 3CGGA 3KXPA 4RQAA 1KY2A 3LBAA 5G53C 5KSYA 4AUNA 4D3ZA 4N2SA 1DX4A 3I2KA 4H2DA 2PIDA 4GC9A 2PFGA 4MAFA 5ALEA 2BR3A 1R15A 1N5JA 1GL6A 1A9XA 2WXGA 3ZCXA 4DPLA 1WG8A 3JQEA 1N2ZA 2ZBUA 2BFAA 3CBQA 3CVJA 2A5LA 2QNRA 4QPCA 2FX3A 1KMCA 2AH5A 2RJNA 3QFHA 4BSZB 3ZD9A 1WOMA 2OCYC 4UXJA 1DIBA 5LP6F 2V58A 2J46A 3ZY5A 4J1QA 3SYTA 2QU7A 1KAOA 3L02A 1LVHA 5L4NA 2RAPA 4DA8A 5C8XA 1Z47A 4GO1A 2EBHX 2HPAA 1HYEA 2R85A 5G2NA 3B2EA 2QQ0A 3G88A 1R9NA 3PFNA 3CZMA 3OKPA 1N0IA 3L8CA 4FIDA 5LA6B 3HXMA 4U0UA 2Q8NA 6ABPA 2GZ2A 2FH5B 3LQ1A 4FEGA 4FOPA 3E7WA 1ZAKA 1SG9A 3H5IA 3WOVA 4CM8A 3KKQA 2VHEA 4E5PA 3PUKA 3KE9A 1AN9A 1V48A 4NQZA 5AENA 4W6ZA 1IVSA 1MB3A 2JI7A 3AHGA 2XBUA 3F6PA 4NPHA 1RXCA 4A0GA 2ZXWE 5K3BA 1UBHS 3LI2A 5LA6A 2I99A 2X7HA 4P34A 4Q9NA 3SQNA 3QK0A 1Z08A 3OZRA 5AW7A 1B3BA 2YX1A 1GUBA 3HKEB 4C4TA 4RKQA 5CH5A 2C9YA 4YVQC 2PSHA 4J4HA 1OYYA 3WRVA 1WQ1R 1MW9X 3DS8A 1JV2B 3P97A 5BWOA 1DNPA 3R3UA 2PGAA 3M4NA 4FMDF 3Q3GE 3LHIA 3HCAA 3CSUA 3EQZA 3F3MA 1LBHA 4DAEA 1ZL0A 3GLFB 1V3UA 4O29A 4EG6A 4A03A 2CLCX 2J08A 3TE7A 3LC2O 4K3UA 4WK2B 1NMEA 3KVOA 2LO6A 1UZUA 2VUHB 3QPDA 1WMAA 2G9ZA 4CM8B 5DF1A 1U0JA 2E21A 2PRZA 2BUAA 3S27A 2M6SA 4ARBA 4RE5A 2HPHA 1JR3E 5D2MC 1N33B 3R9WA 2P2LA 4IUBS 2BZ0A 3NOQA 1FP7A 5EX0A 4KPGA 5CLGA 4KWHA 3GLFA 4NBKA 2C7QA 2W2KA 4D5GA 1LF5A 2I8LA 4JB3A 1JS1X 5AVWA 5CB8A 4CVNA 1K8KG 3H5LA 1E9SA 2M2IA 3ZWCA 4EPRA 2AVPA 3RVBA 3ZZUA 3G17A 4EVSA 4QT4A 4GKJB 5TPWB 1UM8A 5CP8A 4AY4A 1NJ5A 2XNCA 3O4HA 4HNSA 4IHKA 5LB4A 4IJWA 1LC3A 2FPPB 2VK1A 3PQ6A 3KOMA 4G9GA 1XJCA 3AXTA 3ML9A 1K0FA 2P9YA 4J2HA 3CMCO 3HADA 1GUYA 2WZCA 4UPVA 5TQ2B 9LDTA 1N94A 4KSCA 1RYEA 2FPSA 4OP1A 3I37X 5D7NA 1EBBA 1HZZC 3CIAA 1BYIA 3LX8A 1W0KD 1YJ8A 5BNZA 1DTWB 4EB6A 4ZMRA 3GN2A 4K81B 4LZWA 5TQ0B 1YGYA 1P6XA 5JY6A 4FP7A 3T5AA 2CDNA 2A1UA 1V37A 4PYMA 2PVCA 3WSVA 3VYTB 4FP9A 2YNMA 5JZOA 5FO1A 1P9WA 5LLSA 4JI4B 5GP1A 4HC4A 4EKDA 4DYHA 4M9UA 1TJCA 4UI9J 2WTXA 2ZSJA 3W3ZB 2Q4OA 1OXMA 1OY1A 2RIRA 3HO8A 4EVRA 2YQZA 3HGTA 4JZYA 1PX0A 1R4ZA 1U3UA 4IDHA 4LRSB 1Y6ZA 4O4IA 3SX4A 1UXJA 1VJ1A 4HQ0A 3RS3A 3H87A 1GNQA 1OT3A 2GHQA 3FMOB 3DV0B 2C94A 1GL7A 4GW3A 4IILA 4UUNA 1NJ6A 2BJHA 2IP4A 1DWUA 3F4LA 5EZYA 4GDMA 5I9SA 1IY8A 3FUJA 5TQ2A 4PINA 3ZGXA 4A23A 1YA0A 1GQOA 4I7EA 4DS3A 2Q9AA 1RPZA 2Z4RA 1RXYA 1U0RA 1UKAA 3D2BA 4MWTA 2KS6A 4EPYA 1U1FA 3KD7A 2KBFA 4EITA 4HORA 1OTYA 4KQ2A 1KJNA 3D3KA 1LB1B 2PBRA 4RPLA 2J33A 5E9JA 3IMGA 3LL7A 3HVHA 4ZARA 1EE2A 1GSAA 2JNWA 3D4NA 3TLJA 5EMNA 4D9GA 3T7TA 2G1UA 2WICA 3GP8A 4LVUA 2R6FA 2QMYA 2FMTA 4C4YA 1QKIA 3U62A 4WXPA 3R6TA 3BPSA 1AKWA 1FT2A 2DTEA 2Q6OA 1ZDMA 2DWCA 1BS1A 2GB4A 3IGFA 3P4YA 4YCJA 5CCXA 2PYZA 2C3YA 2ZTVA 3CVLA 1TLTA 2PQNA 4N3BA 1D4ZA 1I9GA 1DJNA 1QOZA 2AQHA 5LX8A 3A1NA 1M7HA 3ITNA 1UC4B 1IWBB 3R41A 4IPTA 2BEUA 1UQTA 1UBKS 2QAGA 4ARVA 4NNOA 3BD9A 3I3OA 4FE4A 1Q2XA 1BFUA 4GVXA 1SEVA 1MV5A 4EZKA 5LNK1 2A6PA 2OV1A 3GOQA 3QUAA 5ADVA 4IYJA 1QIJA 1G7SA 1N8SA 3KLPX 1Q0LA 3TBHA 3DZ8A 4YMIA 4QBFA 2M1XA 5AI8A 5EUCA 4FCTA 4A2QA 3C5EA 3JD1A 1PR4A 3NHYA 2W00A 2Y92A 3AR7A 1BKDR 3NFRA 4KIWA 3T0GA 1T6BY 5C9ZA 2DERA 5T5QA 4WUVA 1BJKA 4LW8A 2OEWA 1E0JA 4ZYZA 5EZ5A 4YROA 3Q9UA 4HWPA 3N3AC 1CRWG 1Q17A 4UARA 2P11A 3V7WA 4YY3B 3KR2A 5EIEA 5ENPD 4BCCA 2KB0A 4RZ3A 5CCMA 3OAAD 5JS1A 3SJZA 3MFYA 1QZTA 2F1JA 4G4SO 2GFHA 4MB0A 3LBFA 5KJLA 3FTZA 3R74A 3PXEA 2PSSA 2VBIA 1JQ5A 2P6PA 4XUGB 3VBEA 2D06A 1QNLA 3EG9A 3O21A 3O90A 2R6R1 4H7PA 3VR3D 4JYPA 1IZ7A 3OTQA 1RRCA 3ILVA 2JFWA 5JV5A 3A10A 3ONFA 3JYPA 5EHNA 4AZSA 3UXYA 1Z8HA 1CBUA 3JSAA 3PI6A 2H7VA 2QYUA 2HSZA 2RJ3A 3B52X 3NOXA 4G4SP 4P3YA 5KKAA 3TO5A 3WWDA 5DYWA 1MO5A 4BNLA 5EXSA 5A1JA 3I6MA 2FF5A 3K6SA 4V1CA 3RUCA 5AKXA 2O8FB 5A2QA 1LJUA 3DEPA 4PIVA 3SBTB 1QQ7A 2ZP1A 2ZJZA 4TT8A 2UZIR 5ALZA 2R84A 4MQFA 3VKWA 3KSRA 1GZ4A 2PH5A 1RHJA 3NPAA 1YULA 3UH0A 2DU8A 4JQCA 3F8WA 5CXXA 4JASB 1DV2A 3PPIA 2VI5A 2W11A 4EQ6A 1V41E 2AG0A 3LIPA 3QWVA 5IW8A 2WKWA 2WSBA 3O75A 2ZROA 5ELLA 4F4FA 6GPBA 4JXXA 3FCCA 5F1OA 2Y1XA 3Q4AB 1RJDA 1Z37A 3DMPA 2GN9A 2HU8A 5GM1A 2AC4A 1BHQ1 2NYAA 4ZZ0A 4HNAD 4O4LB 3IAS6 5JD6A 2VYQA 2GCNA 1UM9A 4MZXA 4L8FA 3AHCA 1RWNA 4YJ2A 3RIBA 4HPWA 1VBNA 4MS1B 2P5SA 1KYWA 4U7HA 3B82A 1W5EA 1IYZA 1QBQA 2C5GA 3PC8C 4ZVLA 5JJ6A 4D81A 3QKSB 4LWPA 4GMGA 2G9NA 2K6GA 2ERCA 3RAEC 2Q7XA 3PT5A 3TWWA 4ZCPA 2RE8A 1K3FA 1L4FA 1JXMA 3EU9A 4QC2A 4Z7QB 1FYEA 2P1RA 3KALA 2OZLB 2VGEA 1V1MA 3Q2OA 4GPIB 3UJ7A 3VKHA 4KV9A 4DV1B 2XMCA 4TUMA 2XADA 1TXGA 3CKBA 2VPQA 3VGPA 3KXKA 3IS3A 4OHPA 1G3MA 4FXOA 4I1SA 4MI1A 3T1YB 3IAFA 3ISMC 1DB3A 2WFMA 5JS2A 1FNNA 3HPRA 4Q96A 3IUNA 3L7IA 1PG0A 4JR0A 4UAGA 5CVJA 1QS0B 2X0DA 3GZTB 2RGNA 1SC4A 4PLFA 1KFCB 4XGRA 4ABNA 1K92A 3WRYA 2JKZA 1HDZA 5EXTA 4M7OA 4DLSA 1VZ2A 1E2UA 4MWSA 5EIXA 4RX1A 3J7AC 2ADMA 1QH1A 4WDRA 1FPMA 2RGNC 5EIAA 5LDDC 2GHRA 3P19A 1U3TA 2HO5A 3BWMA 4EGQA 1BRTA 4E6EA 5JCXA 4ZOLB 5B3JA 1XDSA 2J9FA 2C3UA 1PWYE 3F6EX 2X9NA 1LI5A 3RKSA 4J0CA 2EZUA 5LDHA 1OGIA 3QEOA 3VSCA 4AKGA 4ZDJA 1GFIA 3OP1A 3A4LA 2QRGA 2P2GA 3PDIB 4LRWA 5AHKA 1E9RA 1K75A 2QF7A 3W9YA 5JCOC 1PYDA 4U8HA 1I1NA 4S1TA 5HFAA 3GT4A 4YFVA 1S2IA 1Z22A 3ZKWA 1C41A 1H4TA 2WINI 1DRJA 2VYNA 1UT6A 2F9LA 3HUTA 5GONA 4CJXA 1GZ5A 2P0EA 4A8JC 5J90A 1KARA 1S64A 1JDZA 1G1AA 4BNKA 1UH5A 1JYSA 1WZCA 1GV1A 2P7IA 3ROKA 4FHZA 1KDRA 3RYFA 1J4AA 4HDMB 5KAMA 4MCIA 4RFVA 3BE4A 5FKJA 4FHFA 4BL5A 2LPMA 5AIAA 4D3XA 4IGIA 3KXDA 4IMIB 3O9MA 1CUDA 1RZ4A 5TMDA 2DQZA 3EGXB 4WGGA 4DADA 3W5JA 2CV2A 1NJ1A 2J5KA 3SMVA 1LNSA 4HVLA 1X15A 1Z0IA 2CW5A 4RM2A 3IEIA 2JGKA 4YA6A 2OBNA 2FP3A 3EZXA 3UM9A 4PO3X 4ARAA 1X1QA 4G09A 4IUCS 3OZVA 4BVGA 1Q6YA 4MMZB 5I4IA 1GR1A 3UM1A 3FPCA 5HCUA 4YV7A 2QI9C 3PQ5A 4RESA 4EW1A 1Q50A 2O48X 3CZCA 2IK8A 3EMBA 3INTA 3ESXA 1H2XA 4UZFA 3R7SA 2ZU0C 2XBLA 1E9VA 1USVA 3OU7A 4CMHA 5IBQA 3SVZA 2ZBVA 5A6CA 1VA4A 1WR8A 1T5IA 2QD1A 3LPCA 1MVLA 5K05A 4NL4H 3ZDCA 2MSEB 2PQRA 1S2DA 4KH0A 1TAUA 2Y27A 4Y3UA 4IMJB 1OHHA 2QYTA 3KSQA 1Z2DA 4ESOA 4K6MA 1L7RA 4FFRA 1RJ9A 4NOLA 3RUIA 4JXZA 3QVKA 1FTSA 4D4MA 4D45A 2JAOA 2YBDA 2AN1A 4TLEA 4RVOA 3D3EA 2R1UA 2NZJA 1IOZA 1NT4A 3BKWA 2J8ZA 2BE7A 2XF8A 3D6FA 1OV4A 4FOSA 4HGOA 4ZYXA 3RSSA 3KJZA 4KLCA 3TNFA 3VPXA 3PJEA 1JRLA 1D2AA 4X6YA 1DAFA 1XQXA 2JH3A 3FDXA 4JA2A 4MI6A 2JLZA 1CZKA 2DBQA 3C7DB 3QKRA 3R5SA 2W2KB 2POCA 3RHSA 2WKRA 4GPD1 4GYWA 2WIDA 3G2WA 3VR6D 1F17A 3ENKA 1E7MA 2NZXA 4N3AA 3F3SA 3I9FA 1GUAA 3EZGA 1LSJA 3L4EA 4JQOA 2HM7A 3U9TA 1Z62A 2Q5EA 4J0EA 4YV0A 2PSEA 3SI7A 5AW0A 4R0MA 3IIMA 2QTRA 1GNTA 3V42A 1E9CA 3O3MB 1B6GA 2X7XA 1OI7A 1TJ5A 4D41A 3HQ4O 4IOMA 4V0OA 3SR4A 2H2AA 5GIOE 2H29A 4GSKA 5FNVF 5I6DA 2ZANA 3CGHA 3GZ4A 3HVEA 3L92A 3LLCA 4ZGBA 3WHLA 1Z4NA 2VL7A 4O8ZA 4WI1A 2GZ3A 3KSLA 3I3NA 3M34A 4PLGA 3DO5A 4I17A 3OOEA 4W5RA 1M2JA 3U7EB 4A15A 3B5JA 4W82A 4GAAA 2OM6A 3H1EA 5ALKA 4DCSA 3L01A 3D9IA 1XNHA 4G5SA 3N2ZB 4NU0A 2XDQA 4H1UA 3ZV4A 1IXYA 4TYQA 3UA3A 4D9IA 1PEKE 5KWVA 4E03A 2AI3A 2WXPA 4S05A 3LF1A 3U7HB 3EUWA 3OUTA 5DM1A 3L7KA 1EXDA 3EHQA 2ZB2A 3AF3A 3B12A 3N59A 4CTKA 2BSQA 5LLTA 3RO3A 3O73A 1Z2OX 2HJHA 4BEJA 3NOGD 3AVPA 2JLBA 4FLBA 2VTDA 3F0TA 3VSAA 4INAA 2HXSA 1YFLA 4YRFA 3HS3A 4RG6A 3IODA 2I54A 3ONKA 2XQFA 3HHEA 1T24A 4ITUA 3SYMA 3EZYA 4EVQA 2W2NA 4PNHA 1VXOA 4FKZA 3JARA 4QFCA 5JATA 3KETA 5FBLB 2W6ZA 2EX4A 4CMCA 3DMDA 4EG0A 2PRJA 4C6TA 4W5NA 3UTCA 3N8DA 1DWQA 3H7IA 4GB9A 3S0JA 1K68A 4DLNA 1NW9B 5THXA 1G4UR 5CBPB 3WBBA 1LWNA 1GUDA 3U3OA 2XDQB 4YQZA 3DDSA 5E7JA 5AK3A 1RLOA 3RJVA 2HNBA 1EFRD 3BBLA 1DWPA 1F8FA 1SEPA 4RKEA 3WTCA 2GCOA 2PH3A 2V6MA 3SQVA 2G67A 3BMCB 1H6KA 1WHSB 4N7JA 4NX2A 3UENA 3RKVA 4ITRC 5IXYA 5CD1A 5FT9A 3HXEA 1QGED 3BRWA 5CDHA 2E5WA 4CQMB 3QTLA 2FMXA 1CQZA 4HAOA 1CRLA 4L23A 4HAVA 4V2IA 4HQ6A 3ND5A 1TO6A 4RK5A 5AH0A 4IXNA 3ASUA 3SF4A 3H0EA 4LBVA 5AP9A 3ZGNA 5JFOA 4PF1A 2Q28A 4C0EA 3FYDA 2H4XA 4B7UA 3I72A 2ETVA 3AWIA 3PD0A 3W2TA 1N2CE 4IUYA 5GOTA 4AB1A 4LNGA 1KFBB 3QEMB 2AK3A 5JAHA 1Z0KA 2RCYA 3C3WA 4YALA 1DO0A 3FTDA 2VUUA 4JJ8A 1IZZA 1Q6ZA 2HF9A 1N2OA 3O82A 4QGSA 2YJTD 2ZUFA 2HEIA 3MBKA 2VVTA 1GXSB 2REOA 3S28A 1UXGA 2WTNA 3UC5A 2ZKIA 1QIDA 1IZ0A 2EJCA 2H16A 4PZYA 2GCOB 5TT0A 4QSMA 3V1YA 1C7ZA 4BLRA 1UJJA 5BOVA 4G85A 5DW3A 3ZZ1A 2VZ0A 4BNTA 6NULA 2XAUA 4ME6A 3RU7A 4DJFC 1U4NA 4LWOA 1PVVA 5B4VA 3IKMB 5FL7D 3QF4A 4N6OA 4BSXA 3D6VA 2TMYA 3OFVA 4IM7A 4H31A 3N0RA 4YI3A 3BTSA 2W70A 4ZGWA 5LR6A 2ZIAA 4ZK2A 1E2BA 1LK7A 2CXRA 4KWIA 2BR4A 2RJOA 2E87A 4RF5A 4RYDA 1Y7PA 3F7MA 4F93B 1UL1X 2RI6A 1GPJA 2WKPA 2G6TA 2A5JA 3CJTA 4N9QA 1VLHA 4RKFA 3EGIA 4I4IA 1OIXA 3N1UA 5IVHA 1GA6A 1GARA 3KEZA 5E3JA 4XLTA 4DV7B 1ZSVA 4WCFB 4Y98A 4E15A 3HB5X 1YZFA 3HBLA 1K66A 5G55A 3EYAA 4NHOA 3WL3A 1ZJYA 4UVIA 3ECCA 4B3SB 4KYIB 3DM9B 2EWWA 2HSGA 4YASA 4HB5A 2IV2X 3I5UA 4E5MA 1T0BA 2JK0A 4QDXA 1U02A 4PLYA 3EU5A 2EFDB 4X94A 5BRAA 2CHGA 2NOAA 3SC3A 4JD5A 2QX4A 4MJLA 4F85A 1PWZA 4D98A 4XGIA 1AG9A 3AI7A 1FYVA 3M3HA 4UULA 3O94A 3ZHTA 4BQIA 5J4KA 4EGCB 4B84A 4N5QA 2VPYA 3FBWA 1A9PA 1XZAA 4WN9A 3OX4A 3IOCA 3LWZA 4JX8A 1Z8DA 4KTTE 3FUEA 3ITDA 2XQKA 1JGTA 1HDOA 1NVTA 4OBWA 4L8GA 2ZWOA 4B71A 4UM9B 3CYFA 3JYSA 1LGYA 4H0NA 4B2YA 2D0PB 1N8TA 1NU8A 2IFTA 2QM8A 3K73O 4TMFA 3KWMA 2V65A 3NAMA 3P9KA 1WHTB 3UOAB 4KW7A 3ML1A 4F1KA 5EP3A 2DKNA 5FBRB 2VHXA 2AWNA 2W58A 5EFZA 3L18A 3Q8XB 3MPOA 5AI6A 2HUNA 2IEYA 4QTTB 1TN6A 1SURA 4KACA 5BNFA 4EPXA 1EUZA 1SBIA 3LW7A 1R6VA 4XAQA 4CQJA 4G5YA 2ZW9A 4ARIA 3ZC3A 1AE1A 4NACA 2D7DA 2MYOA 4ZZ2A 4ZI3A 1VGVA 1D2NA 1FTNA 2XF2A 3A2NA 1NVFA 4TVOA 1FB5A 1NP7A 1GGFA 1ACMA 1HUQA 1U2ZA 5KSOA 2M32A 1F06A 2XX3A 4KLZA 2RGUA 1NNLA 1T5TA 1GAEO 1N0VC 3I53A 3VHQA 1PV4A 1YJXA 3V33A 1P9OA 4DHWA 5AJTA 3HXCA 2ZS8A 3W78A 4DNXA 5JJ5A 1S01A 4CIXA 1W94A 2RGXA 2PNNA 2ZU6B 4MGEA 4KYVA 1NOIA 3ZN2A 2WFAA 1PTKA 1LVUA 1ZIOA 5JHHB 3CVPA 3QE3A 3OQBA 3JVIA 4BS9A 1WA5A 5JJ7A 5B2EA 4RTRA 1JE0A 5U4QA 4Y2QA 1P29A 4IVRA 3RO2A 4MW4A 4ANUA 3UPUA 3ONWA 3UATA 1OVMA 2R4UA 4GYJA 3KHSA 2IY0C 4AJ9A 2BTOA 2J3QA 1CQIB 3LNTA 3HZRA 2GRLA 1RMQA 3OA2A 4DRXB 3DG9A 5BXYA 3WFJA 1QPZA 3COPA 1CY6A 1AZWA 1KJIA 2MWMA 5IVDA 3ZBUA 1SOWA 2JA2A 2NSHA 3GJ6A 1SXGA 2YVKA 4PRKA 3RSCA 4C0LA 4CKEA 3E1GA 1GPWB 3KU1A 3ZDFA 4B74A 3KWLA 3ZWKA 2FETA 4L4XA 5M29A 1MENA 2WSIA 4Z86A 5DCLA 4ZALA 5HQ3A 2VJQA 2PMEA 4A2PA 3L04A 4PTZA 4Y1FA 4RTQA 3B6ZA 4Y6GB 2WYUA 4IFIA 3RSLA 2UYHA 1EFHA 4YMVA 1JNXX 4I5EA 1M66A 4KPEC 2GTHA 5IXJA 1ZUNB 2AB0A 2JANA 4LJ7A 1N54A 1IY2A 4UU0A 3RWBA 1KZYC 4DG9A 2OOKA 5IDWA 1V3TA 4U2FA 3HI6A 2EBUA 3U7RA 2FI7A 1ZR2A 3SGHA 1N0HA 1J0AA 1SZDA 3REQB 2O2DA 5CK4A 1JDPA 2D5LA 2PU7A 1PUJA 1EGHA 3HG7A 2OAEA 2KQUA 3SFVA 1X8JA 5C4GB 1KMQA 4A2CA 4EHKA 2YFKA 3K0SA 1G7TA 2DC1A 4GPTA 2HA6A 2RAVA 1E62A 3L7CA 1U6KA 2Q5QA 2WKQA 4RF4A 1JKJB 3NEJA 3K0HA 4P5PA 3RIXA 4TRQA 4WUTA 5CDGA 4QFMA 3OURA 1AX9A 4HI9A 1E6EA 4GVPA 4IG4A 1PO7A 1WCYA 2H1IA 5F9HA 3SKVA 2HR1A 1AKEA 5HIIA 3ZBTA 5FWQA 2BCEA 1HE3A 1NG9A 3FUIA 3LU1A 3PR1A 2CZQA 2EEPA 4IDPA 4ZKEA 1VGQA 1R9JA 3Q98A 4CM9D 1WUHS 5DISB 4CF5A 1YK1A 4ZOLF 5ALTA 5C8VA 4M7WA 3UOWA 3HNRA 2JI8A 3FSEA 4JKYA 4AK9A 1C3LA 2N0SA 3VVLA 4A73A 3MHTA 1Y6GA 2H0RA 5KKNB 4LA4A 3TWTA 1SHKA 2B7CA 2HWKA 2OGUA 4F45A 1BX1A 4UXHA 1ADCA 5K4HA 4OMDA 3ZNNA 2ZB7A 4UBNA 3ONEA 2QP9X 2P3OA 5EZQA 1N77A 1ILWA 1VRCA 1WZUA 1KOFA 3NDRA 3RVSA 3VZPA 1N34B 2G9UA 3PDUA 2PS3A 5CFZA 1H1LA 4ZREA 1S8NA 2DHEA 4OI1A 2R4QA 4DTIA 4YCBA 4PBRA 3X2QE 2ERXA 1T43A 4LDZA 4NMHA 4RA6B 3ZX5A 4PX9A 4DMCA 4FCWA 1XTBA 3GBPA 5EG5A 1H8ED 1ECPA 1BEUB 2I3BA 4YYZA 3Q7PA 1HYQA 1GYPA 1A2KC 5P8WA 3ZXYA 1HG1A 4ENTA 2BGIA 4HN2A 3KEQA 3QG5A 4PLHA 1MEOA 3HRAA 1Y1RA 1CJVC 2IQIA 4PUCA 2BL4A 2VHJA 1SA0B 3NH6A 1UJMA 2C5SA 1Y3IA 3CRVA 3D0RA 3WYGA 4QGAA 3TIFA 2P79A 3T15A 1LDMA 1D03A 5FO0A 4G8KA 1NKSA 3U81A 3UV3A 3AETA 3EVCA 3K7EA 5D7BA 1YR6A 4W7SA 1NRXA 4Y7DA 3S81A 2C2HA 2G7ZA 2D8MA 1BQ4A 2HZBA 3ZKAA 4N48A 1SHTX 2XJ4A 4IHJB 2C04A 3V2XA 2AW3A 4TWBA 3I5MA 1X7XA 2Q41A 1M8PA 1NN1A 1QK5A 1RI2A 1W581 2PLWA 3EF3A 3K2IA 5AWFC 1ZB1A 5IJXA 3THRA 5BVGA 2MSWA 3U7IA 2WUEA 4RBNA 2X0RA 2B9VA 2PH7A 3KAPA 4WFJA 4HRLA 4K9RA 4YCSA 4YQFA 1U81A 3RT9A 1DBSA 1J8DA 1SZCA 2LZ0A 1ZVMA 3BRQA 3IBGA 3PXGA 2JFGA 1ZNZA 4WOBA 5C4MA 2LUHA 1VIDA 2J7KA 3L2OB 2O59A 3FNHA 2IIBA 3GR6A 3MTAA 4Z4IA 3EF0A 1ZD9A 2FLKA 5JASA 4R84A 4RZSA 1UJCA 3KSZO 2VAXA 4HDNB 3HV2A 4L3OA 3U4HA 1NRWA 1Z3CA 1M6YA 3FI0A 3HBMA 4HLEA 1SCDA 3M8KA 3RC9A 4DOMA 2F7SA 3DGFC 3IOYA 3QUTA 3CRNA 5FF9A 3G0OA 2PX6A 3QVMA 1GN8A 2RMKA 1EU1A 4ZODA 4R81A 4OREX 4B6PA 5HKPA 4GNKA 1CC1S 4TKZA 2GJKA 1DJQA 1M1UA 2ZIEA 1AKNA 5ESWA 4LYFA 2MYPA 2O1EA 4HQLA 3TL5A 3MCXA 2WU3A 2FP4B 3R5KA 4MLZA 3TLCA 3KUKA 1JEOA 3IEUA 2H85A 4MVJD 2D0IA 2DY0A 1O58A 3EPRA 4JVOA 3AU4A 2A9FA 1W46A 3GRZA 2V0PA 4Y9DA 1A7AA 5AUQA 4BWGA 1G9TA 1YONA 3O47A 5B7GA 2NO9A 2XVZA 2X2PA 3PNMA 3ZXIA 5I7EA 2HRZA 1OH6A 1TK2A 1R64A 3HM2A 4JC0A 2ZPUA 3KSAC 2ZIXA 4EAAA 1P7ZA 1VJ5A 2HPVA 2IEBA 3PEYA 1TNBA 4GLBA 4IV5A 4HH1A 4PVCA 1D04A 1XGWA 2H92A 1UCFA 1PZNA 3URZA 2OO5A 2PMBA 1EK5A 1MXFA 1N9AA 1I2MA 2N47A 4GZCA 7YASA 2IX9A 4Q5IA 4OGWA 1HQDA 1DOHA 4P83A 4B4WA 4ZAVA 1XFDA 1YCHA 3L0ZA 2Z2IA 3DL4A 3I52A 2X14A 2XA1A 2YWEA 2ZKLA 3O0TA 4DDUA 2ZWAA 2ODEA 4M0PA 2PL9A 1I3OA 3ZE8A 1S8FA 2GARA 4JLBA 4JSTA 4LCTA 1D2EA 2EAUA 1XVVA 2QTBA 4RORA 4Z2YA 2ADFA 3NHRA 3ZDYB 3RV3A 4QUBA 3DLBA 1CZHA 1YFKA 2B5VA 2HAEA 3MN1A 2WXKA 1RXEA 2GPBA 3AR3A 1W0JD 4GGOA 5F2OA 3UGTA 1WZNA 3MJRA 4EA7A 6REQB 4JFRA 5FBHA 5EJ8A 3AU8A 3JR7A 2EXXA 2J07A 1KAHA 5BSWA 4MRNA 4I50F 1UZAA 1FUIA 2E82A 1YI0A 3VR6H 2YN4A 4PYJA 4NCBA 2CVPA 3BQNB 4ZYTA 2BUCA 4Q02A 4QRIA 3BK7A 3FPLA 1RBQA 4DLYA 2GK4A 2LVBA 4X61A 4CKYA 1CY0A 5JFTA 3M9LA 2P75A 4P7KA 1Z74A 1WS6A 4MGHA 2WXLA 4JUIA 4E5NA 3LS8A 6LDHA 4PAWA 2OD7A 4U63A 2Y3AA 4MQ6A 2DVWA 3LDZA 2ZU6A 3IV0A 1R6DA 5E8JA 2QTCA 3IB3A 2JBAB 1DCMA 3TZBA 3CXUA 3MEKA 3MRSA 1XRJA 2H4WA 7GPBA 1J2JA 1E1RA 1TE2A 2H2HA 4KIFA 2PS1A 4OLFA 2R00C 4CV3A 4N2QA 4H7XA 3TXYA 3WJ7A 3NLLA 5EDSA 2B9EA 1M1NA 4IIXA 1DI0A 1LQTA 3KJXA 5EL0A 3TTYA 1NQWA 1Y7HA 3Q3CA 4JENA 3S7BA 4DSUA 3ZIDA 1OV6A 4HLUA 5CXQA 4P7GA 2O4UX 5JXGA 3Q8KA 5JBIA 3FUVA 1LNZA 3CM0A 3LCJA 3N8GA 2VOJA 4DY6A 5AIBA 1VI6A 2IC5A 4X3PA 1FW6A 4CDNA 3BSSA 4QLAA 1S3SA 3MF4A 1PWHA 1R3UA 2HRDA 2V45A 1SC3A 1GQRA 3CW9A 3L77A 4U02A 4E85A 1NP3A 2G1KA 3CUKA 3ZQKA 3VPDA 1T1JA 1SIWA 4ER3A 3QELA 1KEKA 3W90A 1NNUA 5AI0A 1L5JA 2OBFA 1CP3A 2HBZA 2QQGA 3PUZA 4H4CA 4KR9A 3RS2A 2BONA 4PAOA 3UK0A 2HK6A 1FUEA 2Q62A 3H42B 4P3PA 5HW0A 1PFUA 3R6LA 2QUIA 3I0NA 2J87A 3KWFA 4MQ4A 3NZEA 2KX7A 2VIIA 2GROB 3QXSA 3CUSA 1E1QA 4DLTA 5L8VA 2I6QA 2Q8PA 3UHPA 2AJBA 4MUYA 3L7OA 2YXPX 1N75A 2WR8A 3E0XA 3ND6A 2EGHA 3ZGYA 4D4GA 2XKKA 3PRJA 4RY0A 3VH3A 4ZHQA 5A5FA 5JHGB 4B17A 1EE9A 1Y3AA 1TM5E 4E1AA 1ZD3A 4J3JA 4WCDA 5I7OA 3GRPA 2DQKA 3GIWA 3GCWA 1RE1A 5L7TA 1EXWA 2J31A 2OBYA 1GFSA 1Y48E 3DKVA 3IJRA 4S0XA 5ERYA 4AU1A 3RB8A 3FVWA 1PZHA 2BD0A 4HF7A 2CMGA 2Y2VA 3DAPA 4GSLA 1HEYA 1V55E 2R751 5B3LA 4UTRA 2PV0A 2AYYA 1Z7BA 1OWPA 4ENPA 1E1CA 3R5HA 1KZHA 1XEWY 2J4BA 2JCSA 2BGUA 1MRZA 4PONA 3NT4A 5GZ6A 2R7KA 4POAA 5F73A 1HGXA 4FPXA 4A0HA 3L5KA 3QHPA 5CD9A 4BKPA 1RYDA 1R4NB 4JY7A 3VVCA 4L4ZA 4V24A 2R97A 4XLLA 3A6HA 4EEKA 5EE0A 4EBFA 4U3JA 3DBHB 1ZRNA 1XTSA 4A3VA 2FX2A 1NVVR 2QDXA 3Q9NA 1K7SN 1RI3A 1RWWA 1X1RA 1Q14A 1Z6GA 2YOFA 3QYFA 5HTKA 1YUNA 3H65A 1ZUWA 2YHIA 4NATA 5AW4A 1QIHA 2LXLA 1KE2A 1RJEA 1H2VC 5ALVA 4G63A 3WDMA 1ESZA 3G5UA 4BNIA 2X6HA 2WHRA 4ISBA 1K06A 3KPUA 4YDWA 3TEFA 1KAMA 3MUFA 1IK4A 3VAAA 1KRXA 1SUFA 2KBXA 1TMOA 1DLJA 3DOOA 3IIKA 1AA9A 3CVNA 1US8B 3D54D 4DWWA 5IASA 2FFRA 3KZXA 4B1FA 1Z3YA 2XQ0A 3JALA 4QVKA 2D5BA 2Z4SA 5K0JA 3BJZA 4EKGA 1NA5A 4YO8A 4BV8A 4W7IA 1QO9A 2C8LA 2CFOA 3SY2A 1VSVA 2WIKA 4A10A 4F92B 3CLSD 2AYZA 5KNBD 4G89A 1CB0A 4JW1A 4ALMA 3S1AA 1J8YF 1YFZA 1AS3A 4NS1A 1D9XA 4PQFA 4Z4EA 3ZJ5A 2IXGA 1H22A 1U98A 3A58B 1EK0A 3HZZA 2VNKA 4XJTA 3PZRA 4A6EA 1VPWA 1HTBA 1Y8AA 3JALB 3ZYMA 1Z5GA 4BZQA 2IY7A 3GFSA 1W5AA 4E21A 5HUJA 4PG5A 4RDIA 5D3KA 1U9CA 4KU4A 3ODPA 4DIEA 1NPDA 2X19A 1UWCA 2A9RA 3VDNB 4BFVA 2WTEA 1VKOA 4TXNA 5AKIA 4EIWA 3S1AB 3NWEA 4GTMA 2V4HC 3BYZA 5AYVA 1H3EA 2ZI3A 5I01A 1PL7A 5FZRA 4TL7A 3UMBA 1B7GO 3NBYC 3ICVA 5FLXA 1OH8A 3OLCX 2IS4A 4TXRA 1P4JA 1KSJA 3GA7A 1EDOA 3VLEA 2OFPA 3GLKA 1L8LA 4JAVC 1SXJC 3MLBA 4KQHA 1P2GA 4D9KA 4YRKA 4Z6KA 1BS2A 3FWHA 4HYYA 5K8TA 1WQ3A 4D25A 5GJBA 2NYVA 2QRHA 4C7KA 4FZRA 2NO5A 2AG1A 2VK2A 3MUEA 3GLIB 5C1DA 2GKSA 4ZPJA 3W5DA 5CT5A 3JD3A 1ZK1A 2MJLA 3KKOA 4P5EA 1NASA 4ALJA 1P73A 2E4VA 1QF7A 2C2OA 1YDGA 2EERA 2J30A 2OXEA 3A6GA 4O4JF 3GJXC 3BRSA 4F46A 1P9RA 3BMQA 2DFDA 4Q3EA 1EDEA 3JQ8B 5A03A 1O4VA 2GH1A 3EG5A 4C3ZA 4LJ4A 1AKVA 1M34A 3TFOA 3GQBA 1UOEA 1E94E 3NJ4A 4FJ1A 4DMUB 4BERA 1VJDA 3N7UA 1UDRA 3RS5A 1CPYA 1SVNA 2YFHA 3F47A 3A6FA 3FOCA 1V95A 2B36A 2A84A 2HBQA 4FS3A 3K9FC 2CUNA 1WABA 3TNDA 1DUIA 1M6HA 2G36A 3HB7A 4H15A 2QZAA 4UE3S 1TNUA 5EHXA 4DRXE 1DL5A 1E1RD 2D5IA 1ZD2P 1ND5A 5JJLA 3T5TA 3IE1A 4E3ZA 2Y4TA 4O60A 1ORWA 2DVMA 1DIGA 1KMHA 4NSNA 2WSMA 1LSSA 1ZJWA 4WFKA 2BBSA 1M10A 2DR3A 1E3WA 1GXSA 2WWWA 3HO1A 2I22A 1ZH4A 2OQRA 2YFYA 1L3BA 3FLBA 4G5GA 4OB7A 4ZT2A 3IRUA 3UQZA 1UXIA 1IBRA 1ITZA 5I7FA 3W1EA 4HDAA 1X8LA 5IULC 1JLRA 5NULA 5GQSA 3T9AA 2QUKA 3EXEA 3FVQA 4PM4A 3SBEA 5KVCA 5JJKA 1EP1B 3IT0A 1NJFA 4AM9A 3D8RA 4MWZA 4K2AA 3E03A 4II3A 3ESBA 3FR7A 5FOVA 4JQYA 2WYIA 4F1WA 5BWMA 1JMVA 1SIUA 2Q1SA 3T9DA 3VU9B 5CBKA 3TPZA 5IAEA 3NNNA 1H2TC 3NXKA 2F3UA 2XW6A 3AUTA 3KOYA 2HJRA 4YJHB 1SRRA 2DRIA 5A9TA 5G05C 1E3QA 3OLVA 3R3VA 4OQ4A 5BURA 1Q1AA 3W4JA 1UFQA 1ECBA 2PH1A 3QFTA 3VPSA 4BQEA 1IN1A 4EQ6B 2CC2A 3BFVA 3FETA 2PX8A 2Y1EA 3E7DA 2HU5A 2XYQA 4I1UA 3ETEA 4X84A 3UG6A 3VH4A 3PZBA 5KCZA 3CX8A 3AW8A 3DTTA 1S0PA 3HCOA 3H6GA 4FFOA 4MMXB 2X0EA 3SHWA 3VU0A 3IRVA 5K0SA 4EJ6A 5C1IA 3NS7A 2VNAA 4FLFA 1JCSA 4JQSA 4PC7A 4ROSA 4O2AF 3PC7A 5DRYA 2YY6A 1F0KA 2QSZA 3B20A 3AOEA 1NC3A 2A1IA 2YJNA 4LGYA 4W9NA 4B32A 3I61A 3I9JA 1E0DA 4LOKA 4F06A 3H3XA 3GA0A 3LHSA 3C3AA 4O3FA 4YB8A 5TDHA 1IBMB 2KPOA 3KD3A 3MM4A 3IKTA 4AXHA 2H1VA 2R6AA 3N7TA 1SO8A 4V0ME 2C5LA 1II9A 5BSKA 3O9ZA 4DM3A 1CIPA 1O0BA 2CZGA 1UBFA 3V2GA 4I99A 1IM5A 4H3KB 1H6DA 1AT1A 1LSUA 3MMPA 3HKDA 2J4DA 3WLSA 4EKNB 2EC5A 2FHSA 4H59A 5AQ7A 1G60A 1NHGA 4PN7A 3D64A 4BGDA 4YR9A 2FQ1A 4OQXA 3GPDG 2IU6A 2CHQA 2HIHA 1T0PA 4OJYA 3EA4A 4L76A 1QZXA 5SZHB 2QMOA 3S2FA 1MLDA 4ZZ1A 5JECA 4KMRA 3ANYB 2QN2A 4PG4A 2GN8A 5KSPA 1K5GA 4WKPA 2UY1A 5DK6A 3IVAA 5BSFA 4IJKA 1TQ8A 3EDQA 4C6SA 1D0VA 1I7DA 2R8BA 4FX2A 4E2FA 1ZH2A 3BDAA 1B3RA 1O94C 1H6PA 3ZYKA 4OEHA 5G0VA 3UAOA 2D1RA 4WXRA 1YUMA 4HAZA 1DX6A 2R5WA 2X5NA 2HIAA 4IJ5A 2A5FA 5CTJA 4EBAA 2OEVA 5F35A 2DULA 1YMVA 4UFPA 4KCGA 4BO7A 5LKRA 3RK6A 2NUAB 5JUWA 3B1ZA 5JTUA 3TUIC 5JH7A 1GZDA 2O8CA 4L9WA 3REGA 2VJBA 2GKOA 1Z0UA 2AL7A 2P6NA 5F12A 4YRAA 2XGGA 5JLAA 2OXFA 2XT0A 1QVWA 1N36B 4AJPA 4W9MC 5I4KA 3PX7A 2GN6A 1BFKA 1OA1A 1YB6A 3ZOKA 5JY1A 1QHEA 2ZDQA 4DDHA 4WZBA 1XDZA 1T8RA 3JWJA 4UAUA 4YMSA 5HKBA 1VFNA 1RPTA 3G59A 5G05J 3UXGA 2AFVA 2ZRAA 4D8YA 4JI3B 3UM2A 2H51A 5LBTA 4MQBA 2VQ6A 1BOOA 1DDGA 2E18A 3TMYA 4PGFA 2CEKA 1NQOA 1TAQA 3I01M 3AKYA 4C0HA 9LDBA 1YMPA 4GT1A 2CSXA 1N7GA 2FSVA 2Z9CA 4QL3A 4UFOA 1TMYA 5JHAA 3DUFB 5C8YB 1V26A 1U5AA 3IP8A 2PCJA 4FGJA 1U9YA 3RFXA 1GV0A 4AXXA 1U8FO 3C5VA 2UXDB 3ZCSA 3AKDA 3PQEA 5HM8A 2W2QA 1XLVA 4K0RA 1P2BA 1IRXA 2DLDA 4WNGA 1JB9A 2QKYA 3BORA 4RH1A 4S1WA 3W1WA 1UPUA 2ZAYA 4QEZA 4TWJA 3QK7A 1KEZA 4RY9A 1R4NA 1ZVQA 5E7IA 5H70A 2Q29A 2W0MA 5E3HA 4CYMD 1H66A 3GZJA 3L0BA 3L4BA 3VA7A 2HDOA 3DEFA 1XAGA 3GARA 4NCIA 5B2FA 3EGDB 2OK8A 2XV1A 1NNEA 2O8BB 3EEIA 1QHIA 4F3TA 3GEMA 5HMMA 1JR2A 4FDTA 1DTSA 3PNQA 4IHAA 2YZMA 2D4AA 3QMMA 2VXYA 3AZPA 2OYRA 4B45A 4C0JA 2VYVA 5KEIA 1Y34E 1FSSA 3E3LA 3FSGD 2APJA 3SD7A 1TM1E 4EK9A 1WXEA 1YQQA 1XDUA 3TVTA 1MBZA 1BFDA 1U2GC 3EXHA 1SU4A 3FTNA 2IQCA 2HRBA 2VK8A 4JLDA 1L3IA 4X1IB 9ATCA 1AA6A 1DG9A 3JWEA 4TGLA 5K1ZA 4KR3A 1E63A 1P2TA 3MNFA 2J7PA 1NLMA 3C7CB 1I4OA 4K9DA 4IIUA 1N4SA 5CNMA 5JO9A 1L5HA 3ZUPA 4F2DA 4GMKA 5CLFA 1B15A 3P4XA 1XPUA 2WB4A 5KJKA 2ZVDA 3C3KA 2FR1A 4J1TC 4P0PB 4JU8A 1KR5A 3OPQA 4MRVA 4NQRA 4BRUA 2PUAA 1X7WA 1J97A 4UCXA 4A8PA 4DLLA 2IBSA 3LRPA 3NTRA 5A3RA 1M72A 2YJZA 3OEWA 5LQMA 2Z08A 4KAFA 4QSHA 3QH4A 3CLUC 1YASA 1ZK4A 3LCUA 4DIKA 1E9FA 2XBMA 4EG8A 3KPWA 4CHTA 2F55A 2YH2A 5A5EA 3Q3EA 3A28A 1XMQB 5HE8A 5C1PA 3ER8A 1Q7RA 4XPZA 1Z29A 3AS4A 3LLSA 1A9XB 2Q5JA 2WJGA 3B1XA 3U26A 4MHTA 1I1QB 3PE6A 4DJDC 1CP2A 4M99A 5ARFA 1IEWA 4RYLA 3OQ1A 3WGQA 1B16A 3AW9A 5EJMA 3ZS9A 4B6SA 4UEQA 1UC5B 4EW3A 2J3MA 2GEKA 1ICIA 3ROFA 4RTJA 2MOKA 1FP1D 1X1TA 1OBOA 1WCV1 4HWSA 4LI3X 1RYNA 4M0EA 2AYXA 2V7VA 3UCXA 7REQB 1D9SA 1HDGO 3JSXA 2PM7A 1P7PA 2EIKE 1BH2A 1TCUA 2FW1A 2I3AA 4FWIB 4XIYA 3WYDA 3ZTWA 2FDCA 2ZWPA 4PSKA 1D6MA 1BW9A 5TNXA 2AF3C 2NVUB 5HQJA 4ARCA 1ZY2A 4C22A 1GKKA 1EA7A 2F48A 2ZZKA 4YYEA 1IBCA 1JJBA 1L5WA 4RTOA 2GVZC 5F1YA 3A05A 2R5FA 3SJ7A 3T9EA 1ZOIA 1BCSA 3G82C 5HG0A 3C3MA 4ZOAA 4HGNA 4B46A 2D0OB 1V2HE 3ASGA 1GITA 5C31A 2HT1A 1CVLA 4IF4A 2JAXA 3TYXA 4UBLA 5FI3A 4PZEA 4YREA 3W5HA 5I5EA 1KJ8A 3E23A 1MFZA 5CT8A 3PEUA 5G3ZA 4RVHA 4M87A 3TTXA 1A82A 1LPAB 3CX4A 1NFRA 2VLIA 1T5LA 3NWPA 4KO4S 5EQJB 3ZHBA 2DTXA 4X90A 4ALLA 1PD1A 4J3NA 1VJCA 1Z38A 2MMGA 4M89A 5DB4A 5EJ5A 3K6RA 3TLAA 1PT7A 4DI3A 3LRXA 2JHAA 1SBHA 2POQX 2X58A 3OCYA 3PQ4A 4G6ZA 4WBSA 3TL3A 1U1GA 3EUAA 3KQUA 4RCZA 5CH3A 3SCZA 5JZBA 4HCJA 1O1RA 1FFYA 4Z1MD 1FFHA 2Q1XA 4DBZA 2G1AA 4DK5A 5AKGA 3T5BA 2IOQA 2C31A 4WNYA 3FPSA 4XM1A 5TMEA 4KE9A 1A4UA 1BWQA 3E48A 1AB6A 3VO1A 3ZHUA 3THXB 1H5QA 1DOZA 3QF7A 4LECA 1VJTA 3CX7A 1OAAA 3GWZA 1ZIYA 4ARZB 2I03A 3PHLA 4G5FA 2XUPA 2IWHA 2DH5A 4DFDA 1EP3B 3W05A 5KC9A 5LL6P 3AKEA 1R6XA 2YR0A 2GHTA 3GGPA 5DHPA 3BICA 3WBJA 4LYGA 2IBMA 1FE8A 2ZR8A 4XVUA 2EATA 3T3HA 2V7QA 3QGMA 3WLKX 1XRSB 4QGGA 4M86A 3F9IA 3VX3A 2UU9B 4U7PB 3BB1A 3GF4A 4WKNA 4HVTA 3MRXA 3V1KA 2OOEA 3GGOA 1T2NA 3AYZB 4NYIQ 1T8UA 2BELA 3W7AA 4E13A 4EJFA 2F43B 4CKWB 1A7KA 3B1KA 4QYTA 1U6JA 3DLIA 3QLEA 1ICEA 4O0MA 4JC8A 5TQVA 5C7LO 2CSUA 1YB7A 3CLTC 5CIWA 1DHTA 3JCKC 1L4NA 3QLJA 5FEMA 5G0UA 3R5JA 3KLNA 3W8EA 1APBA 1H0SA 2W22A 2QN8A 5IRCD 2F8YA 1ZH0A 1D9ZA 1U0TA 1WJGA 4KGVA 1JKFA 1GPYA 3EGCA 1ONSA 3JQFA 3EH2A 2GSDA 1P2UA 3L9WA 3R77A 5G02A 1RQRA 1NXVA 4BKRA 1ADGA 2Z8YA 1E8ZA 1T0HB 1XD9A 5IAGA 2IOFK 1PHRA 5K0FA 4TXLA 3LXMA 4J7WA 3NHFA 1G6HA 2GXUA 4EZLA 2FSPA 2H1LA 4TKVB 3RYHA 1GTG1 3UI2A 1P1KA 4RE6A 4X92A 4YRRA 4EFLA 2E3JA 5M5BA 1M75A 3OIFA 3ZVVA 1DUSA 2H1SA 3I04M 4V03A 4C6TB 1DOAA 3ZGLA 4DLUA 2HWYA 3RYIA 1ZOPA 5J4HA 4B2IA 4AY6A 2XI4A 2RI0A 4FOTA 4BNZA 2G8NA 5LUAA 4UAJA 2NT3A 3FN4A 1U2PA 2JJ1A 4E09A 4E94A 1X92A 4QG3A 5EA2A 2AVNA 1ZNXA 2F3PA 3CR3A 1AXRA 1N2BA 3DT8A 1KYXA 2YJGA 3B2NA 3HCNA 4O1PA 1G9SA 4IIJF 2QVLA 3HSSA 4U39A 1NVUQ 1Y4DE 2FMFA 2PSDA 3TWSA 4B40A 2REXB 3DLPX 3JRWA 1NONA 4G1CA 2IHBA 2XVXA 1N3LA 4KYTA 2HHLA 1PL0A 2WZQA 4QU8A 3WLMA 1YJQA 3BXGA 3CG0A 5E95A 4HFJA 5JVDB 4FR2A 1NBEA 2X5JO 2IYAA 5FL7A 4PX2A 3CNEA 3GNLA 3UX4A 1XEWX 3OU6A 3QB2A 2PGJA 1O5IA 3KKKA 4V0MA 3TQOA 1F5NA 5AARA 1HURA 4LDNA 3H11A 1A1VA 3TW6A 1KYYA 5ICEA 3C24A 2VP9A 4WJKB 1PEDA 1W1IA 2EFJA 4LVNA 2IU4A 2ZYRA 3CUEF 1T36A 1DDOA 3GJYA 5LQAA 4WKBA 4UQLA 3SFXA 1ECJA 1FFDA 2H65A 2Q5FA 1EFPA 3VAZA 4WE3A 2P9UG 1EVQA 3ZBQA 4KDFA 3H2BA 5IZ4A 4IIHA 4A8TA 2H5EA 5IVKA 3MGBA 1RYFA 3E4BA 4A1FA 3L6AA 3CHYA 1J49A 3H11B 4DSNA 2Q2VA 3IIJA 3BGWA 2G06A 3AERB 2XT6A 1YBHA 3HWRA 1YDMA 3H4VA 3HDXA 2VT2A 1I6WA 3F1KA 3IBYA 3IERA 4XXHA 4AL4A 4BFLA 5CVUA 2FYTA 3DFIA 4JL8A 1R4MB 5KTPA 1UPAA 1D2MA 4IAOA 4B0PA 5F2KA 3GH3A 3JAMA 1ECLA 4JJFA 4IYRA 2WM8A 1CUUA 2ZETA 3B6EA 1UBEA 4LF6B 1H2FA 3LLVA 1P8AA 4U8VD 3MRTA 4MRSA 4UATA 3PUHA 5LP6B 4ILEA 3EXG1 2PRYA 1IUOA 1JJIA 4A5SA 4TSFD 1Z34A 2VDWB 3EJWA 3M2TA 1OUVA 2Z43A 5I9TA 3SM3A 3TLMA 4MUNA 2IQ5A 4GZ5A 2QL5A 3FU5A 3CKMA 3QVWA 4WNIA 5DTQA 3WJ1A 1W3BA 1T9BA 3WLEA 4D0RA 1WZIA 1R12A 2J32A 4PFJA 4CN9A 1X5BA 1X0VA 1TADA 1Z0DA 3KDPA 3IEKA 4RTLA 2QBYA 2OKCA 1Z4LA 4X1YB 3BWVA 4I2VA 5K45A 4HOQA 4GKAA 1N95A 3IQHX 5COAA 2JA1A 4DNOA 2JGDA 1QRSA 3QX3A 5TX7A 5JI3E 2BDTA 2NQTA 3X3HA 1ZD8A 2CKMA 4HZIA 4RSGA 3LH5A 3QM1A 3TZCA 3VR5D 1NXQA 1NW8A 5HE9A 4BLUA 3H2YA 2GPWA 3ABZA 2IPOA 3JS5A 4D5EA 3UJCA 4GQAA 1HG0A 1KQ3A 3N2GA 2X0JA 2E48A 3KOZA 3C3DA 2CLOB 3F49S 4KDCA 5UKDA 3TINA 1SBYA 2IHYA 3O2SB 3R8CA 521PA 4ZCQA 3JWPA 4NMWA 5A5DA 3G9XA 2KMLA 4LBZA 1OJLA 1Y5MA 1W25A 2ACVA 5AW5A 1YV9A 1DQYA 2PQ2A 1SU6A 3LK7A 3HWWA 2CNWA 3NFYA 4H7JA 2GPJA 2P6MA 4NJMB 3MMSA 3RPEA 2VPIA 3HA2A 1R8SA 1EJ6A 2QLJA 1DRKA 2VO1A 1JJAA 3AOGA 2Y1LE 3L7BA 5F76A 1N78A 3ZQJA 5LQRA 4J0KA 3WS7A 5JPCA 5IT5A 4DEXA 5JNLA 5K51A 1C0LA 4PNPA 1UR5A 3NASA 3DHVA 3ESDA 3GVCA 3MILA 2GEUA 1EK6A 2A0FA 2UUBB 1XCMA 4B4KA 5KDDA 5AQAA 4AJHA 2OAQ1 1XZDA 3QKSA 1H85A 3EPPA 1L9XA 3JATB 2XMSA 1Z6YA 3RK1A 4RD1A 2ATXA 2BR5A 4CN8A 3QE2A 3KHKA 2BN4A 4CKCB 3EUFA 1UKEA 3EPHA 1JIJA 1N9KA 1QJCA 4HQOA 4B5KA 2CB9A 2HLDA 4FFLA 2O1XA 4K0KB 3MWEA 2XTMA 2JEOA 3LPLA 3I5AA 3PDJA 4KQEA 4J0HA 4W1RA 1YIOA 5EXXA 3VR6A 2V59A 3M1AA 3LPZA 4X8MA 4D0NA 4MRPA 4RY8A 3H86A 1HLGA 3ZU7B 1DAHA 1GTJ1 3FHJA 3SN6A 1KXZA 2VBCA 3RRXA 2AMFA 2D74A 4X60A 2AR7A 1XZKA 3EW9A 3HB4X 4IXMA 5EHQA 5BSMA 1GJRA 3H1PA 2IVZA 4EX6A 2B3TA 3RNOA 1AIPA 4KFCA 2ZDGA 1DCKA 1PGQA 2JGEA 3HHMA 2ZDHA 4YVOA 1LD3A 1OHHD 5A7HA 1HV8A 2J9RA 1AWCB 3KTAB 3NATA 3F8TA 4ZHQF 1KH2A 1Z4IA 1PE0A 2KE5A 3OEEA 3ULQA 2BHSA 4FNMA 2WZBA 3PQ2A 3ETGA 4JUBA 4EQZA 4Y1RA 1JI3A 2FU5C 2IZOA 1PNQA 2FWAA 3N8NA 1P4GA 2H6GA 1RHQA 4YBRA 1CE8A 5CBNA 1OBVA 4GOKA 4AZWA 5CJPA 1T2CA 4JLPA 4LMBA 2JVIA 2VQSA 4KGDA 1Z07A 4NBTA 1D07A 2C5FA 3LOQA 5IT0A 2HLNA 4KZCA 4LIPD 2Q3JA 1OWOA 1U8UA 4Y18A 2FWNA 3L7YA 2JZNA 2OMEA 5BV1A 4HBDA 2IW3A 4B33A 4KP7A 1IOWA 1CDEA 4F11A 4QOSA 4K87A 4QU5A 2O7NA 5D00A 1L3CA 2F0YA 1ULUA 3U37A 1MT3A 5JXHA 3PPYA 1MHQA 2KYRA 4ZO4A 2HFJA 4FUTA 3DCIA 3ZBPA 3GT0A 3DSVA 1P33A 1Y8RB 1I7LA 1QG6A 2R8ZA 4KE8A 3IVMA 2VSXA 3C48A 4CIYA 4A1GA 1ZGAA 2VHCA 3GN1A 3I6YA 3KTAA 3IHLA 4C0SA 1D1SA 1M67A 1ISFA 3CT4A 3F6SA 3B78A 1XLWA 1Q77A 1RQGA 5LOZA 3O7WA 4KXNA 1LV7A 2QRKA 3F6BX 1XHFA 2WMOB 2YJ5A 1V4VA 1OCRE 1YS6A 3GVPA 1NI3A 2ES4A 2W9XA 3VTZA 2CXPA 4EYOA 5KYNA 4BZXA 3ERCA 4C0BA 4OLAA 4OJTA 2WAOA 2HMWA 1SUCA 3CSSA 5EAIA 2HDWA 3TN7A 4DNQA 4DA4A 4UEJA 2NAPA 3AFNA 1E8WA 3W2GA 3EEOA 1F2UA 1MRNA 1WLYA 5K6RA 4B81A 1ZJ4A 4RMGA 3ML8A 1S9DA 2I87A 3CKLA 1T2EA 3QY9A 3SNHA 1HORA 2CXXA 4FFSA 4ZQEA 4TS1A 2EIHA 2Y68A 3T5GA 3L4SO 4CRWB 5HQ3B 5F98A 3U9WA 3VYRB 1NT2A 2BC9A 3ZHRA 3QXJA 1TTPB 3Q12A 3M6UA 4G0OA 5CTAA 3IT1A 3ZGOA 3O84A 3EZNA 2GTPA 2V6JA 2VGXA 1BPOA 2JFZA 2P6UA 2O6LA 2RK6A 1TUBA 2CL0X 3HB9A 4LVCA 2O3TA 2Q6TA 2EW1A 1GDDA 4EGFA 3AZOA 1JG3A 2C8KA 4YDQA 1NF9A 1BO6A 3LYHA 3PXAA 5BSVA 1A2OA 1Q1GA 4CL2A 3STWA 1ZN2A 3BMOB 4CL3A 2OV6A 4JGGA 3FKSD 4TUYF 1HYGA 4APFA 5BSTA 5JQGB 1E1NA 3LEWA 5EYPB 4LNUA 2NPFA 4UUAA 1VECA 1SCJA 3RAJA 2G5CA 4AG3A 3WKAA 1EFDN 1W59A 3NALA 1BA3A 2GEJA 4HQKA 4KSYA 1Y8CA 4B9EA 4R71A 3FY4A 4CG3A 3HWSA 1GCUA 3IMKA 1GPH1 3L7DA 3P94A 1OFHA 3ICWA 4ZXFA 3G0DA 4K3VA 1QIMA 3C6YA 3PF8A 4HUTA 1ZCBA 3GEBA 4BGIA 1IVYA 4G1BA 2ICAA 2BF4A 2J41A 3PXDA 4FGZA 1WMSA 4NZMA 5EYPA 5E9QA 1U11A 2X8WA 2OP1A 5LIPA 4P4GA 4Q03A 1M6NA 4R2XA 1I36A 3EHMA 5DFAA 3QP9A 1HDIA 5E75A 3NGMA 3W8NA 4AP6A 1P4HA 4ARSA 1UBJS 2Q2NA 2YIJA 4YRLA 2MYUA 3B6IA 4HNAA 1E2GA 4DARA 4LDPA 2UVQA 3DZIA 3B1VA 2K5UA 4RANA 1X77A 2YVUA 3ABLE 4JP5A 4DSAA 1IQ0A 3GDFA 3L0PA 1K8RA 1IJKA 4FD3A 4WIAA 4D0LB 5ARGA 5JEDA 2I6GA 3LFUA 4FWBA 4WAFA 3R23A 1Y9ZA 3ASFA 4NYMR 5K0TA 3ZZNA 5DHAA 4GTPA 4AX4A 4EUHA 2P35A 2IHNA 5F9FA 4MIYA 1IM2A 4XOIA 1R8YA 2FPMA 4QE3A 3CLHA 4GPMA 2ANCA 1NY5A 3M0EA 3UK1A 3QV1A 2X3UA 2H7YA 3JV7A 3U49A 4ZAXA 3P0IA 1OJ7A 1G0NA 4LF9B 1P7VA 1P77A 3HP1A 3ZCUA 4FSXA 2C5BA 2QSYA 1XU4A 1FXWF 3KQWA 5BT9A 1LS1A 1RYYA 4I2WA 1ZRMA 4U7TB 1YA4A 3SJBA 2K2WA 1FCJA 5CCDA 4ZTZB 1G66A 1QE3A 1SB8A 3GAZA 4Y2VA 4LWZA 2OR3A 4GL2A 3W1VA 1GSIA 1XF9A 3OCVA 3PU6A 1VZ3A 4GI7A 3ED1A 3RRUA 3GAAA 4DR7B 3I5PA 4OHFA 4S1OA 3MJDA 4CT4B 4F53A 1XNJA 2RAFA 3EIXA 1VL8A 4EI9A 4X7MA 1NW5A 2XQVA 2F00A 3L16A 5JFGA 1YHZA 5A9RA 4MO9A 3CQGB 2A5YB 2BPOA 3MAAC 4EB3A 1A9TA 3FGOA 4QLBA 4FNOA 8AT1A 1IONA 4PAGA 3IXMA 1P62B 3E30A 2I7TA 4Z7OB 5BN1A 3DE5X 4I1RA 5EESA 4D9HA 3LFTA 3F67A 2ZJYA 3LPMA 2AV6A 4M1WA 1W73A 1NMQA 3M9WA 4PLTA 4F6LA 1PNOA 3SF8A 3SBSA 1YS7A 4RMJA 1P4SA 1RAHA 4KDRA 1YC2A 2O2IA 2AJLI 4MYDA 4P38A 4DRYA 4Z4HA 2NLOA 4HBGA 1I3LA 4JYZA 1I14A 5BV0A 2EQ5A 5FOWA 1EFKA 5IAJA 1U1CA 4KFRA 1SW6A 4LISA 2BMVA 3OETA 3FEYA 1D3AA 3R7DA 1K08A 2YVQA 4MITA 4EPVA 4Z3OA 1THTA 3PWTA 3H99A 4FFPA 2ZK7A 4A8JB 1Z63A 2DB3A 3R9MA 2QT9A 2BGNA 2XDAA 5LCWC 3E3AA 1DC4A 2C2YA 1FX0B 2FW0A 3ESQA 1J2YA 3MJCA 3NC4A 1JP7A 3PKZA 2H0QA 4WZBE 1WKCA 4EUSA 2J0QA 4MRMB 1OC4A 5ER9A 3W0LB 2V55B 3WQHA 1XXLA 4IOJA 3ZVKA 3OT5A 2QQFA 3DNPA 1WVGA 3GI1A 1KBZA 1D6JA 2DJ5A 3K20A 2AFHB 1L5SA 2VAVA 3THWA 2JASA 1HWYA 1KJ9A 2GJ8A 4Q7LA 1JNYA 3I12A 3ESZA 4GECA 5ALQA 1NW6A 2XTZA 1HE1C 1XJQA 4BNNA 3TTTA 2Y4UA 1Q3KA 4BVFA 1D1TA 2OZPA 2VATA 3OA0A 3TAHA 4CV1A 2XCQA 3OF5A 4DXAA 4HFGA 3VJKA 4BO0A 5JO0A 1BXKA 3KEGA 1XZHA 1NR1A 2ZIVB 1CUBA 2W4MA 1ACLA 2NU8A 1L9KA 1KKMA 1Z83A 1V9SA 2QVXX 1UM9B 5FZQA 2IGBA 5LMNB 4XZ4A 3WG9A 4J0IA 3P0RA 2RCNA 3LVFO 5JS6A 3HTXA 2RH8A 1ZGCA 2WIBA 3K09A 2NNWB 3QUQA 3AL3A 4WASA 3MGAA 4FYJA 2CWWA 2VF8A 1AF7A 5E4FA 3X2EA 1AQLA 4KN9S 1AHPA 4EX7A 1Z6ZA 3MGKA 5KX5B 5A9SA 2GNPA 2OGTA 5E8RA 2EKLA 5CRIA 3MT7A 4DDMA 4O4HB 3ABRB 1VPTA 3GHHA 3H2SA 5IAOA 5AKHA 3OJWA 3TKLA 1J1IA 5IF9A 5IEBA 2C2LA 4JT2A 3DDOA 1TYEB 2R7NA 1ZM9A 1UN8A 3DA8A 5DM70 5AVTA 4GA2A 4MKGA 5ADHA 2DY1A 2VT7A 5K8VA 1IWPB 1G19A 1EJBA 2H7CA 4IX1A 3QKWA 4BLOA 3G02A 1NHWA 4ZRMA 3WLNA 1J0BA 5ILOA 4HKTA 4OJKA 5BSGA 4L5YA 2IYVA 5C35A 3FVRA 3MYRA 3FOWA 4WNCA 2C9CA 5D87A 2DE0X 3QNWA 4FFNA 3VZSA 1QP7A 1GAWA 1FC0A 1W34A 4OL9A 2I29A 2CHZA 2IL1A 2P1ZA 3FGPA 2WJVA 3I6BA 2ZI9A 5JU6A 4LTNA 1OKKD 2ZVQX 3OQJA 2SKEA 1JWAB 4AIFA 1MF7A 4FC8A 1FW8A 3E2IA 2FXVA 4R01A 2GBLC 3KZNA 4CIVA 2WFLB 5BUQA 3BQMB 1CDDA 1M2NA 4G5OA 1ELOA 1ZESA 4OQQA 2A0UA 3QOWA 3IEXA 2QRVA 3E8XA 1L4LA 1PK9A 1VBKA 4XX0A 3HUDA 5D6NA 1YAHA 3K0FB 1XZGA 2B8WA 4ID9A 1OYVA 1Z4OA 4FMCF 1T9CA 2GRAA 4B6RA 4PPQA 4EZEA 1K89A 4MW0A 3H5OA 1CS0B 3A9VA 1Y3BE 3HXOA 1TEZA 3KE8A 3Q1LA 1KE1A 4OQDA 1G2QA 5BR1A 1E2MA 1CWUA 1H0AA 1M8JA 1G4AE 2DLNA 1U7HA 2QRPA 1XCOA 3UEOA 1KZ1A 2HNKA 2XNDA 4L78A 1YKGA 3VNUA 4B7ZA 3D9LA 2JIDA 5LXTB 1GNVA 2O3QA 3AI3A 4LCJA 5CX1A 4ENRA 3HA7A 3U16A 4R05A 4KRFA 4TTPA 4UMEA 4G5HA 4EUKA 2VJMB 4NFLA 3WGMA 5L4LA 2IPMA 2XHEA 1NVEA 4QYMA 3BE6A 1BMQA 4FFVA 4R2JA 2MMCA 3G7UA 3LF2A 1ZU4A 1J90A 4L1BA 1KK0A 1T13A 3U3DA 1KY4A 3BS4A 4OHKA 3UV6A 1BEZA 3UOGA 4E1BA 1FSPA 1KI6B 2HEGA 3IV9A 5DWVA 1A72A 2GMWA 4UWKA 2GR9A 5CERB 2I2BA 2G88A 1JLKA 1UG3A 1QQTA 3EIFA 4J4TA 4KG7A 5TVGA 2ZAGA 4WBNA 2PJRA 4DILA 2DUWA 4XW2A 4WESB 1E2PA 1N3YA 2WWTA 3AT1A 3ASDA 4AMBA 1CHDA 5HF5A 3KV1A 3EVGA 2FE4A 3CB2A 3SQXA 5BO5A 3DZHA 4YUXA 3ZV7A 3WSTA 3ABSB 3ZU4A 4F3CA 2GA9A 2I0FA 5JMPA 1EVLA 3OIWA 3R75A 2NU9A 1DIRA 1GPNA 1HA3A 3FMPB 4URFA 4AP5A 1U94A 4ANFA 3GMSA 1FSGA 4JLNA 3BQ9A 5IN4A 1PBNA 1Z8FA 3R3SA 4YUAA 4AG5A 2ORYA 1HG5A 1WMFA 3A3YA 5HCNA 5I9LA 1Q3TA 1W0CA 3C1AA 2X0IA 3APDA 3P5SA 4JWKA 4R7GA 2F1KA 4UI9C 3I2IA 4DIFA 2IUEA 1DT5A 3AVOA 3DOHA 1X80B 2PJUA 1CHNA 2OO7A 3IP9A 4JL5A 2ARKA 1L8AA 2A0WA 3A7DA 3V1TC 3ENNA 2DETA 1VP9A 3KEMA 3NW9A 5PNTA 3U7QB 3KAJA 1N2CB 3EAFA 1ZXLA 2F90A 1HXIA 3ETJA 4PVDA 2N46A 4R0NA 2XSZD 2Q5CA 3NNDA 1HE8B 4BVJA 3OM1A 4G0MA 3A1CA 4L8YA 1P1RA 3TWVA 1FFAA 1ZW1A 3C41J 4UWFA 3OE5A 1Y6RA 2ZYVX 3ND9A 3AC0A 2YJ6A 4YO7A 4DZTA 4WV3A 4G1VA 5A6SA 7REQA 1MIOB 1MH9A 1IUNA 2F17A 2QGNA 3G6WA 4CGZA 4IOKA 1C3OB 1LC0A 5ESRA 3UXEA 4B7AA 3CQCB 4DA9A 3CNLA 1RBZA 2FSFA 3EIHA 3L6RA 4CM3A 4PS8A 1M34B 1QH8B 5BQPA 2C2XA 4D44A 5DBKA 1AK1A 2I65A 1EQAA 2Q6KA 2IU1A 2ZTMA 3D1LA 2DYRE 3KZKA 3OE4A 1LSOA 4OKNA 5LC1A 5CEAA 4Z1OA 5ICSA 1JYEA 4P4LA 3MSXA 2R1VA 3VR4A 4IIJB 3R4VA 5EE5B 3ROPA 3BQOA 1CY2A 1X7XB 3DNMA 1XHLA 1C29B 4IDOA 4RF2A 4DG5A 3IT3A 4E5UA 1ISMA 2QW1A 1UAAA 3I1IA 2RGAA 5JISA 1FLAA 3GEGA 4YAIA 4UDXX 1F51E 3DTNA 2BGLA 3QPCA 4WLUA 1CUYA 1MC5A 2NSZA 1KBQA 2AI2A 2FV8A 2I1WA 3KYDA 3TXNA 3L07A 5FJJA 4MGKR 3SDBA 4YCCA 3WA7A 1QCCA 4CMJA 3MJ4A 2EJUA 3JZMA 1QP8A 1UJ5A 3A3NA 3L9XA 2YN2A 3QWAA 2VNHA 3FZYA 4J8FA 2F67A 3SPXA 2BMAA 4F7DA 1GR0A 3LQYA 4D9FA 3QJGA 2EP7A 2DPMA 3ZE2B 3LUGA 2X40A 3MRVA 1V45E 1K9SA 1CT9A 4HOUA 1ZSYA 1GOTA 4BP1A 2R0QC 2BKKB 4F3NA 3T35A 2VYFA 5HP4A 1H2RS 2COEA 5CA0F 4NZOA 1RWVA 3AUXA 5DBOA 3PFKA 1CUCA 5FL3A 1YQTA 3LPDA 4S1VA 5K20A 5B6PA 4IIVA 1W76A 1DRWA 4LPSA 4NEGA 4JIMA 3T3EA 1EUDB 3W5VA 1ZQ1A 1LPNA 3TG4A 1QYDA 1Q15A 3IO5A 4JCOA 4QIHA 4DA6A 4BPBA 3D9QX 2P9LG 2I7VA 4OI4A 3RROA 3SZOA 1XQ9A 3HV0A 1XNQB 3LE8A 3NHSA 1L1RA 4QARA 2GN0A 1Z15A 2YBEA 4N0PA 3ZHCA 3MC1A 3TQIA 4Q7JB 1OILA 4JOQA 2CHXA 2QJOA 3TZLA 4KXQA 3G8BA 4B7CA 2H18A 3ZDRA 3ZGVA 3T4PA 1TRKA 2R3SA 3IQIX 4P35A 4GOXA 4OGKA 4CNBA 2F43A 4WOPA 2ZGDA 1C0KA 2NYUA 3TD2A 1J00A 2GBFA 4UD2A 3GJ8A 1JG4A 4MV5A 3F9RA 3AWDA 5JIBA 1G8JA 3QLUC 1T6XA 1J06A 4JEIA 4MDYA 4R51A 4RHYA 3UUWA 3COWA 1PHPA 3PXXA 2WUFA 2CK3A 1BYUA 5MN5A 4CLRA 1ZXBA 2ALJA 2SICE 3DVQX 3I09A 2VP0A 3K1YA 4OLBA 5K0CA 3QY0A 3ESKA 1IXSB 2QRZA 5DTRA 4YV2A 1H3FA 4MKZA 5EKTA 3P20A 3C6BA 3N2YA 1VPEA 2ZLBA 5FDFA 4L5BA 3RYHB 4TKVA 1CUXA 1DV1A 1G6OA 3F7NA 2RK4A 1XEXA 4I55F 1PQUA 4OJNA 4MHSA 3WGOA 1EUQA 2D1FA 3GC6A 1NULA 4MUBA 4NBUA 4RLYA 2GJAA 1OF1A 3QKIA 2GF9A 5INTA 1QE0A 4D1YA 5BR8B 1QH0A 1XTPA 3GPIA 4B3IA 1EDZA 3O4JA 1RRGA 2V5QC 1WDTA 2IWRA 4DCPA 3VV3A 2H2IA 3ZIAA 1R00A 4YJFB 3OECA 1GPUA 2CCGA 4GWGA 3TJZA 3UMVA 5IKMA 4FYWA 421PA 5KMGA 2H6FA 3RYCA 2F3RA 1SWVA 4WKGA 3UT5B 1Z0ZA 3S55A 4DR4B 6REQA 1QRUA 4BY9E 4KKXB 2WYWA 2H2DA 2VA8A 2RSLA 1QCYA 2GAIA 4PFKA 4A6XA 4OBXA 3CK9A 3FFLA 1RKVA 4PZAA 3TQTA 2COUA 1TB4A 5JCOA 3TEMA 3VR5H 2WPDD 3COSA 3ASOE 1F8UA 1Q7EA 4FBMA 5CPFA 3GJRA 4DANA 1RVV1 4LOIA 2R79A 2YC4C 5JS7A 5DI3A 3FP3A 3ZWAA 5EQFA 1MVOA 2ZRIA 4Y6SA 1O6BA 5IHPA 1I4DD 2AQIA 2YW2A 1NIPA 3H2IA 2JD0A 1UZMA 1SVMA 3TSOA 2UY1B 2NO6A 4EA6A 2EYQA 3HM9A 1RFLA 4G24A 1TW2A 4TN1A 4U2KA 3X1ZA 3WLHA 1USKA 4DIMA 2P9KG 2C4WA 3DE1X 4U9UA 4GXQA 3ZVMA 5MN6A 3A4MA 1FXWA 1GG2A 3RVLA 1I7NA 4GI5A 3OH8A 2P2ZA 1O6CA 3EIUA 4NBNA 4DI4A 1I3NA 1RCTE 2GD6A 2QD2A 3TW4A 5B12A 4FW9A 3MVEA 3PREA 2PA3A 4LJAA 2A4MA 1KAEA 3KJNA 4C0KA 4CXMA 4YHBA 4EO4A 5JR3A 3K05A 2O8CB 2L0TB 4S35A 5FADA 3JQAA 3CLRD 3GVHA 4N49A 1NUQA 1XZMA 5FPKA 1LW7A 5DYGA 4V0KA 1YK0A 4X93A 1NI4B 1L5KA 1OT5A 2R6DA 4UEWA 2DTDA 1BC5A 4KB5A 1NX6A 2ZRPA 2RGDA 4L57A 3V4OA 3KSDO 4C6RA 4MS4B 1H0RA 3V9AA 1T4CB 2XIJA 4MV0A 5BW8C 3PJDA 721PA 2J9XB 4NDNE 5DN9A 1JKXA 1Z6AA 2FW6A 3N6VA 1PSWA 4BNXA 1CYDA 5LBIA 3OESA 1ZUIA 3UIEA 4P84A 1KJJA 1AV7A 4PY2A 4XGKA 2BHNA 4WAUA 2DXIA 2O9JA 1ULTA 5AKKA 2QE7A 1TU3A 2GCIA 1OE0A 1P0QA 3CLTD 3H97A 1Y6FA 4LUNU 4PG6A 3HVKA 4M0CA 3UIPC 4KO1S 4LEUA 2FPGB 2AJAA 4KRYA 1E1CB 1YC5A 3H9GA 2DFNA 1R8XA 3D3NA 4IDNA 3U5ZB 1R50A 4IL5A 2CD7A 4B83A 4ZI2A 1M1YE 4YI5A 4S12A 4W8GA 1AHNA 2FPUA 4HNUA 1K9VF 4FJ2A 3G2IA 3KTDA 4BB9A