2XGMA

Substrate and product analogues as human o-glcnac transferase inhibitors.
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
512
structure length
512
Chain Sequence
PEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 190
structure length 512
sequence length 512
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgmA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgmA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgmA02
3SYMA 4HOTA 5GPBA 4XI0A 1B4DA 2Y4UA 4GA0A 4BQEA 5FZQA 4XIFA 4RIEA 1JIUA 3RSZA 4BWRA 2XMPA 8GPBA 2XCUA 4M7PA 1UQUA 5DXFA 4MI9A 3MS2A 1A17A 5JTUA 2HO1A 3EDTB 1P4HA 3ZCUA 4G25A 2X0EA 3ZCSA 3MBOA 2HYZA 4J8FA 4N39A 1B89A 5DU2A 5EX0A 4UQYA 3BCSA 4N9WA 4AM9A 3OKAA 3SZ7A 1XV5A 3E3NA 2IEGA 2QFCA 2ACWA 3BDAA 3UQ3A 1HLFA 3MKRA 4RG6A 4NC9A 2Q7FA 3MQFA 2BGTA 1JIXA 3PDNA 4PQGA 4MHOA 4BT9A 1P5QA 3G2IA 1PN3A 2R5SA 2FBNA 2C4MA 1XOIA 4RBNA 5FT9A 3FFLA 3MA5A 1QZ2A 1GGNA 5HXAA 3IA7A 4WHMA 1UZUA 3ZGQA 2FETA 2R60A 3CVLA 1J39A 1QM5A 2QNBA 1PYGA 1F0KA 3O3CA 5D0OD 1KT1A 2PRJA 5HQ8A 2QN9A 3CV3A 1O6CA 2XCIA 3BD8A 1GPBA 1SXPA 1HH8A 4BTAA 3IEGA 4W9RA 1Z62A 5TVGA 7GPBA 2QN8A 3VUFA 2IYFA 3ULQA 5KJMA 3Q5MA 5EKQD 3MRTA 3CX4A 4CTMA 4HORA 4YVQC 4EL5A 2IV3A 3C4QA 4RIGA 4H7XA 3NC4A 4AMGA 2VYIA 2XA1A 3RHZA 4J8EA 2ZB2A 2GPAA 3S2UA 2PQRA 4EKYA 4N3AA 2JZCA 2KC7A 4RIIA 2VCEA 4F9FA 2QLNA 1WAO1 2YJNA 3ZCTA 1LWNA 4X6LA 2X0DA 3ZCQA 4Y6CA 3OTHA 2KATA 4BT8A 4CTNA 5BT1A 1FU8A 2I6HA 3DD1A 1OUVA 3OXLA 2R4TA 4IN3B 1JIVA 1FA9A 2C0MA 1KLXA 1JG7A 2X0FA 3CEQA 3CEJA 3RO2A 2KCVA 2SKEA 2LSUA 4KQ2A 1XL0A 3L7AA 1XL1A 2QZSA 2F3QA 1EXVA 4I9CA 5JJ6A 3ZHEB 2AMVA 2UWJG 3G2LA 1NZNA 2UY1B 4QLBA 1PNVA 3D1JA 3BEOA 3MRVA 3AS8A 2IFUA 4REMA 2DBAA 1E96B 2QRQA 3BEEA 3ASHA 2VGXA 5LQDA 5LCWC 4EQFA 1W3BA 4JHRA 4GYOA 5G04C 5ARGA 3TSAA 4GCOA 1K06A 1UQTA 1A8IA 4G26A 4N3CA 4X7MA 1ZU2A 4UI9K 3ZFWA 1FU7A 4NEQA 3Q3EA 3CVPA 2QRGA 2UY1A 2VSNA 3CKBA 3Q3HA 3T3IA 3T3HA 2R68A 2IUYA 2NC9A 3HYMB 2BISA 3S7JA 4CGVA 5CCLA 3QWPA 2FF5A 3QWWA 3K9IA 4ME2A 3UUXA 2R66A 3TG5A 3MTAA 3ZPJA 5JJTA 3MSCA 2PQNA 3VTYA 4WNEA 1Z6PA 3MT9A 3DZCA 3E3LA 3CK9A 4UI9C 3MS4A 2C9ZA 1L7XA 1PSWA 4I2ZA 4N2QA 1P2GA 4YVOA 3MTBA 3QWVA 2OFFA 3D0RA 5TMEA 3S27A 3MEKA 1HZ4A 2SKDA 2V5FA 4GZ3A 1L5WA 2QLLA 4LEIA 3VTXA 1NOJA 2F3SA 3GUHA 4F3VA 1WW3A 2GW1A 5ARFA 3TOVA 3OXGA 4U0SA 3MTDA 3TGOA 1IYGA 1YA6A 2G9UA 2X6QA 3ZCPA 5G05J 3C48A 1C8KA 4F97A 3KD7A 1IIRA 1Y6FA 3ZCRA 4CGWA 4FZRA 4KBQA 2F9FA 1BX3A 2XGOA 1Y8MA 3WADA 3CK7A 1JEJA 2C2LA 3OT5A 2WTXA 4WADA 1IXYA 3OY2A 2BFWA 3G2HA 5AYWD 1IHGA 2XCBA 4BQFA 4Z5XA 2WPVA 1FC0A 1YA0A 5EX3A 3OTGA 2QN3A 3S7FA 2SKCA 3KS2A 3HBFA 3E4BA 4NRHB 1QQEA 3RSCA 3T5TA 5BNWA 3MV3B 3TAXA 1AHPA 3S0JA 5ENZA 2LSVA 2Q6VA 4LEUA 4EL0A 2PYDA 4GZ5A 2YHCA 4U0ZA 1P2BA 3AS4A 4RELA 3OKPA 4AMBA 1Z6QA 2GPNA 5HI7A 3OKCA 2J9QA 4CTOA 3UPVA 1H5UA 3CUVA 4G1TA 2PYIA 2QN1A 3NAZA 3LPZA 4N5CA 3U3WA 1NVKA 5I45A 1P2DA 1L5SA 3L01A 1SXQA 2H1HA 3FWVA 4B94A 1GPAA 2VG8A 5DBKA 3C4VA 3O48A 1XC7A 2C1XA 2C1ZA 3COPA 3HBMA 5DIZA 3ASFA 2G9VA 1ZBPA 3QDNA 3VDMA 2R4UA 3BD7A 3PE3A 1RRVA 4J8DA 3WXXA 4KXKB 4NQ0A 2AZDA 3PE4A 1K08A 2GEJA 1L5QA 3ASGA 4X7RA 2IW1A 2IYAA 1NOKA 3NCHA 2KCLA 2GM9A 3KAEA 1LWOA 2ATIA 2VGXB 1WM5A 4BQIA 2ONDA 4L22A 1P4JA 3UYKA 1KTIA 3SYRA 2OOEA 5A7DB 4BTBA 2FF4A 1Z8DA 2GEKA 1L5RA 3ZCVA 5FZRA 3Q47B 3L79A 3NP9A 4YI5A 3AMVA 2GPBA 1FCHA 3IAAA 2F3UA 1E1YA 4F96A 2PZIA 4X7PA 3TG4A 1RZUA 4FKZA 2IF4A 2XGMA 4J0UA 3L7CA 3NPAA 3Q3IA 3NB0A 1YGPA 4GZ6A 4MRAA 4I1AA 1HXIA 3T3EA 1C3JA 3L7DA 3WC4A 1WV1A 5TMDA 5KJKA 2PQ6A 3QOUA 2VGYA 3UYLA 1TJCA 5KJNA 4JA7A 3BD6A 3MS7A 1L5VA 3CVNA 4LDPA 1NOIA 3MV2B 1WUTA 4AY6A 2IEIA 4MI6A 2XGSA 3RT1A 4N3BA 3RO3A 3CUTA 1FU4A 2AW3A 1JG6A 2ASVA 3U4TA 4UQXA 3H4IA 4U0UA 4RIFA 1ELRA 1P4GA 3S28A 2PRIA 2HR2A 5D0QD 3VDNB 3LCAA 2C0LA 3CVQA 4GA1A 4ABNA 3G2JA 9GPBA 2X6RA 5D01A 3Q15A 4EKEA 3S7BA 2F3PA 4W6QA 2O6LA 2HY7A 1C8LA 3MRXA 1V4VA 3NP7A 3RKVA 3CUYA 4BFCA 1GFZA 3CKCA 4HWGA 4KQMA 5FZSA 3CV0A 2AV6A 4G23A 1ELWA 3FP3A 2IV7A 4YNDA 2QN7A 2H1FA 1F6DA 5KJLA 3CK8A 3SF4A 3T7DA 3T3DA 5G05C 1P29A 3CUUA 1WV0A 1AXRA 4G24A 3BCRA 3MT8A 2QRHA 2L6JA 1GZ5A 2P58C 4JA9A 1WW2A 1KT0A 3RIBA 4HLNA 5A6CA 3S29A 2E2EA 1GPYA 1FTQA 2ACVA 4RENA 5CCMA 2PL2A 1FTYA 3FROA 4GA2A 3GYZA 3GZ1A 5IKPA 3HBJA 1NA0A 2BUGA 4JL0A 2QN2A 4RIHA 4I17A 1PC2A 3DDWA 4I2WA 5BW8C 2ECPA 4GPBA 2G9QA 2AVPA 2FEZA 2JLBA 4WNGA 4EJ2A 4APOA 1C50A 3NF1A 5CHEE 2VQ2A 3ESKA 4O6FA 3E3OA 1L6IA 2BGUA 2QRMA 3QKYA 2QRPA 2XA2A 4KYOB 3ASDA 3JYSA 2XA9A 4MICA 6GPBA 4CDRA 2GT1A 3GW4A 2G9RA 1VGVA 3CEMA 4M83A 3N71A 4GPKA 3VUEA 4Y6WA 3AS5A 4NESA 1NA3A 3CUWA 1WUYA 2JJMA 4G2VA 3BCUA 4A1SA 5IKOA 1NZDA 2MHKA 3EBOA 3OTIA 2VSYA 4WACA 1Y6GA 3H4TA 1M5RA 4WNDA 3DDSA 1XKXA 1NZFA 3EBPA 3S7DA 3QHPA 2QLMA 4M60A 3OY7A 3GZ2A 1GG8A 2FO7A 2VCHA 1FTWA 3GPBA 4GYYA 4YUAA 4XI9A 3R9AB 4GYWA 3RU0A 3OXFA 4U07A 4WUYA 2KCKA 4UQZA 1FS4A 1Y8ZA 3L7BA 3LYAA 2GJ4A 2KS6A 2XCCA 4HOQA 1E4OA 3D0QA 4U04A 5D00A 4MHSA 1ABBA 4G2TA 4HOUA 2P6PA 5LCWJ 4AN4A 2LNIA 5M72A 3T3GA 1XNFA 4N2SA 5G04J 3MT7A 5JJ7A 4RG9A 2YQ8A 4H7YA 5DLDA 3QKWA 4HOSA 5FJYA 4I9EA 3URZA 3G2NA 3LY9A 3ZN3A 4AIFA 2XEVA 4KQ1A 4WNFA 3LY8A 3LKUA 2Y4TA 2XPIA 3LY7A 2WQHA 1QKJA 3G2KA 2FI7A 3Q49B 3ZHEA 1RZVA 1EM6A 4GCNA 4MI3A 3Q4AB 5JTTA 1NLMA 2FFRA 5TMBA 3WAGA 4UI9J 4AY5A 5C1DA 4YI3A 3HBNA 3CEHA 5FTPA 3RJVA
chains in the Genus database with same CATH superfamily
3AI3A 3KCNA 1GOTA 3RAUA 3ZQKA 4LOAA 1DC3A 5JH7A 2MMGA 1H2ZA 4QXAA 2GK6A 3RAPR 4YGXB 3GJ0A 4YGYA 4LZPA 4HI0E 4L6IA 3K9BA 2RHLA 1YR8A 1JIXA 1RBQA 1HYEA 3JARB 3UG7A 1QZ2A 2BMEA 2YMLA 3NJ4A 3WIOA 2ZPUA 1RZRA 3DKVA 2BL4A 4TYQA 5KYUA 3S40A 3GZSA 3W6UA 3VUFA 2CEKA 3PJEA 1XXHB 2DERA 4X8MA 2ORVA 2VBIA 3B6MA 4EZIA 1MIHA 1JSCA 1UC9A 3IOYA 5BSHA 1G59A 4MDHA 1VECA 3HM2A 4V1CB 3PF9A 1TC1A 3D0KA 1K3FA 3KKMA 3AEUB 2X4GA 4RTPA 1CUZA 1NVBA 1BG6A 2WD7B 3F8SA 4AY2A 1WSBA 4BXOB 2PS3A 3LJKA 2W2NA 2GJ8A 4ZAGA 1P2UA 1A76A 5C1PA 1E3JA 2YUIA 3TSAA 2VAPA 1FDUA 1M73E 2EYQA 4PLPA 2HXSA 3FCYA 3Q3HA 2FQYA 4ND3A 2FQXA 2A5FA 3HYMB 3CG4A 4O63O 2HIAA 3KQNA 1M72A 4GNRA 3EVTA 3LS8A 3AG6A 3ZKWB 3A1FA 3KEQA 4RY0A 1PBTA 2F3SA 1XFAA 3G2MA 5CCBA 3SC2B 3HNOA 2VZEA 3F7NA 1JDBC 2BEVB 2YL2A 2D7DA 1AH2A 3OY2A 3TWTA 3CW2A 1YKGA 1PJLA 3SLGA 3SZRA 3HBAA 3RSCA 4ZDIA 4B87A 4BV3A 2YRFA 4GI5A 1NYTA 4EF4A 1NKTA 2JI6A 1W8IA 4F2GA 3NAZA 3KDPA 1T2AA 1OBHA 4AO7A 3EVGA 5ESDA 1T2DA 5BWMA 4IEFB 4D4KA 4OV6B 3IR5A 3HWX1 3PE3A 1JYFA 3VR2D 4LMAA 3SQDA 4JKIA 4MWCA 3UPTA 2B0CA 3A3OA 4IXMA 3FVTA 2RH8A 2Z2XA 1NN3A 4Z9AA 4EELA 2VWQA 1J5XA 3TL2A 3K9QO 5B36A 2A5UA 5ESWA 1NJ2A 4HEJA 1AV6A 3HXDA 1KIAA 1QF6A 1CUXA 4IF4A 3EU9A 1KZ6A 2HWXA 1EFLA 2EOAA 4B75A 3UMJA 2H4XA 1ADFA 2EKBA 2JAQA 2NO9A 1DGQA 2VJQA 4IV5A 2CG3A 4YDQA 2GJKA 3GLIB 4BLVA 4YO8A 3JVEA 4PZPA 2VHWA 3RTEA 2FYTA 2OO5C 1PQYA 1P9NA 3IXLA 4BTVA 2UXBB 2I3AA 5JSZB 1E6UA 1IL0A 2PKQP 2BM9A 6Q21A 2BR4A 4KDFA 4GTTA 4BTEA 2HU5A 2WYUA 1KI1A 2BM1A 1RWOA 1U2QA 4CIYA 3VR6D 3DRAA 3T5BA 3C74A 3OJEA 5EILA 2YV4A 3OLYA 3KLOA 1TYZA 2AD1A 3O8DA 4HVTA 4ZJPA 1WXEA 4U7WA 4LS3A 4R01A 2PUEA 4IMPA 5EMNA 4ZCLA 3C5EA 4URHA 3E22A 5TGTA 5MGNA 5JASA 1QOQB 3DBLB 1ZS9A 5T4YA 5CDSA 3LT0A 1JAIA 5BSWA 3WBFA 4BQOA 4FOLA 4R1UA 2W2OA 4WZAA 1AUXA 5C7OO 4RADA 4K9QA 3AIIA 1VMAA 2FZ5A 3I0NA 4LNHA 1II8B 5DW0A 4YUZA 1S01A 2AZXA 5D3QA 2OZLB 2X19A 4G2NA 4NENB 4IDHA 3B3FA 2XPIA 4EY5A 1QKJA 1U6KA 1FPMA 4UUPA 3MCWA 4C0MA 3VZCA 2QJTA 4CBVA 3HU2A 5CM2Z 4XA8A 4QICA 2A94A 4TV8B 1KDTA 4E6HA 1A17A 9ATCA 5JTUA 4WKPA 1TIBA 3IP7A 3KALA 5G1OA 3BRCA 1SKQA 3K0CA 3WRXC 2FRVA 2WLSA 1N6IA 4V03A 4PICA 2EV9A 1D9XA 3JRNA 3GG2A 2VJMB 2MCFA 2WTEA 4P5DA 4WK0B 2JKZA 3CLRC 2AOVA 3CSUA 5C4IA 2FEKA 1A71A 4DRXA 2RG8A 1I2MA 3FKJA 2AUTA 1IY8A 3VSCA 5IWCA 1TZ2A 3FSGA 4N5IX 2IOSA 4V3CA 1U0SY 1E1CB 1R6BX 4AOFA 4OM7A 4V39A 4I50B 3I53A 4EZEA 1A4UA 2ZIUB 4I1MA 2AYZA 3PQCA 4DCSA 3OJLA 3IPLA 3K5IA 4CI9A 2A9VA 3BM5A 1PDOA 5KU7A 5A71A 3AF3A 4IZ6A 3GJSA 3UO8B 1BXGA 2CJYA 1CB0A 3OZUA 2R4QA 3SI5A 4E0BA 1ZWLA 2YBEA 2AOUA 4XWTA 3UJ9A 3ZOZA 3HXKA 1RP1A 1V16B 5CCEA 1DZ3A 4XZ3A 1QYVA 2QRVA 2HZBA 3I9JA 3DPYA 2ECFA 4GMKA 1NBWB 2C9ZA 4CM5A 3FA2A 5FUXA 4R41A 1L7NA 1XRLA 1SEPA 2IYPA 1G3RA 3RYHA 5DSTA 3T8KA 2JFOA 5P21A 3QFSA 3RRYA 3CR8A 3UT4A 2Y4NA 2EL9A 2LP4Y 3TQIA 4Q3KA 1W85A 3HU5A 3TZLA 3JYPA 5DK6A 4EG4A 4OHBA 4DX6D 3OKCA 4HN4B 2H92A 5DM0A 2YWJA 5ARBA 3WL8A 1URPA 4JT8A 1UK8A 1L5SA 3VYTB 3ANYB 3OQPA 1OB2A 1TT5B 4KXKB 2WA2A 1BGWA 1ZSNA 3AG2E 1RAAA 3IVCA 4RYLA 5IJ0A 2HCJB 1N0WA 4F85A 4RO0A 3ZXIA 3ZDYB 4FHFA 1YRHA 5FPYA 2YFHA 5AVQA 1LEHA 4XASA 3OJ0A 1HPLA 4N0MA 4Q4JB 4OH7A 3ZEIA 4JR2A 4EEZA 2DT8A 4CWAA 1FVHA 1AQNA 3PT9A 1FFAA 1B3RA 3M6IA 4ZEXA 2I4NA 2XWBF 5C7IO 3FKSD 3MS7A 3W2TA 1P9OA 5EJEA 5AW8A 1OLXB 5FPQA 2Q7DA 3DBVO 3T95A 1C3LA 4ARVA 2M6SA 4HZUA 2JIZA 2I22A 3RS9A 2ZCVA 5LXTA 3F5DA 2YASA 4UVDA 1U5AA 4HDNB 1CJMA 5FP0A 1KFEB 1LV8A 5G05C 3O47A 4OHFA 2ZJFA 1ZCBA 2WXFA 1BDIA 3WWZA 2XUPA 5AP9A 3ROGA 1RXYA 5EN4A 2AFIA 4FHKA 3H1FA 1D1SA 3G6WA 1BO6A 2VA8A 4PNEA 3FHCB 1PC2A 1ZJWA 1WCXA 2FMIA 3Q9NC 5BR7A 3BULA 1JXOA 4MIYA 1XMSA 4FWIB 2DPMA 4ZMRA 1M8GA 3P9ZA 2PZLA 4PUCA 5KSOA 4NOJA 4XX0A 4DEXA 2M6RA 4JITA 1LLQA 5HJ7A 3U09A 5KX5B 1WUYA 5DISB 3QVGA 1TCVA 4B44A 1QGYA 3P0FA 1TU3A 3SFVA 5LR6A 3D02A 1OU0A 3ZU2A 5BN1A 1H6PA 2NVUA 1OH6A 4K8RB 4NK5A 4ARSA 3L7BA 4R8VA 1JEYB 1ABBA 2XCRB 2COKA 1SA4A 3N76A 1VE1A 2BFBB 1WPXA 3L40A 3ULYA 1E0KA 4QIHA 3KU1A 4QUJA 3QGMA 4B35A 4XQEA 1JHZA 1YAJA 3D43A 3QUTA 1DQPA 2QUIA 2DQ4A 2XZOA 2BBSA 2A2ZA 3FWHA 4BKPA 2Y1OA 3MJWA 2IE0A 3M5DA 1YSCA 3K2IA 4DNOA 1CSEE 3V46A 4FJ0A 4TUUA 1EEHA 3E34A 2OSVA 1S7CA 2P40A 4UTVA 4BIIA 4CF3A 3Q79A 2G83A 2PG3A 2AMLA 5J9FA 3MTQA 4QA9A 1CDEA 3WSTA 1I2CA 4BMNA 4YLGA 2PLRA 1M9NA 4LYHA 2KI5A 4HVBA 2XOXA 3TMYA 4R83A 1TD1A 2EJVA 2RK3A 1DCTA 6REQA 3R9XB 3RC1A 1PFYA 3HLTA 4FR0A 1KZPA 1BXRA 5CGZA 1V2HE 1ZC3A 5E7JA 2XQVA 4YRMA 5CEEA 1CUBA 2P9BA 5DN9A 2PUGA 2VHEA 2X0FA 1KEUA 5DXAA 1FW8A 5BSFA 1SB8A 1WF3A 4X8HA 3ZPXA 4HL6A 3FTYA 2J0SA 4L27A 3E27A 2R96A 5KNDD 2H7XA 1L2TA 1U8AA 1M5TA 3OCVA 3VR5D 2VWGA 4F4IA 4LW8A 1EH5A 4RK1A 4BSXA 3THOA 2I1LA 2IDZA 1Q3TA 4TYYA 5CFOA 4Q4LA 3VTAA 4QBGB 1PW5A 1I2AA 3A1EA 2ILRA 3ML9A 4UU7A 4U3JB 2PMEA 4QEDA 2WSMA 3T35A 2DHEA 3TIGA 3ZJ4A 2I7CA 2Y1CA 3I4LA 1N5LA 4WXYB 4OXQA 5CXXA 3BX1A 1M67A 1DMSA 4UEWA 1E7UA 2Q5FA 4DWWA 2FPUA 3HCEA 1WG8A 4GNKA 3OETA 4C14A 2PL9A 1E0JA 3JYQA 1X1DA 4QFBA 1D1TA 3FTNA 1H9BA 1TJYA 4EL0A 1Z6QA 3P9IA 3PGKA 4NNPA 3CUVA 1ZM4A 2QD3A 1Z33A 3FCSB 3SN6A 3E9CA 4HQDA 3QKIA 3OMXA 5U4QA 1JCQA 1YC5A 4HDCA 4LRTB 3TQSA 3PTAA 3O82A 3K1TA 4ZQBA 1T6XA 1J8FA 2V6MA 4D8WA 1N1MA 3BQ9A 5ERXA 3A9UA 4LGCA 4YJKA 2C5HA 4WSOA 4KH0A 4BJ1A 5I7AA 4XLZA 3EZYA 2P9EA 1R5BA 2YINC 1R2QA 2B8WA 2QYTA 2PGNA 2ETCA 1EVYA 3IBEA 4KVZA 2AZ4A 5BNFA 5HTOA 1WSWA 3QK7A 1HURA 4LJ5A 3DLCA 2VJKA 1TE2A 1NVTA 3MKQA 4BNDA 2HKIA 2IO3C 1YK1A 1N7GA 2QUKA 3TSZA 4GOXA 3ZWNA 1KR5A 4L08A 4M0LA 4NK4A 4X1KA 2JGMA 3LO5A 2IGBA 3IHLA 4TVBA 4F38A 1CFJA 3O9ZA 1T24A 1W1WA 2PL5A 1HZZC 2WTBA 4ZHQB 3SQMA 5FIUA 4D0RA 1NKSA 3IURA 4QGAA 2AJTA 2ZGGA 5LMCA 1KARA 4BFWA 1X15A 1E2GA 3UICA 3DFKA 3SXJA 1CVIA 2GSDA 3LECA 3KOYA 1TDJA 3OFKA 3F9IA 4DNPA 1KQPA 4HH3C 3MYRA 1LW6E 3JQAB 1EB9A 4EPWA 1NXSA 2Y1WA 1U1GA 4XDGA 5IAJA 3OQHA 4PSCA 2PDAA 3OOJA 3KQKA 4CLXA 3ONEA 4EGQA 3OU6A 2ISQA 4GSLA 5LCWJ 1G16A 1WXQA 1BS1A 3O4IA 2IX3A 5T3UA 3TJPA 5JJ7A 3QV1A 1QH1A 4JSYA 2UVQA 1T25A 5F73A 3QKRB 2JANA 4YJHB 1AUPA 4KXFB 1H2RS 1OXKB 5IG2A 2POQX 2J9FA 1S70B 1L4MA 1Y4DE 3JALB 4BP9A 1H0SA 3HTXA 3H9JA 1EAMA 3OFJA 3I62A 4WQMA 3H6KA 1UOHA 5I9IA 4AZWA 4FFRA 3ANNA 1QQ7A 1N6KA 2EWMA 2R6ZA 1KE1A 5BSVA 3M8KA 3WSVA 1YA4A 1KT1A 1TUBA 1W36D 7GPBA 3L77A 3DL0A 2R85A 4GR4A 2IV2X 1XQ1A 2FPOA 5KWVA 1ORTA 1SBZA 4Q00A 2FSPA 2A0KA 1BD4A 3TZ6A 3IPRA 2ZWVA 1Y6IA 4RIIA 2VDQB 4X3OA 3ZCTA 4D25A 3UGKA 4UM5A 1OUVA 4PCUA 3UWPA 2HUNA 4GDFA 1SZCA 5JRJA 4F6LA 4ZYLA 3A6ZA 1S63A 1JKMA 3LHFA 2UY1B 4OGFA 2JZOA 5HMLA 1XZAA 4LDRA 5CCXA 5JPDA 4MUYA 5KMGB 2FMUA 4RORA 4P35A 2W7TA 1XXHE 4UUAA 4DA7A 2WWWA 4IYJA 4JJAA 3KCQA 4J7CA 3E3LA 2E85A 2HSDA 5BN5A 5KQMA 4P3NA 3FYSA 4TM8A 4HLQB 1R10A 4I36A 2AE1A 1YZTA 3PFWO 1Z83A 1BX3A 3R0ZA 2HHJA 3HVEA 2A5EA 2OCBA 4KR2A 4N12A 4R54A 5HJ5A 3PQDA 3W79A 2AJDA 2ZDQA 3S0JA 5EUMA 1K3ZD 3OU2A 3UM9A 4X64B 4CVNA 4MMZB 1ZMXA 1G1MA 4HNGA 5JJCA 1OH5A 2TMDA 1CUIA 1SOUA 3Q7QA 2V58A 1VHTA 2YHIB 3X44A 4GPTA 4EAAA 3G8DA 4ZC8A 1ZEJA 3H2ZA 1R16A 1K0FA 3EEYA 1FFCA 3GNLA 2KPOA 3FWPA 4ZI7B 5G3YA 5K2OA 3CWCA 3MMNA 4EPVA 3FUFA 1JKFA 4FGZA 2XQIA 5M3BA 3ZZUA 1XTKA 1M8PA 4JELA 4Q9NA 1U2GC 3WGJA 2FPGA 1WV1A 3BMNA 2EG9A 2NXPA 2ZYSA 4WXMA 2OBXA 3FFBA 1XE3A 4YCDA 1OPXA 3DT6A 3BE4A 2KJQA 4YP1A 1G7SA 2BMVA 2FO1E 4K87A 2VPYA 1V7PC 2C9OA 4CFSA 4DPMA 4UULA 1GNRA 5L3SB 1FUKA 1ESCA 2ZUDA 3IAM1 3R6GA 5TT0A 4DLAA 4PO8A 4QQFA 2Q5IA 3CV0A 1J23A 2OORA 3IRVA 5KJLA 4ZDKA 4MW2A 4AWAA 5CX1B 3QE2A 3HL0A 3F9RA 3TZCA 4WERA 4BERA 5J5VA 3Q9UA 3NR2A 3AHJA 5AVRA 3R41A 5I9MA 3W5UA 2GRLA 2YZKA 2VS1A 4K5AB 4OI2A 1XF9A 1VJCA 3R3XA 2C2WA 1JHOA 2NO1A 4GB9A 3O8QB 1ZFNA 1O08A 1NRWA 5LMZA 1PU2A 1K86A 1PUXA 5ENSD 4QPJC 4KL8S 4CDRA 5IC6A 4BCBA 3F5QA 1CCWA 4IFIA 4P5PA 2OBFA 3T4EA 2GX6A 2KW5A 3HO1A 1DVPA 1V5FA 4C1NA 1QG4A 3K94A 1Z3IX 3SBEA 4POAA 4KDRA 5D3MB 2GFQA 4K6KA 2IYTA 4FFWA 2IXAA 3JD1A 3N0RA 4QDJA 1KY2A 5DLDA 2EIHA 4O4IB 3EC2A 2BFOA 1EWRA 2FU5C 2NU9A 5JCJA 2GZHA 4ZKDA 1E96A 3QYJA 5DBHX 4K9SA 4I4CA 5CDTA 5D8DA 1W6UA 4DHEA 3RIYA 5K6AC 3F78A 4M8LA 2HYZA 1N8TA 3OKAA 4YRIA 1LTXA 1GZ7A 3AEQB 1X42A 3JWIA 1CPYA 1SZ9A 4QHSA 3S2YA 2CNKA 3CVOA 2X3MA 5KNDH 3FE2A 3IIJA 1H6DA 5JJBA 1TKRA 3VR5H 5KEIA 5EJ2A 2XPYA 1O5MA 3CV3A 3RSEG 2ZVJA 1U81A 3QFRA 2VJYA 1L5OA 3VNBA 2OFOA 4YV0A 2YVAA 5EMKA 1E1RD 3T1TA 4TWAA 2C2YA 3QARA 1N1EA 4PAMA 5L4NA 2GM4A 5FOSA 2VAMA 1Y6ZA 4RMIA 1RJWA 5ELXA 3G9XA 4MVXA 1YIOA 4G8BA 4OXXA 4KE9A 2QJRA 2R6AA 1DO2A 4CQMB 2G80A 3H5OA 3LIPA 4TXPA 2DHCA 3VH3A 2VDRB 2D2IA 1YZQA 3BE8A 1XRJA 4IWYA 3OZVA 1KKMA 4KOEC 4PYIA 2QZ4A 1ZW1A 2AEEA 2WICA 5GV7A 2Q5QA 5GJBA 3I2KA 1SU7A 2BFDA 3TVTA 1QBGA 5JC1A 3CM0A 4RZHA 4GH5A 1JAZA 4RNCA 5EIFA 1ZBDA 4CGVA 3IYLW 2FJPA 4MAAA 4JLOA 1JG2A 2YXDA 1W0JA 4BSZB 3ZNNA 1P73A 3MSCA 4L7QA 1E0AA 2ZXFA 2Z58A 4R0NA 4W5RA 4W5TA 3SQOA 4GRDA 3W1WA 2NTJA 1O95C 2X9GA 4Q1DA 4XVUA 2X8AA 2LAHA 2HDHA 2CUNA 4DN6A 5BUZA 4JLVA 2RJNA 2PD4A 3Q4GA 4R2LA 4BEJA 1LFAA 4HDKA 5CDYA 2MHCA 4CF5A 4D43A 1P1BA 4W8HA 3TX6A 5AVZA 4LSWA 4NZMA 4B7XA 1QFJA 4UWKA 1ELKA 2G25A 3PUZA 1Q1QA 2DBVO 4HYTA 1WSDA 5EOVA 4FEAA 3B9QA 1RQXA 2IHNA 1E2HA 4GOKA 3HBMA 4Q4AB 2O0LA 1G8KA 1VLQA 3NT2A 3K1ZA 5EEHA 2R1TB 2OXCA 3AKYA 1V6SA 1QGAA 2F1KA 5B58T 4OHPA 1ODLA 1ZA1A 3GLFA 2GEUA 3T06B 1FYDA 3KKOA 1UZNA 5I7FA 3PR3A 4CMJA 1AUVA 4PN3A 3KT8A 4JVSA 4JT4A 2WHEA 1M3SA 2IX9A 1TJCA 3BD6A 3BMCB 4CEIA 3PUXA 4M0DA 3ZE0B 4TKUB 3IQZA 1KJNA 3MCTA 4RX1A 1USWA 4W9NC 2N46A 4OLHA 4FLFA 3HJFA 3S2SA 3LCJA 5BR4A 2UZ0A 3KOXA 3HYCA 4ENRA 3SICE 1I4LD 5IM4F 5JZVA 1R1DA 4DABA 3R7WA 3WP1B 4QYXA 4F2HA 2VUHB 2ZRCA 3GN1A 3WIDA 3HIZA 2NPIA 2WZBA 5B3KA 3H13A 3B7BA 2PT7A 3PIRA 1KBZA 3U7GA 4HLNA 5HVNA 3HH8A 1GPYA 3EQ8A 3MOSA 2I2DA 4HK4A 2XPCA 4JX8A 1FP4B 1ZGJA 2PLWA 4PAGA 1A04A 4WNGA 3R6WA 1C0EA 4PQEA 3FDZB 2VTBB 3KJIA 4LCEA 1KQFA 2XVAA 1TVKB 4EI7A 1YCDA 3NPMA 4BRSA 4H3HB 4S1TA 3BILA 5CW1A 2PZMA 3PUVA 1Q57A 3ESQA 3PA8A 3V1UA 1QX3A 1FRZA 3HJNA 2ATXA 2WYIA 5HQJA 4HRMB 4GQBA 4Z9FA 2RHJA 3LHSA 2WHPA 4FYWA 5K9ZA 2DWZA 1U2ZA 1R50A 1RRFA 3SC6A 4B45A 3TIFA 4OLJA 1JJVA 3LY7A 4FKMA 4O4LF 3TZHA 5ES4B 4TYMA 4W9RA 1EP1B 4OVKA 4FYIA 5HBGA 4G5YA 4DM4A 2GCNA 3ORYA 2H17A 3RTGA 3M4XA 3HA5A 1VTKA 4FS8A 2V4ZA 1MAVA 3U2QA 4FMDB 1DBSA 5CG1A 4RA6B 3VNSA 4E2YA 3QVJA 4IWNA 4Y9DA 2N1MA 1EFCA 1QYRA 3DL2A 2CLLB 4X1YB 3K0EA 1NFQA 1ZGZA 5EIBE 1BOOA 3KAKA 1JEOA 1HKUA 2VDOB 4JLSA 3ZWDA 3A4MA 1D5CA 2QRJA 2GO7A 3RR2A 4V3IA 4O08A 5EA2A 3QAQA 3FCOA 5AVYA 1US8B 5IJ9B 2GA8A 2LAIA 3DOJA 2O05A 5EC8A 3W5AA 4I4NA 3A6KA 2IHVA 3T94A 4PPGA 1XMJA 3TLMA 2WJ6A 3K72B 4ZDWA 2P65A 1JAHA 3EWIA 2ORWA 1K8KG 4F3RA 1ZXBA 2CJXA 1THTA 3FUCA 2EIJE 2OMEA 5H9VA 5E0OA 2HF2A 1QRRA 5IC5A 2IYVA 3KVOA 2XVZA 3OHPA 4G1VA 1N3LA 2R9VA 1KF0A 4BECA 1U0EA 2HT6A 4PYQA 3OZSA 4LERA 5B3AA 4LVNA 4G1FA 3SMVA 1T3HA 5ED4A 3NVAA 4A8TA 1W5AA 2DWUA 4OU4A 3U80A 4B09A 4AP2A 2WFLA 1TK9A 2XMRA 2Q62A 3LGSA 3KLMX 4CYMA 1DRJA 2W2PA 2PY6A 3MGKA 1Y6FA 2Q2QA 1J24A 2ODWA 1F3OA 2WM2A 3ADPA 3QLEA 4XYLA 3TE6A 1BU5A 4TUYA 4ARUA 4MLCA 4J2OA 1KJQA 1U11A 4RXMA 3N59A 1RMQA 3HJBA 4PSAA 3UPUA 3OIDA 1ZNQO 3R5JA 4GPAA 3V80A 3K32A 1WY6A 4EF6A 5FULA 3TRFA 5AH0A 3LPCA 3ZHQA 5I5GA 2C1ZA 5AW4A 3R8FA 4MS6A 4RTQA 4H4EA 1TYQG 1TM1E 2PUVA 3B8EA 3LUBA 1RACA 1E5DA 4UHEA 1IN1A 3V4RA 4L7VA 5E95A 5EKTA 3TZQA 1KO7A 1RPTA 4UTXA 1HOXA 2VOEA 3P5SA 1WMBA 2YWFA 2WTNA 2POCA 3BWCA 5A6SA 1IE3A 3PEUB 3HVUA 1WQ1R 3KS9A 3A2KA 3C8UA 5T3RA 1HETA 2OD7A 1WUTA 4NNOA 4AY6A 1JVNA 4UWLA 2VDLB 4S12A 2DVMA 2PEYA 2Q5LA 1KP3A 1SCDA 5GONF 3HU3A 3B9RA 4I1PA 4XX5A 5IZCA 1E9EA 1AXGA 2VPQA 4KHPB 2IIQA 4HEA6 2R751 3JQ7A 1WHSB 1NTRA 4BPBA 3GEDA 2IPNA 3A4NA 1U0BB 1ICEA 3DE6X 2PFKA 1IB0A 2D7CA 4MWZA 1KEEA 5AKLA 3ECSA 2R7AA 5EJ8A 1SBCA 5JH7F 2VYCA 4QGFA 3WIVA 1WZ2A 3I5XA 3UHOA 1VC2A 3VU0A 1MLDA 2RH5A 1GYRA 3Q7AA 5FA5A 4F21A 3S2EA 2I5PO 2P9HA 2NU7B 4XD2A 1YZNA 1HDRA 1ZIOA 4BVAA 2CXSA 2QRMA 4BVKA 2VNAA 3LUDA 3I64A 3IFSA 4CDMA 3GFBA 4I1VA 4PSKA 3K9NA 2VKQA 5JY1A 4E21A 4H1UA 3WLSA 1LI7A 3ZD7A 3AILA 2FSVA 2GDJA 3N53A 2J1LA 1R5OA 2J0EA 3PNLB 5DF1A 3T3GA 2WQ6A 4O4LA 1K1AA 4WY5A 1JG4A 2V7UA 3H3XA 2QRZA 3WWOA 3UN1A 4YAGA 1W5TA 3AVXA 3OAAD 1W34A 2LZ0A 3PGA1 4PLTA 1C3EA 2Q2VA 3WAGA 1OR8A 3LF1A 2H9YA 1TJFA 4BWRA 5DHTA 4J1QA 2R8PA 3FUWA 4RHTA 3MFYA 3EDTB 4N39A 3ON5A 4Q9AA 4PRKA 3I8XA 1IDN1 4JROA 1JUDA 1OAOA 3D3EA 4EUSA 1HEYA 1B8OA 4ZI3A 2AF4C 2QROA 3G88A 3OJFA 1QYXA 4TV9A 5AKZA 1U2VG 5IDVA 4EABA 2P9YA 4QPNA 3FRJA 4BTAA 1FRFS 1DBVO 3ME5A 4B84A 1YQXA 3PEEA 4ODIA 5EG5A 3FYUB 1ESZA 3RM3A 2CNWD 3CNBA 4X3CA 3GPDG 3JV7A 1YJ8A 5DCLA 1JQAA 4IIYA 4TLCA 4ZPJA 1NWHA 5EESA 4ENVA 1H3NA 3GWGA 4OYRA 2HSGA 4BP8A 4M9XA 1WUHS 2K5UA 5A62A 3WWDA 3H9CA 3SR0A 4RKWA 2A59A 5H5JA 3W5JA 5FAKA 2UWJG 1ID8A 2Y05A 3LBFA 1R6AA 1BWPA 1D2GA 2W83A 1A8IA 1VPEA 1V41E 2HBQA 3ZFWA 3BH0A 4MRMB 2F8SA 3FTZA 4B3JA 2BGWA 2FF5A 1CFZA 1T9KA 3CGHA 2NTNA 4Z4EA 1EJ0A 3BAFA 4L4UA 3FPBA 3CHQA 3KDAA 5BMVB 2PJUA 1B7GO 1ZD3A 4DSTA 2YICA 3AUUA 4TKLA 1JQEA 5DMHA 1PAUA 2HM7A 2O8DA 5EQTA 3LC2O 4HQ0A 4IX1A 2B99A 1SXJC 2LDXA 4AJPA 1E0DA 1JEJA 2WBLC 4TZTA 1FC0A 1HZJA 1YUNA 4KXLA 1NVGA 1GM5A 3OO1A 5BNWA 2QAGB 4H3SA 4HWTA 2P6RA 5CA1A 4P81A 1CD5A 1REQA 4UEOA 1W4LA 5AOCA 5K8TA 3HN7A 2D00A 1YE5A 2H1HA 2NX2A 1SXQA 4B94A 2RGNA 5ENTD 3DT9A 4E94A 3P26A 3MLBA 1DCEA 2RK4A 2A4ZA 1C1DA 1KJ9A 3ZJUA 3DR5A 3KAEA 1YU9A 4DM3A 3TJMA 2YZNA 3AHFA 5ALZA 3BQNB 2BKVA 3TKAA 5KREA 1IZ9A 4A6EA 4KR3A 3D4PA 4MCAA 1TPYA 5FLYA 1U1EA 1I3KA 3O83A 1LS6A 3ET5A 1ZUD1 1ZD8A 3LW7A 2Q3DA 1EM8A 2CBZA 4N65A 1KJIA 3S28A 1M1XB 4DDHA 1EXMA 5AK3A 2Q3BA 4YJ2A 2EX4A 4XSGA 1HLPA 3SKVA 5LQNA 5DM2A 4A2CA 2G5GX 1R0WA 1DJOA 5DM60 3G02A 2WU3A 1EYZA 3C6KA 4GVLA 4Y6OA 3Q6IA 2IOLA 5EGSA 1YWGO 3UXGA 4H1TA 1E9BA 5BT8A 3I6ZA 2G6BA 3QU2A 1XMPA 4YBRA 4U7DA 5LQKA 4JQSA 5AARA 4RIHA 5J2TA 4EG5A 2AQ8A 2JLCA 5CYOA 4P4NA 7REQA 1X70A 5EJ9A 1MV8A 2P90A 1GAWA 4C22A 4E5MA 1IM5A 2O2CA 3SKYA 3PUWA 2ZBQA 4C2AA 1CQZA 4QWWA 5CMYA 4EQ6B 1N52A 4RMJA 1ETUA 4FVTA 4AMVA 2L42A 4EW6A 3CONA 4QODA 1QC5B 4YUAA 4CI0B 4WCFA 2KCKA 2F0YA 2YIJA 1L5LA 4U04A 621PA 5K8JB 4HGNA 3ONFA 1JFLA 3ZD8A 3K73O 1ZSYA 4PR0A 2O5EA 3VZBA 3BOSA 4MI1A 4K9DA 2FI7A 1NU6A 3WRWA 3CEHA 4HQRA 2VP5A 3KZNA 3I30X 4HAVA 4QUAA 4JP8A 2ZGVA 5LNK6 5KZMB 3WXBA 5E4JA 2J08A 4MUFA 221PA 2R11A 1K8RA 2G72A 4XPIB 1SNYA 4M36A 3SZ7A 2DUMA 5K45A 3F4LA 4FXOA 2WXLA 3SHOA 4M9UA 4BX2A 1X1QA 1EB8A 4UPEA 1U9ZA 3RC3A 2YYAA 1BX1A 4PV7A 2G4CA 5KQGA 1OCRE 2OAEA 1UBTS 3TWOA 4IBOA 5TVGA 1TMYA 2R3SA 3NBZC 1DDIA 3DPIA 5HS4A 3OWXA 3REGA 3AQ4A 2BTQB 3H5VA 2II6A 2PQRA 2CHXA 3R5TA 4YT5A 2AC4A 3G2VA 2PMCA 1JB1A 3V4SA 4BO4A 4O59O 3O8RA 1MC8A 2COUA 4B6PA 5KSYA 5COQA 1VIDA 3HJRA 5A3RA 1IG3A 2DHDA 3THYB 1P44A 1QYIA 4OUDB 3KJFA 1AHNA 4JP1A 2QI9C 2ZUCA 3DT8A 4J8SA 4DV6B 5A05A 1E69A 3LVBA 3KLBA 5LLSA 1G9XA 3X1JA 3F46A 4FMCF 2VDMB 5KTKA 3UKJA 3IDAA 4BP1A 3DKPA 1DBPA 3Q3EA 1A97A 5LN1A 4XM2A 1UBUS 5JW6A 5FWYB 1PD0A 2R68A 1RXVA 3QWWA 4EYKA 3DQQA 3A14A 5BNIA 1TIKA 1D6NA 3G13A 3PC6A 3MBKA 3NEAA 4B1FA 4CKXA 4DIEA 4KXVA 3G59A 1V4NA 5F64A 2D2VA 2MDTA 1M6NA 3GAMA 4CT5A 2I87A 3O95A 4OHZA 4FZRA 1G5FA 4HAZA 4DPRA 5EHGA 4W82A 3VKHA 5LXTF 2OLKA 3NHPA 5MFZA 2G5PA 3K6SA 1IU9A 4E85A 2R25B 4RELA 3OKPA 2FMHA 3NTXA 4YACA 3OO0A 4MKRA 4NFYA 3C6ZA 4Z9YA 1N7IA 4ALKA 4P92A 2PIAA 2NAFA 3FPGA 4B4DA 1X6VA 1N2ZA 5EP4A 4TWZA 2LUHA 3TLCA 3HCNA 3D6TB 2UXDB 2XYHA 3F6QA 3SE7A 3O90A 4AO8A 1KRHA 5L9AA 4LVUA 3RBAA 5JDIA 4IO0A 5ALEA 4FBMA 3EPHA 4DMCA 1KO5A 1BN7A 3O2JA 2XWJI 5ALXA 4KE7A 3EUFA 4FP7A 3EA5A 3PWSA 3WGUA 2WUGA 5H82A 2VJ8A 3V7UA 4F2PA 1WXDA 5LKRA 2ZQ5A 1JKJB 3UMSA 1JHQA 4BC0A 4FNAA 2MJLA 1XU4A 1R3UA 2D0DA 5BQ3A 2QN7A 2G1KA 3JQFA 1XP5A 5TQ2A 4CT4A 3P4XA 4JD2G 1T8WA 2AG8A 4YRFA 4Y6GB 2X23A 1COWD 2WIDA 3FXAA 5DULA 3GUYA 4MVJE 4EHLA 1TZKA 1C1XB 4KRFA 3HBJA 3GYGA 5L6MB 2WJJA 3GEEA 3MILA 2BT4A 4M46A 3DUFA 1YF3A 4QBTA 4R2KA 1LV7A 2X40A 4DKXA 3AV0B 5FTNA 4F3NA 2HWKA 1LVUA 2NTEA 1XELA 5F5LA 4NU8X 1ICIA 2J5KA 2DKOA 2HA7A 1ANKA 2CXUA 3CB4A 4MMXB 3JATA 4N6NA 3K20A 1P2VA 1WMSA 1ZKDA 3DC2A 4MHSA 1PK7A 3HXMA 3NKVA 3W6OA 1Z4OA 2D0OB 4EJMA 1RCUA 4GPZA 1XCLA 1Z6YA 5G41A 3OFND 3MFQA 1CF9A 2O8NA 4B6GA 3BK7A 1UEJA 2ATEA 4CZ2D 2E6KA 4L2LA 4QAQA 3L7NA 5K0CA 3S7ZA 4N3NA 3S2IA 2NLOA 5JISA 4IHKA 3JUIA 4QU0A 4W1SA 2BKKB 4BO3A 4AZSA 1M8JA 3TLAA 1GTJ1 5CEDB 1Z16A 3JU3A 3ITDA 1R6DA 2BMFA 3SSNA 3VPSA 3H9UA 4WLEA 4KIWA 4OMCA 3AL2A 1PLKA 4UHKA 3R3YA 1PFUA 4RACA 3PZ2A 3RKRA 3QE3A 3O84A 2BEWB 3FMIA 2WG0A 4RGBA 3CLKA 3CE9A 4DUZB 2FWRA 2XE7A 5F7ZA 2XZLA 2QV0A 1YCSB 1ML4A 3R4CA 3CX4A 4CTMA 1EHCA 1QFMA 3R5SA 4RIGA 4KQIA 4BX8A 3CZAA 4M1MA 3DAOA 4RA9B 5FOTA 4RKYA 1FQWA 2QYUA 5A4KA 1VLHA 1ONBA 1NI1A 2WPNA 2XZPA 3IE0A 5MN6A 2SKEA 1DAGA 2FJUA 1TGVA 2BFPA 2J87A 4PYKA 4JI5B 4C4ZA 3WGLA 4ZQHA 3REFA 3ROEA 4LYDA 4NICA 4QG3A 4HJXA 2FDRA 1N33B 4M0KA 1CE8B 4ND7A 2PZGA 2CBXA 3UB2A 1YZUA 2H0QA 1QGED 1E7YA 5HFJA 4JYBA 4I8XA 5F2NA 2FFJA 3BZBA 1X1EA 2GLUA 3PXEA 2OK7A 1VXOA 3FPLA 2PX8A 1JR6A 1LJLA 1J6UA 4PS7A 1ZU4A 1ADBA 3OZGA 3RODA 3S27A 2A5DA 1ECLA 4QTZA 3FUEA 4YP6A 4WMLA 3RNOA 3UENA 2COEA 2OCLA 2ZWMA 4BQNA 2RAVA 3ZYCA 1TRKA 2XNHA 2TMKA 4QUKA 5TLSA 4Z5XA 3VISA 2UYOA 3U40A 1NZJA 3BBLA 3ESAA 2PKXA 4RPKA 4C7KA 1KWGA 3IEUA 4K88A 2WQ7A 1SKAA 4IOMA 3A1DA 4YFYA 1M83A 3H9EO 5AHOA 1PSZA 2OL4A 5K3OA 3RU2A 5IKMA 1GITA 1TJNA 3FWVA 1GPAA 1RCTE 1NKVA 3AKDA 1Z68A 2C4UA 1WHTB 5LA6B 1XAIA 4J8DA 1VZ3A 2VDJA 2VHZA 3EN0A 3G68A 4CTJA 2WXMA 3W9UA 2FMFA 5GZ1A 2ONDA 1L5KA 4EJSC 1RM5A 5C5CA 3DDNA 3JSXA 1P0QA 1TECE 2I62A 1E3TA 1PJ2A 2AJBA 2VBGA 4Z7QB 1NBME 3DM9B 3I61A 1YQEA 1DDOA 2RH9B 4TRQA 4KC0A 2NU6A 3ASUA 5KYKA 3RWMB 1QZTA 4OXRA 4RD3A 1E7VA 1NC3A 3H2SA 4PC1A 2ZTLA 5B4VA 3WA7A 3KJEA 4ZXFA 1MORA 4GOND 2X5JO 2OFXA 4FZJA 3O8BA 1W4BA 4HH1A 2RONA 4F8EA 2OCCE 2O7RA 5T67A 5SY4A 5A7GA 5MF6A 2GKGA 4PG8A 2VDPB 2YN0A 2O59A 1UMDA 3F1LA 3IKJA 2ZYIA 4YNBA 1CQJA 3VO9A 1Z9BA 3NTOA 4QECA 5CHEA 3BJEA 3RV3A 5AM5A 1UAGA 1JSLA 2B4TO 1KWKA 2SECE 1G4UR 4HWSA 1F2UB 3G1UA 3I04A 1OA1A 3N58A 3HN2A 3LXXA 1GCIA 2QTHA 2GJ9A 3NC0C 3V32A 3QMMA 1Z07A 2PH5A 1E4YA 4UBLA 5KTTA 4ASUA 5DYWA 4AUMA 3UH0A 5HKKD 3QI2A 2Y8EA 2YKGA 1WABA 4MRVA 3HDQA 1PWYE 2Q0HA 2D5IA 3PLRA 1ZAYA 5F7JA 1KC3A 2CLOB 3EIWA 1HH4A 3JQEA 2F9LA 2B20A 1XVUA 2EEPA 3WRYC 4WH0A 1Z3YA 1XJWA 4U2BA 1ACMA 2G08A 3P9YA 1K7YA 2HJ9A 1W0KA 4JNKA 3ZR4B 3IKLA 3KUDA 4NIKA 2F1HA 1CBUA 3RLIA 2R17C 4P4TA 2B30A 2X22A 3CNQS 3CISA 5HKPA 4KI7A 1EVKA 2RJOA 2JH3A 1C7EA 3LX4A 3FUVA 1DARA 2GCPA 1SQMA 5EYPB 5IF9A 3C41J 2BR3A 2ZP1A 1L7QA 3DHYA 1M34B 3IVRA 2VP3A 1YYHA 1RC8A 4FXPA 1NUTA 2ZIEA 3Q41A 4GGMX 4EHHA 1IPEA 3LBIA 1GDTA 1EUQA 1N5IA 3P9NA 1T0UA 4JFAA 4QYIB 2BZSA 3ZHXA 4MKXA 2OXEA 2IYRA 5NULA 3WRVA 5A9SA 3KOUA 2Z83A 4NFHA 3W4JA 3L1UA 3PNYA 3H1AA 4LY0A 2W0MA 5JCZA 5AXAA 1H85A 3WK4A 1V43A 5EMLA 3N2GB 3NWJA 4URXR 3SOZA 1OC2A 2YXPX 1SK8A 3PHLA 8ATCA 3G0CA 1EFKA 3MTEA 2Y66A 4H6WA 3ZH2A 4OP2A 4QPCA 2PPLA 4E51A 10MHA 1R4MA 3NHBA 1K6JA 1NW7A 3OJCA 3I5PA 1RHRA 4AI6A 3U56A 3UNXA 1JHYA 5G0UA 4RSHA 1GT91 3DEYX 3ZVMA 1NZNA 4XD7D 2JAHA 4PGFA 1M2FA 1YL6A 3FSEA 5ALJA 1QUEA 1JZSA 1E63A 1EX9A 2VI5A 2WFZA 3O93A 4QJ4A 3QUBA 4W5JA 4L76A 4R8SA 4YECA 2BM8A 2P2CA 4NJEB 2Y3AA 5BSGA 3LBYA 3OE1A 4OU5A 3H2KA 3C3QA 3BREA 4ARAA 2H00A 3CF0A 4DFDA 3HP7A 2FKAA 3FDIA 3H65A 2XB8A 5JVDA 5KO2A 2SICE 4XEIG 2J4FA 5LDGA 1M6VB 3CLTD 2ZWPA 2FLWA 3ROPA 1K8XB 3CGGA 4ZQCB 4PYRA 1MN6A 4JI1B 4QRIA 1MABA 2PQMA 3BK1A 1RDFA 5B6IA 5LUBA 5EZ6B 2CDRA 3TNYA 5TPZA 4PXAA 3SF0A 4CMBA 3D8UA 3SQXA 3D3WB 5BW8A 1RHKA 1YS7A 4OL0A 1T5HX 4UDXX 3ADCA 1E6EA 2W9XA 5C3UA 1GNQA 1C5KA 4XYEA 3QUAA 1N2XA 1CNMA 5CB4A 3M6FA 4KJZA 3S99A 4JXZA 4YWJA 3JVVA 3HMKA 2K87A 4OK5A 1JE1A 4BQRA 3Q7TA 5IANA 2F43A 2GF9A 3LQFA 1E89A 4N18A 1QRDA 4G0MA 3JQGB 2GD6A 1J7KA 1GFWA 4BB0A 1TNOA 1W4CA 2FRXA 2QV7A 4M6WA 1V96A 4FLEA 1NN5A 4Q48A 1V1JA 5CH3A 4JMLA 2PCJA 4V38A 4ZC1A 2QPTA 4GP7A 3VQTA 1EFHA 1Z4MA 3ZV7A 2NSDA 3UM1A 1C9MA 2JCYA 3Q7IA 2YVQA 2WG2A 4GAAA 5F4BA 4MW0A 3PEYA 3DEZA 5IRCD 2CGEA 3JPWA 1MA3A 1M33A 3Q3CA 1SC4A 2JFGA 1Y8CA 4PG5A 4BMYA 4CMHA 3TUZC 3M6UA 2BFMA 2KM4A 1KK1A 4JJ7A 1F12A 1D0IA 5CRUA 2ADFA 2EATA 2VBFA 1L6RA 3DTVB 3Q0TA 2ZJ5A 3QEKA 4HEA1 2ZU6B 3GZ1A 3F2VA 3WGKA 1QK3A 2OCAA 1OCOE 5EUBA 4PF1A 2EF1A 5E1BA 3AY3A 2HJWA 3LZ6A 4GUDA 2R1ZA 5K3EA 2XA2A 2PR2A 4WL0A 2G9RA 4UATA 2B4QA 3DEAA 3GNSA 4JQOA 3UTCA 3ZWAA 3INRA 1TZCA 2DQSA 4OG2A 2ZYRA 2W93A 1DFHA 1VFPA 4YRTA 3P0RA 3R9AB 3KB8A 3KXDA 1H0AA 2AQKA 2O8EB 4KPFC 2LNIA 4MUMA 3WHKA 3RQSA 4MCHA 5A4JA 4AKGA 1CG6A 1H2YA 2QTWB 4HQFA 4NF2A 2I1QA 2CK3D 1BIFA 1ZD4A 2OO3A 4O8ZA 1QIMA 3FTVA 1Y5LA 1TKBA 1AWCB 3AUTA 3GEHA 4W6ZA 3NAMA 4XIFA 4DE5A 3I6BA 4YAIA 3O7WA 1VYUA 2IXFA 3EZNA 2J41A 2OA0A 3H87A 5JYBA 1E2IA 3MBOA 5FPKA 3RFUA 2D06A 2QVZX 3E3NA 4KNYA 5BV8A 4CM9D 4MGKR 2A0YA 1D4AA 4U9UA 2H31A 1KDRA 4R5HA 4Q01A 1C1HA 1XEXA 3G7UA 3AJEA 1UBSB 2HU2A 4YDOA 1YFKA 4KPUA 2QYOA 4AKEA 1C3VA 3KV3O 1KFCB 2QNBA 3KQUA 2WFMA 1RYFA 1HQKA 2H85A 2ZRBA 3DJYA 4ESEA 5BR8B 4HB4A 1OSNA 2XMGA 2EVWX 3WTCA 3BL8A 1O94D 1XCGB 1SJ9A 1L9XA 1SB9A 4RS4A 4P2GA 4R9SA 4NP6A 3FLEA 4YAKA 4B2LA 2BV3A 3RIHA 3L7AA 1PJCA 2QN6A 3KT6A 5BSMA 4EEXA 1ECPA 2LCFA 2CNBA 3SP1A 1H8HD 1Y7TA 1GPMA 2V59A 1ZOPA 1X7YA 4QBIA 4NYIR 1TW2A 1E5LA 1UP4A 1BWQA 3FBTA 2JIOA 4CQLA 3LOUA 2I7VA 3OPYB 2QZAA 3HGQA 2EARA 4P84A 3FOWA 1GKKA 5G1NA 3OTOB 4HI8A 1U80A 4GTQA 1PQWA 2OHHA 3SQLA 1LNSA 3DAYA 3UXEA 2GKOA 3JWEA 1SBYA 4W4TA 2WP8J 5C9ZA 1E99A 4FOSA 3CH5A 3ZQJA 4DQXA 4MTLA 4FCCA 5TDHA 4M4SA 4A16A 2F67A 3MTDA 4Z3OA 3GMTA 1WXFA 2I1KA 3GLHB 2GCIA 2YRWA 3NANA 2C7RA 1K97A 2ZXWE 2R5FA 5KYTA 1N5KA 3TAXA 3UGJA 4MV5A 2Z8XA 4N40A 1OXBB 2O8FA 2ALJA 2O3JA 1J9EA 4CM8A 3L01A 1Q3KA 2I2FA 2NZUG 3L18A 3NYQA 2BUBA 1J21A 3N0TA 5F23A 3I45A 4ALLA 1P0MA 3BD7A 3Q7RA 3NEJA 4QL3A 2ZUVA 3MWGA 4KPGA 5EXPA 4KAXA 4QYSA 1Z37A 4Z1MA 3UQYS 2NXCA 3D5QA 4CR6A 2YYSA 4ENQA 1DCMA 5FZRA 2CSXA 1LNQA 3FFWA 3TTSA 4CNBA 3I0MA 3KQWA 1RM0A 4HN9A 4PX5A 2NTVA 1XKTA 4IDNA 1ZIDA 1MIOA 4H59A 1NQOA 3NRJA 2B35A 1H5QA 1L5MA 3BL5A 4DNQA 2P4HX 2PNJA 2YXBA 2QSYA 5K8UA 2K7ZA 4PZYA 1QGUB 1JT2A 3ICPA 1WB9A 1HGXA 2ST1A 4CIWA 2PSEA 3FMVA 3PTLA 1RM4A 3VKUA 2WWVD 2X8BA 1UC8A 4Z51A 2O6LA 3MOIA 5C1OA 3EZGA 5EZQA 1E5VA 3RYCB 3EEIA 3LTNC 1ELWA 4DW8A 1HDOA 3MJHA 1V71A 5FA6A 1GZ5A 3M2TA 3D9IA 5ANRB 5JFOA 1I51A 1JAXA 1BLXB 4EECA 1M7GA 4HMPA 4EA9A 2QD2A 4G1CA 2HNBA 4Y2HA 4MYHA 3SZUA 4BU1A 3MWFA 4GR9A 1BDBA 1CUAA 2CLCX 1S8FA 3ULEG 3IKVA 5KJEA 2I71A 1WXHA 4IJ6A 3SIRA 1L7MA 3HUUA 3MRSA 3E7PA 2IXEA 1OLUA 2J9GA 5EKSA 3H1TA 4O2RA 2OHGA 2BAGA 4N49A 1NRJB 2J3QA 2BZ0A 2F9MA 3WL3A 3QW2A 4CMEA 2GAFA 3A1VA 3ROMA 3L6UA 4LJLA 3V7WA 4GLLA 2H5EA 1L7PA 1KERA 1E3EA 2B5OA 4EY4A 2CMGA 2IE8A 2O9JA 1ODIA 2ZBVA 2I80A 4MWEA 3DZ8A 2KX7A 5GINE 1K3UB 1GNPA 1XU9A 3EB9A 3JZDA 1IONA 4JYCA 4UM9D 4KAFA 2JGAA 3QLVC 4B33A 5E4TA 4B89A 3HXTA 3VX4A 2QIPA 3CHMA 1P6XA 1OILA 1FT1A 2E5LB 5CDHA 3E6AA 4C7OA 3KVYA 3RS8A 1ATIA 4DT1A 4M0MA 3SVLA 2Z4TA 3HUDA 5LNK1 3SIWA 5ENNA 5AJUA 4XKBA 3U48A 4C6RA 1UMBB 1H2VC 4RKRA 1BZYA 1WP4A 5BYBA 3EC1A 4TUYF 3A1WA 1R0YA 3RHSA 3E9NA 3TL6A 5SZJA 5FL7A 3LV8A 5JS1A 1DSSG 3RTDA 2XUFA 3KT3A 2Z1NA 1VPDA 1H2WA 5KKNB 4I1OB 5F1KA 3HCFA 3ZE9A 1D4ZA 4ZCMA 3L0YA 1BS9A 1X7DA 3K71B 2XENA 4DL9A 1IK6A 3VOBA 4IEEA 1AQLA 2OXFA 4DY4A 4F1SA 3BF8A 1RHJA 1Y9EA 4ZT3A 1XVVA 1U0JA 4HXYA 1XEAA 3IQEA 1L7AA 5J08A 5D3ZA 2C7VA 4H08A 5HKLA 3DO8A 1QHIA 3DOIA 2DR3A 1FSZA 2VUSA 6PFKA 4KW7A 3ZI4A 1MEJA 4OGKA 3WXMA 3GZTB 1RJDA 1C8KA 1YNOA 3BTOA 3LVFO 4DYVA 1DCFA 6LDHA 4Q4HA 1LRKA 3G2HA 5DCYA 1OFVA 5EE3A 4ZGBA 3M82A 1HYBA 4U9HS 3WMWA 3PXBA 2ZVPX 2PKCA 3DF7A 2OCXA 2CVFA 4HATA 4EFNA 2JEYA 3N07A 1TNZA 2FW0A 2ODNA 4O2AA 1X19A 3FZGA 5KNBA 3DOEA 4HUQB 4F6RD 3UUFA 2GUGA 4G37A 2DFPA 4EHDA 3G23A 2IU4A 1WCIB 3H7AA 2A35A 3LFUA 3PC2A 2X6TA 5LZ8A 3TUIC 4RD2A 1O5IA 1YZGA 2O4CA 5KYYA 3EWNA 3L1IA 3Q98A 2GROB 1BW9A 4EVSA 1TU0A 2ZVDA 2FPPA 1Y37A 4QO7A 2IY7A 3DONA 1T29A 4J0DA 1BN6A 2CB0A 2A7XA 1T0HB 1IZ8A 1QMPA 3B52X 4F4DA 4NG5A 1IY2A 4B74A 1MKYA 1KI2A 2GM3A 2P4UA 2A84A 3TNJA 1AKUA 4NV0A 4AYTA 4CF7A 4MCIA 4L73A 3WO1A 2EZ9A 4LDZA 3S55A 2WA1A 3ZDEA 3GJ3A 3W78A 4FFBB 5BSUA 4RHUA 1ZC4A 3SY2A 1XCJA 2CWDA 3IILA 3V55A 3PQ4A 1PBNA 3HFSA 4G41A 4R2JA 4EPXA 2ZT7A 2HCTA 2H8KA 2WYVA 3OA0A 3LLVA 3WRXA 4P3YA 2YWEA 3D4BA 3UJ3X 4IFEA 3EF0A 2IKSA 1Y8QA 1EFDN 1OHHA 4B4UA 5FPSA 1E8ZA 2I7XA 4Q7JB 4C0XA 4K9PA 3K1JA 1ENPA 1SBHA 3FLAA 3G2PA 121PA 4HNAA 2BDEA 2J0VA 4R2XA 3H8JA 2OMKA 3Q72A 1M8KA 4TV9F 1JVBA 4GPKA 3TWQA 4NAHA 1RZRD 1LPMA 1V95A 1Q14A 3EXIA 3WA6A 1MJGM 5BV7A 5IH7A 3FZQA 3G8AA 3CF2A 3U7IA 1Y89A 1OV4A 2ODQA 2ZUSA 1FXUA 3I9NA 3KUKA 2YY5A 3DNMA 3D0QA 1CY1A 1AV7A 3C5VA 3T7KA 3UXMA 3CBQA 4IG4A 4U00A 4O2LA 4CKEA 3MTJA 2R8YA 1SUWA 1EDOA 3PNSA 4X3PA 4IIJB 5JNLA 2DG2A 3HADA 3O2NA 4G09A 1RXSA 3LC1O 3DBOB 3FUDA 3HVJA 1QFSA 2PBZA 4NMHA 3KQSA 2C4TA 1J8VA 3IH5A 5BO5A 4XUDA 5IT9A 2Y0BG 3BUAA 3CN9A 1HLFA 3GRPA 4QX6A 4L4SA 3BXOA 4RBNA 1CHNA 1GO2A 3GOQA 3P52A 2PKEA 4ZAZA 1JJIA 1OXVA 2F90A 3CX3A 3VR4H 4FJ2A 4ACLA 3IT0A 5DM70 1TF7A 1CB7A 1Z0JA 5TGDA 1TO2E 3E4CA 3F7MA 3CLVA 4RJKA 4PHFA 2WTUA 3TN7A 1M34E 1CUVA 5CA1F 3DV9A 1DBIA 1E2BA 4OBWA 4WK2B 4MW4A 4DUYB 3C97A 4P54A 2FPWA 4U7GA 2ONKA 4BNJA 1NR1A 4OREX 3VHXA 1NVWQ 1RAGA 3FEXA 1LJUA 2GETA 1Z6GA 5LCWC 2FOLA 2VHXA 2GFHA 3OQJA 1BCRA 1K06A 1UQTA 4ZCRA 3JAMA 3CW8X 4AURA 1PIWA 2B36A 2LNDA 1QKIA 1V6CA 2BISA 2FN8A 3URKA 3JUEA 1OMOA 5FBRB 5IVPA 1U2EA 4GM1A 3SWWA 4LXGA 1BPOA 2XDAA 1XG5A 1ZK1A 3C3RA 2C03A 2D4HA 4F3CA 2ZDHA 4K81B 4HFNA 5E3HA 1YA6A 2PL1A 3SXUB 1AB6A 3DLTA 1GTL1 2WXRA 2AX4A 2D8MA 3B1WA 2RKKA 1OKKA 2GN1A 4G36A 3K8OE 3ZHZA 4Y6LA 1YA0A 5H3CA 4YJ2F 1YTLA 3L43A 2AGVA 2VOJA 3QLUC 3CFYA 5KIAA 4LGVA 4OXNA 3QVWA 5DI3A 3UPVA 4UOEA 4ND8B 3U3WA 2RAUA 1D8DA 2X4LA 2A0XA 1P1JA 1PDVA 2HJGA 5F5XA 4QVGA 2I1JA 2J31A 4FGJA 1RRVA 2GQ0A 1ZYUA 1BKYA 5J2TF 5F78A 5BOVA 1QV7A 3NHRA 5JARA 1D6JA 5CDGA 1ZO8A 2X77A 1RNLA 4XUEA 1QZUA 5AK4A 3C3YA 5C31A 3KVNA 4MPRA 1U9IC 3MPOA 1W30A 2PS0A 3GFSA 5JU6A 5THXA 1Z0KA 4J94A 3TLBA 3ZZ0A 4RZQA 1KY4A 4KHZA 1ISPA 1DQSA 4I19A 3KZOA 3QRWA 2GK4A 2YIMA 4JK3A 2Y27A 1OI2A 2AJLI 1KYQA 1E9DA 5HQ3A 2L6BA 2VJCA 3LPAA 3MRXA 4PGHA 4L8LA 2FMKA 1VLLA 2GRQB 2XH8A 1KH2A 5L3ZA 2C5FA 3EQ6A 3PG5A 1HQCA 4WZ6A 4ITVA 3LP5A 3FPAA 2CYBA 2VNJA 3DH0A 4V0OA 3QZUA 3GLQA 2EZ8A 3CXUA 3LUJA 1S0PA 3QPUA 3RNLA 3HB7A 1W2WB 2ICAA 5C80A 5BN4B 2ODAA 5AUPB 5HILA 3CF4G 3N6RA 4WT7A 3C3MA 1SG0A 3W9GA 3PRKE 5AD1A 1YQ9A 1Z36A 2YQ4A 1Z13A 3L13A 1ZB1A 2FRDA 1UJ6A 1CYDA 5TEVA 2RKBA 4FIZA 4MWSA 4DUPA 4FYYA 4DANA 4EKDA 2ZKLA 3FSGD 4NMWA 2Y0CA 5IHXA 1CYEA 5I47A 1C2TA 4CKWA 1PQPA 1FVFA 3PDJA 2JD1A 3SEAA 2V7PA 4ZVOA 2GZ3A 2YQ8A 3JWHA 3Q7SA 5AI0A 3VSEA 3FHTA 3SD7A 3ICOA 2VQFB 5DEIA 1RQLA 1TF5A 2RHCA 4WOBA 1JU9A 4L5IA 4RF2A 1SD2A 4AZ3B 4RIEA 1NBIA 4CG1A 2WYWA 4E1BA 3DFIA 3M5WA 1ITZA 2IL1A 3HA7A 1YS4A 5LPNA 4GTSA 4ZVKA 4MWBA 5KNLA 2PE5A 4IJQA 4RHCA 1S3IA 1Y8RA 3ZK9A 2WAYA 2NGRA 4J0QA 1BGVA 5IX8A 2PAAA 3RGWS 2NV2B 2J3HA 5LL6P 5LJLA 4LDNA 4TSKA 5LBTA 3ZEFA 4OSEA 1X2BA 4M8NE 1NM5A 5BQPA 2W8BA 1MEEA 3H11B 5AHRA 1USIA 1LLUA 4PNZA 1XNRB 1QDUA 3GFQA 2UZ4A 4GYKA 3I1IA 4NYMR 1FRQA 2OVFA 4Q19A 3ZWKA 3RVBA 5U1PA 1A5TA 3E5RA 3T9CA 1I6WA 2RKOA 1NPDA 1B6SA 2V0NA 1ZCFA 2PT6A 1H3FA 1E8NA 1F1JA 2GESA 3GVPA 4TTJA 5EZYA 5JDCA 4W5NA 4F1PA 1C7IA 3A7EA 4BKOA 2YINA 2B1GA 2IXGA 3KQQA 4JHRA 2GYWA 1ZJ6A 3CEAA 2GK3A 4RY8A 4EY6A 3LQRA 2ZOSA 5JECA 5H70A 4RD1A 2P7HA 1YVEI 3K9IA 4I8DA 2R66A 3RRMB 4DQKA 2NXWA 4R7TA 3OG9A 3IHKA 2WJVA 2R7KA 2VHCA 5CHYA 4O02B 4WBNA 5LX8A 1V3QE 2OV4A 3VZQA 1N5RA 3C8MA 2XNJA 4YRBA 1BAPA 3B6ZA 1R15A 5ICEA 2WILA 2PBFA 3AZPA 4WNAB 3F8TA 3EF1A 4DADA 1DWUA 2JIZD 2XCBA 1MXFA 4CT0A 3C8DA 4EA7A 1TR4A 4R1OA 4MV0A 3R7DA 1Z5ZA 5BXYA 3CTMA 3AVUA 3D6NB 3HUFA 1BTOA 4L4YA 3B53X 1Z8FA 2YHCA 1ZSVA 4BVEA 3AG3E 2W58A 4RW0A 2JC3A 3ZNPA 3EY4A 5AW5A 2PA0A 3RPEA 5HFAA 2VG8A 3D6AA 1ZAKA 4CMCA 2XGJA 5DNUA 4HGYA 3FMPB 5I7OA 4D6YA 4X8LA 1U0NA 3GLHE 5PGMA 5HCUA 2MYNA 3KXIA 3RSFA 4TL7A 3T5VA 3DSTA 1Z0UA 5AVTA 3ZTYA 1VG9B 3H9BA 2YRXA 3CY6A 4D7AA 2XY4A 2WIAA 3BFXA 4IS3A 4QGSA 2WM3A 1H0RA 1QCYA 5IFKA 2IPOA 4LF5B 2O8BA 4BZWA 4LRYA 5ALHA 3UBMA 2PGOA 4GA1A 3I9FA 3K31A 5CERB 4L5YA 3P2OA 1F2TB 2DPLA 3FH7A 1G6KA 5E7MA 2EQAA 4XGIA 1DRVA 1JUQA 2R8OA 3PI7A 1Q7TA 1PGPA 3FVWA 1S2LA 1U3CA 3T15A 3E5MA 3AVOA 2ZRNA 5DN6A 4RCZA 3BG1B 4PRZA 1NXPA 4B0OA 3MGAA 4B48A 5CCMA 2X41A 5JD4A 3FROA 4D82A 2ZZMA 3TWRA 4TN1A 1NF3A 3EQ7A 3FLBA 4XGQA 1DWPA 5JJKA 5BVGA 4JC4A 4IHJA 3E61A 3N2NA 3KSMA 2Y1GA 5ETJA 4U96D 3GUCA 3VNRA 3EUVA 2JJ8A 4W7HA 4IDFA 1XDSA 4LHEA 3IAEA 3SMQA 1V1RA 3W6NA 1QO0A 1A9RA 5AXBA 2Y0PA 3TMAA 1BRMA 1PJRA 3D2BA 1H65A 3K53A 1QYMA 4B17A 3C3CA 4DMRA 1ZGCA 2YZMA 4HGQA 1E2PA 5H02A 1APBA 3MT7A 4ACBA 4LMPA 2ZAOA 4KRGA 4KIUA 3LY8A 4Y67A 5ADUS 3AP2A 4ZVPA 4D4IA 3PXUA 1I9CA 2ZSEA 1JEDA 1U2PA 1VIAA 1YV9A 2XQJA 4XI0A 2X8JA 1E1DA 4LSGA 4OBXA 2QA5A 5EWMB 2NNLD 5A03A 1P4HA 5T4HA 2ZR7A 3IJRA 3MJSA 2VNSA 3OEHA 5ITSA 1ZUHA 1XTTA 5FI0B 3VKVA 5IMBA 3IDSA 4DJDC 3PDHA 3O38A 4MHOA 2VPIA 3G2IA 3L8DA 1N94A 2GDZA 1EVIA 3EA0A 3CVLA 3GT7A 3HXCA 3ZHTA 4HLDA 5JS7A 2B7CA 5EKQD 4PHHA 1Z22A 3FUNA 4LZJA 1YDWA 2JLYA 4MGZR 3ZS8A 2M1XA 4JLDA 3PBKA 2B82A 4J03A 3ADBA 2WU0A 4S3MA 1XZPA 4RK0A 5B7QA 3P5BA 4AS3A 1NLFA 3F73A 2X8WA 4WLVA 2UZIR 1X38A 4B32A 4NMXB 1GR0A 2P78A 3M9WA 1XPUA 2P9IG 4H15A 4PZAA 4M9SA 3F9CA 3TR5A 4D0LB 2APJA 3S6JA 4A3VA 1ISRA 3PVCA 2NOAA 2UVPA 3TKLA 3ESXA 3RAGA 3M49A 2C00A 1AX9A 4JU9A 1KRXA 1ZISA 1E20A 4FJYA 3M1IA 1U90A 1P45A 1VBNA 1ZCJA 2C98A 3SOPA 4NBRA 4I4IA 3OMWA 5FA8A 3LHDA 3OXGA 1HNNA 1LF5A 2AFRA 4ETMA 1ZHOA 5HKAA 2I65A 2H06A 3D2LA 3HBFA 3VLDA 4YRPA 3PXDA 1U7OA 2ZIAA 2Y9PB 4BTLA 1E1MA 3AYZB 3MBIA 5DH9A 1Y1LA 3GIDA 1LBTA 4J0EA 1T15A 1R4NA 1WOYA 2V55B 4ZI2A 4BAUA 3U3DA 3G89A 4HVCA 3TLEA 4S05A 1BJRE 4X9XA 5KVQA 2G8NA 2ZS7A 2DMRA 1ZQ9A 1W96A 5IVDA 2IYAA 3CUSA 1IRXA 3LYUA 3H5RA 4YRDA 3MIIA 3T5PA 3VYSB 1D07A 4IVRA 3ZUPA 1ES9A 1Q21A 3AF2A 1I4OA 3RSOA 3U3XA 2PGLA 5HMMA 3GN2A 3DZJA 2XUDA 1T4CB 5FUWA 1JWGA 5IP5A 2GTHA 2DAPA 3PJGA 4OYHA 2QX6A 2JDIA 2IHUA 4YT4A 3OOSA 2ILVA 1KYYA 3UEOA 4XJXA 2Y0DA 1XPOA 1D2HA 3M9XA 3NQPA 1FTSA 2FA9A 5T6BA 4NAVA 5K0EA 4G65A 4B8AA 2LD4A 3KSBC 5IN4A 3MJRA 3LQ2A 1OE0A 1XBTA 1Y7LA 1JCSA 3DLAA 3JZMA 2XYVA 5I9BA 4O5OA 4LFAB 4ZRDA 2DU8A 2VSOA 5D66A 5G4LA 2CL0X 5J23A 1L6IA 3EHNA 1G5RA 3PQEA 4W5HA 5LKAA 4D8UA 5FYDA 3OIWA 4ZYTA 3FBWA 4WACA 1G55A 1XKXA 1Y5IA 1HL3A 4PS0A 5FQ7A 3JAKA 5KOJB 3KJZA 4JOSA 4B8WA 4QAJA 4MR8B 3CVVA 3ESBA 1KO8A 2H2DA 3GUZA 1CZHA 4LE2A 4CL3A 2P2CP 1JI3A 4OJMX 5KDOA 3PEFA 1ZM9A 2IZ0A 2XODA 3WK8A 5AJYA 2KB0A 5DCWA 4MUXA 2MSWA 3F7OA 4N0PA 2P5UA 2OEWA 1UZMA 2PA3A 3C3EA 5AVSA 4EFKA 2FDXA 4DWOA 3ZHVA 3ONNA 3I8SA 3PZRA 1CIVA 5D7NA 5CBKA 4M1OA 1RVDA 4J8FA 3ZWPA 4RTJA 4D9JA 1QANA 4ENSA 3CZQA 4X24A 4I55B 4TXHA 5JVDF 1L3IA 4E4TA 4YMSA 2GBLC 4YJ3B 5SYAA 4BHTA 1UJJA 4G5XA 4MUEA 4M0EA 1I5RA 3DG9A 3DSVA 3FPKA 1IMOA 2QLFA 2ZQYA 4AKTA 2A9RA 3NVKI 1ZOSA 2VVTA 3WDSA 5JO9A 3ER6A 3QU4A 4N3GA 1KAEA 5T64A 3WS7A 5AJVB 2ZULA 1D8AA 1V25A 3TRJA 4DMKA 1S2IA 5JS8A 1E59A 4RYDA 3I73A 4PC7A 2MYTA 4TGLA 4D99A 4DGSA 1YTUA 2Y77A 4AJNA 3JAWB 3QF4B 2JVKA 5TS3A 4G0XA 3AZOA 4FFSA 1QH9A 4KNVA 1KA9H 2AMVA 4HQOA 4KB5A 5CBNA 3ZQ6A 2YWRA 5CB4F 1VE9A 2ZJAA 1UJ5A 2NZVG 2ZJ3A 4DJ5X 2WU8A 4E14A 1OGJA 2XEHA 4ZU1X 5HDQA 1RLUA 1LVHA 3P2YA 4X92A 1PL6A 3NFYA 1LTKA 2R84A 2H6GA 3IMKA 1FYVA 4O0MA 5EIBC 1HDZA 4BVGA 3I2IA 3P9KA 1GZ4A 1YKFA 4QSHA 3H6GA 5E6RA 4E4RA 4Q9DA 3H6HA 4V1CI 2G0NA 3WHPA 1HXHA 3ONVA 4UUMA 3WG9A 2RK6A 4BEPA 1H22A 5EWJA 3CRW1 3NGMA 3W6ZA 3N2KA 1O4WA 2P77A 3EDYA 1E9SA 3UM2A 1X8KA 3BWVA 3LLCA 3A6GA 5E6UB 1F17A 3T5TA 5AW1A 2AJ8A 2BM0A 2FXVA 3OPMA 5T4BA 1A4XA 1P81A 2QLBA 3EXHB 4JUCA 5J63A 5J2UB 3GZNA 4FGSA 3QLJA 5FUYA 5G0WA 2I2XB 3RAFC 3U3MA 4GXRA 2BP7B 3KQVA 4UD6A 3NHYA 2J7PD 1K08A 1CUYA 4UVHA 4G84A 3KTAB 2IWRA 2FF4A 1ISGA 3E1KA 1FYEA 4BP3A 3GFPA 1Z4IA 3E05A 2Y1EA 2WXKA 1J0CA 4CL2A 1YB4A 1O87A 3NB0A 3FNRA 2LXNA 1KAGA 1YGPA 1DX9A 4DXAA 5ARCA 4B31A 3UYLA 3O4FA 1MH1A 4MWDA 3BORA 1DKQA 2MSKA 1CJTC 1V8DA 1VMEA 4FI3F 2Z5GA 4ENPA 3WB2A 1MB0A 1GG9A 4ZKEA 4B3CA 3VYRB 4EBBA 3JWPA 4II2A 4L72A 2O50A 2R05A 4F92B 3I4RB 2QSJA 1N5DA 1KOLA 3TQTA 1P3Y1 4WAFA 2VYND 3ENZA 3HZRA 3ZXYA 1ZG3A 5GJCA 3V8NA 4E6PA 3T61A 2J07A 2IZZA 2QMUA 2FPMA 2DKNA 4ZAFA 4AZ0A 1VP3A 1EVLA 2ZBGA 2DY0A 1JN0A 2FLKA 3FMGA 1GZSA 4EAQA 4KE8A 1QG2A 3ZHSA 4ZV4A 1SVIA 2VPXA 1RSZA 1Z34A 5L3RA 1I3NA 5EJ6A 1ZIPA 3MCZA 5AICA 4B7ZA 4ZN6A 4HKTA 4I2NA 3EBOA 3W2HA 3DBHB 3FNQA 3LTEA 5IT0A 4COOA 2ZRKA 2HBZA 1K98A 3IXMA 3N39C 3ZXPA 4E5DA 3T4PA 2XUQA 4ZANA 4U7EB 2UUAB 1XROA 4Q7MB 1IATA 4AWXA 2O48X 4P8RA 3EG9A 16PKA 3HDTA 2RIRA 1OFHA 2YX1A 5FJYA 3EPLA 4ML3A 1QFZA 3RSHA 2BTDA 2FZCA 4X61A 2BGKA 1T9AA 1LKZA 3DXKG 4X7BA 3ZHEA 2ONJA 1GADO 3A32A 5SV2A 3HR8A 1ZMTA 3QE9Y 3FZNA 3SYMA 4AXBA 3LXUX 5H9WA 4FNMA 3M1AA 1IBCA 5AQ1A 2H1CA 1XNJA 3A8TA 5D2CA 5CLQA 3AR7A 4Q93A 1ADCA 4XKCA 3IP1A 1KPSB 3VLEA 3S70A 1HLGA 3NHJA 4INOA 4D2IA 1W0JD 1OBFO 4BL5A 5LP6B 4RETA 4GX1A 5A6VA 3O75A 2C4MA 3C3XA 4G67A 2Z6VA 4HC4A 3WQQA 4ETIA 5FBKA 1C41A 3VDRA 5CT5A 4KXYA 2AG5A 4MKFA 4XYBA 2JFFA 2WT9A 2Y1XA 4KMSA 1CF2O 1DJMA 2AEJA 2WEKA 2HM8A 2X0DA 5ALIA 2R4TA 5FQ8A 3LUAA 3PUJA 5BWNA 2NVBA 4MVWA 1M54A 4KE6A 4BO0A 3T5CA 1G18A 1FDOA 1W29A 4IXNA 4FEGA 3SLKA 1VI6A 2WWGA 4FOTA 2OOKA 4FONA 4ZYYA 4KPEC 1E8MA 1VIVA 3BUSA 4P7BA 1J90A 1SM4A 4RY9A 2P35A 1H4TA 1K4KA 5BYKA 3VGJA 3OFSA 3EIXA 1L5WA 3AFNA 1D6MA 2VGEA 1X14A 1ENZA 3K35A 1ESMA 4BNIA 3B13A 1Y5RA 1DEOA 3CSFA 3AOEC 2CCJA 4MZXA 5ADVA 2H1WA 4LG6A 1FLDA 3DZFA 3HCRA 3MV3B 1BEUB 4OIMA 3EGXA 1RLMA 3E7FA 2AXUA 2QTMA 1RXUA 4FU0A 2FQWA 4BDSA 1Y7PA 2CFRA 4HAUA 4M88A 1UT8A 5LZ9A 1RPJA 1BEZA 1H1LB 4EG3A 5D85A 5CH5A 1P5ZB 1NVFA 4RL6A 1BD3A 4WBXC 4TQUS 5EE1A 2ZI4A 3BB1A 3IV9A 5KJFA 2NVOA 1HX8A 5DMXA 4NU0A 4JUFA 3Q47B 5CXQA 5GMOA 4FZ3A 5REQA 3WJ1A 1QRUA 3HHMA 4TL9A 3B6KA 1P7PA 1RZUA 3A25A 3L0BA 4FT4A 3F47A 4Y9TA 5COAA 3UATA 3DMHA 3KX2A 5GGXA 1UJBA 3L5KA 1NT4A 2PQ6A 5FBQB 1KJJA 3EULA 1RQGA 1CJBA 4W8GA 3OSUA 4EO9A 2QTCA 5K99A 2OO7A 1P0PA 4IJUA 2IEIA 1GCUA 1YDGA 2JIMA 4J7AA 2W0SA 4HZIA 2DBRA 1R6TA 2Y76A 4RZSA 2IDMA 4NE9A 2WJHA 4LWQA 4TT8A 3BS4A 1ZJZA 3AM1A 2ZE7A 4LC0A 2ZRFA 1PL0A 3SD5A 3S1LA 3WGGA 3CNOA 5BWOA 2B2NA 4HXGA 3EXEA 3MT8A 5J58A 2QM7A 1NASA 1WETA 1IUPA 1QZXA 4U7JA 5HYVA 3U4QA 2H7VA 1MOPA 3AR4A 5DWVA 4TS3A 4Z8YA 5NLLA 4NPCA 2WKPA 3NHMA 1LPSA 4Q1VA 421PA 3DNFA 5TPWA 4MQ4A 2C77A 5CMWA 4QOFA 3UJCA 1GP2A 4K03A 3VPHA 1HOTA 4DMUB 1DUIA 3AIMA 1OWNA 3QWIA 4MJ7A 5KQRA 1IAQA 4ZU6X 2EP8A 1UJKA 3PNVA 1SCKA 3GJQA 3VJMA 1EA5A 3ZYQA 3CSTA 2OZPA 2NUTB 2ZI9A 4UBJA 2X42A 1NVUQ 1X9HA 2YWGA 5ALPA 1IWBB 3ESDA 4B4KA 2XTNA 5SZIA 3VR4D 1OBCA 3J80A 1G98A 3MJCA 3LVRE 3VR3A 3LL4A 1LUAA 1WD5A 1UMCB 5CCDA 3I6YA 1PW7A 2EINE 3RWBA 3QKSA 3U62A 1VL5A 2I8AA 1M2VB 4YH1A 3KAJA 2AXNA 5DTEA 4JZKA 2GPWA 2L82A 3TXXA 2XDQB 1SXJA 2G9NA 4L9SA 1L3CA 2PXAA 1G63A 1WUJS 4OMUA 2P6NA 1CLEA 1N2JA 1QHHB 3ASOE 2P2NA 3WZMA 3M4NA 4BO1A 1Q17A 3VU8A 3KSUA 4CYMD 3BIWA 3D54D 3BMXA 3LU1A 4QBKA 1UM9A 1VKZA 2HRCA 2JIDA 2CXNA 3CVJA 1GPWB 4PVCA 4RULA 2GEBA 4PLVA 4GWLA 5JCOA 1AGPA 2XVXA 3UI2A 4FYMA 3ESYA 1MJHA 2R02A 4RGYA 4TTIA 5IF3A 3R0XA 2VP4A 5FR2A 1P1FA 3ET4A 2BFCB 2R1VA 3P2IA 3IVXA 3MWEA 1FU8A 4GMDA 2QL7A 4EKNB 4O2AF 5EXTA