2XGMA

Substrate and product analogues as human o-glcnac transferase inhibitors.
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
512
structure length
512
Chain Sequence
PEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 190
structure length 512
sequence length 512
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgmA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgmA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgmA02
1SXPA 2VSYA 1P4JA 3L7DA 3FFLA 1EM6A 2VQ2A 3Q4AB 2QRMA 1JIUA 3T7DA 1ZBPA 1Z6PA 4I1AA 5C1DA 4J8DA 3U4TA 2HO1A 4BTBA 1YA6A 1PYGA 3ZCUA 3DDSA 4W9RA 2HR2A 3L7CA 4G24A 2IFUA 3AS8A 1FA9A 3BEEA 1PNVA 2VGXA 4H7YA 2IF4A 3CEMA 4RIFA 1NZNA 3ULQA 5CCLA 2UY1A 4I2ZA 4UI9C 3T5TA 3C4QA 3QWPA 2QN3A 3UPVA 5I45A 3VDMA 4KYOB 3S7BA 2Y4UA 5ARGA 2WQHA 1YA0A 4G2VA 4U04A 2ONDA 5EKQD 3C48A 1IXYA 2KS6A 3HBFA 3ZFWA 1JEJA 2XA1A 4CTNA 1E4OA 4X7PA 2C1ZA 1SXQA 5D00A 2VSNA 2PQNA 2IEGA 1A8IA 7GPBA 3S7FA 1JIXA 1P2BA 2QN1A 4U0ZA 1YGPA 5D0QD 4XIFA 4M83A 3ASHA 4GZ5A 5M72A 2LSVA 3GYZA 3NAZA 2XGOA 2XA2A 5EX0A 3MS4A 3T3DA 3QWWA 4X7RA 4ME2A 2F3UA 3NF1A 4LEIA 5JJ7A 1L6IA 2YHCA 3MA5A 1GPBA 4UI9J 4ABNA 3G2NA 1L5SA 4U0SA 5A6CA 3E3OA 3QOUA 2GT1A 2YJNA 3S29A 1XNFA 4F96A 1WM5A 4J8FA 3G2LA 3L7BA 1Y6GA 3S7DA 2BISA 3CUVA 1QZ2A 1UQUA 5BW8C 5ENZA 4AMBA 3Q49B 2GPBA 2GPNA 3OTIA 1L5WA 4N3CA 3BDAA 3MV2B 5TVGA 3UYKA 3Q3HA 3S7JA 2IUYA 2QN8A 3IEGA 4GZ3A 3LY8A 5G05C 4HOSA 3RHZA 1KTIA 2FI7A 2X0EA 5DBKA 2QLLA 4NC9A 1XKXA 3ZGQA 2ATIA 4BFCA 2GEJA 2XA9A 3G2KA 3ASGA 3L7AA 2IV7A 1PC2A 1L5QA 4HORA 4KXKB 4U0UA 3S27A 4GYYA 2X6QA 1NZDA 2G9VA 3ZPJA 1RZUA 2O6LA 3T3EA 1P29A 5JJTA 1FTYA 2XMPA 1KT1A 3T3IA 2G9QA 1Z8DA 1HZ4A 5AYWD 1HH8A 1C3JA 5FZQA 1GG8A 2E2EA 4N3AA 3BD8A 3FROA 4MI9A 5FZSA 3JYSA 3OTHA 2H1FA 3MQFA 2HY7A 1RRVA 4GYOA 4APOA 2P6PA 1P4HA 2F9FA 2C2LA 5HQ8A 3CVPA 1UZUA 3MTAA 5LQDA 3QWVA 2XCBA 1QQEA 1XOIA 4RG9A 3Q3EA 4B94A 3MT7A 1NA3A 3H4TA 4LDPA 2WTXA 4KQ2A 3S28A 3ZCQA 3E3NA 3OTGA 2FO7A 5TMEA 3ZCTA 2G9RA 2P58C 1WUYA 3D1JA 1P2DA 3OKAA 3BCRA 5TMBA 3CK7A 4CDRA 4RENA 1ELRA 2HYZA 2OOEA 3MS7A 4UQZA 3OT5A 3CK9A 3KS2A 4CGVA 4G1TA 2XPIA 1NA0A 2QZSA 4X6LA 2SKCA 3AS4A 2XCCA 1B4DA 2AZDA 4WNEA 4GA0A 3CEJA 4G26A 2C0MA 4RBNA 2PYDA 3URZA 2XEVA 4GA1A 2IEIA 1L7XA 5G04J 4N3BA 4GPKA 5G05J 3SZ7A 3TSAA 1E96B 2H1HA 1E1YA 2F3SA 5JTUA 2QN7A 1ZU2A 2SKDA 3VTXA 3G2JA 3UYLA 3CV3A 4GZ6A 4HLNA 3U3WA 1K06A 2JJMA 4AMGA 3ZCRA 4EL5A 2C9ZA 3ZCSA 3ZCVA 4Y6CA 3BD6A 4LEUA 2QN2A 1J39A 2R4TA 3NB0A 3R9AB 4EQFA 3COPA 3MKRA 1LWNA 2GPAA 3ZHEB 3N71A 1L5RA 2FETA 2Q7FA 4KBQA 1WW3A 9GPBA 3HBNA 2XGSA 5CHEE 2YQ8A 2LSUA 4UQXA 3K9IA 3LKUA 2R68A 2PRJA 4MICA 2FBNA 4GCNA 2C0LA 2BGUA 2LNIA 2ACVA 5HI7A 3T3HA 3KAEA 3RU0A 1O6CA 3RSCA 1KT0A 5ARFA 1NOJA 2Q6VA 3UQ3A 4IN3B 4BWRA 4M7PA 3PDNA 5FTPA 4HOUA 1WV0A 2IV3A 3CVNA 4J8EA 3RO2A 1F6DA 4NRHB 1GZ5A 4H7XA 1GFZA 3NP7A 4BT8A 3VDNB 3LCAA 3EDTB 1A17A 2KC7A 2JLBA 2XCIA 2QRHA 3OXFA 3FWVA 3CKCA 1NOKA 2AV6A 3ZN3A 3PE3A 3MS2A 1OUVA 2PRIA 2GW1A 3GZ1A 4BTAA 3QKWA 3CEQA 5DU2A 2SKEA 5KJNA 3LPZA 4L22A 3TG5A 3ZHEA 2V5FA 1FC0A 3AMVA 4YVQC 1P4GA 4MHOA 5A7DB 3FP3A 2FFRA 3ASDA 2BGTA 4EL0A 2DBAA 1GGNA 3CUUA 3E4BA 1PSWA 1C8LA 1IHGA 1LWOA 3LYAA 3IAAA 4XI0A 4QLBA 2UWJG 1P5QA 3TOVA 1QKJA 1AXRA 3MRTA 2PZIA 1FU4A 4BQEA 3ZCPA 4PQGA 4WACA 4HWGA 3TGOA 1GPYA 6GPBA 2R5SA 3EBPA 3H4IA 2XCUA 3L79A 2GEKA 3WXXA 4RIHA 4J0UA 1FTQA 3WAGA 4RELA 4GYWA 3TAXA 3MRXA 3RSZA 1Z62A 4O6FA 2X6RA 2R66A 3BCUA 2BFWA 4JA9A 3MRVA 2XGMA 3SF4A 4MRAA 2R60A 3T3GA 4UI9K 2PQRA 2MHKA 1JIVA 1FU8A 3S2UA 2QN9A 2AMVA 4EKYA 4CTMA 4WHMA 4W6QA 4WUYA 5JTTA 3Q47B 2PL2A 3CEHA 5KJMA 3TG4A 1K08A 3OKPA 1WAO1 4A1SA 4GCOA 3QDNA 4BT9A 3BD7A 2UY1B 4I9EA 1C50A 4I17A 2FF5A 2VCEA 4F97A 2KCVA 3HYMB 4XI9A 3ESKA 4G25A 1GPAA 1VGVA 4YVOA 3QKYA 4REMA 5FJYA 5DLDA 2G9UA 3MTBA 4BQFA 4RIEA 4RG6A 2KCLA 4HOTA 3G2HA 3OKCA 2VYIA 4NQ0A 1XV5A 3CVQA 4X7MA 4N5CA 5KJLA 1BX3A 1NLMA 1M5RA 4EJ2A 3LY9A 4FZRA 4G2TA 1W3BA 3OY2A 1HXIA 4CTOA 2ACWA 4N2QA 3S0JA 3EBOA 2NC9A 2QRPA 5EX3A 3OY7A 3UUXA 3WC4A 5KJKA 3VUFA 4BQIA 1Y8ZA 5FZRA 3WADA 2F3QA 4YNDA 2QFCA 3CV0A 3D0QA 3CK8A 3NCHA 2R4UA 3MT9A 3RT1A 5CCMA 2ASVA 2QRGA 1Y8MA 1JG7A 3MT8A 4NESA 5GPBA 3DD1A 4CGWA 4Z5XA 5DIZA 3GPBA 3MBOA 2FEZA 4MI3A 2QLNA 4JL0A 4YUAA 3CUYA 3SYMA 3SYRA 2KATA 4N2SA 3RKVA 2OFFA 5JJ6A 1KLXA 3IA7A 1IIRA 1V4VA 1C8KA 3E3LA 1FTWA 3GZ2A 3Q15A 2BUGA 1Y6FA 2VGYA 3O3CA 3MTDA 2J9QA 2KCKA 3PE4A 3MSCA 2C4MA 1NZFA 3CUTA 8GPBA 4WNGA 2VCHA 3NC4A 3AS5A 3QHPA 1H5UA 3VTYA 1WW2A 2Y4TA 1NOIA 4GPBA 3OXLA 3MEKA 4AM9A 4AIFA 3RJVA 1Z6QA 4AY6A 4Y6WA 3DDWA 4HOQA 1AHPA 4UQYA 2ECPA 4GA2A 4N39A 1P2GA 1QM5A 1NVKA 3Q3IA 1HLFA 1WV1A 5DXFA 3NPAA 3BCSA 1B89A 3VUEA 4AN4A 2IYFA 1JG6A 3OXGA 4NEQA 5HXAA 4M60A 4MI6A 1EXVA 3CKBA 2IW1A 2PQ6A 4KQ1A 4F3VA 4N9WA 5IKOA 2X0FA 2VGXB 4YI3A 1ELWA 4WNDA 3ASFA 4FKZA 3L01A 1RZVA 4I2WA 3CUWA 3RO3A 4I9CA 1XL0A 5IKPA 4AY5A 1XL1A 3LY7A 3HBMA 3CVLA 1UQTA 4KQMA 3CX4A 3G2IA 4F9FA 1F0KA 5FT9A 3D0RA 1PN3A 2IYAA 2FF4A 1WUTA 3NP9A 5BT1A 5D01A 2QLMA 3KD7A 2L6JA 1FCHA 2JZCA 2F3PA 5TMDA 3HBJA 5G04C 2AVPA 3C4VA 2ZB2A 2PYIA 2QNBA 5BNWA 4G23A 4EKEA 4WADA 3DZCA 1IYGA 4YI5A 3MV3B 2X0DA 2VG8A 4RIGA 3GUHA 1FU7A 2I6HA 3O48A 3BEOA 5D0OD 1ABBA 2C1XA 2GJ4A 4JA7A 1XC7A 2QRQA 4MHSA 1TJCA 4WNFA 2WPVA 3Q5MA 4JHRA 5LCWJ 4RIIA 4U07A 1FS4A 1L5VA 2GM9A 3RIBA 2AW3A 3GW4A 5LCWC
chains in the Genus database with same CATH superfamily
4P7FA 1SXPA 2JAQA 1M83A 4C48B 2IZ5A 2O2GA 2ZJ0A 1TK2A 1SHUX 2BONA 2PMWB 3B9RA 3JXEA 3KVYA 4Y7DA 3VZQA 1JFRA 4LFBB 2NADA 3QB2A 3L43A 1PVDA 3U1VA 4FXOA 3QXSA 4DNFA 3JQCA 3ZWDA 3GLIA 2TSYB 1XZIA 1GPUA 5AM3A 4C0BA 4FT4A 3ERCA 1BCRB 2YHBA 1MC5A 2CHZA 3JQ8B 1YDGA 2D2EA 4I81A 3LGAA 4ZYUA 2E1PA 4G24A 4TWZA 2P41A 3OHMA 3QBJA 4XDYA 5EJ2A 4WUTA 1NMQA 4MW9A 5IHXA 4RVUA 1HNXB 1G8SA 1K88A 1E3EA 1UQRA 1FRQA 3AJIA 1UXIA 4GE0A 3W7VA 2HTFA 1ZIDA 3NXSA 4CF5A 5ES4B 4KB5A 4DCPA 4F2WA 3FW1A 3O26A 1KRHA 4H0FA 3JD1A 2IU4A 2BKKB 2HSWA 2KS6A 4G0MA 4IR7A 1RC1A 4INJA 4D8TA 4RQAA 5KQPA 2Z04A 4PTYA 4M9QA 1R8JA 3HVUA 4G4IA 1EP3B 1L2TA 1E4OA 2XA1A 2BKGA 3LP6A 5F23A 5HIAA 5CH8A 4GG1A 1KAOA 3L0YA 3I53A 1L9XA 3ZWVA 3CGWA 4TYYA 2FH5B 2QTBA 4Q4AA 3JZFA 2A1UB 2P9IG 1EQ2A 3SE7A 3FLEA 3OEHD 5AVZA 1JG3A 2XY4A 5EIOA 5IC6A 3AO0B 3WGQA 3WLEA 5CGQB 2D8MA 1OI4A 4KE7A 2E7ZA 1OAOC 4JSYA 4DEVA 5AVRA 3D3WA 4MV8A 3NF1A 16PKA 3STTA 1IN4A 2YHCA 1R5BA 3EIEA 3RIEA 5LNK1 2ST1A 4K6HA 4TUYB 1URPA 4U0SA 4RVSA 4TKZA 3O75A 3S29A 4KOEC 5AJDA 1KEWA 3THYB 4UULA 2DRIA 1AP7A 3RWBA 1A4XA 2HO5A 2BISA 3Q9LA 4R84A 1ENOA 3EGDB 4RJIA 1U98A 3HSYA 5TX7A 4JC5A 3SQVA 4EHLA 2XQGA 1GKYA 2OZLA 4IIYA 5LA6A 1F4LA 1IBMB 3KP1A 3SMVA 2HYDA 1UBRS 2VHQA 4F3CA 1LZKA 2QXTA 1XMQB 2PSEA 3MKQA 1TA0A 3DAYA 4L3OA 5CNKA 3C97A 4KGXA 4HB4A 5EXEA 4XGNA 4LYFA 3TQTA 3SR0A 1AV6A 2PH3A 2AYXA 1OYYA 4PRLA 5CA1A 4DB4A 3KDPA 2GBLC 5B2FA 2AXQA 2PO7A 4NMHA 1POWA 2IPMA 1NUSA 4ALIA 4RK4A 3KETA 2GN8A 1V6CA 2RIPA 1BHQ1 4AY3A 3IBTA 3JUIA 1VKNA 3P9KA 2C3MA 4TYMA 1N5DA 1RT9A 3Q11A 4XD7D 4YCCA 1Q22A 3IR6A 4FFPA 1PEKE 1L4HA 4L9RA 5LQJA 2PZJA 3AKDA 3KM0A 1G5QA 5CVTA 3PH0C 2NXPA 3FGZA 1C3JA 1OFHA 2Q5HA 3UKUG 1CZUA 1ZM3A 4PAQA 1CS0B 2IYNA 3QBDA 1ZIXA 4MI9A 4PG7A 4RE6A 4W1RA 5IAGA 3WGJA 5JPCA 1XZ8A 5ALTA 2UYHA 2UZ1A 4HB2A 2HU5A 3MUFA 3N2LA 3AVTA 4OJNA 5E9WA 2H1FA 1CUEA 3QEOA 4MHTA 4M1EA 2UV8A 1PG5A 4P7GA 2I8AA 4RTNA 4DSNA 4MVYA 5LXTF 1O0BA 4KGZA 2XCBA 2DEUA 4J1TC 1K5PA 3NIBA 1YXMA 3RJZA 5EMJA 2WJPA 1Y9EA 4K9MA 2XLBA 2RHHA 3LWNA 1K8KG 5ALYA 5AQ1A 4ZOCA 4LCJA 1ZVJA 1HDYA 3I2FA 2Y1FA 4KXNA 4UDXX 5E9JA 1OHHD 2M98A 3COZA 4HFJA 4XARA 3SQOA 2WSSD 1Z4JA 2YXPX 4F8EA 3U4MA 2PWAA 4HWPA 3OIGA 4Z2YA 2PSJA 1TF5A 3U4GA 4LK3A 2FX2A 2CXXA 4IV0A 2VF8A 1C7RA 4AKGA 4X63A 2VF2A 3RC1A 1MUUA 4MGYR 4NS4A 2JD1A 3KU1A 1ISSA 1CZLA 2IJGX 3G8DA 1NASA 2VYCA 3JTMA 4WNIA 3D7KA 3RYIA 4L8FA 2AZDA 4WWPA 1AGNA 2BE7A 3AONB 3I9KA 3Q8XB 4M1YA 3WGMA 5I7VA 1YR2A 2FN8A 3GUUA 2XAUA 1DO0A 2QXYA 1TNBA 3ZJVA 3HABA 3G0OA 2OILA 3HPRA 1OFGA 4JR0A 2OBYA 2CNKA 3ICPA 5AXCA 3LJKA 4MARA 5BO5A 1IDN1 4N3BA 4PGMA 4TQGA 3FWKA 2YY6A 3I92A 2F48A 4BKRA 3M89A 4C5AA 4BQPA 5BOSB 2GAFA 3DAOA 3C5VA 1F3OA 2FFAA 621PA 2FWMX 5K4AA 1YNOA 3ETDA 4B47A 3U66A 1XB2A 2F9LA 2I4RA 5JI2E 3FFBA 1GUBA 2PKWA 3CPJB 1MIOB 1VTKA 1H8ED 3GZNA 3QLUC 4KYTA 2E85A 4B71A 3I61A 2BF7A 1LW6E 2ZRDA 3PPIA 3FYTA 3OOSA 3SZMA 4PHFA 2JB9A 5TF4A 1YHNA 1Z3XA 3CUSA 4OLJA 4L7TA 2LCQA 4XYMA 4KUEA 1J39A 2P2SA 3B9QA 3KQPA 3HKDA 1O95A 2WQZA 4RD0A 3BMOA 3IJEB 3DKKA 4UTXA 3BM5A 4BVEA 2XKJE 1KZOA 4DCUA 3ANNA 1P75A 1GRRA 2CE2X 1W36B 3N71A 1YDEA 2IHYA 2PMFA 3CLTD 1P62B 2IT1A 3B7GA 3FRHA 4BNVA 5AESA 5KNDD 2PM6A 3DZ8A 2KBEA 5D3MA 3R7LA 2YWBA 2CDCA 3DXKG 2GCOA 2GF2A 2YQ8A 1RYNA 3EZ9A 4C2UA 1JNYA 1SXJD 2JDIA 4UQXA 2B2XA 2ZGGA 3G1WA 1R0ZA 3U3KA 1ODKA 2BGUA 5HCNA 5TS3A 4IFBA 3ET4A 2HA5A 3WIBA 1NOJA 1U0HC 1OLXB 1U0TA 3UQ3A 3CJQA 4L27A 4M7PA 1Z6AA 1A0OA 4WA8A 5IBQA 4ACAA 1ZWKA 4B82A 5FUQA 2OZLB 1YL6A 2VF4X 5BRJA 3G5AA 3RJ5A 2CEAA 3FCEA 5KWEA 1I8TA 1X1AA 3RO2A 5FCDA 5AI8A 4OP3A 5I5GA 2I6QA 1HG5A 2JGDB 2AHOA 3QKUA 3F97A 1KFJB 2J48A 3JD2A 5F21A 1W4AA 1WTCA 1T3SA 3LBFA 1CUCA 2GCIA 5K03A 2KC7A 3CRQA 4WK0B 2JLBA 1AHHA 4OQYA 1P2TA 2RGNA 4EENA 4D0SA 4RGVA 4L5AA 1ZJZA 2WJHA 3FMPB 2JGAA 5DGDA 2PWYA 3KAJA 4CFSA 3IULA 4IV5A 2WM9A 3TRJA 1XQ9A 3HH8A 1QDEA 3WSWA 1FFHA 5GMOA 1D4AA 3CF4G 3DDNA 4ARCA 3EMBA 2V5FA 3V33A 3DW1X 1VCOA 4TM8A 3WHIA 2ZJZA 1B6SA 4I9NA 4JH0A 4G09A 1ORHA 2WB2A 5KTNA 1V2GA 3IT1A 4JVLA 3AKEA 3FYDA 3M9WA 3NYIA 1QCDA 1ISFA 1COWD 1DDIA 2I1WA 3OCWA 3OQMA 2BFCA 2CYBA 1Z4PX 1TRKA 1R6TA 4AVXA 1O03A 2GBLA 2QE6A 3AXSA 3EFBA 3JQEA 2KBXA 1XA4A 1JWGA 4DIKA 4Z4EA 4XIYA 2A92A 3EC1A 3FFTA 3QNUA 3E34A 4MQUA 1D1QA 2QX6A 3TOVA 4E15A 1AXRA 4R6XA 3HYNA 1GITA 2FHPA 3MRTA 1WCIB 2EJBA 1I3OA 1LTHR 1OAAA 3BPSA 3CVJA 3KPUA 4KIUA 2CHUA 3K5PA 5LX8A 2C1EA 2EYQA 1XFAA 3KT3A 5I51A 2OP1A 4QU9A 3U37A 5ENQD 3VAZA 1U1GA 2O1XA 3C24A 2WJAA 1B42A 2DH6A 3HEBA 1K2VN 2GN0A 2HSZA 1XVUA 1LTQA 3WAGA 2EKPA 2YL2A 3G8BA 2HHLA 1BMQA 4IIJF 3L02A 4MWSA 1XCGB 5CVEA 1AQ6A 1Z62A 3GXOA 3WRVA 4G56A 2QRZA 3BCUA 4K3VA 4M2LA 2CK3D 1N7JA 3KFXA 5D84A 4BZPA 4JA9A 2CVQA 1WDYA 1CNMA 3AFIA 2DT8A 2UAGA 1VKRA 2GQ0A 3OX4A 3Q4GA 1HQCA 4LBZA 1HX8A 1PJZA 3CNEA 1E1RA 4YO8A 2WPDD 1SUSA 3KDSE 1BRMA 1CEYA 3KV3O 4ECAA 5A3QA 2AXZA 2QBYA 2WNSA 4EKYA 2A7XA 2XGJA 4ZPXA 2AKAB 4G1BA 3ZIDA 3UJCA 3B2NA 2V54A 5KOHB 3OQNA 4ZOBA 3GR6A 1QOQB 3M5WA 1ECJA 4RPHA 3AL0C 1JG2A 3M6AA 1GGMA 3ENVA 4RU1A 2Z2XA 4GM0A 5E6SA 4BDTA 3WLJA 3RAPR 4DQKA 4O60A 4JU9A 1HURA 4DNOA 1EVEA 4LYGA 2HLDD 1SCKA 3F3SA 4ZQEA 4JXTA 4HDMA 1TEZA 4L2LA 4I1OB 3M4YA 4KNWA 4BQFA 3VA7A 2B8EA 4JLOA 4DA0A 3EDYA 3G2HA 5BPHA 4HNSA 2MCFA 3OJFA 3AUFA 3PFGA 3IODA 2WSMA 3K9QO 1PR9A 3MYYA 4GSYA 3RK4A 5JH7A 3D2AA 6AT1A 2CJFA 5ECYA 4TV9B 2CMKA 5J59A 1BX0A 3L77A 4RD1A 1ECCA 1L5OA 3ME5A 1GNSA 5EJ9A 2EATA 3I76A 1VDMA 3D6VA 4G2NA 1E2NA 1UOQA 3TWQA 3MIZA 3IKTA 3PEFA 5FJIA 5LJIA 4QL3A 2PSFA 5KJKA 4G6ZA 2PUVA 3GGSA 5DNAA 3DEFA 3W9SA 4Q4HA 3JYQA 3TZBA 3WADA 1NVMB 3DSVA 1AF7A 1G2IA 3AV0B 1T4CA 2F3QA 4M1WA 3A9VA 3MSXA 2ZYIA 3EUEA 3ASZA 5ECWA 2JKVA 1IKND 1T3TA 3EOZA 3G5LA 2O05A 3KOZA 5LMUB 4ILHB 3JYNA 4ER7A 5JS2A 3KL4A 5KNBH 2JKYA 3U44A 1OLXA 4R2JA 4BU0A 1RNLA 1Y8MA 3ZBPA 4Z9AA 3MT8A 2HIHA 5C80A 4RQIA 1QF9A 4G89A 8OHMA 1G5TA 3VBCA 1ISIA 2M6SA 1ILWA 1X7XB 2PTGA 3H1PA 4U7GA 5CT6A 3WWZA 4LQDA 1ZAYA 5FJJA 5G0TA 3MBOA 1TTPB 3RC7A 5IG2A 3KVNA 3ZIMA 4KQ6A 5GWXA 3CUYA 4RJTA 4HQDA 2VDWB 3BGDA 4B89A 1C4WA 2Y1KA 2YFYA 5FBWB 2H2AA 5T8KA 3TI7A 2BH2A 1G3UA 2FFJA 2OKCA 3Q8LA 3NBYC 2V7VA 1JL3A 2VHUA 2BUGA 5FA8A 1F7VA 2VZ8A 5EERA 2NVUB 4P93A 4R5MA 4DV4B 5CRVA 1Y6FA 1W46A 2DWQA 1SIWA 1Y3BE 3UWMA 1NBME 1ECFA 1S01A 1SKQA 2XMDA 1PNTA 1Y63A 2AOXA 2EWMA 2NU6A 2QD5A 1NN3A 1SHJA 3DAGA 4DR1B 2CLFB 1WUHS 3ILHA 3HXFA 3B1VA 5JWOA 1FFXB 2EC5A 4Q01A 4IMPA 1QZUA 2C4MA 2XT6A 3V8PA 3TW6A 1PJAA 4FP9A 3G0BA 4E2XA 4TRRA 5I7WA 1DO2A 1P8JA 1ZGAA 3QUAA 2R00C 1WW2A 4K6CA 1O57A 1OBFO 1JDBC 1Z0SA 4CLXA 4AY6A 4X61A 3P9XA 1E63A 1X19A 1NI1A 1T34A 1XZEA 2CYAA 2Z09A 3V7WA 1Z2OX 4DLPA 1P5HA 3A70A 1JB9A 1D6NA 3NLLA 4JCOA 3ZYMA 1N6KA 5ALZA 4DMUB 2QDKA 2ZR8A 1WV1A 5DP1A 5CFRA 5IEBA 1UC8A 4EEXA 2I4NA 1DPGA 2QLJA 2R25B 3HY3A 3IEIA 2WFZA 4CQNA 2NMVA 1TEXA 3VUEA 3V42A 1JCSA 3ANYB 4B76A 2DFPA 4BPBA 1U63A 3P9PA 3HE3A 4UBNA 1XNQB 3DEPA 2CXUA 2V3VA 3I8OA 3LCCA 1NXVA 1WXGA 4IHAA 1U8UA 3GBSA 3GL9A 3RODA 3KTOA 1EX9A 1SEPA 1SG9A 3NIFB 4IFTA 1APBA 1Q7CA 3I64A 3PX3A 1GCGA 2VUIB 5E9AA 1U28C 3B7TA 1DKLA 4BEVA 2LUHA 3B7BA 5AICA 4WBNF 2JCYA 1TTQB 1ZICA 2IXBA 4JT4A 3R5SA 1B6TA 4XOUA 4YPOA 5IT5A 4DUYB 3LY7A 4ARBA 4C2AA 1HDZA 2Y3AA 1XSEA 1ZEJA 2F8LA 2WSSA 3NATA 4MV3A 5DLQC 2HSDA 4F9FA 3BQOA 1UOPA 2C2XA 4H7IA 3ULYA 3S70A 2NXEA 2HPAA 2J7PA 4HB0A 1SEVA 4XSGA 4B2LA 3ZXUB 4EG5A 5BNIA 4K5AB 1KZPA 3LX4A 3OJOA 1N8KA 3KD7A 1GGHA 4MCIA 3O8QA 2VTBB 1Q17A 2ZRKA 1U6JA 2B3DA 3ETEA 5TMDA 3QBVA 4LOHA 3ZVVA 1JQKA 5CBPA 2VF7A 4D0NA 1CR0A 4QZVA 4O4IA 4NV1A 2RC5A 5CYGA 5DTEA 1CY8A 4JUFA 3UJ6A 5I5EA 3VNQA 3DM5A 3T0IA 3CC8A 5FQOA 3GC6A 3DBVO 3IQWA 3EDRA 4YI5A 5JPDA 1WBDA 1ZUNA 5DZSA 4GE3A 3KX2A 4IIBA 3L6CA 1PG2A 4TRQA 3RVRA 4WJLA 1J07A 5B7NA 3MJTA 3L7YA 4G4JA 5EE1A 2OO3A 2DWCA 3A9UA 4HPWA 1AX9A 4GB9A 1Z35A 5A23A 3KJGA 4MHSA 2J31A 3R7WA 3ORQA 3ZY4A 1RBZA 2G17A 1EJ0A 5BORA 2XIQA 1DLIA 4URFA 4ZTUB 3NMUF 1Q57A 4PO3X 4ID9A 4BKQA 4LBWA 2IYPA 4OI2A 1PFKA 3E7PA 2AWNA 4TX1A 4X1YB 3T5MA 3VSBA 2I1QA 3ZJ4A 5A4MS 3I5XA 2VSYA 1R10A 1YTLA 1UBSB 1P4JA 3EGWA 1X2EA 4YECA 3APFA 1OXUA 2MSWA 3WGGA 2BI8A 2B83A 2SECE 2P9QA 2VYNA 3BZUA 3DDZX 3ONEA 4IJKA 4J8DA 4R3WA 4DA9A 1ZL2A 3D5TA 4DR7B 3BSSA 4EFMA 1E2BA 2O7NA 4KMSA 1YA6A 1SQ5A 3K0AB 4X71A 4KXUA 1GZ3A 1O87A 4HHEA 3A1WA 3QVLA 2NNLD 1B76A 1FMTA 1MEEA 3L7CA 4GKAA 2ZQZA 1QTRA 3BC1A 1SCUB 3N7UA 3NT4A 2DTEA 4HP8A 2ATEA 1WNTA 4OK3A 3SJUA 3TBFA 3VDXA 1ENPA 9ABPA 4B7CA 4EPXA 1EEXB 2IYUA 2J3DA 3B3QA 4V0MA 1OH8A 2O8CB 3OBBA 4ZARA 3Q7AA 2P35A 3JQRA 4QYSA 3JAWA 4A63B 4JP8A 4KDFA 5K0FA 4MPTA 3A1SA 1AKTA 4Y6OA 3E9ZA 1ECPA 1J0BA 4NBNA 4R7LA 3HBFA 4CIWA 2BM0A 4KRGA 4KDEA 4OUKX 5AW4A 1D7AA 3I28A 5G2NA 4UZSA 3LXUX 1R15A 3AG1E 1J2JA 3MJFA 1VI2A 3OOWA 3P0HA 2XRMA 4X7PA 4BC0A 2VRBA 5EZQA 4GP9A 2AMYA 3NORA 2Q7DA 4EI8A 5IBCA 3EU5A 1P4AA 1T10A 1SR8A 1ULBA 4IS2A 4Y1RA 5JCXA 1KQGA 3Q7FA 1YJAA 4MCAA 1NURA 4MGZR 3LQQA 3GRUA 2XGOA 3RT9A 3UUGA 4OBXA 1F8UA 1S6YA 3OEHA 2Z1NA 4B81A 2OYSA 3MHPA 2G0TA 3HR8A 4RLFA 3MX3A 1W6UA 4ALMA 3NHSA 4A15A 1J1ZA 2O8NA 3P2OA 3QVTA 1TPYA 3QOUA 4BYMA 3GV0A 3J5PA 4IJWA 3PNMA 1JQAA 2M1ZA 2LWIA 4J8FA 1I4OA 1N2CE 1AUXA 4FBLA 3U6KA 2PR2A 1HRKA 4JC8A 4RZ3A 1KH3A 1SA4A 3L1JA 3RADC 2AB0A 2BFDB 3WHPA 2VPQA 1J99A 2PNFA 3F3MA 4ZJZA 1N33B 1S3IA 1L5WA 2P27A 4CU5A 1UMBB 1ISJA 4P3XA 2ZM5A 5KSOA 3M2TA 3WRWA 1P5FA 2W0MA 1F38A 4F4UA 3UPUA 3SJ7A 2VWGA 3ZE7A 2OTCA 3IE1A 4UJ5A 3RKUA 2FI7A 2F1KA 2JH9A 3HA7A 3K0CA 2YJTD 2HWWA 3U9TA 1ORWA 1V35A 3OZSA 5FI3A 5JS7A 5LP1A 1Y8CA 4OAUC 4NQZA 5K1ZA 3UMBA 1ML4A 5BV2P 1F2UB 1TVCA 4P35A 2OA0A 4YRFA 5F1KA 5I01A 4ARZB 1IN7A 1U8TA 4X9XA 3JPYA 4KXKB 2DPXA 4HNHA 1G8PA 4D80A 1X7DA 1EFRA 1AY0A 3N8KA 2IIBA 4KWIA 5CFOA 4LNAA 5EIHA 2OBLA 5JAIA 5C52B 3BG0B 1D1SA 2DECA 2NUTB 2QNIA 2RGXA 3D6TB 4RK6A 1Y7IA 1U3WA 2MJLA 1OXMA 4IXNA 5CNIA 4ALKA 5A4KA 3AL2A 2WF7A 3AFOA 1DAOA 1BROA 1OZ0A 1M6VB 4BPRA 2C04A 3FAKA 3TG2A 3BD8A 3FROA 4JXZA 4F11A 3VNAA 1TN7A 1T0UA 4KE9A 4NBTA 4AZSA 1IHDA 5LZ4A 1XAHA 1RRVA 1H5QA 4Y9SA 5THKA 1NHWA 1SNYA 1KKMA 1X94A 3PCTA 1G3QA 1U9CA 3RRUA 1V8DA 4M0PA 4Q1BA 1WSWA 4Q4JA 3GT0A 3MTAA 3QVSA 4TLAA 4YV0A 2RG8A 1YRQA 3DTVA 3QLTA 1DXQA 1GPLA 4E6HA 1D2HA 1LDMA 1NR5A 1XOIA 2PO5A 2BMAA 5KNCA 2WMDA 1U5BA 2OHGA 2QMZA 1J1UA 1XVVA 1Y3AA 2BFNA 2GDJA 2WU4A 3BJEA 3NOVA 5ELMA 2RHWA 4RMGA 3VYTB 5A4JA 4Q15A 3B1FA 4GHWA 5DW3A 4RPIA 2H6FA 2OO7A 4YUWA 2DSNA 3ITDA 3MJVA 4JA0A 3EPLA 3H0EA 4N4AA 1RC8A 3I1IA 1K92A 1EX6A 5EIDA 5FUYA 3RIYA 1FDTA 1YAHA 2Z56A 4CM1A 3EAGA 1PK7A 4BLVA 5A4DA 2WUVA 3RIGA 1ZG3A 5A7GA 3LM8A 2YJZA 3PUHA 3V4FA 5B58T 3G7UA 3W77A 3BE4A 4DZZA 3EX7C 2BMFA 2OV2A 2GFIA 2AEJA 3A37A 2C98A 3GLTA 3FUDA 1AUOA 1Z4KA 2PD3A 2WZCA 3V32A 4AXBA 3B5IA 2G04A 4X3OA 1GV1A 1XCOA 4XDGA 4MUJA 3L84A 5LM3A 2XEVA 4CEHB 3R6GA 5J2TF 3L0CA 1KWKA 2BELA 3VKVA 1C1DB 3L8FA 4KPUB 3AVXA 3IUBA 4J8PA 1XROA 1Z12A 4MINA 2ERCA 3K4HA 4RDHA 3IUMA 4P54A 4JR1A 2CVZA 4FC8A 1JT9A 4ZT2A 5D85A 5G0VA 4ZI7B 4D4KA 1RXIA 4PU0A 1OROA 2I54A 2EJTA 3IHWA 5AHKA 4J7UA 1JT2A 3ZCVA 4BVFA 4EW2A 3GAZA 4IDQA 5SICE 1FX0A 3T5BA 2PAFA 4NCJA 1GGJA 4EMUA 1OZFA 2WUDA 2C3UA 3VZCA 5DMXA 4JJ4A 1I5EA 4EZIA 5JEEA 3P1JA 2ECQA 4NFLA 3AF5A 5BXYA 2PUDA 1QIJA 3G7NA 3PNSA 4L8GA 2ERYA 2ZWOA 3L0ZA 2WUWE 4E7PA 3E61A 1KBZA 4CM9A 2UVPA 3UC9A 1Q92A 4M98A 1HE3A 1YJXA 1U04A 4G1UC 3IPLA 4QT0A 5EGSA 4HDKB 2PLAA 3N3BC 3OWHA 5FLEX 5G0SA 4CIXA 5D6OA 3CPSA 5FAKA 3EQ9A 4BO0A 1EUCA 3AVPA 1TQ6A 1CZHA 2FX3A 1U2PA 3T5GA 1E3DA 1AA6A 3IB6A 1T5LA 2FUG1 2ID7A 2R7AA 1OFVA 4LF9B 4IX9A 5LLTA 5IKXA 1WHTA 2DHEA 1ZH4A 3CTMA 3L8YA 2QC9A 1UWVA 2C4HA 3RK6A 4BWRA 1P9NA 3F7NA 3BN3A 3N05A 3PHHA 2XNSA 3RABA 1Q7EA 2HIMA 4H7DA 4LYAA 3WLSA 1NFIE 2DBVO 3M1AA 3V2HA 4PNPA 5FTNA 4DR6B 1ZI6A 2PLNA 3KZKA 2IY9A 2D00A 4PO9A 4QAJA 2VBCA 2B9VA 2MSEB 4DLRA 3L4EA 1AV7A 2A9JA 2FMIA 2H29A 1KYVA 4BV3A 4R83A 3AFNA 5KWIA 2XCIA 3W3AD 4GX5A 2E4AA 1W2GA 4YASA 4J9UE 1WU7A 1FK8A 3HYCA 2F59A 3HY6A 3L6OO 2ZSDA 1LKZA 2X2PA 4S1OA 2PXXA 4Q7QA 1PYDA 4FWTA 4HDAA 4N0DA 1O6FA 1JAHA 4RGQA 4D0GA 4TWJA 4C5BA 4RMNA 2W11A 1KMQA 2AEEA 4DM4A 1G8FA 3QUCA 5CT8A 3TTSA 3QELB 2MOKA 2YZMA 3UK0A 4KRFA 4JB0A 1THTA 2EERA 2VJAA 1UKYA 3FVWA 3B36A 3GG9A 4IQ0A 3O1HB 3OMXA 4IZHA 5H9WA 1I14A 2W43A 3LW7A 1A8QA 4UEQA 1GGNA 4Q37A 2GA9A 4BO1A 4URXR 3KZNA 5REQA 2CT8A 3T9BA 3TXYA 5L7TA 4HSGA 4HDSA 4HN2A 1W75A 4R2LA 1RXUA 4INZA 4LISA 3PNOA 4ZQCB 4H0NA 1TYDE 2UWJG 1E2PA 2V58A 5G41A 3RU7A 3O38A 1I9GA 5IY5E 3FTWA 1KR2A 1K6EA 1DG1G 2FQYA 2JIZD 2Q9CA 2UVDA 3CLRC 3IDQA 4KEAA 5TQ0B 4DG8A 3DZDA 4HLCA 4OQEA 5AIBA 3FTNA 5CLIA 4DC1A 1L8LA 4NRDA 1ZS9A 2GJSA 3AF4A 5K6RA 3U3XA 1H8HA 2X5NA 1BVUA 3R3SA 2WYUA 4EFNA 4WNYA 3MC1A 3MRXA 4KX3A 4U1RA 3H84A 4EA8A 1I36A 2LE0A 1E8MA 2WTNA 1PV4A 4JQSA 3GBPA 5JNSA 1T5HX 2PZFA 1CBUA 1ZJJA 2IYRA 2ZPUA 4IVPA 3PS6A 2ZETA 4LXIA 5C8YA 4ENRA 1TYCA 5DYIA 1N8SA 4OFXA 3SYLA 3EHRA 5T67A 3EIQC 1BW9B 1JIVA 2ADFA 3Q7QA 4ISBA 1FU8A 5BVGA 4XEIG 2B34A 1U8FO 2XUQA 2H6EA 4KLNA 1DAPA 1GVHA 2PL5A 3S2UA 1IJKA 3ZI7A 1YASA 4WBNA 5DASA 2OFPA 1D4OA 1BE1A 2HLPA 3RC2A 1X38A 1KWGA 2BGRA 2YYAA 2GRQB 2FXIA 3DE5X 3MJSA 4QARA 2W2LD 4X5OA 3P9YA 3NYWA 2AQIA 1R4MB 4JBXA 3DAPA 5K20A 3K5WA 4NH4A 5AQBA 3KR1A 1QGUA 2B99A 4JX9A 2TS1A 3ZXPA 2PD4A 3DFMA 4LDAA 4NENB 3AJ9A 2YYSA 2R5NA 5IC4A 1Q2XA 5JCOA 1N6PA 2W37A 2PLRA 2CB0A 2ZP1A 3CTPA 3DLPX 1KQPA 3ESKA 4ZAGA 5KINB 2DF8A 2I78A 2XUDA 3ZW9A 1NYQA 1OX4B 5EIWA 3R7FA 4DJ5X 4G5SA 3QU4A 4QHTA 3FYHA 2NUTA 5AOVA 3KZMA 3HKEB 3MTBA 4K9KA 3HVEA 1Y80A 4YJGB 2H1CA 4C0HA 4CETA 3VO2A 3GVCA 2QP4A 2ZYGA 1P9LA 2OBMA 3IH5A 1L3BA 1PJCA 4EJ6A 1FUEA 4E4YA 1M5RA 1OGIA 4X1IB 1WF3A 1CRZA 2QGNA 1SHLA 2GRRB 2FW1A 2EFDB 1MZCA 4XEHA 1OJ7A 3PXCX 4CKEB 3S7TA 3FDHA 3FNFA 3BRWA 5ITVA 4ITVA 4TTQA 2VJLA 3D9JA 2PKXA 2UZIR 1AB6A 3ONDA 1O9GA 4O5AA 3RBZA 4BWFB 4CM7A 1CYEA 5FZRA 1NE7A 1ZMTA 4OH7A 4CF7A 4JBGA 2FOLA 3WL6A 3KAQA 4JKIA 5IAJA 5C31A 3USZA 2K7FA 2GZRA 4LOIA 1MABB 4K7JA 3D8SA 4O0LA 1S9HA 1K0FA 1ZP6A 4LZAA 4R01A 3RVMA 2HNAA 4JS0A 2XT0A 1KK0A 3DC2A 4C4AA 4CODB 3O6VA 4TL9A 5FPPA 4E31A 2CGEA 2PKYX 1EDDA 2MSDB 2ZUVA 3LPNA 1C2YA 1CETA 4LNHA 4HMPA 4RPKA 1C8VB 3FKJA 4QJ4A 4MYDA 2C31A 5A6SA 1E7SA 3KZ1E 3RS4A 3KXPA 3MERA 3MWEB 3MJDA 3EG9A 3ICWA 2PK3A 3WRXC 1F3LA 1A72A 2VYQA 3OTQA 5ADVA 2OBFA 2Z5LA 2ZTSA 3DWEX 1NAHA 2QPAA 3C8DA 3E3LA 5DB4A 4CKCA 2VBIA 1C14A 3Q15A 1DFIA 3KLOA 2YZKA 4X1KB 1FNBA 3MK31 2VP0A 1M66A 3U4IA 3HB7A 4KXFB 1D6SA 1HQYE 3F6RA 3TTYA 4CBVA 3FWHA 3WQSB 2YHIA 3PR2B 2BZ1A 1EJBA 1PK9A 1UK7A 2VC2B 3ZWQA 5B1BE 5JAUA 1TMOA 4XW2A 2PH5A 4N6GA 4EPZA 1V4BA 3E9MA 3J5QB 5A5DA 1N4SA 4US2R 3BXEA 3QWAA 1SQSA 1OASA 1YBFA 3AEKA 4M21A 4XASA 5ALOA 2FJPA 5H82A 4UHBA 1L7NA 3CZAA 1GJRA 3B89A 5E38A 1VC2A 5E6UA 1FFWA 2MSLA 4N01A 1OVMA 4GPBA 4O2BA 1OV6A 4JUCA 3UV3A 1BWSA 2LAIA 3FYSA 2JVIA 3KO8A 4PAWA 5CRIA 3TSYA 3VPDA 2BUCA 3ANLA 3AF3A 4WCFC 3BH6A 4ACBA 5ALUA 2GS9A 4C0WA 1S2IA 4YAJA 3O4FA 4J3FA 3NZEA 4IHJB 4B0OA 5JD5A 2CLHB 2W2OA 3L7LA 3FMOB 1TN6A 3LX6A 4CRWB 3GFGA 4QFDA 3B7SA 5CCXA 3M3PA 1B89A 3KOYA 2EP8A 4AN4A 3E8XA 2I91A 4IWXA 1GPJA 2YXDA 4L74A 5E4FA 3ZI4A 4BLOA 5AENA 1U0BB 4X3CA 2E6KA 4R5HA 5AUOB 5G1PA 2ONKA 1NJ5A 4B2YA 2WIBA 1EDOA 2A3NA 3AKCA 1G38A 1OC2A 2B6HA 5TY0A 4N47A 1RBYA 3NBNB 1RZVA 2W2TA 2XHEA 4EYOA 1YF3A 4R9UC 1A7AA 1N5JA 1T4GA 2JJQA 2KSQA 2ZJ8A 3A4TA 1W35A 1EPUA 4NHEA 3VKUA 4GAEA 5IKPA 3D7MA 4PCLA 1XJ0A 5HFAA 3Q7PA 5DBHX 1ZOPA 4B3IA 3ISJA 4RKWA 3H87A 1M54A 1QVVA 1NX9A 4PWYA 2R79A 3GMDA 2O48X 1JH8A 5DM1A 3DDOA 4FHGA 2YZNA 2HMUA 3GVHA 1TECE 1CF2O 2I6GA 3ZJ5A 2B8NA 2IYAA 4Q1AA 2YJGA 2F67A 3NTRA 5DHPA 2O8DB 1XAIA 3C5EA 4B8AA 4MNTA 3KQOA 2WJ4A 3PUWA 4G0VA 1Q12A 1BYIA 4DCMA 1X14A 1FCHA 4O4IB 1E59A 4L4XA 2WJVA 1GPNA 2QROA 2GYYA 1TKAA 3FIJA 4X00A 1MO3A 3F2VA 4XGQA 4PXSA 4LHEA 3THWA 1NZJA 4CUZA 2WJ3A 4ZYWA 1MX3A 2GRUA 4OHVA 3SZUA 1K3FA 5F3DA 4G0WA 5DW0A 1YVUA 4J2TA 1G8GA 3O47A 4RIGA 3TL2A 1OU4A 1V4NA 2AJBA 2COUA 2NO5A 1GPWB 3C5HA 3QU9A 1GTRA 3EVBA 3HRAA 1UOOA 1ZYUA 1FYWA 2BRUA 3TQFA 5IANA 2ZUSA 2A9VA 2PN1A 4HEJA 3RYCA 1E4EB 1TNOA 3UXYA 3KEQA 4CKYA 2NT3A 1K9SA 4WNAB 4BE9A 1H0SA 4JV5B 3KR2A 5B2ZA 4PYQA 4L8WB 4NL4H 3PRHA 2XVZA 3C98A 3CQCB 4GR5A 4GX0A 4WZBB 1BJTA 1JBEA 4F1WA 3MFYA 4BBJA 2D0PB 5HKPA 2RH9B 3OFND 4TV3A 1K8RA 3F71A 4MV6A 4O4IF 3SJZA 4ZHBA 4U95D 1RKXA 4UU7A 5EYPA 1KS9A 3EDQA 3G0DA 4QHSA 5L3SB 2WNHA 1CUWA 4J6EA 4Q94A 1NBAA 2UVQA 5D87A 5FEMA 2JGNA 3E5MA 3HFGA 1VE6A 1NN0A 2IODA 1KH1A 3ND7A 4FFRA 4Y8VA 4YFVA 3TDMA 2OEVA 2AF4C 4JDUA 4RXTA 1ZQ9A 3OP4A 5HOEA 6PFKA 3BSYA 3MBIA 2NU9A 2M32A 3UPDA 1J8MF 1DEKA 1NVVR 1TUIA 2G72A 2O2SA 2V3WA 3PFWO 1DQPA 4GICA 4RHCA 1YZFA 1TA9A 3IP8A 4I4NA 2I67A 1L5FA 5BURA 4CMCA 4EGFA 3QWPA 4EPWA 3ONVA 3G2UA 1KRWA 2AN1A 3IEUA 2VNHA 2X5JO 1GT6A 3ENKA 3IJRA 4L2IA 3C48A 1Y1KE 5D3ZA 2V7TA 3M82A 1T1GA 3T06B 3ZYKA 4GKBA 4C6HA 5B3KA 3U1BA 3K3PA 3VPAA 2VJ8A 5B36A 2P6RA 3ZYLA 3WWEA 4ZHQA 4RO0A 3UW3A 1G20E 1JNXX 1H85A 1LK5A 1NPDA 1VG0B 1WKCA 5JFGA 3N0XA 3F98A 2G07A 1W93A 1Z6XA 2NU6B 3I34X 5KWVA 4RSMA 1C1XB 2QUAA 2ATXA 4YJ3A 3H9JA 3KPVA 2PKCA 2R00A 3N39C 1WQ4A 3G68A 3IEVA 3LXXA 4JB3A 2X7JA 1PZEA 2JBAA 1BRTA 3DP7A 3ASHA 2C3PA 3O21A 3UG7A 4LXHA 3IOCA 4PLPA 2PAAA 2AHRA 5JAQA 1G9XA 3R9XA 2C88A 5IUKC 4MQMA 5KUTA 1D2GA 2MIIA 4BGVA 1C3VA 2WK1A 1K5GA 1H6BA 3D2BA 4WSOA 4C7KA 3L7IA 4D9KA 1BJKA 2WSIA 1QGOA 1WZEA 4W5WA 2O3QA 3KSZO 4QFBA 4PS3A 4ROSA 3QUTA 3K6JA 4GSLA 1R12A 1WQ1R 1YA4A 3AINA 3EGCA 4HFGA 4PINA 4R4JA 3VSDA 1ZKMA 2L6BA 4ARUA 3CUVA 4D02A 3FCOA 1P61B 3EW7A 1IY2A 2P4HX 4HDRA 3S3TA 2VDVE 1T36A 4W9NA 4XD7A 2GPNA 4OXYA 5TJHA 2ALJA 3TIIA 1QCYA 2VBFA 3AUKA 3GD5A 3NAGA 4NYJQ 2GZHA 5AT1A 1LBQA 3LBHA 3HKBB 1PZHA 2IOLA 3CZCA 1KMNA 5AIAA 3BE5A 2BUBA 5HFJA 1PLKA 2R2GA 4NBRA 3TCXB 5MN6A 2B5WA 3WBBA 3G2VA 5J58A 4DV0B 3NJRA 2Z2ZA 3QZUA 5JD6A 1JB1A 2H1WA 4RA6A 2V6MA 3M0EA 2O2CA 4U2GA 4PLGA 1DKRA 2MWMA 2Q5LA 3ZGQA 1VYHA 1RYZA 4BNJA 1ESZA 3GLIE 1WETA 1YJBA 2AG0A 3U6BA 3L7AA 1AU9A 4DIOA 1ZRMA 3UJNA 1MLDA 1L4YA 1VL8A 2J4FA 4X60A 2I1LA 3S27A 1HG2A 4E51A 1QO0A 1YAJA 3CM0A 4TQ9A 4PIMA 2DR0A 4B44A 2Y68A 1YH3A 3BAZA 3C7DB 3LCRA 4YCLA 3K9CA 3D4NA 1CB0A 4HDMB 1ZISA 2XMPA 4QSMA 1Z2NX 4C0EA 5JHBA 2ZE8A 2AK3A 1M2HA 1QNLA 3TF5A 3DL0A 4KZKA 1PGJA 2PVCA 3WNBA 2YN2A 1E3MA 5KOYA 1HFJA 2O2HA 3CRZA 3ANXA 1U3CA 3H3XA 3VDRA 5AUPB 1Y1LA 2IFTA 1W2HA 4LTNA 4BN0A 1WX1A 1ULSA 1I2DA 4A26A 5TT0A 1LF0A 2HY7A 4DW8A 3A1VA 5L4NA 2EEPA 1TE2A 3BWBA 3UPTA 3PF9A 4RHTA 1XD2A 1QGED 1WOMA 4QDTA 1WKVA 2KE5A 2WAMA 3HCAA 3KTAA 3B48A 1CF9A 4BERA 3VR3A 1MD9A 3GJ4A 5I4IA 5JSFA 2OHHA 4S0ZA 4Z8YA 4OG2A 4G8JA 4MUMA 2GYVA 3DLAA 4RKFA 3OM9A 4KQ2A 4P3PA 4Q3EA 1CZNA 1ZOLA 5HRYA 3GLQA 2VJMA 1FTGA 1J56A 2FSSA 5TRTA 4XJXA 3E7FA 1IU9A 3IALA 3KC2A 4XR4A 3FOAA 1KH2A 1NKVA 1S64A 1B8UA 1N5OX 3TI9A 1XEWY 3BCRA 5TMBA 4GLOA 4NV3A 3KEFA 1QOPB 4YJ2A 4HG2A 5KNBA 1DSSG 3DXFA 4CLHA 3AJ8A 2I9PA 3T8MA 1Z74A 4OV6B 4R81A 1LLDA 1FYVA 5DN6D 2G67A 1TXGA 3VC1A 3UGQA 1T9DA 4ZWNA 3ZD7A 1ZIYA 2SKCA 3LZDA 5CLJA 4P2GA 1O1SA 5AAOA 1X80A 2D2FA 3NKFA 2PX5A 1E6UA 2WG1A 2ZE6A 1K6IA 1Q44A 1KOJA 2FE1A 1W1UA 1QWSA 4MQ5A 2P7IA 1UL1X 3C3XA 1QORA 3SSOA 3T4PA 2O8DA 1T43A 2XDQA 4WZ6A 5AKEA 4BB5A 2Q5QA 2CF6A 3I9V6 4RZ2A 1P1HA 4YTEA 5HBRA 1PKEA 5IJAA 3TSAA 1UFVA 5JJKA 2ZTMA 3NRJA 2IBSA 1E9DA 5ECGC 4MP8A 2L0TB 1V0JA 1RQPA 1C0LA 1ZRHA 2PRZA 5AK5A 2FSHA 5G02A 3S55A 2Q3JA 3WA7A 1K06A 3ZW7A 5HKKA 2JJMA 3SVTA 1K5DA 1UT5A 3HA3A 2FWJA 4K86A 4NPHA 3V7UA 4QBGB 1ATZA 1E3SA 4QJ3A 1TCUA 4ADSG 2HA2A 2ETCA 1T9HA 4RKQA 5IEJA 2WA1A 3DDCA 3AVOA 3P2EA 4YH1A 2XB4A 1G3IA 4FZVA 1JAXA 3H5TA 1U2SA 2B1GA 2EGGA 3CZQA 3AF0A 3NT5A 4FDVA 2XYPA 3NVDA 3OLYA 4PGHA 2R4TA 3GLRA 1N2CA 2DBYA 5CT9A 4RXMA 3T95A 3QVKA 2L18A 1ZVVA 4EQFA 1CJUC 1DEOA 3GZ4A 1U2EA 3E9RA 4H4CA 1YK0A 4KZPA 3OE7D 4U9HS 5ILGA 1KYYA 5EE3A 1RC0A 3ES9A 3NTOA 4RF2A 4AP5A 4BP9A 4WJZA 2Q7OE 3RU3A 3WLAA 4HTAA 1G20A 5H5JA 4RX1A 5B7PA 1WXIA 3B60A 4BGIA 1NVAA 1GZHB 3AG3E 3R6LA 4DDHA 4GXRA 2H7YA 3RYHB 4MUHA 4MB2A 2NVBA 4ENVA 1SQMA 2KI5A 1MB0A 4LWOA 3QEBZ 2O2XA 2C7OA 4EHFA 2Q5JA 5KYWB 4QQNA 1GFIA 1F2TB 4JHJA 5AW5A 3IMCA 3WBKA 1M6NA 2E6UX 4LZPA 3E23A 2ARKA 5T5QA 1FDOA 2HA4A 1DAGA 2JA1A 1F6DA 3KOUA 4F8JA 4J4TA 1OI2A 1K75A 2EP7A 4WKOA 3I83A 5F5NA 2H6GA 2CFSA 3KUXA 3M34A 3NP7A 2XWSA 3BMOB 4IEIA 4MITA 1WY6A 3LKZA 4Y2TA 3CLJA 1JXAA 3VR6D 4ZYZA 2ZCVA 3QKSA 2VUSA 4BQQA 3CKCA 5L6LB 1IWPB 1GM5A 2I2CA 1Z2CA 3LUBA 2AFHB 4KZ0A 1E77A 3P27A 4EM6A 4O4LF 2BFFB 3WMRA 4ESVA 4K1XA 1XQ1A 4ROTA 5DH9A 5BWBA 3DEIA 2VDNB 4ODIA 1HDEA 1E79A 3AMVA 2IPNA 3U13A 2GPSA 1M7HA 3OESA 4UC0A 2JLXA 1ECBA 3FTVA 3CJTA 4BO3A 3ICEA 5A7DB 1OQAA 4YY3B 5IU6A 2BVNA 3ZBQA 1FJXA 1F9EA 2C7RA 2F0YA 4EL0A 1RJGA 2RHGB 4LZZA 2C97A 1VPTA 3N7AA 2CKDA 4BEPA 1BE8A 2B9EA 1H9AA 4XJSA 1KI6A 4AAYA 2ZR0A 2WMNA 1Q20A 3D7LA 4LC9A 5AJWA 3PVLA 2ZBDA 4CTJA 2X8JA 1EP9A 1QGDA 3G9ZA 3K1ZA 3MB8A 4H18A 1LQTA 3SEQA 1AKEA 3A9TA 5ALFA 4PSDA 5EVCA 4FCVA 2YVKA 1NC1A 5FPYA 3BTOA 3UXEA 3VTKA 4GM4A 1Y89A 4ARSA 2Y67A 1DC4A 1IN6A 2BP7A 3EY4A 4ZQFA 3IEXA 3H4IA 1Z0DA 1CIVA 1QUFA 2Y05A 1EWYA 1BGVA 1F5SA 4G9EA 4JA2A 1ZK4A 3FGOA 4C03A 3ENEA 1USWA 3C3YA 3OEED 1FUUA 2PMKA 4DX6D 3EHDA 4HEA6 4JQCA 2AG1A 3AAAC 1MP0A 3SFVA 4P36A 1MX2A 1LQUA 1T8PA 5KTSA 2ZWAA 4Q18A 2NLOA 4FHZA 1KJYA 5LWHA 4QOGA 5JO9A 1OH5A 1DJMA 1A9XB 1Q6YA 1ZHFA 2HIAA 2QVGA 2C0QA 3H5IA 1DJLA 1E1LA 2I4TA 2WJYA 3BS4A 3IQHX 3NYRA 4F6RD 2IDKA 4CT4A 1VMKA 2OCYC 4FI3F 5CFMA 1F7UA 1ZZEA 2PT7A 2Z8YA 4L4RA 2WHPA 1P0QA 1CUZA 2XJ4A 3BREA 4G4SO 4FEAA 3B70A 2NYAA 1FW6A 1RWWA 1PJLA 3W34A 2R7LA 4EJSC 1WL8A 1X7YA 3Q9NA 1DIRA 5A5GA 4KH0A 3ROKA 2C5EA 5FTKA 2HI0A 5CB6A 4ZP1A 4P6VF 2BCEA 1A5AB 4JZKA 2ZXEA 4U2EA 1NMSA 2Y0BG 5KJMA 1L4MA 2VJNA 4FT2A 4MWTA 4OA5A 2QE7A 1IB6A 5ER6A 1DIBA 3IMKA 3M4XA 1M2VB 1WAO1 4DDWA 1Q0TA 3HZRA 5K3FA 2IVFA 4B8YA 4NYIR 1IY1A 3LVQE 4AIRA 1HE4A 3A1EA 3UCFA 3K35A 1GPAA 2Q6KA 4MQFA 1RRFA 1BXKA 3WMWA 4EVIA 2ZAOA 1IL0A 2B7LA 4BZQA 3PNKA 3L82A 1Q84A 1JDTA 1W85A 2OQVA 3TLGA 1YA8A 3O8BA 3NVKI 2N42A 4QNMA 4OYRA 3G17A 3ZLVA 3F3YA 4B6GA 4BUCA 1GKLA 1HY3A 1ZXBA 3RGGA 3TEJA 4D42A 7AT1A 4QRHA 3TNYA 1NXXA 3GQBB 4ZCQA 2HSGA 3TRDA 2ZJAA 3MPUA 4PPNA 3ZYCA 1P9RA 4ZMSA 2PUJA 1DV1A 4CIAA 4PQYA 3KYIB 2HCBA 3IP6A 1AT1A 1UK6A 3A1NA 1JILA 1YU9A 1F6BA 1VSVA 3INRA 4UNPA 2GEFA 3CQGB 2QAGA 4JJZA 3RC9A 4ONEA 4KR3A 3GGCA 3V1KA 4MR9B 3AETB 4H77A 1I13A 3V34A 4PUCA 3IBYA 5AYVA 4H60A 4Q6BA 2RGDA 3WQHA 2CY0A 4I3HA 3GUZA 4II7A 4KFSA 4X8HA 5KU1A 2BW0A 2YBDA 3PSHA 4F5EA 2RG1A 1FW8A 1WQ3A 1PW7A 2OGTA 1YS6A 3JQGA 3K09C 4NENA 4AMYA 1H66A 1T15A 1BOOA 3M1YA 2BDEA 3P2YA 4MS4A 4WK4B 4CXMA 1KK2A 3PPXA 3QJ5A 1PEAA 3BGIA 3OLCX 5ALLA 3TIFA 2ZJOA 3K0EA 2XWBF 2DB3A 1NFFA 4PG6A 3FOFC 4WVLA 1FFYA 1R50A 3CKLA 5ENRD 2J59A 4GP6A 1H1DA 5JU6A 4UUMA 1SUAA 2H51A 4I14A 1RPJA 3M4ZA 3RU2A 5MGBA 3SYMA 1XLTA 3SYRA 3ZDCA 1H6CA 3QJZA 1KEKA 2RGUA 1KORA 4OKSA 2WWHA 3VO9A 4C7VA 3EF1A 4K9PA 1C8KA 1KYTA 2GR9A 2P6MA 2QTCA 3IT2A 3MJRA 3FWZA 5JISA 1N2BA 1W96A 2G6BA 4RJKA 2V74B 3CIFA 3BL8A 4X85A 1EA5A 1JEQA 2YNMC 2VGYA 2HJHA 3GJ5A 4C05A 1YJ8A 3K30A 4RTMA 4MJXA 4TWIA 1H1TA 3D31A 2JEYA 3MTDA 2QM7A 2Y93A 4MGKR 4RZQA 3HN6A 1K97A 3U5TA 3LC2O 3GCZA 2Y1LA 3V1YA 3VI3B 2WXFA 1EFPB 3HNOA 5DHSA 1FP1D 3PLNA 2BPOA 1X42A 2G82A 5H83A 3SZRA 1PEDA 1ZSVA 4REOA 1VYTA 5AJUA 1XNRB 2DBRA 3BUAA 5T4EA 3MEKA 1FPQA 4HXFB 4LNBA 3ASYA 3BWDD 4MXDA 4LJSA 4O33A 1Y81A 4DIMA 1BWQA 2XI4A 3JPWA 1T6YA 4LJ8A 5REQB 4AN1A 5JMWA 4BRSA 4PQEA 4ZTBA 2FPLA 4C76A 1ECLA 1KJNA 1SKYE 3MJ4A 5KHLB 2R8RA 2L0XA 3LOQA 1M3SA 1GKIA 3VFDA 2HV9A 5JAHA 3NHUA 3ZEFA 2NZUG 4J7CA 1N4QA 2EFEB 4H16A 1TJ3A 5EGNA 1N11A 2QT1A 1X5BA 5JXJA 1MU0A 2OCAA 3UHJA 1TA4A 1TO1E 1H0HA 1W59A 3MJEA 4MI6A 4TWBA 3T41A 3E5NA 3CKBA 1FRVA 2D5LA 1I7LA 3FKSD 3Q8WA 4ON9A 3LP5A 4Q9DA 2BT4A 3GPLA 3NNNA 4LV8B 1EVKA 2IO2C 3NM6B 5COAA 3VU9B 4WD3A 3SQDA 2GZDA 5CDTA 4QXRA 1T4DA 1TQ8A 2R5FA 5EZYB 1Z6GA 2YDXA 4XCXA 5GV7A 5TB5A 3ORFA 1DINA 2VH2A 2XV1A 3IP3A 2AJAA 1WPQA 3DNPA 4EY4A 2P62A 3RO3A 1UMKA 1SH7A 5CM8B 1U28A 1E3IA 2RFAA 1M9NA 1VMIA 3N87A 4QYMA 5D7BA 1SHTX 2PVPA 2Q46A 2C9BA 4TVBA 4E88A 3K4PA 5F7XA 1XZBA 3DL7A 4P0PB 4ER6A 3Q0EA 4FOSA 4JELA 4NMXB 4UASA 3SBTB 2B1RA 1QKKA 4GX2A 2Q9UA 2IS1A 4I5DA 4FA6A 4PS1A 3EK2A 1L5HA 1N8NA 4QATA 1WOYA 5BVHA 5DI3B 2HFKA 1HRDA 2PBZA 3JAKB 4ND2A 2CHXA 4XX0A 2PYZA 3V4VB 3UOGA 3DL2A 3I9FA 3L9WA 1SU7A 4M0DA 2PMEA 1P4RA 4DG9A 2ZT7A 1KSGA 1IYGA 4M1SA 1EEHA 4DBLC 2YN4A 1CUYA 4KJXA 3GUHA 1JYSA 5EIFA 4RTOA 4A0FA 2OM2A 2X13A 2GKGA 3CEAA 4UFPA 5KBYA 5JY6A 4QE3A 3OX3A 4QYWA 4FK8A 3V8MA 3ZJYA 1NBOA 2CZCA 3MLBA 2HM8A 1C3EA 3CBGA 3VV3A 4KVFA 1PX2A 2BEVA 2GGSA 2WXKA 3ROZA 1CPYA 1H9CA 4CKWA 3GA7A 3LHIA 5EJFA 4LE0A 3G6WA 2OFXA 4P08A 1WVIA 4F46A 4CGYA 1CUHA 3Q4AB 1ADFA 2RD2A 4EHNA 3BAFA 1VA5A 2LV8A 5C1DA 3ANSA 2HO1A 2JEKA 3R7BA 4INPA 2H63A 1HLGA 1DAFA 1TAQA 2ODNA 2OCPA 3F5SA 3I45A 5HIMA 5KDOA 4E6PA 2PKQO 3U26A 3UI2A 2CJPA 4MRPA 3S5UA 1EXDA 3O7MA 3LCVB 2RGWA 4QO7A 3A3NA 4P34A 4X92A 3SS7X 4H9GA 3UENA 3VU9A 4AQDA 4RD2A 3NYQA 4RIFA 4ENPA 1YQUA 3M6UA 3PCXA 3BEDA 4MIKA 4PR3A 3HLTA 3KE8A 4ZI7F 2QN3A 1FY2A 4UTNA 1JR6A 4G2VA 5LDHA 2Q3MA 4UJ3A 5KQLA 5AHXA 2VPWA 4LF5B 2R6GA 2GBIA 3ZFWA 4GTMA 3T5DA 4D3DA 4DADA 3OSZA 4AROA 2Q1TA 1MOZA 2Y9PB 3ULKA 3QEMB 4NZOA 1QIFA 1J24A 4HQKA 2PGAA 2BGIA 4TLDA 3HFJA 1RABA 1SIUA 1XFDA 2I55A 5AQ9A 3O90A 2QN1A 1WVMA 3KKLA 1MV8A 1UJNA 2HMSA 2P2YA 4WERA 5FV7A 4XIFA 3FFWA 1QOZA 2SICE 3E2PA 4FN4A 2XXAB 2LSVA 1VCIA 3DEJA 2YHUA 3NAZA 4WCVA 1UMCA 5DI9A 4XYEA 4DZRA 3T3DA 5JNLA 5MHTA 4PFQA 4HAYA 1JTFA 2HJSA 1MVLA 4H1VA 3Q3GE 1SFRA 4OBWA 3KQTA 1X1BA 3L93A 4FSDA 4AP2A 4N3GA 4TYNA 2B0OE 2AJTA 3FNEA 3O4VA 4HVCA 1RRPA 1WABA 4DR3B 1M0WA 2O3SA 4Q4JB 3GJRA 1XNFA 5K3AA 3V3KA 3ZHZA 1LA2A 4A1OA 4BFTA 3NHKA 5HYVA 3G23A 3S7DA 5I7UA 2Y1EA 1QZ2A 2MINB 1SZCA 2BDTA 1UAGA 1GTMA 1XHFA 4BTLA 1YFZA 3Q49B 3HXEA 1TO6A 4D74A 2A94A 4EB6B 5ISMA 4MDEA 1NUUA 1IOZA 4YDSA 4JYCA 2ES4A 2XE6A 2IOHA 4LOLA 1DCKA 2X7HA 3D2CA 3CR3A 1KY3A 1ZOIA 3ER6A 1R0LA 3Q3HA 4O25A 3X3HA 2XCTB 1Z06A 1KTIA 3IHLA 1H2XA 1R66A 4QOSA 5HKAA 5DSZA 4ABYA 3MCUA 4ZYVA 4KU4A 4G8LA 4NZYA 3K6RA 5ALNA 4PR0A 2ZJFA 3SEZA 3A3PA 3IJPA 3VAAA 2E55A 2LVBA 1UXOA 3AB8A 1UBLS 3AG4E 3BWVA 4O1MA 1QHEA 1EXWA 1L0BA 4MWGA 4O4LA 3ZTTA 4FDLA 4TSKA 4IWNA 4KR9A 1IY0A 3GFOA 1SN7A 3N0VA 3PI6A 1OYOA 2XKBA 5LP6F 5I8WA 3FWNA 1BVHA 4ZOLF 4FFVA 3FUJA 2RARA 1V25A 1FTYA 1I7PA 4BGUA 1SQ0A 2ZDQA 4N6OA 4OFBA 2JCVA 3QSYA 4M37A 1TLTA 1XRJA 4HWTA 3RS0A 1Q11A 3GFQA 3PEWA 5CTAA 2H2GA 3SC2B 3KXKA 1T5BA 1WSBA 1TT5A 3VBEA 3VZPA 4UOEA 2ZR9A 4CUKA 2OSVA 3E8SA 4NP6A 5FZSA 1KR5A 4MW7A 1NNI1 1WXDA 3MM4A 4D9IA 4YLEA 5LP6B 1UPCA 4OGLA 4XRRA 2XS1A 3V8NA 3WB2A 1WTAA 4MVJE 3C5WP 2CFTA 2JCGA 1OC4A 4NECA 1YOVA 4JEUA 1X7YB 4WI1A 4WY8A 3SBDA 1THGA 3ZS9A 4AECA 1G5IA 5LQDA 1IHYA 4KQGA 2KM1A 4MYUA 5ANRB 3I2JA 3JATA 4KQXA 3ZHSA 1RTKA 4UE2A 2HSJA 2C77A 3D7RA 3MBKA 5ENTD 3UKDA 5LR6A 2C61A 4UD6A 2NTVA 5F73A 3NRCA 4B35A 3QE3A 1EF1C 2P11A 4H1HA 2C5GA 2IELA 3SXUB 3WWYA 3QXXA 1KMHB 4BO7A 4YRTA 2V9PA 2LXMA 1JSLA 4HZUB 4TKVB 4S04A 1TUBA 5FQ8A 2R1TB 1FCJA 1V45E 2XTZA 3GOQA 3KYDB 3RTCA 1K7XB 1EZZA 3L8MA 4NAUA 3R0ZA 1ELRA 2VGEA 4EZLA 1YZYA 3DXMG 3G8AA 5AI4A 3EEYA 3ESYA 2GJKA 2ZCUA 4JK3A 2FRVA 4U4AA 4F3TA 3R0VA 1BN6A 3UMSA 1V6AA 2FV8A 3EVAA 1JKXA 2Y2VA 2G28A 1CKEA 1Q2ZA 3QXHA 2OVFA 1DJQA 1U2ZA 1GDDA 1YZ3A 3G85A 4UBMA 3ILSA 3VTZA 2H1OA 4ZU3A 4ZZ2A 1KYQA 4ANUA 1DCQA 5AXAA 4OSOA 4DIUA 5HW0A 4KN9S 3PFHA 5I3CA 5JTUA 1HFKA 1A3CA 4HO1X 4PPYA 3W05A 4BWVA 1XAJA 4N0EA 4ED9A 1V1MA 1OAKA 1Z0JA 1VQ1A 3ABRB 4OTZA 3ROXA 2XYHA 2Q07A 2XJ9A 4JMLA 3AKZA 3U7GA 4C30A 2ZTHA 4IMRA 4PYNA 3OX2A 3JYHA 2C9ZA 4RHXA 4N76A 1DHRA 2CVOA 3RTDA 3C43A 3MOIA 2VFAA 1QYWA 1V7ZA 2DJ5A 3PT9A 4A8PA 2HHHB 2DZOA 1TNUA 4YT5A 1XTRA 4Z7QB 4D9JA 3C6QA 2A58A 4V38A 5KMGA 3W5CA 2IS2A 1W25A 3BXPA 1MTZA 2Q99A 2GERA 5L53A 3Q7TA 1VE3A 4GOMD 3WWCA 1J9EA 1T6BY 2ODTX 3FIUA 4JHLA 5LA6F 5AD1A 2Z8XA 4A4DA 3ML8A 1KJJA 1LVGA 1UMDB 5HG0A 1E0KA 1EWKA 7REQA 4X45A 1ZUNB 3SJBA 1Y6JA 3JQPA 1RLJA 4LW8A 1HT3A 2XR1A 3U7EB 1PAQA 1CLUA 2RMKA 2JFBA 3B2QA 4GC9A 5FIUA 2DR3A 3LIIA 5ICSA 4MI1A 3D8TA 3P9NA 2PRJA 2VNKA 3KOXA 5JMPA 3MRSA 3RU0A 3OAAA 3SS8A 4E5PA 3VH3A 3VYUB 1DCMA 4MMZB 4EKGA 1PFUA 1YRAA 3K0FB 3WO0A 2FRDA 2ZBGA 3I6QA 4RF3A 2H1IA 3FF4A 5FTPA 2OYCA 3BIWA 5DSTA 4LV5B 3M33A 1GZ6A 1VHTA 3NC0C 4DHWA 5M2QA 4L2YA 3U64A 4NRHB 5KOIA 1CT9A 4NOLA 5KNCH 1QLWA 3NBXX 1OB2A 4NS1A 2ZOSA 4OX9Y 4BT8A 3OPXA 3RS5A 3VMFA 2JAXA 2P9TA 3W5HA 4PQFA 4NKRA 5JCPA 5C0OE 4C6SA 4H3KB 3AEUA 3W5UA 1AS2A 3L92A 3TOXA 3V1UA 1BXGB 1FMCA 3QSGA 2AV6A 1MQ9A 2PU5A 1YE3A 4H7PA 4YPVA 4TMZA 2FZWA 4XUEA 1OUVA 4DLNA 5AVXA 1FL9A 2JW5A 1E1NA 4G5FA 4PX5A 3BZBA 1UJMA 4YRDA 3QPWA 4B3CA 4L22A 1W30A 1D0SA 1WDTA 4B93B 1EVQA 1Y7PA 1YMVA 2WEKA 4H3HB 5LZ5A 3ZIAD 4QIHA 4DJJA 1FQWA 4DLBA 4EQZA 5FI0B 4DLSA 2O8FA 4JW1A 2JFZA 2PIDA 3BILA 3WGYA 1UPTA 2GK3A 3AG5A 4UHEA 4BNYA 2FPIB 1N5RA 3AI3A 4C4XA 3PHGA 4LSGA 1HA3A 4YALA 5B1DA 1PLJA 1P7ZA 3EVZA 1R18A 1KZ4A 5IXSA 4ACLA 1H4SA 4AS2A 1DWOA 2JFPA 2RHBA 1A7KA 3ND9A 5HWSA 2XNDD 2YS6A 3K2QA 3O94A 3F7OA 2A9RA 2PUHA 1XXHA 1XDGA 3M6XA 1M76A 3OQIB 2C84A 2CDBA 4PBTA 5DK6A 4U02A 3U60B 6GPBA 1HM5A 5EIXA 1KVRA 2NO7A 4DX5D 3PUJA 1II9A 1HG0A 2PUAA 1JWLA 3OD5A 4RUKA 1V9LA 2FW6A 2PJDA 1LF8A 1UKVY 4RF5A 1E2MA 3RSZA 1PL6A 3DEOA 5F7JA 2W0SA 2UUOA 4YAUA 5SV2A 4YROA 1L4UA 2IGBA 5L9AA 1WLSA 1BMFA 1PHRA 3KEMA 1IB0A 4INOA 2PM7A 4TTRA 1Z5VA 2PV7A 4R31A 4LSZE 1SOUA 1ZXXA 1INLA 4MRAA 4G0QA 1MHTA 2GXSA 2NO9A 4K26A 3U7IA 5HM8A 1RHRA 2C92A 2DHCA 1FYEA 1DRUA 1KFCB 2VNAA 3I30X 4GLBA 5FNZA 8MHTA 1VIMA 4KQIA 2BKLA 5HRAA 5BV0A 1BVRA 2QN9A 4RH0A 3EHQA 5AJVB 4CTMA 1WXWA 4LGCA 3ZU4A 4XWKA 3FH5A 2A5UA 4FADA 2ZBVA 4D99A 3OCVA 2PL2A 1PUIA 4JJAA 5MN4A 4KSYA 3OKPA 1Y6IA 5CW1A 3T9CA 1K8QA 4OQLA 2B25A 2PXAA 4FIZA 5BSMA 3G0CA 3MTIA 4MUYA 1FP4B 3OT1B 3W6PA 4B45A 1XTUA 3AHJA 1UK9A 3IV9A 3VU3A 2GSWA 4CHTA 1JZSA 1Z29A 4AJ2A 1EBFA 5A0FA 3TTVA 3W04A 2CHQA 4QXOA 1YIOA 1HOXA 2YMQA 4KK4A 2ZIXB 1GYPA 2BHTA 1LLCA 5FL3A 3UHOA 3ZG6A 3GYBA 1QK4A 4EHIA 3RHFA 4O2AB 2XE4A 2ZI9A 1U0RA 4NBVA 1QIHA 3ICCA 3LX8A 2CLKB 4HDNB 3KKMA 5FL7D 3TLXA 4BO4A 1XJCA 4ZEMA 5DO9A 2C58A 4C43A 4G36A 1QU2A 1H05A 1BEEA 2WJWA 3ADCA 3C6ZA 3QNWA 4RC9A 5D8DA 1E2HA 3GJ7A 4Y67A 4CLDA 1HXIA 1E61A 1E2EA 2WZDA 4ZU6X 1DIHA 4ZRNA 2EQ5A 4YRSA 2CD9A 1XU4A 1RACA 2PGDA 3GHYA 3QFHA 2V7BA 3MPOA 4IYRA 1VB5A 4X20A 3JQ9C 3RR2A 3UJPA 4D9EA 5C7OO 1BYUA 2PL1A 1USKA 3BMXA 3PPYA 1GUFA 1UFOA 1FP4A 2VAWA 3OT1A 4D98A 4AURA 3HDHA 3H8VA 2W2MA 4ANVA 2FQ1A 2XMGA 4H7KA 4O1IA 3WG9A 1Z34A 4JBNA 4P38A 4BFLA 2FMFA 3WYDA 3ZDFA 4K9OA 2O19A 4C22A 4KFCA 4ID3A 2KHZA 1PNQA 3WK4A 1B14A 4M8SA 4BVHA 5C3MA 3DSTA 1H2EA 3AUXA 1HYHA 4G3XA 4D5GA 2X2OA 2ZJBA 2DCUA 3O2QB 4MWZA 4BZWA 1TM3E 5CB4B 3GEGA 1PSZA 5FWQA 5KTOA 3OZAA 2O6HA 5AKIA 4BO5A 4KPFC 3ZXYA 2NT4A 3DMTA 4N2SA 1MVOA 4JJ7A 4MUBA 4QBHA 4EW1A 3C14C 3IA7A 2H9AA 4L3WA 4YWHA 4EGCB 1KJIA 4PTLA 4MWDA 3VPXA 1DMSA 1HE8B 2O52A 1KEVA 4YJ3B 4FYIA 3A8TA 1KMCA 2JCSA 2IY8A 2D2VA 1KJQA 1YS4A 2X19A 1CVIA 4KBYA 3O83A 1WZNA 1Z37A 3LWZA 4XE5A 2KCKA 2QKYA 5JADA 1GTSA 2BKVA 2VCHA 3EA0A 3JVIA 3MCZA 3TE6A 2OGUA 1Z2EA 3AEYA 4HT3B 1QH9A 4L2IB 1XTKA 3C8UA 1YKGA 4QUBA 2XB6A 1SKUA 1JLRA 1RZ3A 2QYUA 1SO8A 1O08A 2P2CA 4MO2A 2OXEA 4I55F 1C1XA 3K09A 1IOLA 3GJ3A 4Q3AA 4PDXA 2DY1A 3AR6A 3DUWA 4Q3NA 1BGWA 4M8KA 4FGJA 2TRSB 5CEDB 2HDWA 3FJOA 1ZNQO 3W5VA 4D4MA 2UZ0A 2C8LA 3IL2A 4MKGA 1SUPA 3RYFA 3SR3A 5T3RA 3D0OA 3IDAA 2ZVQX 1ABFA 1CY0A 1DDOA 1JG6A 2WT8A 1K1AA 2A5JA 2D13A 2YWXA 3D6MA 4GPD1 2UUPA 1WCYA 4URHA 3TPFA 3F73A 2C9DA 3F7TA 5AW1A 5G2OA 4HS4A 4UQOA 3WIEA 3ZS8A 5F76A 2WM9B 1ZBQA 4GR4A 2X0FA 2DETA 4DM7A 1VG1A 5JUWA 1ELWA 1H1LB 1LJ8A 3H1AA 5EE9A 2NTYC 4GOLD 1G59A 4PSVA 1AHIA 3DWFA 2EG9A 6REQB 2ZRQA 5HSGA 4LX8A 2GASA 4DDVA 5CDYA 4MQBA 1EFDN 1I9CA 2OUKA 4Q19A 2VATA 3HTXA 3PLAE 3FTSA 3A9SA 1QQBA 2D2XA 1NF9A 4IIHA 2AG5A 3V1LA 5D86A 2X0JA 4OHOA 1YVEI 3EJ6A 5CERB 2XTMA 3GJYA 4MYRA 1SHZA 3ND8A 1BXRA 2YIMA 3MOGA 4FQ5A 3RM3A 4DGQA 5BR7A 2R6FA 4JASB 5FH9A 5BR8B 2HX1A 4WZBA 1YYHA 2RGNC 3ZZTA 5I7AA 2XNCA 4IUDS 5CLGA 4YRKA 1HLDA 2FGKA 2GD2A 2GUGA 1X1TA 1U8EA 3EISA 3H2KA 2CMFA 2FJUA 5CVDA 1L1RA 2AVPA 3KBOA 1L5GB 3WTBA 2OB2A 1QH0A 2PQ0A 2DIWA 2GZ2A 1Y6RA 4QBIA 1RWKA 5SYAA 1JLLB 3OX1A 4UU1A 5IJ0A 1UC4B 1LX6A 1HTWA 1WY5A 3DMPA 4DUGA 2C5FA 2IX9A 1UPFA 4WKBA 3C7TA 2C1XA 3FB1A 2GZAA 2WWRA 2B21A 4MW2A 1U3DA 3LPLA 1YJ5A 2XYQA 4Q16A 3W5BA 4MJLA 4ZAFA 3R0XA 4DCSA 1AHNA 2BJHA 3EW9A 3TKAA 2PU7A 1HNZB 2QTRA 4KL8S 5KMGB 3PHBE 4C7OA 1D09A 3WRYA 4Z68A 3URMA 3CLVA 3I9LA 4DSOA 1XQXA 4G8CA 2V4ZA 1EM6A 2OG1A 4YP5A 4D9BA 4E5YA 3RUIA 2JAOA 4PONA 1H2AS 4MUAA 4ZVMA 2R5WA 4I1AA 4JD5A 3VHRA 3DBLA 3ZZ1A 5AKKA 2QTFA 1UKZA 2Y66A 1CZKA 2Z83A 4FB5A 4LRWA 2ORIA 3IX7A 5FPSA 4I99A 5G4KB 1Q3KA 1CWUA 3HR4A 1R2QA 1RU3A 3J80A 5CX1B 2HR2A 4ZAZA 2QMOA 4URVR 1FZTA 4D41A 4ILIA 1I01A 1QPBA 4IHJA 1AJEA 2JIOA 2OBXA 3UICA 3BEEA 3HCCA 3LT2A 1PZGA 3K2BA 3AIIA 3QLUA 5F33A 4ZC8A 4D45A 5CCLA 2FRDC 2OQ2A 3DNMA 4Y2HA 5GP1A 2W6OA 3KSQA 4MEAA 4ZMBA 1SZJG 4KYOB 4CV2A 4EO7A 3E37A 2EJWA 1ZEMA 4DAOA 1XMIA 1QG4A 3FUUA 4U04A 1YMQA 3JZDA 1FF9A 4EARA 3V8RA 1P6XA 1BI7B 3TXAA 1RKBA 1T9AA 2WTEA 4L50A 4OXKA 1JEJA 1N6NA 2VJCA 4KDRA 3ASUA 3KQYA 4HAZA 4M53A 4WOBA 3UFBA 6YASA 2FZLA 1KI9A 3IHTA 1CP2A 1E20A 3MMXA 3N2KA 4FVTA 5D00A 3W6UA 5BYKA 4E4RA 1YZVA 2V03A 3VNSA 5MFPA 4N7RA 3S7FA 1CB7A 4RVFA 4PZDA 3RIMA 4JLAA 1X3LA 4GIBA 1NKTA 3RT7A 2IH2A 3ZV5A 3L7NA 3FGPA 4BTEA 2XDYA 4RE5A 1YD7A 2QUZA 3I39X 2PZLA 1QHXA 1R27A 5DXJA 3MINA 3HHMA 3S2AA 1G1MA 2B20A 2DWUA 1NC3A 4J76A 4JMPA 4BLWA 1LH0A 5HA5A 3DVLA 2CJYA 1I32A 5BSHA 5JJ7A 1DX6A 4HXGA 3U3JA 4JWTA 1NWHA 2GEDA 4BCCA 5AKLA 3OE4A 4CMHA 3F46A 3CURA 4ND7A 2RAPA 4AG3A 4YAFA 2ZSFA 1QP8A 1WM5A 3SXUA 1GNTA 3PXBA 1DCTA 2QX8A 3PR1A 5ENZA 5BW8C 1AQLA 1KEEB 4QTTB 3G88A 4M1KA 5ICGA 4JLBA 1EHIA 1N95A 4Z4GA 1QP0A 1TR4A 4WESA 4YYEA 3TIXB 3UMGA 4WH0A 4J0FA 1E5TA 5I4BA 4FHEA 5BW8A 1NXSA 3IEGA 5BR4A 2A9PA 2ZYAA 4FNOA 1YR7A 1CJCA 3RHZA 5FTWA 4D8XA 1D7OA 1JIKA 3BRCA 4ZCLA 3KBBA 3C15C 1V9SA 3NBUA 1JJIA 2E4ZA 2XCLA 3GF4A 2FLKA 2PGLA 3O0TA 2REOA 1FFDA 3A26A 4KV7A 1WBJB 5G1NA 2JRCA 2TMDA 3PG5A 3UTDA 2FI1A 3WDKA 4A6PA 1JW9B 1MABA 3O9VA 4DV2B 3EFHA 2XH8A 5FBLB 1OH7A 1L5QA 2YNQA 3HC7A 4U0UA 4ANXA 1W5BA 1L5JA 2CXTA 1B0AA 4XOIA 4YAOA 1KVUA 4RPCA 4LWPA 4TS3A 2LP4Y 3MAJA 4FJ2A 5B12A 4W5OA 1I10A 3AILA 1WWKA 1IZZA 5B3LA 3BHIA 3TRKA 3U1TA 1U2GA 5AHWA 1A9YA 5FOQA 3HB0A 2BTOA 3H2YA 4L4UA 5AYWD 3W6NA 7ABPA 4XM0A 3UH0A 3K1JA 4F6CA 1LFAA 1BI8B 2BCJQ 3U80A 3QH4A 3PDIB 2E2EA 3VR2A 4IINA 5LA6B 5K0LA 3VVMA 3QPVA 5DM0A 1NJ1A 4Z8XA 4LZWA 1GN8A 1YQEA 1TAGA 3D4BA 1QGUB 2RI1A 4C7JA 4ZCIA 1QHHB 2RH4A 2HHAA 4GTRA 4PTZA 1IEXA 4NYIQ 5DX0A 1JQLB 3MLEA 3TOSA 4B9EA 2LIPA 5EC8A 3VO1A 1QTQA 3U7QB 2QSJA 1X1CA 1Y4AE 3Q9UC 3QWVA 1I2MA 1UP6A 3GNSA 4PQRA 3L06A 4LBYA 3AQ4A 3ICQB 3ZV3A 3M6VA 4LDPA 1P74A 1OOEA 4TLEA 3GRZA 4LJ9A 3IV0A 5AW8A 4TV8F 3PKJA 3TD9A 4D46A 1GP2A 1V5IA 4GI2A 2G1AA 4Z7OB 1VZ3A 2Q8PA 3KT6A 4BATA 2HMAA 2ODWA 2CXOA 4W63A 2R1VA 3BFXA 5FUBA 1EUZA 3D1JA 1FFAA 1XU7A 1B26A 2PGIA 2QLTA 2VDLB 4JXJA 4L0DA 4D3FA 3RHSA 4ZJPA 3HDGA 5A1TA 2PA3A 4B9AA 5C1IA 4QHYA 4ZEXA 3MS7A 4PICA 2OV3A 3AESB 4DGSA 4WBSA 3B82A 4M8IA 4UPDA 2QZSA 4J0JA 4V2IA 4ZCPA 3RANA 4E6EA 2M6RA 2ZQ5A 5DMHA 4LVUA 2ZM6B 4IF4A 4GQAA 3AP3A