3KSLA

Structure of fpt bound to datfp-dh-gpp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyltransferase, CAAX box, alpha
publication title Synthesis, properties, and applications of diazotrifluropropanoyl-containing photoactive analogs of farnesyl diphosphate containing modified linkages for enhanced stability.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 127
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3kslA00
1JCSA 1LD8A 2H6HA 3E37A 3HXEA 3Q75A 3Q79A 1FPPA 3EU5A 3SFXA 1FT1A 3SFYA 1S63A 4YDOA 1SA4A 2H6IA 3E34A 1QBQA 2H6GA 3PZ3A 4GTTA 2ZISA 4GTMA 1SA5A 2F0YA 1N4PA 4GTVA 3HXFA 3PZ4A 3Q73A 3DSXA 3DSTA 1O5MA 4GTPA 1TN7A 4GTRA 1LD7A 3DRAA 1X81A 3KSQA 3KSLA 1KZOA 1N9AA 3C72A 4EHMA 4LNBA 3Q78A 4GTQA 2H6FA 4MBGA 1S64A 3Q7FA 3DSWA 1FT2A 2IEJA 3HXCA 1N4RA 1N4QA 3PZ2A 1TNBA 4GTOA 3HXDA 3E33A 2BEDA 3E30A 4GTSA 1JCQA 3EUVA 3PZ1A 4YDEA 2ZIRA 1DCEA 4LNGA 3DSVA 1TNZA 3DSSA 1TNUA 2R2LA 3HXBA 1O1SA 1O1RA 3Q7AA 1N94A 1KZPA 1NL4A 1D8EA 1N95A 3E32A 1TN8A 3DPYA 1TNYA 1NI1A 1LTXA 1N4SA 1O1TA 1MZCA 1JCRA 4L9PA 1TN6A 3DSUA 1D8DA 1TNOA
chains in the Genus database with same CATH superfamily
4ANWA 3ASGA 3CVNA 5FINA 2GW1A 3L22A 4JHRA 3LYAA 1N11A 3IHYA 4YVOA 1WY6A 2C0LA 1MHQA 2WXJA 2F0YA 3ZYQA 2KCLA 3S2AA 4ATGA 2WXKA 2L6JA 2WB2A 3S7BA 5BXUA 1QYMA 3AU5A 3AJIA 3FDHA 1ZBPA 3ZVVA 1EPUA 3SQVA 3UT7A 4O1PA 1PC2A 5CCLA 1B89A 4J8DA 2HM8A 4F6RD 2E0IA 2NC9A 5EDSA 5CECB 1H6PA 1WG0A 3R9AB 3CHOA 3PZ2A 3TXMA 2WMOA 3E33A 4N3CA 5IY5E 4GMJA 1EDUA 3SGHA 4WNEA 5A7DB 5ITZF 1DNPA 4HOSA 3CVWA 3DSSA 3L54A 4CEMA 3UIOC 5CMYA 3I4RB 3RKVA 2KC7A 4B93B 1KZPA 3MCXA 3PS6A 3AG3E 3BU8A 3C3RA 1HU3A 5AQBA 3D3MA 4C0MA 3SY2A 1JCRA 4UWKA 3BQOA 5A23A 3GZ1A 3EHRA 3EHNA 2CHZA 3EU9A 3HDXA 4GZDA 3G2TA 4YDWA 4BSXA 5LP0A 3HHMA 5FQ8A 3L9TA 2EIJE 2IFUA 4F1SA 3HRAA 2PQRA 5T3RA 1MYOA 5HKPA 2ZISA 5AIJA 1YMPA 2UY1A 4URKA 2I9CA 4KT6B 2DZOA 1TN7A 4LRZA 4BSZB 2V5FA 4GTRA 3QB2A 1X81A 5LCWC 3ZEFA 2XCCA 1OCRE 3KSQA 3HIZA 3Q15A 5D0QD 4HI9A 3TWVA 1N52A 3CIAA 1A5EA 3UINC 4NACA 4MS6A 2QC9A 1H6KA 2H6FA 4MBGA 3LJNA 3PNLB 5BPPA 2IEJA 5JMND 3HXCA 5KNGA 1MX4A 3V79K 2VYIA 4AVXA 4DX1A 2DCPA 2X3MA 4N39A 1UJJA 2DIWA 5AAOA 4FU3A 3AG2E 1V55E 2P9SG 3MYVA 4M7CA 1DCQA 4YVQC 4BX9A 4EBAG 1HS6A 3FUEA 1OWMA 4GB9A 4AY6A 4W9RA 3Q4AB 3GZ2A 2WXGA 2VGYA 4G8LA 4HRNA 1HG2A 3CQCB 1NA3A 4K03A 4XKBA 2VTBA 3DBSA 4ACKA 4IYPA 3E37A 3QOUA 1ELWA 5FQ7A 4XKCA 2FEZA 3HVEA 3ONKA 1SA4A 4IULA 1HO8A 3QWPA 2WM9A 4UWGA 1N4PA 4G24A 4UWHA 3D9PA 4UI9K 5B1BE 3PEUB 3I3NA 3KEZA 4GTPA 4N3AA 3UM0A 3RU0A 4N2SA 3CHRA 1IHBA 3DRAA 2EILE 2L6BA 3AS5A 3BEEA 3FFLA 2P9PG 2JLBA 2P2CP 1WAO1 1X5BA 4B8AA 3DSWA 2LSVA 3EIJA 2DYSE 2WVIA 4ZFHA 4APFA 3SO8A 2BEDA 3IKOB 2WPVA 3LKUA 4HI8A 2LSUA 1TEZA 5CEAA 4G1TA 2FF4A 2ZIRA 5AJDA 1SW6A 2QZAA 3PH0C 3VLDA 1O1RA 3UTMA 3TWUA 3NF1A 3FP3A 4XEIG 2WXRA 5FZSA 4GZ6A 5KWDA 2HE0A 1KLXA 1JWGA 4I9EA 1JWFA 4CCAA 4KXKB 2ETBA 1AWCB 3S7DA 2WXQA 3UM3A 3ZIMA 1WM5A 4RQIA 4AM9A 1OWNA 4APOA 4F53A 3CQGB 3PDNA 2QFCA 3CEQA 2XZTG 4DI4A 4A3TA 3FTWA 2YHEA 4HNAD 4ANVA 1HXIA 4AY5A 5LFAA 1JUQA 5CEDB 3G2VA 2ZGDA 3QC1A 4AP2A 2JABA 3CVVA 3Q9NC 2V8SE 3NZSA 4DLOA 2J9QA 4EQFA 2EINE 3DEPA 3LXUX 4TUUA 1Z5SC 4PH4B 5BXOA 1ZU2A 3B7UX 4I2ZA 2KCKA 3FEYA 2OEWA 3E30A 4JW1A 2QY7A 3W9FA 5HRYA 2WXLA 2GRLA 4F7AA 3OAWA 5G05C 1H19A 2XPIA 5JHBA 4A1GA 2R2LA 3ZYLA 4Y6CA 4CDMA 5ENRD 3ZNGA 1E90A 2XEEA 4AJWA 4BX8A 1N95A 3AAAC 3D9LA 3FH7A 4X8QA 3SHFA 3FUMA 1UW4B 3X2QE 1D8DA 3CK8A 2QYUA 2J49A 1DVPA 3I4GA 1IXVA 3Q5MA 4GMRA 2OVFA 5BV1A 3N71A 5ENNA 3FU3A 4FA6A 1H6OA 4KVOA 2V5QC 2H6IA 3ZFWA 3BUAA 4HORA 4GTTA 1SA5A 4FP7A 3PRZA 3ZU7B 2MRIA 1PY1A 2Y1LE 2EIKE 5CRUA 1QNFA 3MKQB 3ESLA 1GW6A 3L16A 5LOZA 3ZXPA 2ZXWE 4U0UA 2J4DA 3AS4A 5AQ7A 1S64A 4GPMA 4PUCA 4BTBA 3DWLG 2ZU6B 4HLEA 4G8KA 3ZYKA 1TNBA 5T4YA 2WXPA 4ANUA 2XGOA 3EUVA 1YYHA 2LUHA 2X6HA 4N5QA 3BG1B 4GZ5A 4RVBA 3OXLA 3J5QB 3KS2A 4CZ2D 1TNZA 5ANRA 2OCCE 4FHKA 2WXFA 3FTYA 4I6EA 5JJ6A 3HXBA 2YINA 2Y69E 4TUMA 2AXVA 4UWLA 1E8WA 2AXZA 2NYJA 3FU5A 2LO6A 1E8YA 3F6QA 3QDNA 4JA9A 3NBNB 1OCOE 5AQ9A 1BD8A 5M72A 4RG6A 5ENTD 3FU6A 4B94A 2XGMA 2F37A 2J8SD 3ASFA 5AENA 2XRYA 2NSZA 3ZRHA 1O5MA 1HZ4A 1U3DA 3P1UA 1ELRA 4K0RA 3GYZA 4JHJA 4UUCA 3URZA 2GRPB 2VSYA 4GTQA 4Q69A 4N3BA 4DX7D 3RJVA 3RO2A 1HE8A 4DLQA 2XHEA 2CFUA 3ZPJA 3ONLA 1DCEA 5EIDA 5ENSD 3KAEA 3L6AA 4B89A 5BV0A 1LF8A 3VTYA 2V4LA 4J8FA 4TV3A 2KCVA 3UM2A 3QWWA 5AN8A 4EECA 2F8YA 4HB5A 4GZ3A 4GYYA 2B6CA 4JC8A 3SFZA 3DEOA 2IO2C 4DJAA 3D9IA 3V2XA 3GZSA 4BTAA 3FUKA 3FULA 4GPKA 4BERA 4FADA 4J8EA 2VGXB 5DIZA 5BNWA 2XZDG 3PREA 4IRUA 5G2NA 3L82A 3UI2A 1KPSB 4TRQA 2VGXA 3ESKA 3FUJA 4OAVB 4HLLA 2XCBA 5CBNA 4JHKA 5BW8C 1MX2A 3C5RA 2H6GA 2I6HA 4BESA 1UOHA 2ETCA 4WWOA 3CLJA 2KATA 4Z68A 4AOFA 4G2VA 5JHAA 1LD7A 2AWIA 4I43A 2UY1B 3B13A 2CHXA 4U7EB 1KZOA 5LX8A 3ZHEA 2IO3C 2CFZA 1QQEA 3NAWA 5KJLA 3Q78A 3FEXA 4WWPA 5LCWJ 3D9MA 3EHMA 3I5PA 2XPYA 2CG3A 3SI5A 2WXOA 5ANLA 3Q49B 3ASOE 4U0ZA 1OY3D 4J8YA 1EYHA 3U4TA 2OOEA 3LCAA 1BLXB 5JJ7A 4XX5A 1N94A 4ILHB 2CHWA 1K1AA 3E32A 4DPRA 4MKTA 4FJYA 4H7XA 2A5EA 3PEVB 4FHJA 3RRUA 3TWQA 3ML9A 3ULYA 4C9BB 5D0OD 3ISMC 4I1OB 2DVWA 3SF4A 2L0TB 3SFXA 3DPDA 2GRRB 4HRMB 3D9HA 1N0QA 3CVLA 2FO1E 2VTBB 3PUKA 2VQ2A 3QK0A 4Q96A 5EYPF 2PQNA 1BI7B 3HVEB 3FTZA 4G25A 1KT1A 3T8MA 2DWZA 2R5SA 5FQ4A 4U8HA 3UT8A 1G3NB 1MJ0A 3TJPA 5FQ6A 2PM6A 3UIPC 3FUIA 3CVPA 1AP7A 2AXUA 2MYOA 3Q9UC 3IHVA 4HS2A 4GA2A 3TG5A 4UI9J 1IKND 3CHSA 3CGHA 3MV3B 3PZ1A 4UI9C 3LEWA 3DSVA 4L2YA 4JB8P 1IQRA 4YDYA 3TWXA 4QQIA 3ASDA 5EN5D 3SBTB 5B1AE 1D8EA 1IYGA 2RFMA 4HRLA 1P5QA 2GROB 2X6FA 2Y4UA 3DXMG 3UM1A 3HXEA 2ONDA 3MEKA 4J0UA 1S63A 2BKKB 4U8YD 5FZQA 3LY8A 4JD2G 3PE4A 4FLHA 5T8IA 3B7TA 3APDA 5JA4D 3LS8A 3NZUA 4KYOB 3FU0A 3V31A 5CERB 3D9OA 4EZKA 1OXJA 3ZYMA 1PAQA 2L9BA 3SD5A 3Q7FA 4JL0A 3VLFA 4WWNA 1N4RA 4H7YA 4GYWA 3RSEG 3HXDA 2GRQB 5ENPD 2J4BA 1E7VA 4FLBA 4L2LA 3V2OA 2YQ8A 4U95D 4KZCA 4V3IA 3LVQE 3JUEA 4CT4A 1NL4A 1U2VG 5G04C 2A5UA 4LUNU 2WQHA 5G05J 3RAUA 4RG9A 4EPZA 4L9PA 1TN6A 1HG5A 3RK6A 2GRNB 2R05A 1XGWA 3D9NA 5J08A 3LDZA 3LY9A 4CGVA 2ZGGA 3UPVA 3S7FA 3Q75A 1FPPA 4N5CA 3FWVA 2AJAA 3PZ3A 4TXRA 2I2OA 1S0PA 1BPOA 3PZ4A 3DSXA 2XENA 5HS0A 3CSTA 2Y4TA 4KBQA 3CK9A 5KJKA 3KSLA 4JXTA 4HOQA 4LERA 3D9KA 3ULEG 1SVXA 2RFAA 3ZN3A 3UX4A 3G2UA 3FHEA 5BT1A 3RRMB 4NURA 3B7BA 3O4ZA 5E76A 3CHMA 1Z3XA 1H2VC 5D2MC 3IBEA 4ACLA 3RIBA 5KJMA 5DBKA 4UQXA 5HI7A 3IV0A 2GGFA 2R17C 3EJNA 4XI0A 3PUJA 4XI9A 5FTPA 3DXKG 3T5VA 4A55A 4PS8A 1IQUA 4KMOA 2V4HC 4DK5A 3TXNA 2YNQA 2AVPA 1UG3A 3WG7E 4U04A 1N4SA 4E85A 3HYMB 2F8XK 3DSUA 2BF0X 4NIKA 1TNOA 3ZXSA 5CBOA 3JYSA 4J7WA 4L7TA 5B3SE 4AIFA 2LAIA 1TJCA 4KZ0A 3NB2A 2I1KA 5E75A 1E8ZA 1FT1A 4HXIA 4GAAA 3E34A 4BT9A 1E7UA 4GTMA 3CVUA 4CT0A 3NQPA 3JQ1A 5A6CA 4QFVA 3T8KA 4DX6D 5ARGA 2P9KG 5CMWA 3QKYA 3KEAA 1HF8A 1N54A 3S7JA 2OVBA 1FCHA 4LNBA 1SZAA 1UN9A 1INZA 3LPZA 4UWFA 2V0PA 4KVMA 1TYQG 3JXIA 4M3OA 3OXGA 2A4ZA 5FT9A 4DUIA 4A3VA 3ULQA 3TWTA 4LSZE 4DI3A 5FZRA 3JUIA 1VDYA 2KZTA 4K5AB 5AARA 3PNTB 2WXMA 3ZKJA 3CVQA 2IY0C 4ILIA 5EX3A 2PZIA 4GA1A 1TR4A 4AEZC 1NI1A 3R9MA 2J08A 4AXHA 1OWPA 2XPZA 2JEKA 4RLYA 1YCSB 2YHCA 2XEVA 5EX0A 4XIFA 5CRVA 2DBAA 1K8KG 4ME2A 1A17A 4YDOA 4FC8A 2Q7FA 3GW4A 4NQ0A 3U64A 4R7LA 2OV8A 4Q94A 3MV2B 1MX6A 1SQMA 2FI7A 2WXIA 2I1JA 1TJFA 4N2QA 3G2SA 4HFGA 1ELKA 3CSFA 4UQZA 4OYSA 2AW6A 2VSXE 3E4BA 3IXEA 3ML8A 3C72A 2M63A 2P9IG 2C2LA 4U8VD 3BG0B 3UKRG 1FT2A 5EILA 2EIME 4J6IA 4WNDA 1Q2ZA 3RRNB 2PNNA 3KD7A 3APCA 3PZDA 4GTOA 3ZHEB 2X6IA 4OVUA 4XE0A 4GTSA 5EKQD 1HFAA 1W3BA 3WXXA 4ABNA 3OXFA 2XQ0A 3AS8A 3T5XA 1BU9A 3QNKA 3CKCA 3ZUVB 4D10C 4G26A 1O1SA 1D9SA 4MLPA 3AG1E 3ABLE 4JA7A 3DPYA 4BEPA 4ATZD 1O1TA 1MZCA 3VTXA 3FTUA 3ZGQA 5ARFA 2R03A 1JCSA 3CVYA 3FUHA 4LEUA 1NFIE 4TXQA 5EYLA 3TWRA 1RZ4A 2XRZA 1RW2A 2HR2A 2XS1A 4DX2A 4GA0A 4WUYA 3CKBA 4JPSA 4CRWA 3MJWA 2QYJA 2X6KA 2ILRA 2OEVA 2IOSA 5KBAA 1H0AA 3TWWA 2RG8A 2MOWA 3O48A 1OWLA 3AG4E 4BY6A 5HQ8A 1V54E 4MRUA 4EHMA 2GRMA 5D66A 5CCMA 4EZLA 3B95A 1K3ZD 1Y8MA 5G55A 4EBAA 1QZ2A 2LXMA 2C0MA 1OUVA 2WXNA 3EHQA 2WQ6A 3ABME 3FTVA 2IONA 2HO1A 4YDEA 3UKUG 4GZCA 4HBDA 4ANXA 4LG6A 3MKRA 3APFA 3EDTB 5C1DA 4JEUA 2LXLA 5FIOA 2IF4A 1UJKA 3NOGD 1NZNA 3ASHA 3FY4A 1TNYA 4PDXA 4EZJA 3V30A 1Y6IA 3QJZA 3W9GA 3ENEA 2R02A 3FUDA 4L1BA 3P2BA 1U3CA 1SZ9A 3TG4A 2H6HA 3UQ3A 1DC2A 3Q79A 3JXJA 3EU5A 3FTSA 4E6HA 1UN8A 1JPLA 4HQDA 3B7SA 1QBQA 2VSNA 2EQXA 4B8CB 3TWSA 4U96D 4YNDA 1E8XA 3J5PA 2P9LG 3DSTA 4UQYA 2IU1A 4BFRA 2X6JA 3FUFA 4IN3B 4HOUA 2CG2A 3TAXA 5C2YA 3PE3A 2WXHA 1N9AA 3FTXA 4G23A 4FJZA 1KT0A 3R7QA 2FO7A 4K5CA 1EF1C 2UWJG 3UUXA 3CK7A 4O60A 2DYRE 2IQCA 2XEHA 3SZ7A 1FVHA 4ZHBA 3VLEA 4LNGA 1OWOA 3IEGA 1E96B 4GCNA 3JCKC 4JEHA 3MGBA 3D9JA 4C0EA 3U3WA 3C98A 3QAQA 1OT8A 5ENOD 4I6JA 4P29A 4OAUC 4CGWA 4JZYA 1YA0A 2WQ7A 2XS8A 3AU4A 2DZNA 3PVLA 3SBSA 2PM7A 3MZLB 3QWVA 5CHEE 1IHGA 3L08A 2J07A 3CHQA 5G04J 4I1AA 4BETA 3ASNE 2VGEA 1XNFA 3HG0D 3SFYA 3FUNA 1HH8A 1OCZE 3L13A 3UXGA 5J90A 5EIBE 2PL2A 4G11A 4U63A 2Y0BG 4WNGA 2BKGA 3MA5A 3Q73A 4DRXE 4LCTA 3ABKE 2E2EA 3B7RL 4NRHB 3U9WA 1K1BA 4GMLA 4A63B 4RSYA 4Y6WA 3RO3A 4CYMD 1H2TC 4F1PA 2R59A 2FBNA 2BTDA 4I6GA 2LNIA 3EIQC 3QARA 3OTNA 4O6FA 2ETAA 1N0RA 2KBXA 4DX5D 4I1MA 5FJYA 1HX8A 3UMVA 5AYWD 4AV7A 4BWRA 3MX3A 5AQAA 5FWQA 4U0SA 1Z3YA 4CDNA 4GYOA 4I17A 3FH8A 5KCMA 2P58C 3Q47B 2P9NG 3T9KA 4HVBA 1TN8A 4WAFA 4HOTA 2J09A 4I9CA 3U66A 4ILGA 4PS3A 1LTXA 5KJNA 1H2UA 4K5BA 3L17A 3NOCD 4I2WA 2X38A 4CDRA 3K9IA 1LD8A 2LAHA 3LY7A 4F3VA 3CR3A 4BT8A 4C48B 1S70B 2P9UG 1FVFA 4OVVA 1NA0A 2XGSA 3ZW3A 2RKKA 5H7PA 3LVRE 4J8SA 3CV0A 1L5JA 3MKQA 4FULA 3LJ3A 4GTVA 4XZ4A 3HXFA 3R7RA 4U07A 2B0OE 4LNUD 4JVSA 2FULA 4GCOA 4GU5A 5ENQD 3TL5A 3SNXA 3C3OA 1WDYA 2HYZA 3TGOA 1BI8B 3CHPA 3G2WA 4WNFA 4TXPA 5JJTA 4L23A 2Y3AA 2BUGA 4PS7A 5AJLA 5KNHD 2VSOE 3CVXA 3JQ0A 1N4QA 1NP7A 1JCQA 3C3QA 2IOLA 2RD0A 1Z6TA 4O1OA 3FH5A 4B0ZA 5BUZA 4A1SA 1TNUA 2IJGX 1OCCE 2KXPC 3UT4A 3Q7AA 1ZB1A 2VJ8A 2WMNA 2MHKA 2KZTB 1MQSA 2KM4A 2L0IA 2NXPA
chains in the Genus database with same CATH topology
1JCSA 1LD8A 2H6HA 3E37A 3HXEA 3Q75A 3Q79A 1FPPA 3EU5A 3SFXA 1FT1A 3SFYA 1S63A 4YDOA 1SA4A 2H6IA 3E34A 1QBQA 2H6GA 3PZ3A 4GTTA 2ZISA 4GTMA 1SA5A 2F0YA 1N4PA 4GTVA 3HXFA 3PZ4A 3Q73A 3DSXA 3DSTA 1O5MA 4GTPA 1TN7A 4GTRA 1LD7A 3DRAA 1X81A 3KSQA 3KSLA 1KZOA 1N9AA 3C72A 4EHMA 4LNBA 3Q78A 4GTQA 2H6FA 4MBGA 1S64A 3Q7FA 3DSWA 1FT2A 2IEJA 3HXCA 1N4RA 1N4QA 3PZ2A 1TNBA 4GTOA 3HXDA 3E33A 2BEDA 3E30A 4GTSA 1JCQA 3EUVA 3PZ1A 4YDEA 2ZIRA 1DCEA 4LNGA 3DSVA 1TNZA 3DSSA 1TNUA 2R2LA 3HXBA 1O1SA 1O1RA 3Q7AA 1N94A 1KZPA 1NL4A 1D8EA 1N95A 3E32A 1TN8A 3DPYA 1TNYA 1NI1A 1LTXA 1N4SA 1O1TA 1MZCA 1JCRA 4L9PA 1TN6A 3DSUA 1D8DA 1TNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCS A;  1LD8 A;  2H6H A;  3E37 A;  3HXE A;  3Q75 A;  3Q79 A;  1FPP A;  3EU5 A;  3SFX A;  1FT1 A;  3SFY A;  1S63 A;  4YDO A;  1SA4 A;  2H6I A;  3E34 A;  1QBQ A;  2H6G A;  3PZ3 A;  4GTT A;  2ZIS A;  4GTM A;  1SA5 A;  2F0Y A;  1N4P A;  4GTV A;  3HXF A;  3PZ4 A;  3Q73 A;  3DSX A;  3DST A;  1O5M A;  4GTP A;  1TN7 A;  4GTR A;  1LD7 A;  3DRA A;  1X81 A;  3KSQ A;  3KSL A;  1KZO A;  1N9A A;  3C72 A;  4EHM A;  4LNB A;  3Q78 A;  4GTQ A;  2H6F A;  4MBG A;  1S64 A;  3Q7F A;  3DSW A;  1FT2 A;  2IEJ A;  3HXC A;  1N4R A;  1N4Q A;  3PZ2 A;  1TNB A;  4GTO A;  3HXD A;  3E33 A;  2BED A;  3E30 A;  4GTS A;  1JCQ A;  3EUV A;  3PZ1 A;  4YDE A;  2ZIR A;  1DCE A;  4LNG A;  3DSV A;  1TNZ A;  3DSS A;  1TNU A;  2R2L A;  3HXB A;  1O1S A;  1O1R A;  3Q7A A;  1N94 A;  1KZP A;  1NL4 A;  1D8E A;  1N95 A;  3E32 A;  1TN8 A;  3DPY A;  1TNY A;  1NI1 A;  1LTX A;  1N4S A;  1O1T A;  1MZC A;  1JCR A;  4L9P A;  1TN6 A;  3DSU A;  1D8D A;  1TNO A; 
#chains in the Genus database with same CATH topology
 4ANW A;  3ASG A;  3CVN A;  5FIN A;  2GW1 A;  3L22 A;  4JHR A;  3LYA A;  1N11 A;  3IHY A;  4YVO A;  1WY6 A;  2C0L A;  1MHQ A;  2WXJ A;  2F0Y A;  3ZYQ A;  2KCL A;  3S2A A;  4ATG A;  2WXK A;  2L6J A;  2WB2 A;  3S7B A;  5BXU A;  1QYM A;  3AU5 A;  3AJI A;  3FDH A;  1ZBP A;  3ZVV A;  1EPU A;  3SQV A;  3UT7 A;  4O1P A;  1PC2 A;  5CCL A;  1B89 A;  4J8D A;  2HM8 A;  4F6R D;  2E0I A;  2NC9 A;  5EDS A;  5CEC B;  1H6P A;  1WG0 A;  3R9A B;  3CHO A;  3PZ2 A;  3TXM A;  2WMO A;  3E33 A;  4N3C A;  5IY5 E;  4GMJ A;  1EDU A;  3SGH A;  4WNE A;  5A7D B;  5ITZ F;  1DNP A;  4HOS A;  3CVW A;  3DSS A;  3L54 A;  4CEM A;  3UIO C;  5CMY A;  3I4R B;  3RKV A;  2KC7 A;  4B93 B;  1KZP A;  3MCX A;  3PS6 A;  3AG3 E;  3BU8 A;  3C3R A;  1HU3 A;  5AQB A;  3D3M A;  4C0M A;  3SY2 A;  1JCR A;  4UWK A;  3BQO A;  5A23 A;  3GZ1 A;  3EHR A;  3EHN A;  2CHZ A;  3EU9 A;  3HDX A;  4GZD A;  3G2T A;  4YDW A;  4BSX A;  5LP0 A;  3HHM A;  5FQ8 A;  3L9T A;  2EIJ E;  2IFU A;  4F1S A;  3HRA A;  2PQR A;  5T3R A;  1MYO A;  5HKP A;  2ZIS A;  5AIJ A;  1YMP A;  2UY1 A;  4URK A;  2I9C A;  4KT6 B;  2DZO A;  1TN7 A;  4LRZ A;  4BSZ B;  2V5F A;  4GTR A;  3QB2 A;  1X81 A;  5LCW C;  3ZEF A;  2XCC A;  1OCR E;  3KSQ A;  3HIZ A;  3Q15 A;  5D0Q D;  4HI9 A;  3TWV A;  1N52 A;  3CIA A;  1A5E A;  3UIN C;  4NAC A;  4MS6 A;  2QC9 A;  1H6K A;  2H6F A;  4MBG A;  3LJN A;  3PNL B;  5BPP A;  2IEJ A;  5JMN D;  3HXC A;  5KNG A;  1MX4 A;  3V79 K;  2VYI A;  4AVX A;  4DX1 A;  2DCP A;  2X3M A;  4N39 A;  1UJJ A;  2DIW A;  5AAO A;  4FU3 A;  3AG2 E;  1V55 E;  2P9S G;  3MYV A;  4M7C A;  1DCQ A;  4YVQ C;  4BX9 A;  4EBA G;  1HS6 A;  3FUE A;  1OWM A;  4GB9 A;  4AY6 A;  4W9R A;  3Q4A B;  3GZ2 A;  2WXG A;  2VGY A;  4G8L A;  4HRN A;  1HG2 A;  3CQC B;  1NA3 A;  4K03 A;  4XKB A;  2VTB A;  3DBS A;  4ACK A;  4IYP A;  3E37 A;  3QOU A;  1ELW A;  5FQ7 A;  4XKC A;  2FEZ A;  3HVE A;  3ONK A;  1SA4 A;  4IUL A;  1HO8 A;  3QWP A;  2WM9 A;  4UWG A;  1N4P A;  4G24 A;  4UWH A;  3D9P A;  4UI9 K;  5B1B E;  3PEU B;  3I3N A;  3KEZ A;  4GTP A;  4N3A A;  3UM0 A;  3RU0 A;  4N2S A;  3CHR A;  1IHB A;  3DRA A;  2EIL E;  2L6B A;  3AS5 A;  3BEE A;  3FFL A;  2P9P G;  2JLB A;  2P2C P;  1WAO 1;  1X5B A;  4B8A A;  3DSW A;  2LSV A;  3EIJ A;  2DYS E;  2WVI A;  4ZFH A;  4APF A;  3SO8 A;  2BED A;  3IKO B;  2WPV A;  3LKU A;  4HI8 A;  2LSU A;  1TEZ A;  5CEA A;  4G1T A;  2FF4 A;  2ZIR A;  5AJD A;  1SW6 A;  2QZA A;  3PH0 C;  3VLD A;  1O1R A;  3UTM A;  3TWU A;  3NF1 A;  3FP3 A;  4XEI G;  2WXR A;  5FZS A;  4GZ6 A;  5KWD A;  2HE0 A;  1KLX A;  1JWG A;  4I9E A;  1JWF A;  4CCA A;  4KXK B;  2ETB A;  1AWC B;  3S7D A;  2WXQ A;  3UM3 A;  3ZIM A;  1WM5 A;  4RQI A;  4AM9 A;  1OWN A;  4APO A;  4F53 A;  3CQG B;  3PDN A;  2QFC A;  3CEQ A;  2XZT G;  4DI4 A;  4A3T A;  3FTW A;  2YHE A;  4HNA D;  4ANV A;  1HXI A;  4AY5 A;  5LFA A;  1JUQ A;  5CED B;  3G2V A;  2ZGD A;  3QC1 A;  4AP2 A;  2JAB A;  3CVV A;  3Q9N C;  2V8S E;  3NZS A;  4DLO A;  2J9Q A;  4EQF A;  2EIN E;  3DEP A;  3LXU X;  4TUU A;  1Z5S C;  4PH4 B;  5BXO A;  1ZU2 A;  3B7U X;  4I2Z A;  2KCK A;  3FEY A;  2OEW A;  3E30 A;  4JW1 A;  2QY7 A;  3W9F A;  5HRY A;  2WXL A;  2GRL A;  4F7A A;  3OAW A;  5G05 C;  1H19 A;  2XPI A;  5JHB A;  4A1G A;  2R2L A;  3ZYL A;  4Y6C A;  4CDM A;  5ENR D;  3ZNG A;  1E90 A;  2XEE A;  4AJW A;  4BX8 A;  1N95 A;  3AAA C;  3D9L A;  3FH7 A;  4X8Q A;  3SHF A;  3FUM A;  1UW4 B;  3X2Q E;  1D8D A;  3CK8 A;  2QYU A;  2J49 A;  1DVP A;  3I4G A;  1IXV A;  3Q5M A;  4GMR A;  2OVF A;  5BV1 A;  3N71 A;  5ENN A;  3FU3 A;  4FA6 A;  1H6O A;  4KVO A;  2V5Q C;  2H6I A;  3ZFW A;  3BUA A;  4HOR A;  4GTT A;  1SA5 A;  4FP7 A;  3PRZ A;  3ZU7 B;  2MRI A;  1PY1 A;  2Y1L E;  2EIK E;  5CRU A;  1QNF A;  3MKQ B;  3ESL A;  1GW6 A;  3L16 A;  5LOZ A;  3ZXP A;  2ZXW E;  4U0U A;  2J4D A;  3AS4 A;  5AQ7 A;  1S64 A;  4GPM A;  4PUC A;  4BTB A;  3DWL G;  2ZU6 B;  4HLE A;  4G8K A;  3ZYK A;  1TNB A;  5T4Y A;  2WXP A;  4ANU A;  2XGO A;  3EUV A;  1YYH A;  2LUH A;  2X6H A;  4N5Q A;  3BG1 B;  4GZ5 A;  4RVB A;  3OXL A;  3J5Q B;  3KS2 A;  4CZ2 D;  1TNZ A;  5ANR A;  2OCC E;  4FHK A;  2WXF A;  3FTY A;  4I6E A;  5JJ6 A;  3HXB A;  2YIN A;  2Y69 E;  4TUM A;  2AXV A;  4UWL A;  1E8W A;  2AXZ A;  2NYJ A;  3FU5 A;  2LO6 A;  1E8Y A;  3F6Q A;  3QDN A;  4JA9 A;  3NBN B;  1OCO E;  5AQ9 A;  1BD8 A;  5M72 A;  4RG6 A;  5ENT D;  3FU6 A;  4B94 A;  2XGM A;  2F37 A;  2J8S D;  3ASF A;  5AEN A;  2XRY A;  2NSZ A;  3ZRH A;  1O5M A;  1HZ4 A;  1U3D A;  3P1U A;  1ELR A;  4K0R A;  3GYZ A;  4JHJ A;  4UUC A;  3URZ A;  2GRP B;  2VSY A;  4GTQ A;  4Q69 A;  4N3B A;  4DX7 D;  3RJV A;  3RO2 A;  1HE8 A;  4DLQ A;  2XHE A;  2CFU A;  3ZPJ A;  3ONL A;  1DCE A;  5EID A;  5ENS D;  3KAE A;  3L6A A;  4B89 A;  5BV0 A;  1LF8 A;  3VTY A;  2V4L A;  4J8F A;  4TV3 A;  2KCV A;  3UM2 A;  3QWW A;  5AN8 A;  4EEC A;  2F8Y A;  4HB5 A;  4GZ3 A;  4GYY A;  2B6C A;  4JC8 A;  3SFZ A;  3DEO A;  2IO2 C;  4DJA A;  3D9I A;  3V2X A;  3GZS A;  4BTA A;  3FUK A;  3FUL A;  4GPK A;  4BER A;  4FAD A;  4J8E A;  2VGX B;  5DIZ A;  5BNW A;  2XZD G;  3PRE A;  4IRU A;  5G2N A;  3L82 A;  3UI2 A;  1KPS B;  4TRQ A;  2VGX A;  3ESK A;  3FUJ A;  4OAV B;  4HLL A;  2XCB A;  5CBN A;  4JHK A;  5BW8 C;  1MX2 A;  3C5R A;  2H6G A;  2I6H A;  4BES A;  1UOH A;  2ETC A;  4WWO A;  3CLJ A;  2KAT A;  4Z68 A;  4AOF A;  4G2V A;  5JHA A;  1LD7 A;  2AWI A;  4I43 A;  2UY1 B;  3B13 A;  2CHX A;  4U7E B;  1KZO A;  5LX8 A;  3ZHE A;  2IO3 C;  2CFZ A;  1QQE A;  3NAW A;  5KJL A;  3Q78 A;  3FEX A;  4WWP A;  5LCW J;  3D9M A;  3EHM A;  3I5P A;  2XPY A;  2CG3 A;  3SI5 A;  2WXO A;  5ANL A;  3Q49 B;  3ASO E;  4U0Z A;  1OY3 D;  4J8Y A;  1EYH A;  3U4T A;  2OOE A;  3LCA A;  1BLX B;  5JJ7 A;  4XX5 A;  1N94 A;  4ILH B;  2CHW A;  1K1A A;  3E32 A;  4DPR A;  4MKT A;  4FJY A;  4H7X A;  2A5E A;  3PEV B;  4FHJ A;  3RRU A;  3TWQ A;  3ML9 A;  3ULY A;  4C9B B;  5D0O D;  3ISM C;  4I1O B;  2DVW A;  3SF4 A;  2L0T B;  3SFX A;  3DPD A;  2GRR B;  4HRM B;  3D9H A;  1N0Q A;  3CVL A;  2FO1 E;  2VTB B;  3PUK A;  2VQ2 A;  3QK0 A;  4Q96 A;  5EYP F;  2PQN A;  1BI7 B;  3HVE B;  3FTZ A;  4G25 A;  1KT1 A;  3T8M A;  2DWZ A;  2R5S A;  5FQ4 A;  4U8H A;  3UT8 A;  1G3N B;  1MJ0 A;  3TJP A;  5FQ6 A;  2PM6 A;  3UIP C;  3FUI A;  3CVP A;  1AP7 A;  2AXU A;  2MYO A;  3Q9U C;  3IHV A;  4HS2 A;  4GA2 A;  3TG5 A;  4UI9 J;  1IKN D;  3CHS A;  3CGH A;  3MV3 B;  3PZ1 A;  4UI9 C;  3LEW A;  3DSV A;  4L2Y A;  4JB8 P;  1IQR A;  4YDY A;  3TWX A;  4QQI A;  3ASD A;  5EN5 D;  3SBT B;  5B1A E;  1D8E A;  1IYG A;  2RFM A;  4HRL A;  1P5Q A;  2GRO B;  2X6F A;  2Y4U A;  3DXM G;  3UM1 A;  3HXE A;  2OND A;  3MEK A;  4J0U A;  1S63 A;  2BKK B;  4U8Y D;  5FZQ A;  3LY8 A;  4JD2 G;  3PE4 A;  4FLH A;  5T8I A;  3B7T A;  3APD A;  5JA4 D;  3LS8 A;  3NZU A;  4KYO B;  3FU0 A;  3V31 A;  5CER B;  3D9O A;  4EZK A;  1OXJ A;  3ZYM A;  1PAQ A;  2L9B A;  3SD5 A;  3Q7F A;  4JL0 A;  3VLF A;  4WWN A;  1N4R A;  4H7Y A;  4GYW A;  3RSE G;  3HXD A;  2GRQ B;  5ENP D;  2J4B A;  1E7V A;  4FLB A;  4L2L A;  3V2O A;  2YQ8 A;  4U95 D;  4KZC A;  4V3I A;  3LVQ E;  3JUE A;  4CT4 A;  1NL4 A;  1U2V G;  5G04 C;  2A5U A;  4LUN U;  2WQH A;  5G05 J;  3RAU A;  4RG9 A;  4EPZ A;  4L9P A;  1TN6 A;  1HG5 A;  3RK6 A;  2GRN B;  2R05 A;  1XGW A;  3D9N A;  5J08 A;  3LDZ A;  3LY9 A;  4CGV A;  2ZGG A;  3UPV A;  3S7F A;  3Q75 A;  1FPP A;  4N5C A;  3FWV A;  2AJA A;  3PZ3 A;  4TXR A;  2I2O A;  1S0P A;  1BPO A;  3PZ4 A;  3DSX A;  2XEN A;  5HS0 A;  3CST A;  2Y4T A;  4KBQ A;  3CK9 A;  5KJK A;  3KSL A;  4JXT A;  4HOQ A;  4LER A;  3D9K A;  3ULE G;  1SVX A;  2RFA A;  3ZN3 A;  3UX4 A;  3G2U A;  3FHE A;  5BT1 A;  3RRM B;  4NUR A;  3B7B A;  3O4Z A;  5E76 A;  3CHM A;  1Z3X A;  1H2V C;  5D2M C;  3IBE A;  4ACL A;  3RIB A;  5KJM A;  5DBK A;  4UQX A;  5HI7 A;  3IV0 A;  2GGF A;  2R17 C;  3EJN A;  4XI0 A;  3PUJ A;  4XI9 A;  5FTP A;  3DXK G;  3T5V A;  4A55 A;  4PS8 A;  1IQU A;  4KMO A;  2V4H C;  4DK5 A;  3TXN A;  2YNQ A;  2AVP A;  1UG3 A;  3WG7 E;  4U04 A;  1N4S A;  4E85 A;  3HYM B;  2F8X K;  3DSU A;  2BF0 X;  4NIK A;  1TNO A;  3ZXS A;  5CBO A;  3JYS A;  4J7W A;  4L7T A;  5B3S E;  4AIF A;  2LAI A;  1TJC A;  4KZ0 A;  3NB2 A;  2I1K A;  5E75 A;  1E8Z A;  1FT1 A;  4HXI A;  4GAA A;  3E34 A;  4BT9 A;  1E7U A;  4GTM A;  3CVU A;  4CT0 A;  3NQP A;  3JQ1 A;  5A6C A;  4QFV A;  3T8K A;  4DX6 D;  5ARG A;  2P9K G;  5CMW A;  3QKY A;  3KEA A;  1HF8 A;  1N54 A;  3S7J A;  2OVB A;  1FCH A;  4LNB A;  1SZA A;  1UN9 A;  1INZ A;  3LPZ A;  4UWF A;  2V0P A;  4KVM A;  1TYQ G;  3JXI A;  4M3O A;  3OXG A;  2A4Z A;  5FT9 A;  4DUI A;  4A3V A;  3ULQ A;  3TWT A;  4LSZ E;  4DI3 A;  5FZR A;  3JUI A;  1VDY A;  2KZT A;  4K5A B;  5AAR A;  3PNT B;  2WXM A;  3ZKJ A;  3CVQ A;  2IY0 C;  4ILI A;  5EX3 A;  2PZI A;  4GA1 A;  1TR4 A;  4AEZ C;  1NI1 A;  3R9M A;  2J08 A;  4AXH A;  1OWP A;  2XPZ A;  2JEK A;  4RLY A;  1YCS B;  2YHC A;  2XEV A;  5EX0 A;  4XIF A;  5CRV A;  2DBA A;  1K8K G;  4ME2 A;  1A17 A;  4YDO A;  4FC8 A;  2Q7F A;  3GW4 A;  4NQ0 A;  3U64 A;  4R7L A;  2OV8 A;  4Q94 A;  3MV2 B;  1MX6 A;  1SQM A;  2FI7 A;  2WXI A;  2I1J A;  1TJF A;  4N2Q A;  3G2S A;  4HFG A;  1ELK A;  3CSF A;  4UQZ A;  4OYS A;  2AW6 A;  2VSX E;  3E4B A;  3IXE A;  3ML8 A;  3C72 A;  2M63 A;  2P9I G;  2C2L A;  4U8V D;  3BG0 B;  3UKR G;  1FT2 A;  5EIL A;  2EIM E;  4J6I A;  4WND A;  1Q2Z A;  3RRN B;  2PNN A;  3KD7 A;  3APC A;  3PZD A;  4GTO A;  3ZHE B;  2X6I A;  4OVU A;  4XE0 A;  4GTS A;  5EKQ D;  1HFA A;  1W3B A;  3WXX A;  4ABN A;  3OXF A;  2XQ0 A;  3AS8 A;  3T5X A;  1BU9 A;  3QNK A;  3CKC A;  3ZUV B;  4D10 C;  4G26 A;  1O1S A;  1D9S A;  4MLP A;  3AG1 E;  3ABL E;  4JA7 A;  3DPY A;  4BEP A;  4ATZ D;  1O1T A;  1MZC A;  3VTX A;  3FTU A;  3ZGQ A;  5ARF A;  2R03 A;  1JCS A;  3CVY A;  3FUH A;  4LEU A;  1NFI E;  4TXQ A;  5EYL A;  3TWR A;  1RZ4 A;  2XRZ A;  1RW2 A;  2HR2 A;  2XS1 A;  4DX2 A;  4GA0 A;  4WUY A;  3CKB A;  4JPS A;  4CRW A;  3MJW A;  2QYJ A;  2X6K A;  2ILR A;  2OEV A;  2IOS A;  5KBA A;  1H0A A;  3TWW A;  2RG8 A;  2MOW A;  3O48 A;  1OWL A;  3AG4 E;  4BY6 A;  5HQ8 A;  1V54 E;  4MRU A;  4EHM A;  2GRM A;  5D66 A;  5CCM A;  4EZL A;  3B95 A;  1K3Z D;  1Y8M A;  5G55 A;  4EBA A;  1QZ2 A;  2LXM A;  2C0M A;  1OUV A;  2WXN A;  3EHQ A;  2WQ6 A;  3ABM E;  3FTV A;  2ION A;  2HO1 A;  4YDE A;  3UKU G;  4GZC A;  4HBD A;  4ANX A;  4LG6 A;  3MKR A;  3APF A;  3EDT B;  5C1D A;  4JEU A;  2LXL A;  5FIO A;  2IF4 A;  1UJK A;  3NOG D;  1NZN A;  3ASH A;  3FY4 A;  1TNY A;  4PDX A;  4EZJ A;  3V30 A;  1Y6I A;  3QJZ A;  3W9G A;  3ENE A;  2R02 A;  3FUD A;  4L1B A;  3P2B A;  1U3C A;  1SZ9 A;  3TG4 A;  2H6H A;  3UQ3 A;  1DC2 A;  3Q79 A;  3JXJ A;  3EU5 A;  3FTS A;  4E6H A;  1UN8 A;  1JPL A;  4HQD A;  3B7S A;  1QBQ A;  2VSN A;  2EQX A;  4B8C B;  3TWS A;  4U96 D;  4YND A;  1E8X A;  3J5P A;  2P9L G;  3DST A;  4UQY A;  2IU1 A;  4BFR A;  2X6J A;  3FUF A;  4IN3 B;  4HOU A;  2CG2 A;  3TAX A;  5C2Y A;  3PE3 A;  2WXH A;  1N9A A;  3FTX A;  4G23 A;  4FJZ A;  1KT0 A;  3R7Q A;  2FO7 A;  4K5C A;  1EF1 C;  2UWJ G;  3UUX A;  3CK7 A;  4O60 A;  2DYR E;  2IQC A;  2XEH A;  3SZ7 A;  1FVH A;  4ZHB A;  3VLE A;  4LNG A;  1OWO A;  3IEG A;  1E96 B;  4GCN A;  3JCK C;  4JEH A;  3MGB A;  3D9J A;  4C0E A;  3U3W A;  3C98 A;  3QAQ A;  1OT8 A;  5ENO D;  4I6J A;  4P29 A;  4OAU C;  4CGW A;  4JZY A;  1YA0 A;  2WQ7 A;  2XS8 A;  3AU4 A;  2DZN A;  3PVL A;  3SBS A;  2PM7 A;  3MZL B;  3QWV A;  5CHE E;  1IHG A;  3L08 A;  2J07 A;  3CHQ A;  5G04 J;  4I1A A;  4BET A;  3ASN E;  2VGE A;  1XNF A;  3HG0 D;  3SFY A;  3FUN A;  1HH8 A;  1OCZ E;  3L13 A;  3UXG A;  5J90 A;  5EIB E;  2PL2 A;  4G11 A;  4U63 A;  2Y0B G;  4WNG A;  2BKG A;  3MA5 A;  3Q73 A;  4DRX E;  4LCT A;  3ABK E;  2E2E A;  3B7R L;  4NRH B;  3U9W A;  1K1B A;  4GML A;  4A63 B;  4RSY A;  4Y6W A;  3RO3 A;  4CYM D;  1H2T C;  4F1P A;  2R59 A;  2FBN A;  2BTD A;  4I6G A;  2LNI A;  3EIQ C;  3QAR A;  3OTN A;  4O6F A;  2ETA A;  1N0R A;  2KBX A;  4DX5 D;  4I1M A;  5FJY A;  1HX8 A;  3UMV A;  5AYW D;  4AV7 A;  4BWR A;  3MX3 A;  5AQA A;  5FWQ A;  4U0S A;  1Z3Y A;  4CDN A;  4GYO A;  4I17 A;  3FH8 A;  5KCM A;  2P58 C;  3Q47 B;  2P9N G;  3T9K A;  4HVB A;  1TN8 A;  4WAF A;  4HOT A;  2J09 A;  4I9C A;  3U66 A;  4ILG A;  4PS3 A;  1LTX A;  5KJN A;  1H2U A;  4K5B A;  3L17 A;  3NOC D;  4I2W A;  2X38 A;  4CDR A;  3K9I A;  1LD8 A;  2LAH A;  3LY7 A;  4F3V A;  3CR3 A;  4BT8 A;  4C48 B;  1S70 B;  2P9U G;  1FVF A;  4OVV A;  1NA0 A;  2XGS A;  3ZW3 A;  2RKK A;  5H7P A;  3LVR E;  4J8S A;  3CV0 A;  1L5J A;  3MKQ A;  4FUL A;  3LJ3 A;  4GTV A;  4XZ4 A;  3HXF A;  3R7R A;  4U07 A;  2B0O E;  4LNU D;  4JVS A;  2FUL A;  4GCO A;  4GU5 A;  5ENQ D;  3TL5 A;  3SNX A;  3C3O A;  1WDY A;  2HYZ A;  3TGO A;  1BI8 B;  3CHP A;  3G2W A;  4WNF A;  4TXP A;  5JJT A;  4L23 A;  2Y3A A;  2BUG A;  4PS7 A;  5AJL A;  5KNH D;  2VSO E;  3CVX A;  3JQ0 A;  1N4Q A;  1NP7 A;  1JCQ A;  3C3Q A;  2IOL A;  2RD0 A;  1Z6T A;  4O1O A;  3FH5 A;  4B0Z A;  5BUZ A;  4A1S A;  1TNU A;  2IJG X;  1OCC E;  2KXP C;  3UT4 A;  3Q7A A;  1ZB1 A;  2VJ8 A;  2WMN A;  2MHK A;  2KZT B;  1MQS A;  2KM4 A;  2L0I A;  2NXP A; 
#chains in the Genus database with same CATH homology
 1JCS A;  1LD8 A;  2H6H A;  3E37 A;  3HXE A;  3Q75 A;  3Q79 A;  1FPP A;  3EU5 A;  3SFX A;  1FT1 A;  3SFY A;  1S63 A;  4YDO A;  1SA4 A;  2H6I A;  3E34 A;  1QBQ A;  2H6G A;  3PZ3 A;  4GTT A;  2ZIS A;  4GTM A;  1SA5 A;  2F0Y A;  1N4P A;  4GTV A;  3HXF A;  3PZ4 A;  3Q73 A;  3DSX A;  3DST A;  1O5M A;  4GTP A;  1TN7 A;  4GTR A;  1LD7 A;  3DRA A;  1X81 A;  3KSQ A;  3KSL A;  1KZO A;  1N9A A;  3C72 A;  4EHM A;  4LNB A;  3Q78 A;  4GTQ A;  2H6F A;  4MBG A;  1S64 A;  3Q7F A;  3DSW A;  1FT2 A;  2IEJ A;  3HXC A;  1N4R A;  1N4Q A;  3PZ2 A;  1TNB A;  4GTO A;  3HXD A;  3E33 A;  2BED A;  3E30 A;  4GTS A;  1JCQ A;  3EUV A;  3PZ1 A;  4YDE A;  2ZIR A;  1DCE A;  4LNG A;  3DSV A;  1TNZ A;  3DSS A;  1TNU A;  2R2L A;  3HXB A;  1O1S A;  1O1R A;  3Q7A A;  1N94 A;  1KZP A;  1NL4 A;  1D8E A;  1N95 A;  3E32 A;  1TN8 A;  3DPY A;  1TNY A;  1NI1 A;  1LTX A;  1N4S A;  1O1T A;  1MZC A;  1JCR A;  4L9P A;  1TN6 A;  3DSU A;  1D8D A;  1TNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...