3KSLA

Structure of fpt bound to datfp-dh-gpp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, properties, and applications of diazotrifluropropanoyl-containing photoactive analogs of farnesyl diphosphate containing modified linkages for enhanced stability.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Farnesyltransferase, CAAX box, alpha
total genus 127
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3kslA00
3DSXA 1JCRA 4GTOA 4LNBA 1N94A 3Q7FA 3DRAA 3Q78A 1NI1A 1TN6A 4GTVA 1LTXA 1D8EA 3HXEA 3HXCA 1FT1A 1N4PA 3PZ1A 2H6IA 1KZPA 4GTTA 1MZCA 3E33A 1N4SA 4LNGA 3EUVA 1TN7A 4YDOA 3E34A 1QBQA 1X81A 1O1RA 3PZ2A 1JCQA 3Q73A 3E32A 2ZIRA 1TNOA 1TNUA 3SFXA 1LD8A 4GTQA 2R2LA 1TN8A 1S64A 2IEJA 1SA4A 4GTSA 3PZ4A 3DSUA 1N4QA 1D8DA 1FPPA 3HXDA 1KZOA 1FT2A 3E30A 3HXBA 3PZ3A 1TNYA 4L9PA 3HXFA 1SA5A 4GTRA 2H6FA 3C72A 3EU5A 4GTMA 3DPYA 3SFYA 1N9AA 1O1SA 1TNBA 3E37A 2F0YA 2H6HA 2H6GA 1TNZA 1DCEA 1N4RA 1JCSA 3DSVA 4YDEA 3Q79A 1N95A 3DSSA 2BEDA 4GTPA 1O1TA 3KSLA 3DSWA 3DSTA 1NL4A 1S63A 1LD7A 2ZISA 1O5MA 4EHMA 3Q7AA 4MBGA 3KSQA 3Q75A
chains in the Genus database with same CATH superfamily
1FVFA 3ZUVB 4L2LA 4LNBA 3HRAA 1G3NB 3B7BA 3BG0B 3EU9A 4HOSA 3HXEA 2JEKA 4ANUA 1YYHA 1KZPA 2P58C 2LAIA 4JPSA 1MQSA 1TEZA 1DNPA 4B93B 3ENEA 3ABLE 2Y69E 2X6HA 4HLLA 1S70B 1TNUA 4GTQA 2R2LA 1TN8A 2IEJA 1SA4A 2EIJE 4N3CA 1D9SA 4MLPA 2J09A 2KM4A 3QOUA 3W9FA 4Y6CA 3CR3A 1KZOA 3O4ZA 1GW6A 3ML9A 4JL0A 5AYWD 1TJFA 1DC2A 2ETCA 4U63A 4L9PA 3VLDA 2WXQA 2IFUA 3JUEA 3MKRA 5HQ8A 2IOSA 2AXZA 2X3MA 4I2ZA 2AVPA 3FUFA 1N4RA 3SBSA 3D9IA 4URKA 3NZUA 2PQNA 3UT4A 2P9LG 3ZHEA 3DBSA 2KCKA 3V2XA 3QAQA 3LKUA 4LRZA 3HDXA 1RZ4A 4Z68A 2WM9A 3ESLA 5EX3A 4PUCA 2ILRA 4B0ZA 1DCQA 3ZU7B 3ISMC 3EHNA 4CCAA 3FFLA 1HS6A 5ANLA 3MJWA 3L13A 1EYHA 1OY3D 4GTTA 3Q47B 2P2CP 1XGWA 4A1SA 4UUCA 4WNGA 4GA2A 4G23A 3LCAA 4B8CB 3NAWA 3SFXA 3NQPA 4FHJA 3IXEA 4JHJA 2FEZA 3CHMA 1V55E 1DVPA 4RVBA 3TWSA 4DX7D 4GA1A 3TG5A 4WAFA 1AWCB 4UWGA 4XEIG 1N52A 2RD0A 2IF4A 2R03A 1OCCE 4GB9A 4YNDA 3FH8A 3HXFA 2XRZA 2IOLA 3TWVA 1PC2A 4KZCA 1Z5SC 3UM1A 1O1SA 5CCMA 3GZ2A 2HYZA 4GZ3A 5DIZA 2DVWA 4ATZD 3CKBA 3UKRG 5EKQD 3D9MA 4GPKA 4F7AA 3DSWA 2GGFA 3S7DA 2LXMA 4R7LA 1BI8B 2J9QA 4JEUA 2IO3C 4AVXA 3PDNA 4TUUA 4MS6A 4U04A 3NZSA 3EJNA 4YVOA 3JXIA 1INZA 1FT1A 4FLBA 2KXPC 4AP2A 2JLBA 1IHGA 4CDMA 4HRNA 3MKQB 3SZ7A 3RU0A 4IN3B 3FUMA 1NA3A 2VSOE 1E96B 2J49A 4AV7A 3PZ4A 1N54A 1EPUA 1H2VC 2MYOA 2XQ0A 4ILIA 2GRLA 2LAHA 5KJKA 4GCOA 1FT2A 2XENA 3T5XA 4KXKB 3RSEG 1SA5A 2ZU6B 3PUKA 3CVYA 2P9PG 2IY0C 3ZYKA 4ACLA 3QK0A 4AJWA 2X6IA 2H6HA 2WPVA 3UMVA 2VGEA 4FJZA 3LEWA 4G1TA 4FLHA 4A55A 3DPDA 4G24A 5ENNA 4CDRA 4K5BA 4MRUA 4TV3A 4BT9A 3FUKA 2B0OE 3FUNA 3DSSA 4RQIA 3D9HA 4OYSA 4BT8A 2P9KG 3DSTA 4K0RA 2XEEA 4WNFA 1N11A 1O5MA 3HG0D 3OXGA 3GYZA 2XPIA 4J7WA 2AJAA 4OVUA 4JXTA 2C2LA 4WNEA 5JMND 1K8KG 4ANWA 3TG4A 2CFZA 3FP3A 4U96D 4TUMA 3CK8A 3RAUA 2A5EA 3HHMA 4V3IA 5AJLA 4KBQA 3TGOA 4LEUA 5FQ4A 2QC9A 2GROB 1H2TC 5AN8A 3NOCD 1QQEA 4ABNA 5LCWJ 2MOWA 4EZKA 4LNUD 5B3SE 3B7RL 2A4ZA 3GZ1A 1EDUA 4G2VA 2I2OA 3D9KA 2QFCA 2P9IG 4CEMA 2J4BA 3AJIA 3EU5A 2CG3A 2V0PA 2X6KA 2XZTG 2BKKB 2XS1A 4JHRA 3SO8A 5FQ7A 2ONDA 2X6FA 2I1JA 1OWPA 2OEWA 4ACKA 4C48B 4GTPA 2OVFA 3I4RB 1E7UA 5HI7A 4GCNA 1LD7A 3Q7AA 1U3DA 4EZLA 5JJTA 2LNIA 3APCA 2BF0X 2DBAA 4BSZB 3DEPA 4F6RD 4A3TA 4U0SA 5CBOA 1N0QA 3PUJA 2H6IA 5CEAA 3E33A 1P5QA 3E34A 3E4BA 2CHZA 5BNWA 4WWOA 2I9CA 3MCXA 2XZDG 2A5UA 3MV2B 5E76A 4F1SA 2OV8A 2DZNA 5EIDA 3ZGQA 2WXFA 4BETA 1NZNA 1KPSB 1H0AA 1E8YA 2VTBA 1BD8A 3RRNB 4BEPA 3UM0A 3E30A 4GPMA 3PEUB 2QYJA 3HXBA 2P9NG 2L6JA 5T4YA 3ZNGA 4JA9A 1Y6IA 5G55A 3FULA 3FU3A 5FZRA 4YVQC 3ASGA 3I5PA 2EINE 3ZXPA 1N9AA 3U3WA 2EIKE 2X38A 5JJ6A 1HXIA 2DCPA 3RO2A 1TR4A 2ZGGA 2FF4A 2WB2A 3ZHEB 3NOGD 3U64A 3L82A 3LVQE 1E90A 3CVQA 3LPZA 3J5PA 3FUDA 3KSQA 3Q75A 2NYJA 3CSTA 5KCMA 4BTBA 5T8IA 5CMYA 4U95D 4DK5A 3EHMA 1OCRE 4LNGA 3C3OA 5CMWA 4TXQA 3ZFWA 1JPLA 3PZ2A 4ZHBA 5D0QD 2ZIRA 1TNOA 4KYOB 4E6HA 3CKCA 3MYVA 3HVEB 1OWLA 5LCWC 5JHBA 2EILE 4BFRA 1N4QA 4BSXA 3NF1A 4UQYA 3ZYQA 3L9TA 2KZTB 4J8DA 1E8XA 1X5BA 3LY8A 1VDYA 3BUAA 1TNYA 5B1BE 2IO2C 3VTXA 5AIJA 5ENRD 3FTUA 3B13A 2IQCA 3VTYA 4G8LA 1SVXA 3PNTB 2DYRE 1OXJA 4EBAA 3FWVA 3R9MA 2YHCA 4EPZA 2RFMA 4HI8A 1IQRA 5EX0A 2F8YA 1OT8A 3SBTB 4UI9K 5A23A 4FADA 3FU5A 3URZA 3QB2A 4HNAD 3UX4A 3FTYA 3UT8A 2KBXA 2VTBB 3V79K 5FZQA 3CHQA 5H7PA 3ONKA 4Y6WA 1MX4A 1MX2A 1ZU2A 2V8SE 3CVXA 3UKUG 2J8SD 1NI1A 3FH7A 3V31A 3LVRE 4FC8A 2HO1A 5FWQA 5ENQD 4N2QA 4I17A 5ENTD 4GMRA 5CEDB 3G2WA 4WNDA 1WY6A 1X81A 3BQOA 3E32A 3FUIA 3RIBA 3FU6A 3QJZA 3Q9UC 4WUYA 2LSVA 4I1OB 3ASFA 2XGSA 4J6IA 3TL5A 3JQ1A 1BLXB 2QZAA 3SD5A 2MRIA 4M7CA 2J4DA 1H2UA 3D3MA 4BX8A 3PZ3A 3ZVVA 3SHFA 4K03A 2NC9A 3PZDA 3ML8A 4GTMA 3Q15A 2BKGA 3ZRHA 3DPYA 3PRZA 4H7YA 4ZFHA 2F0YA 3L6AA 3PVLA 2YHEA 1MX6A 4DJAA 1Y8MA 4DX5D 3AG4E 2GRMA 5D0OD 1W3BA 1Q2ZA 4I43A 4L1BA 3DSVA 4CZ2D 2Y3AA 3G2SA 2BEDA 3LJ3A 1H6PA 3CGHA 5HRYA 5BPPA 4PS3A 4HRMB 4CYMD 5E75A 3HIZA 4O1OA 4B94A 4A3VA 2X6JA 1D8EA 5HKPA 2GRQB 3CV0A 2NXPA 2FULA 5FQ6A 3CQGB 5CECB 2I1KA 2V4LA 3LDZA 1HE8A 2R5SA 2ZXWE 4UQXA 3FTWA 1UJKA 1IQUA 4GTSA 1TJCA 1NP7A 4HI9A 4TXPA 1FPPA 4BESA 3AS4A 5C2YA 3J5QB 1MJ0A 2WQHA 4XE0A 2XHEA 4GYWA 5CRUA 3D9JA 1WM5A 3D9OA 4GTRA 4GYYA 2ETBA 3WG7E 5BXUA 3U66A 3FTXA 5ENOD 1HG2A 5C1DA 1DCEA 4I1MA 5D2MC 3B7TA 3U9WA 3MX3A 5EN5D 1QZ2A 3IBEA 4XKBA 3G2UA 3MEKA 1ELRA 1Z6TA 1OWOA 4DRXE 3LXUX 4Q69A 4B8AA 5FQ8A 3CHOA 2XGOA 1K1AA 2ZISA 4BX9A 2OEVA 4LG6A 2WXLA 2WVIA 1OWMA 3DEOA 2CHXA 4GTVA 3G2VA 4QFVA 3D9NA 3G2TA 3AU4A 5ENSD 2XCCA 3AAAC 1NFIE 4HB5A 4YDOA 4DX1A 4GU5A 4LERA 4F1PA 4JEHA 2RKKA 1Z3YA 5AQBA 4G11A 1ZBPA 3Q73A 5AENA 4GMLA 3SY2A 4N5QA 4CGWA 5CERB 2LO6A 2PQRA 3ESKA 4JC8A 4ME2A 4GZ5A 4JVSA 3JUIA 1JUQA 3ZKJA 5A7DB 3JCKC 3NBNB 1HO8A 5LP0A 4GYOA 4KT6B 1UOHA 3PEVB 2YQ8A 2P9SG 4U7EB 3ABME 2ETAA 2UWJG 3Q5MA 3X2QE 2HR2A 3TWXA 2H6FA 2J08A 5KNGA 2YNQA 4AY5A 2XPYA 3P1UA 4APOA 3D9PA 3UTMA 4DI4A 3LS8A 4DPRA 4HQDA 2F8XK 3UIOC 2WMNA 3V30A 4AOFA 3FTSA 3T5VA 3UQ3A 4JHKA 3NB2A 4AIFA 4J8FA 5DBKA 2CHWA 1E8WA 5JA4D 2WXKA 4HORA 4NURA 5FZSA 2RG8A 4K5AB 5KWDA 1SW6A 1S0PA 1H19A 1QNFA 3DSXA 5LX8A 1N94A 3Q7FA 4A1GA 3RRUA 5CCLA 4GMJA 3AU5A 3R7RA 3L16A 4IYPA 4PH4B 4FP7A 1ELWA 4FJYA 2VJ8A 4KVMA 5G04J 3FU0A 5G2NA 4XI0A 3PE3A 1LF8A 3ASHA 5FINA 3FEYA 3ZW3A 3I3NA 4I2WA 4BERA 4FHKA 1EF1C 2F37A 1SQMA 3ZEFA 3CVLA 3B7SA 4C0MA 3FH5A 3RKVA 4FA6A 3MGBA 1OCZE 3APFA 4H7XA 1FVHA 4GAAA 5T3RA 3JYSA 3BU8A 4HRLA 4GZ6A 3KD7A 1IKND 4N3AA 4MKTA 2L6BA 2XEVA 2C0MA 4F53A 2OOEA 4RSYA 3HYMB 4D10C 2ZGDA 2Q7FA 4CRWA 4NIKA 3IV0A 1V54E 3SF4A 5EDSA 4XI9A 4U0ZA 2FO7A 4ANVA 3CIAA 5CRVA 5IY5E 3KSLA 4CGVA 3OXLA 4F3VA 4PDXA 5M72A 3LY9A 4I9EA 4G8KA 3TXMA 4B89A 2DIWA 2Y0BG 4I6JA 3L17A 4O6FA 1QYMA 4DLOA 2AW6A 3BEEA 1A17A 3CVUA 4L2YA 3QARA 3O48A 2VSXE 4WWNA 4OAVB 1QBQA 3EIQC 3QWVA 3B7UX 4XZ4A 2WXOA 1IXVA 3PE4A 5D66A 4K5CA 4DX6D 2AXUA 3LYAA 4YDYA 3ZYMA 4JZYA 1HH8A 3OAWA 3EDTB 4J8YA 2GW1A 2AXVA 3IHVA 4JA7A 4HXIA 4RG6A 1UG3A 3AG1E 3CLJA 3L22A 4ILGA 3ASOE 3CHPA 4CT0A 5J90A 4ATGA 4A63B 1TNBA 4OVVA 4UWKA 2VYIA 3LY7A 5EILA 1JCSA 4KMOA 2WXRA 4HOUA 2VSYA 3CK9A 4HOTA 4AEZC 1ELKA 4G26A 4N5CA 4UI9J 4EBAG 3IEGA 1SZ9A 1O1TA 2CG2A 1HFAA 3UM2A 2AWIA 5BV0A 4UWFA 2VGXB 2VQ2A 4DX2A 2Y4UA 4GTOA 3AS8A 1YA0A 1A5EA 4OAUC 4U8HA 4O60A 1FCHA 1HX8A 3ZIMA 1JWGA 3S7BA 1PAQA 3MZLB 4X8QA 5LFAA 4E85A 4I6GA 2WXIA 2KC7A 3D9LA 3P2BA 3UINC 4AY6A 2WXGA 2WXHA 1BPOA 3EHRA 4UWHA 4DLQA 1U3CA 3HXDA 3R7QA 2WXNA 2NSZA 2R02A 4BWRA 5KJNA 2GRPB 1HG5A 1OUVA 3TAXA 2IJGX 3FTVA 4I1AA 3ABKE 3SFZA 3F6QA 3SQVA 3SFYA 1KT0A 3PNLB 5AAOA 2H6GA 3CVVA 2I6HA 2WXPA 2C0LA 1ZB1A 3QWWA 4NACA 5G04C 4J0UA 2RFAA 4O1PA 2FO1E 2L0IA 2FBNA 2XS8A 3UUXA 2L9BA 3CEQA 1NL4A 3CVNA 1S63A 3S7FA 5ENPD 5J08A 3I4GA 4KZ0A 4XIFA 4CDNA 3C98A 2QY7A 3HXCA 3PZ1A 2XGMA 5BW8C 3TWQA 1PY1A 5EIBE 3EUVA 4G25A 3FUHA 3B95A 4JD2G 3T8KA 5ITZF 4APFA 1B89A 5G05C 5AARA 1JCQA 3ONLA 4I9CA 2L0TB 2WXMA 1N0RA 3Q49B 1HF8A 3GW4A 4GZCA 2YINA 3TXNA 2GRRB 2LUHA 4LUNU 2XCBA 3CSFA 2KATA 3ZXSA 2P9UG 2PM7A 3TWRA 3FUJA 5BT1A 4BY6A 2M63A 3VLEA 4LSZE 2CFUA 1MHQA 3KAEA 3KEZA 3C72A 5FTPA 1AP7A 5LOZA 3C3QA 5BXOA 5BV1A 1U2VG 1TNZA 2HE0A 2KZTA 4LCTA 1WG0A 4AXHA 2V5FA 4UI9C 1WDYA 3ULYA 4W9RA 2IU1A 4NQ0A 5AQ7A 1L5JA 5FJYA 2OCCE 3T9KA 3JXJA 3MV3B 1E7VA 3AG3E 2EIME 2XRYA 3UI2A 5JJ7A 3C3RA 3ASDA 3BG1B 4HFGA 4MBGA 3ULEG 1JCRA 4PS8A 3FTZA 5JHAA 4WWPA 1LTXA 2LSUA 3DXKG 4U0UA 4BTAA 3QNKA 3SNXA 2DWZA 3N71A 1O1RA 2QYUA 5HS0A 3U4TA 4QQIA 3DXMG 3RO3A 4J8EA 3SGHA 3JQ0A 4JW1A 4DUIA 2DYSE 2KCLA 2R59A 3CHRA 2BUGA 4UQZA 5AJDA 1XNFA 3C5RA 4L7TA 5AQAA 2UY1B 2PM6A 2UY1A 4FULA 5KBAA 3Q4AB 1YCSB 3TJPA 2LXLA 3CVPA 1JWFA 5CHEE 4L23A 5KJLA 2VGYA 3CK7A 1UN9A 3TWWA 2Y1LE 3UIPC 3APDA 4AM9A 3PH0C 2WQ7A 3TWUA 5EYPF 4Q96A 3FY4A 1E8ZA 4TXRA 4XKCA 3S2AA 3ULQA 4HLEA 2VSNA 4U8YD 3AG2E 1IHBA 3S7JA 4I6EA 2MHKA 3EIJA 1WAO1 3KS2A 2E0IA 3IKOB 2V4HC 4TRQA 3QC1A 2OVBA 3DRAA 3Q78A 3QKYA 4RG9A 3EHQA 2PZIA 2Y4TA 3K9IA 4N2SA 5FT9A 1N4SA 4XX5A 1K3ZD 3DWLG 5KNHD 4GA0A 3T8MA 4J8SA 5BUZA 2J07A 4C0EA 2FI7A 3ZN3A 2IONA 1LD8A 2WQ6A 3L08A 1S64A 5ANRA 4UWLA 4M3OA 3DSUA 4HS2A 3MA5A 4YDWA 2DZOA 1Z3XA 3SI5A 3QDNA 1OWNA 4EQFA 2PL2A 3FHEA 1YMPA 3CVWA 1K1BA 4GZDA 1H6OA 4ANXA 4DI3A 3E37A 2EQXA 2B6CA 1HZ4A 3W9GA 3LJNA 4P29A 1BU9A 2R17C 1HU3A 3OXFA 4YDEA 3KEAA 4FU3A 5G05J 1KT1A 3AS5A 4HOQA 4ILHB 1RW2A 3L54A 5KJMA 4NRHB 1BI7B 2E2EA 3GZSA 5A6CA 2XEHA 4U07A 5B1AE 3WXXA 2WXJA 3UXGA 1H6KA 1TN6A 3RRMB 4EZJA 2JABA 3HVEA 3V2OA 1IYGA 3Q9NC 1N4PA 4N39A 3ZPJA 1MZCA 1OCOE 1TN7A 1NA0A 2BTDA 3TWTA 5ARFA 4C9BB 4CT4A 3R9AB 4PS7A 2HM8A 3OTNA 4EECA 4IULA 1UN8A 1D8DA 3QWPA 5EYLA 3UPVA 2KCVA 3FDHA 5CBNA 2WMOA 4U8VD 5FIOA 3PREA 4KVOA 2GRNB 3FEXA 3VLFA 3PS6A 5AQ9A 1TYQG 3UT7A 2VGXA 5ARGA 3IHYA 1UJJA 4HVBA 3CHSA 4Q94A 3MKQA 2XPZA 4HBDA 4IRUA 4JB8P 1SZAA 4RLYA 2R05A 3FUEA 3UM3A 1UW4B 1KLXA 3CQCB 3Q79A 1N95A 4N3BA 3RK6A 3RJVA 2V5QC 3ASNE 1MYOA 2PNNA 3ZYLA 4EHMA
chains in the Genus database with same CATH topology
3DSXA 1JCRA 4GTOA 4LNBA 1N94A 3Q7FA 3DRAA 3Q78A 1NI1A 1TN6A 4GTVA 1LTXA 1D8EA 3HXEA 3HXCA 1FT1A 1N4PA 3PZ1A 2H6IA 1KZPA 4GTTA 1MZCA 3E33A 1N4SA 4LNGA 3EUVA 1TN7A 4YDOA 3E34A 1QBQA 1X81A 1O1RA 3PZ2A 1JCQA 3Q73A 3E32A 2ZIRA 1TNOA 1TNUA 3SFXA 1LD8A 4GTQA 2R2LA 1TN8A 1S64A 2IEJA 1SA4A 4GTSA 3PZ4A 3DSUA 1N4QA 1D8DA 1FPPA 3HXDA 1KZOA 1FT2A 3E30A 3HXBA 3PZ3A 1TNYA 4L9PA 3HXFA 1SA5A 4GTRA 2H6FA 3C72A 3EU5A 4GTMA 3DPYA 3SFYA 1N9AA 1O1SA 1TNBA 3E37A 2F0YA 2H6HA 2H6GA 1TNZA 1DCEA 1N4RA 1JCSA 3DSVA 4YDEA 3Q79A 1N95A 3DSSA 2BEDA 4GTPA 1O1TA 3KSLA 3DSWA 3DSTA 1NL4A 1S63A 1LD7A 2ZISA 1O5MA 4EHMA 3Q7AA 4MBGA 3KSQA 3Q75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSX A;  1JCR A;  4GTO A;  4LNB A;  1N94 A;  3Q7F A;  3DRA A;  3Q78 A;  1NI1 A;  1TN6 A;  4GTV A;  1LTX A;  1D8E A;  3HXE A;  3HXC A;  1FT1 A;  1N4P A;  3PZ1 A;  2H6I A;  1KZP A;  4GTT A;  1MZC A;  3E33 A;  1N4S A;  4LNG A;  3EUV A;  1TN7 A;  4YDO A;  3E34 A;  1QBQ A;  1X81 A;  1O1R A;  3PZ2 A;  1JCQ A;  3Q73 A;  3E32 A;  2ZIR A;  1TNO A;  1TNU A;  3SFX A;  1LD8 A;  4GTQ A;  2R2L A;  1TN8 A;  1S64 A;  2IEJ A;  1SA4 A;  4GTS A;  3PZ4 A;  3DSU A;  1N4Q A;  1D8D A;  1FPP A;  3HXD A;  1KZO A;  1FT2 A;  3E30 A;  3HXB A;  3PZ3 A;  1TNY A;  4L9P A;  3HXF A;  1SA5 A;  4GTR A;  2H6F A;  3C72 A;  3EU5 A;  4GTM A;  3DPY A;  3SFY A;  1N9A A;  1O1S A;  1TNB A;  3E37 A;  2F0Y A;  2H6H A;  2H6G A;  1TNZ A;  1DCE A;  1N4R A;  1JCS A;  3DSV A;  4YDE A;  3Q79 A;  1N95 A;  3DSS A;  2BED A;  4GTP A;  1O1T A;  3KSL A;  3DSW A;  3DST A;  1NL4 A;  1S63 A;  1LD7 A;  2ZIS A;  1O5M A;  4EHM A;  3Q7A A;  4MBG A;  3KSQ A;  3Q75 A; 
#chains in the Genus database with same CATH topology
 1FVF A;  3ZUV B;  4L2L A;  4LNB A;  3HRA A;  1G3N B;  3B7B A;  3BG0 B;  3EU9 A;  4HOS A;  3HXE A;  2JEK A;  4ANU A;  1YYH A;  1KZP A;  2P58 C;  2LAI A;  4JPS A;  1MQS A;  1TEZ A;  1DNP A;  4B93 B;  3ENE A;  3ABL E;  2Y69 E;  2X6H A;  4HLL A;  1S70 B;  1TNU A;  4GTQ A;  2R2L A;  1TN8 A;  2IEJ A;  1SA4 A;  2EIJ E;  4N3C A;  1D9S A;  4MLP A;  2J09 A;  2KM4 A;  3QOU A;  3W9F A;  4Y6C A;  3CR3 A;  1KZO A;  3O4Z A;  1GW6 A;  3ML9 A;  4JL0 A;  5AYW D;  1TJF A;  1DC2 A;  2ETC A;  4U63 A;  4L9P A;  3VLD A;  2WXQ A;  2IFU A;  3JUE A;  3MKR A;  5HQ8 A;  2IOS A;  2AXZ A;  2X3M A;  4I2Z A;  2AVP A;  3FUF A;  1N4R A;  3SBS A;  3D9I A;  4URK A;  3NZU A;  2PQN A;  3UT4 A;  2P9L G;  3ZHE A;  3DBS A;  2KCK A;  3V2X A;  3QAQ A;  3LKU A;  4LRZ A;  3HDX A;  1RZ4 A;  4Z68 A;  2WM9 A;  3ESL A;  5EX3 A;  4PUC A;  2ILR A;  4B0Z A;  1DCQ A;  3ZU7 B;  3ISM C;  3EHN A;  4CCA A;  3FFL A;  1HS6 A;  5ANL A;  3MJW A;  3L13 A;  1EYH A;  1OY3 D;  4GTT A;  3Q47 B;  2P2C P;  1XGW A;  4A1S A;  4UUC A;  4WNG A;  4GA2 A;  4G23 A;  3LCA A;  4B8C B;  3NAW A;  3SFX A;  3NQP A;  4FHJ A;  3IXE A;  4JHJ A;  2FEZ A;  3CHM A;  1V55 E;  1DVP A;  4RVB A;  3TWS A;  4DX7 D;  4GA1 A;  3TG5 A;  4WAF A;  1AWC B;  4UWG A;  4XEI G;  1N52 A;  2RD0 A;  2IF4 A;  2R03 A;  1OCC E;  4GB9 A;  4YND A;  3FH8 A;  3HXF A;  2XRZ A;  2IOL A;  3TWV A;  1PC2 A;  4KZC A;  1Z5S C;  3UM1 A;  1O1S A;  5CCM A;  3GZ2 A;  2HYZ A;  4GZ3 A;  5DIZ A;  2DVW A;  4ATZ D;  3CKB A;  3UKR G;  5EKQ D;  3D9M A;  4GPK A;  4F7A A;  3DSW A;  2GGF A;  3S7D A;  2LXM A;  4R7L A;  1BI8 B;  2J9Q A;  4JEU A;  2IO3 C;  4AVX A;  3PDN A;  4TUU A;  4MS6 A;  4U04 A;  3NZS A;  3EJN A;  4YVO A;  3JXI A;  1INZ A;  1FT1 A;  4FLB A;  2KXP C;  4AP2 A;  2JLB A;  1IHG A;  4CDM A;  4HRN A;  3MKQ B;  3SZ7 A;  3RU0 A;  4IN3 B;  3FUM A;  1NA3 A;  2VSO E;  1E96 B;  2J49 A;  4AV7 A;  3PZ4 A;  1N54 A;  1EPU A;  1H2V C;  2MYO A;  2XQ0 A;  4ILI A;  2GRL A;  2LAH A;  5KJK A;  4GCO A;  1FT2 A;  2XEN A;  3T5X A;  4KXK B;  3RSE G;  1SA5 A;  2ZU6 B;  3PUK A;  3CVY A;  2P9P G;  2IY0 C;  3ZYK A;  4ACL A;  3QK0 A;  4AJW A;  2X6I A;  2H6H A;  2WPV A;  3UMV A;  2VGE A;  4FJZ A;  3LEW A;  4G1T A;  4FLH A;  4A55 A;  3DPD A;  4G24 A;  5ENN A;  4CDR A;  4K5B A;  4MRU A;  4TV3 A;  4BT9 A;  3FUK A;  2B0O E;  3FUN A;  3DSS A;  4RQI A;  3D9H A;  4OYS A;  4BT8 A;  2P9K G;  3DST A;  4K0R A;  2XEE A;  4WNF A;  1N11 A;  1O5M A;  3HG0 D;  3OXG A;  3GYZ A;  2XPI A;  4J7W A;  2AJA A;  4OVU A;  4JXT A;  2C2L A;  4WNE A;  5JMN D;  1K8K G;  4ANW A;  3TG4 A;  2CFZ A;  3FP3 A;  4U96 D;  4TUM A;  3CK8 A;  3RAU A;  2A5E A;  3HHM A;  4V3I A;  5AJL A;  4KBQ A;  3TGO A;  4LEU A;  5FQ4 A;  2QC9 A;  2GRO B;  1H2T C;  5AN8 A;  3NOC D;  1QQE A;  4ABN A;  5LCW J;  2MOW A;  4EZK A;  4LNU D;  5B3S E;  3B7R L;  2A4Z A;  3GZ1 A;  1EDU A;  4G2V A;  2I2O A;  3D9K A;  2QFC A;  2P9I G;  4CEM A;  2J4B A;  3AJI A;  3EU5 A;  2CG3 A;  2V0P A;  2X6K A;  2XZT G;  2BKK B;  2XS1 A;  4JHR A;  3SO8 A;  5FQ7 A;  2OND A;  2X6F A;  2I1J A;  1OWP A;  2OEW A;  4ACK A;  4C48 B;  4GTP A;  2OVF A;  3I4R B;  1E7U A;  5HI7 A;  4GCN A;  1LD7 A;  3Q7A A;  1U3D A;  4EZL A;  5JJT A;  2LNI A;  3APC A;  2BF0 X;  2DBA A;  4BSZ B;  3DEP A;  4F6R D;  4A3T A;  4U0S A;  5CBO A;  1N0Q A;  3PUJ A;  2H6I A;  5CEA A;  3E33 A;  1P5Q A;  3E34 A;  3E4B A;  2CHZ A;  5BNW A;  4WWO A;  2I9C A;  3MCX A;  2XZD G;  2A5U A;  3MV2 B;  5E76 A;  4F1S A;  2OV8 A;  2DZN A;  5EID A;  3ZGQ A;  2WXF A;  4BET A;  1NZN A;  1KPS B;  1H0A A;  1E8Y A;  2VTB A;  1BD8 A;  3RRN B;  4BEP A;  3UM0 A;  3E30 A;  4GPM A;  3PEU B;  2QYJ A;  3HXB A;  2P9N G;  2L6J A;  5T4Y A;  3ZNG A;  4JA9 A;  1Y6I A;  5G55 A;  3FUL A;  3FU3 A;  5FZR A;  4YVQ C;  3ASG A;  3I5P A;  2EIN E;  3ZXP A;  1N9A A;  3U3W A;  2EIK E;  2X38 A;  5JJ6 A;  1HXI A;  2DCP A;  3RO2 A;  1TR4 A;  2ZGG A;  2FF4 A;  2WB2 A;  3ZHE B;  3NOG D;  3U64 A;  3L82 A;  3LVQ E;  1E90 A;  3CVQ A;  3LPZ A;  3J5P A;  3FUD A;  3KSQ A;  3Q75 A;  2NYJ A;  3CST A;  5KCM A;  4BTB A;  5T8I A;  5CMY A;  4U95 D;  4DK5 A;  3EHM A;  1OCR E;  4LNG A;  3C3O A;  5CMW A;  4TXQ A;  3ZFW A;  1JPL A;  3PZ2 A;  4ZHB A;  5D0Q D;  2ZIR A;  1TNO A;  4KYO B;  4E6H A;  3CKC A;  3MYV A;  3HVE B;  1OWL A;  5LCW C;  5JHB A;  2EIL E;  4BFR A;  1N4Q A;  4BSX A;  3NF1 A;  4UQY A;  3ZYQ A;  3L9T A;  2KZT B;  4J8D A;  1E8X A;  1X5B A;  3LY8 A;  1VDY A;  3BUA A;  1TNY A;  5B1B E;  2IO2 C;  3VTX A;  5AIJ A;  5ENR D;  3FTU A;  3B13 A;  2IQC A;  3VTY A;  4G8L A;  1SVX A;  3PNT B;  2DYR E;  1OXJ A;  4EBA A;  3FWV A;  3R9M A;  2YHC A;  4EPZ A;  2RFM A;  4HI8 A;  1IQR A;  5EX0 A;  2F8Y A;  1OT8 A;  3SBT B;  4UI9 K;  5A23 A;  4FAD A;  3FU5 A;  3URZ A;  3QB2 A;  4HNA D;  3UX4 A;  3FTY A;  3UT8 A;  2KBX A;  2VTB B;  3V79 K;  5FZQ A;  3CHQ A;  5H7P A;  3ONK A;  4Y6W A;  1MX4 A;  1MX2 A;  1ZU2 A;  2V8S E;  3CVX A;  3UKU G;  2J8S D;  1NI1 A;  3FH7 A;  3V31 A;  3LVR E;  4FC8 A;  2HO1 A;  5FWQ A;  5ENQ D;  4N2Q A;  4I17 A;  5ENT D;  4GMR A;  5CED B;  3G2W A;  4WND A;  1WY6 A;  1X81 A;  3BQO A;  3E32 A;  3FUI A;  3RIB A;  3FU6 A;  3QJZ A;  3Q9U C;  4WUY A;  2LSV A;  4I1O B;  3ASF A;  2XGS A;  4J6I A;  3TL5 A;  3JQ1 A;  1BLX B;  2QZA A;  3SD5 A;  2MRI A;  4M7C A;  2J4D A;  1H2U A;  3D3M A;  4BX8 A;  3PZ3 A;  3ZVV A;  3SHF A;  4K03 A;  2NC9 A;  3PZD A;  3ML8 A;  4GTM A;  3Q15 A;  2BKG A;  3ZRH A;  3DPY A;  3PRZ A;  4H7Y A;  4ZFH A;  2F0Y A;  3L6A A;  3PVL A;  2YHE A;  1MX6 A;  4DJA A;  1Y8M A;  4DX5 D;  3AG4 E;  2GRM A;  5D0O D;  1W3B A;  1Q2Z A;  4I43 A;  4L1B A;  3DSV A;  4CZ2 D;  2Y3A A;  3G2S A;  2BED A;  3LJ3 A;  1H6P A;  3CGH A;  5HRY A;  5BPP A;  4PS3 A;  4HRM B;  4CYM D;  5E75 A;  3HIZ A;  4O1O A;  4B94 A;  4A3V A;  2X6J A;  1D8E A;  5HKP A;  2GRQ B;  3CV0 A;  2NXP A;  2FUL A;  5FQ6 A;  3CQG B;  5CEC B;  2I1K A;  2V4L A;  3LDZ A;  1HE8 A;  2R5S A;  2ZXW E;  4UQX A;  3FTW A;  1UJK A;  1IQU A;  4GTS A;  1TJC A;  1NP7 A;  4HI9 A;  4TXP A;  1FPP A;  4BES A;  3AS4 A;  5C2Y A;  3J5Q B;  1MJ0 A;  2WQH A;  4XE0 A;  2XHE A;  4GYW A;  5CRU A;  3D9J A;  1WM5 A;  3D9O A;  4GTR A;  4GYY A;  2ETB A;  3WG7 E;  5BXU A;  3U66 A;  3FTX A;  5ENO D;  1HG2 A;  5C1D A;  1DCE A;  4I1M A;  5D2M C;  3B7T A;  3U9W A;  3MX3 A;  5EN5 D;  1QZ2 A;  3IBE A;  4XKB A;  3G2U A;  3MEK A;  1ELR A;  1Z6T A;  1OWO A;  4DRX E;  3LXU X;  4Q69 A;  4B8A A;  5FQ8 A;  3CHO A;  2XGO A;  1K1A A;  2ZIS A;  4BX9 A;  2OEV A;  4LG6 A;  2WXL A;  2WVI A;  1OWM A;  3DEO A;  2CHX A;  4GTV A;  3G2V A;  4QFV A;  3D9N A;  3G2T A;  3AU4 A;  5ENS D;  2XCC A;  3AAA C;  1NFI E;  4HB5 A;  4YDO A;  4DX1 A;  4GU5 A;  4LER A;  4F1P A;  4JEH A;  2RKK A;  1Z3Y A;  5AQB A;  4G11 A;  1ZBP A;  3Q73 A;  5AEN A;  4GML A;  3SY2 A;  4N5Q A;  4CGW A;  5CER B;  2LO6 A;  2PQR A;  3ESK A;  4JC8 A;  4ME2 A;  4GZ5 A;  4JVS A;  3JUI A;  1JUQ A;  3ZKJ A;  5A7D B;  3JCK C;  3NBN B;  1HO8 A;  5LP0 A;  4GYO A;  4KT6 B;  1UOH A;  3PEV B;  2YQ8 A;  2P9S G;  4U7E B;  3ABM E;  2ETA A;  2UWJ G;  3Q5M A;  3X2Q E;  2HR2 A;  3TWX A;  2H6F A;  2J08 A;  5KNG A;  2YNQ A;  4AY5 A;  2XPY A;  3P1U A;  4APO A;  3D9P A;  3UTM A;  4DI4 A;  3LS8 A;  4DPR A;  4HQD A;  2F8X K;  3UIO C;  2WMN A;  3V30 A;  4AOF A;  3FTS A;  3T5V A;  3UQ3 A;  4JHK A;  3NB2 A;  4AIF A;  4J8F A;  5DBK A;  2CHW A;  1E8W A;  5JA4 D;  2WXK A;  4HOR A;  4NUR A;  5FZS A;  2RG8 A;  4K5A B;  5KWD A;  1SW6 A;  1S0P A;  1H19 A;  1QNF A;  3DSX A;  5LX8 A;  1N94 A;  3Q7F A;  4A1G A;  3RRU A;  5CCL A;  4GMJ A;  3AU5 A;  3R7R A;  3L16 A;  4IYP A;  4PH4 B;  4FP7 A;  1ELW A;  4FJY A;  2VJ8 A;  4KVM A;  5G04 J;  3FU0 A;  5G2N A;  4XI0 A;  3PE3 A;  1LF8 A;  3ASH A;  5FIN A;  3FEY A;  3ZW3 A;  3I3N A;  4I2W A;  4BER A;  4FHK A;  1EF1 C;  2F37 A;  1SQM A;  3ZEF A;  3CVL A;  3B7S A;  4C0M A;  3FH5 A;  3RKV A;  4FA6 A;  3MGB A;  1OCZ E;  3APF A;  4H7X A;  1FVH A;  4GAA A;  5T3R A;  3JYS A;  3BU8 A;  4HRL A;  4GZ6 A;  3KD7 A;  1IKN D;  4N3A A;  4MKT A;  2L6B A;  2XEV A;  2C0M A;  4F53 A;  2OOE A;  4RSY A;  3HYM B;  4D10 C;  2ZGD A;  2Q7F A;  4CRW A;  4NIK A;  3IV0 A;  1V54 E;  3SF4 A;  5EDS A;  4XI9 A;  4U0Z A;  2FO7 A;  4ANV A;  3CIA A;  5CRV A;  5IY5 E;  3KSL A;  4CGV A;  3OXL A;  4F3V A;  4PDX A;  5M72 A;  3LY9 A;  4I9E A;  4G8K A;  3TXM A;  4B89 A;  2DIW A;  2Y0B G;  4I6J A;  3L17 A;  4O6F A;  1QYM A;  4DLO A;  2AW6 A;  3BEE A;  1A17 A;  3CVU A;  4L2Y A;  3QAR A;  3O48 A;  2VSX E;  4WWN A;  4OAV B;  1QBQ A;  3EIQ C;  3QWV A;  3B7U X;  4XZ4 A;  2WXO A;  1IXV A;  3PE4 A;  5D66 A;  4K5C A;  4DX6 D;  2AXU A;  3LYA A;  4YDY A;  3ZYM A;  4JZY A;  1HH8 A;  3OAW A;  3EDT B;  4J8Y A;  2GW1 A;  2AXV A;  3IHV A;  4JA7 A;  4HXI A;  4RG6 A;  1UG3 A;  3AG1 E;  3CLJ A;  3L22 A;  4ILG A;  3ASO E;  3CHP A;  4CT0 A;  5J90 A;  4ATG A;  4A63 B;  1TNB A;  4OVV A;  4UWK A;  2VYI A;  3LY7 A;  5EIL A;  1JCS A;  4KMO A;  2WXR A;  4HOU A;  2VSY A;  3CK9 A;  4HOT A;  4AEZ C;  1ELK A;  4G26 A;  4N5C A;  4UI9 J;  4EBA G;  3IEG A;  1SZ9 A;  1O1T A;  2CG2 A;  1HFA A;  3UM2 A;  2AWI A;  5BV0 A;  4UWF A;  2VGX B;  2VQ2 A;  4DX2 A;  2Y4U A;  4GTO A;  3AS8 A;  1YA0 A;  1A5E A;  4OAU C;  4U8H A;  4O60 A;  1FCH A;  1HX8 A;  3ZIM A;  1JWG A;  3S7B A;  1PAQ A;  3MZL B;  4X8Q A;  5LFA A;  4E85 A;  4I6G A;  2WXI A;  2KC7 A;  3D9L A;  3P2B A;  3UIN C;  4AY6 A;  2WXG A;  2WXH A;  1BPO A;  3EHR A;  4UWH A;  4DLQ A;  1U3C A;  3HXD A;  3R7Q A;  2WXN A;  2NSZ A;  2R02 A;  4BWR A;  5KJN A;  2GRP B;  1HG5 A;  1OUV A;  3TAX A;  2IJG X;  3FTV A;  4I1A A;  3ABK E;  3SFZ A;  3F6Q A;  3SQV A;  3SFY A;  1KT0 A;  3PNL B;  5AAO A;  2H6G A;  3CVV A;  2I6H A;  2WXP A;  2C0L A;  1ZB1 A;  3QWW A;  4NAC A;  5G04 C;  4J0U A;  2RFA A;  4O1P A;  2FO1 E;  2L0I A;  2FBN A;  2XS8 A;  3UUX A;  2L9B A;  3CEQ A;  1NL4 A;  3CVN A;  1S63 A;  3S7F A;  5ENP D;  5J08 A;  3I4G A;  4KZ0 A;  4XIF A;  4CDN A;  3C98 A;  2QY7 A;  3HXC A;  3PZ1 A;  2XGM A;  5BW8 C;  3TWQ A;  1PY1 A;  5EIB E;  3EUV A;  4G25 A;  3FUH A;  3B95 A;  4JD2 G;  3T8K A;  5ITZ F;  4APF A;  1B89 A;  5G05 C;  5AAR A;  1JCQ A;  3ONL A;  4I9C A;  2L0T B;  2WXM A;  1N0R A;  3Q49 B;  1HF8 A;  3GW4 A;  4GZC A;  2YIN A;  3TXN A;  2GRR B;  2LUH A;  4LUN U;  2XCB A;  3CSF A;  2KAT A;  3ZXS A;  2P9U G;  2PM7 A;  3TWR A;  3FUJ A;  5BT1 A;  4BY6 A;  2M63 A;  3VLE A;  4LSZ E;  2CFU A;  1MHQ A;  3KAE A;  3KEZ A;  3C72 A;  5FTP A;  1AP7 A;  5LOZ A;  3C3Q A;  5BXO A;  5BV1 A;  1U2V G;  1TNZ A;  2HE0 A;  2KZT A;  4LCT A;  1WG0 A;  4AXH A;  2V5F A;  4UI9 C;  1WDY A;  3ULY A;  4W9R A;  2IU1 A;  4NQ0 A;  5AQ7 A;  1L5J A;  5FJY A;  2OCC E;  3T9K A;  3JXJ A;  3MV3 B;  1E7V A;  3AG3 E;  2EIM E;  2XRY A;  3UI2 A;  5JJ7 A;  3C3R A;  3ASD A;  3BG1 B;  4HFG A;  4MBG A;  3ULE G;  1JCR A;  4PS8 A;  3FTZ A;  5JHA A;  4WWP A;  1LTX A;  2LSU A;  3DXK G;  4U0U A;  4BTA A;  3QNK A;  3SNX A;  2DWZ A;  3N71 A;  1O1R A;  2QYU A;  5HS0 A;  3U4T A;  4QQI A;  3DXM G;  3RO3 A;  4J8E A;  3SGH A;  3JQ0 A;  4JW1 A;  4DUI A;  2DYS E;  2KCL A;  2R59 A;  3CHR A;  2BUG A;  4UQZ A;  5AJD A;  1XNF A;  3C5R A;  4L7T A;  5AQA A;  2UY1 B;  2PM6 A;  2UY1 A;  4FUL A;  5KBA A;  3Q4A B;  1YCS B;  3TJP A;  2LXL A;  3CVP A;  1JWF A;  5CHE E;  4L23 A;  5KJL A;  2VGY A;  3CK7 A;  1UN9 A;  3TWW A;  2Y1L E;  3UIP C;  3APD A;  4AM9 A;  3PH0 C;  2WQ7 A;  3TWU A;  5EYP F;  4Q96 A;  3FY4 A;  1E8Z A;  4TXR A;  4XKC A;  3S2A A;  3ULQ A;  4HLE A;  2VSN A;  4U8Y D;  3AG2 E;  1IHB A;  3S7J A;  4I6E A;  2MHK A;  3EIJ A;  1WAO 1;  3KS2 A;  2E0I A;  3IKO B;  2V4H C;  4TRQ A;  3QC1 A;  2OVB A;  3DRA A;  3Q78 A;  3QKY A;  4RG9 A;  3EHQ A;  2PZI A;  2Y4T A;  3K9I A;  4N2S A;  5FT9 A;  1N4S A;  4XX5 A;  1K3Z D;  3DWL G;  5KNH D;  4GA0 A;  3T8M A;  4J8S A;  5BUZ A;  2J07 A;  4C0E A;  2FI7 A;  3ZN3 A;  2ION A;  1LD8 A;  2WQ6 A;  3L08 A;  1S64 A;  5ANR A;  4UWL A;  4M3O A;  3DSU A;  4HS2 A;  3MA5 A;  4YDW A;  2DZO A;  1Z3X A;  3SI5 A;  3QDN A;  1OWN A;  4EQF A;  2PL2 A;  3FHE A;  1YMP A;  3CVW A;  1K1B A;  4GZD A;  1H6O A;  4ANX A;  4DI3 A;  3E37 A;  2EQX A;  2B6C A;  1HZ4 A;  3W9G A;  3LJN A;  4P29 A;  1BU9 A;  2R17 C;  1HU3 A;  3OXF A;  4YDE A;  3KEA A;  4FU3 A;  5G05 J;  1KT1 A;  3AS5 A;  4HOQ A;  4ILH B;  1RW2 A;  3L54 A;  5KJM A;  4NRH B;  1BI7 B;  2E2E A;  3GZS A;  5A6C A;  2XEH A;  4U07 A;  5B1A E;  3WXX A;  2WXJ A;  3UXG A;  1H6K A;  1TN6 A;  3RRM B;  4EZJ A;  2JAB A;  3HVE A;  3V2O A;  1IYG A;  3Q9N C;  1N4P A;  4N39 A;  3ZPJ A;  1MZC A;  1OCO E;  1TN7 A;  1NA0 A;  2BTD A;  3TWT A;  5ARF A;  4C9B B;  4CT4 A;  3R9A B;  4PS7 A;  2HM8 A;  3OTN A;  4EEC A;  4IUL A;  1UN8 A;  1D8D A;  3QWP A;  5EYL A;  3UPV A;  2KCV A;  3FDH A;  5CBN A;  2WMO A;  4U8V D;  5FIO A;  3PRE A;  4KVO A;  2GRN B;  3FEX A;  3VLF A;  3PS6 A;  5AQ9 A;  1TYQ G;  3UT7 A;  2VGX A;  5ARG A;  3IHY A;  1UJJ A;  4HVB A;  3CHS A;  4Q94 A;  3MKQ A;  2XPZ A;  4HBD A;  4IRU A;  4JB8 P;  1SZA A;  4RLY A;  2R05 A;  3FUE A;  3UM3 A;  1UW4 B;  1KLX A;  3CQC B;  3Q79 A;  1N95 A;  4N3B A;  3RK6 A;  3RJV A;  2V5Q C;  3ASN E;  1MYO A;  2PNN A;  3ZYL A;  4EHM A; 
#chains in the Genus database with same CATH homology
 3DSX A;  1JCR A;  4GTO A;  4LNB A;  1N94 A;  3Q7F A;  3DRA A;  3Q78 A;  1NI1 A;  1TN6 A;  4GTV A;  1LTX A;  1D8E A;  3HXE A;  3HXC A;  1FT1 A;  1N4P A;  3PZ1 A;  2H6I A;  1KZP A;  4GTT A;  1MZC A;  3E33 A;  1N4S A;  4LNG A;  3EUV A;  1TN7 A;  4YDO A;  3E34 A;  1QBQ A;  1X81 A;  1O1R A;  3PZ2 A;  1JCQ A;  3Q73 A;  3E32 A;  2ZIR A;  1TNO A;  1TNU A;  3SFX A;  1LD8 A;  4GTQ A;  2R2L A;  1TN8 A;  1S64 A;  2IEJ A;  1SA4 A;  4GTS A;  3PZ4 A;  3DSU A;  1N4Q A;  1D8D A;  1FPP A;  3HXD A;  1KZO A;  1FT2 A;  3E30 A;  3HXB A;  3PZ3 A;  1TNY A;  4L9P A;  3HXF A;  1SA5 A;  4GTR A;  2H6F A;  3C72 A;  3EU5 A;  4GTM A;  3DPY A;  3SFY A;  1N9A A;  1O1S A;  1TNB A;  3E37 A;  2F0Y A;  2H6H A;  2H6G A;  1TNZ A;  1DCE A;  1N4R A;  1JCS A;  3DSV A;  4YDE A;  3Q79 A;  1N95 A;  3DSS A;  2BED A;  4GTP A;  1O1T A;  3KSL A;  3DSW A;  3DST A;  1NL4 A;  1S63 A;  1LD7 A;  2ZIS A;  1O5M A;  4EHM A;  3Q7A A;  4MBG A;  3KSQ A;  3Q75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...