3KSLA

Structure of fpt bound to datfp-dh-gpp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase, CAAX box, alpha
publication title Synthesis, properties, and applications of diazotrifluropropanoyl-containing photoactive analogs of farnesyl diphosphate containing modified linkages for enhanced stability.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 127
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3kslA00
4GTPA 1N9AA 1NI1A 2H6HA 3HXFA 3EU5A 4L9PA 3SFXA 4MBGA 4LNGA 1DCEA 1X81A 3SFYA 3C72A 4GTQA 1FT1A 1LTXA 1TN6A 1S64A 3DSXA 2R2LA 3PZ3A 1SA5A 3KSQA 4GTSA 1O5MA 4YDOA 2ZIRA 1D8EA 3E30A 3DSSA 3E33A 1N4QA 3DSVA 1D8DA 1N95A 1TNZA 1N4SA 1KZOA 3HXCA 2BEDA 3Q73A 1TN7A 3KSLA 4EHMA 2H6IA 3Q7FA 4GTTA 1TNYA 1TNOA 4GTVA 3E34A 3PZ4A 4GTOA 3DRAA 2IEJA 1FT2A 1FPPA 1SA4A 1LD8A 1KZPA 3Q7AA 3EUVA 3DSTA 3Q78A 2F0YA 3E32A 3HXBA 3DPYA 1O1RA 1JCSA 1LD7A 3HXEA 3DSWA 1O1TA 4LNBA 4GTRA 1N4PA 1QBQA 1TNUA 2H6GA 3DSUA 1S63A 3PZ1A 2ZISA 1JCQA 3HXDA 1N94A 2H6FA 1MZCA 1JCRA 1TN8A 3Q79A 3Q75A 3E37A 1O1SA 4GTMA 3PZ2A 1NL4A 1N4RA 1TNBA 4YDEA
chains in the Genus database with same CATH superfamily
4BSZB 2V4HC 3T5XA 3AS8A 4N39A 4J8EA 3JYSA 3W9GA 2J9QA 3JQ0A 3UPVA 4HLEA 2KCLA 4DLQA 4QFVA 1WM5A 3ABME 4AXHA 5CMWA 5EX3A 3ZPJA 3DSSA 4LNUD 5E76A 2P9NG 1N95A 4AY5A 3CK9A 4K5AB 4M7CA 1JUQA 3Q73A 1TN7A 3EU9A 3SD5A 1BD8A 3JXJA 4K03A 2ZXWE 2P9LG 4NQ0A 4I6JA 3ISMC 4KYOB 2MHKA 4D10C 3KEAA 1WDYA 3ESLA 5G05J 3MJWA 1ELWA 2CHZA 3FTVA 4G24A 4OAUC 3JUEA 1BPOA 4B8CB 5FT9A 4J6IA 4A55A 3ZXPA 4XI0A 3FUNA 3EIJA 3SO8A 5ITZF 4JHRA 3E37A 3NZSA 2J08A 3ZGQA 3UM1A 1HG2A 2ETBA 1OCOE 4RLYA 2Y1LE 3CVLA 3AU5A 3AS4A 3RO3A 1K8KG 4IYPA 5T8IA 3F6QA 3CV0A 3S7DA 3HRAA 2LNIA 2L6BA 1EF1C 2IO2C 3CHOA 5ENNA 3ZUVB 1LF8A 5AYWD 4F6RD 3PZ3A 2L0IA 2UY1A 4DI3A 2WXQA 3V79K 5G04J 4GB9A 2PM6A 2HE0A 5ENSD 2BEDA 3TWSA 3V30A 2XZTG 3P1UA 2PNNA 4EZJA 4DPRA 1TNOA 2IOSA 5ENOD 3QDNA 4N3BA 3G2VA 5DIZA 3HVEB 4TXPA 5JJ7A 4LERA 4A63B 3CHRA 3EHQA 3TG5A 3TAXA 1E8ZA 3SNXA 3DSTA 2VQ2A 4ACKA 3UMVA 4CYMD 3R9AB 1Y6IA 3QWWA 5D0QD 2L0TB 3CKCA 4EZLA 4WNGA 1N4PA 4HI8A 1N52A 5A6CA 1JCQA 3TXNA 3ASGA 3ASHA 2H6FA 5BXUA 5A7DB 3KAEA 4U0SA 4HNAD 2WXJA 3OXGA 5B1AE 1XGWA 2WXMA 4XKBA 3FUJA 2VGXB 2EIJE 2AWIA 3UT4A 3ZYLA 2J49A 4HRLA 4HB5A 2GRNB 3DSXA 2XEHA 3ZRHA 4MLPA 4K5CA 4XI9A 4G26A 3MX3A 4TXQA 4CRWA 4ILGA 2UWJG 5FZQA 4OVUA 5JMND 4EECA 3E34A 4HI9A 4RVBA 5FZRA 5AQAA 2IEJA 4O60A 2XRYA 1SW6A 4ZHBA 5FINA 3T5VA 4QQIA 2A4ZA 4RG9A 3RRMB 3SF4A 4BERA 1PC2A 1SZ9A 1HX8A 2XPIA 3FUHA 5CBOA 1HXIA 3DPYA 2ZGDA 5AJLA 2WQ7A 3DSWA 3CK7A 5AQBA 4UWLA 5D66A 1TNUA 3SY2A 2OVFA 4JEHA 2KZTB 4WWNA 4N3CA 1UJJA 1OCZE 4K0RA 2WVIA 3I4GA 2BTDA 2XRZA 1E8XA 5FTPA 4DX2A 3RRNB 3ONKA 5CEAA 2LXLA 2EILE 3EDTB 2VGXA 5D2MC 4GCNA 4C48B 2VSXE 4DX7D 2RKKA 3OXFA 3UTMA 1N9AA 3UM0A 5A23A 4GA2A 3LPZA 1H6PA 4I6GA 4UWGA 5CERB 5FQ8A 4AM9A 4DRXE 4I9EA 3T8MA 3UIPC 4KZ0A 5AIJA 3NOGD 3AJIA 5FQ7A 3LEWA 2LSVA 4AOFA 2P9UG 1EYHA 2LAHA 5ENTD 3PZDA 1QQEA 3LY7A 1TNYA 4U95D 1E8WA 4OAVB 2GRQB 3CVNA 3AS5A 3PVLA 3LS8A 4HRNA 5BUZA 1FT2A 2IU1A 4ABNA 3U4TA 4GYYA 3MKQB 2CG2A 3U64A 3E32A 4N5CA 1OT8A 2WM9A 2KZTA 4CDRA 5FWQA 5G05C 1VDYA 1BLXB 4GZ5A 4AVXA 2R59A 1OWMA 3RK6A 4MS6A 4GZDA 4F1PA 3PS6A 3R9MA 4GTMA 4GPKA 2IOLA 3QKYA 1WG0A 2CHXA 4NACA 3FUKA 5AQ9A 2GRMA 3FY4A 4U8HA 2XGOA 1MX2A 1ZBPA 3D9MA 3MKRA 2NSZA 4LNGA 1OWLA 3EIQC 3AG4E 1SQMA 3NAWA 1O5MA 2IFUA 3CVWA 2P9SG 1FCHA 4Q94A 3ASFA 5LFAA 1U2VG 2XEVA 3IXEA 3MEKA 3QB2A 3TWUA 3FH5A 3ULQA 2ZGGA 5KJNA 1XNFA 4J0UA 3IBEA 2VSNA 4WNDA 3C5RA 2P9KG 2XENA 5G04C 4F3VA 4IN3B 2XS8A 3MKQA 4HVBA 3X2QE 3GW4A 2FBNA 1N54A 4ME2A 5H7PA 3SZ7A 3BUAA 4KBQA 2Y4TA 1H2TC 2OEVA 3AU4A 5BNWA 2JABA 3HXBA 1OWPA 2R17C 1H19A 4WAFA 3ULEG 5EIDA 1S63A 1GW6A 2I2OA 4FADA 2DWZA 1PY1A 4IRUA 3ZFWA 4WNFA 1MYOA 3D9HA 4FHKA 3VTYA 2WXLA 4JEUA 4CT0A 3TXMA 4CDNA 1AWCB 3BG1B 1X5BA 4PS8A 3UQ3A 2I1JA 2WQHA 2GROB 3PREA 4NURA 5T4YA 1RZ4A 4A1SA 3OAWA 3ENEA 4KZCA 3VLEA 4F1SA 3LVQE 4ATGA 2LUHA 4U63A 2XHEA 2V5QC 2X6IA 3HDXA 4GTTA 1N0RA 2WXOA 4ATZD 4B8AA 1HZ4A 3AG3E 2MRIA 4R7LA 1IYGA 1PAQA 4JA9A 1V55E 2FF4A 4I1AA 3LDZA 2Y4UA 3G2TA 3GYZA 4EBAG 3ONLA 1OY3D 4XE0A 5BV1A 4YVQC 3SI5A 5BT1A 1TJFA 1HFAA 4C0EA 1DVPA 4UI9J 2NC9A 1O1TA 3DSUA 4V3IA 3GZ2A 4FLBA 3BQOA 1MZCA 5CECB 2PQNA 2DCPA 1HF8A 3IHVA 3ZU7B 1YA0A 3B7SA 2VGYA 3WG7E 1TYQG 2IO3C 4JA7A 1DNPA 3N71A 4F53A 2XCCA 2Y3AA 4HBDA 3SBSA 3NB2A 2XEEA 2X6FA 2HR2A 3EJNA 3C72A 1FT1A 2OCCE 1OWNA 1TN6A 2P9PG 1S64A 2QYUA 3UM2A 4PUCA 4BFRA 2ZIRA 5DBKA 3E30A 3D9IA 3ZYKA 3E33A 4L2YA 5G2NA 2F8XK 1QNFA 2V4LA 3V2XA 3MV3B 4BTAA 5IY5E 3HHMA 2OOEA 2WPVA 3APCA 5B1BE 3FTSA 4GTOA 5G55A 3R7RA 3C3OA 1ELRA 4U0UA 4UUCA 2P2CP 2HM8A 5ANLA 3FUFA 2B0OE 5B3SE 3UT8A 1WAO1 4CGVA 4BTBA 2BUGA 3CVQA 4F7AA 2LXMA 2KCVA 2RFAA 3ZNGA 3D9KA 3UIOC 2NXPA 5JHAA 4G8LA 2XGMA 5KCMA 2FI7A 2H6GA 2KATA 1SZAA 3QWPA 3FUMA 4GAAA 1YYHA 3Q79A 3TWVA 4AP2A 1NL4A 1H6KA 1BI8B 2GRLA 3SGHA 2KCKA 2IY0C 4U8YD 2P9IG 3FTZA 3UUXA 1NI1A 1HO8A 3EU5A 3SFXA 4MBGA 1OXJA 4AIFA 2R03A 4HXIA 4LUNU 4DI4A 4G8KA 3LYAA 2R5SA 2EIME 2FO7A 3UX4A 2WXIA 1W3BA 2MYOA 5EX0A 3HXCA 3ZHEB 5CHEE 2RG8A 4ACLA 2F37A 2J4BA 4AV7A 4G23A 1QYMA 2GRPB 3Q7FA 4GPMA 2X3MA 2XQ0A 4JD2G 2ETCA 4TUMA 2OEWA 4HRMB 3DXMG 5EDSA 3DBSA 1NZNA 4GA0A 3B13A 2FO1E 3QOUA 2HO1A 5CRUA 2XGSA 3Q7AA 2WXRA 3OXLA 1MX4A 1K1BA 2V0PA 4CDMA 3HVEA 2F0YA 3TWRA 3D3MA 3Q4AB 3GZ1A 2PQRA 4DLOA 5FQ6A 3NF1A 3JUIA 3MV2B 1MQSA 3C3QA 4U96D 4H7XA 4WNEA 5M72A 5KNHD 3IV0A 3FFLA 5D0OD 3I3NA 4FC8A 4RSYA 3PNLB 3ASOE 3B7RL 2VGEA 3ZN3A 3GZSA 3VLFA 5HS0A 3CHPA 4W9RA 4Y6CA 4APOA 5C2YA 3KS2A 3FEYA 1X81A 2PM7A 2FEZA 2X6HA 3C3RA 4K5BA 2AXZA 3Q9NC 4YDYA 4UWKA 4I1MA 1K1AA 5EYPF 5ARFA 3CIAA 3MCXA 3ZW3A 1KZOA 3MGBA 4APFA 3FH8A 4JC8A 3FUIA 3Q5MA 3VTXA 5FJYA 2VYIA 3UINC 3TWQA 4LG6A 4GYOA 4OYSA 3LCAA 3CHQA 4UWFA 4AEZC 4A3VA 2IJGX 2WB2A 1JWGA 4BX8A 2X38A 4ANXA 1OCCE 4BSXA 2ONDA 3G2SA 3T9KA 4LEUA 4JZYA 4DUIA 1UOHA 2QZAA 4TUUA 4UI9K 3L17A 2ZU6B 4N3AA 2QC9A 3L22A 3QWVA 5KJKA 3I4RB 4UI9C 3T8KA 4BESA 4TXRA 2GGFA 5LP0A 3PZ2A 4BT8A 4BWRA 2KM4A 4CGWA 5HI7A 2XPZA 2XS1A 1YMPA 2F8YA 3D9LA 4CZ2D 4TV3A 5ANRA 1NA0A 4LCTA 2XPYA 5EIBE 3E4BA 1OUVA 4HOUA 1V54E 3MZLB 1N0QA 3HG0D 2LO6A 4TRQA 4G11A 4GMJA 3UKUG 2R05A 4XZ4A 4HOTA 3TL5A 4Q69A 2LSUA 4Q96A 3DEOA 4RG6A 2DVWA 2VTBB 3ZEFA 3MA5A 1N4SA 2P58C 5ENQD 4EBAA 1OCRE 2QY7A 2RFMA 4C0MA 3KSLA 3IHYA 3Q9UC 3FEXA 4EQFA 5JHBA 1H2VC 1ZB1A 3DRAA 2YHCA 2A5EA 2ILRA 4GA1A 1WY6A 4HFGA 3QJZA 2WXGA 3O4ZA 4KT6B 2I1KA 4FHJA 2DZNA 4B0ZA 3LJ3A 5BW8C 1UG3A 3Q49B 1Q2ZA 4G2VA 2KXPC 3ZXSA 4H7YA 1INZA 3L54A 4L1BA 4KXKB 4DX5D 1NP7A 1O1RA 4GMRA 1JCSA 2PZIA 1U3CA 4B94A 3LY8A 1IQRA 5AARA 4EPZA 4MRUA 3L16A 2CFUA 3D9PA 2DYRE 2KBXA 5JJTA 3U66A 3U3WA 2X6JA 5ENRD 2AW6A 1N4RA 5LX8A 2PL2A 2JEKA 4B93B 1MHQA 4P29A 5CMYA 4KMOA 3KEZA 5AN8A 4DX1A 4FLHA 2H6HA 4KVOA 5BXOA 4N2SA 3FHEA 1SA5A 1P5QA 4FULA 2QYJA 5ARGA 2AJAA 4ILIA 2V5FA 2QFCA 4U04A 2AXUA 1AP7A 2A5UA 2V8SE 3UT7A 3C98A 3J5QB 4U7EB 3PZ4A 3L08A 5J90A 4CT4A 4BX9A 5AENA 3BU8A 1KZPA 3DXKG 2R02A 1B89A 3UXGA 3Q78A 2WXNA 1K3ZD 2WQ6A 5FQ4A 2WMNA 4GZ3A 2C0LA 3FP3A 4DX6D 4ANUA 4URKA 3PZ1A 1N11A 3VLDA 4BY6A 4I43A 1E7VA 4GU5A 1DCQA 3R7QA 5BV0A 5E75A 3TGOA 3FUDA 4J8DA 4GTPA 3PEUB 1E8YA 4HLLA 1IHGA 2UY1B 4LRZA 3W9FA 1DCEA 4Y6WA 4YNDA 5CRVA 4L7TA 3JXIA 2ETAA 3G2UA 3DWLG 3TWWA 4GTSA 4I6EA 3CLJA 3MYVA 4JW1A 3S7BA 1HG5A 1Z6TA 4JHKA 4WWOA 3CVXA 1ZU2A 4WUYA 1DC2A 3B7BA 3NQPA 4GMLA 1UW4B 2H6IA 4GTVA 1S0PA 1FVHA 3FULA 3U9WA 3OTNA 5ENPD 1TJCA 1ELKA 4GZCA 3V31A 4E6HA 3LJNA 4GCOA 3NBNB 5LOZA 5J08A 3CHMA 5HQ8A 3CVUA 5EN5D 4C9BB 2GW1A 1UN8A 2NYJA 2YHEA 3RSEG 4I17A 2EINE 5FIOA 4CCAA 3D9NA 4BETA 1EPUA 3FDHA 3FU5A 3Q75A 1O1SA 2IF4A 4NIKA 5BPPA 4U0ZA 5LCWJ 1TEZA 1FVFA 3PEVB 4XX5A 3FWVA 3QAQA 5EYLA 3B7UX 3RJVA 3QK0A 2BKKB 1OWOA 3SFYA 2CG3A 2KC7A 1LTXA 3CK8A 3KSQA 2WXPA 4YDOA 4RQIA 2BF0X 4GZ6A 1TNZA 2XCBA 3ABKE 4ANWA 4U8VD 4EHMA 1Z5SC 4XIFA 3RKVA 1HE8A 4I1OB 4PH4B 3TWXA 1U3DA 3ZIMA 2L9BA 4YDWA 1Z3YA 3RAUA 2YQ8A 1FPPA 3JQ1A 5KWDA 4A3TA 2YINA 4Z68A 1IKND 1YCSB 2YNQA 3ULYA 4WWPA 2M63A 1JPLA 3D9OA 3FTXA 3FUEA 4DK5A 4N5QA 3AG1E 3SHFA 4GTRA 3PH0C 2ZISA 1N94A 4N2QA 3ESKA 1KPSB 1NA3A 1H2UA 4U07A 1JWFA 3O48A 4I9CA 5KJMA 2VJ8A 4UQXA 2GRRB 3FU0A 2RD0A 2EIKE 5KNGA 4AJWA 4FP7A 4O1OA 3S2AA 3ZKJA 3ZVVA 3FU3A 1MJ0A 2C0MA 2Y0BG 3CVPA 2CFZA 4FJZA 3LKUA 4M3OA 3PDNA 3UI2A 4JXTA 3DSVA 3HYMB 1D8DA 2J09A 3BEEA 3FTWA 1S70B 2B6CA 4FJYA 4J8FA 4L23A 4FU3A 3KD7A 4A1GA 3IKOB 3ASDA 2L6JA 3LY9A 2DBAA 3SQVA 1BU9A 3EHMA 3ZHEA 3Q15A 5JJ6A 3PE4A 2HYZA 4GYWA 4G1TA 1KT1A 3EHRA 5EILA 3EHNA 3PRZA 3K9IA 4PDXA 3BG0B 2Y69E 3RU0A 3ZYQA 1BI7B 3DPDA 1LD7A 5HRYA 5FZSA 1E7UA 3I5PA 5CCMA 3SFZA 3HXDA 5JA4D 3ML9A 3PUKA 1SVXA 4XKCA 3QARA 2J4DA 5KJLA 3B7TA 1TNBA 3ASNE 4YDEA 4BEPA 5CBNA 4OVVA 4UWHA 2EQXA 3CKBA 3L9TA 5AAOA 1EDUA 3HIZA 2I9CA 4J8YA 4L9PA 5C1DA 3WXXA 2J07A 3B95A 2WXHA 2OVBA 3CVVA 4GTQA 3TJPA 4G25A 4ILHB 2Q7FA 3CR3A 4DJAA 3S7FA 4LSZE 1NFIE 2R2LA 4B89A 3SBTB 4BT9A 3CGHA 3TWTA 2WXKA 2LAIA 3NZUA 4PS7A 3G2WA 4JB8P 3LVRE 3AG2E 3APDA 1E96B 5HKPA 5AJDA 5AQ7A 4PS3A 1IQUA 1HH8A 4KVMA 1TR4A 4ANVA 3QNKA 1IXVA 2DZOA 2J8SD 3APFA 4IULA 1RW2A 1KLXA 1MX6A 4UQYA 1QZ2A 4I2ZA 3L13A 3UKRG 2DIWA 2E2EA 3HXEA 2VSOE 2AVPA 1QBQA 2FULA 3Q47B 3PUJA 2VSYA 4CEMA 5EKQD 2MOWA 1L5JA 4JVSA 1D9SA 3FH7A 4I2WA 3P2BA 4L2LA 3L82A 4NRHB 2WMOA 2X6KA 3NOCD 1Y8MA 1A5EA 4JL0A 4JHJA 3S7JA 1HU3A 5KBAA 4HQDA 5T3RA 3ZYMA 3RIBA 3RRUA 5LCWC 3CHSA 4UQZA 3RO2A 1H6OA 3CQCB 3PNTB 3HXFA 1E90A 3ABLE 2BKGA 2XZDG 3PE3A 4O1PA 4HOQA 3QC1A 1UJKA 3DEPA 1D8EA 3LXUX 1N4QA 3J5PA 4AY6A 1KT0A 3CSTA 3FU6A 4X8QA 2CHWA 2IQCA 3FTYA 3ML8A 2VTBA 3CEQA 5CCLA 1HS6A 1SA4A 2AXVA 1LD8A 4E85A 1G3NB 3FTUA 3URZA 4J8SA 4HORA 3EUVA 3IEGA 3JCKC 4MKTA 2IONA 3V2OA 1UN9A 2C2LA 2DYSE 3CQGB 2I6HA 4EZKA 4YVOA 4J7WA 3AAAC 4LNBA 2JLBA 1A17A 1H0AA 1IHBA 4HOSA 1JCRA 1TN8A 3D9JA 4XEIG 5CEDB 4FA6A 4JPSA 4ZFHA 3UM3A 1Z3XA 2WXFA 4HS2A 2OV8A 3L6AA 3CSFA 3TG4A 3CVYA 2E0IA 4O6FA
chains in the Genus database with same CATH topology
4GTPA 1N9AA 1NI1A 2H6HA 3HXFA 3EU5A 4L9PA 3SFXA 4MBGA 4LNGA 1DCEA 1X81A 3SFYA 3C72A 4GTQA 1FT1A 1LTXA 1TN6A 1S64A 3DSXA 2R2LA 3PZ3A 1SA5A 3KSQA 4GTSA 1O5MA 4YDOA 2ZIRA 1D8EA 3E30A 3DSSA 3E33A 1N4QA 3DSVA 1D8DA 1N95A 1TNZA 1N4SA 1KZOA 3HXCA 2BEDA 3Q73A 1TN7A 3KSLA 4EHMA 2H6IA 3Q7FA 4GTTA 1TNYA 1TNOA 4GTVA 3E34A 3PZ4A 4GTOA 3DRAA 2IEJA 1FT2A 1FPPA 1SA4A 1LD8A 1KZPA 3Q7AA 3EUVA 3DSTA 3Q78A 2F0YA 3E32A 3HXBA 3DPYA 1O1RA 1JCSA 1LD7A 3HXEA 3DSWA 1O1TA 4LNBA 4GTRA 1N4PA 1QBQA 1TNUA 2H6GA 3DSUA 1S63A 3PZ1A 2ZISA 1JCQA 3HXDA 1N94A 2H6FA 1MZCA 1JCRA 1TN8A 3Q79A 3Q75A 3E37A 1O1SA 4GTMA 3PZ2A 1NL4A 1N4RA 1TNBA 4YDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTP A;  1N9A A;  1NI1 A;  2H6H A;  3HXF A;  3EU5 A;  4L9P A;  3SFX A;  4MBG A;  4LNG A;  1DCE A;  1X81 A;  3SFY A;  3C72 A;  4GTQ A;  1FT1 A;  1LTX A;  1TN6 A;  1S64 A;  3DSX A;  2R2L A;  3PZ3 A;  1SA5 A;  3KSQ A;  4GTS A;  1O5M A;  4YDO A;  2ZIR A;  1D8E A;  3E30 A;  3DSS A;  3E33 A;  1N4Q A;  3DSV A;  1D8D A;  1N95 A;  1TNZ A;  1N4S A;  1KZO A;  3HXC A;  2BED A;  3Q73 A;  1TN7 A;  3KSL A;  4EHM A;  2H6I A;  3Q7F A;  4GTT A;  1TNY A;  1TNO A;  4GTV A;  3E34 A;  3PZ4 A;  4GTO A;  3DRA A;  2IEJ A;  1FT2 A;  1FPP A;  1SA4 A;  1LD8 A;  1KZP A;  3Q7A A;  3EUV A;  3DST A;  3Q78 A;  2F0Y A;  3E32 A;  3HXB A;  3DPY A;  1O1R A;  1JCS A;  1LD7 A;  3HXE A;  3DSW A;  1O1T A;  4LNB A;  4GTR A;  1N4P A;  1QBQ A;  1TNU A;  2H6G A;  3DSU A;  1S63 A;  3PZ1 A;  2ZIS A;  1JCQ A;  3HXD A;  1N94 A;  2H6F A;  1MZC A;  1JCR A;  1TN8 A;  3Q79 A;  3Q75 A;  3E37 A;  1O1S A;  4GTM A;  3PZ2 A;  1NL4 A;  1N4R A;  1TNB A;  4YDE A; 
#chains in the Genus database with same CATH topology
 4BSZ B;  2V4H C;  3T5X A;  3AS8 A;  4N39 A;  4J8E A;  3JYS A;  3W9G A;  2J9Q A;  3JQ0 A;  3UPV A;  4HLE A;  2KCL A;  4DLQ A;  4QFV A;  1WM5 A;  3ABM E;  4AXH A;  5CMW A;  5EX3 A;  3ZPJ A;  3DSS A;  4LNU D;  5E76 A;  2P9N G;  1N95 A;  4AY5 A;  3CK9 A;  4K5A B;  4M7C A;  1JUQ A;  3Q73 A;  1TN7 A;  3EU9 A;  3SD5 A;  1BD8 A;  3JXJ A;  4K03 A;  2ZXW E;  2P9L G;  4NQ0 A;  4I6J A;  3ISM C;  4KYO B;  2MHK A;  4D10 C;  3KEA A;  1WDY A;  3ESL A;  5G05 J;  3MJW A;  1ELW A;  2CHZ A;  3FTV A;  4G24 A;  4OAU C;  3JUE A;  1BPO A;  4B8C B;  5FT9 A;  4J6I A;  4A55 A;  3ZXP A;  4XI0 A;  3FUN A;  3EIJ A;  3SO8 A;  5ITZ F;  4JHR A;  3E37 A;  3NZS A;  2J08 A;  3ZGQ A;  3UM1 A;  1HG2 A;  2ETB A;  1OCO E;  4RLY A;  2Y1L E;  3CVL A;  3AU5 A;  3AS4 A;  3RO3 A;  1K8K G;  4IYP A;  5T8I A;  3F6Q A;  3CV0 A;  3S7D A;  3HRA A;  2LNI A;  2L6B A;  1EF1 C;  2IO2 C;  3CHO A;  5ENN A;  3ZUV B;  1LF8 A;  5AYW D;  4F6R D;  3PZ3 A;  2L0I A;  2UY1 A;  4DI3 A;  2WXQ A;  3V79 K;  5G04 J;  4GB9 A;  2PM6 A;  2HE0 A;  5ENS D;  2BED A;  3TWS A;  3V30 A;  2XZT G;  3P1U A;  2PNN A;  4EZJ A;  4DPR A;  1TNO A;  2IOS A;  5ENO D;  3QDN A;  4N3B A;  3G2V A;  5DIZ A;  3HVE B;  4TXP A;  5JJ7 A;  4LER A;  4A63 B;  3CHR A;  3EHQ A;  3TG5 A;  3TAX A;  1E8Z A;  3SNX A;  3DST A;  2VQ2 A;  4ACK A;  3UMV A;  4CYM D;  3R9A B;  1Y6I A;  3QWW A;  5D0Q D;  2L0T B;  3CKC A;  4EZL A;  4WNG A;  1N4P A;  4HI8 A;  1N52 A;  5A6C A;  1JCQ A;  3TXN A;  3ASG A;  3ASH A;  2H6F A;  5BXU A;  5A7D B;  3KAE A;  4U0S A;  4HNA D;  2WXJ A;  3OXG A;  5B1A E;  1XGW A;  2WXM A;  4XKB A;  3FUJ A;  2VGX B;  2EIJ E;  2AWI A;  3UT4 A;  3ZYL A;  2J49 A;  4HRL A;  4HB5 A;  2GRN B;  3DSX A;  2XEH A;  3ZRH A;  4MLP A;  4K5C A;  4XI9 A;  4G26 A;  3MX3 A;  4TXQ A;  4CRW A;  4ILG A;  2UWJ G;  5FZQ A;  4OVU A;  5JMN D;  4EEC A;  3E34 A;  4HI9 A;  4RVB A;  5FZR A;  5AQA A;  2IEJ A;  4O60 A;  2XRY A;  1SW6 A;  4ZHB A;  5FIN A;  3T5V A;  4QQI A;  2A4Z A;  4RG9 A;  3RRM B;  3SF4 A;  4BER A;  1PC2 A;  1SZ9 A;  1HX8 A;  2XPI A;  3FUH A;  5CBO A;  1HXI A;  3DPY A;  2ZGD A;  5AJL A;  2WQ7 A;  3DSW A;  3CK7 A;  5AQB A;  4UWL A;  5D66 A;  1TNU A;  3SY2 A;  2OVF A;  4JEH A;  2KZT B;  4WWN A;  4N3C A;  1UJJ A;  1OCZ E;  4K0R A;  2WVI A;  3I4G A;  2BTD A;  2XRZ A;  1E8X A;  5FTP A;  4DX2 A;  3RRN B;  3ONK A;  5CEA A;  2LXL A;  2EIL E;  3EDT B;  2VGX A;  5D2M C;  4GCN A;  4C48 B;  2VSX E;  4DX7 D;  2RKK A;  3OXF A;  3UTM A;  1N9A A;  3UM0 A;  5A23 A;  4GA2 A;  3LPZ A;  1H6P A;  4I6G A;  4UWG A;  5CER B;  5FQ8 A;  4AM9 A;  4DRX E;  4I9E A;  3T8M A;  3UIP C;  4KZ0 A;  5AIJ A;  3NOG D;  3AJI A;  5FQ7 A;  3LEW A;  2LSV A;  4AOF A;  2P9U G;  1EYH A;  2LAH A;  5ENT D;  3PZD A;  1QQE A;  3LY7 A;  1TNY A;  4U95 D;  1E8W A;  4OAV B;  2GRQ B;  3CVN A;  3AS5 A;  3PVL A;  3LS8 A;  4HRN A;  5BUZ A;  1FT2 A;  2IU1 A;  4ABN A;  3U4T A;  4GYY A;  3MKQ B;  2CG2 A;  3U64 A;  3E32 A;  4N5C A;  1OT8 A;  2WM9 A;  2KZT A;  4CDR A;  5FWQ A;  5G05 C;  1VDY A;  1BLX B;  4GZ5 A;  4AVX A;  2R59 A;  1OWM A;  3RK6 A;  4MS6 A;  4GZD A;  4F1P A;  3PS6 A;  3R9M A;  4GTM A;  4GPK A;  2IOL A;  3QKY A;  1WG0 A;  2CHX A;  4NAC A;  3FUK A;  5AQ9 A;  2GRM A;  3FY4 A;  4U8H A;  2XGO A;  1MX2 A;  1ZBP A;  3D9M A;  3MKR A;  2NSZ A;  4LNG A;  1OWL A;  3EIQ C;  3AG4 E;  1SQM A;  3NAW A;  1O5M A;  2IFU A;  3CVW A;  2P9S G;  1FCH A;  4Q94 A;  3ASF A;  5LFA A;  1U2V G;  2XEV A;  3IXE A;  3MEK A;  3QB2 A;  3TWU A;  3FH5 A;  3ULQ A;  2ZGG A;  5KJN A;  1XNF A;  4J0U A;  3IBE A;  2VSN A;  4WND A;  3C5R A;  2P9K G;  2XEN A;  5G04 C;  4F3V A;  4IN3 B;  2XS8 A;  3MKQ A;  4HVB A;  3X2Q E;  3GW4 A;  2FBN A;  1N54 A;  4ME2 A;  5H7P A;  3SZ7 A;  3BUA A;  4KBQ A;  2Y4T A;  1H2T C;  2OEV A;  3AU4 A;  5BNW A;  2JAB A;  3HXB A;  1OWP A;  2R17 C;  1H19 A;  4WAF A;  3ULE G;  5EID A;  1S63 A;  1GW6 A;  2I2O A;  4FAD A;  2DWZ A;  1PY1 A;  4IRU A;  3ZFW A;  4WNF A;  1MYO A;  3D9H A;  4FHK A;  3VTY A;  2WXL A;  4JEU A;  4CT0 A;  3TXM A;  4CDN A;  1AWC B;  3BG1 B;  1X5B A;  4PS8 A;  3UQ3 A;  2I1J A;  2WQH A;  2GRO B;  3PRE A;  4NUR A;  5T4Y A;  1RZ4 A;  4A1S A;  3OAW A;  3ENE A;  4KZC A;  3VLE A;  4F1S A;  3LVQ E;  4ATG A;  2LUH A;  4U63 A;  2XHE A;  2V5Q C;  2X6I A;  3HDX A;  4GTT A;  1N0R A;  2WXO A;  4ATZ D;  4B8A A;  1HZ4 A;  3AG3 E;  2MRI A;  4R7L A;  1IYG A;  1PAQ A;  4JA9 A;  1V55 E;  2FF4 A;  4I1A A;  3LDZ A;  2Y4U A;  3G2T A;  3GYZ A;  4EBA G;  3ONL A;  1OY3 D;  4XE0 A;  5BV1 A;  4YVQ C;  3SI5 A;  5BT1 A;  1TJF A;  1HFA A;  4C0E A;  1DVP A;  4UI9 J;  2NC9 A;  1O1T A;  3DSU A;  4V3I A;  3GZ2 A;  4FLB A;  3BQO A;  1MZC A;  5CEC B;  2PQN A;  2DCP A;  1HF8 A;  3IHV A;  3ZU7 B;  1YA0 A;  3B7S A;  2VGY A;  3WG7 E;  1TYQ G;  2IO3 C;  4JA7 A;  1DNP A;  3N71 A;  4F53 A;  2XCC A;  2Y3A A;  4HBD A;  3SBS A;  3NB2 A;  2XEE A;  2X6F A;  2HR2 A;  3EJN A;  3C72 A;  1FT1 A;  2OCC E;  1OWN A;  1TN6 A;  2P9P G;  1S64 A;  2QYU A;  3UM2 A;  4PUC A;  4BFR A;  2ZIR A;  5DBK A;  3E30 A;  3D9I A;  3ZYK A;  3E33 A;  4L2Y A;  5G2N A;  2F8X K;  1QNF A;  2V4L A;  3V2X A;  3MV3 B;  4BTA A;  5IY5 E;  3HHM A;  2OOE A;  2WPV A;  3APC A;  5B1B E;  3FTS A;  4GTO A;  5G55 A;  3R7R A;  3C3O A;  1ELR A;  4U0U A;  4UUC A;  2P2C P;  2HM8 A;  5ANL A;  3FUF A;  2B0O E;  5B3S E;  3UT8 A;  1WAO 1;  4CGV A;  4BTB A;  2BUG A;  3CVQ A;  4F7A A;  2LXM A;  2KCV A;  2RFA A;  3ZNG A;  3D9K A;  3UIO C;  2NXP A;  5JHA A;  4G8L A;  2XGM A;  5KCM A;  2FI7 A;  2H6G A;  2KAT A;  1SZA A;  3QWP A;  3FUM A;  4GAA A;  1YYH A;  3Q79 A;  3TWV A;  4AP2 A;  1NL4 A;  1H6K A;  1BI8 B;  2GRL A;  3SGH A;  2KCK A;  2IY0 C;  4U8Y D;  2P9I G;  3FTZ A;  3UUX A;  1NI1 A;  1HO8 A;  3EU5 A;  3SFX A;  4MBG A;  1OXJ A;  4AIF A;  2R03 A;  4HXI A;  4LUN U;  4DI4 A;  4G8K A;  3LYA A;  2R5S A;  2EIM E;  2FO7 A;  3UX4 A;  2WXI A;  1W3B A;  2MYO A;  5EX0 A;  3HXC A;  3ZHE B;  5CHE E;  2RG8 A;  4ACL A;  2F37 A;  2J4B A;  4AV7 A;  4G23 A;  1QYM A;  2GRP B;  3Q7F A;  4GPM A;  2X3M A;  2XQ0 A;  4JD2 G;  2ETC A;  4TUM A;  2OEW A;  4HRM B;  3DXM G;  5EDS A;  3DBS A;  1NZN A;  4GA0 A;  3B13 A;  2FO1 E;  3QOU A;  2HO1 A;  5CRU A;  2XGS A;  3Q7A A;  2WXR A;  3OXL A;  1MX4 A;  1K1B A;  2V0P A;  4CDM A;  3HVE A;  2F0Y A;  3TWR A;  3D3M A;  3Q4A B;  3GZ1 A;  2PQR A;  4DLO A;  5FQ6 A;  3NF1 A;  3JUI A;  3MV2 B;  1MQS A;  3C3Q A;  4U96 D;  4H7X A;  4WNE A;  5M72 A;  5KNH D;  3IV0 A;  3FFL A;  5D0O D;  3I3N A;  4FC8 A;  4RSY A;  3PNL B;  3ASO E;  3B7R L;  2VGE A;  3ZN3 A;  3GZS A;  3VLF A;  5HS0 A;  3CHP A;  4W9R A;  4Y6C A;  4APO A;  5C2Y A;  3KS2 A;  3FEY A;  1X81 A;  2PM7 A;  2FEZ A;  2X6H A;  3C3R A;  4K5B A;  2AXZ A;  3Q9N C;  4YDY A;  4UWK A;  4I1M A;  1K1A A;  5EYP F;  5ARF A;  3CIA A;  3MCX A;  3ZW3 A;  1KZO A;  3MGB A;  4APF A;  3FH8 A;  4JC8 A;  3FUI A;  3Q5M A;  3VTX A;  5FJY A;  2VYI A;  3UIN C;  3TWQ A;  4LG6 A;  4GYO A;  4OYS A;  3LCA A;  3CHQ A;  4UWF A;  4AEZ C;  4A3V A;  2IJG X;  2WB2 A;  1JWG A;  4BX8 A;  2X38 A;  4ANX A;  1OCC E;  4BSX A;  2OND A;  3G2S A;  3T9K A;  4LEU A;  4JZY A;  4DUI A;  1UOH A;  2QZA A;  4TUU A;  4UI9 K;  3L17 A;  2ZU6 B;  4N3A A;  2QC9 A;  3L22 A;  3QWV A;  5KJK A;  3I4R B;  4UI9 C;  3T8K A;  4BES A;  4TXR A;  2GGF A;  5LP0 A;  3PZ2 A;  4BT8 A;  4BWR A;  2KM4 A;  4CGW A;  5HI7 A;  2XPZ A;  2XS1 A;  1YMP A;  2F8Y A;  3D9L A;  4CZ2 D;  4TV3 A;  5ANR A;  1NA0 A;  4LCT A;  2XPY A;  5EIB E;  3E4B A;  1OUV A;  4HOU A;  1V54 E;  3MZL B;  1N0Q A;  3HG0 D;  2LO6 A;  4TRQ A;  4G11 A;  4GMJ A;  3UKU G;  2R05 A;  4XZ4 A;  4HOT A;  3TL5 A;  4Q69 A;  2LSU A;  4Q96 A;  3DEO A;  4RG6 A;  2DVW A;  2VTB B;  3ZEF A;  3MA5 A;  1N4S A;  2P58 C;  5ENQ D;  4EBA A;  1OCR E;  2QY7 A;  2RFM A;  4C0M A;  3KSL A;  3IHY A;  3Q9U C;  3FEX A;  4EQF A;  5JHB A;  1H2V C;  1ZB1 A;  3DRA A;  2YHC A;  2A5E A;  2ILR A;  4GA1 A;  1WY6 A;  4HFG A;  3QJZ A;  2WXG A;  3O4Z A;  4KT6 B;  2I1K A;  4FHJ A;  2DZN A;  4B0Z A;  3LJ3 A;  5BW8 C;  1UG3 A;  3Q49 B;  1Q2Z A;  4G2V A;  2KXP C;  3ZXS A;  4H7Y A;  1INZ A;  3L54 A;  4L1B A;  4KXK B;  4DX5 D;  1NP7 A;  1O1R A;  4GMR A;  1JCS A;  2PZI A;  1U3C A;  4B94 A;  3LY8 A;  1IQR A;  5AAR A;  4EPZ A;  4MRU A;  3L16 A;  2CFU A;  3D9P A;  2DYR E;  2KBX A;  5JJT A;  3U66 A;  3U3W A;  2X6J A;  5ENR D;  2AW6 A;  1N4R A;  5LX8 A;  2PL2 A;  2JEK A;  4B93 B;  1MHQ A;  4P29 A;  5CMY A;  4KMO A;  3KEZ A;  5AN8 A;  4DX1 A;  4FLH A;  2H6H A;  4KVO A;  5BXO A;  4N2S A;  3FHE A;  1SA5 A;  1P5Q A;  4FUL A;  2QYJ A;  5ARG A;  2AJA A;  4ILI A;  2V5F A;  2QFC A;  4U04 A;  2AXU A;  1AP7 A;  2A5U A;  2V8S E;  3UT7 A;  3C98 A;  3J5Q B;  4U7E B;  3PZ4 A;  3L08 A;  5J90 A;  4CT4 A;  4BX9 A;  5AEN A;  3BU8 A;  1KZP A;  3DXK G;  2R02 A;  1B89 A;  3UXG A;  3Q78 A;  2WXN A;  1K3Z D;  2WQ6 A;  5FQ4 A;  2WMN A;  4GZ3 A;  2C0L A;  3FP3 A;  4DX6 D;  4ANU A;  4URK A;  3PZ1 A;  1N11 A;  3VLD A;  4BY6 A;  4I43 A;  1E7V A;  4GU5 A;  1DCQ A;  3R7Q A;  5BV0 A;  5E75 A;  3TGO A;  3FUD A;  4J8D A;  4GTP A;  3PEU B;  1E8Y A;  4HLL A;  1IHG A;  2UY1 B;  4LRZ A;  3W9F A;  1DCE A;  4Y6W A;  4YND A;  5CRV A;  4L7T A;  3JXI A;  2ETA A;  3G2U A;  3DWL G;  3TWW A;  4GTS A;  4I6E A;  3CLJ A;  3MYV A;  4JW1 A;  3S7B A;  1HG5 A;  1Z6T A;  4JHK A;  4WWO A;  3CVX A;  1ZU2 A;  4WUY A;  1DC2 A;  3B7B A;  3NQP A;  4GML A;  1UW4 B;  2H6I A;  4GTV A;  1S0P A;  1FVH A;  3FUL A;  3U9W A;  3OTN A;  5ENP D;  1TJC A;  1ELK A;  4GZC A;  3V31 A;  4E6H A;  3LJN A;  4GCO A;  3NBN B;  5LOZ A;  5J08 A;  3CHM A;  5HQ8 A;  3CVU A;  5EN5 D;  4C9B B;  2GW1 A;  1UN8 A;  2NYJ A;  2YHE A;  3RSE G;  4I17 A;  2EIN E;  5FIO A;  4CCA A;  3D9N A;  4BET A;  1EPU A;  3FDH A;  3FU5 A;  3Q75 A;  1O1S A;  2IF4 A;  4NIK A;  5BPP A;  4U0Z A;  5LCW J;  1TEZ A;  1FVF A;  3PEV B;  4XX5 A;  3FWV A;  3QAQ A;  5EYL A;  3B7U X;  3RJV A;  3QK0 A;  2BKK B;  1OWO A;  3SFY A;  2CG3 A;  2KC7 A;  1LTX A;  3CK8 A;  3KSQ A;  2WXP A;  4YDO A;  4RQI A;  2BF0 X;  4GZ6 A;  1TNZ A;  2XCB A;  3ABK E;  4ANW A;  4U8V D;  4EHM A;  1Z5S C;  4XIF A;  3RKV A;  1HE8 A;  4I1O B;  4PH4 B;  3TWX A;  1U3D A;  3ZIM A;  2L9B A;  4YDW A;  1Z3Y A;  3RAU A;  2YQ8 A;  1FPP A;  3JQ1 A;  5KWD A;  4A3T A;  2YIN A;  4Z68 A;  1IKN D;  1YCS B;  2YNQ A;  3ULY A;  4WWP A;  2M63 A;  1JPL A;  3D9O A;  3FTX A;  3FUE A;  4DK5 A;  4N5Q A;  3AG1 E;  3SHF A;  4GTR A;  3PH0 C;  2ZIS A;  1N94 A;  4N2Q A;  3ESK A;  1KPS B;  1NA3 A;  1H2U A;  4U07 A;  1JWF A;  3O48 A;  4I9C A;  5KJM A;  2VJ8 A;  4UQX A;  2GRR B;  3FU0 A;  2RD0 A;  2EIK E;  5KNG A;  4AJW A;  4FP7 A;  4O1O A;  3S2A A;  3ZKJ A;  3ZVV A;  3FU3 A;  1MJ0 A;  2C0M A;  2Y0B G;  3CVP A;  2CFZ A;  4FJZ A;  3LKU A;  4M3O A;  3PDN A;  3UI2 A;  4JXT A;  3DSV A;  3HYM B;  1D8D A;  2J09 A;  3BEE A;  3FTW A;  1S70 B;  2B6C A;  4FJY A;  4J8F A;  4L23 A;  4FU3 A;  3KD7 A;  4A1G A;  3IKO B;  3ASD A;  2L6J A;  3LY9 A;  2DBA A;  3SQV A;  1BU9 A;  3EHM A;  3ZHE A;  3Q15 A;  5JJ6 A;  3PE4 A;  2HYZ A;  4GYW A;  4G1T A;  1KT1 A;  3EHR A;  5EIL A;  3EHN A;  3PRZ A;  3K9I A;  4PDX A;  3BG0 B;  2Y69 E;  3RU0 A;  3ZYQ A;  1BI7 B;  3DPD A;  1LD7 A;  5HRY A;  5FZS A;  1E7U A;  3I5P A;  5CCM A;  3SFZ A;  3HXD A;  5JA4 D;  3ML9 A;  3PUK A;  1SVX A;  4XKC A;  3QAR A;  2J4D A;  5KJL A;  3B7T A;  1TNB A;  3ASN E;  4YDE A;  4BEP A;  5CBN A;  4OVV A;  4UWH A;  2EQX A;  3CKB A;  3L9T A;  5AAO A;  1EDU A;  3HIZ A;  2I9C A;  4J8Y A;  4L9P A;  5C1D A;  3WXX A;  2J07 A;  3B95 A;  2WXH A;  2OVB A;  3CVV A;  4GTQ A;  3TJP A;  4G25 A;  4ILH B;  2Q7F A;  3CR3 A;  4DJA A;  3S7F A;  4LSZ E;  1NFI E;  2R2L A;  4B89 A;  3SBT B;  4BT9 A;  3CGH A;  3TWT A;  2WXK A;  2LAI A;  3NZU A;  4PS7 A;  3G2W A;  4JB8 P;  3LVR E;  3AG2 E;  3APD A;  1E96 B;  5HKP A;  5AJD A;  5AQ7 A;  4PS3 A;  1IQU A;  1HH8 A;  4KVM A;  1TR4 A;  4ANV A;  3QNK A;  1IXV A;  2DZO A;  2J8S D;  3APF A;  4IUL A;  1RW2 A;  1KLX A;  1MX6 A;  4UQY A;  1QZ2 A;  4I2Z A;  3L13 A;  3UKR G;  2DIW A;  2E2E A;  3HXE A;  2VSO E;  2AVP A;  1QBQ A;  2FUL A;  3Q47 B;  3PUJ A;  2VSY A;  4CEM A;  5EKQ D;  2MOW A;  1L5J A;  4JVS A;  1D9S A;  3FH7 A;  4I2W A;  3P2B A;  4L2L A;  3L82 A;  4NRH B;  2WMO A;  2X6K A;  3NOC D;  1Y8M A;  1A5E A;  4JL0 A;  4JHJ A;  3S7J A;  1HU3 A;  5KBA A;  4HQD A;  5T3R A;  3ZYM A;  3RIB A;  3RRU A;  5LCW C;  3CHS A;  4UQZ A;  3RO2 A;  1H6O A;  3CQC B;  3PNT B;  3HXF A;  1E90 A;  3ABL E;  2BKG A;  2XZD G;  3PE3 A;  4O1P A;  4HOQ A;  3QC1 A;  1UJK A;  3DEP A;  1D8E A;  3LXU X;  1N4Q A;  3J5P A;  4AY6 A;  1KT0 A;  3CST A;  3FU6 A;  4X8Q A;  2CHW A;  2IQC A;  3FTY A;  3ML8 A;  2VTB A;  3CEQ A;  5CCL A;  1HS6 A;  1SA4 A;  2AXV A;  1LD8 A;  4E85 A;  1G3N B;  3FTU A;  3URZ A;  4J8S A;  4HOR A;  3EUV A;  3IEG A;  3JCK C;  4MKT A;  2ION A;  3V2O A;  1UN9 A;  2C2L A;  2DYS E;  3CQG B;  2I6H A;  4EZK A;  4YVO A;  4J7W A;  3AAA C;  4LNB A;  2JLB A;  1A17 A;  1H0A A;  1IHB A;  4HOS A;  1JCR A;  1TN8 A;  3D9J A;  4XEI G;  5CED B;  4FA6 A;  4JPS A;  4ZFH A;  3UM3 A;  1Z3X A;  2WXF A;  4HS2 A;  2OV8 A;  3L6A A;  3CSF A;  3TG4 A;  3CVY A;  2E0I A;  4O6F A; 
#chains in the Genus database with same CATH homology
 4GTP A;  1N9A A;  1NI1 A;  2H6H A;  3HXF A;  3EU5 A;  4L9P A;  3SFX A;  4MBG A;  4LNG A;  1DCE A;  1X81 A;  3SFY A;  3C72 A;  4GTQ A;  1FT1 A;  1LTX A;  1TN6 A;  1S64 A;  3DSX A;  2R2L A;  3PZ3 A;  1SA5 A;  3KSQ A;  4GTS A;  1O5M A;  4YDO A;  2ZIR A;  1D8E A;  3E30 A;  3DSS A;  3E33 A;  1N4Q A;  3DSV A;  1D8D A;  1N95 A;  1TNZ A;  1N4S A;  1KZO A;  3HXC A;  2BED A;  3Q73 A;  1TN7 A;  3KSL A;  4EHM A;  2H6I A;  3Q7F A;  4GTT A;  1TNY A;  1TNO A;  4GTV A;  3E34 A;  3PZ4 A;  4GTO A;  3DRA A;  2IEJ A;  1FT2 A;  1FPP A;  1SA4 A;  1LD8 A;  1KZP A;  3Q7A A;  3EUV A;  3DST A;  3Q78 A;  2F0Y A;  3E32 A;  3HXB A;  3DPY A;  1O1R A;  1JCS A;  1LD7 A;  3HXE A;  3DSW A;  1O1T A;  4LNB A;  4GTR A;  1N4P A;  1QBQ A;  1TNU A;  2H6G A;  3DSU A;  1S63 A;  3PZ1 A;  2ZIS A;  1JCQ A;  3HXD A;  1N94 A;  2H6F A;  1MZC A;  1JCR A;  1TN8 A;  3Q79 A;  3Q75 A;  3E37 A;  1O1S A;  4GTM A;  3PZ2 A;  1NL4 A;  1N4R A;  1TNB A;  4YDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...