4Y6CA

Q17m crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
212
structure length
212
Chain Sequence
b'HMEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANSERINA PUTATIVE KINESIN LIGHT chain
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Unknown function
total genus 89
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6cA00
3MEKA 4GA2A 2UY1B 3KS2A 3RO3A 3Q15A 4N2QA 3LCAA 4GCNA 4CGVA 2PQRA 5EX3A 4NQ0A 4GA1A 5FT9A 2BUGA 3AS8A 3PDNA 4J8DA 1B89A 3EDTB 3TG4A 3U3WA 2R5SA 1NA3A 3URZA 2C0LA 2ONDA 5CCLA 4BT8A 2FBNA 3QDNA 3AS4A 5CHEE 5FZSA 2OOEA 1KT1A 4J8EA 4BTAA 4JA9A 5KJNA 3ASDA 1NA0A 3S7JA 4U0SA 2LSVA 2P58C 3QKYA 3O48A 4G2VA 2QFCA 3RU0A 5BW8C 5HI7A 3NF1A 5C1DA 4UI9K 4H7YA 4N3BA 4RG6A 2VSNA 4HOTA 2VSYA 3LKUA 3AS5A 3Q5MA 4UQXA 2NC9A 1HXIA 3ASGA 2KCVA 3CVNA 4N3CA 3CVPA 5FJYA 4KYOB 2XCBA 3ULQA 3ZFWA 3SZ7A 1IHGA 5BT1A 4I17A 4HORA 2VYIA 3CKBA 4AIFA 4AM9A 5DBKA 5CCMA 2HR2A 2PQNA 4N3AA 1QZ2A 4KXKB 2UY1A 2VGXB 2HO1A 4NRHB 3VTXA 5ARGA 4CGWA 1WAO1 3RO2A 5G04C 3CK8A 3KD7A 1E96B 2WPVA 3ZHEB 4U0UA 3UUXA 3LY8A 5G05C 5HQ8A 4F3VA 4N2SA 5D0QD 1A17A 1IYGA 5G05J 5A7DB 3QWWA 2XEVA 3GYZA 4N39A 2Q7FA 4HOQA 4JL0A 3QWVA 3CKCA 1OUVA 1ZU2A 3QOUA 3MKRA 3RKVA 2KATA 2GW1A 4Y6WA 3PE4A 2XGMA 4BTBA 5EX0A 2HYZA 3FWVA 4UQZA 4AY6A 2KCLA 2I6HA 3R9AB 2XPIA 4G23A 5EKQD 3ASHA 2JLBA 3MV2B 4EQFA 5FTPA 1QQEA 4I1AA 5JJ6A 3GW4A 1PC2A 3CK7A 2LSUA 4GA0A 4UI9C 3UQ3A 4G1TA 3N71A 4J0UA 4YVOA 5M72A 4J8FA 2WQHA 4APOA 5KJMA 2FI7A 2PL2A 5KJLA 2IF4A 3ZN3A 3FFLA 3CV0A 4UI9J 1ZBPA 4A1SA 4CDRA 2DBAA 3QWPA 2VGXA 5JJTA 4H7XA 4YNDA 4WNDA 3ASFA 5A6CA 3IEGA 4N5CA 5LCWC 3TG5A 4G24A 3S7FA 1YA0A 3OXGA 3TGOA 4GYOA 3ZHEA 4JHRA 3S7DA 4GCOA 4LEUA 5LCWJ 3LYAA 2J9QA 3Q47B 3OXFA 4U04A 4GYWA 1FCHA 1WM5A 4ME2A 3GZ1A 5G04J 3ZGQA 3CVLA 4O6FA 2LNIA 3MV3B 4XIFA 3ZPJA 1P5QA 4GYYA 3ESKA 5BNWA 4BWRA 2VGYA 4HOSA 2YHCA 2E2EA 2FO7A 4G25A 3E4BA 4GZ6A 4I9CA 3K9IA 3MA5A 4JA7A 3OXLA 1Y8MA 4XI9A 4I2ZA 1W3BA 5JJ7A 3LY9A 5ARFA 3UPVA 2AVPA 4GPKA 1HZ4A 2XGSA 4ABNA 1ELWA 3HYMB 2KC7A 4GZ3A 3GZ2A 5D0OD 4AY5A 2Y4TA 3JYSA 4WNGA 3FP3A 2FF4A 4U0ZA 2MHKA 5FZRA 4WUYA 1XNFA 1KT0A 3WXXA 4U07A 1ELRA 5AYWD 4HOUA 3KAEA 3VTYA 3LPZA 4G26A 2XCCA 3RJVA 2XGOA 3U4TA 3CVQA 2FEZA 4XI0A 5KJKA 3LY7A 5DIZA 4I2WA 4WNFA 3CEQA 1KLXA 2IFUA 3RIBA 2C2LA 3PE3A 1HH8A 4GZ5A 1NZNA 2KCKA 4W9RA 2L6JA 4RG9A 2Y4UA 2V5FA 3BEEA 4KBQA 4YVQC 4I9EA 5FZQA 4B94A 2PZIA 3TAXA 2VQ2A 3Q49B 3CK9A 2C0MA 3SF4A 1TJCA 3Q4AB 4WNEA 4UQYA 4IN3B 4Y6CA 2UWJG 4BT9A 2YQ8A 3S7BA
chains in the Genus database with same CATH superfamily
3MEKA 3RO3A 4N2QA 2VTBA 1HG5A 4LG6A 4CGVA 3BU8A 2M63A 5T3RA 3EIQC 1UJKA 5FT9A 3UX4A 1ELKA 3TXMA 4J8DA 4FP7A 1B89A 3EHRA 3NQPA 3EDTB 3TWSA 3TG4A 1DNPA 3BG1B 3SO8A 3EU5A 3OAWA 2ONDA 4F53A 5CCLA 1N4SA 5CHEE 5FZSA 1KT1A 3DEPA 4LCTA 4JA9A 1WY6A 4EZLA 2LSVA 3O48A 4G2VA 3T5VA 4K5BA 1EYHA 2VSOE 3C3RA 4B0ZA 3IKOB 1HE8A 5C1DA 2WXIA 3L17A 3FUFA 1H6PA 4RG6A 2VSNA 3LKUA 3AS5A 3EHNA 4MBGA 3FTWA 4JHKA 3T8KA 3CVNA 3FUMA 4N3CA 1YMPA 1Z6TA 4BEPA 5AIJA 3T8MA 4ACLA 4RSYA 1IHGA 5KBAA 2XS8A 1UG3A 4ATZD 2I9CA 3DWLG 1N95A 2VYIA 4AIFA 4G11A 5DBKA 1HU3A 3PZ4A 4FHJA 3HHMA 1AWCB 2R02A 3L08A 3D9MA 2UY1A 2EIKE 3FU3A 4A3TA 3PUJA 2DIWA 4BESA 3ABME 5ARGA 4EZKA 1QBQA 2WVIA 3CK8A 2WPVA 2BF0X 5HQ8A 3ULEG 4YDOA 1H2VC 5E75A 2BEDA 3CIAA 4LNUD 4X8QA 1H2UA 4HXIA 4K03A 3QWWA 3E33A 4HB5A 1TNYA 1BPOA 1IXVA 4ANVA 3GYZA 2Q7FA 3U64A 2XHEA 4BSZB 3L9TA 4TUUA 1OCCE 4PS7A 3ONLA 3QC1A 3TWVA 3NOCD 3QOUA 3APFA 2J4BA 2KATA 2GW1A 4DLOA 1UOHA 3R7QA 4NURA 3PE4A 2RFAA 4BTBA 4HLLA 2A5EA 3FWVA 3DXMG 3FU6A 1SA5A 2XZDG 4L1BA 5EKQD 3LEWA 2F37A 2JABA 3DBSA 3MV2B 4DX6D 1S70B 4DRXE 3FUEA 1HF8A 3I4RB 4GA0A 4JEHA 2RD0A 3LS8A 3SD5A 4J0UA 1HS6A 4FADA 4U8VD 5AQ7A 5KJMA 2IJGX 2H6GA 2VGEA 3ZN3A 3E32A 3FFLA 1X81A 3EUVA 4UI9J 3D9KA 4AXHA 1ZBPA 4TV3A 1HFAA 5AENA 4WNDA 5CBNA 5A6CA 2V4HC 1O1RA 1JCQA 3L16A 3SFXA 3AG3E 2ILRA 4G24A 2XRYA 3TGOA 1K3ZD 1G3NB 4JHRA 1V54E 2R17C 3FTUA 4BX8A 4GCOA 3KEAA 3TWQA 4LEUA 2WMOA 3ASNE 4BSXA 3Q47B 2LAHA 1ZB1A 1JCRA 4ME2A 3ZIMA 2A5UA 4UWLA 3O4ZA 3V31A 2RG8A 2YINA 3TJPA 3ESKA 2BKKB 3MGBA 1NP7A 4UUCA 3K9IA 1U2VG 3MA5A 4JA7A 3OXLA 3D3MA 5D2MC 4I2ZA 4B93B 4EPZA 1AP7A 4K5AB 4BX9A 3JUEA 3B7SA 1N52A 4QQIA 2KC7A 3EU9A 4MRUA 3MZLB 4MLPA 2CHZA 3Q78A 5AARA 5AAOA 1EF1C 3TWTA 2MHKA 1UN8A 1KZPA 1XNFA 1OWPA 1XGWA 1JPLA 4U07A 1ELRA 4HOUA 4G26A 3SFYA 3NZSA 3FTXA 3ENEA 1SZAA 4A63B 3IBEA 4EHMA 2GRPB 4WNFA 2YHEA 3P2BA 1OWNA 5CEAA 3RIBA 2C2LA 4ILHB 3PE3A 1HH8A 1MHQA 4KZCA 3HVEB 4LNBA 4FLHA 3JQ1A 2GRLA 4DPRA 2DYSE 2L6JA 4UWKA 3JCKC 1Y6IA 1Q2ZA 3UINC 4WWNA 1HG2A 3PRZA 3ULYA 3DRAA 3AG2E 4GZCA 4DI4A 5FQ8A 3E34A 3ZKJA 2J4DA 1BU9A 1TJCA 2XQ0A 3FTZA 3DSWA 4WNEA 3UIPC 4Y6CA 3UT4A 1BI8B 2EQXA 1TR4A 4JC8A 3KS2A 3Q15A 2OEVA 4GCNA 3JQ0A 4LRZA 4NQ0A 2CG2A 5ITZF 4BETA 1QYMA 3UXGA 4HQDA 3W9GA 3PDNA 3LVRE 5BXOA 2PNNA 3EHMA 1NA3A 5ENTD 3URZA 2CFUA 4BT8A 2FBNA 3QDNA 3AS4A 3CVWA 3I4GA 1FPPA 2P9SG 1NA0A 4C0EA 3FDHA 3NZUA 4U0SA 3C3OA 2P58C 3QAQA 3B7BA 4I1OB 2DYRE 3PVLA 3NF1A 4TUMA 3L13A 3PEUB 4B8CB 2WMNA 3ZXSA 2R59A 3ASGA 5CEDB 2H6IA 5JHAA 5BXUA 2KZTB 2YNQA 1BLXB 2BKGA 4BERA 3FUDA 3OTNA 3ZFWA 3SZ7A 1Z5SC 2P9NG 4V3IA 4HORA 4DX7D 3CHOA 1HX8A 3D9IA 3CKBA 3ZRHA 4L23A 2PQNA 1QZ2A 3R7RA 4NACA 2X6JA 4E6HA 1MJ0A 2WM9A 2BTDA 3RK6A 3VTXA 4CGWA 5EIDA 1VDYA 1D9SA 3FHEA 3ZHEB 4U0UA 2NYJA 4HI9A 3LY8A 4PDXA 3UUXA 3WG7E 3BG0B 3BUAA 3FU0A 3JUIA 4I6GA 4N5QA 1TNOA 2KXPC 2WXFA 1Z3XA 3B7TA 4N2SA 4GTOA 5D0QD 3CHRA 4GTTA 5G05J 4U96D 2X3MA 5B1BE 4A1GA 2QYUA 2OV8A 4C0MA 4CDNA 4N39A 4HVBA 3ZYLA 4PS8A 4Q96A 1OUVA 4AEZC 5J90A 2ETCA 1D8EA 1N54A 4F1PA 2WXGA 3MKRA 4CT0A 3LJNA 3PNLB 2ETAA 3NB2A 2Y3AA 3T5XA 3MKQA 4BY6A 4XEIG 2V4LA 5CRVA 2KCLA 3DPYA 3R9AB 3ZVVA 3ZUVB 2IOSA 1QQEA 1OWLA 1PC2A 2XENA 2LSUA 5IY5E 4UI9C 1K1BA 1OCZE 4OVUA 3VLFA 3U9WA 5T4YA 2WQHA 2FI7A 2PL2A 5KJLA 2Y69E 4YDYA 3CV0A 1UW4B 2IY0C 5H7PA 3CVYA 3QWPA 2VGXA 2I2OA 3UM0A 5HRYA 5FQ6A 2A4ZA 4N5CA 2P9KG 1YA0A 4J6IA 5FQ4A 5D66A 2NXPA 4JHJA 5G2NA 3MX3A 4L7TA 2B6CA 5KNGA 5LCWJ 3LYAA 5J08A 4IULA 4U04A 1FVHA 4GYWA 3RRNB 4WWOA 4DUIA 4F7AA 1FCHA 2J08A 2LXMA 2WXHA 2PM6A 4RVBA 3AU5A 3UT8A 5CERB 3CVLA 3R9MA 2F8YA 5LFAA 2LXLA 2LNIA 3Q73A 4XIFA 2I1KA 3ZEFA 2IONA 3TWWA 2VGYA 4BWRA 2X6IA 3NBNB 4GTSA 4HOSA 2XPYA 2FO7A 4U7EB 4FJYA 3Q79A 4XE0A 3UM2A 3KEZA 2J8SD 2XZTG 3UMVA 1PY1A 4U8YD 3L22A 1Y8MA 1TN6A 5JJ7A 1K1AA 3C98A 4ANUA 3UPVA 3L54A 1S63A 2VTBB 4EZJA 1HZ4A 4GPKA 1N11A 4ABNA 3QK0A 1ELWA 5BPPA 1LTXA 5D0OD 2QC9A 1OY3D 4WNGA 3FP3A 4GPMA 5KCMA 5ENPD 2FF4A 3HXDA 4GMLA 3TWUA 4Q69A 1EDUA 4OAUC 4WUYA 1L5JA 2LUHA 3IV0A 3ML8A 3CVXA 3B13A 3L82A 2XGOA 4XX5A 3HXCA 3U4TA 1OXJA 2J49A 2WXMA 1MQSA 3CVQA 2FEZA 5C2YA 2IQCA 3CGHA 4HRLA 3PZ3A 1RW2A 5DIZA 3CEQA 2QY7A 1KLXA 2IFUA 3FU5A 1E8XA 4F1SA 2AXVA 3UKUG 5LX8A 3IHVA 4TXQA 2CG3A 4O60A 2XPZA 1DCQA 2KCKA 1NZNA 2V5QC 3D9JA 3SBSA 4W9RA 1O5MA 3AU4A 5CRUA 4RG9A 2Y4UA 1JWGA 4JVSA 4YVQC 3E37A 4YDEA 5FZQA 3PNTB 2PZIA 2MRIA 3QB2A 3AG4E 2VJ8A 3Q49B 3UM3A 3PH0C 4MS6A 3T9KA 2IO2C 3FEXA 2C0MA 2EINE 3SF4A 3TXNA 3Q4AB 4C9BB 2H6FA 4AV7A 4IN3B 3RAUA 2GGFA 3IXEA 2JEKA 2UWJG 3S7BA 3C5RA 3HXBA 4GA2A 2UY1B 3LJ3A 3LCAA 5EX3A 3FY4A 3FUJA 3Q7FA 4GA1A 1H2TC 3CSTA 3LDZA 1INZA 2IEJA 3CVVA 1PAQA 2R5SA 1BI7B 2CFZA 3UTMA 4AOFA 2C0LA 4Q94A 5G55A 1WDYA 2XEHA 2OOEA 4DI3A 4J8EA 2WXQA 4BTAA 3X2QE 5EN5D 1E90A 3QKYA 3ZYQA 2QFCA 3RU0A 5HI7A 2DVWA 3ASOE 3ISMC 4UI9K 4H7YA 4N3BA 3G2VA 4HOTA 3EJNA 5EIBE 5E76A 3CR3A 1TN7A 3Q5MA 1MZCA 3FUNA 1HXIA 1S0PA 1FT1A 2KCVA 4ILIA 2GRQB 4R7LA 3CVPA 3V30A 4JD2G 3RRUA 4ANWA 3VLEA 4UWFA 5BT1A 3HIZA 4DLQA 2R05A 4AM9A 2LAIA 2HR2A 4KXKB 2VSXE 1V55E 1N4QA 4GZDA 2HO1A 4NRHB 1JWFA 3FEYA 1JUQA 1WAO1 3ONKA 5G04C 1OCRE 4IYPA 4G8LA 4UWHA 2ZGGA 3QJZA 4U63A 4LSZE 5G05C 2KBXA 2R2LA 3U66A 4EECA 3DXKG 1A17A 4ZHBA 3APCA 3ABLE 1D8DA 4XZ4A 1TYQG 3S2AA 3DSUA 3MJWA 4M3OA 4YDWA 3CLJA 1U3DA 5HKPA 3CKCA 3FH8A 4PH4B 1MX6A 1E8YA 4Y6WA 3SFZA 2XGMA 5EX0A 2WB2A 3MCXA 2X6HA 2AW6A 3AG1E 4AY6A 1OWOA 2I6HA 3AJIA 4G23A 1E8ZA 3ASHA 4EQFA 3ML9A 1E7UA 2DZOA 2HE0A 3CHQA 5JJ6A 1OWMA 4CEMA 1HO8A 2EILE 4FJZA 4G8KA 5M72A 4J8FA 4APOA 4TRQA 4GTVA 1N94A 3Q75A 2IF4A 4CT4A 4CYMD 4K0RA 3UIOC 5ANLA 2GRRB 2GRMA 4A1SA 5JJTA 3GZSA 4H7XA 4HNAD 3D9LA 1GW6A 5AQAA 3ASFA 3HRAA 4UWGA 2WXOA 3IEGA 4J7WA 5LCWC 3D9HA 2WXKA 3S7FA 3OXGA 2DWZA 4GYOA 3B7UX 3S7DA 2OVFA 3I5PA 5EYPF 5BUZA 5BV0A 3CSFA 2GRNB 2J9QA 4APFA 3HXFA 3W9FA 4JW1A 5FWQA 2WXPA 2L0TB 1N4RA 3C3QA 3QARA 5G04J 5BV1A 4FLBA 4JB8P 4O6FA 4LNGA 3SY2A 4GMJA 1P5QA 3Q7AA 4OVVA 2XRZA 5BNWA 1UJJA 4G25A 3KSQA 3ABKE 4I9CA 4XI9A 3SQVA 1W3BA 2KM4A 5FIOA 1H6KA 3LY9A 2P9IG 4DX1A 1IQUA 3SI5A 2AXUA 2OCCE 4M7CA 4HRMB 5ENQD 3LXUX 3NOGD 3LVQE 4QFVA 4A3VA 1SQMA 3E30A 2X6KA 3GZ2A 2Y4TA 3JYSA 1KZOA 4JXTA 4JZYA 1IKND 4GMRA 2IO3C 1BD8A 5FZRA 3FH5A 5JHBA 5AYWD 3KAEA 4FA6A 3PS6A 3VTYA 4GTPA 2ZXWE 2ETBA 2XCCA 5ENRD 3CHPA 2QZAA 2ZIRA 5CBOA 5ENSD 3TWRA 3J5PA 2RKKA 3G2UA 1N9AA 4NIKA 1N4PA 3V79K 3PZDA 4I1MA 1E7VA 1SZ9A 2Y0BG 2AWIA 2L0IA 1N0RA 3ZU7B 2J07A 2WXNA 5B1AE 4KZ0A 4GZ5A 1FVFA 4FULA 3FUHA 3D9NA 1LD8A 1SVXA 4HFGA 4XKCA 2WQ6A 2V5FA 3BEEA 4KBQA 5EDSA 4A55A 4ILGA 4WWPA 2X6FA 3DSTA 3TAXA 2VQ2A 4O1PA 4L9PA 2F8XK 3BQOA 3PEVB 4HRNA 3UT7A 3CQGB 1IQRA 1DCEA 2NSZA 5EYLA 2YQ8A 3HDXA 2MYOA 2P2CP 4LUNU 4I6JA 2PQRA 3PZ2A 5ENOD 3L6AA 3SNXA 4ZFHA 2BUGA 3RSEG 3AS8A 4E85A 2IU1A 4PUCA 2V0PA 2WQ7A 3HG0D 3U3WA 3VLDA 2ZISA 2CHWA 5T8IA 3Q9NC 5KJNA 3ASDA 3S7JA 4HI8A 2CHXA 4B89A 5AN8A 5AJDA 4FC8A 5BW8C 5FQ7A 3Q9UC 2QYJA 1H19A 4HBDA 2FULA 2AXZA 2VSYA 5JMND 2EIME 3FULA 3HVEA 4AJWA 2EIJE 2ZU6B 3D9OA 4UQXA 5AQ9A 2NC9A 2R03A 3MKQB 4XKBA 1MYOA 2Y1LE 2HM8A 3ZXPA 2E0IA 2DZNA 3ZYMA 5FJYA 3B95A 4KYOB 2XCBA 2I1JA 1S64A 3ULQA 2IOLA 5KNHD 4MKTA 3TWXA 3V2OA 4ANXA 1TEZA 2FO1E 5FINA 4I17A 5CCMA 2GROB 2P9LG 3DPDA 4N3AA 1MX2A 4FHKA 3D9PA 3HXEA 2VGXB 1Z3YA 2WXJA 3F6QA 1NI1A 3CHMA 3QNKA 3RO2A 4AP2A 4URKA 2X38A 3KD7A 1E96B 4B8AA 1NFIE 4J8SA 2P9UG 2LO6A 1FT2A 4F3VA 4KMOA 3UI2A 4I6EA 2PM7A 1WG0A 4DX5D 1IYGA 4K5CA 3CHSA 1KPSB 4KT6B 1N0QA 5A7DB 4RLYA 1SA4A 2L6BA 2XEEA 2XEVA 3FTVA 3ESLA 3I3NA 4HOQA 4JL0A 3AAAC 5ENNA 3QWVA 2J09A 1EPUA 1ZU2A 5CMWA 3UM1A 4FU3A 3RKVA 5LOZA 3IHYA 3NAWA 4CCAA 2HYZA 4UQZA 2B0OE 1IHBA 2KZTA 5CMYA 3B7RL 3G2TA 2ZGDA 2XPIA 1A5EA 2JLBA 5FTPA 4EBAG 1OCOE 4I1AA 5HS0A 1E8WA 3GW4A 1TNUA 3CK7A 1UN9A 3ZYKA 3UQ3A 4G1TA 3N71A 4TXPA 4CRWA 4YVOA 4KVMA 3J5QB 5LP0A 3KSLA 4PS3A 1TJFA 4KVOA 4DK5A 3G2SA 1OT8A 4CDRA 2DBAA 4P29A 5ANRA 1K8KG 4YNDA 4JPSA 3ZNGA 3FUIA 1TNBA 4GAAA 3TG5A 4U95D 2WXLA 4IRUA 3DSXA 4J8YA 3ZHEA 4CDMA 4F6RD 1NL4A 3JXJA 1LF8A 1SW6A 3P1UA 3OXFA 4L2YA 3ZW3A 2P9PG 3JXIA 1WM5A 5EILA 4Z68A 2DCPA 1TNZA 3GZ1A 1H0AA 4DJAA 3ZGQA 3DEOA 4GTRA 3MV3B 3ZPJA 4GYYA 3PREA 5AJLA 3SGHA 2YHCA 4GU5A 2OVBA 2E2EA 3E4BA 4GZ6A 4I43A 2AJAA 4RQIA 3FTYA 3RRMB 5ARFA 3TL5A 2AVPA 4L2LA 2H6HA 4WAFA 2XGSA 2F0YA 3EIJA 3CQCB 3FH7A 3HYMB 5JA4D 4GZ3A 4AY5A 4JEUA 3CVUA 5KWDA 4U0ZA 4DX2A 1KT0A 4BFRA 3WXXA 3FUKA 4LERA 3V2XA 5B3SE 4O1OA 3LPZA 1JCSA 3SBTB 3DSSA 4HLEA 1O1SA 2L9BA 3RJVA 5A23A 1O1TA 4XI0A 4AVXA 1QNFA 5KJKA 4ACKA 4ATGA 4GTQA 3LY7A 3UKRG 4I2WA 1RZ4A 3PUKA 3APDA 2XS1A 2RFMA 3EHQA 3MYVA 1TN8A 3PZ1A 2V8SE 2MOWA 4C48B 3C72A 3FTSA 4GTMA 2OEWA 4I9EA 1YYHA 3DSVA 4CZ2D 4B94A 3SHFA 5AQBA 1X5BA 1MX4A 1DC2A 1H6OA 3CK9A 4HS2A 4GB9A 1DVPA 2WXRA 5CECB 1YCSB 4TXRA 4OYSA 1U3CA 4D10C 4UQYA 4BT9A 4EBAA 3G2WA 4U8HA 4OAVB 1LD7A
chains in the Genus database with same CATH topology
3MEKA 4GA2A 4JC8A 2UY1B 4LUNU 3KS2A 3RO3A 3LJ3A 3Q15A 4N2QA 2VTBA 1HG5A 4I6JA 3LCAA 4GCNA 4CGVA 3JQ0A 4LRZA 2PQRA 5EX3A 3FY4A 2M63A 3FUJA 4NQ0A 5T3RA 2CG2A 4GA1A 3EIQC 3L6AA 1UJKA 3SNXA 5FT9A 2BUGA 3AS8A 4E85A 3UX4A 1ELKA 1H2TC 3PDNA 3TXMA 4J8DA 3CSTA 2IU1A 3LVRE 3LDZA 1B89A 4FP7A 4PUCA 1INZA 3NQPA 3EDTB 3CVVA 2V0PA 2WQ7A 3TG4A 1DNPA 3BG1B 3EHMA 3U3WA 1PAQA 2R5SA 1NA3A 2CFZA 4AOFA 3URZA 3OAWA 2C0LA 2CFUA 2ONDA 4Q94A 4F53A 5G55A 5CCLA 4BT8A 2FBNA 3QDNA 3AS4A 3CVWA 3I4GA 3VLDA 5CHEE 5FZSA 2OOEA 4DI3A 1KT1A 4J8EA 2CHWA 2WXQA 4LCTA 5T8IA 4BTAA 4JA9A 1WY6A 5KJNA 3ASDA 1NA0A 4C0EA 3S7JA 1E90A 2CHXA 3FDHA 3NZUA 4U0SA 2LSVA 4EZLA 2P58C 3QKYA 3O48A 4G2VA 4B89A 3T5VA 3QAQA 3ZYQA 1EYHA 4I1OB 2QFCA 5AJDA 4FC8A 2VSOE 3RU0A 5BW8C 5HI7A 4B0ZA 3IKOB 5FQ7A 3PVLA 3NF1A 1HE8A 5C1DA 2WXIA 3L13A 3L17A 4UI9K 4H7YA 1H19A 3G2VA 3FUFA 4N3BA 4RG6A 2VSNA 2FULA 4HOTA 2AXZA 2VSYA 3EJNA 3PEUB 4B8CB 2WMNA 3LKUA 3AS5A 3FULA 3HVEA 5E76A 3CR3A 4AJWA 3EHNA 2ZU6B 3ZXSA 3D9OA 3Q5MA 2R59A 3FUNA 4UQXA 3FTWA 4JHKA 2NC9A 1HXIA 1S0PA 3MKQB 4XKBA 3ASGA 2KCVA 3CVNA 3FUMA 4N3CA 2HM8A 4ILIA 5JHAA 2KZTB 1Z6TA 2E0IA 2YNQA 4R7LA 3CVPA 3ZYMA 5FJYA 5AIJA 3T8MA 4ACLA 4KYOB 3FUDA 2XCBA 2I1JA 3OTNA 3ULQA 2IOLA 3RRUA 3ZFWA 4RSYA 3SZ7A 1IHGA 4MKTA 4ANWA 3VLEA 1UG3A 4V3IA 4UWFA 4ANXA 2I9CA 1TEZA 5BT1A 4I17A 4HORA 3CHOA 3HIZA 1HX8A 3D9IA 2VYIA 3CKBA 4AIFA 3ZRHA 4AM9A 4G11A 5DBKA 4DLQA 5CCMA 4L23A 2LAIA 2HR2A 2PQNA 3DPDA 1HU3A 4N3AA 1QZ2A 4FHKA 3R7RA 4NACA 2X6JA 4FHJA 4E6HA 3D9PA 3HHMA 4KXKB 2VSXE 3L08A 2WM9A 3D9MA 2UY1A 2VGXB 2BTDA 3FU3A 4A3TA 3PUJA 1Z3YA 3RK6A 2DIWA 4GZDA 2HO1A 4NRHB 2WXJA 1JWFA 3VTXA 5ARGA 4CGWA 4EZKA 3CHMA 1JUQA 1VDYA 1WAO1 3FEYA 3ONKA 3QNKA 3RO2A 5G04C 3FHEA 4AP2A 4URKA 4IYPA 2X38A 2WVIA 3CK8A 3KD7A 1E96B 2WPVA 4UWHA 3ZHEB 4U0UA 4B8AA 3UUXA 3LY8A 4PDXA 4J8SA 2BF0X 3QJZA 3BG0B 3FU0A 3JUIA 4U63A 2LO6A 5G05C 5HQ8A 4I6GA 4F3VA 3U66A 1H2VC 4KMOA 5E75A 2WXFA 3CIAA 4I6EA 1Z3XA 3B7TA 4EECA 4N2SA 2PM7A 5D0QD 1A17A 1H2UA 3CHRA 1IYGA 3CHSA 4HXIA 5G05J 4K03A 3APCA 4KT6B 5A7DB 2X3MA 3QWWA 4A1GA 2OV8A 4C0MA 1BPOA 2XEVA 4ANVA 3FTVA 4CDNA 3GYZA 3ESLA 4N39A 2Q7FA 4HVBA 3U64A 4XZ4A 3S2AA 2XHEA 3ZYLA 3I3NA 4HOQA 3MJWA 4M3OA 4PS8A 4JL0A 3CLJA 1U3DA 4Q96A 3QWVA 5ENNA 3CKCA 4TUUA 2J09A 4PS7A 1EPUA 1OUVA 4AEZC 5J90A 1ZU2A 3FH8A 3ONLA 3QC1A 4PH4B 5CMWA 3QOUA 1N54A 4FU3A 3APFA 1E8YA 2J4BA 2WXGA 3MKRA 3RKVA 2KATA 4CT0A 2GW1A 4DLOA 3PNLB 5LOZA 3R7QA 4Y6WA 3IHYA 3SFZA 4NURA 4CCAA 3PE4A 2XGMA 4BTBA 2Y3AA 5EX0A 2HYZA 3T5XA 3MKQA 4BY6A 2WB2A 3MCXA 3FWVA 4UQZA 2V4LA 2X6HA 2AW6A 4AY6A 2KCLA 2KZTA 5CMYA 1OWOA 3FU6A 3B7RL 3G2TA 2I6HA 3R9AB 2XPIA 4G23A 4L1BA 3ZVVA 1E8ZA 5EKQD 3LEWA 3ASHA 2JLBA 3DBSA 3MV2B 4EQFA 5FTPA 2IOSA 4EBAG 3ML9A 1QQEA 1E7UA 4I1AA 1E8WA 1OWLA 3FUEA 3CHQA 5JJ6A 3GW4A 1OWMA 1PC2A 4CEMA 1HO8A 3CK7A 1UN9A 1HF8A 2LSUA 3ZYKA 3I4RB 4GA0A 4JEHA 4FJZA 4UI9C 3UQ3A 2RD0A 3LS8A 4G1TA 3N71A 4OVUA 3SD5A 3VLFA 4CRWA 3U9WA 4J0UA 1HS6A 5T4YA 4YVOA 5M72A 4FADA 4J8FA 2WQHA 4KVMA 4APOA 5KJMA 4TRQA 2IJGX 2FI7A 2PL2A 5KJLA 2IF4A 3ZN3A 4CT4A 5LP0A 3FFLA 4PS3A 1TJFA 4KVOA 4DK5A 3G2SA 3CV0A 4UI9J 1UW4B 4K0RA 3D9KA 5ANLA 4AXHA 2GRMA 1ZBPA 4A1SA 4TV3A 4CDRA 1HFAA 2DBAA 4P29A 5ANRA 3QWPA 2VGXA 5AENA 5JJTA 3CVYA 3GZSA 4H7XA 4YNDA 3D9LA 1GW6A 2I2OA 4JPSA 4WNDA 3ASFA 5A6CA 5FQ6A 2WXOA 3FUIA 4GAAA 4UWGA 2A4ZA 3IEGA 4N5CA 5LCWC 3TG5A 3L16A 2ILRA 2WXLA 2WXKA 4G24A 1YA0A 2XRYA 3S7FA 4J6IA 5FQ4A 3OXGA 4IRUA 3TGOA 2NXPA 4GYOA 4JHJA 3ZHEA 4JHRA 4CDMA 3B7UX 5G2NA 3MX3A 3S7DA 2R17C 3FTUA 4BX8A 4L7TA 4GCOA 4LEUA 5LCWJ 1LF8A 3LYAA 2OVFA 3I5PA 2WMOA 5BUZA 4BSXA 5BV0A 3CSFA 5J08A 3P1UA 2J9QA 3Q47B 4IULA 3OXFA 4APFA 4U04A 1FVHA 2LAHA 4L2YA 4GYWA 4JW1A 5FWQA 3ZW3A 3RRNB 4WWOA 2WXPA 2L0TB 4F7AA 1FCHA 2J08A 1WM5A 2DCPA 2WXHA 2PM6A 4ME2A 4RVBA 3ZIMA 2A5UA 4UWLA 3O4ZA 3GZ1A 3QARA 1H0AA 5G04J 4DJAA 3AU5A 4FLBA 3UT8A 3CVLA 3ZGQA 5BV1A 2RG8A 2YINA 5LFAA 4O6FA 3TJPA 2LNIA 4GMJA 3MV3B 4XIFA 2I1KA 3ZEFA 1P5QA 3ZPJA 2IONA 4GYYA 3PREA 4OVVA 3ESKA 5AJLA 3SGHA 5BNWA 4BWRA 2VGYA 2XRZA 2X6IA 3MGBA 4HOSA 2YHCA 1NP7A 1UJJA 2OVBA 2XPYA 4GU5A 2E2EA 2FO7A 4G25A 3E4BA 4FJYA 4GZ6A 4I43A 4XE0A 4I9CA 3KEZA 3K9IA 3MA5A 3UMVA 1PY1A 4JA7A 3OXLA 3D3MA 3L22A 1Y8MA 4XI9A 4I2ZA 1W3BA 5JJ7A 2KM4A 1H6KA 3LY9A 3C98A 3FTYA 3RRMB 4ANUA 4EPZA 5ARFA 3TL5A 3UPVA 3L54A 1IQUA 3SI5A 2AXUA 2AVPA 4L2LA 4BX9A 1HZ4A 4EZJA 2VTBB 4GPKA 4WAFA 2XGSA 3LXUX 3B7SA 1N52A 3LVQE 4QFVA 3EIJA 3CQCB 4ABNA 3FH7A 3QK0A 1ELWA 3HYMB 2KC7A 1SQMA 4A3VA 5BPPA 2X6KA 4GZ3A 3GZ2A 5D0OD 4MRUA 4AY5A 2Y4TA 3JYSA 3MZLB 4MLPA 4WNGA 2CHZA 3FP3A 4JXTA 5KCMA 4JZYA 2FF4A 4JEUA 3CVUA 4GMLA 1EF1C 4U0ZA 2MHKA 4Q69A 1EDUA 1UN8A 5FZRA 4WUYA 1L5JA 1KT0A 1OWPA 1XNFA 3FH5A 3WXXA 3FUKA 4LERA 1XGWA 4BFRA 1JPLA 4U07A 5JHBA 1ELRA 3IV0A 4HOUA 5AYWD 3KAEA 4FA6A 3PS6A 3VTYA 3LPZA 3ML8A 3CVXA 3SBTB 4HLEA 4G26A 2XCCA 2L9BA 3B13A 3RJVA 2XGOA 4XX5A 3CHPA 5A23A 3NZSA 3U4TA 2J49A 3FTXA 2WXMA 1MQSA 3CVQA 2FEZA 4XI0A 4AVXA 1QNFA 5KJKA 5C2YA 4ACKA 3ENEA 1SZAA 3G2UA 4ATGA 2IQCA 3CGHA 3LY7A 3IBEA 3PZDA 4I1MA 5DIZA 4I2WA 3PUKA 1E7VA 1SZ9A 4WNFA 2AWIA 2YHEA 3APDA 2L0IA 3CEQA 2QY7A 3P2BA 1OWNA 1KLXA 2IFUA 3FU5A 3MYVA 2J07A 1E8XA 2C2LA 3RIBA 4F1SA 2WXNA 4ILHB 2AXVA 2V8SE 3PE3A 4KZ0A 1HH8A 4GZ5A 1MHQA 4KZCA 1FVFA 3HVEB 3IHVA 5LX8A 2CG3A 2MOWA 4FULA 2XPZA 3FUHA 3D9NA 1NZNA 2KCKA 4FLHA 3JQ1A 2GRLA 3D9JA 3SBSA 4HFGA 4W9RA 4DPRA 3AU4A 2L6JA 4UWKA 3JCKC 4RG9A 4XKCA 1Y6IA 2Y4UA 2WQ6A 1JWGA 2V5FA 3BEEA 4KBQA 5EDSA 4JVSA 4YVQC 3FTSA 4I9EA 4WWNA 1HG2A 3PRZA 5FZQA 4A55A 4ILGA 4WWPA 3PNTB 4B94A 2PZIA 2MRIA 3QB2A 4GZCA 3SHFA 2X6FA 3TAXA 4DI4A 1X5BA 2VQ2A 2VJ8A 3Q49B 3PH0C 4MS6A 5FQ8A 3CK9A 2J4DA 4HS2A 3FEXA 4GB9A 2C0MA 1DVPA 2WXRA 3SF4A 3PEVB 1TJCA 2XQ0A 3FTZA 3TXNA 3Q4AB 4C9BB 3UT7A 4WNEA 3CQGB 4OYSA 1U3CA 4D10C 4AV7A 4UQYA 1IQRA 4IN3B 4Y6CA 2GGFA 3UT4A 2JEKA 2UWJG 2NSZA 4BT9A 3G2WA 4EBAA 4U8HA 2EQXA 2YQ8A 3S7BA 3HDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEK A;  4GA2 A;  2UY1 B;  3KS2 A;  3RO3 A;  3Q15 A;  4N2Q A;  3LCA A;  4GCN A;  4CGV A;  2PQR A;  5EX3 A;  4NQ0 A;  4GA1 A;  5FT9 A;  2BUG A;  3AS8 A;  3PDN A;  4J8D A;  1B89 A;  3EDT B;  3TG4 A;  3U3W A;  2R5S A;  1NA3 A;  3URZ A;  2C0L A;  2OND A;  5CCL A;  4BT8 A;  2FBN A;  3QDN A;  3AS4 A;  5CHE E;  5FZS A;  2OOE A;  1KT1 A;  4J8E A;  4BTA A;  4JA9 A;  5KJN A;  3ASD A;  1NA0 A;  3S7J A;  4U0S A;  2LSV A;  2P58 C;  3QKY A;  3O48 A;  4G2V A;  2QFC A;  3RU0 A;  5BW8 C;  5HI7 A;  3NF1 A;  5C1D A;  4UI9 K;  4H7Y A;  4N3B A;  4RG6 A;  2VSN A;  4HOT A;  2VSY A;  3LKU A;  3AS5 A;  3Q5M A;  4UQX A;  2NC9 A;  1HXI A;  3ASG A;  2KCV A;  3CVN A;  4N3C A;  3CVP A;  5FJY A;  4KYO B;  2XCB A;  3ULQ A;  3ZFW A;  3SZ7 A;  1IHG A;  5BT1 A;  4I17 A;  4HOR A;  2VYI A;  3CKB A;  4AIF A;  4AM9 A;  5DBK A;  5CCM A;  2HR2 A;  2PQN A;  4N3A A;  1QZ2 A;  4KXK B;  2UY1 A;  2VGX B;  2HO1 A;  4NRH B;  3VTX A;  5ARG A;  4CGW A;  1WAO 1;  3RO2 A;  5G04 C;  3CK8 A;  3KD7 A;  1E96 B;  2WPV A;  3ZHE B;  4U0U A;  3UUX A;  3LY8 A;  5G05 C;  5HQ8 A;  4F3V A;  4N2S A;  5D0Q D;  1A17 A;  1IYG A;  5G05 J;  5A7D B;  3QWW A;  2XEV A;  3GYZ A;  4N39 A;  2Q7F A;  4HOQ A;  4JL0 A;  3QWV A;  3CKC A;  1OUV A;  1ZU2 A;  3QOU A;  3MKR A;  3RKV A;  2KAT A;  2GW1 A;  4Y6W A;  3PE4 A;  2XGM A;  4BTB A;  5EX0 A;  2HYZ A;  3FWV A;  4UQZ A;  4AY6 A;  2KCL A;  2I6H A;  3R9A B;  2XPI A;  4G23 A;  5EKQ D;  3ASH A;  2JLB A;  3MV2 B;  4EQF A;  5FTP A;  1QQE A;  4I1A A;  5JJ6 A;  3GW4 A;  1PC2 A;  3CK7 A;  2LSU A;  4GA0 A;  4UI9 C;  3UQ3 A;  4G1T A;  3N71 A;  4J0U A;  4YVO A;  5M72 A;  4J8F A;  2WQH A;  4APO A;  5KJM A;  2FI7 A;  2PL2 A;  5KJL A;  2IF4 A;  3ZN3 A;  3FFL A;  3CV0 A;  4UI9 J;  1ZBP A;  4A1S A;  4CDR A;  2DBA A;  3QWP A;  2VGX A;  5JJT A;  4H7X A;  4YND A;  4WND A;  3ASF A;  5A6C A;  3IEG A;  4N5C A;  5LCW C;  3TG5 A;  4G24 A;  3S7F A;  1YA0 A;  3OXG A;  3TGO A;  4GYO A;  3ZHE A;  4JHR A;  3S7D A;  4GCO A;  4LEU A;  5LCW J;  3LYA A;  2J9Q A;  3Q47 B;  3OXF A;  4U04 A;  4GYW A;  1FCH A;  1WM5 A;  4ME2 A;  3GZ1 A;  5G04 J;  3ZGQ A;  3CVL A;  4O6F A;  2LNI A;  3MV3 B;  4XIF A;  3ZPJ A;  1P5Q A;  4GYY A;  3ESK A;  5BNW A;  4BWR A;  2VGY A;  4HOS A;  2YHC A;  2E2E A;  2FO7 A;  4G25 A;  3E4B A;  4GZ6 A;  4I9C A;  3K9I A;  3MA5 A;  4JA7 A;  3OXL A;  1Y8M A;  4XI9 A;  4I2Z A;  1W3B A;  5JJ7 A;  3LY9 A;  5ARF A;  3UPV A;  2AVP A;  4GPK A;  1HZ4 A;  2XGS A;  4ABN A;  1ELW A;  3HYM B;  2KC7 A;  4GZ3 A;  3GZ2 A;  5D0O D;  4AY5 A;  2Y4T A;  3JYS A;  4WNG A;  3FP3 A;  2FF4 A;  4U0Z A;  2MHK A;  5FZR A;  4WUY A;  1XNF A;  1KT0 A;  3WXX A;  4U07 A;  1ELR A;  5AYW D;  4HOU A;  3KAE A;  3VTY A;  3LPZ A;  4G26 A;  2XCC A;  3RJV A;  2XGO A;  3U4T A;  3CVQ A;  2FEZ A;  4XI0 A;  5KJK A;  3LY7 A;  5DIZ A;  4I2W A;  4WNF A;  3CEQ A;  1KLX A;  2IFU A;  3RIB A;  2C2L A;  3PE3 A;  1HH8 A;  4GZ5 A;  1NZN A;  2KCK A;  4W9R A;  2L6J A;  4RG9 A;  2Y4U A;  2V5F A;  3BEE A;  4KBQ A;  4YVQ C;  4I9E A;  5FZQ A;  4B94 A;  2PZI A;  3TAX A;  2VQ2 A;  3Q49 B;  3CK9 A;  2C0M A;  3SF4 A;  1TJC A;  3Q4A B;  4WNE A;  4UQY A;  4IN3 B;  4Y6C A;  2UWJ G;  4BT9 A;  2YQ8 A;  3S7B A; 
#chains in the Genus database with same CATH topology
 3MEK A;  3RO3 A;  4N2Q A;  2VTB A;  1HG5 A;  4LG6 A;  4CGV A;  3BU8 A;  2M63 A;  5T3R A;  3EIQ C;  1UJK A;  5FT9 A;  3UX4 A;  1ELK A;  3TXM A;  4J8D A;  4FP7 A;  1B89 A;  3EHR A;  3NQP A;  3EDT B;  3TWS A;  3TG4 A;  1DNP A;  3BG1 B;  3SO8 A;  3EU5 A;  3OAW A;  2OND A;  4F53 A;  5CCL A;  1N4S A;  5CHE E;  5FZS A;  1KT1 A;  3DEP A;  4LCT A;  4JA9 A;  1WY6 A;  4EZL A;  2LSV A;  3O48 A;  4G2V A;  3T5V A;  4K5B A;  1EYH A;  2VSO E;  3C3R A;  4B0Z A;  3IKO B;  1HE8 A;  5C1D A;  2WXI A;  3L17 A;  3FUF A;  1H6P A;  4RG6 A;  2VSN A;  3LKU A;  3AS5 A;  3EHN A;  4MBG A;  3FTW A;  4JHK A;  3T8K A;  3CVN A;  3FUM A;  4N3C A;  1YMP A;  1Z6T A;  4BEP A;  5AIJ A;  3T8M A;  4ACL A;  4RSY A;  1IHG A;  5KBA A;  2XS8 A;  1UG3 A;  4ATZ D;  2I9C A;  3DWL G;  1N95 A;  2VYI A;  4AIF A;  4G11 A;  5DBK A;  1HU3 A;  3PZ4 A;  4FHJ A;  3HHM A;  1AWC B;  2R02 A;  3L08 A;  3D9M A;  2UY1 A;  2EIK E;  3FU3 A;  4A3T A;  3PUJ A;  2DIW A;  4BES A;  3ABM E;  5ARG A;  4EZK A;  1QBQ A;  2WVI A;  3CK8 A;  2WPV A;  2BF0 X;  5HQ8 A;  3ULE G;  4YDO A;  1H2V C;  5E75 A;  2BED A;  3CIA A;  4LNU D;  4X8Q A;  1H2U A;  4HXI A;  4K03 A;  3QWW A;  3E33 A;  4HB5 A;  1TNY A;  1BPO A;  1IXV A;  4ANV A;  3GYZ A;  2Q7F A;  3U64 A;  2XHE A;  4BSZ B;  3L9T A;  4TUU A;  1OCC E;  4PS7 A;  3ONL A;  3QC1 A;  3TWV A;  3NOC D;  3QOU A;  3APF A;  2J4B A;  2KAT A;  2GW1 A;  4DLO A;  1UOH A;  3R7Q A;  4NUR A;  3PE4 A;  2RFA A;  4BTB A;  4HLL A;  2A5E A;  3FWV A;  3DXM G;  3FU6 A;  1SA5 A;  2XZD G;  4L1B A;  5EKQ D;  3LEW A;  2F37 A;  2JAB A;  3DBS A;  3MV2 B;  4DX6 D;  1S70 B;  4DRX E;  3FUE A;  1HF8 A;  3I4R B;  4GA0 A;  4JEH A;  2RD0 A;  3LS8 A;  3SD5 A;  4J0U A;  1HS6 A;  4FAD A;  4U8V D;  5AQ7 A;  5KJM A;  2IJG X;  2H6G A;  2VGE A;  3ZN3 A;  3E32 A;  3FFL A;  1X81 A;  3EUV A;  4UI9 J;  3D9K A;  4AXH A;  1ZBP A;  4TV3 A;  1HFA A;  5AEN A;  4WND A;  5CBN A;  5A6C A;  2V4H C;  1O1R A;  1JCQ A;  3L16 A;  3SFX A;  3AG3 E;  2ILR A;  4G24 A;  2XRY A;  3TGO A;  1K3Z D;  1G3N B;  4JHR A;  1V54 E;  2R17 C;  3FTU A;  4BX8 A;  4GCO A;  3KEA A;  3TWQ A;  4LEU A;  2WMO A;  3ASN E;  4BSX A;  3Q47 B;  2LAH A;  1ZB1 A;  1JCR A;  4ME2 A;  3ZIM A;  2A5U A;  4UWL A;  3O4Z A;  3V31 A;  2RG8 A;  2YIN A;  3TJP A;  3ESK A;  2BKK B;  3MGB A;  1NP7 A;  4UUC A;  3K9I A;  1U2V G;  3MA5 A;  4JA7 A;  3OXL A;  3D3M A;  5D2M C;  4I2Z A;  4B93 B;  4EPZ A;  1AP7 A;  4K5A B;  4BX9 A;  3JUE A;  3B7S A;  1N52 A;  4QQI A;  2KC7 A;  3EU9 A;  4MRU A;  3MZL B;  4MLP A;  2CHZ A;  3Q78 A;  5AAR A;  5AAO A;  1EF1 C;  3TWT A;  2MHK A;  1UN8 A;  1KZP A;  1XNF A;  1OWP A;  1XGW A;  1JPL A;  4U07 A;  1ELR A;  4HOU A;  4G26 A;  3SFY A;  3NZS A;  3FTX A;  3ENE A;  1SZA A;  4A63 B;  3IBE A;  4EHM A;  2GRP B;  4WNF A;  2YHE A;  3P2B A;  1OWN A;  5CEA A;  3RIB A;  2C2L A;  4ILH B;  3PE3 A;  1HH8 A;  1MHQ A;  4KZC A;  3HVE B;  4LNB A;  4FLH A;  3JQ1 A;  2GRL A;  4DPR A;  2DYS E;  2L6J A;  4UWK A;  3JCK C;  1Y6I A;  1Q2Z A;  3UIN C;  4WWN A;  1HG2 A;  3PRZ A;  3ULY A;  3DRA A;  3AG2 E;  4GZC A;  4DI4 A;  5FQ8 A;  3E34 A;  3ZKJ A;  2J4D A;  1BU9 A;  1TJC A;  2XQ0 A;  3FTZ A;  3DSW A;  4WNE A;  3UIP C;  4Y6C A;  3UT4 A;  1BI8 B;  2EQX A;  1TR4 A;  4JC8 A;  3KS2 A;  3Q15 A;  2OEV A;  4GCN A;  3JQ0 A;  4LRZ A;  4NQ0 A;  2CG2 A;  5ITZ F;  4BET A;  1QYM A;  3UXG A;  4HQD A;  3W9G A;  3PDN A;  3LVR E;  5BXO A;  2PNN A;  3EHM A;  1NA3 A;  5ENT D;  3URZ A;  2CFU A;  4BT8 A;  2FBN A;  3QDN A;  3AS4 A;  3CVW A;  3I4G A;  1FPP A;  2P9S G;  1NA0 A;  4C0E A;  3FDH A;  3NZU A;  4U0S A;  3C3O A;  2P58 C;  3QAQ A;  3B7B A;  4I1O B;  2DYR E;  3PVL A;  3NF1 A;  4TUM A;  3L13 A;  3PEU B;  4B8C B;  2WMN A;  3ZXS A;  2R59 A;  3ASG A;  5CED B;  2H6I A;  5JHA A;  5BXU A;  2KZT B;  2YNQ A;  1BLX B;  2BKG A;  4BER A;  3FUD A;  3OTN A;  3ZFW A;  3SZ7 A;  1Z5S C;  2P9N G;  4V3I A;  4HOR A;  4DX7 D;  3CHO A;  1HX8 A;  3D9I A;  3CKB A;  3ZRH A;  4L23 A;  2PQN A;  1QZ2 A;  3R7R A;  4NAC A;  2X6J A;  4E6H A;  1MJ0 A;  2WM9 A;  2BTD A;  3RK6 A;  3VTX A;  4CGW A;  5EID A;  1VDY A;  1D9S A;  3FHE A;  3ZHE B;  4U0U A;  2NYJ A;  4HI9 A;  3LY8 A;  4PDX A;  3UUX A;  3WG7 E;  3BG0 B;  3BUA A;  3FU0 A;  3JUI A;  4I6G A;  4N5Q A;  1TNO A;  2KXP C;  2WXF A;  1Z3X A;  3B7T A;  4N2S A;  4GTO A;  5D0Q D;  3CHR A;  4GTT A;  5G05 J;  4U96 D;  2X3M A;  5B1B E;  4A1G A;  2QYU A;  2OV8 A;  4C0M A;  4CDN A;  4N39 A;  4HVB A;  3ZYL A;  4PS8 A;  4Q96 A;  1OUV A;  4AEZ C;  5J90 A;  2ETC A;  1D8E A;  1N54 A;  4F1P A;  2WXG A;  3MKR A;  4CT0 A;  3LJN A;  3PNL B;  2ETA A;  3NB2 A;  2Y3A A;  3T5X A;  3MKQ A;  4BY6 A;  4XEI G;  2V4L A;  5CRV A;  2KCL A;  3DPY A;  3R9A B;  3ZVV A;  3ZUV B;  2IOS A;  1QQE A;  1OWL A;  1PC2 A;  2XEN A;  2LSU A;  5IY5 E;  4UI9 C;  1K1B A;  1OCZ E;  4OVU A;  3VLF A;  3U9W A;  5T4Y A;  2WQH A;  2FI7 A;  2PL2 A;  5KJL A;  2Y69 E;  4YDY A;  3CV0 A;  1UW4 B;  2IY0 C;  5H7P A;  3CVY A;  3QWP A;  2VGX A;  2I2O A;  3UM0 A;  5HRY A;  5FQ6 A;  2A4Z A;  4N5C A;  2P9K G;  1YA0 A;  4J6I A;  5FQ4 A;  5D66 A;  2NXP A;  4JHJ A;  5G2N A;  3MX3 A;  4L7T A;  2B6C A;  5KNG A;  5LCW J;  3LYA A;  5J08 A;  4IUL A;  4U04 A;  1FVH A;  4GYW A;  3RRN B;  4WWO A;  4DUI A;  4F7A A;  1FCH A;  2J08 A;  2LXM A;  2WXH A;  2PM6 A;  4RVB A;  3AU5 A;  3UT8 A;  5CER B;  3CVL A;  3R9M A;  2F8Y A;  5LFA A;  2LXL A;  2LNI A;  3Q73 A;  4XIF A;  2I1K A;  3ZEF A;  2ION A;  3TWW A;  2VGY A;  4BWR A;  2X6I A;  3NBN B;  4GTS A;  4HOS A;  2XPY A;  2FO7 A;  4U7E B;  4FJY A;  3Q79 A;  4XE0 A;  3UM2 A;  3KEZ A;  2J8S D;  2XZT G;  3UMV A;  1PY1 A;  4U8Y D;  3L22 A;  1Y8M A;  1TN6 A;  5JJ7 A;  1K1A A;  3C98 A;  4ANU A;  3UPV A;  3L54 A;  1S63 A;  2VTB B;  4EZJ A;  1HZ4 A;  4GPK A;  1N11 A;  4ABN A;  3QK0 A;  1ELW A;  5BPP A;  1LTX A;  5D0O D;  2QC9 A;  1OY3 D;  4WNG A;  3FP3 A;  4GPM A;  5KCM A;  5ENP D;  2FF4 A;  3HXD A;  4GML A;  3TWU A;  4Q69 A;  1EDU A;  4OAU C;  4WUY A;  1L5J A;  2LUH A;  3IV0 A;  3ML8 A;  3CVX A;  3B13 A;  3L82 A;  2XGO A;  4XX5 A;  3HXC A;  3U4T A;  1OXJ A;  2J49 A;  2WXM A;  1MQS A;  3CVQ A;  2FEZ A;  5C2Y A;  2IQC A;  3CGH A;  4HRL A;  3PZ3 A;  1RW2 A;  5DIZ A;  3CEQ A;  2QY7 A;  1KLX A;  2IFU A;  3FU5 A;  1E8X A;  4F1S A;  2AXV A;  3UKU G;  5LX8 A;  3IHV A;  4TXQ A;  2CG3 A;  4O60 A;  2XPZ A;  1DCQ A;  2KCK A;  1NZN A;  2V5Q C;  3D9J A;  3SBS A;  4W9R A;  1O5M A;  3AU4 A;  5CRU A;  4RG9 A;  2Y4U A;  1JWG A;  4JVS A;  4YVQ C;  3E37 A;  4YDE A;  5FZQ A;  3PNT B;  2PZI A;  2MRI A;  3QB2 A;  3AG4 E;  2VJ8 A;  3Q49 B;  3UM3 A;  3PH0 C;  4MS6 A;  3T9K A;  2IO2 C;  3FEX A;  2C0M A;  2EIN E;  3SF4 A;  3TXN A;  3Q4A B;  4C9B B;  2H6F A;  4AV7 A;  4IN3 B;  3RAU A;  2GGF A;  3IXE A;  2JEK A;  2UWJ G;  3S7B A;  3C5R A;  3HXB A;  4GA2 A;  2UY1 B;  3LJ3 A;  3LCA A;  5EX3 A;  3FY4 A;  3FUJ A;  3Q7F A;  4GA1 A;  1H2T C;  3CST A;  3LDZ A;  1INZ A;  2IEJ A;  3CVV A;  1PAQ A;  2R5S A;  1BI7 B;  2CFZ A;  3UTM A;  4AOF A;  2C0L A;  4Q94 A;  5G55 A;  1WDY A;  2XEH A;  2OOE A;  4DI3 A;  4J8E A;  2WXQ A;  4BTA A;  3X2Q E;  5EN5 D;  1E90 A;  3QKY A;  3ZYQ A;  2QFC A;  3RU0 A;  5HI7 A;  2DVW A;  3ASO E;  3ISM C;  4UI9 K;  4H7Y A;  4N3B A;  3G2V A;  4HOT A;  3EJN A;  5EIB E;  5E76 A;  3CR3 A;  1TN7 A;  3Q5M A;  1MZC A;  3FUN A;  1HXI A;  1S0P A;  1FT1 A;  2KCV A;  4ILI A;  2GRQ B;  4R7L A;  3CVP A;  3V30 A;  4JD2 G;  3RRU A;  4ANW A;  3VLE A;  4UWF A;  5BT1 A;  3HIZ A;  4DLQ A;  2R05 A;  4AM9 A;  2LAI A;  2HR2 A;  4KXK B;  2VSX E;  1V55 E;  1N4Q A;  4GZD A;  2HO1 A;  4NRH B;  1JWF A;  3FEY A;  1JUQ A;  1WAO 1;  3ONK A;  5G04 C;  1OCR E;  4IYP A;  4G8L A;  4UWH A;  2ZGG A;  3QJZ A;  4U63 A;  4LSZ E;  5G05 C;  2KBX A;  2R2L A;  3U66 A;  4EEC A;  3DXK G;  1A17 A;  4ZHB A;  3APC A;  3ABL E;  1D8D A;  4XZ4 A;  1TYQ G;  3S2A A;  3DSU A;  3MJW A;  4M3O A;  4YDW A;  3CLJ A;  1U3D A;  5HKP A;  3CKC A;  3FH8 A;  4PH4 B;  1MX6 A;  1E8Y A;  4Y6W A;  3SFZ A;  2XGM A;  5EX0 A;  2WB2 A;  3MCX A;  2X6H A;  2AW6 A;  3AG1 E;  4AY6 A;  1OWO A;  2I6H A;  3AJI A;  4G23 A;  1E8Z A;  3ASH A;  4EQF A;  3ML9 A;  1E7U A;  2DZO A;  2HE0 A;  3CHQ A;  5JJ6 A;  1OWM A;  4CEM A;  1HO8 A;  2EIL E;  4FJZ A;  4G8K A;  5M72 A;  4J8F A;  4APO A;  4TRQ A;  4GTV A;  1N94 A;  3Q75 A;  2IF4 A;  4CT4 A;  4CYM D;  4K0R A;  3UIO C;  5ANL A;  2GRR B;  2GRM A;  4A1S A;  5JJT A;  3GZS A;  4H7X A;  4HNA D;  3D9L A;  1GW6 A;  5AQA A;  3ASF A;  3HRA A;  4UWG A;  2WXO A;  3IEG A;  4J7W A;  5LCW C;  3D9H A;  2WXK A;  3S7F A;  3OXG A;  2DWZ A;  4GYO A;  3B7U X;  3S7D A;  2OVF A;  3I5P A;  5EYP F;  5BUZ A;  5BV0 A;  3CSF A;  2GRN B;  2J9Q A;  4APF A;  3HXF A;  3W9F A;  4JW1 A;  5FWQ A;  2WXP A;  2L0T B;  1N4R A;  3C3Q A;  3QAR A;  5G04 J;  5BV1 A;  4FLB A;  4JB8 P;  4O6F A;  4LNG A;  3SY2 A;  4GMJ A;  1P5Q A;  3Q7A A;  4OVV A;  2XRZ A;  5BNW A;  1UJJ A;  4G25 A;  3KSQ A;  3ABK E;  4I9C A;  4XI9 A;  3SQV A;  1W3B A;  2KM4 A;  5FIO A;  1H6K A;  3LY9 A;  2P9I G;  4DX1 A;  1IQU A;  3SI5 A;  2AXU A;  2OCC E;  4M7C A;  4HRM B;  5ENQ D;  3LXU X;  3NOG D;  3LVQ E;  4QFV A;  4A3V A;  1SQM A;  3E30 A;  2X6K A;  3GZ2 A;  2Y4T A;  3JYS A;  1KZO A;  4JXT A;  4JZY A;  1IKN D;  4GMR A;  2IO3 C;  1BD8 A;  5FZR A;  3FH5 A;  5JHB A;  5AYW D;  3KAE A;  4FA6 A;  3PS6 A;  3VTY A;  4GTP A;  2ZXW E;  2ETB A;  2XCC A;  5ENR D;  3CHP A;  2QZA A;  2ZIR A;  5CBO A;  5ENS D;  3TWR A;  3J5P A;  2RKK A;  3G2U A;  1N9A A;  4NIK A;  1N4P A;  3V79 K;  3PZD A;  4I1M A;  1E7V A;  1SZ9 A;  2Y0B G;  2AWI A;  2L0I A;  1N0R A;  3ZU7 B;  2J07 A;  2WXN A;  5B1A E;  4KZ0 A;  4GZ5 A;  1FVF A;  4FUL A;  3FUH A;  3D9N A;  1LD8 A;  1SVX A;  4HFG A;  4XKC A;  2WQ6 A;  2V5F A;  3BEE A;  4KBQ A;  5EDS A;  4A55 A;  4ILG A;  4WWP A;  2X6F A;  3DST A;  3TAX A;  2VQ2 A;  4O1P A;  4L9P A;  2F8X K;  3BQO A;  3PEV B;  4HRN A;  3UT7 A;  3CQG B;  1IQR A;  1DCE A;  2NSZ A;  5EYL A;  2YQ8 A;  3HDX A;  2MYO A;  2P2C P;  4LUN U;  4I6J A;  2PQR A;  3PZ2 A;  5ENO D;  3L6A A;  3SNX A;  4ZFH A;  2BUG A;  3RSE G;  3AS8 A;  4E85 A;  2IU1 A;  4PUC A;  2V0P A;  2WQ7 A;  3HG0 D;  3U3W A;  3VLD A;  2ZIS A;  2CHW A;  5T8I A;  3Q9N C;  5KJN A;  3ASD A;  3S7J A;  4HI8 A;  2CHX A;  4B89 A;  5AN8 A;  5AJD A;  4FC8 A;  5BW8 C;  5FQ7 A;  3Q9U C;  2QYJ A;  1H19 A;  4HBD A;  2FUL A;  2AXZ A;  2VSY A;  5JMN D;  2EIM E;  3FUL A;  3HVE A;  4AJW A;  2EIJ E;  2ZU6 B;  3D9O A;  4UQX A;  5AQ9 A;  2NC9 A;  2R03 A;  3MKQ B;  4XKB A;  1MYO A;  2Y1L E;  2HM8 A;  3ZXP A;  2E0I A;  2DZN A;  3ZYM A;  5FJY A;  3B95 A;  4KYO B;  2XCB A;  2I1J A;  1S64 A;  3ULQ A;  2IOL A;  5KNH D;  4MKT A;  3TWX A;  3V2O A;  4ANX A;  1TEZ A;  2FO1 E;  5FIN A;  4I17 A;  5CCM A;  2GRO B;  2P9L G;  3DPD A;  4N3A A;  1MX2 A;  4FHK A;  3D9P A;  3HXE A;  2VGX B;  1Z3Y A;  2WXJ A;  3F6Q A;  1NI1 A;  3CHM A;  3QNK A;  3RO2 A;  4AP2 A;  4URK A;  2X38 A;  3KD7 A;  1E96 B;  4B8A A;  1NFI E;  4J8S A;  2P9U G;  2LO6 A;  1FT2 A;  4F3V A;  4KMO A;  3UI2 A;  4I6E A;  2PM7 A;  1WG0 A;  4DX5 D;  1IYG A;  4K5C A;  3CHS A;  1KPS B;  4KT6 B;  1N0Q A;  5A7D B;  4RLY A;  1SA4 A;  2L6B A;  2XEE A;  2XEV A;  3FTV A;  3ESL A;  3I3N A;  4HOQ A;  4JL0 A;  3AAA C;  5ENN A;  3QWV A;  2J09 A;  1EPU A;  1ZU2 A;  5CMW A;  3UM1 A;  4FU3 A;  3RKV A;  5LOZ A;  3IHY A;  3NAW A;  4CCA A;  2HYZ A;  4UQZ A;  2B0O E;  1IHB A;  2KZT A;  5CMY A;  3B7R L;  3G2T A;  2ZGD A;  2XPI A;  1A5E A;  2JLB A;  5FTP A;  4EBA G;  1OCO E;  4I1A A;  5HS0 A;  1E8W A;  3GW4 A;  1TNU A;  3CK7 A;  1UN9 A;  3ZYK A;  3UQ3 A;  4G1T A;  3N71 A;  4TXP A;  4CRW A;  4YVO A;  4KVM A;  3J5Q B;  5LP0 A;  3KSL A;  4PS3 A;  1TJF A;  4KVO A;  4DK5 A;  3G2S A;  1OT8 A;  4CDR A;  2DBA A;  4P29 A;  5ANR A;  1K8K G;  4YND A;  4JPS A;  3ZNG A;  3FUI A;  1TNB A;  4GAA A;  3TG5 A;  4U95 D;  2WXL A;  4IRU A;  3DSX A;  4J8Y A;  3ZHE A;  4CDM A;  4F6R D;  1NL4 A;  3JXJ A;  1LF8 A;  1SW6 A;  3P1U A;  3OXF A;  4L2Y A;  3ZW3 A;  2P9P G;  3JXI A;  1WM5 A;  5EIL A;  4Z68 A;  2DCP A;  1TNZ A;  3GZ1 A;  1H0A A;  4DJA A;  3ZGQ A;  3DEO A;  4GTR A;  3MV3 B;  3ZPJ A;  4GYY A;  3PRE A;  5AJL A;  3SGH A;  2YHC A;  4GU5 A;  2OVB A;  2E2E A;  3E4B A;  4GZ6 A;  4I43 A;  2AJA A;  4RQI A;  3FTY A;  3RRM B;  5ARF A;  3TL5 A;  2AVP A;  4L2L A;  2H6H A;  4WAF A;  2XGS A;  2F0Y A;  3EIJ A;  3CQC B;  3FH7 A;  3HYM B;  5JA4 D;  4GZ3 A;  4AY5 A;  4JEU A;  3CVU A;  5KWD A;  4U0Z A;  4DX2 A;  1KT0 A;  4BFR A;  3WXX A;  3FUK A;  4LER A;  3V2X A;  5B3S E;  4O1O A;  3LPZ A;  1JCS A;  3SBT B;  3DSS A;  4HLE A;  1O1S A;  2L9B A;  3RJV A;  5A23 A;  1O1T A;  4XI0 A;  4AVX A;  1QNF A;  5KJK A;  4ACK A;  4ATG A;  4GTQ A;  3LY7 A;  3UKR G;  4I2W A;  1RZ4 A;  3PUK A;  3APD A;  2XS1 A;  2RFM A;  3EHQ A;  3MYV A;  1TN8 A;  3PZ1 A;  2V8S E;  2MOW A;  4C48 B;  3C72 A;  3FTS A;  4GTM A;  2OEW A;  4I9E A;  1YYH A;  3DSV A;  4CZ2 D;  4B94 A;  3SHF A;  5AQB A;  1X5B A;  1MX4 A;  1DC2 A;  1H6O A;  3CK9 A;  4HS2 A;  4GB9 A;  1DVP A;  2WXR A;  5CEC B;  1YCS B;  4TXR A;  4OYS A;  1U3C A;  4D10 C;  4UQY A;  4BT9 A;  4EBA A;  3G2W A;  4U8H A;  4OAV B;  1LD7 A; 
#chains in the Genus database with same CATH homology
 3MEK A;  4GA2 A;  4JC8 A;  2UY1 B;  4LUN U;  3KS2 A;  3RO3 A;  3LJ3 A;  3Q15 A;  4N2Q A;  2VTB A;  1HG5 A;  4I6J A;  3LCA A;  4GCN A;  4CGV A;  3JQ0 A;  4LRZ A;  2PQR A;  5EX3 A;  3FY4 A;  2M63 A;  3FUJ A;  4NQ0 A;  5T3R A;  2CG2 A;  4GA1 A;  3EIQ C;  3L6A A;  1UJK A;  3SNX A;  5FT9 A;  2BUG A;  3AS8 A;  4E85 A;  3UX4 A;  1ELK A;  1H2T C;  3PDN A;  3TXM A;  4J8D A;  3CST A;  2IU1 A;  3LVR E;  3LDZ A;  1B89 A;  4FP7 A;  4PUC A;  1INZ A;  3NQP A;  3EDT B;  3CVV A;  2V0P A;  2WQ7 A;  3TG4 A;  1DNP A;  3BG1 B;  3EHM A;  3U3W A;  1PAQ A;  2R5S A;  1NA3 A;  2CFZ A;  4AOF A;  3URZ A;  3OAW A;  2C0L A;  2CFU A;  2OND A;  4Q94 A;  4F53 A;  5G55 A;  5CCL A;  4BT8 A;  2FBN A;  3QDN A;  3AS4 A;  3CVW A;  3I4G A;  3VLD A;  5CHE E;  5FZS A;  2OOE A;  4DI3 A;  1KT1 A;  4J8E A;  2CHW A;  2WXQ A;  4LCT A;  5T8I A;  4BTA A;  4JA9 A;  1WY6 A;  5KJN A;  3ASD A;  1NA0 A;  4C0E A;  3S7J A;  1E90 A;  2CHX A;  3FDH A;  3NZU A;  4U0S A;  2LSV A;  4EZL A;  2P58 C;  3QKY A;  3O48 A;  4G2V A;  4B89 A;  3T5V A;  3QAQ A;  3ZYQ A;  1EYH A;  4I1O B;  2QFC A;  5AJD A;  4FC8 A;  2VSO E;  3RU0 A;  5BW8 C;  5HI7 A;  4B0Z A;  3IKO B;  5FQ7 A;  3PVL A;  3NF1 A;  1HE8 A;  5C1D A;  2WXI A;  3L13 A;  3L17 A;  4UI9 K;  4H7Y A;  1H19 A;  3G2V A;  3FUF A;  4N3B A;  4RG6 A;  2VSN A;  2FUL A;  4HOT A;  2AXZ A;  2VSY A;  3EJN A;  3PEU B;  4B8C B;  2WMN A;  3LKU A;  3AS5 A;  3FUL A;  3HVE A;  5E76 A;  3CR3 A;  4AJW A;  3EHN A;  2ZU6 B;  3ZXS A;  3D9O A;  3Q5M A;  2R59 A;  3FUN A;  4UQX A;  3FTW A;  4JHK A;  2NC9 A;  1HXI A;  1S0P A;  3MKQ B;  4XKB A;  3ASG A;  2KCV A;  3CVN A;  3FUM A;  4N3C A;  2HM8 A;  4ILI A;  5JHA A;  2KZT B;  1Z6T A;  2E0I A;  2YNQ A;  4R7L A;  3CVP A;  3ZYM A;  5FJY A;  5AIJ A;  3T8M A;  4ACL A;  4KYO B;  3FUD A;  2XCB A;  2I1J A;  3OTN A;  3ULQ A;  2IOL A;  3RRU A;  3ZFW A;  4RSY A;  3SZ7 A;  1IHG A;  4MKT A;  4ANW A;  3VLE A;  1UG3 A;  4V3I A;  4UWF A;  4ANX A;  2I9C A;  1TEZ A;  5BT1 A;  4I17 A;  4HOR A;  3CHO A;  3HIZ A;  1HX8 A;  3D9I A;  2VYI A;  3CKB A;  4AIF A;  3ZRH A;  4AM9 A;  4G11 A;  5DBK A;  4DLQ A;  5CCM A;  4L23 A;  2LAI A;  2HR2 A;  2PQN A;  3DPD A;  1HU3 A;  4N3A A;  1QZ2 A;  4FHK A;  3R7R A;  4NAC A;  2X6J A;  4FHJ A;  4E6H A;  3D9P A;  3HHM A;  4KXK B;  2VSX E;  3L08 A;  2WM9 A;  3D9M A;  2UY1 A;  2VGX B;  2BTD A;  3FU3 A;  4A3T A;  3PUJ A;  1Z3Y A;  3RK6 A;  2DIW A;  4GZD A;  2HO1 A;  4NRH B;  2WXJ A;  1JWF A;  3VTX A;  5ARG A;  4CGW A;  4EZK A;  3CHM A;  1JUQ A;  1VDY A;  1WAO 1;  3FEY A;  3ONK A;  3QNK A;  3RO2 A;  5G04 C;  3FHE A;  4AP2 A;  4URK A;  4IYP A;  2X38 A;  2WVI A;  3CK8 A;  3KD7 A;  1E96 B;  2WPV A;  4UWH A;  3ZHE B;  4U0U A;  4B8A A;  3UUX A;  3LY8 A;  4PDX A;  4J8S A;  2BF0 X;  3QJZ A;  3BG0 B;  3FU0 A;  3JUI A;  4U63 A;  2LO6 A;  5G05 C;  5HQ8 A;  4I6G A;  4F3V A;  3U66 A;  1H2V C;  4KMO A;  5E75 A;  2WXF A;  3CIA A;  4I6E A;  1Z3X A;  3B7T A;  4EEC A;  4N2S A;  2PM7 A;  5D0Q D;  1A17 A;  1H2U A;  3CHR A;  1IYG A;  3CHS A;  4HXI A;  5G05 J;  4K03 A;  3APC A;  4KT6 B;  5A7D B;  2X3M A;  3QWW A;  4A1G A;  2OV8 A;  4C0M A;  1BPO A;  2XEV A;  4ANV A;  3FTV A;  4CDN A;  3GYZ A;  3ESL A;  4N39 A;  2Q7F A;  4HVB A;  3U64 A;  4XZ4 A;  3S2A A;  2XHE A;  3ZYL A;  3I3N A;  4HOQ A;  3MJW A;  4M3O A;  4PS8 A;  4JL0 A;  3CLJ A;  1U3D A;  4Q96 A;  3QWV A;  5ENN A;  3CKC A;  4TUU A;  2J09 A;  4PS7 A;  1EPU A;  1OUV A;  4AEZ C;  5J90 A;  1ZU2 A;  3FH8 A;  3ONL A;  3QC1 A;  4PH4 B;  5CMW A;  3QOU A;  1N54 A;  4FU3 A;  3APF A;  1E8Y A;  2J4B A;  2WXG A;  3MKR A;  3RKV A;  2KAT A;  4CT0 A;  2GW1 A;  4DLO A;  3PNL B;  5LOZ A;  3R7Q A;  4Y6W A;  3IHY A;  3SFZ A;  4NUR A;  4CCA A;  3PE4 A;  2XGM A;  4BTB A;  2Y3A A;  5EX0 A;  2HYZ A;  3T5X A;  3MKQ A;  4BY6 A;  2WB2 A;  3MCX A;  3FWV A;  4UQZ A;  2V4L A;  2X6H A;  2AW6 A;  4AY6 A;  2KCL A;  2KZT A;  5CMY A;  1OWO A;  3FU6 A;  3B7R L;  3G2T A;  2I6H A;  3R9A B;  2XPI A;  4G23 A;  4L1B A;  3ZVV A;  1E8Z A;  5EKQ D;  3LEW A;  3ASH A;  2JLB A;  3DBS A;  3MV2 B;  4EQF A;  5FTP A;  2IOS A;  4EBA G;  3ML9 A;  1QQE A;  1E7U A;  4I1A A;  1E8W A;  1OWL A;  3FUE A;  3CHQ A;  5JJ6 A;  3GW4 A;  1OWM A;  1PC2 A;  4CEM A;  1HO8 A;  3CK7 A;  1UN9 A;  1HF8 A;  2LSU A;  3ZYK A;  3I4R B;  4GA0 A;  4JEH A;  4FJZ A;  4UI9 C;  3UQ3 A;  2RD0 A;  3LS8 A;  4G1T A;  3N71 A;  4OVU A;  3SD5 A;  3VLF A;  4CRW A;  3U9W A;  4J0U A;  1HS6 A;  5T4Y A;  4YVO A;  5M72 A;  4FAD A;  4J8F A;  2WQH A;  4KVM A;  4APO A;  5KJM A;  4TRQ A;  2IJG X;  2FI7 A;  2PL2 A;  5KJL A;  2IF4 A;  3ZN3 A;  4CT4 A;  5LP0 A;  3FFL A;  4PS3 A;  1TJF A;  4KVO A;  4DK5 A;  3G2S A;  3CV0 A;  4UI9 J;  1UW4 B;  4K0R A;  3D9K A;  5ANL A;  4AXH A;  2GRM A;  1ZBP A;  4A1S A;  4TV3 A;  4CDR A;  1HFA A;  2DBA A;  4P29 A;  5ANR A;  3QWP A;  2VGX A;  5AEN A;  5JJT A;  3CVY A;  3GZS A;  4H7X A;  4YND A;  3D9L A;  1GW6 A;  2I2O A;  4JPS A;  4WND A;  3ASF A;  5A6C A;  5FQ6 A;  2WXO A;  3FUI A;  4GAA A;  4UWG A;  2A4Z A;  3IEG A;  4N5C A;  5LCW C;  3TG5 A;  3L16 A;  2ILR A;  2WXL A;  2WXK A;  4G24 A;  1YA0 A;  2XRY A;  3S7F A;  4J6I A;  5FQ4 A;  3OXG A;  4IRU A;  3TGO A;  2NXP A;  4GYO A;  4JHJ A;  3ZHE A;  4JHR A;  4CDM A;  3B7U X;  5G2N A;  3MX3 A;  3S7D A;  2R17 C;  3FTU A;  4BX8 A;  4L7T A;  4GCO A;  4LEU A;  5LCW J;  1LF8 A;  3LYA A;  2OVF A;  3I5P A;  2WMO A;  5BUZ A;  4BSX A;  5BV0 A;  3CSF A;  5J08 A;  3P1U A;  2J9Q A;  3Q47 B;  4IUL A;  3OXF A;  4APF A;  4U04 A;  1FVH A;  2LAH A;  4L2Y A;  4GYW A;  4JW1 A;  5FWQ A;  3ZW3 A;  3RRN B;  4WWO A;  2WXP A;  2L0T B;  4F7A A;  1FCH A;  2J08 A;  1WM5 A;  2DCP A;  2WXH A;  2PM6 A;  4ME2 A;  4RVB A;  3ZIM A;  2A5U A;  4UWL A;  3O4Z A;  3GZ1 A;  3QAR A;  1H0A A;  5G04 J;  4DJA A;  3AU5 A;  4FLB A;  3UT8 A;  3CVL A;  3ZGQ A;  5BV1 A;  2RG8 A;  2YIN A;  5LFA A;  4O6F A;  3TJP A;  2LNI A;  4GMJ A;  3MV3 B;  4XIF A;  2I1K A;  3ZEF A;  1P5Q A;  3ZPJ A;  2ION A;  4GYY A;  3PRE A;  4OVV A;  3ESK A;  5AJL A;  3SGH A;  5BNW A;  4BWR A;  2VGY A;  2XRZ A;  2X6I A;  3MGB A;  4HOS A;  2YHC A;  1NP7 A;  1UJJ A;  2OVB A;  2XPY A;  4GU5 A;  2E2E A;  2FO7 A;  4G25 A;  3E4B A;  4FJY A;  4GZ6 A;  4I43 A;  4XE0 A;  4I9C A;  3KEZ A;  3K9I A;  3MA5 A;  3UMV A;  1PY1 A;  4JA7 A;  3OXL A;  3D3M A;  3L22 A;  1Y8M A;  4XI9 A;  4I2Z A;  1W3B A;  5JJ7 A;  2KM4 A;  1H6K A;  3LY9 A;  3C98 A;  3FTY A;  3RRM B;  4ANU A;  4EPZ A;  5ARF A;  3TL5 A;  3UPV A;  3L54 A;  1IQU A;  3SI5 A;  2AXU A;  2AVP A;  4L2L A;  4BX9 A;  1HZ4 A;  4EZJ A;  2VTB B;  4GPK A;  4WAF A;  2XGS A;  3LXU X;  3B7S A;  1N52 A;  3LVQ E;  4QFV A;  3EIJ A;  3CQC B;  4ABN A;  3FH7 A;  3QK0 A;  1ELW A;  3HYM B;  2KC7 A;  1SQM A;  4A3V A;  5BPP A;  2X6K A;  4GZ3 A;  3GZ2 A;  5D0O D;  4MRU A;  4AY5 A;  2Y4T A;  3JYS A;  3MZL B;  4MLP A;  4WNG A;  2CHZ A;  3FP3 A;  4JXT A;  5KCM A;  4JZY A;  2FF4 A;  4JEU A;  3CVU A;  4GML A;  1EF1 C;  4U0Z A;  2MHK A;  4Q69 A;  1EDU A;  1UN8 A;  5FZR A;  4WUY A;  1L5J A;  1KT0 A;  1OWP A;  1XNF A;  3FH5 A;  3WXX A;  3FUK A;  4LER A;  1XGW A;  4BFR A;  1JPL A;  4U07 A;  5JHB A;  1ELR A;  3IV0 A;  4HOU A;  5AYW D;  3KAE A;  4FA6 A;  3PS6 A;  3VTY A;  3LPZ A;  3ML8 A;  3CVX A;  3SBT B;  4HLE A;  4G26 A;  2XCC A;  2L9B A;  3B13 A;  3RJV A;  2XGO A;  4XX5 A;  3CHP A;  5A23 A;  3NZS A;  3U4T A;  2J49 A;  3FTX A;  2WXM A;  1MQS A;  3CVQ A;  2FEZ A;  4XI0 A;  4AVX A;  1QNF A;  5KJK A;  5C2Y A;  4ACK A;  3ENE A;  1SZA A;  3G2U A;  4ATG A;  2IQC A;  3CGH A;  3LY7 A;  3IBE A;  3PZD A;  4I1M A;  5DIZ A;  4I2W A;  3PUK A;  1E7V A;  1SZ9 A;  4WNF A;  2AWI A;  2YHE A;  3APD A;  2L0I A;  3CEQ A;  2QY7 A;  3P2B A;  1OWN A;  1KLX A;  2IFU A;  3FU5 A;  3MYV A;  2J07 A;  1E8X A;  2C2L A;  3RIB A;  4F1S A;  2WXN A;  4ILH B;  2AXV A;  2V8S E;  3PE3 A;  4KZ0 A;  1HH8 A;  4GZ5 A;  1MHQ A;  4KZC A;  1FVF A;  3HVE B;  3IHV A;  5LX8 A;  2CG3 A;  2MOW A;  4FUL A;  2XPZ A;  3FUH A;  3D9N A;  1NZN A;  2KCK A;  4FLH A;  3JQ1 A;  2GRL A;  3D9J A;  3SBS A;  4HFG A;  4W9R A;  4DPR A;  3AU4 A;  2L6J A;  4UWK A;  3JCK C;  4RG9 A;  4XKC A;  1Y6I A;  2Y4U A;  2WQ6 A;  1JWG A;  2V5F A;  3BEE A;  4KBQ A;  5EDS A;  4JVS A;  4YVQ C;  3FTS A;  4I9E A;  4WWN A;  1HG2 A;  3PRZ A;  5FZQ A;  4A55 A;  4ILG A;  4WWP A;  3PNT B;  4B94 A;  2PZI A;  2MRI A;  3QB2 A;  4GZC A;  3SHF A;  2X6F A;  3TAX A;  4DI4 A;  1X5B A;  2VQ2 A;  2VJ8 A;  3Q49 B;  3PH0 C;  4MS6 A;  5FQ8 A;  3CK9 A;  2J4D A;  4HS2 A;  3FEX A;  4GB9 A;  2C0M A;  1DVP A;  2WXR A;  3SF4 A;  3PEV B;  1TJC A;  2XQ0 A;  3FTZ A;  3TXN A;  3Q4A B;  4C9B B;  3UT7 A;  4WNE A;  3CQG B;  4OYS A;  1U3C A;  4D10 C;  4AV7 A;  4UQY A;  1IQR A;  4IN3 B;  4Y6C A;  2GGF A;  3UT4 A;  2JEK A;  2UWJ G;  2NSZ A;  4BT9 A;  3G2W A;  4EBA A;  4U8H A;  2EQX A;  2YQ8 A;  3S7B A;  3HDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...