4Y6CA

Q17m crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
212
structure length
212
Chain Sequence
HMEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords ANSERINA PUTATIVE KINESIN LIGHT chain
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
total genus 89
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6cA00
1QQEA 1TJCA 4XI0A 4G24A 4J8DA 3ASHA 4EQFA 3TG4A 2VQ2A 4GA1A 1NA3A 5FZSA 3EDTB 2XCBA 3PE3A 4JA9A 1B89A 4APOA 2R5SA 2KCLA 5D0OD 1ZU2A 4AY6A 5EKQD 3ZPJA 3ZHEB 3RO3A 5M72A 4RG9A 4N2QA 1WM5A 4CDRA 5HI7A 2VSYA 5G05C 2C2LA 2UWJG 3TG5A 5LCWJ 4ABNA 1KLXA 3BEEA 2Y4TA 4HOSA 4KYOB 5BT1A 4GCNA 2Q7FA 2C0MA 3AS5A 4U07A 4JL0A 3GZ1A 4GZ3A 4JHRA 5JJTA 5JJ6A 4NQ0A 2JLBA 3MV2B 3S7BA 2OOEA 4HOQA 3S7DA 4J8EA 2FEZA 3RIBA 3K9IA 5KJLA 3OXLA 4WNEA 3NF1A 4CGWA 4GYWA 4N2SA 1P5QA 3E4BA 4G26A 3OXFA 4XI9A 5FJYA 2FI7A 3U4TA 4WNGA 5DIZA 3CEQA 3URZA 5FZQA 2KCKA 2LSVA 2XGOA 3Q15A 3U3WA 1QZ2A 3QWPA 4GA2A 4B94A 4BT8A 2P58C 5JJ7A 1IHGA 3KAEA 4U0SA 4G25A 2UY1B 3MV3B 3FP3A 3CVNA 5EX3A 4GZ5A 2MHKA 2HO1A 3QKYA 4GA0A 4JA7A 3GZ2A 5FZRA 3QDNA 4UQXA 4HOTA 4U0UA 3PDNA 3PE4A 3CK9A 2UY1A 3SZ7A 4I2ZA 2PL2A 4Y6WA 1KT1A 3GYZA 2IF4A 4W9RA 1YA0A 5BW8C 2NC9A 2KCVA 5CCLA 4YNDA 3CKCA 2LSUA 4BTAA 2I6HA 3QOUA 3UPVA 3CK7A 3LCAA 3ZHEA 4CGVA 3VTXA 1Y8MA 2QFCA 2L6JA 4UQYA 4BTBA 2WPVA 4KXKB 5LCWC 4YVQC 4WNDA 2HYZA 5EX0A 2AVPA 3CV0A 5G04J 2PQRA 3LY8A 1HXIA 3UQ3A 2GW1A 4N3BA 3IEGA 2YHCA 2XGMA 3QWVA 3AS4A 4HORA 4BT9A 3RU0A 5G04C 4IN3B 5A7DB 2PZIA 3LKUA 5KJKA 4N39A 3Q4AB 3O48A 5C1DA 3MEKA 3Q47B 5DBKA 5A6CA 3ASDA 3FWVA 2FF4A 2VYIA 5BNWA 1FCHA 3MKRA 2PQNA 2LNIA 4WUYA 2KC7A 2E2EA 4G2VA 2XGSA 4J0UA 4A1SA 4I17A 4GYOA 2FO7A 4I9CA 4Y6CA 3N71A 2VSNA 5D0QD 2XPIA 4I9EA 1A17A 3GW4A 3SF4A 2KATA 3CKBA 3LY9A 4G23A 3S7FA 3ZGQA 2DBAA 3LY7A 1HH8A 4I1AA 3CVPA 1PC2A 4AY5A 3ULQA 2BUGA 4YVOA 1ELRA 4U04A 2HR2A 1OUVA 2Y4UA 2C0LA 3OXGA 3QWWA 5G05J 3KS2A 2IFUA 3CVQA 3ZN3A 3CVLA 1WAO1 3JYSA 5ARGA 1NZNA 3S7JA 3R9AB 2YQ8A 4H7YA 3Q49B 2ONDA 3Q5MA 3KD7A 5FT9A 1KT0A 2FBNA 2WQHA 4GPKA 4N3AA 4N3CA 4ME2A 4HOUA 4G1TA 2XEVA 1W3BA 4WNFA 2V5FA 1E96B 3HYMB 3ZFWA 5CCMA 3FFLA 4I2WA 5CHEE 4KBQA 3WXXA 5FTPA 4BWRA 5AYWD 3UUXA 5KJNA 3AS8A 4UI9K 4NRHB 4RG6A 3LPZA 4U0ZA 3RJVA 3VTYA 5KJMA 4UI9J 1XNFA 3LYAA 4UQZA 1HZ4A 2VGYA 4F3VA 4LEUA 1NA0A 2VGXB 5HQ8A 2J9QA 4J8FA 3ASGA 4UI9C 3CK8A 3ESKA 5ARFA 4GZ6A 4H7XA 3TGOA 3ASFA 4AIFA 3RKVA 4XIFA 4GYYA 3MA5A 1ZBPA 4GCOA 3TAXA 4O6FA 2XCCA 4N5CA 1IYGA 2VGXA 4AM9A 3RO2A 1ELWA
chains in the Genus database with same CATH superfamily
4J8DA 2A4ZA 4O60A 2J4BA 3JXIA 1MX4A 1H6PA 5EYPF 1N4SA 2ZXWE 2VQ2A 4GA1A 5AQ9A 5ENRD 1SZAA 2VSXE 1TN7A 2KCLA 5T3RA 4LNBA 1ZU2A 3ZPJA 1TNUA 2V4LA 1QYMA 4U63A 3T8MA 3FDHA 1Z5SC 4FU3A 1TR4A 3HVEB 3ZRHA 3DEPA 2C2LA 4GMJA 3C98A 4TRQA 1JWGA 5ENTD 4WWOA 3SO8A 3BEEA 5BT1A 3MX3A 1S64A 1SW6A 1YYHA 5FINA 2ZGGA 4GCNA 4RLYA 3HVEA 2C0MA 3AS5A 1HO8A 3FU5A 3TWUA 3CHQA 2BF0X 5G2NA 1L5JA 3FUEA 2X38A 2H6GA 5JJTA 1E8XA 3B13A 5ENSD 1TYQG 2R2LA 4U8VD 3O4ZA 3C3OA 3RRNB 4J8EA 3SFYA 4DI3A 1U2VG 5BV0A 4ZHBA 4WNEA 2I9CA 3NF1A 3BUAA 2BKKB 3C3QA 3KSLA 4ILHB 1QNFA 1Q2ZA 1N4QA 2AW6A 1HF8A 4L7TA 1N9AA 5FJYA 1K1AA 4JB8P 2MRIA 4AP2A 3QC1A 3CEQA 4K03A 4CYMD 4U7EB 2XGOA 1ELKA 2KZTB 3Q15A 2IU1A 1DVPA 4GZDA 2X3MA 1QZ2A 3L6AA 4UWFA 1OT8A 3UTMA 2P9NG 5AJDA 3F6QA 3ZNGA 1N4PA 4U0SA 1U3CA 3LEWA 2NSZA 3CSTA 5EX3A 3HXBA 4HRMB 2KZTA 2R02A 3PZ3A 2RG8A 4IYPA 3FTXA 1OXJA 2HE0A 4TXQA 4HOTA 4K5BA 4GMRA 1DC2A 3CK9A 2QC9A 4I2ZA 4GZCA 2WXJA 4LUNU 4RSYA 1QBQA 1LD8A 3L08A 1BD8A 4RQIA 1N0RA 3DBSA 3OAWA 4QFVA 2P2CP 2NC9A 2ETBA 1FVFA 1FPPA 3IKOB 2F37A 3FULA 2I6HA 5ENNA 3ABLE 3D9OA 4J7WA 1HX8A 2L6JA 4UQYA 3T5XA 4F6RD 2RD0A 1VDYA 2AVPA 3CV0A 5EX0A 5FQ7A 5G04J 1MJ0A 3LY8A 3UQ3A 2GW1A 3IEGA 1X81A 3WG7E 3QWVA 1K3ZD 3Q7FA 3AS4A 4JPSA 3FU3A 1UJJA 3G2TA 4IN3B 2PZIA 3LKUA 4LRZA 2V8SE 1BLXB 2WVIA 3ZYQA 5AN8A 3Q4AB 3O48A 5C1DA 3MEKA 5ENQD 4X8QA 5BXUA 1UN9A 2EILE 3HXCA 3UIOC 2FF4A 3HDXA 2VYIA 2WQ7A 1E7VA 2OV8A 1FCHA 4WAFA 4XKCA 3MKRA 3NB2A 4ANVA 5LFAA 3DPYA 2XGSA 4G8KA 3MJWA 4I17A 4ANXA 3L54A 4GYOA 2FO7A 4Y6CA 2AJAA 3ASOE 5AQBA 4BETA 5D0QD 3FUIA 4XKBA 1Z6TA 2ZIRA 1MZCA 2LXLA 2ZISA 1X5BA 3ZXPA 3FUFA 3PRZA 3EHQA 4G23A 2XENA 3HXDA 2DBAA 4TUMA 2VGEA 3JUEA 5EIBE 3CVPA 2BUGA 4YVOA 4UWKA 2IO2C 4MS6A 4L23A 5JHBA 1OUVA 2Y4UA 1H19A 2VTBB 3D9NA 2V0PA 4UWLA 5AJLA 4RVBA 5G05J 1RZ4A 3PZ2A 1XGWA 1WAO1 3UKRG 3VLEA 1K8KG 3R9AB 2NXPA 3LS8A 3Q49B 4FULA 4DK5A 1TNOA 5B1AE 1KT0A 2VSOE 2WQHA 4I6GA 2WXQA 2VTBA 4N3CA 4XEIG 1W3BA 2V4HC 2DWZA 3MYVA 5J90A 4I6EA 3SGHA 3FTWA 1O1SA 3ZFWA 1MX6A 4CT0A 4I2WA 4KMOA 4KBQA 2GROB 5FTPA 5AYWD 2ZGDA 3SBSA 4UI9K 4EHMA 2DVWA 4RG6A 4Q96A 3CSFA 4UI9J 3G2UA 4UQZA 1LTXA 5CMYA 2ILRA 3ZVVA 5ARFA 5KNGA 2QYJA 3TGOA 4CCAA 3RRMB 3DXMG 4GCOA 3Q9NC 4BY6A 4O6FA 2XCCA 3TWRA 3ESLA 3JUIA 4A63B 1IYGA 3D9LA 2F0YA 2Y0BG 1H6KA 3TWWA 1Z3XA 2Y3AA 1QQEA 5ITZF 1K1BA 4GAAA 4EPZA 3APDA 1TN6A 3TG4A 3DRAA 4I1OB 2M63A 3EHNA 1N94A 1GW6A 3FY4A 3DWLG 2WXKA 3EDTB 2OCCE 4ZFHA 4APOA 1OCOE 1YCSB 5D0OD 5EKQD 3ZHEB 3RO3A 5M72A 4RG9A 3UM0A 2EINE 3CHSA 2IOSA 5HI7A 3C3RA 1UG3A 5G05C 1KPSB 3B7BA 3TG5A 3CVUA 1SZ9A 4ABNA 1KLXA 3SNXA 4NIKA 1FVHA 4KYOB 2V5QC 1UN8A 4KT6B 2XPZA 3R9MA 2Q7FA 2X6KA 5KBAA 2WXOA 1KZPA 3T5VA 1N0QA 3OTNA 4GZ3A 2L0IA 4JHRA 5JJ6A 1S63A 1O1TA 2MYOA 2OOEA 2CHZA 3NOGD 3PREA 4P29A 3B95A 3RAUA 4CGWA 3FH8A 4JD2G 3ABME 1P5QA 4QQIA 4DX1A 2RFMA 5E76A 3OXFA 1OCRE 4O1OA 1NP7A 3U4TA 5HRYA 2QYUA 1PAQA 4MKTA 3CVXA 5EIDA 3URZA 3I3NA 4PH4B 2KCKA 1H2VC 2YNQA 2IY0C 1IXVA 5AQAA 3P1UA 4FHJA 3EU5A 4WWNA 4EZKA 1LD7A 2EQXA 2CFZA 1JPLA 4BT8A 2H6FA 2GRRB 5JJ7A 1IHGA 3HXEA 4CEMA 1SA4A 2HO1A 2LUHA 2XRYA 3I4RB 3GZ2A 3FEYA 4UQXA 1JCSA 5BXOA 3PDNA 1D9SA 3SZ7A 3L16A 2DZOA 4Y6WA 2DIWA 2R05A 4FJZA 4YDYA 3MCXA 2KCVA 3T9KA 2GRNB 3DSUA 2JABA 3IHYA 4U96D 1OWPA 2WXLA 3CKCA 2LSUA 3QOUA 2XRZA 2H6HA 3LCAA 4KZCA 4HFGA 3PUKA 2WPVA 4ACKA 4CZ2D 1EDUA 4KXKB 4WNDA 3BG0B 5FQ4A 3U66A 3SI5A 1WY6A 2XGMA 3JCKC 3NAWA 1BU9A 4PS3A 1UOHA 5CBOA 3PZ1A 4BT9A 5FIOA 5JHAA 5KJKA 4HRLA 3FEXA 2ETAA 3TWVA 4JHJA 4OVVA 3ZW3A 3R7RA 3PNLB 5AAOA 2WB2A 4A3TA 3B7SA 3J5QB 3HXFA 3D9KA 4FJYA 4K5CA 4WUYA 2E2EA 2AWIA 2R59A 3JQ0A 3CHRA 4PUCA 2WXFA 3FTUA 1HS6A 1DNPA 5B3SE 4I9CA 3SBTB 3R7QA 1IQUA 3VLFA 4B8CB 4Q69A 1PY1A 2XPIA 4I9EA 3BQOA 3D9IA 2WXNA 1A17A 4GTRA 4MBGA 5CMWA 3GW4A 4TXPA 3RSEG 3G2VA 3ZYKA 4BERA 1PC2A 3ULQA 4OAVB 5BPPA 1ELRA 4U04A 4BX8A 3ZU7B 2C0LA 1OWNA 1MHQA 2WMOA 4F1SA 2IFUA 3E32A 3ZN3A 4UWHA 3FUDA 3JYSA 5ARGA 3S7JA 2KM4A 2ONDA 1YMPA 4C9BB 3D9PA 4FHKA 5FT9A 5LP0A 5JMND 1N52A 4GTQA 2WXHA 5CECB 1KZOA 1S70B 3SFXA 4F7AA 3EJNA 1IQRA 3ABKE 3QNKA 2OEWA 3L13A 4E6HA 5CHEE 1MQSA 2XZDG 3JXJA 3WXXA 3UUXA 5KJNA 4V3IA 4Q94A 1DCEA 3LPZA 4L1BA 1OCZE 3VTYA 5KJMA 2WMNA 5E75A 1HZ4A 4L9PA 3ULYA 4C48B 2IQCA 4XX5A 5HQ8A 2RFAA 3PNTB 4DX5D 4ATGA 3C5RA 5EDSA 4J8FA 4EZJA 2B6CA 3ULEG 4H7XA 3FUNA 3ASFA 4AIFA 5ANRA 4KVOA 5EYLA 4DRXE 4GYYA 3MA5A 4HBDA 5KNHD 3ASNE 3QK0A 4N5CA 1HG2A 4JEUA 2P9IG 3D9HA 3CQGB 2IONA 4O1PA 1TNZA 3DXKG 1NA3A 5FZSA 5T8IA 4IULA 3FTVA 1FT1A 2XCBA 3HHMA 4JA9A 2NYJA 1B89A 4U8YD 2L0TB 2R5SA 1N54A 4BFRA 4AY6A 4BSZB 1AWCB 1SVXA 4NURA 4N2QA 3FTSA 3KEAA 1N95A 2VSYA 4HLLA 4TV3A 3S2AA 2UWJG 2CG2A 2CG3A 4FP7A 4FADA 3TWXA 2Y4TA 4UUCA 1MYOA 4F1PA 3ZXSA 3AG4E 2WXPA 3LJNA 1N4RA 3I5PA 4U07A 3V30A 2OEVA 3GZ1A 4JL0A 4AXHA 4JVSA 4JXTA 4B8AA 2QZAA 4NQ0A 2JLBA 4AV7A 3MV2B 2BTDA 3S7BA 4HOQA 4EECA 2FEZA 3RIBA 2E0IA 4FLHA 1O1RA 2PM7A 2L9BA 4N2SA 4GB9A 4MLPA 3G2SA 3E4BA 4G26A 3PZDA 3DEOA 4M7CA 3FUHA 3RK6A 2FI7A 3TJPA 3PH0C 4GTOA 4BX9A 4HVBA 1INZA 2BKGA 3FUJA 4JHKA 3U3WA 4XE0A 4GA2A 3EHRA 4B94A 4KVMA 5AIJA 3KAEA 3E34A 3GZSA 3MV3B 3FP3A 1NI1A 3DSWA 4ANUA 3CVNA 4GZ5A 5JA4D 3SQVA 4GA0A 4EBAG 1TEZA 5C2YA 4JA7A 4PS8A 4PDXA 3ZIMA 2OVBA 3HIZA 4AJWA 3FHEA 1HU3A 3PEUB 3SY2A 2PL2A 4CRWA 3GYZA 4AEZC 2IF4A 4HLEA 5BW8C 3UKUG 3CR3A 2X6HA 4A3VA 5CCLA 3E37A 1V55E 5FQ8A 3EIJA 3B7RL 4BTAA 4DLQA 3IHVA 3ZHEA 4J8YA 2XHEA 1BPOA 2F8XK 3VTXA 1Y8MA 1Y6IA 4BTBA 2X6FA 4DX6D 3BU8A 4YVQC 2HYZA 3EHMA 3NQPA 4NACA 5ANLA 4N3BA 2XEEA 2YHCA 4CDMA 2A5EA 3L17A 2VJ8A 1EPUA 3UT8A 1TNYA 3V79K 4N39A 4LSZE 3Q47B 2GRMA 2XS1A 5DBKA 3CIAA 3TL5A 3UM3A 1NFIE 3FWVA 1NL4A 3U9WA 1BI7B 5D66A 2P9SG 2LNIA 1TN8A 5IY5E 2KC7A 4KZ0A 1E8WA 4J0UA 3HRAA 3KEZA 1RW2A 4I1MA 3CHMA 4OAUC 3N71A 4IRUA 3HG0D 4B93B 2VSNA 5D2MC 1HE8A 3UT7A 4G11A 2IEJA 3Q75A 3QARA 3SF4A 5J08A 1OY3D 2AXUA 3CVYA 3S7FA 3ZGQA 3ONLA 4J6IA 3LY7A 5BUZA 3Q9UC 3TXNA 1HH8A 4I1AA 2FO1E 4AY5A 4N5QA 2GRLA 5H7PA 2HR2A 2KXPC 3ENEA 3KS2A 2DCPA 3PS6A 4EBAA 1DCQA 1FT2A 3CVLA 4OYSA 5ENPD 4D10C 3UMVA 5FWQA 2R17C 2YQ8A 3QJZA 3KD7A 4YDEA 2LAHA 2F8YA 2GGFA 2ETCA 1N11A 4HNAD 4GPKA 4N3AA 3D9JA 4ME2A 4BESA 2P9UG 2XEVA 1SA5A 3P2BA 2V5FA 1H6OA 2HM8A 2IJGX 3HYMB 1G3NB 5CCMA 3FFLA 3PEVB 3RRUA 1HFAA 2H6IA 2YINA 4GTPA 4BWRA 4ATZD 3DSTA 4FLBA 4BEPA 5T4YA 3T8KA 3MKQB 2FULA 1H0AA 3W9FA 3V31A 3PUJA 3FH7A 5LOZA 1JWFA 2J9QA 3Q7AA 3PZ4A 3ASGA 2J07A 5AQ7A 3CK8A 3ESKA 4GZ6A 2CHWA 4DUIA 3RKVA 1WG0A 3VLDA 4K5AB 4XIFA 3LXUX 3CHPA 4LG6A 3SHFA 1ZBPA 3TAXA 2IOLA 3AAAC 3CGHA 3MKQA 2P9LG 1HG5A 5CRVA 3TWSA 3FUKA 3ZYMA 1E90A 2AXVA 3RO2A 3UI2A 4FC8A 4ILIA 1TJCA 2I1KA 4XI0A 4XZ4A 3EIQC 4G24A 2I1JA 4DLOA 3ASHA 4EQFA 2A5UA 4B89A 4DX2A 4U95D 4ILGA 4GTMA 3LJ3A 3Q78A 1WDYA 3APCA 4L2LA 3PE3A 4URKA 3L82A 3AG2E 5KWDA 3EU9A 3NBNB 4TXRA 4GTTA 2WM9A 5CEDB 2WXMA 3UM1A 1WM5A 4CDRA 3AG3E 4DJAA 3CHOA 4HS2A 3X2QE 1JCQA 5LCWJ 4CDNA 3ML8A 4GMLA 4OVUA 4HOSA 5CERB 4TUUA 2DZNA 2OVFA 5CBNA 2QY7A 5CEAA 1EF1C 2XS8A 1JCRA 1SQMA 3LDZA 3DSSA 3J5PA 3PVLA 3FUMA 3SFZA 4JC8A 3E30A 2JEKA 3FU0A 2RKKA 1IHBA 3UX4A 1UW4B 3DSVA 3SD5A 4C0MA 5EN5D 3S7DA 1LF8A 2P9KG 2YHEA 3UT4A 3K9IA 5KJLA 3V2XA 3OXLA 1OWLA 3ZYLA 3UXGA 4UWGA 4GYWA 4LNGA 4MRUA 1MX2A 4I43A 3AU5A 2DYRE 2CFUA 3LVRE 4XI9A 3L22A 3AJIA 1H2TC 4WNGA 3U64A 5DIZA 1BI8B 3CVWA 3ML9A 5FZQA 1ZB1A 2LSVA 3IBEA 4HRNA 3D9MA 4JW1A 5BV1A 4GTSA 1A5EA 2IO3C 1D8EA 3QWPA 3LVQE 3MGBA 1O5MA 3Q79A 4CT4A 2P58C 4G25A 2UY1B 3G2WA 2DYSE 4APFA 2J08A 1OCCE 3TWTA 3AG1E 3C72A 3ONKA 2MHKA 3QKYA 4AVXA 1H2UA 2ZU6B 4GTVA 4HXIA 3EUVA 5FZRA 2GRPB 3QDNA 3TXMA 4A55A 2XEHA 3FTYA 4U0UA 4G8LA 2GRQB 2Y1LE 3PE4A 2LAIA 2UY1A 5CRUA 3ZKJA 1V54E 4R7LA 1KT1A 4W9RA 1YA0A 4AOFA 2J49A 4YNDA 3ISMC 3D3MA 2B0OE 4EZLA 4HI8A 3UPVA 3CK7A 1EYHA 4CGVA 5AENA 3FH5A 2QFCA 3UIPC 2J09A 3KSQA 5LCWC 5KCMA 3DSXA 2PQRA 2KBXA 5G55A 4LERA 1HXIA 3BG1B 2XZTG 3W9GA 3ZEFA 4HORA 4HI9A 3RU0A 3DPDA 2J4DA 3Q73A 5G04C 5A7DB 4BSXA 3B7UX 2EIJE 4J8SA 3IXEA 1E8YA 3FU6A 4JZYA 2BEDA 5A6CA 3ZUVB 3ASDA 2WXRA 3NZUA 2P9PG 5BNWA 2PNNA 4FA6A 3L9TA 2PQNA 3UM2A 3E33A 2I2OA 4GPMA 2EIME 1S0PA 1D8DA 1OWOA 4G2VA 1Z3YA 2EIKE 4A1SA 4ACLA 4YDOA 2AXZA 1JUQA 4LNUD 4M3OA 3CVVA 4K0RA 4C0EA 5B1BE 1AP7A 4YDWA 4WWPA 2LXMA 2WXIA 2KATA 3CKBA 3LY9A 5EILA 2J8SD 3CQCB 5ENOD 4A1GA 2XPYA 2Y69E 4U8HA 3UINC 3B7TA 3IV0A 3APFA 4DI4A 3OXGA 3QWWA 1TNBA 3CVQA 2LO6A 2R03A 1NZNA 2PM6A 2WQ6A 2XQ0A 3MZLB 4H7YA 1UJKA 3Q5MA 1E8ZA 3QB2A 5HS0A 1OWMA 2FBNA 4HOUA 4HQDA 4G1TA 4WNFA 4PS7A 4DPRA 1E96B 3FTZA 4GU5A 5LX8A 3AU4A 3TWQA 3AS8A 4NRHB 2CHXA 3JQ1A 4HB5A 4U0ZA 3I4GA 3RJVA 3CLJA 4ANWA 1XNFA 3LYAA 1E7UA 1TJFA 5FQ6A 4B0ZA 2VGYA 4F3VA 4LEUA 1NA0A 2VGXB 4F53A 1U3DA 2MOWA 4UI9C 2X6IA 2WXGA 5AARA 5A23A 1IKND 4Z68A 2L6BA 4E85A 4JEHA 3V2OA 3NOCD 4L2YA 3NZSA 4I6JA 3QAQA 2VGXA 4AM9A 4LCTA 4DX7D 2X6JA 5HKPA 1ELWA
chains in the Genus database with same CATH topology
1Z3XA 2Y3AA 1QQEA 4ILIA 1TJCA 2I1KA 3CQGB 4XI0A 3EIQC 4XZ4A 4G24A 2I1JA 2IONA 4J8DA 4GAAA 3ASHA 4DLOA 2A4ZA 4EPZA 3APDA 4EQFA 2A5UA 4B89A 3TG4A 4I1OB 2M63A 2J4BA 2VQ2A 4ILGA 4GA1A 1NA3A 3EHNA 3LJ3A 5FZSA 5T8IA 1GW6A 3FY4A 4IULA 3FTVA 3APCA 2WXKA 3EDTB 4L2LA 2XCBA 3HHMA 1SZAA 3PE3A 4JA9A 1B89A 4URKA 2VSXE 2L0TB 2R5SA 4APOA 2KCLA 5T3RA 1N54A 5D0OD 4BFRA 1ZU2A 4AY6A 5EKQD 3ZPJA 3ZHEB 2V4LA 3RO3A 5M72A 4U63A 4RG9A 4NURA 4N2QA 3T8MA 3FDHA 2WM9A 4FU3A 2WXMA 3CHSA 1WM5A 3HVEB 3FTSA 4CDRA 2IOSA 3ZRHA 5HI7A 4DJAA 1UG3A 2VSYA 3CHOA 5G05C 2C2LA 4HS2A 4GMJA 4TV3A 3S2AA 3C98A 4TRQA 2UWJG 3TG5A 2CG2A 1JWGA 1SZ9A 2CG3A 3CVUA 4FP7A 5LCWJ 4FADA 4CDNA 4WWOA 3ML8A 4ABNA 1KLXA 3SNXA 4GMLA 3BEEA 2Y4TA 4OVUA 4HOSA 1FVHA 4KYOB 4TUUA 5BT1A 2OVFA 2QY7A 1UN8A 3MX3A 3ZXSA 4KT6B 1EF1C 2WXPA 2XPZA 4GCNA 1SQMA 2Q7FA 3I5PA 3LDZA 2X6KA 3HVEA 2C0MA 3AS5A 1HO8A 4U07A 3FU5A 3CHQA 3PVLA 2WXOA 2BF0X 5G2NA 3FUMA 4JL0A 3GZ1A 3SFZA 3T5VA 4AXHA 4JVSA 1L5JA 4JC8A 3OTNA 3FUEA 4GZ3A 2L0IA 2X38A 4JHRA 4JXTA 5JJTA 2JEKA 5JJ6A 3FU0A 4B8AA 1E8XA 4NQ0A 3B13A 2JLBA 3UX4A 1UW4B 4AV7A 3SD5A 3MV2B 2BTDA 4C0MA 3S7BA 2OOEA 3O4ZA 4HOQA 3S7DA 3RRNB 4J8EA 1LF8A 4EECA 2CHZA 4DI3A 2FEZA 3RIBA 2YHEA 5BV0A 3UT4A 3K9IA 2E0IA 3PREA 5KJLA 3OXLA 1OWLA 4FLHA 4P29A 4WNEA 3ZYLA 2I9CA 3NF1A 2PM7A 4UWGA 4CGWA 3FH8A 4ILHB 2L9BA 4GYWA 1QNFA 4N2SA 4GB9A 4MLPA 3G2SA 4MRUA 1P5QA 3E4BA 4G26A 3PZDA 4I43A 3AU5A 2CFUA 3FUHA 5E76A 3LVRE 3OXFA 4XI9A 2AW6A 3RK6A 1HF8A 4L7TA 3L22A 5FJYA 2FI7A 3TJPA 1H2TC 1NP7A 3PH0C 3U4TA 4WNGA 2MRIA 1PAQA 3QC1A 4MKTA 3CEQA 5DIZA 3U64A 3URZA 3I3NA 4PH4B 4AP2A 3CVWA 3ML9A 4K03A 5FZQA 2KCKA 1H2VC 2LSVA 2YNQA 4BX9A 3IBEA 2XGOA 4HVBA 3D9MA 4JW1A 5BV1A 1ELKA 1INZA 2KZTB 3FUJA 3Q15A 2IU1A 4JHKA 3P1UA 1DVPA 4FHJA 4GZDA 2X3MA 3U3WA 1QZ2A 4XE0A 4WWNA 3L6AA 3QWPA 4GA2A 4UWFA 4EZKA 3LVQE 3MGBA 2EQXA 2CFZA 1JPLA 4B94A 5AJDA 4CT4A 4BT8A 2P58C 4KVMA 5AIJA 5JJ7A 1IHGA 3KAEA 4U0SA 4G25A 1U3CA 3LEWA 2UY1B 3G2WA 3GZSA 3MV3B 4CEMA 3FP3A 4APFA 2NSZA 3CSTA 4ANUA 2J08A 3CVNA 5EX3A 4GZ5A 3ONKA 2HO1A 2MHKA 3QKYA 2KZTA 4AVXA 1H2UA 4GA0A 4EBAG 2ZU6B 1TEZA 4HXIA 2RG8A 4IYPA 5C2YA 2XRYA 3I4RB 4JA7A 3FTXA 3GZ2A 5FZRA 3QDNA 3TXMA 4A55A 3FEYA 3FTYA 4UQXA 4HOTA 4U0UA 4PS8A 4PDXA 3ZIMA 3PDNA 3PE4A 2OVBA 3HIZA 2LAIA 3CK9A 1HU3A 2UY1A 3FHEA 4AJWA 3SZ7A 3PEUB 4I2ZA 3L16A 2PL2A 2WXJA 4GZCA 4LUNU 4RSYA 4CRWA 3L08A 4Y6WA 4R7LA 2DIWA 1KT1A 3GYZA 4AEZC 2IF4A 4W9RA 4HLEA 1YA0A 3DBSA 4FJZA 4AOFA 3OAWA 4QFVA 5BW8C 2NC9A 2J49A 3CR3A 2X6HA 2KCVA 3MCXA 4YNDA 4A3VA 5CCLA 1FVFA 3IHYA 1OWPA 2WXLA 3D3MA 3IKOB 5FQ8A 3EIJA 3B7RL 3CKCA 2LSUA 3FULA 4EZLA 4BTAA 2I6HA 5ENNA 4DLQA 3QOUA 3IHVA 3UPVA 2XRZA 3CK7A 3LCAA 1EYHA 3ZHEA 3CVXA 4CGVA 5AENA 2XHEA 1BPOA 3FH5A 4KZCA 3D9OA 4HFGA 3PUKA 3VTXA 1HX8A 1Y6IA 1Y8MA 2QFCA 2L6JA 4UQYA 3T5XA 4BTBA 2X6FA 2RD0A 2WPVA 4ACKA 2J09A 1EDUA 4KXKB 1VDYA 5LCWC 4YVQC 5KCMA 2HYZA 3EHMA 2AVPA 3CV0A 3NQPA 4WNDA 5EX0A 5FQ7A 5G04J 2PQRA 5G55A 3LY8A 4NACA 5ANLA 4LERA 3BG0B 5FQ4A 1HXIA 3UQ3A 3SI5A 3U66A 2GW1A 4N3BA 3BG1B 3IEGA 2YHCA 1WY6A 2XGMA 3JCKC 3QWVA 4CDMA 3AS4A 3ZEFA 4HORA 4PS3A 3L17A 4JPSA 4BT9A 3RU0A 2VJ8A 3FU3A 1UJJA 3DPDA 2J4DA 3G2TA 5G04C 1EPUA 4IN3B 5A7DB 2PZIA 3LKUA 4LRZA 3UT8A 4BSXA 5JHAA 3B7UX 4J8SA 5KJKA 2V8SE 2WVIA 3ZYQA 3FEXA 4N39A 3Q4AB 3O48A 5C1DA 3MEKA 1E8YA 3FU6A 4JHJA 3Q47B 4JZYA 2GRMA 4OVVA 3ZW3A 5DBKA 3CIAA 3R7RA 3TL5A 3PNLB 5A6CA 3ASDA 2WB2A 2WXRA 4A3TA 1UN9A 3FWVA 3NZUA 2FF4A 3HDXA 3B7SA 2VYIA 2WQ7A 3U9WA 1E7VA 5BNWA 2OV8A 1FCHA 4WAFA 3R9AB 4FA6A 4XKCA 3MKRA 2PQNA 2I2OA 2LNIA 3D9KA 4FJYA 4WUYA 2KC7A 4ANVA 2E2EA 1S0PA 1OWOA 2AWIA 5LFAA 4G2VA 2R59A 4KZ0A 1Z3YA 3JQ0A 1E8WA 2XGSA 4J0UA 4A1SA 4ACLA 3CHRA 4PUCA 3MJWA 4I17A 4ANXA 2WXFA 3FTUA 3KEZA 3L54A 4D10C 2AXZA 1HS6A 4I1MA 3CHMA 1DNPA 4GYOA 2FO7A 4I9CA 3SBTB 4Y6CA 3R7QA 3N71A 1JUQA 4IRUA 2VSNA 1IQUA 3VLFA 4B8CB 5D0QD 4Q69A 3FUIA 4M3OA 1PY1A 1HE8A 4XKBA 1Z6TA 3UT7A 3CVVA 2XPIA 4I9EA 4K0RA 4C0EA 3D9IA 2WXNA 1A17A 4G11A 5CMWA 3GW4A 1X5BA 3PRZA 3FUFA 3QARA 4WWPA 3SF4A 5J08A 2WXIA 2AXUA 2KATA 3CVYA 3CKBA 3LY9A 4G23A 3S7FA 3ZGQA 3G2VA 3ONLA 2DBAA 3ZYKA 3CQCB 4J6IA 3LY7A 5BUZA 3TXNA 1HH8A 4I1AA 4A1GA 3CVPA 1PC2A 2XPYA 4AY5A 3ULQA 2BUGA 4U8HA 4YVOA 2GRLA 4UWKA 5BPPA 1ELRA 4U04A 4BX8A 4MS6A 4L23A 5JHBA 3B7TA 3IV0A 2HR2A 3APFA 1OUVA 2Y4UA 1H19A 2VTBB 4DI4A 2C0LA 3D9NA 3ENEA 3OXGA 2V0PA 3QWWA 4UWLA 5AJLA 4RVBA 5G05J 1OWNA 1MHQA 2WMOA 3KS2A 2IFUA 4F1SA 2DCPA 3PS6A 3CVQA 4EBAA 3ZN3A 4UWHA 2LO6A 1XGWA 3CVLA 3FUDA 4OYSA 1WAO1 3JYSA 3VLEA 5ARGA 1NZNA 3S7JA 3UMVA 2KM4A 2PM6A 5FWQA 2R17C 2XQ0A 3MZLB 2YQ8A 1UJKA 2NXPA 3LS8A 2ONDA 3Q49B 3KD7A 3Q5MA 3QJZA 4H7YA 2LAHA 4C9BB 3D9PA 4FULA 4FHKA 2GGFA 4DK5A 1E8ZA 3QB2A 5FT9A 1OWMA 5LP0A 1KT0A 2FBNA 2VSOE 2WQ6A 2WQHA 4I6GA 2WXQA 4N3AA 2VTBA 4GPKA 3D9JA 4N3CA 4ME2A 4HOUA 4G1TA 2XEVA 3P2BA 1W3BA 4WNFA 1N52A 2V5FA 2WXHA 3MYVA 4PS7A 2HM8A 5J90A 4F7AA 3EJNA 4DPRA 4I6EA 3SGHA 3FTWA 1IQRA 1E96B 2IJGX 3FTZA 3QNKA 3HYMB 4GU5A 3ZFWA 5CCMA 3FFLA 3PEVB 4CT0A 4I2WA 3RRUA 3L13A 1HFAA 5LX8A 4E6HA 5CHEE 4KMOA 2YINA 4KBQA 1MQSA 3AU4A 3WXXA 5FTPA 4BWRA 5AYWD 3UUXA 5KJNA 3AS8A 3SBSA 4UI9K 4FLBA 4NRHB 4V3IA 2CHXA 4Q94A 4RG6A 3JQ1A 4Q96A 5T4YA 3CSFA 3LPZA 4U0ZA 3I4GA 3RJVA 4L1BA 3VTYA 5KJMA 3CLJA 4UI9J 4ANWA 2WMNA 3MKQB 2FULA 3G2UA 1H0AA 1XNFA 3LYAA 5E75A 1E7UA 1TJFA 1HZ4A 4UQZA 5FQ6A 2VGYA 4B0ZA 4F3VA 4LEUA 1NA0A 5CMYA 2IQCA 3PUJA 3FH7A 2VGXB 1JWFA 4XX5A 2J9QA 5LOZA 5HQ8A 4F53A 1U3DA 2MOWA 3PNTB 5EDSA 4ATGA 2ILRA 4J8FA 4EZJA 3ASGA 2J07A 3ZVVA 4UI9C 2X6IA 2WXGA 3CK8A 3ESKA 4GZ6A 5ARFA 2CHWA 4H7XA 3FUNA 5A23A 3TGOA 4CCAA 3RRMB 3ASFA 4AIFA 3RKVA 5ANRA 4KVOA 3VLDA 4XIFA 3LXUX 3CHPA 3SHFA 4GYYA 3MA5A 4E85A 1ZBPA 4GCOA 4JEHA 3TAXA 3QK0A 4BY6A 2IOLA 4O6FA 3CGHA 2XCCA 4N5CA 3MKQA 3ESLA 1HG5A 3JUIA 4L2YA 3FUKA 3NZSA 3ZYMA 4I6JA 3QAQA 1IYGA 2VGXA 1HG2A 3D9LA 4JEUA 4AM9A 1E90A 2AXVA 4LCTA 2X6JA 3RO2A 4FC8A 1H6KA 1ELWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQE A;  1TJC A;  4XI0 A;  4G24 A;  4J8D A;  3ASH A;  4EQF A;  3TG4 A;  2VQ2 A;  4GA1 A;  1NA3 A;  5FZS A;  3EDT B;  2XCB A;  3PE3 A;  4JA9 A;  1B89 A;  4APO A;  2R5S A;  2KCL A;  5D0O D;  1ZU2 A;  4AY6 A;  5EKQ D;  3ZPJ A;  3ZHE B;  3RO3 A;  5M72 A;  4RG9 A;  4N2Q A;  1WM5 A;  4CDR A;  5HI7 A;  2VSY A;  5G05 C;  2C2L A;  2UWJ G;  3TG5 A;  5LCW J;  4ABN A;  1KLX A;  3BEE A;  2Y4T A;  4HOS A;  4KYO B;  5BT1 A;  4GCN A;  2Q7F A;  2C0M A;  3AS5 A;  4U07 A;  4JL0 A;  3GZ1 A;  4GZ3 A;  4JHR A;  5JJT A;  5JJ6 A;  4NQ0 A;  2JLB A;  3MV2 B;  3S7B A;  2OOE A;  4HOQ A;  3S7D A;  4J8E A;  2FEZ A;  3RIB A;  3K9I A;  5KJL A;  3OXL A;  4WNE A;  3NF1 A;  4CGW A;  4GYW A;  4N2S A;  1P5Q A;  3E4B A;  4G26 A;  3OXF A;  4XI9 A;  5FJY A;  2FI7 A;  3U4T A;  4WNG A;  5DIZ A;  3CEQ A;  3URZ A;  5FZQ A;  2KCK A;  2LSV A;  2XGO A;  3Q15 A;  3U3W A;  1QZ2 A;  3QWP A;  4GA2 A;  4B94 A;  4BT8 A;  2P58 C;  5JJ7 A;  1IHG A;  3KAE A;  4U0S A;  4G25 A;  2UY1 B;  3MV3 B;  3FP3 A;  3CVN A;  5EX3 A;  4GZ5 A;  2MHK A;  2HO1 A;  3QKY A;  4GA0 A;  4JA7 A;  3GZ2 A;  5FZR A;  3QDN A;  4UQX A;  4HOT A;  4U0U A;  3PDN A;  3PE4 A;  3CK9 A;  2UY1 A;  3SZ7 A;  4I2Z A;  2PL2 A;  4Y6W A;  1KT1 A;  3GYZ A;  2IF4 A;  4W9R A;  1YA0 A;  5BW8 C;  2NC9 A;  2KCV A;  5CCL A;  4YND A;  3CKC A;  2LSU A;  4BTA A;  2I6H A;  3QOU A;  3UPV A;  3CK7 A;  3LCA A;  3ZHE A;  4CGV A;  3VTX A;  1Y8M A;  2QFC A;  2L6J A;  4UQY A;  4BTB A;  2WPV A;  4KXK B;  5LCW C;  4YVQ C;  4WND A;  2HYZ A;  5EX0 A;  2AVP A;  3CV0 A;  5G04 J;  2PQR A;  3LY8 A;  1HXI A;  3UQ3 A;  2GW1 A;  4N3B A;  3IEG A;  2YHC A;  2XGM A;  3QWV A;  3AS4 A;  4HOR A;  4BT9 A;  3RU0 A;  5G04 C;  4IN3 B;  5A7D B;  2PZI A;  3LKU A;  5KJK A;  4N39 A;  3Q4A B;  3O48 A;  5C1D A;  3MEK A;  3Q47 B;  5DBK A;  5A6C A;  3ASD A;  3FWV A;  2FF4 A;  2VYI A;  5BNW A;  1FCH A;  3MKR A;  2PQN A;  2LNI A;  4WUY A;  2KC7 A;  2E2E A;  4G2V A;  2XGS A;  4J0U A;  4A1S A;  4I17 A;  4GYO A;  2FO7 A;  4I9C A;  4Y6C A;  3N71 A;  2VSN A;  5D0Q D;  2XPI A;  4I9E A;  1A17 A;  3GW4 A;  3SF4 A;  2KAT A;  3CKB A;  3LY9 A;  4G23 A;  3S7F A;  3ZGQ A;  2DBA A;  3LY7 A;  1HH8 A;  4I1A A;  3CVP A;  1PC2 A;  4AY5 A;  3ULQ A;  2BUG A;  4YVO A;  1ELR A;  4U04 A;  2HR2 A;  1OUV A;  2Y4U A;  2C0L A;  3OXG A;  3QWW A;  5G05 J;  3KS2 A;  2IFU A;  3CVQ A;  3ZN3 A;  3CVL A;  1WAO 1;  3JYS A;  5ARG A;  1NZN A;  3S7J A;  3R9A B;  2YQ8 A;  4H7Y A;  3Q49 B;  2OND A;  3Q5M A;  3KD7 A;  5FT9 A;  1KT0 A;  2FBN A;  2WQH A;  4GPK A;  4N3A A;  4N3C A;  4ME2 A;  4HOU A;  4G1T A;  2XEV A;  1W3B A;  4WNF A;  2V5F A;  1E96 B;  3HYM B;  3ZFW A;  5CCM A;  3FFL A;  4I2W A;  5CHE E;  4KBQ A;  3WXX A;  5FTP A;  4BWR A;  5AYW D;  3UUX A;  5KJN A;  3AS8 A;  4UI9 K;  4NRH B;  4RG6 A;  3LPZ A;  4U0Z A;  3RJV A;  3VTY A;  5KJM A;  4UI9 J;  1XNF A;  3LYA A;  4UQZ A;  1HZ4 A;  2VGY A;  4F3V A;  4LEU A;  1NA0 A;  2VGX B;  5HQ8 A;  2J9Q A;  4J8F A;  3ASG A;  4UI9 C;  3CK8 A;  3ESK A;  5ARF A;  4GZ6 A;  4H7X A;  3TGO A;  3ASF A;  4AIF A;  3RKV A;  4XIF A;  4GYY A;  3MA5 A;  1ZBP A;  4GCO A;  3TAX A;  4O6F A;  2XCC A;  4N5C A;  1IYG A;  2VGX A;  4AM9 A;  3RO2 A;  1ELW A; 
#chains in the Genus database with same CATH topology
 4J8D A;  2A4Z A;  4O60 A;  2J4B A;  3JXI A;  1MX4 A;  1H6P A;  5EYP F;  1N4S A;  2ZXW E;  2VQ2 A;  4GA1 A;  5AQ9 A;  5ENR D;  1SZA A;  2VSX E;  1TN7 A;  2KCL A;  5T3R A;  4LNB A;  1ZU2 A;  3ZPJ A;  1TNU A;  2V4L A;  1QYM A;  4U63 A;  3T8M A;  3FDH A;  1Z5S C;  4FU3 A;  1TR4 A;  3HVE B;  3ZRH A;  3DEP A;  2C2L A;  4GMJ A;  3C98 A;  4TRQ A;  1JWG A;  5ENT D;  4WWO A;  3SO8 A;  3BEE A;  5BT1 A;  3MX3 A;  1S64 A;  1SW6 A;  1YYH A;  5FIN A;  2ZGG A;  4GCN A;  4RLY A;  3HVE A;  2C0M A;  3AS5 A;  1HO8 A;  3FU5 A;  3TWU A;  3CHQ A;  2BF0 X;  5G2N A;  1L5J A;  3FUE A;  2X38 A;  2H6G A;  5JJT A;  1E8X A;  3B13 A;  5ENS D;  1TYQ G;  2R2L A;  4U8V D;  3O4Z A;  3C3O A;  3RRN B;  4J8E A;  3SFY A;  4DI3 A;  1U2V G;  5BV0 A;  4ZHB A;  4WNE A;  2I9C A;  3NF1 A;  3BUA A;  2BKK B;  3C3Q A;  3KSL A;  4ILH B;  1QNF A;  1Q2Z A;  1N4Q A;  2AW6 A;  1HF8 A;  4L7T A;  1N9A A;  5FJY A;  1K1A A;  4JB8 P;  2MRI A;  4AP2 A;  3QC1 A;  3CEQ A;  4K03 A;  4CYM D;  4U7E B;  2XGO A;  1ELK A;  2KZT B;  3Q15 A;  2IU1 A;  1DVP A;  4GZD A;  2X3M A;  1QZ2 A;  3L6A A;  4UWF A;  1OT8 A;  3UTM A;  2P9N G;  5AJD A;  3F6Q A;  3ZNG A;  1N4P A;  4U0S A;  1U3C A;  3LEW A;  2NSZ A;  3CST A;  5EX3 A;  3HXB A;  4HRM B;  2KZT A;  2R02 A;  3PZ3 A;  2RG8 A;  4IYP A;  3FTX A;  1OXJ A;  2HE0 A;  4TXQ A;  4HOT A;  4K5B A;  4GMR A;  1DC2 A;  3CK9 A;  2QC9 A;  4I2Z A;  4GZC A;  2WXJ A;  4LUN U;  4RSY A;  1QBQ A;  1LD8 A;  3L08 A;  1BD8 A;  4RQI A;  1N0R A;  3DBS A;  3OAW A;  4QFV A;  2P2C P;  2NC9 A;  2ETB A;  1FVF A;  1FPP A;  3IKO B;  2F37 A;  3FUL A;  2I6H A;  5ENN A;  3ABL E;  3D9O A;  4J7W A;  1HX8 A;  2L6J A;  4UQY A;  3T5X A;  4F6R D;  2RD0 A;  1VDY A;  2AVP A;  3CV0 A;  5EX0 A;  5FQ7 A;  5G04 J;  1MJ0 A;  3LY8 A;  3UQ3 A;  2GW1 A;  3IEG A;  1X81 A;  3WG7 E;  3QWV A;  1K3Z D;  3Q7F A;  3AS4 A;  4JPS A;  3FU3 A;  1UJJ A;  3G2T A;  4IN3 B;  2PZI A;  3LKU A;  4LRZ A;  2V8S E;  1BLX B;  2WVI A;  3ZYQ A;  5AN8 A;  3Q4A B;  3O48 A;  5C1D A;  3MEK A;  5ENQ D;  4X8Q A;  5BXU A;  1UN9 A;  2EIL E;  3HXC A;  3UIO C;  2FF4 A;  3HDX A;  2VYI A;  2WQ7 A;  1E7V A;  2OV8 A;  1FCH A;  4WAF A;  4XKC A;  3MKR A;  3NB2 A;  4ANV A;  5LFA A;  3DPY A;  2XGS A;  4G8K A;  3MJW A;  4I17 A;  4ANX A;  3L54 A;  4GYO A;  2FO7 A;  4Y6C A;  2AJA A;  3ASO E;  5AQB A;  4BET A;  5D0Q D;  3FUI A;  4XKB A;  1Z6T A;  2ZIR A;  1MZC A;  2LXL A;  2ZIS A;  1X5B A;  3ZXP A;  3FUF A;  3PRZ A;  3EHQ A;  4G23 A;  2XEN A;  3HXD A;  2DBA A;  4TUM A;  2VGE A;  3JUE A;  5EIB E;  3CVP A;  2BUG A;  4YVO A;  4UWK A;  2IO2 C;  4MS6 A;  4L23 A;  5JHB A;  1OUV A;  2Y4U A;  1H19 A;  2VTB B;  3D9N A;  2V0P A;  4UWL A;  5AJL A;  4RVB A;  5G05 J;  1RZ4 A;  3PZ2 A;  1XGW A;  1WAO 1;  3UKR G;  3VLE A;  1K8K G;  3R9A B;  2NXP A;  3LS8 A;  3Q49 B;  4FUL A;  4DK5 A;  1TNO A;  5B1A E;  1KT0 A;  2VSO E;  2WQH A;  4I6G A;  2WXQ A;  2VTB A;  4N3C A;  4XEI G;  1W3B A;  2V4H C;  2DWZ A;  3MYV A;  5J90 A;  4I6E A;  3SGH A;  3FTW A;  1O1S A;  3ZFW A;  1MX6 A;  4CT0 A;  4I2W A;  4KMO A;  4KBQ A;  2GRO B;  5FTP A;  5AYW D;  2ZGD A;  3SBS A;  4UI9 K;  4EHM A;  2DVW A;  4RG6 A;  4Q96 A;  3CSF A;  4UI9 J;  3G2U A;  4UQZ A;  1LTX A;  5CMY A;  2ILR A;  3ZVV A;  5ARF A;  5KNG A;  2QYJ A;  3TGO A;  4CCA A;  3RRM B;  3DXM G;  4GCO A;  3Q9N C;  4BY6 A;  4O6F A;  2XCC A;  3TWR A;  3ESL A;  3JUI A;  4A63 B;  1IYG A;  3D9L A;  2F0Y A;  2Y0B G;  1H6K A;  3TWW A;  1Z3X A;  2Y3A A;  1QQE A;  5ITZ F;  1K1B A;  4GAA A;  4EPZ A;  3APD A;  1TN6 A;  3TG4 A;  3DRA A;  4I1O B;  2M63 A;  3EHN A;  1N94 A;  1GW6 A;  3FY4 A;  3DWL G;  2WXK A;  3EDT B;  2OCC E;  4ZFH A;  4APO A;  1OCO E;  1YCS B;  5D0O D;  5EKQ D;  3ZHE B;  3RO3 A;  5M72 A;  4RG9 A;  3UM0 A;  2EIN E;  3CHS A;  2IOS A;  5HI7 A;  3C3R A;  1UG3 A;  5G05 C;  1KPS B;  3B7B A;  3TG5 A;  3CVU A;  1SZ9 A;  4ABN A;  1KLX A;  3SNX A;  4NIK A;  1FVH A;  4KYO B;  2V5Q C;  1UN8 A;  4KT6 B;  2XPZ A;  3R9M A;  2Q7F A;  2X6K A;  5KBA A;  2WXO A;  1KZP A;  3T5V A;  1N0Q A;  3OTN A;  4GZ3 A;  2L0I A;  4JHR A;  5JJ6 A;  1S63 A;  1O1T A;  2MYO A;  2OOE A;  2CHZ A;  3NOG D;  3PRE A;  4P29 A;  3B95 A;  3RAU A;  4CGW A;  3FH8 A;  4JD2 G;  3ABM E;  1P5Q A;  4QQI A;  4DX1 A;  2RFM A;  5E76 A;  3OXF A;  1OCR E;  4O1O A;  1NP7 A;  3U4T A;  5HRY A;  2QYU A;  1PAQ A;  4MKT A;  3CVX A;  5EID A;  3URZ A;  3I3N A;  4PH4 B;  2KCK A;  1H2V C;  2YNQ A;  2IY0 C;  1IXV A;  5AQA A;  3P1U A;  4FHJ A;  3EU5 A;  4WWN A;  4EZK A;  1LD7 A;  2EQX A;  2CFZ A;  1JPL A;  4BT8 A;  2H6F A;  2GRR B;  5JJ7 A;  1IHG A;  3HXE A;  4CEM A;  1SA4 A;  2HO1 A;  2LUH A;  2XRY A;  3I4R B;  3GZ2 A;  3FEY A;  4UQX A;  1JCS A;  5BXO A;  3PDN A;  1D9S A;  3SZ7 A;  3L16 A;  2DZO A;  4Y6W A;  2DIW A;  2R05 A;  4FJZ A;  4YDY A;  3MCX A;  2KCV A;  3T9K A;  2GRN B;  3DSU A;  2JAB A;  3IHY A;  4U96 D;  1OWP A;  2WXL A;  3CKC A;  2LSU A;  3QOU A;  2XRZ A;  2H6H A;  3LCA A;  4KZC A;  4HFG A;  3PUK A;  2WPV A;  4ACK A;  4CZ2 D;  1EDU A;  4KXK B;  4WND A;  3BG0 B;  5FQ4 A;  3U66 A;  3SI5 A;  1WY6 A;  2XGM A;  3JCK C;  3NAW A;  1BU9 A;  4PS3 A;  1UOH A;  5CBO A;  3PZ1 A;  4BT9 A;  5FIO A;  5JHA A;  5KJK A;  4HRL A;  3FEX A;  2ETA A;  3TWV A;  4JHJ A;  4OVV A;  3ZW3 A;  3R7R A;  3PNL B;  5AAO A;  2WB2 A;  4A3T A;  3B7S A;  3J5Q B;  3HXF A;  3D9K A;  4FJY A;  4K5C A;  4WUY A;  2E2E A;  2AWI A;  2R59 A;  3JQ0 A;  3CHR A;  4PUC A;  2WXF A;  3FTU A;  1HS6 A;  1DNP A;  5B3S E;  4I9C A;  3SBT B;  3R7Q A;  1IQU A;  3VLF A;  4B8C B;  4Q69 A;  1PY1 A;  2XPI A;  4I9E A;  3BQO A;  3D9I A;  2WXN A;  1A17 A;  4GTR A;  4MBG A;  5CMW A;  3GW4 A;  4TXP A;  3RSE G;  3G2V A;  3ZYK A;  4BER A;  1PC2 A;  3ULQ A;  4OAV B;  5BPP A;  1ELR A;  4U04 A;  4BX8 A;  3ZU7 B;  2C0L A;  1OWN A;  1MHQ A;  2WMO A;  4F1S A;  2IFU A;  3E32 A;  3ZN3 A;  4UWH A;  3FUD A;  3JYS A;  5ARG A;  3S7J A;  2KM4 A;  2OND A;  1YMP A;  4C9B B;  3D9P A;  4FHK A;  5FT9 A;  5LP0 A;  5JMN D;  1N52 A;  4GTQ A;  2WXH A;  5CEC B;  1KZO A;  1S70 B;  3SFX A;  4F7A A;  3EJN A;  1IQR A;  3ABK E;  3QNK A;  2OEW A;  3L13 A;  4E6H A;  5CHE E;  1MQS A;  2XZD G;  3JXJ A;  3WXX A;  3UUX A;  5KJN A;  4V3I A;  4Q94 A;  1DCE A;  3LPZ A;  4L1B A;  1OCZ E;  3VTY A;  5KJM A;  2WMN A;  5E75 A;  1HZ4 A;  4L9P A;  3ULY A;  4C48 B;  2IQC A;  4XX5 A;  5HQ8 A;  2RFA A;  3PNT B;  4DX5 D;  4ATG A;  3C5R A;  5EDS A;  4J8F A;  4EZJ A;  2B6C A;  3ULE G;  4H7X A;  3FUN A;  3ASF A;  4AIF A;  5ANR A;  4KVO A;  5EYL A;  4DRX E;  4GYY A;  3MA5 A;  4HBD A;  5KNH D;  3ASN E;  3QK0 A;  4N5C A;  1HG2 A;  4JEU A;  2P9I G;  3D9H A;  3CQG B;  2ION A;  4O1P A;  1TNZ A;  3DXK G;  1NA3 A;  5FZS A;  5T8I A;  4IUL A;  3FTV A;  1FT1 A;  2XCB A;  3HHM A;  4JA9 A;  2NYJ A;  1B89 A;  4U8Y D;  2L0T B;  2R5S A;  1N54 A;  4BFR A;  4AY6 A;  4BSZ B;  1AWC B;  1SVX A;  4NUR A;  4N2Q A;  3FTS A;  3KEA A;  1N95 A;  2VSY A;  4HLL A;  4TV3 A;  3S2A A;  2UWJ G;  2CG2 A;  2CG3 A;  4FP7 A;  4FAD A;  3TWX A;  2Y4T A;  4UUC A;  1MYO A;  4F1P A;  3ZXS A;  3AG4 E;  2WXP A;  3LJN A;  1N4R A;  3I5P A;  4U07 A;  3V30 A;  2OEV A;  3GZ1 A;  4JL0 A;  4AXH A;  4JVS A;  4JXT A;  4B8A A;  2QZA A;  4NQ0 A;  2JLB A;  4AV7 A;  3MV2 B;  2BTD A;  3S7B A;  4HOQ A;  4EEC A;  2FEZ A;  3RIB A;  2E0I A;  4FLH A;  1O1R A;  2PM7 A;  2L9B A;  4N2S A;  4GB9 A;  4MLP A;  3G2S A;  3E4B A;  4G26 A;  3PZD A;  3DEO A;  4M7C A;  3FUH A;  3RK6 A;  2FI7 A;  3TJP A;  3PH0 C;  4GTO A;  4BX9 A;  4HVB A;  1INZ A;  2BKG A;  3FUJ A;  4JHK A;  3U3W A;  4XE0 A;  4GA2 A;  3EHR A;  4B94 A;  4KVM A;  5AIJ A;  3KAE A;  3E34 A;  3GZS A;  3MV3 B;  3FP3 A;  1NI1 A;  3DSW A;  4ANU A;  3CVN A;  4GZ5 A;  5JA4 D;  3SQV A;  4GA0 A;  4EBA G;  1TEZ A;  5C2Y A;  4JA7 A;  4PS8 A;  4PDX A;  3ZIM A;  2OVB A;  3HIZ A;  4AJW A;  3FHE A;  1HU3 A;  3PEU B;  3SY2 A;  2PL2 A;  4CRW A;  3GYZ A;  4AEZ C;  2IF4 A;  4HLE A;  5BW8 C;  3UKU G;  3CR3 A;  2X6H A;  4A3V A;  5CCL A;  3E37 A;  1V55 E;  5FQ8 A;  3EIJ A;  3B7R L;  4BTA A;  4DLQ A;  3IHV A;  3ZHE A;  4J8Y A;  2XHE A;  1BPO A;  2F8X K;  3VTX A;  1Y8M A;  1Y6I A;  4BTB A;  2X6F A;  4DX6 D;  3BU8 A;  4YVQ C;  2HYZ A;  3EHM A;  3NQP A;  4NAC A;  5ANL A;  4N3B A;  2XEE A;  2YHC A;  4CDM A;  2A5E A;  3L17 A;  2VJ8 A;  1EPU A;  3UT8 A;  1TNY A;  3V79 K;  4N39 A;  4LSZ E;  3Q47 B;  2GRM A;  2XS1 A;  5DBK A;  3CIA A;  3TL5 A;  3UM3 A;  1NFI E;  3FWV A;  1NL4 A;  3U9W A;  1BI7 B;  5D66 A;  2P9S G;  2LNI A;  1TN8 A;  5IY5 E;  2KC7 A;  4KZ0 A;  1E8W A;  4J0U A;  3HRA A;  3KEZ A;  1RW2 A;  4I1M A;  3CHM A;  4OAU C;  3N71 A;  4IRU A;  3HG0 D;  4B93 B;  2VSN A;  5D2M C;  1HE8 A;  3UT7 A;  4G11 A;  2IEJ A;  3Q75 A;  3QAR A;  3SF4 A;  5J08 A;  1OY3 D;  2AXU A;  3CVY A;  3S7F A;  3ZGQ A;  3ONL A;  4J6I A;  3LY7 A;  5BUZ A;  3Q9U C;  3TXN A;  1HH8 A;  4I1A A;  2FO1 E;  4AY5 A;  4N5Q A;  2GRL A;  5H7P A;  2HR2 A;  2KXP C;  3ENE A;  3KS2 A;  2DCP A;  3PS6 A;  4EBA A;  1DCQ A;  1FT2 A;  3CVL A;  4OYS A;  5ENP D;  4D10 C;  3UMV A;  5FWQ A;  2R17 C;  2YQ8 A;  3QJZ A;  3KD7 A;  4YDE A;  2LAH A;  2F8Y A;  2GGF A;  2ETC A;  1N11 A;  4HNA D;  4GPK A;  4N3A A;  3D9J A;  4ME2 A;  4BES A;  2P9U G;  2XEV A;  1SA5 A;  3P2B A;  2V5F A;  1H6O A;  2HM8 A;  2IJG X;  3HYM B;  1G3N B;  5CCM A;  3FFL A;  3PEV B;  3RRU A;  1HFA A;  2H6I A;  2YIN A;  4GTP A;  4BWR A;  4ATZ D;  3DST A;  4FLB A;  4BEP A;  5T4Y A;  3T8K A;  3MKQ B;  2FUL A;  1H0A A;  3W9F A;  3V31 A;  3PUJ A;  3FH7 A;  5LOZ A;  1JWF A;  2J9Q A;  3Q7A A;  3PZ4 A;  3ASG A;  2J07 A;  5AQ7 A;  3CK8 A;  3ESK A;  4GZ6 A;  2CHW A;  4DUI A;  3RKV A;  1WG0 A;  3VLD A;  4K5A B;  4XIF A;  3LXU X;  3CHP A;  4LG6 A;  3SHF A;  1ZBP A;  3TAX A;  2IOL A;  3AAA C;  3CGH A;  3MKQ A;  2P9L G;  1HG5 A;  5CRV A;  3TWS A;  3FUK A;  3ZYM A;  1E90 A;  2AXV A;  3RO2 A;  3UI2 A;  4FC8 A;  4ILI A;  1TJC A;  2I1K A;  4XI0 A;  4XZ4 A;  3EIQ C;  4G24 A;  2I1J A;  4DLO A;  3ASH A;  4EQF A;  2A5U A;  4B89 A;  4DX2 A;  4U95 D;  4ILG A;  4GTM A;  3LJ3 A;  3Q78 A;  1WDY A;  3APC A;  4L2L A;  3PE3 A;  4URK A;  3L82 A;  3AG2 E;  5KWD A;  3EU9 A;  3NBN B;  4TXR A;  4GTT A;  2WM9 A;  5CED B;  2WXM A;  3UM1 A;  1WM5 A;  4CDR A;  3AG3 E;  4DJA A;  3CHO A;  4HS2 A;  3X2Q E;  1JCQ A;  5LCW J;  4CDN A;  3ML8 A;  4GML A;  4OVU A;  4HOS A;  5CER B;  4TUU A;  2DZN A;  2OVF A;  5CBN A;  2QY7 A;  5CEA A;  1EF1 C;  2XS8 A;  1JCR A;  1SQM A;  3LDZ A;  3DSS A;  3J5P A;  3PVL A;  3FUM A;  3SFZ A;  4JC8 A;  3E30 A;  2JEK A;  3FU0 A;  2RKK A;  1IHB A;  3UX4 A;  1UW4 B;  3DSV A;  3SD5 A;  4C0M A;  5EN5 D;  3S7D A;  1LF8 A;  2P9K G;  2YHE A;  3UT4 A;  3K9I A;  5KJL A;  3V2X A;  3OXL A;  1OWL A;  3ZYL A;  3UXG A;  4UWG A;  4GYW A;  4LNG A;  4MRU A;  1MX2 A;  4I43 A;  3AU5 A;  2DYR E;  2CFU A;  3LVR E;  4XI9 A;  3L22 A;  3AJI A;  1H2T C;  4WNG A;  3U64 A;  5DIZ A;  1BI8 B;  3CVW A;  3ML9 A;  5FZQ A;  1ZB1 A;  2LSV A;  3IBE A;  4HRN A;  3D9M A;  4JW1 A;  5BV1 A;  4GTS A;  1A5E A;  2IO3 C;  1D8E A;  3QWP A;  3LVQ E;  3MGB A;  1O5M A;  3Q79 A;  4CT4 A;  2P58 C;  4G25 A;  2UY1 B;  3G2W A;  2DYS E;  4APF A;  2J08 A;  1OCC E;  3TWT A;  3AG1 E;  3C72 A;  3ONK A;  2MHK A;  3QKY A;  4AVX A;  1H2U A;  2ZU6 B;  4GTV A;  4HXI A;  3EUV A;  5FZR A;  2GRP B;  3QDN A;  3TXM A;  4A55 A;  2XEH A;  3FTY A;  4U0U A;  4G8L A;  2GRQ B;  2Y1L E;  3PE4 A;  2LAI A;  2UY1 A;  5CRU A;  3ZKJ A;  1V54 E;  4R7L A;  1KT1 A;  4W9R A;  1YA0 A;  4AOF A;  2J49 A;  4YND A;  3ISM C;  3D3M A;  2B0O E;  4EZL A;  4HI8 A;  3UPV A;  3CK7 A;  1EYH A;  4CGV A;  5AEN A;  3FH5 A;  2QFC A;  3UIP C;  2J09 A;  3KSQ A;  5LCW C;  5KCM A;  3DSX A;  2PQR A;  2KBX A;  5G55 A;  4LER A;  1HXI A;  3BG1 B;  2XZT G;  3W9G A;  3ZEF A;  4HOR A;  4HI9 A;  3RU0 A;  3DPD A;  2J4D A;  3Q73 A;  5G04 C;  5A7D B;  4BSX A;  3B7U X;  2EIJ E;  4J8S A;  3IXE A;  1E8Y A;  3FU6 A;  4JZY A;  2BED A;  5A6C A;  3ZUV B;  3ASD A;  2WXR A;  3NZU A;  2P9P G;  5BNW A;  2PNN A;  4FA6 A;  3L9T A;  2PQN A;  3UM2 A;  3E33 A;  2I2O A;  4GPM A;  2EIM E;  1S0P A;  1D8D A;  1OWO A;  4G2V A;  1Z3Y A;  2EIK E;  4A1S A;  4ACL A;  4YDO A;  2AXZ A;  1JUQ A;  4LNU D;  4M3O A;  3CVV A;  4K0R A;  4C0E A;  5B1B E;  1AP7 A;  4YDW A;  4WWP A;  2LXM A;  2WXI A;  2KAT A;  3CKB A;  3LY9 A;  5EIL A;  2J8S D;  3CQC B;  5ENO D;  4A1G A;  2XPY A;  2Y69 E;  4U8H A;  3UIN C;  3B7T A;  3IV0 A;  3APF A;  4DI4 A;  3OXG A;  3QWW A;  1TNB A;  3CVQ A;  2LO6 A;  2R03 A;  1NZN A;  2PM6 A;  2WQ6 A;  2XQ0 A;  3MZL B;  4H7Y A;  1UJK A;  3Q5M A;  1E8Z A;  3QB2 A;  5HS0 A;  1OWM A;  2FBN A;  4HOU A;  4HQD A;  4G1T A;  4WNF A;  4PS7 A;  4DPR A;  1E96 B;  3FTZ A;  4GU5 A;  5LX8 A;  3AU4 A;  3TWQ A;  3AS8 A;  4NRH B;  2CHX A;  3JQ1 A;  4HB5 A;  4U0Z A;  3I4G A;  3RJV A;  3CLJ A;  4ANW A;  1XNF A;  3LYA A;  1E7U A;  1TJF A;  5FQ6 A;  4B0Z A;  2VGY A;  4F3V A;  4LEU A;  1NA0 A;  2VGX B;  4F53 A;  1U3D A;  2MOW A;  4UI9 C;  2X6I A;  2WXG A;  5AAR A;  5A23 A;  1IKN D;  4Z68 A;  2L6B A;  4E85 A;  4JEH A;  3V2O A;  3NOC D;  4L2Y A;  3NZS A;  4I6J A;  3QAQ A;  2VGX A;  4AM9 A;  4LCT A;  4DX7 D;  2X6J A;  5HKP A;  1ELW A; 
#chains in the Genus database with same CATH homology
 1Z3X A;  2Y3A A;  1QQE A;  4ILI A;  1TJC A;  2I1K A;  3CQG B;  4XI0 A;  3EIQ C;  4XZ4 A;  4G24 A;  2I1J A;  2ION A;  4J8D A;  4GAA A;  3ASH A;  4DLO A;  2A4Z A;  4EPZ A;  3APD A;  4EQF A;  2A5U A;  4B89 A;  3TG4 A;  4I1O B;  2M63 A;  2J4B A;  2VQ2 A;  4ILG A;  4GA1 A;  1NA3 A;  3EHN A;  3LJ3 A;  5FZS A;  5T8I A;  1GW6 A;  3FY4 A;  4IUL A;  3FTV A;  3APC A;  2WXK A;  3EDT B;  4L2L A;  2XCB A;  3HHM A;  1SZA A;  3PE3 A;  4JA9 A;  1B89 A;  4URK A;  2VSX E;  2L0T B;  2R5S A;  4APO A;  2KCL A;  5T3R A;  1N54 A;  5D0O D;  4BFR A;  1ZU2 A;  4AY6 A;  5EKQ D;  3ZPJ A;  3ZHE B;  2V4L A;  3RO3 A;  5M72 A;  4U63 A;  4RG9 A;  4NUR A;  4N2Q A;  3T8M A;  3FDH A;  2WM9 A;  4FU3 A;  2WXM A;  3CHS A;  1WM5 A;  3HVE B;  3FTS A;  4CDR A;  2IOS A;  3ZRH A;  5HI7 A;  4DJA A;  1UG3 A;  2VSY A;  3CHO A;  5G05 C;  2C2L A;  4HS2 A;  4GMJ A;  4TV3 A;  3S2A A;  3C98 A;  4TRQ A;  2UWJ G;  3TG5 A;  2CG2 A;  1JWG A;  1SZ9 A;  2CG3 A;  3CVU A;  4FP7 A;  5LCW J;  4FAD A;  4CDN A;  4WWO A;  3ML8 A;  4ABN A;  1KLX A;  3SNX A;  4GML A;  3BEE A;  2Y4T A;  4OVU A;  4HOS A;  1FVH A;  4KYO B;  4TUU A;  5BT1 A;  2OVF A;  2QY7 A;  1UN8 A;  3MX3 A;  3ZXS A;  4KT6 B;  1EF1 C;  2WXP A;  2XPZ A;  4GCN A;  1SQM A;  2Q7F A;  3I5P A;  3LDZ A;  2X6K A;  3HVE A;  2C0M A;  3AS5 A;  1HO8 A;  4U07 A;  3FU5 A;  3CHQ A;  3PVL A;  2WXO A;  2BF0 X;  5G2N A;  3FUM A;  4JL0 A;  3GZ1 A;  3SFZ A;  3T5V A;  4AXH A;  4JVS A;  1L5J A;  4JC8 A;  3OTN A;  3FUE A;  4GZ3 A;  2L0I A;  2X38 A;  4JHR A;  4JXT A;  5JJT A;  2JEK A;  5JJ6 A;  3FU0 A;  4B8A A;  1E8X A;  4NQ0 A;  3B13 A;  2JLB A;  3UX4 A;  1UW4 B;  4AV7 A;  3SD5 A;  3MV2 B;  2BTD A;  4C0M A;  3S7B A;  2OOE A;  3O4Z A;  4HOQ A;  3S7D A;  3RRN B;  4J8E A;  1LF8 A;  4EEC A;  2CHZ A;  4DI3 A;  2FEZ A;  3RIB A;  2YHE A;  5BV0 A;  3UT4 A;  3K9I A;  2E0I A;  3PRE A;  5KJL A;  3OXL A;  1OWL A;  4FLH A;  4P29 A;  4WNE A;  3ZYL A;  2I9C A;  3NF1 A;  2PM7 A;  4UWG A;  4CGW A;  3FH8 A;  4ILH B;  2L9B A;  4GYW A;  1QNF A;  4N2S A;  4GB9 A;  4MLP A;  3G2S A;  4MRU A;  1P5Q A;  3E4B A;  4G26 A;  3PZD A;  4I43 A;  3AU5 A;  2CFU A;  3FUH A;  5E76 A;  3LVR E;  3OXF A;  4XI9 A;  2AW6 A;  3RK6 A;  1HF8 A;  4L7T A;  3L22 A;  5FJY A;  2FI7 A;  3TJP A;  1H2T C;  1NP7 A;  3PH0 C;  3U4T A;  4WNG A;  2MRI A;  1PAQ A;  3QC1 A;  4MKT A;  3CEQ A;  5DIZ A;  3U64 A;  3URZ A;  3I3N A;  4PH4 B;  4AP2 A;  3CVW A;  3ML9 A;  4K03 A;  5FZQ A;  2KCK A;  1H2V C;  2LSV A;  2YNQ A;  4BX9 A;  3IBE A;  2XGO A;  4HVB A;  3D9M A;  4JW1 A;  5BV1 A;  1ELK A;  1INZ A;  2KZT B;  3FUJ A;  3Q15 A;  2IU1 A;  4JHK A;  3P1U A;  1DVP A;  4FHJ A;  4GZD A;  2X3M A;  3U3W A;  1QZ2 A;  4XE0 A;  4WWN A;  3L6A A;  3QWP A;  4GA2 A;  4UWF A;  4EZK A;  3LVQ E;  3MGB A;  2EQX A;  2CFZ A;  1JPL A;  4B94 A;  5AJD A;  4CT4 A;  4BT8 A;  2P58 C;  4KVM A;  5AIJ A;  5JJ7 A;  1IHG A;  3KAE A;  4U0S A;  4G25 A;  1U3C A;  3LEW A;  2UY1 B;  3G2W A;  3GZS A;  3MV3 B;  4CEM A;  3FP3 A;  4APF A;  2NSZ A;  3CST A;  4ANU A;  2J08 A;  3CVN A;  5EX3 A;  4GZ5 A;  3ONK A;  2HO1 A;  2MHK A;  3QKY A;  2KZT A;  4AVX A;  1H2U A;  4GA0 A;  4EBA G;  2ZU6 B;  1TEZ A;  4HXI A;  2RG8 A;  4IYP A;  5C2Y A;  2XRY A;  3I4R B;  4JA7 A;  3FTX A;  3GZ2 A;  5FZR A;  3QDN A;  3TXM A;  4A55 A;  3FEY A;  3FTY A;  4UQX A;  4HOT A;  4U0U A;  4PS8 A;  4PDX A;  3ZIM A;  3PDN A;  3PE4 A;  2OVB A;  3HIZ A;  2LAI A;  3CK9 A;  1HU3 A;  2UY1 A;  3FHE A;  4AJW A;  3SZ7 A;  3PEU B;  4I2Z A;  3L16 A;  2PL2 A;  2WXJ A;  4GZC A;  4LUN U;  4RSY A;  4CRW A;  3L08 A;  4Y6W A;  4R7L A;  2DIW A;  1KT1 A;  3GYZ A;  4AEZ C;  2IF4 A;  4W9R A;  4HLE A;  1YA0 A;  3DBS A;  4FJZ A;  4AOF A;  3OAW A;  4QFV A;  5BW8 C;  2NC9 A;  2J49 A;  3CR3 A;  2X6H A;  2KCV A;  3MCX A;  4YND A;  4A3V A;  5CCL A;  1FVF A;  3IHY A;  1OWP A;  2WXL A;  3D3M A;  3IKO B;  5FQ8 A;  3EIJ A;  3B7R L;  3CKC A;  2LSU A;  3FUL A;  4EZL A;  4BTA A;  2I6H A;  5ENN A;  4DLQ A;  3QOU A;  3IHV A;  3UPV A;  2XRZ A;  3CK7 A;  3LCA A;  1EYH A;  3ZHE A;  3CVX A;  4CGV A;  5AEN A;  2XHE A;  1BPO A;  3FH5 A;  4KZC A;  3D9O A;  4HFG A;  3PUK A;  3VTX A;  1HX8 A;  1Y6I A;  1Y8M A;  2QFC A;  2L6J A;  4UQY A;  3T5X A;  4BTB A;  2X6F A;  2RD0 A;  2WPV A;  4ACK A;  2J09 A;  1EDU A;  4KXK B;  1VDY A;  5LCW C;  4YVQ C;  5KCM A;  2HYZ A;  3EHM A;  2AVP A;  3CV0 A;  3NQP A;  4WND A;  5EX0 A;  5FQ7 A;  5G04 J;  2PQR A;  5G55 A;  3LY8 A;  4NAC A;  5ANL A;  4LER A;  3BG0 B;  5FQ4 A;  1HXI A;  3UQ3 A;  3SI5 A;  3U66 A;  2GW1 A;  4N3B A;  3BG1 B;  3IEG A;  2YHC A;  1WY6 A;  2XGM A;  3JCK C;  3QWV A;  4CDM A;  3AS4 A;  3ZEF A;  4HOR A;  4PS3 A;  3L17 A;  4JPS A;  4BT9 A;  3RU0 A;  2VJ8 A;  3FU3 A;  1UJJ A;  3DPD A;  2J4D A;  3G2T A;  5G04 C;  1EPU A;  4IN3 B;  5A7D B;  2PZI A;  3LKU A;  4LRZ A;  3UT8 A;  4BSX A;  5JHA A;  3B7U X;  4J8S A;  5KJK A;  2V8S E;  2WVI A;  3ZYQ A;  3FEX A;  4N39 A;  3Q4A B;  3O48 A;  5C1D A;  3MEK A;  1E8Y A;  3FU6 A;  4JHJ A;  3Q47 B;  4JZY A;  2GRM A;  4OVV A;  3ZW3 A;  5DBK A;  3CIA A;  3R7R A;  3TL5 A;  3PNL B;  5A6C A;  3ASD A;  2WB2 A;  2WXR A;  4A3T A;  1UN9 A;  3FWV A;  3NZU A;  2FF4 A;  3HDX A;  3B7S A;  2VYI A;  2WQ7 A;  3U9W A;  1E7V A;  5BNW A;  2OV8 A;  1FCH A;  4WAF A;  3R9A B;  4FA6 A;  4XKC A;  3MKR A;  2PQN A;  2I2O A;  2LNI A;  3D9K A;  4FJY A;  4WUY A;  2KC7 A;  4ANV A;  2E2E A;  1S0P A;  1OWO A;  2AWI A;  5LFA A;  4G2V A;  2R59 A;  4KZ0 A;  1Z3Y A;  3JQ0 A;  1E8W A;  2XGS A;  4J0U A;  4A1S A;  4ACL A;  3CHR A;  4PUC A;  3MJW A;  4I17 A;  4ANX A;  2WXF A;  3FTU A;  3KEZ A;  3L54 A;  4D10 C;  2AXZ A;  1HS6 A;  4I1M A;  3CHM A;  1DNP A;  4GYO A;  2FO7 A;  4I9C A;  3SBT B;  4Y6C A;  3R7Q A;  3N71 A;  1JUQ A;  4IRU A;  2VSN A;  1IQU A;  3VLF A;  4B8C B;  5D0Q D;  4Q69 A;  3FUI A;  4M3O A;  1PY1 A;  1HE8 A;  4XKB A;  1Z6T A;  3UT7 A;  3CVV A;  2XPI A;  4I9E A;  4K0R A;  4C0E A;  3D9I A;  2WXN A;  1A17 A;  4G11 A;  5CMW A;  3GW4 A;  1X5B A;  3PRZ A;  3FUF A;  3QAR A;  4WWP A;  3SF4 A;  5J08 A;  2WXI A;  2AXU A;  2KAT A;  3CVY A;  3CKB A;  3LY9 A;  4G23 A;  3S7F A;  3ZGQ A;  3G2V A;  3ONL A;  2DBA A;  3ZYK A;  3CQC B;  4J6I A;  3LY7 A;  5BUZ A;  3TXN A;  1HH8 A;  4I1A A;  4A1G A;  3CVP A;  1PC2 A;  2XPY A;  4AY5 A;  3ULQ A;  2BUG A;  4U8H A;  4YVO A;  2GRL A;  4UWK A;  5BPP A;  1ELR A;  4U04 A;  4BX8 A;  4MS6 A;  4L23 A;  5JHB A;  3B7T A;  3IV0 A;  2HR2 A;  3APF A;  1OUV A;  2Y4U A;  1H19 A;  2VTB B;  4DI4 A;  2C0L A;  3D9N A;  3ENE A;  3OXG A;  2V0P A;  3QWW A;  4UWL A;  5AJL A;  4RVB A;  5G05 J;  1OWN A;  1MHQ A;  2WMO A;  3KS2 A;  2IFU A;  4F1S A;  2DCP A;  3PS6 A;  3CVQ A;  4EBA A;  3ZN3 A;  4UWH A;  2LO6 A;  1XGW A;  3CVL A;  3FUD A;  4OYS A;  1WAO 1;  3JYS A;  3VLE A;  5ARG A;  1NZN A;  3S7J A;  3UMV A;  2KM4 A;  2PM6 A;  5FWQ A;  2R17 C;  2XQ0 A;  3MZL B;  2YQ8 A;  1UJK A;  2NXP A;  3LS8 A;  2OND A;  3Q49 B;  3KD7 A;  3Q5M A;  3QJZ A;  4H7Y A;  2LAH A;  4C9B B;  3D9P A;  4FUL A;  4FHK A;  2GGF A;  4DK5 A;  1E8Z A;  3QB2 A;  5FT9 A;  1OWM A;  5LP0 A;  1KT0 A;  2FBN A;  2VSO E;  2WQ6 A;  2WQH A;  4I6G A;  2WXQ A;  4N3A A;  2VTB A;  4GPK A;  3D9J A;  4N3C A;  4ME2 A;  4HOU A;  4G1T A;  2XEV A;  3P2B A;  1W3B A;  4WNF A;  1N52 A;  2V5F A;  2WXH A;  3MYV A;  4PS7 A;  2HM8 A;  5J90 A;  4F7A A;  3EJN A;  4DPR A;  4I6E A;  3SGH A;  3FTW A;  1IQR A;  1E96 B;  2IJG X;  3FTZ A;  3QNK A;  3HYM B;  4GU5 A;  3ZFW A;  5CCM A;  3FFL A;  3PEV B;  4CT0 A;  4I2W A;  3RRU A;  3L13 A;  1HFA A;  5LX8 A;  4E6H A;  5CHE E;  4KMO A;  2YIN A;  4KBQ A;  1MQS A;  3AU4 A;  3WXX A;  5FTP A;  4BWR A;  5AYW D;  3UUX A;  5KJN A;  3AS8 A;  3SBS A;  4UI9 K;  4FLB A;  4NRH B;  4V3I A;  2CHX A;  4Q94 A;  4RG6 A;  3JQ1 A;  4Q96 A;  5T4Y A;  3CSF A;  3LPZ A;  4U0Z A;  3I4G A;  3RJV A;  4L1B A;  3VTY A;  5KJM A;  3CLJ A;  4UI9 J;  4ANW A;  2WMN A;  3MKQ B;  2FUL A;  3G2U A;  1H0A A;  1XNF A;  3LYA A;  5E75 A;  1E7U A;  1TJF A;  1HZ4 A;  4UQZ A;  5FQ6 A;  2VGY A;  4B0Z A;  4F3V A;  4LEU A;  1NA0 A;  5CMY A;  2IQC A;  3PUJ A;  3FH7 A;  2VGX B;  1JWF A;  4XX5 A;  2J9Q A;  5LOZ A;  5HQ8 A;  4F53 A;  1U3D A;  2MOW A;  3PNT B;  5EDS A;  4ATG A;  2ILR A;  4J8F A;  4EZJ A;  3ASG A;  2J07 A;  3ZVV A;  4UI9 C;  2X6I A;  2WXG A;  3CK8 A;  3ESK A;  4GZ6 A;  5ARF A;  2CHW A;  4H7X A;  3FUN A;  5A23 A;  3TGO A;  4CCA A;  3RRM B;  3ASF A;  4AIF A;  3RKV A;  5ANR A;  4KVO A;  3VLD A;  4XIF A;  3LXU X;  3CHP A;  3SHF A;  4GYY A;  3MA5 A;  4E85 A;  1ZBP A;  4GCO A;  4JEH A;  3TAX A;  3QK0 A;  4BY6 A;  2IOL A;  4O6F A;  3CGH A;  2XCC A;  4N5C A;  3MKQ A;  3ESL A;  1HG5 A;  3JUI A;  4L2Y A;  3FUK A;  3NZS A;  3ZYM A;  4I6J A;  3QAQ A;  1IYG A;  2VGX A;  1HG2 A;  3D9L A;  4JEU A;  4AM9 A;  1E90 A;  2AXV A;  4LCT A;  2X6J A;  3RO2 A;  4FC8 A;  1H6K A;  1ELW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...