4Y6CA

Q17m crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
212
structure length
212
Chain Sequence
HMEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANSERINA PUTATIVE KINESIN LIGHT chain
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Unknown function
total genus 89
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6cA00
4GYOA 4Y6CA 1B89A 4BWRA 4N3BA 4EQFA 1WM5A 5FZRA 4UI9K 3ZPJA 3R9AB 4J8DA 4W9RA 2PQRA 3CVPA 2LSUA 5ARFA 4CGVA 4N3AA 5A6CA 2IF4A 3AS5A 3ZFWA 3KAEA 5DIZA 2HR2A 4GZ3A 3KD7A 1QQEA 3EDTB 3N71A 1HH8A 1Y8MA 3LPZA 3Q5MA 1ZBPA 5G04C 4N39A 1KT0A 3S7BA 4BTAA 2PQNA 4NRHB 1YA0A 2UY1B 3TG5A 3AS8A 1NZNA 4HOSA 5BT1A 4ABNA 2YHCA 3CK9A 4HOQA 4BTBA 3SF4A 3ZHEA 5LCWJ 5JJ6A 2KATA 4I9EA 4CDRA 5BNWA 3QDNA 1TJCA 4GYWA 2WPVA 2XCBA 4AY6A 1IHGA 4J8FA 3CVLA 4XIFA 3LCAA 4JL0A 3GZ2A 5BW8C 2VGXA 3S7FA 3OXGA 3PDNA 1ZU2A 3CVNA 1QZ2A 2VQ2A 3OXFA 2UY1A 2C0LA 3AS4A 2J9QA 5HQ8A 4WUYA 3JYSA 3ASFA 2FEZA 4G23A 2XCCA 4JA9A 2QFCA 1NA3A 4I9CA 5FT9A 3ASGA 3ASHA 4AM9A 2FBNA 3RO3A 2C0MA 3QKYA 3URZA 3QWWA 4UQZA 5LCWC 4KYOB 4WNDA 3TG4A 4B94A 3VTYA 1PC2A 3KS2A 5EX0A 2MHKA 3OXLA 3LY9A 4UQXA 2WQHA 5HI7A 3ULQA 4I2WA 2XGSA 4YVOA 1NA0A 3ZHEB 3Q4AB 2KCLA 2BUGA 1KLXA 3TAXA 4U0UA 5FTPA 3CK7A 4U07A 2VGYA 4GPKA 3TGOA 2VGXB 3MV3B 3MA5A 3RIBA 5KJLA 3CKCA 4GCOA 3ZGQA 1ELRA 4WNFA 4YVQC 3Q15A 1OUVA 4UI9J 4GZ5A 3HYMB 3E4BA 4XI0A 4GCNA 5JJTA 4WNEA 3UUXA 4I17A 1ELWA 4G26A 3NF1A 2XGOA 5A7DB 4XI9A 4U0SA 4G25A 3LY7A 4N2QA 3UPVA 3Q47B 2P58C 4IN3B 2FO7A 4ME2A 4HOTA 2FI7A 2XEVA 4AIFA 3PE4A 4JHRA 2HO1A 5EX3A 3IEGA 4CGWA 2Y4UA 5AYWD 3RU0A 1IYGA 1WAO1 3MEKA 3CV0A 1HXIA 4H7YA 3U4TA 4GA2A 3UQ3A 3CK8A 4YNDA 3RO2A 2YQ8A 2VYIA 1HZ4A 3RKVA 4UI9C 4GYYA 5CCMA 4GZ6A 2VSNA 2UWJG 5CHEE 4G2VA 5DBKA 1P5QA 2L6JA 3S7JA 1FCHA 3ESKA 5FZQA 4I1AA 4N5CA 4I2ZA 2OOEA 5ARGA 2KCVA 5G05J 2VSYA 5FZSA 3SZ7A 1E96B 2XGMA 2KC7A 4N2SA 5EKQD 3CVQA 2AVPA 1XNFA 3Q49B 3LKUA 4BT8A 3FWVA 1W3BA 1A17A 3MV2B 4N3CA 2IFUA 3CEQA 4APOA 3RJVA 5D0OD 3K9IA 3ASDA 4GA1A 4KXKB 2PL2A 4BT9A 3O48A 5KJNA 5KJMA 4O6FA 2C2LA 5D0QD 3MKRA 3U3WA 3VTXA 5CCLA 3FP3A 2JLBA 4G24A 5M72A 2Q7FA 4J8EA 4RG9A 4AY5A 3PE3A 2Y4TA 2PZIA 3WXXA 2KCKA 3ZN3A 5G05C 4NQ0A 2NC9A 2XPIA 4U0ZA 4HORA 3QWPA 2E2EA 2DBAA 4KBQA 4F3VA 3BEEA 3QWVA 4A1SA 3GW4A 3GZ1A 3LY8A 4J0UA 2LNIA 4G1TA 2LSVA 2R5SA 2HYZA 2ONDA 3CKBA 2GW1A 4Y6WA 2V5FA 4U04A 3LYAA 3QOUA 1KT1A 5C1DA 4H7XA 5FJYA 4HOUA 3GYZA 5JJ7A 4WNGA 4GA0A 5G04J 4RG6A 4UQYA 5KJKA 2I6HA 3FFLA 4JA7A 3S7DA 2FF4A 4LEUA
chains in the Genus database with same CATH superfamily
3FUHA 1YMPA 4IYPA 4I1MA 1MHQA 3FUMA 5ENNA 4K0RA 4EQFA 2R59A 2DZOA 3T5VA 2GRNB 1H19A 3ZPJA 4K5BA 3VLFA 4FHJA 3RK6A 2XPZA 2H6FA 2XZTG 3SFYA 3UX4A 2IF4A 1BI7B 3B7TA 3ASOE 4L2LA 4RLYA 3J5PA 3DSTA 5DIZA 2HR2A 1TNOA 1SA4A 4G8KA 4B0ZA 4GZ3A 4PH4B 2WXPA 3KD7A 3FU3A 3DBSA 3G2TA 1OWMA 3N71A 4OAVB 3ZXSA 1SQMA 4N5QA 5JHBA 3R7RA 2Y3AA 5G04C 4BTAA 2L0TB 1BD8A 4DX6D 2DZNA 3AS8A 1NZNA 3EHRA 4F7AA 1UN9A 5EYLA 4HOSA 4ABNA 4HOQA 2ILRA 2P9SG 4BTBA 4HB5A 1E90A 5AQ9A 3ZHEA 3D9HA 2KXPC 4I9EA 4CDRA 3C5RA 1EYHA 1UG3A 4AXHA 1ZB1A 3V30A 1SA5A 3GZ2A 3L54A 2VGXA 3EIQC 4J8SA 5KCMA 1WDYA 2DVWA 2BKGA 4J7WA 1ZU2A 3RRNB 4PUCA 3TWRA 2RG8A 3AS4A 3JXJA 3Q73A 2J9QA 4M7CA 2HE0A 2GROB 1H2UA 2WM9A 2XCCA 4WAFA 3D9OA 5AQAA 1O5MA 4JZYA 2X6FA 3EHQA 3L16A 2AWIA 3SNXA 4OYSA 4M3OA 4PS8A 3ZKJA 3DSVA 4BSZB 3PZ4A 3ML8A 4JB8P 4FJYA 4TRQA 1Z3XA 3ESLA 5CEAA 3IHYA 2ETBA 4WWPA 2R02A 3L82A 3LS8A 4KYOB 3LXUX 2XS8A 3AU4A 3PNTB 3HHMA 5EX0A 5EDSA 2MHKA 2AXVA 1NL4A 1TN8A 5EIDA 1GW6A 3I4RB 5HI7A 3EU5A 3NOGD 2J09A 3FH7A 4TXRA 3HXFA 4EECA 1HF8A 3BUAA 5KNGA 1KLXA 3CHRA 3PUKA 2P9IG 1NI1A 4JPSA 2L9BA 3UM2A 4U07A 2L0IA 2VGYA 4GPKA 3TGOA 5KNHD 3ZW3A 2AW6A 1O1SA 5AN8A 1OUVA 4GMRA 4UI9J 3MKQB 3HYMB 3E4BA 3UINC 1SW6A 5FIOA 3EHMA 4WNEA 2QYUA 4FADA 4G26A 1FT2A 1OCRE 2XGOA 4J6IA 4XI9A 4U0SA 1EPUA 3B7SA 1MYOA 3Q9NC 4AIFA 3B7UX 3MGBA 4K5CA 4JHRA 2PM6A 4DLOA 3LVRE 2Y4UA 4UUCA 5AYWD 3RU0A 1OWLA 1WAO1 3MEKA 3IV0A 1VDYA 4H7YA 1V55E 2MOWA 3FUKA 3CK8A 4LNBA 4YNDA 3MYVA 2YQ8A 1S63A 3RKVA 4GZ6A 4XKCA 2VSNA 1IHBA 3HXDA 1MX6A 4G2VA 1DVPA 2J4BA 3EIJA 3CHPA 3L22A 1FCHA 5FZQA 4N5CA 4HNAD 4AV7A 3JXIA 4BETA 4L7TA 5ARGA 3E32A 1OT8A 5G05J 1Y6IA 4A63B 2XGMA 1OCZE 4URKA 3ZYKA 2KC7A 5EKQD 5IY5E 2CHZA 3QJZA 4GZDA 4ANXA 3AJIA 4ANVA 5ITZF 4FLBA 4F53A 4JD2G 5LFAA 2XS1A 4HRLA 1H6OA 4FHKA 2XEHA 1QNFA 4N3CA 5ANRA 1D8EA 5ENOD 1H6PA 3UXGA 2CG3A 3TWTA 3FULA 3F6QA 2C2LA 4CDNA 1E7VA 2LXLA 3FTSA 1INZA 1Z5SC 2X6IA 3U3WA 2KBXA 4C9BB 4U95D 4O60A 4G24A 3PREA 5M72A 2R03A 1LD8A 3E30A 1N9AA 4AY5A 5CEDB 4UWGA 5KWDA 2KCKA 3Q7FA 3V31A 4DPRA 2CFUA 3ENEA 3TWQA 4HVBA 2YHEA 4WWNA 5EILA 1FVHA 4JC8A 2QC9A 2IO2C 2A4ZA 3TXMA 1N4PA 1E8ZA 3TWVA 3DWLG 3E34A 5CBNA 3GZ1A 3LY8A 2YNQA 5JMND 2LSVA 2HYZA 1PY1A 3UKRG 4MBGA 3BU8A 2VSOE 4MLPA 3DSWA 2X3MA 2V5FA 3ABKE 3CR3A 3T5XA 3CHQA 1D9SA 5G04J 4MRUA 2GRMA 2EIKE 3S7DA 4KVOA 4BFRA 4LEUA 3BG0B 2IY0C 1BU9A 4BWRA 4CEMA 4R7LA 1U3DA 3ULEG 4CT0A 2EINE 5FZRA 4XE0A 3L6AA 3R9AB 4J8DA 4W9RA 2Y1LE 2KZTA 2LSUA 3MX3A 3FTYA 3JUIA 2X6JA 1TNZA 3DPYA 1HU3A 4EBAA 4ZHBA 3FUIA 2V0PA 1QQEA 3ZEFA 4LG6A 3EDTB 2WXLA 5E75A 2I9CA 3I5PA 3DEPA 1N4RA 3FUEA 2PQNA 4NRHB 4FA6A 3D9IA 4G11A 3TG5A 2RFMA 3NBNB 2YINA 5ENQD 3SGHA 4AOFA 3TL5A 1N52A 4DK5A 4U8YD 4I6EA 1N95A 3FUFA 4Q69A 4FLHA 3UT7A 4AY6A 1IHGA 4GTMA 3CSFA 3S7FA 3APFA 3PDNA 1BI8B 4B93B 2IOLA 3OXFA 2V4HC 2UY1A 2C0LA 4PS7A 3I4GA 5HQ8A 4DX2A 5AAOA 3RSEG 1ELKA 3SY2A 2QFCA 2Y0BG 4LUNU 1TR4A 5FT9A 4C0EA 2VTBA 2NXPA 3ASHA 3UI2A 3P1UA 3RO3A 1MX2A 4HI9A 1WG0A 4U96D 3C3QA 3QWWA 3SD5A 3VTYA 4AVXA 5AARA 3R7QA 1K1BA 4HLEA 2WQHA 3R9MA 1UN8A 3G2UA 5FTPA 4U8VD 2H6GA 3T8MA 3QC1A 2ZU6B 4KZCA 3BQOA 1ELRA 4WNFA 1FT1A 4JEUA 4YVQC 2XRZA 3FY4A 3NAWA 5EYPF 4GZ5A 4BEPA 1U3CA 5T4YA 4XI0A 4MKTA 1N0RA 3UT4A 1NP7A 4I17A 1ELWA 3NB2A 5EN5D 5A7DB 3PEUB 3Q47B 1E8WA 4ME2A 1S70B 2FI7A 2WMOA 2XEVA 5AQBA 1N94A 3TWXA 3SO8A 3PZDA 2HO1A 4APFA 3UIOC 4CGWA 2F8XK 1IQUA 3RAUA 1H6KA 4GTOA 3IXEA 4ANUA 1IYGA 2WXFA 3AG3E 2WXOA 1HXIA 3CHSA 5FINA 3UQ3A 2P2CP 3LDZA 2ZXWE 3KEZA 3CSTA 4XX5A 3RO2A 4IRUA 4Q94A 1HZ4A 3APCA 4B8AA 4GYYA 5CCMA 5CMWA 5DBKA 2M63A 3LEWA 4HBDA 3ZYQA 4I1AA 4L2YA 1MX4A 4WWOA 1E96B 3FEYA 3CVQA 3CVUA 3FUDA 3MZLB 1A5EA 3FWVA 1PAQA 5CBOA 1W3BA 1A17A 3CQCB 4A3VA 5HRYA 3CHOA 1FVFA 4EZKA 2IJGX 4K03A 1K8KG 3FU0A 2IFUA 3CEQA 3RRUA 4APOA 2WMNA 3K9IA 1MZCA 5ENTD 2WXNA 4HRNA 2PL2A 4Q96A 1BPOA 4BT9A 4HQDA 5CMYA 5KJMA 5BXUA 2AXUA 4BESA 5CCLA 2JLBA 4C48B 2DYSE 4HS2A 4J8EA 3P2BA 4RG9A 3D9MA 2I1JA 5E76A 3WXXA 2XRYA 1N0QA 2ZGDA 4FU3A 2NC9A 3B7BA 3UM1A 3CVVA 2OEWA 4U0ZA 3TWUA 2RFAA 4GB9A 3QWPA 3WG7E 4F1SA 4F3VA 1N4QA 3QWVA 3HDXA 2J4DA 2BEDA 5LX8A 5ANLA 4RVBA 3B7RL 2P9UG 1TN7A 3GW4A 4UWKA 4CZ2D 1K3ZD 1RZ4A 3OTNA 2WQ7A 4J0UA 4G1TA 4JHJA 4XEIG 2R5SA 4DX1A 3CKBA 3L08A 3LYAA 3QOUA 1EDUA 4QQIA 4GTSA 1Z6TA 4H7XA 3Q9UC 4HOUA 3GYZA 3ULYA 4GA0A 3KSQA 4NIKA 3FFLA 4JA7A 3C3RA 3KSLA 3MJWA 3ZYMA 3CLJA 3ZYLA 4U8HA 1B89A 2OV8A 3B95A 2GGFA 5HS0A 4KVMA 3HVEB 1WM5A 1D8DA 2RD0A 4UWLA 1HS6A 3ABLE 2PQRA 4CRWA 3CVPA 5ARFA 4CGVA 1JCRA 2E0IA 2WXKA 3ZFWA 1QBQA 3KAEA 3V2OA 2PM7A 4A3TA 3FU5A 3QB2A 1SZ9A 1HH8A 5JA4D 3LPZA 3Q5MA 1ZBPA 3EJNA 1YA0A 4ILHB 3FH5A 3ZU7B 5BT1A 3U64A 2YHCA 3CK9A 4DI3A 2VSXE 4DUIA 5H7PA 2XEEA 2LAIA 3APDA 2ZISA 4HFGA 5JJ6A 4EZJA 3ZUVB 2KATA 3HRAA 1OWPA 3SI5A 2P9PG 3QDNA 4B8CB 1TJCA 2WPVA 4A1GA 3HXEA 4GU5A 4J8FA 4ATZD 3LCAA 2V8SE 3CQGB 5BW8C 1LTXA 3QARA 2WXRA 4L23A 2LAHA 2P9NG 3ZNGA 4WUYA 3JYSA 3ASFA 2FEZA 3JQ1A 4I6JA 4JHKA 4I1OB 3PZ2A 4JA9A 2ZIRA 4BX8A 3EUVA 1NA3A 3ZRHA 4I9CA 3ASGA 2A5EA 4HXIA 4HRMB 4ZFHA 4AM9A 2HM8A 4U7EB 3PZ1A 2C0MA 3QKYA 1E8YA 5BXOA 2JEKA 3MCXA 4UQZA 3Q7AA 5LCWC 4A55A 3QAQA 3TG4A 2IO3C 4KT6B 1PC2A 3KS2A 3OXLA 4TUUA 3LY9A 3PUJA 1KZPA 5J08A 4I2WA 2GRLA 2XGSA 1H2TC 1NA0A 5FQ8A 2KCLA 2BUGA 2WXHA 4ILIA 5AQ7A 2OCCE 3TAXA 2A5UA 4U0UA 2XQ0A 3AG4E 2AXZA 4OVVA 3MV3B 2IQCA 3RIBA 3CKCA 3FHEA 4GCOA 3ZGQA 1TYQG 2B0OE 2I1KA 2CHWA 3E37A 3FUNA 3Q15A 3D3MA 4F6RD 3IHVA 2V4LA 2MYOA 1HE8A 2X6HA 3PVLA 2WB2A 4GCNA 4GTPA 5CECB 2LO6A 3UUXA 1WY6A 1OY3D 2GRRB 4OVUA 1NFIE 5AJDA 1DC2A 3HXCA 5BUZA 5CERB 3I3NA 4N2QA 5B1BE 5BV1A 4UWFA 3D9KA 2FO7A 2XPYA 1IKND 1MQSA 2P9LG 3L9TA 4ACKA 3UM3A 4JXTA 3DXKG 2J08A 3X2QE 5EX3A 3IEGA 2IOSA 4CCAA 1HFAA 1HG5A 3E33A 3QK0A 1YCSB 4L1BA 3MKQA 4Z68A 3Q78A 3TWWA 3CV0A 4PDXA 3UTMA 4GA2A 1OXJA 3CVWA 4EPZA 3ZVVA 3PZ3A 1DCQA 3SFXA 3U66A 2PNNA 1OWOA 4KZ0A 1E7UA 3T8KA 3NZUA 2UWJG 2L6JA 3S7JA 5LP0A 4I2ZA 2OOEA 3FTXA 3TXNA 2KCVA 1JWFA 4X8QA 5FZSA 4AP2A 1L5JA 3ONLA 5G2NA 4GTRA 3DSXA 3ZXPA 1TEZA 1N54A 3Q49B 4FC8A 2DCPA 1XGWA 5T8IA 3SHFA 1SZAA 2H6HA 2H6IA 5AJLA 2X38A 2WXJA 3RJVA 1IQRA 3W9GA 2J07A 3FH8A 4ACLA 1YYHA 2QZAA 3O48A 1UOHA 5KJNA 3PEVB 2QY7A 3MKRA 3PRZA 2WXQA 4EHMA 3FP3A 1LF8A 1HG2A 3HVEA 2PZIA 1K1AA 4DLQA 3ZN3A 4KMOA 2F0YA 4GAAA 3PH0C 4YDWA 4V3IA 4NURA 3NOCD 3UKUG 2NSZA 4DX5D 2J49A 1MJ0A 4KBQA 1OCCE 3DSSA 4A1SA 2XZDG 4L9PA 3SBSA 1S0PA 2GW1A 3D9LA 3ZIMA 1SVXA 2KZTB 4XZ4A 3HG0D 2DYRE 2VJ8A 1KT1A 3EU9A 3FEXA 3PS6A 2BF0X 1N4SA 4BSXA 5JJ7A 1TJFA 4UQYA 5KJKA 5ENSD 3V79K 2NYJA 4GYOA 4Y6CA 4GTTA 4LRZA 4CYMD 2WXGA 4GMLA 3FTWA 5A23A 4ILGA 4N3BA 1S64A 3DXMG 1UW4B 4UI9K 1TNUA 1QYMA 3FU6A 3TWSA 4OAUC 1RW2A 2AJAA 4N3AA 3KEAA 5A6CA 3U9WA 2J8SD 2WVIA 3AS5A 1LD7A 1JCQA 2F8YA 4JVSA 4TXPA 2R2LA 4F1PA 1E8XA 4UWHA 1H0AA 3CHMA 4EBAG 4AEZC 4DRXE 5D2MC 1JUQA 1HX8A 4ATGA 4TXQA 2FULA 1Y8MA 1JPLA 2KM4A 4TV3A 4N39A 1KT0A 3S7BA 2UY1B 1UJJA 2V5QC 2CHXA 4XKBA 5ENPD 3FTZA 2WQ6A 3HXBA 1O1RA 4YDYA 4LSZE 2IONA 1TNBA 2CG2A 3G2WA 3SF4A 5LCWJ 2VTBB 2EQXA 4E85A 1JCSA 5BNWA 4BERA 4I43A 1OCOE 4GYWA 4O1OA 2XCBA 3CVLA 4XIFA 3B13A 1BLXB 1N11A 4JL0A 2BKKB 5BV0A 3OXGA 1FPPA 1KZOA 3PNLB 4RSYA 5FQ7A 1DCEA 3CVNA 1QZ2A 2VQ2A 2WXMA 2X6KA 3UMVA 4O1PA 3CVXA 4HI8A 3ASNE 4JW1A 2MRIA 5CRVA 2IU1A 1UJKA 1Q2ZA 4G23A 5JHAA 5J90A 5LOZA 3FUJA 4D10C 1IXVA 4JEHA 5AENA 3S2AA 4GTVA 2FBNA 4C0MA 2OEVA 2ETCA 3URZA 3GZSA 1JWGA 4WNDA 4GMJA 3QNKA 4B94A 3D9JA 2FO1E 3G2SA 4IULA 1TN6A 4NACA 4I6GA 3ONKA 3JCKC 3D9NA 4U63A 4UQXA 3C98A 3ULQA 1KPSB 4YVOA 3ZHEB 3Q4AB 1AP7A 3G2VA 3CK7A 3Q75A 5B1AE 4ANWA 1H2VC 1U2VG 2VGXB 1DNPA 3MA5A 5KJLA 5HKPA 2WXIA 3T9KA 3C3OA 2OVBA 3J5QB 5FQ6A 4E6HA 3FTVA 3NZSA 2Y69E 4LCTA 4GTQA 4LERA 2I2OA 4GZCA 4DX7D 3O4ZA 1O1TA 1V54E 5JJTA 4BY6A 4TUMA 3NF1A 3LJ3A 1Z3YA 2BTDA 4J8YA 4G25A 3LY7A 3FTUA 4GPMA 3RRMB 2L6BA 2LXMA 3UPVA 4CT4A 2P58C 4YDOA 4IN3B 3LJNA 2ETAA 4HOTA 3L17A 2R17C 5FQ4A 2VGEA 3LVQE 3PE4A 3HIZA 2IEJA 4EZLA 3JQ0A 2EILE 4RQIA 3CGHA 5B3SE 3UT8A 3AU5A 5FWQA 3TJPA 3DPDA 3IKOB 3U4TA 4G8LA 2B6CA 3SFZA 2VYIA 4FJZA 5EIBE 4PS3A 4UI9C 5BPPA 4MS6A 5CHEE 2GRQB 2GRPB 3L13A 2CFZA 2QYJA 1P5QA 3ESKA 5ENRD 4YDEA 3VLEA 4K5AB 2VSYA 3SZ7A 5KBAA 3EHNA 4N2SA 4HLLA 3W9FA 3JUEA 2AVPA 1XNFA 3LKUA 4BT8A 3UIPC 4DJAA 2DWZA 2JABA 3AG1E 3MV2B 1EF1C 3DSUA 3CIAA 2LUHA 2P9KG 1X81A 5D0OD 3DEOA 3Q79A 3ASDA 4GA1A 2XENA 4KXKB 4LNGA 1OWNA 4O6FA 5D66A 5D0QD 3VTXA 3ISMC 2RKKA 3SQVA 4LNUD 3BG1B 2Q7FA 1HO8A 4BX9A 2DIWA 3PE3A 2Y4TA 2F37A 3V2XA 5G05C 4NQ0A 5G55A 1G3NB 2XPIA 4HORA 2ZGGA 2E2EA 5AIJA 2DBAA 4DI4A 3BEEA 3C72A 3IBEA 4B89A 3VLDA 4AJWA 3DRAA 5T3RA 3ML9A 1AWCB 3NQPA 2LNIA 3D9PA 4QFVA 2R05A 2ONDA 4FULA 2XHEA 4FP7A 4P29A 4Y6WA 4U04A 5CRUA 3AG2E 3AAAC 5C1DA 3UM0A 1X5BA 5C2YA 2EIJE 5FJYA 3FDHA 3SBTB 4WNGA 2OVFA 4RG6A 3OAWA 2I6HA 3CVYA 2EIME 4CDMA 1TNYA 3ABME 2FF4A
chains in the Genus database with same CATH topology
3BG0B 3FUHA 3ZYLA 4U8HA 4GYOA 4Y6CA 1B89A 2OV8A 4LRZA 4IYPA 4BWRA 4CEMA 2GGFA 1MHQA 4I1MA 4R7LA 2WXGA 4GMLA 3FTWA 3FUMA 1U3DA 4KVMA 5ENNA 4CT0A 4K0RA 5A23A 4ILGA 3HVEB 4N3BA 4EQFA 1WM5A 4XE0A 2R59A 2RD0A 5FZRA 4UWLA 3T5VA 1HS6A 1UW4B 3L6AA 1H19A 4UI9K 3ZPJA 3R9AB 4J8DA 4W9RA 3FU6A 2KZTA 2PQRA 4CRWA 3VLFA 3CVPA 2LSUA 5ARFA 4FHJA 3MX3A 3RK6A 2XPZA 4CGVA 3FTYA 4N3AA 3JUIA 3UX4A 5A6CA 2X6JA 3U9WA 2IF4A 2WVIA 2E0IA 3AS5A 2WXKA 1HU3A 3ZFWA 3B7TA 4EBAA 3KAEA 4JVSA 4L2LA 5DIZA 1E8XA 4UWHA 1H0AA 3FUIA 3CHMA 2HR2A 4EBAG 4B0ZA 4GZ3A 2PM7A 4A3TA 4PH4B 2WXPA 4AEZC 3KD7A 2V0PA 1QQEA 3ZEFA 3FU3A 1JUQA 1HX8A 3FU5A 1SZ9A 3QB2A 4ATGA 3DBSA 3G2TA 3EDTB 1OWMA 1HH8A 3N71A 3ZXSA 1SQMA 2FULA 2WXLA 2I9CA 5E75A 1Y8MA 3I5PA 5JHBA 3LPZA 1JPLA 2KM4A 3Q5MA 1ZBPA 4TV3A 3R7RA 2Y3AA 5G04C 3EJNA 4N39A 1KT0A 2L0TB 3S7BA 4BTAA 3FUEA 2PQNA 4NRHB 1YA0A 4FA6A 2UY1B 4ILHB 3D9IA 4G11A 1UJJA 3FH5A 3TG5A 2CHXA 4XKBA 3AS8A 1NZNA 4F7AA 1UN9A 2YINA 3FTZA 2WQ6A 4HOSA 5BT1A 4ABNA 3U64A 2YHCA 3CK9A 4HOQA 4DI3A 3SGHA 2ILRA 2VSXE 4BTBA 4AOFA 1E90A 3TL5A 1N52A 2IONA 2CG2A 3G2WA 2LAIA 3SF4A 3APDA 3ZHEA 5LCWJ 4HFGA 5JJ6A 4EZJA 2VTBB 4DK5A 2EQXA 4E85A 2KATA 4HOTA 4I9EA 4I6EA 4CDRA 4Q69A 3FUFA 5BNWA 4FLHA 1OWPA 3SI5A 1EYHA 3UT7A 1UG3A 4AXHA 4I43A 3QDNA 4B8CB 1TJCA 4GYWA 2WPVA 4A1GA 4GU5A 2XCBA 4AY6A 1IHGA 4J8FA 3CVLA 3CSFA 4XIFA 3B13A 3LCAA 4JL0A 2V8SE 3GZ2A 3CQGB 3L54A 5BW8C 2VGXA 5BV0A 3S7FA 3OXGA 3APFA 3EIQC 3PDNA 3QARA 4J8SA 5KCMA 2WXRA 3PNLB 4RSYA 5FQ7A 1ZU2A 2IOLA 1QZ2A 2WXMA 2VQ2A 2X6KA 3CVNA 3OXFA 4L23A 3RRNB 3UMVA 4PUCA 3CVXA 2RG8A 2UY1A 2C0LA 2LAHA 3I4GA 4PS7A 3AS4A 2J9QA 4JW1A 5HQ8A 4WUYA 2MRIA 3JYSA 3ASFA 2FEZA 2IU1A 1ELKA 3JQ1A 1UJKA 4I6JA 4JHKA 4I1OB 4G23A 5JHAA 1H2UA 2WM9A 2XCCA 4JA9A 4WAFA 4BX8A 2QFCA 3D9OA 4LUNU 5J90A 1NA3A 5LOZA 3FUJA 3ZRHA 4JZYA 4I9CA 5FT9A 4D10C 4C0EA 2X6FA 4JEHA 3L16A 3ASGA 2AWIA 4HXIA 3SNXA 2VTBA 2NXPA 3ASHA 5AENA 4OYSA 4M3OA 4PS8A 3S2AA 4AM9A 2HM8A 2FBNA 3P1UA 4C0MA 3RO3A 2C0MA 3QKYA 3ML8A 1E8YA 4FJYA 4TRQA 1Z3XA 3URZA 3GZSA 3ESLA 2JEKA 3IHYA 1JWGA 3MCXA 3QWWA 4UQZA 4WWPA 3LS8A 5LCWC 4KYOB 4WNDA 4GMJA 3SD5A 3LXUX 4A55A 3QAQA 3TG4A 3QNKA 4B94A 3D9JA 4KT6B 3VTYA 3G2SA 1PC2A 3AU4A 3PNTB 4AVXA 3HHMA 4IULA 3KS2A 5EX0A 2MHKA 5EDSA 2AXVA 3R7QA 3OXLA 4NACA 4I6GA 3ONKA 3JCKC 4TUUA 4HLEA 3LY9A 3D9NA 4U63A 4UQXA 3PUJA 1GW6A 2WQHA 3I4RB 5HI7A 5J08A 3C98A 3ULQA 2J09A 4I2WA 3FH7A 2GRLA 2XGSA 4YVOA 4EECA 1H2TC 1NA0A 3Q4AB 5FQ8A 3ZHEB 1HF8A 2KCLA 2BUGA 2WXHA 4ILIA 1UN8A 3G2VA 3G2UA 1KLXA 3CHRA 3PUKA 3TAXA 2A5UA 4U0UA 5FTPA 2XQ0A 3CK7A 4JPSA 2L9BA 4ANWA 4U07A 2L0IA 2VGYA 4GPKA 1H2VC 3TGOA 2AXZA 4OVVA 3ZW3A 2VGXB 2AW6A 3T8MA 3QC1A 3MV3B 2ZU6B 1DNPA 2IQCA 3MA5A 3RIBA 5KJLA 3CKCA 3FHEA 4GCOA 4KZCA 3ZGQA 2I1KA 2WXIA 1ELRA 2CHWA 4WNFA 3FUNA 2OVBA 4JEUA 4YVQC 3Q15A 5FQ6A 4E6HA 2XRZA 3D3MA 3FTVA 1OUVA 3NZSA 3FY4A 3IHVA 2V4LA 4UI9J 4GZ5A 4LCTA 4LERA 1HE8A 2I2OA 4GZCA 1U3CA 2X6HA 3E4BA 3HYMB 3MKQB 3PVLA 3O4ZA 4XI0A 5T4YA 2WB2A 4MKTA 4GCNA 3EHMA 5JJTA 4BY6A 4WNEA 3UT4A 2LO6A 1NP7A 3UUXA 1WY6A 4I17A 1ELWA 4OVUA 4FADA 4G26A 3NF1A 5AJDA 2XGOA 3LJ3A 1Z3YA 4J6IA 5BUZA 5A7DB 4XI9A 4U0SA 1EPUA 2BTDA 4LEUA 4G25A 3LY7A 3FTUA 3B7SA 3RRMB 3PEUB 3I3NA 4N2QA 3UPVA 3Q47B 4CT4A 5BV1A 4UWFA 2P58C 3D9KA 1E8WA 2FO7A 2XPYA 4IN3B 2FI7A 2WMOA 1MQSA 2R17C 2XEVA 3L17A 4ME2A 5FQ4A 4AIFA 3B7UX 3LVQE 3MGBA 3PE4A 4ACKA 3HIZA 4JHRA 4JXTA 2PM6A 3PZDA 2HO1A 4EZLA 4APFA 2J08A 3JQ0A 4DLOA 3CGHA 5EX3A 3IEGA 4CGWA 1IQUA 2IOSA 4CCAA 1HFAA 3LVRE 1HG5A 3UT8A 1H6KA 2Y4UA 3QK0A 5AYWD 3RU0A 1OWLA 4L1BA 4ANUA 3AU5A 1IYGA 1WAO1 2WXFA 3MKQA 2WXOA 3MEKA 5FWQA 3IV0A 1VDYA 3CV0A 1HXIA 3CHSA 3TJPA 3DPDA 3IKOB 4H7YA 4PDXA 3U4TA 4GA2A 2MOWA 3FUKA 3UQ3A 3SFZA 3CK8A 3LDZA 3CVWA 4EPZA 3KEZA 4XX5A 3CSTA 3MYVA 4YNDA 3ZVVA 3RO2A 4IRUA 4Q94A 2YQ8A 2VYIA 4FJZA 1HZ4A 3RKVA 4PS3A 4UI9C 3APCA 4B8AA 4GYYA 3U66A 1OWOA 4KZ0A 5BPPA 1E7UA 5CCMA 4GZ6A 4XKCA 3NZUA 2VSNA 4MS6A 2UWJG 5CHEE 4G2VA 1DVPA 3L13A 5CMWA 2CFZA 2J4BA 3EIJA 5DBKA 3CHPA 3L22A 1P5QA 2L6JA 2M63A 3LEWA 1FCHA 3S7JA 3ZYQA 3ESKA 5FZQA 4I1AA 4N5CA 4AV7A 5LP0A 4I2ZA 4L2YA 2OOEA 3FTXA 3TXNA 4L7TA 5ARGA 3VLEA 2KCVA 1JWFA 5G05J 2VSYA 5FZSA 4WWOA 3SZ7A 1L5JA 4AP2A 1E96B 1Y6IA 2XGMA 3EHNA 3ONLA 3FEYA 4URKA 3ZYKA 2KC7A 5G2NA 4N2SA 5EKQD 3CVQA 3CVUA 2CHZA 1TEZA 3QJZA 3FUDA 2AVPA 3MZLB 1XNFA 1N54A 3Q49B 4GZDA 4ANXA 3LKUA 4FC8A 4BT8A 2DCPA 1PAQA 3FWVA 1W3BA 1XGWA 5T8IA 4ANVA 4DJAA 1A17A 4FLBA 4F53A 3MV2B 3CQCB 1EF1C 4A3VA 5LFAA 3SHFA 3CHOA 1SZAA 3CIAA 4FHKA 1FVFA 1QNFA 4N3CA 4EZKA 2IJGX 4K03A 5AJLA 2X38A 3FU0A 5ANRA 2IFUA 3CEQA 2WXJA 3RRUA 4APOA 2WMNA 3RJVA 5D0OD 3K9IA 2CG3A 1IQRA 2J07A 3FH8A 3ASDA 4GA1A 4ACLA 2WXNA 4KXKB 2PL2A 4Q96A 1BPOA 4BT9A 3FULA 3O48A 5CMYA 5KJNA 5KJMA 4O6FA 1OWNA 2C2LA 3PEVB 4CDNA 1E7VA 2QY7A 3FTSA 5D0QD 1INZA 2AXUA 3MKRA 2X6IA 3U3WA 3PRZA 2WXQA 4C9BB 3VTXA 5CCLA 3FP3A 2JLBA 4HS2A 4G24A 3BG1B 3PREA 5M72A 2Q7FA 4J8EA 1HO8A 1LF8A 3P2BA 4BX9A 2DIWA 4RG9A 1HG2A 4AY5A 3PE3A 3D9MA 4UWGA 3HVEA 2I1JA 5E76A 2Y4TA 2PZIA 3WXXA 2KCKA 2XRYA 4FU3A 4DLQA 3ZN3A 4DPRA 5G05C 4NQ0A 4KMOA 5G55A 2NC9A 2CFUA 3ENEA 4GAAA 3PH0C 4HVBA 2XPIA 2YHEA 4WWNA 3CVVA 4U0ZA 4V3IA 4NURA 4HORA 2NSZA 1FVHA 4GB9A 3QWPA 2E2EA 5AIJA 4JC8A 2DBAA 4DI4A 4F1SA 2J49A 4KBQA 4F3VA 3BEEA 2A4ZA 3TXMA 3QWVA 1E8ZA 3HDXA 2J4DA 4BFRA 5LX8A 3IBEA 5ANLA 4RVBA 3B7RL 4A1SA 4B89A 3GW4A 4UWKA 3VLDA 4AJWA 3GZ1A 5T3RA 3SBSA 3ML9A 3LY8A 3OTNA 3NQPA 2WQ7A 2YNQA 4J0UA 2LNIA 3D9PA 1S0PA 4G1TA 4JHJA 2LSVA 2R5SA 4QFVA 2HYZA 1PY1A 2ONDA 3CKBA 4FULA 2GW1A 2VSOE 2XHEA 3L08A 3D9LA 3ZIMA 2KZTB 4MLPA 4FP7A 4XZ4A 4P29A 4Y6WA 2X3MA 2V5FA 4U04A 3LYAA 3QOUA 2VJ8A 1KT1A 3CR3A 3T5XA 3CHQA 3FEXA 1EDUA 5C1DA 1X5BA 1Z6TA 3PS6A 4H7XA 2BF0X 5C2YA 5FJYA 4HOUA 3FDHA 3GYZA 3SBTB 4WNGA 1TJFA 4BSXA 4GA0A 5JJ7A 2OVFA 5G04J 4RG6A 4UQYA 5KJKA 3OAWA 2I6HA 2GRMA 4MRUA 3CVYA 3FFLA 4CDMA 4JA7A 3S7DA 2FF4A 4KVOA 3MJWA 3ZYMA 3CLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYO A;  4Y6C A;  1B89 A;  4BWR A;  4N3B A;  4EQF A;  1WM5 A;  5FZR A;  4UI9 K;  3ZPJ A;  3R9A B;  4J8D A;  4W9R A;  2PQR A;  3CVP A;  2LSU A;  5ARF A;  4CGV A;  4N3A A;  5A6C A;  2IF4 A;  3AS5 A;  3ZFW A;  3KAE A;  5DIZ A;  2HR2 A;  4GZ3 A;  3KD7 A;  1QQE A;  3EDT B;  3N71 A;  1HH8 A;  1Y8M A;  3LPZ A;  3Q5M A;  1ZBP A;  5G04 C;  4N39 A;  1KT0 A;  3S7B A;  4BTA A;  2PQN A;  4NRH B;  1YA0 A;  2UY1 B;  3TG5 A;  3AS8 A;  1NZN A;  4HOS A;  5BT1 A;  4ABN A;  2YHC A;  3CK9 A;  4HOQ A;  4BTB A;  3SF4 A;  3ZHE A;  5LCW J;  5JJ6 A;  2KAT A;  4I9E A;  4CDR A;  5BNW A;  3QDN A;  1TJC A;  4GYW A;  2WPV A;  2XCB A;  4AY6 A;  1IHG A;  4J8F A;  3CVL A;  4XIF A;  3LCA A;  4JL0 A;  3GZ2 A;  5BW8 C;  2VGX A;  3S7F A;  3OXG A;  3PDN A;  1ZU2 A;  3CVN A;  1QZ2 A;  2VQ2 A;  3OXF A;  2UY1 A;  2C0L A;  3AS4 A;  2J9Q A;  5HQ8 A;  4WUY A;  3JYS A;  3ASF A;  2FEZ A;  4G23 A;  2XCC A;  4JA9 A;  2QFC A;  1NA3 A;  4I9C A;  5FT9 A;  3ASG A;  3ASH A;  4AM9 A;  2FBN A;  3RO3 A;  2C0M A;  3QKY A;  3URZ A;  3QWW A;  4UQZ A;  5LCW C;  4KYO B;  4WND A;  3TG4 A;  4B94 A;  3VTY A;  1PC2 A;  3KS2 A;  5EX0 A;  2MHK A;  3OXL A;  3LY9 A;  4UQX A;  2WQH A;  5HI7 A;  3ULQ A;  4I2W A;  2XGS A;  4YVO A;  1NA0 A;  3ZHE B;  3Q4A B;  2KCL A;  2BUG A;  1KLX A;  3TAX A;  4U0U A;  5FTP A;  3CK7 A;  4U07 A;  2VGY A;  4GPK A;  3TGO A;  2VGX B;  3MV3 B;  3MA5 A;  3RIB A;  5KJL A;  3CKC A;  4GCO A;  3ZGQ A;  1ELR A;  4WNF A;  4YVQ C;  3Q15 A;  1OUV A;  4UI9 J;  4GZ5 A;  3HYM B;  3E4B A;  4XI0 A;  4GCN A;  5JJT A;  4WNE A;  3UUX A;  4I17 A;  1ELW A;  4G26 A;  3NF1 A;  2XGO A;  5A7D B;  4XI9 A;  4U0S A;  4G25 A;  3LY7 A;  4N2Q A;  3UPV A;  3Q47 B;  2P58 C;  4IN3 B;  2FO7 A;  4ME2 A;  4HOT A;  2FI7 A;  2XEV A;  4AIF A;  3PE4 A;  4JHR A;  2HO1 A;  5EX3 A;  3IEG A;  4CGW A;  2Y4U A;  5AYW D;  3RU0 A;  1IYG A;  1WAO 1;  3MEK A;  3CV0 A;  1HXI A;  4H7Y A;  3U4T A;  4GA2 A;  3UQ3 A;  3CK8 A;  4YND A;  3RO2 A;  2YQ8 A;  2VYI A;  1HZ4 A;  3RKV A;  4UI9 C;  4GYY A;  5CCM A;  4GZ6 A;  2VSN A;  2UWJ G;  5CHE E;  4G2V A;  5DBK A;  1P5Q A;  2L6J A;  3S7J A;  1FCH A;  3ESK A;  5FZQ A;  4I1A A;  4N5C A;  4I2Z A;  2OOE A;  5ARG A;  2KCV A;  5G05 J;  2VSY A;  5FZS A;  3SZ7 A;  1E96 B;  2XGM A;  2KC7 A;  4N2S A;  5EKQ D;  3CVQ A;  2AVP A;  1XNF A;  3Q49 B;  3LKU A;  4BT8 A;  3FWV A;  1W3B A;  1A17 A;  3MV2 B;  4N3C A;  2IFU A;  3CEQ A;  4APO A;  3RJV A;  5D0O D;  3K9I A;  3ASD A;  4GA1 A;  4KXK B;  2PL2 A;  4BT9 A;  3O48 A;  5KJN A;  5KJM A;  4O6F A;  2C2L A;  5D0Q D;  3MKR A;  3U3W A;  3VTX A;  5CCL A;  3FP3 A;  2JLB A;  4G24 A;  5M72 A;  2Q7F A;  4J8E A;  4RG9 A;  4AY5 A;  3PE3 A;  2Y4T A;  2PZI A;  3WXX A;  2KCK A;  3ZN3 A;  5G05 C;  4NQ0 A;  2NC9 A;  2XPI A;  4U0Z A;  4HOR A;  3QWP A;  2E2E A;  2DBA A;  4KBQ A;  4F3V A;  3BEE A;  3QWV A;  4A1S A;  3GW4 A;  3GZ1 A;  3LY8 A;  4J0U A;  2LNI A;  4G1T A;  2LSV A;  2R5S A;  2HYZ A;  2OND A;  3CKB A;  2GW1 A;  4Y6W A;  2V5F A;  4U04 A;  3LYA A;  3QOU A;  1KT1 A;  5C1D A;  4H7X A;  5FJY A;  4HOU A;  3GYZ A;  5JJ7 A;  4WNG A;  4GA0 A;  5G04 J;  4RG6 A;  4UQY A;  5KJK A;  2I6H A;  3FFL A;  4JA7 A;  3S7D A;  2FF4 A;  4LEU A; 
#chains in the Genus database with same CATH topology
 3FUH A;  1YMP A;  4IYP A;  4I1M A;  1MHQ A;  3FUM A;  5ENN A;  4K0R A;  4EQF A;  2R59 A;  2DZO A;  3T5V A;  2GRN B;  1H19 A;  3ZPJ A;  4K5B A;  3VLF A;  4FHJ A;  3RK6 A;  2XPZ A;  2H6F A;  2XZT G;  3SFY A;  3UX4 A;  2IF4 A;  1BI7 B;  3B7T A;  3ASO E;  4L2L A;  4RLY A;  3J5P A;  3DST A;  5DIZ A;  2HR2 A;  1TNO A;  1SA4 A;  4G8K A;  4B0Z A;  4GZ3 A;  4PH4 B;  2WXP A;  3KD7 A;  3FU3 A;  3DBS A;  3G2T A;  1OWM A;  3N71 A;  4OAV B;  3ZXS A;  1SQM A;  4N5Q A;  5JHB A;  3R7R A;  2Y3A A;  5G04 C;  4BTA A;  2L0T B;  1BD8 A;  4DX6 D;  2DZN A;  3AS8 A;  1NZN A;  3EHR A;  4F7A A;  1UN9 A;  5EYL A;  4HOS A;  4ABN A;  4HOQ A;  2ILR A;  2P9S G;  4BTB A;  4HB5 A;  1E90 A;  5AQ9 A;  3ZHE A;  3D9H A;  2KXP C;  4I9E A;  4CDR A;  3C5R A;  1EYH A;  1UG3 A;  4AXH A;  1ZB1 A;  3V30 A;  1SA5 A;  3GZ2 A;  3L54 A;  2VGX A;  3EIQ C;  4J8S A;  5KCM A;  1WDY A;  2DVW A;  2BKG A;  4J7W A;  1ZU2 A;  3RRN B;  4PUC A;  3TWR A;  2RG8 A;  3AS4 A;  3JXJ A;  3Q73 A;  2J9Q A;  4M7C A;  2HE0 A;  2GRO B;  1H2U A;  2WM9 A;  2XCC A;  4WAF A;  3D9O A;  5AQA A;  1O5M A;  4JZY A;  2X6F A;  3EHQ A;  3L16 A;  2AWI A;  3SNX A;  4OYS A;  4M3O A;  4PS8 A;  3ZKJ A;  3DSV A;  4BSZ B;  3PZ4 A;  3ML8 A;  4JB8 P;  4FJY A;  4TRQ A;  1Z3X A;  3ESL A;  5CEA A;  3IHY A;  2ETB A;  4WWP A;  2R02 A;  3L82 A;  3LS8 A;  4KYO B;  3LXU X;  2XS8 A;  3AU4 A;  3PNT B;  3HHM A;  5EX0 A;  5EDS A;  2MHK A;  2AXV A;  1NL4 A;  1TN8 A;  5EID A;  1GW6 A;  3I4R B;  5HI7 A;  3EU5 A;  3NOG D;  2J09 A;  3FH7 A;  4TXR A;  3HXF A;  4EEC A;  1HF8 A;  3BUA A;  5KNG A;  1KLX A;  3CHR A;  3PUK A;  2P9I G;  1NI1 A;  4JPS A;  2L9B A;  3UM2 A;  4U07 A;  2L0I A;  2VGY A;  4GPK A;  3TGO A;  5KNH D;  3ZW3 A;  2AW6 A;  1O1S A;  5AN8 A;  1OUV A;  4GMR A;  4UI9 J;  3MKQ B;  3HYM B;  3E4B A;  3UIN C;  1SW6 A;  5FIO A;  3EHM A;  4WNE A;  2QYU A;  4FAD A;  4G26 A;  1FT2 A;  1OCR E;  2XGO A;  4J6I A;  4XI9 A;  4U0S A;  1EPU A;  3B7S A;  1MYO A;  3Q9N C;  4AIF A;  3B7U X;  3MGB A;  4K5C A;  4JHR A;  2PM6 A;  4DLO A;  3LVR E;  2Y4U A;  4UUC A;  5AYW D;  3RU0 A;  1OWL A;  1WAO 1;  3MEK A;  3IV0 A;  1VDY A;  4H7Y A;  1V55 E;  2MOW A;  3FUK A;  3CK8 A;  4LNB A;  4YND A;  3MYV A;  2YQ8 A;  1S63 A;  3RKV A;  4GZ6 A;  4XKC A;  2VSN A;  1IHB A;  3HXD A;  1MX6 A;  4G2V A;  1DVP A;  2J4B A;  3EIJ A;  3CHP A;  3L22 A;  1FCH A;  5FZQ A;  4N5C A;  4HNA D;  4AV7 A;  3JXI A;  4BET A;  4L7T A;  5ARG A;  3E32 A;  1OT8 A;  5G05 J;  1Y6I A;  4A63 B;  2XGM A;  1OCZ E;  4URK A;  3ZYK A;  2KC7 A;  5EKQ D;  5IY5 E;  2CHZ A;  3QJZ A;  4GZD A;  4ANX A;  3AJI A;  4ANV A;  5ITZ F;  4FLB A;  4F53 A;  4JD2 G;  5LFA A;  2XS1 A;  4HRL A;  1H6O A;  4FHK A;  2XEH A;  1QNF A;  4N3C A;  5ANR A;  1D8E A;  5ENO D;  1H6P A;  3UXG A;  2CG3 A;  3TWT A;  3FUL A;  3F6Q A;  2C2L A;  4CDN A;  1E7V A;  2LXL A;  3FTS A;  1INZ A;  1Z5S C;  2X6I A;  3U3W A;  2KBX A;  4C9B B;  4U95 D;  4O60 A;  4G24 A;  3PRE A;  5M72 A;  2R03 A;  1LD8 A;  3E30 A;  1N9A A;  4AY5 A;  5CED B;  4UWG A;  5KWD A;  2KCK A;  3Q7F A;  3V31 A;  4DPR A;  2CFU A;  3ENE A;  3TWQ A;  4HVB A;  2YHE A;  4WWN A;  5EIL A;  1FVH A;  4JC8 A;  2QC9 A;  2IO2 C;  2A4Z A;  3TXM A;  1N4P A;  1E8Z A;  3TWV A;  3DWL G;  3E34 A;  5CBN A;  3GZ1 A;  3LY8 A;  2YNQ A;  5JMN D;  2LSV A;  2HYZ A;  1PY1 A;  3UKR G;  4MBG A;  3BU8 A;  2VSO E;  4MLP A;  3DSW A;  2X3M A;  2V5F A;  3ABK E;  3CR3 A;  3T5X A;  3CHQ A;  1D9S A;  5G04 J;  4MRU A;  2GRM A;  2EIK E;  3S7D A;  4KVO A;  4BFR A;  4LEU A;  3BG0 B;  2IY0 C;  1BU9 A;  4BWR A;  4CEM A;  4R7L A;  1U3D A;  3ULE G;  4CT0 A;  2EIN E;  5FZR A;  4XE0 A;  3L6A A;  3R9A B;  4J8D A;  4W9R A;  2Y1L E;  2KZT A;  2LSU A;  3MX3 A;  3FTY A;  3JUI A;  2X6J A;  1TNZ A;  3DPY A;  1HU3 A;  4EBA A;  4ZHB A;  3FUI A;  2V0P A;  1QQE A;  3ZEF A;  4LG6 A;  3EDT B;  2WXL A;  5E75 A;  2I9C A;  3I5P A;  3DEP A;  1N4R A;  3FUE A;  2PQN A;  4NRH B;  4FA6 A;  3D9I A;  4G11 A;  3TG5 A;  2RFM A;  3NBN B;  2YIN A;  5ENQ D;  3SGH A;  4AOF A;  3TL5 A;  1N52 A;  4DK5 A;  4U8Y D;  4I6E A;  1N95 A;  3FUF A;  4Q69 A;  4FLH A;  3UT7 A;  4AY6 A;  1IHG A;  4GTM A;  3CSF A;  3S7F A;  3APF A;  3PDN A;  1BI8 B;  4B93 B;  2IOL A;  3OXF A;  2V4H C;  2UY1 A;  2C0L A;  4PS7 A;  3I4G A;  5HQ8 A;  4DX2 A;  5AAO A;  3RSE G;  1ELK A;  3SY2 A;  2QFC A;  2Y0B G;  4LUN U;  1TR4 A;  5FT9 A;  4C0E A;  2VTB A;  2NXP A;  3ASH A;  3UI2 A;  3P1U A;  3RO3 A;  1MX2 A;  4HI9 A;  1WG0 A;  4U96 D;  3C3Q A;  3QWW A;  3SD5 A;  3VTY A;  4AVX A;  5AAR A;  3R7Q A;  1K1B A;  4HLE A;  2WQH A;  3R9M A;  1UN8 A;  3G2U A;  5FTP A;  4U8V D;  2H6G A;  3T8M A;  3QC1 A;  2ZU6 B;  4KZC A;  3BQO A;  1ELR A;  4WNF A;  1FT1 A;  4JEU A;  4YVQ C;  2XRZ A;  3FY4 A;  3NAW A;  5EYP F;  4GZ5 A;  4BEP A;  1U3C A;  5T4Y A;  4XI0 A;  4MKT A;  1N0R A;  3UT4 A;  1NP7 A;  4I17 A;  1ELW A;  3NB2 A;  5EN5 D;  5A7D B;  3PEU B;  3Q47 B;  1E8W A;  4ME2 A;  1S70 B;  2FI7 A;  2WMO A;  2XEV A;  5AQB A;  1N94 A;  3TWX A;  3SO8 A;  3PZD A;  2HO1 A;  4APF A;  3UIO C;  4CGW A;  2F8X K;  1IQU A;  3RAU A;  1H6K A;  4GTO A;  3IXE A;  4ANU A;  1IYG A;  2WXF A;  3AG3 E;  2WXO A;  1HXI A;  3CHS A;  5FIN A;  3UQ3 A;  2P2C P;  3LDZ A;  2ZXW E;  3KEZ A;  3CST A;  4XX5 A;  3RO2 A;  4IRU A;  4Q94 A;  1HZ4 A;  3APC A;  4B8A A;  4GYY A;  5CCM A;  5CMW A;  5DBK A;  2M63 A;  3LEW A;  4HBD A;  3ZYQ A;  4I1A A;  4L2Y A;  1MX4 A;  4WWO A;  1E96 B;  3FEY A;  3CVQ A;  3CVU A;  3FUD A;  3MZL B;  1A5E A;  3FWV A;  1PAQ A;  5CBO A;  1W3B A;  1A17 A;  3CQC B;  4A3V A;  5HRY A;  3CHO A;  1FVF A;  4EZK A;  2IJG X;  4K03 A;  1K8K G;  3FU0 A;  2IFU A;  3CEQ A;  3RRU A;  4APO A;  2WMN A;  3K9I A;  1MZC A;  5ENT D;  2WXN A;  4HRN A;  2PL2 A;  4Q96 A;  1BPO A;  4BT9 A;  4HQD A;  5CMY A;  5KJM A;  5BXU A;  2AXU A;  4BES A;  5CCL A;  2JLB A;  4C48 B;  2DYS E;  4HS2 A;  4J8E A;  3P2B A;  4RG9 A;  3D9M A;  2I1J A;  5E76 A;  3WXX A;  2XRY A;  1N0Q A;  2ZGD A;  4FU3 A;  2NC9 A;  3B7B A;  3UM1 A;  3CVV A;  2OEW A;  4U0Z A;  3TWU A;  2RFA A;  4GB9 A;  3QWP A;  3WG7 E;  4F1S A;  4F3V A;  1N4Q A;  3QWV A;  3HDX A;  2J4D A;  2BED A;  5LX8 A;  5ANL A;  4RVB A;  3B7R L;  2P9U G;  1TN7 A;  3GW4 A;  4UWK A;  4CZ2 D;  1K3Z D;  1RZ4 A;  3OTN A;  2WQ7 A;  4J0U A;  4G1T A;  4JHJ A;  4XEI G;  2R5S A;  4DX1 A;  3CKB A;  3L08 A;  3LYA A;  3QOU A;  1EDU A;  4QQI A;  4GTS A;  1Z6T A;  4H7X A;  3Q9U C;  4HOU A;  3GYZ A;  3ULY A;  4GA0 A;  3KSQ A;  4NIK A;  3FFL A;  4JA7 A;  3C3R A;  3KSL A;  3MJW A;  3ZYM A;  3CLJ A;  3ZYL A;  4U8H A;  1B89 A;  2OV8 A;  3B95 A;  2GGF A;  5HS0 A;  4KVM A;  3HVE B;  1WM5 A;  1D8D A;  2RD0 A;  4UWL A;  1HS6 A;  3ABL E;  2PQR A;  4CRW A;  3CVP A;  5ARF A;  4CGV A;  1JCR A;  2E0I A;  2WXK A;  3ZFW A;  1QBQ A;  3KAE A;  3V2O A;  2PM7 A;  4A3T A;  3FU5 A;  3QB2 A;  1SZ9 A;  1HH8 A;  5JA4 D;  3LPZ A;  3Q5M A;  1ZBP A;  3EJN A;  1YA0 A;  4ILH B;  3FH5 A;  3ZU7 B;  5BT1 A;  3U64 A;  2YHC A;  3CK9 A;  4DI3 A;  2VSX E;  4DUI A;  5H7P A;  2XEE A;  2LAI A;  3APD A;  2ZIS A;  4HFG A;  5JJ6 A;  4EZJ A;  3ZUV B;  2KAT A;  3HRA A;  1OWP A;  3SI5 A;  2P9P G;  3QDN A;  4B8C B;  1TJC A;  2WPV A;  4A1G A;  3HXE A;  4GU5 A;  4J8F A;  4ATZ D;  3LCA A;  2V8S E;  3CQG B;  5BW8 C;  1LTX A;  3QAR A;  2WXR A;  4L23 A;  2LAH A;  2P9N G;  3ZNG A;  4WUY A;  3JYS A;  3ASF A;  2FEZ A;  3JQ1 A;  4I6J A;  4JHK A;  4I1O B;  3PZ2 A;  4JA9 A;  2ZIR A;  4BX8 A;  3EUV A;  1NA3 A;  3ZRH A;  4I9C A;  3ASG A;  2A5E A;  4HXI A;  4HRM B;  4ZFH A;  4AM9 A;  2HM8 A;  4U7E B;  3PZ1 A;  2C0M A;  3QKY A;  1E8Y A;  5BXO A;  2JEK A;  3MCX A;  4UQZ A;  3Q7A A;  5LCW C;  4A55 A;  3QAQ A;  3TG4 A;  2IO3 C;  4KT6 B;  1PC2 A;  3KS2 A;  3OXL A;  4TUU A;  3LY9 A;  3PUJ A;  1KZP A;  5J08 A;  4I2W A;  2GRL A;  2XGS A;  1H2T C;  1NA0 A;  5FQ8 A;  2KCL A;  2BUG A;  2WXH A;  4ILI A;  5AQ7 A;  2OCC E;  3TAX A;  2A5U A;  4U0U A;  2XQ0 A;  3AG4 E;  2AXZ A;  4OVV A;  3MV3 B;  2IQC A;  3RIB A;  3CKC A;  3FHE A;  4GCO A;  3ZGQ A;  1TYQ G;  2B0O E;  2I1K A;  2CHW A;  3E37 A;  3FUN A;  3Q15 A;  3D3M A;  4F6R D;  3IHV A;  2V4L A;  2MYO A;  1HE8 A;  2X6H A;  3PVL A;  2WB2 A;  4GCN A;  4GTP A;  5CEC B;  2LO6 A;  3UUX A;  1WY6 A;  1OY3 D;  2GRR B;  4OVU A;  1NFI E;  5AJD A;  1DC2 A;  3HXC A;  5BUZ A;  5CER B;  3I3N A;  4N2Q A;  5B1B E;  5BV1 A;  4UWF A;  3D9K A;  2FO7 A;  2XPY A;  1IKN D;  1MQS A;  2P9L G;  3L9T A;  4ACK A;  3UM3 A;  4JXT A;  3DXK G;  2J08 A;  3X2Q E;  5EX3 A;  3IEG A;  2IOS A;  4CCA A;  1HFA A;  1HG5 A;  3E33 A;  3QK0 A;  1YCS B;  4L1B A;  3MKQ A;  4Z68 A;  3Q78 A;  3TWW A;  3CV0 A;  4PDX A;  3UTM A;  4GA2 A;  1OXJ A;  3CVW A;  4EPZ A;  3ZVV A;  3PZ3 A;  1DCQ A;  3SFX A;  3U66 A;  2PNN A;  1OWO A;  4KZ0 A;  1E7U A;  3T8K A;  3NZU A;  2UWJ G;  2L6J A;  3S7J A;  5LP0 A;  4I2Z A;  2OOE A;  3FTX A;  3TXN A;  2KCV A;  1JWF A;  4X8Q A;  5FZS A;  4AP2 A;  1L5J A;  3ONL A;  5G2N A;  4GTR A;  3DSX A;  3ZXP A;  1TEZ A;  1N54 A;  3Q49 B;  4FC8 A;  2DCP A;  1XGW A;  5T8I A;  3SHF A;  1SZA A;  2H6H A;  2H6I A;  5AJL A;  2X38 A;  2WXJ A;  3RJV A;  1IQR A;  3W9G A;  2J07 A;  3FH8 A;  4ACL A;  1YYH A;  2QZA A;  3O48 A;  1UOH A;  5KJN A;  3PEV B;  2QY7 A;  3MKR A;  3PRZ A;  2WXQ A;  4EHM A;  3FP3 A;  1LF8 A;  1HG2 A;  3HVE A;  2PZI A;  1K1A A;  4DLQ A;  3ZN3 A;  4KMO A;  2F0Y A;  4GAA A;  3PH0 C;  4YDW A;  4V3I A;  4NUR A;  3NOC D;  3UKU G;  2NSZ A;  4DX5 D;  2J49 A;  1MJ0 A;  4KBQ A;  1OCC E;  3DSS A;  4A1S A;  2XZD G;  4L9P A;  3SBS A;  1S0P A;  2GW1 A;  3D9L A;  3ZIM A;  1SVX A;  2KZT B;  4XZ4 A;  3HG0 D;  2DYR E;  2VJ8 A;  1KT1 A;  3EU9 A;  3FEX A;  3PS6 A;  2BF0 X;  1N4S A;  4BSX A;  5JJ7 A;  1TJF A;  4UQY A;  5KJK A;  5ENS D;  3V79 K;  2NYJ A;  4GYO A;  4Y6C A;  4GTT A;  4LRZ A;  4CYM D;  2WXG A;  4GML A;  3FTW A;  5A23 A;  4ILG A;  4N3B A;  1S64 A;  3DXM G;  1UW4 B;  4UI9 K;  1TNU A;  1QYM A;  3FU6 A;  3TWS A;  4OAU C;  1RW2 A;  2AJA A;  4N3A A;  3KEA A;  5A6C A;  3U9W A;  2J8S D;  2WVI A;  3AS5 A;  1LD7 A;  1JCQ A;  2F8Y A;  4JVS A;  4TXP A;  2R2L A;  4F1P A;  1E8X A;  4UWH A;  1H0A A;  3CHM A;  4EBA G;  4AEZ C;  4DRX E;  5D2M C;  1JUQ A;  1HX8 A;  4ATG A;  4TXQ A;  2FUL A;  1Y8M A;  1JPL A;  2KM4 A;  4TV3 A;  4N39 A;  1KT0 A;  3S7B A;  2UY1 B;  1UJJ A;  2V5Q C;  2CHX A;  4XKB A;  5ENP D;  3FTZ A;  2WQ6 A;  3HXB A;  1O1R A;  4YDY A;  4LSZ E;  2ION A;  1TNB A;  2CG2 A;  3G2W A;  3SF4 A;  5LCW J;  2VTB B;  2EQX A;  4E85 A;  1JCS A;  5BNW A;  4BER A;  4I43 A;  1OCO E;  4GYW A;  4O1O A;  2XCB A;  3CVL A;  4XIF A;  3B13 A;  1BLX B;  1N11 A;  4JL0 A;  2BKK B;  5BV0 A;  3OXG A;  1FPP A;  1KZO A;  3PNL B;  4RSY A;  5FQ7 A;  1DCE A;  3CVN A;  1QZ2 A;  2VQ2 A;  2WXM A;  2X6K A;  3UMV A;  4O1P A;  3CVX A;  4HI8 A;  3ASN E;  4JW1 A;  2MRI A;  5CRV A;  2IU1 A;  1UJK A;  1Q2Z A;  4G23 A;  5JHA A;  5J90 A;  5LOZ A;  3FUJ A;  4D10 C;  1IXV A;  4JEH A;  5AEN A;  3S2A A;  4GTV A;  2FBN A;  4C0M A;  2OEV A;  2ETC A;  3URZ A;  3GZS A;  1JWG A;  4WND A;  4GMJ A;  3QNK A;  4B94 A;  3D9J A;  2FO1 E;  3G2S A;  4IUL A;  1TN6 A;  4NAC A;  4I6G A;  3ONK A;  3JCK C;  3D9N A;  4U63 A;  4UQX A;  3C98 A;  3ULQ A;  1KPS B;  4YVO A;  3ZHE B;  3Q4A B;  1AP7 A;  3G2V A;  3CK7 A;  3Q75 A;  5B1A E;  4ANW A;  1H2V C;  1U2V G;  2VGX B;  1DNP A;  3MA5 A;  5KJL A;  5HKP A;  2WXI A;  3T9K A;  3C3O A;  2OVB A;  3J5Q B;  5FQ6 A;  4E6H A;  3FTV A;  3NZS A;  2Y69 E;  4LCT A;  4GTQ A;  4LER A;  2I2O A;  4GZC A;  4DX7 D;  3O4Z A;  1O1T A;  1V54 E;  5JJT A;  4BY6 A;  4TUM A;  3NF1 A;  3LJ3 A;  1Z3Y A;  2BTD A;  4J8Y A;  4G25 A;  3LY7 A;  3FTU A;  4GPM A;  3RRM B;  2L6B A;  2LXM A;  3UPV A;  4CT4 A;  2P58 C;  4YDO A;  4IN3 B;  3LJN A;  2ETA A;  4HOT A;  3L17 A;  2R17 C;  5FQ4 A;  2VGE A;  3LVQ E;  3PE4 A;  3HIZ A;  2IEJ A;  4EZL A;  3JQ0 A;  2EIL E;  4RQI A;  3CGH A;  5B3S E;  3UT8 A;  3AU5 A;  5FWQ A;  3TJP A;  3DPD A;  3IKO B;  3U4T A;  4G8L A;  2B6C A;  3SFZ A;  2VYI A;  4FJZ A;  5EIB E;  4PS3 A;  4UI9 C;  5BPP A;  4MS6 A;  5CHE E;  2GRQ B;  2GRP B;  3L13 A;  2CFZ A;  2QYJ A;  1P5Q A;  3ESK A;  5ENR D;  4YDE A;  3VLE A;  4K5A B;  2VSY A;  3SZ7 A;  5KBA A;  3EHN A;  4N2S A;  4HLL A;  3W9F A;  3JUE A;  2AVP A;  1XNF A;  3LKU A;  4BT8 A;  3UIP C;  4DJA A;  2DWZ A;  2JAB A;  3AG1 E;  3MV2 B;  1EF1 C;  3DSU A;  3CIA A;  2LUH A;  2P9K G;  1X81 A;  5D0O D;  3DEO A;  3Q79 A;  3ASD A;  4GA1 A;  2XEN A;  4KXK B;  4LNG A;  1OWN A;  4O6F A;  5D66 A;  5D0Q D;  3VTX A;  3ISM C;  2RKK A;  3SQV A;  4LNU D;  3BG1 B;  2Q7F A;  1HO8 A;  4BX9 A;  2DIW A;  3PE3 A;  2Y4T A;  2F37 A;  3V2X A;  5G05 C;  4NQ0 A;  5G55 A;  1G3N B;  2XPI A;  4HOR A;  2ZGG A;  2E2E A;  5AIJ A;  2DBA A;  4DI4 A;  3BEE A;  3C72 A;  3IBE A;  4B89 A;  3VLD A;  4AJW A;  3DRA A;  5T3R A;  3ML9 A;  1AWC B;  3NQP A;  2LNI A;  3D9P A;  4QFV A;  2R05 A;  2OND A;  4FUL A;  2XHE A;  4FP7 A;  4P29 A;  4Y6W A;  4U04 A;  5CRU A;  3AG2 E;  3AAA C;  5C1D A;  3UM0 A;  1X5B A;  5C2Y A;  2EIJ E;  5FJY A;  3FDH A;  3SBT B;  4WNG A;  2OVF A;  4RG6 A;  3OAW A;  2I6H A;  3CVY A;  2EIM E;  4CDM A;  1TNY A;  3ABM E;  2FF4 A; 
#chains in the Genus database with same CATH homology
 3BG0 B;  3FUH A;  3ZYL A;  4U8H A;  4GYO A;  4Y6C A;  1B89 A;  2OV8 A;  4LRZ A;  4IYP A;  4BWR A;  4CEM A;  2GGF A;  1MHQ A;  4I1M A;  4R7L A;  2WXG A;  4GML A;  3FTW A;  3FUM A;  1U3D A;  4KVM A;  5ENN A;  4CT0 A;  4K0R A;  5A23 A;  4ILG A;  3HVE B;  4N3B A;  4EQF A;  1WM5 A;  4XE0 A;  2R59 A;  2RD0 A;  5FZR A;  4UWL A;  3T5V A;  1HS6 A;  1UW4 B;  3L6A A;  1H19 A;  4UI9 K;  3ZPJ A;  3R9A B;  4J8D A;  4W9R A;  3FU6 A;  2KZT A;  2PQR A;  4CRW A;  3VLF A;  3CVP A;  2LSU A;  5ARF A;  4FHJ A;  3MX3 A;  3RK6 A;  2XPZ A;  4CGV A;  3FTY A;  4N3A A;  3JUI A;  3UX4 A;  5A6C A;  2X6J A;  3U9W A;  2IF4 A;  2WVI A;  2E0I A;  3AS5 A;  2WXK A;  1HU3 A;  3ZFW A;  3B7T A;  4EBA A;  3KAE A;  4JVS A;  4L2L A;  5DIZ A;  1E8X A;  4UWH A;  1H0A A;  3FUI A;  3CHM A;  2HR2 A;  4EBA G;  4B0Z A;  4GZ3 A;  2PM7 A;  4A3T A;  4PH4 B;  2WXP A;  4AEZ C;  3KD7 A;  2V0P A;  1QQE A;  3ZEF A;  3FU3 A;  1JUQ A;  1HX8 A;  3FU5 A;  1SZ9 A;  3QB2 A;  4ATG A;  3DBS A;  3G2T A;  3EDT B;  1OWM A;  1HH8 A;  3N71 A;  3ZXS A;  1SQM A;  2FUL A;  2WXL A;  2I9C A;  5E75 A;  1Y8M A;  3I5P A;  5JHB A;  3LPZ A;  1JPL A;  2KM4 A;  3Q5M A;  1ZBP A;  4TV3 A;  3R7R A;  2Y3A A;  5G04 C;  3EJN A;  4N39 A;  1KT0 A;  2L0T B;  3S7B A;  4BTA A;  3FUE A;  2PQN A;  4NRH B;  1YA0 A;  4FA6 A;  2UY1 B;  4ILH B;  3D9I A;  4G11 A;  1UJJ A;  3FH5 A;  3TG5 A;  2CHX A;  4XKB A;  3AS8 A;  1NZN A;  4F7A A;  1UN9 A;  2YIN A;  3FTZ A;  2WQ6 A;  4HOS A;  5BT1 A;  4ABN A;  3U64 A;  2YHC A;  3CK9 A;  4HOQ A;  4DI3 A;  3SGH A;  2ILR A;  2VSX E;  4BTB A;  4AOF A;  1E90 A;  3TL5 A;  1N52 A;  2ION A;  2CG2 A;  3G2W A;  2LAI A;  3SF4 A;  3APD A;  3ZHE A;  5LCW J;  4HFG A;  5JJ6 A;  4EZJ A;  2VTB B;  4DK5 A;  2EQX A;  4E85 A;  2KAT A;  4HOT A;  4I9E A;  4I6E A;  4CDR A;  4Q69 A;  3FUF A;  5BNW A;  4FLH A;  1OWP A;  3SI5 A;  1EYH A;  3UT7 A;  1UG3 A;  4AXH A;  4I43 A;  3QDN A;  4B8C B;  1TJC A;  4GYW A;  2WPV A;  4A1G A;  4GU5 A;  2XCB A;  4AY6 A;  1IHG A;  4J8F A;  3CVL A;  3CSF A;  4XIF A;  3B13 A;  3LCA A;  4JL0 A;  2V8S E;  3GZ2 A;  3CQG B;  3L54 A;  5BW8 C;  2VGX A;  5BV0 A;  3S7F A;  3OXG A;  3APF A;  3EIQ C;  3PDN A;  3QAR A;  4J8S A;  5KCM A;  2WXR A;  3PNL B;  4RSY A;  5FQ7 A;  1ZU2 A;  2IOL A;  1QZ2 A;  2WXM A;  2VQ2 A;  2X6K A;  3CVN A;  3OXF A;  4L23 A;  3RRN B;  3UMV A;  4PUC A;  3CVX A;  2RG8 A;  2UY1 A;  2C0L A;  2LAH A;  3I4G A;  4PS7 A;  3AS4 A;  2J9Q A;  4JW1 A;  5HQ8 A;  4WUY A;  2MRI A;  3JYS A;  3ASF A;  2FEZ A;  2IU1 A;  1ELK A;  3JQ1 A;  1UJK A;  4I6J A;  4JHK A;  4I1O B;  4G23 A;  5JHA A;  1H2U A;  2WM9 A;  2XCC A;  4JA9 A;  4WAF A;  4BX8 A;  2QFC A;  3D9O A;  4LUN U;  5J90 A;  1NA3 A;  5LOZ A;  3FUJ A;  3ZRH A;  4JZY A;  4I9C A;  5FT9 A;  4D10 C;  4C0E A;  2X6F A;  4JEH A;  3L16 A;  3ASG A;  2AWI A;  4HXI A;  3SNX A;  2VTB A;  2NXP A;  3ASH A;  5AEN A;  4OYS A;  4M3O A;  4PS8 A;  3S2A A;  4AM9 A;  2HM8 A;  2FBN A;  3P1U A;  4C0M A;  3RO3 A;  2C0M A;  3QKY A;  3ML8 A;  1E8Y A;  4FJY A;  4TRQ A;  1Z3X A;  3URZ A;  3GZS A;  3ESL A;  2JEK A;  3IHY A;  1JWG A;  3MCX A;  3QWW A;  4UQZ A;  4WWP A;  3LS8 A;  5LCW C;  4KYO B;  4WND A;  4GMJ A;  3SD5 A;  3LXU X;  4A55 A;  3QAQ A;  3TG4 A;  3QNK A;  4B94 A;  3D9J A;  4KT6 B;  3VTY A;  3G2S A;  1PC2 A;  3AU4 A;  3PNT B;  4AVX A;  3HHM A;  4IUL A;  3KS2 A;  5EX0 A;  2MHK A;  5EDS A;  2AXV A;  3R7Q A;  3OXL A;  4NAC A;  4I6G A;  3ONK A;  3JCK C;  4TUU A;  4HLE A;  3LY9 A;  3D9N A;  4U63 A;  4UQX A;  3PUJ A;  1GW6 A;  2WQH A;  3I4R B;  5HI7 A;  5J08 A;  3C98 A;  3ULQ A;  2J09 A;  4I2W A;  3FH7 A;  2GRL A;  2XGS A;  4YVO A;  4EEC A;  1H2T C;  1NA0 A;  3Q4A B;  5FQ8 A;  3ZHE B;  1HF8 A;  2KCL A;  2BUG A;  2WXH A;  4ILI A;  1UN8 A;  3G2V A;  3G2U A;  1KLX A;  3CHR A;  3PUK A;  3TAX A;  2A5U A;  4U0U A;  5FTP A;  2XQ0 A;  3CK7 A;  4JPS A;  2L9B A;  4ANW A;  4U07 A;  2L0I A;  2VGY A;  4GPK A;  1H2V C;  3TGO A;  2AXZ A;  4OVV A;  3ZW3 A;  2VGX B;  2AW6 A;  3T8M A;  3QC1 A;  3MV3 B;  2ZU6 B;  1DNP A;  2IQC A;  3MA5 A;  3RIB A;  5KJL A;  3CKC A;  3FHE A;  4GCO A;  4KZC A;  3ZGQ A;  2I1K A;  2WXI A;  1ELR A;  2CHW A;  4WNF A;  3FUN A;  2OVB A;  4JEU A;  4YVQ C;  3Q15 A;  5FQ6 A;  4E6H A;  2XRZ A;  3D3M A;  3FTV A;  1OUV A;  3NZS A;  3FY4 A;  3IHV A;  2V4L A;  4UI9 J;  4GZ5 A;  4LCT A;  4LER A;  1HE8 A;  2I2O A;  4GZC A;  1U3C A;  2X6H A;  3E4B A;  3HYM B;  3MKQ B;  3PVL A;  3O4Z A;  4XI0 A;  5T4Y A;  2WB2 A;  4MKT A;  4GCN A;  3EHM A;  5JJT A;  4BY6 A;  4WNE A;  3UT4 A;  2LO6 A;  1NP7 A;  3UUX A;  1WY6 A;  4I17 A;  1ELW A;  4OVU A;  4FAD A;  4G26 A;  3NF1 A;  5AJD A;  2XGO A;  3LJ3 A;  1Z3Y A;  4J6I A;  5BUZ A;  5A7D B;  4XI9 A;  4U0S A;  1EPU A;  2BTD A;  4LEU A;  4G25 A;  3LY7 A;  3FTU A;  3B7S A;  3RRM B;  3PEU B;  3I3N A;  4N2Q A;  3UPV A;  3Q47 B;  4CT4 A;  5BV1 A;  4UWF A;  2P58 C;  3D9K A;  1E8W A;  2FO7 A;  2XPY A;  4IN3 B;  2FI7 A;  2WMO A;  1MQS A;  2R17 C;  2XEV A;  3L17 A;  4ME2 A;  5FQ4 A;  4AIF A;  3B7U X;  3LVQ E;  3MGB A;  3PE4 A;  4ACK A;  3HIZ A;  4JHR A;  4JXT A;  2PM6 A;  3PZD A;  2HO1 A;  4EZL A;  4APF A;  2J08 A;  3JQ0 A;  4DLO A;  3CGH A;  5EX3 A;  3IEG A;  4CGW A;  1IQU A;  2IOS A;  4CCA A;  1HFA A;  3LVR E;  1HG5 A;  3UT8 A;  1H6K A;  2Y4U A;  3QK0 A;  5AYW D;  3RU0 A;  1OWL A;  4L1B A;  4ANU A;  3AU5 A;  1IYG A;  1WAO 1;  2WXF A;  3MKQ A;  2WXO A;  3MEK A;  5FWQ A;  3IV0 A;  1VDY A;  3CV0 A;  1HXI A;  3CHS A;  3TJP A;  3DPD A;  3IKO B;  4H7Y A;  4PDX A;  3U4T A;  4GA2 A;  2MOW A;  3FUK A;  3UQ3 A;  3SFZ A;  3CK8 A;  3LDZ A;  3CVW A;  4EPZ A;  3KEZ A;  4XX5 A;  3CST A;  3MYV A;  4YND A;  3ZVV A;  3RO2 A;  4IRU A;  4Q94 A;  2YQ8 A;  2VYI A;  4FJZ A;  1HZ4 A;  3RKV A;  4PS3 A;  4UI9 C;  3APC A;  4B8A A;  4GYY A;  3U66 A;  1OWO A;  4KZ0 A;  5BPP A;  1E7U A;  5CCM A;  4GZ6 A;  4XKC A;  3NZU A;  2VSN A;  4MS6 A;  2UWJ G;  5CHE E;  4G2V A;  1DVP A;  3L13 A;  5CMW A;  2CFZ A;  2J4B A;  3EIJ A;  5DBK A;  3CHP A;  3L22 A;  1P5Q A;  2L6J A;  2M63 A;  3LEW A;  1FCH A;  3S7J A;  3ZYQ A;  3ESK A;  5FZQ A;  4I1A A;  4N5C A;  4AV7 A;  5LP0 A;  4I2Z A;  4L2Y A;  2OOE A;  3FTX A;  3TXN A;  4L7T A;  5ARG A;  3VLE A;  2KCV A;  1JWF A;  5G05 J;  2VSY A;  5FZS A;  4WWO A;  3SZ7 A;  1L5J A;  4AP2 A;  1E96 B;  1Y6I A;  2XGM A;  3EHN A;  3ONL A;  3FEY A;  4URK A;  3ZYK A;  2KC7 A;  5G2N A;  4N2S A;  5EKQ D;  3CVQ A;  3CVU A;  2CHZ A;  1TEZ A;  3QJZ A;  3FUD A;  2AVP A;  3MZL B;  1XNF A;  1N54 A;  3Q49 B;  4GZD A;  4ANX A;  3LKU A;  4FC8 A;  4BT8 A;  2DCP A;  1PAQ A;  3FWV A;  1W3B A;  1XGW A;  5T8I A;  4ANV A;  4DJA A;  1A17 A;  4FLB A;  4F53 A;  3MV2 B;  3CQC B;  1EF1 C;  4A3V A;  5LFA A;  3SHF A;  3CHO A;  1SZA A;  3CIA A;  4FHK A;  1FVF A;  1QNF A;  4N3C A;  4EZK A;  2IJG X;  4K03 A;  5AJL A;  2X38 A;  3FU0 A;  5ANR A;  2IFU A;  3CEQ A;  2WXJ A;  3RRU A;  4APO A;  2WMN A;  3RJV A;  5D0O D;  3K9I A;  2CG3 A;  1IQR A;  2J07 A;  3FH8 A;  3ASD A;  4GA1 A;  4ACL A;  2WXN A;  4KXK B;  2PL2 A;  4Q96 A;  1BPO A;  4BT9 A;  3FUL A;  3O48 A;  5CMY A;  5KJN A;  5KJM A;  4O6F A;  1OWN A;  2C2L A;  3PEV B;  4CDN A;  1E7V A;  2QY7 A;  3FTS A;  5D0Q D;  1INZ A;  2AXU A;  3MKR A;  2X6I A;  3U3W A;  3PRZ A;  2WXQ A;  4C9B B;  3VTX A;  5CCL A;  3FP3 A;  2JLB A;  4HS2 A;  4G24 A;  3BG1 B;  3PRE A;  5M72 A;  2Q7F A;  4J8E A;  1HO8 A;  1LF8 A;  3P2B A;  4BX9 A;  2DIW A;  4RG9 A;  1HG2 A;  4AY5 A;  3PE3 A;  3D9M A;  4UWG A;  3HVE A;  2I1J A;  5E76 A;  2Y4T A;  2PZI A;  3WXX A;  2KCK A;  2XRY A;  4FU3 A;  4DLQ A;  3ZN3 A;  4DPR A;  5G05 C;  4NQ0 A;  4KMO A;  5G55 A;  2NC9 A;  2CFU A;  3ENE A;  4GAA A;  3PH0 C;  4HVB A;  2XPI A;  2YHE A;  4WWN A;  3CVV A;  4U0Z A;  4V3I A;  4NUR A;  4HOR A;  2NSZ A;  1FVH A;  4GB9 A;  3QWP A;  2E2E A;  5AIJ A;  4JC8 A;  2DBA A;  4DI4 A;  4F1S A;  2J49 A;  4KBQ A;  4F3V A;  3BEE A;  2A4Z A;  3TXM A;  3QWV A;  1E8Z A;  3HDX A;  2J4D A;  4BFR A;  5LX8 A;  3IBE A;  5ANL A;  4RVB A;  3B7R L;  4A1S A;  4B89 A;  3GW4 A;  4UWK A;  3VLD A;  4AJW A;  3GZ1 A;  5T3R A;  3SBS A;  3ML9 A;  3LY8 A;  3OTN A;  3NQP A;  2WQ7 A;  2YNQ A;  4J0U A;  2LNI A;  3D9P A;  1S0P A;  4G1T A;  4JHJ A;  2LSV A;  2R5S A;  4QFV A;  2HYZ A;  1PY1 A;  2OND A;  3CKB A;  4FUL A;  2GW1 A;  2VSO E;  2XHE A;  3L08 A;  3D9L A;  3ZIM A;  2KZT B;  4MLP A;  4FP7 A;  4XZ4 A;  4P29 A;  4Y6W A;  2X3M A;  2V5F A;  4U04 A;  3LYA A;  3QOU A;  2VJ8 A;  1KT1 A;  3CR3 A;  3T5X A;  3CHQ A;  3FEX A;  1EDU A;  5C1D A;  1X5B A;  1Z6T A;  3PS6 A;  4H7X A;  2BF0 X;  5C2Y A;  5FJY A;  4HOU A;  3FDH A;  3GYZ A;  3SBT B;  4WNG A;  1TJF A;  4BSX A;  4GA0 A;  5JJ7 A;  2OVF A;  5G04 J;  4RG6 A;  4UQY A;  5KJK A;  3OAW A;  2I6H A;  2GRM A;  4MRU A;  3CVY A;  3FFL A;  4CDM A;  4JA7 A;  3S7D A;  2FF4 A;  4KVO A;  3MJW A;  3ZYM A;  3CLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...