4Y6CA

Q17m crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
212
structure length
212
Chain Sequence
HMEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYMANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Unknown function
molecule keywords ANSERINA PUTATIVE KINESIN LIGHT chain
total genus 89
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6cA00
4GYWA 3K9IA 3VTYA 4G24A 4GCNA 2AVPA 5FJYA 3ZGQA 5BT1A 4CGVA 4N5CA 5CCLA 1YA0A 4XI9A 3R9AB 2OOEA 3CVLA 5ARGA 2PZIA 3GZ1A 5FTPA 4HOQA 2P58C 5BNWA 2VGXA 4U0UA 1ELWA 2XGOA 4JL0A 4U0ZA 4WNDA 3O48A 3RKVA 4GA2A 2Y4TA 4KBQA 3Q4AB 4GZ5A 1WM5A 4H7YA 4J8EA 4F3VA 3AS8A 1W3BA 2KC7A 2XCCA 4I17A 3LYAA 3LKUA 5EX3A 5JJTA 4EQFA 4NQ0A 4YVOA 4BTBA 2R5SA 3QWWA 2XGSA 1KT0A 3HYMB 1HZ4A 5D0OD 4G1TA 1IYGA 2VSNA 3LPZA 3MEKA 4WUYA 3SZ7A 4UI9K 4BWRA 4BT8A 4CDRA 2YQ8A 2J9QA 2FI7A 3PE3A 4HOSA 3TG4A 3BEEA 2YHCA 2KCVA 5D0QD 5KJKA 4GZ3A 2UY1B 2WQHA 4GYYA 2I6HA 2E2EA 3CKBA 5DBKA 5G04J 3QKYA 2XEVA 4WNEA 5FT9A 5ARFA 3RJVA 3ZHEB 3ASHA 2Q7FA 2IF4A 3N71A 5JJ6A 4A1SA 2PQRA 3ESKA 4HOTA 4UI9C 1NA0A 4N3BA 3LCAA 2XPIA 3OXLA 4G2VA 4GPKA 5FZSA 2XCBA 3Q5MA 3WXXA 1P5QA 3Q47B 4AY6A 1XNFA 3Q49B 4GCOA 1E96B 2VGYA 3E4BA 3CK8A 4J8DA 2C0LA 2HYZA 2JLBA 4UQZA 5CHEE 5EX0A 2KATA 4HORA 3ASDA 1NZNA 3TAXA 5LCWJ 4RG9A 5KJNA 3UQ3A 5BW8C 4NRHB 4UQXA 3ZN3A 4J0UA 2V5FA 2WPVA 3ASFA 3QOUA 4U07A 2VGXB 1ZU2A 4XIFA 4W9RA 3KAEA 3AS4A 4JA7A 2LSUA 3QWPA 5A7DB 5C1DA 4ME2A 4I9CA 3CVPA 1ZBPA 3LY8A 5LCWC 4G25A 5A6CA 1KLXA 3CKCA 3CK7A 3FP3A 3ZFWA 3RU0A 2LSVA 3KS2A 2VSYA 3MV3B 4GYOA 3KD7A 2LNIA 2XGMA 3IEGA 4HOUA 3S7JA 4KXKB 1A17A 4ABNA 5G05J 1IHGA 4WNFA 1TJCA 3OXGA 5CCMA 5M72A 2FO7A 3LY7A 2FBNA 4YNDA 4APOA 4I2WA 3TG5A 5JJ7A 3EDTB 3CK9A 1KT1A 3RIBA 3UUXA 2PQNA 4I1AA 1HXIA 3QDNA 3CVNA 5FZQA 5AYWD 4AM9A 3AS5A 3CVQA 2DBAA 2VQ2A 5G05C 3RO2A 2KCLA 2Y4UA 3S7BA 3S7FA 1FCHA 2C0MA 3U3WA 4N2SA 4AIFA 3JYSA 1QQEA 3Q15A 4IN3B 1WAO1 1ELRA 2KCKA 3ASGA 4U04A 2UWJG 1QZ2A 4KYOB 4RG6A 5EKQD 2L6JA 2HR2A 3OXFA 4AY5A 4LEUA 4Y6WA 4J8FA 5HQ8A 4N3CA 4WNGA 1Y8MA 3PE4A 3QWVA 4I9EA 3VTXA 2FF4A 3GZ2A 4GA1A 5FZRA 3ZPJA 2FEZA 2HO1A 3GW4A 1B89A 2C2LA 3RO3A 3MKRA 4JHRA 4BTAA 1PC2A 3MV2B 2VYIA 3LY9A 3TGOA 1OUVA 2NC9A 2QFCA 3FFLA 4H7XA 4O6FA 4Y6CA 2UY1A 4U0SA 4N39A 2BUGA 2MHKA 2IFUA 4XI0A 1HH8A 3ULQA 3U4TA 3CV0A 4G26A 3ZHEA 5KJLA 3MA5A 4I2ZA 4B94A 4GA0A 3SF4A 4GZ6A 2PL2A 2ONDA 3FWVA 3GYZA 2GW1A 4G23A 3PDNA 4UI9J 4JA9A 5DIZA 5G04C 4N3AA 5HI7A 4BT9A 4N2QA 3CEQA 4CGWA 1NA3A 3NF1A 4UQYA 4YVQC 5KJMA 3UPVA 3URZA 3S7DA
chains in the Genus database with same CATH superfamily
1HFAA 3SNXA 5BT1A 5FJYA 3R9AB 4HOQA 2LXMA 3G2WA 4RQIA 4LNBA 5AQ9A 3ULYA 4GZ5A 5KBAA 3L22A 3EUVA 4TUUA 3PUKA 3QWWA 5D0OD 5CMYA 5H7PA 4G1TA 3JQ0A 5JHBA 1HE8A 1N4PA 3UINC 4JVSA 1U3DA 1UOHA 4J8SA 3DPDA 4AV7A 4WWNA 4N3BA 2OVFA 2CFZA 4ZFHA 5JMND 2F8XK 2ETBA 3UQ3A 4OYSA 3ASFA 1QNFA 5D66A 1ZBPA 2LAIA 1OXJA 3JQ1A 1N0RA 4I6EA 3D9MA 1OCCE 2H6GA 4WNFA 2WXIA 3DSUA 3W9FA 2Y4UA 3U3WA 2PNNA 3ZRHA 3TL5A 4LEUA 3EIJA 3SO8A 1Y8MA 3QWVA 1GW6A 5ENOD 3FTVA 2NC9A 4K0RA 4O6FA 4XI0A 3QC1A 3MKQA 4I43A 4BESA 4UQYA 1TEZA 1PAQA 2P9SG 2AVPA 4G8LA 5CCLA 3L17A 4ILGA 5LFAA 1BI7B 5BV0A 1JCSA 2XGOA 3MX3A 2IEJA 4B89A 4F3VA 1V55E 4ACKA 1SA5A 2IU1A 5BUZA 3HYMB 1IYGA 1S70B 2H6HA 2AXVA 1DCEA 3FTYA 2UY1B 2E2EA 5DBKA 2WXMA 2IF4A 2EIKE 3TWXA 2DWZA 2ZXWE 1E8YA 3UX4A 3Q5MA 1IQUA 4JC8A 2V5FA 1OT8A 2VGXB 4U7EB 4JA7A 1DNPA 4ME2A 4I9CA 1D9SA 5FQ7A 3KEAA 3KS2A 3CVWA 3WG7E 3S7JA 4GTTA 2EQXA 3EU9A 5G05J 3V79K 2IO3C 1EDUA 3D9LA 4I1AA 3CVNA 3S7FA 5G05C 3ASOE 1H2TC 4KYOB 4XKCA 3OXFA 2HR2A 3LVRE 1B89A 3NQPA 2KZTB 4A3VA 4URKA 4FJZA 3FU5A 4U95D 4CDMA 3UKUG 4HRNA 3VTYA 4N5CA 3CVLA 2P58C 2VGXA 3ZIMA 4J8EA 3RK6A 4EZKA 3ULEG 5HS0A 4CDNA 1D8EA 4PUCA 5AENA 3MEKA 4BWRA 3ABKE 3T5XA 1LF8A 3VLDA 2XEVA 3BG0B 4DJAA 4GCOA 3T8MA 2XENA 1SW6A 2XHEA 4GMJA 2PM7A 1S63A 3ASDA 4HORA 2FULA 2P9PG 3UM1A 4L23A 1KZPA 3J5PA 3QWPA 2VTBA 5J90A 3CK7A 3MV3B 2RG8A 2VGEA 3IEGA 3NZSA 3ZKJA 3QB2A 1EYHA 4YNDA 5IY5E 1JUQA 3CK9A 4YDWA 3V2OA 1UJJA 1A5EA 3AS5A 3LJ3A 3LEWA 1N0QA 1ELRA 1WAO1 2DVWA 3HDXA 3DSXA 3TGOA 3MJWA 4H7XA 3DPYA 3C98A 1PY1A 1TNBA 1QBQA 5KNHD 3AU4A 1U3CA 3ONKA 2J07A 3FH8A 4KT6B 1BU9A 4GZDA 3NZUA 4G24A 3ZW3A 4HNAD 5FTPA 5BNWA 4A3TA 4WNDA 4A63B 3APCA 4UWFA 3CLJA 4NURA 3D3MA 1HZ4A 2R03A 3ISMC 3U64A 3APDA 3FTUA 3G2UA 3JXIA 3CVXA 4L9PA 3ZEFA 4BSZB 3UT8A 4Q96A 3T5VA 1E7UA 2QY7A 4HQDA 1MHQA 5ENSD 4L1BA 4UQZA 2C0LA 4U8HA 4EZLA 4TRQA 4F1SA 4RG9A 1FPPA 2LSUA 4UWLA 4APFA 1Q2ZA 4LNGA 2BF0X 3NOGD 2YHEA 4ABNA 4HLEA 4GTQA 4KMOA 3SBSA 1XGWA 3FY4A 3B7RL 2KCLA 3MYVA 4IN3B 5EILA 2X6JA 3TWWA 3ESLA 4J8FA 1MX4A 4K03A 4ACLA 3ZNGA 3CHMA 5CRVA 3C3RA 4JHRA 3Q9NC 4BTAA 2UY1A 4N39A 1HH8A 3U4TA 3B95A 3IV0A 1BPOA 4G23A 3HVEB 3W9GA 3UI2A 4K5AB 3UPVA 1UW4B 2V4HC 4XI9A 4F6RD 3PNTB 4FA6A 2XS1A 1O5MA 3O48A 2QZAA 4HXIA 3B7BA 2QYJA 1H6PA 2R5SA 1NL4A 1SZAA 4HB5A 4GPMA 1AWCB 1UJKA 2B6CA 3ZYKA 2I2OA 5G55A 3QNKA 5KJKA 3JCKC 1DCQA 4XEIG 2BTDA 2WMNA 3PS6A 4ZHBA 4DI3A 2OEWA 2XPZA 4RSYA 3CVUA 2X6FA 2VGYA 3D9NA 5EX0A 2CHXA 4W9RA 2X6KA 2VSYA 3FULA 4V3IA 1Z3YA 2AW6A 3AG1E 1YMPA 3VLEA 2PQNA 5FZQA 4GMRA 2DBAA 5FQ8A 1DC2A 1Z5SC 1QQEA 4XKBA 3Q15A 4EHMA 3BU8A 5EKQD 2YNQA 4AY5A 2RKKA 5HQ8A 4I9EA 4DX7D 3CR3A 3ZPJA 1JPLA 3C72A 1UN8A 3RO3A 2E0IA 3LY9A 3RRUA 3FUNA 4Q94A 4JA9A 3R7QA 3FTWA 1IQRA 1NA3A 1YYHA 4JPSA 3QK0A 3ZGQA 1K8KG 5KWDA 2OOEA 3DSVA 3U9WA 4HBDA 2Y4TA 2AXZA 2VSOE 4DI4A 3QAQA 4A55A 4NQ0A 2RFMA 4EBAG 4QFVA 2ETCA 4XX5A 3SD5A 4UI9K 4MS6A 4GYYA 3CKBA 4EQFA 3QKYA 3RJVA 4WNEA 3ZHEB 2F0YA 3AU5A 3RSEG 5FZSA 1XNFA 2GRPB 5CHEE 2XZTG 3TJPA 4UQXA 3EHNA 5A7DB 1ZU2A 2XEHA 3EHQA 3T8KA 4YDYA 3RU0A 1E8WA 5EIDA 2LNIA 3I4GA 3E30A 1IXVA 4DX5D 2NYJA 4O60A 3BUAA 3QDNA 3CVQA 4FLHA 2C0MA 4LSZE 3D9PA 2MRIA 1H6OA 5AARA 3JUIA 1LD7A 2WVIA 2P9KG 4I6JA 2CHWA 4BY6A 3MKRA 1PC2A 2HM8A 4G26A 2GRMA 2CG3A 4B94A 2PL2A 2ONDA 3FWVA 3GYZA 2XEEA 4JW1A 2GRRB 3CHOA 1U2VG 4CGWA 5KJMA 3G2TA 2LUHA 4DK5A 1ELKA 4GTOA 3ZU7B 3Q9UC 2GGFA 3RKVA 3L08A 3CHSA 4MBGA 3FEXA 4WWOA 2P9LG 2F8YA 3UT4A 4JB8P 4FLBA 2J9QA 4G8KA 1O1SA 4HVBA 3FUKA 5KCMA 4GZCA 4GPKA 2H6FA 3D9JA 4LUNU 3CIAA 2HYZA 2WM9A 3TWRA 1K3ZD 5AAOA 3PREA 3UM3A 3G2VA 1TN8A 3ZYLA 1KLXA 1N54A 1MYOA 3I3NA 3L9TA 2LSVA 3L54A 2XPYA 3ZUVB 5C2YA 1YCSB 4JHJA 1V54E 3SFXA 1N4RA 2P9IG 4QQIA 1OWPA 1KT1A 3TWSA 5BPPA 3HG0D 2VQ2A 3S7BA 4BX9A 5BV1A 2MYOA 2KCKA 4U04A 2UWJG 4E6HA 5ANLA 4Y6WA 5BXOA 4OAUC 3P1UA 4JD2G 3GZ2A 2VSXE 3OTNA 2R05A 4L2LA 3ULQA 2IFUA 1G3NB 3EHRA 2DIWA 3NF1A 4YVQC 2FO1E 2X6HA 4TXQA 1S0PA 3I4RB 3FTXA 3G2SA 3T9KA 4P29A 5CRUA 2PZIA 3AG2E 1ELWA 4I1OB 4JL0A 5AIJA 2DZOA 3CVVA 2Y1LE 4ANUA 3L82A 5ENQD 3DXMG 5FIOA 4I1MA 4J7WA 2WXFA 2WXRA 4IRUA 3TWTA 3LPZA 2OVBA 2Y3AA 3C5RA 1O1RA 4GZ3A 2WXKA 5G04J 3RO2A 4CZ2D 3B7TA 2PQRA 5BXUA 5T3RA 4YDEA 2XPIA 3FTZA 4G11A 3BG1B 1N4SA 5B1AE 4J8DA 3UM0A 2KATA 4XIFA 3EIQC 1DVPA 3ZFWA 5CMWA 1INZA 1MQSA 2DYRE 4KXKB 3PZ1A 3PEVB 5CECB 1SZ9A 3UIPC 3D9KA 3AJIA 1K1BA 4N2SA 3DSWA 3UKRG 3QARA 3ZYQA 3MV2B 3LXUX 2XQ0A 5LX8A 2X6IA 3E37A 2OCCE 4TXRA 3CSTA 2X3MA 3PZ4A 2M63A 1Y6IA 3CQCB 1HX8A 1WG0A 5CBOA 4AVXA 2CHZA 2J4DA 3ZXPA 3NOCD 4OVUA 1S64A 1X5BA 4TV3A 2I9CA 4M3OA 4U0UA 3V2XA 2NXPA 2IONA 3NAWA 1UN9A 1OWMA 4I17A 2LAHA 1KT0A 4BT8A 4HOSA 3TG4A 2YHCA 4AJWA 4UWHA 4XE0A 2XRYA 1NA0A 4DX2A 1KZOA 1P5QA 2R59A 5JHAA 3FU6A 3TAXA 2B0OE 3DEPA 4BEPA 1JCQA 1TJFA 1HS6A 3L16A 2IOLA 3B7SA 1FT2A 2WXNA 4G25A 5A6CA 4HFGA 3KD7A 4HOUA 1TYQG 5M72A 2JABA 1MX2A 3TG5A 2L6BA 3UUXA 4CRWA 3E34A 2WB2A 4ATGA 2WXPA 3PRZA 4LG6A 5E76A 4U96D 3PNLB 1QZ2A 4GTVA 4RG6A 3PE4A 1N52A 3RAUA 2HO1A 3GW4A 4U63A 3SY2A 2VYIA 2KBXA 2WXLA 3FUFA 1WY6A 1HG5A 4ILHB 2ETAA 2V8SE 4PS7A 5A23A 3CQGB 3S7DA 5HRYA 3E33A 4K5BA 4GCNA 3PUJA 1YA0A 1H0AA 4OVVA 4AP2A 4JEUA 4IYPA 4I6GA 3FEYA 2XCCA 1E7VA 3RRMB 3FU0A 3TXMA 2BEDA 4CDRA 2ZISA 2ZGDA 5D0QD 4B0ZA 4IULA 3UMVA 3FDHA 4UWKA 1IHBA 3WXXA 3L6AA 2XZDG 4AY6A 2JLBA 3QJZA 5ENPD 5KJNA 4NRHB 3ZN3A 3IBEA 2LO6A 2F37A 1A17A 2MOWA 1L5JA 2FO7A 4PS3A 5EYLA 4KVOA 1X81A 4J6IA 3SI5A 4AIFA 3SFYA 1E90A 3KSQA 4CT0A 4HI8A 2WQ6A 1TNUA 1RZ4A 2GRLA 1N9AA 2FF4A 2JEKA 1AP7A 2C2LA 4CEMA 3JUEA 5T4YA 2WXJA 3MA5A 4BSXA 1HO8A 4GA0A 3SF4A 4F53A 4D10C 3UM2A 3R9MA 4CGVA 5ARGA 2R2LA 4EECA 3B13A 1BI8B 1O1TA 3I5PA 4GTPA 3AS8A 3ZXSA 4Z68A 4MKTA 4YVOA 5AQ7A 2L0TB 3O4ZA 2VSNA 2KM4A 5ANRA 2FI7A 4C0EA 3HXFA 4C0MA 2I6HA 4GMLA 5T8IA 5FT9A 3ASHA 3EJNA 5JJ6A 2XS8A 3ESKA 5FINA 3LCAA 1FVHA 3PEUB 1OWLA 3D9HA 3E4BA 1UG3A 2AXUA 2EILE 4KVMA 5LCWJ 3CHRA 3AAAC 2HE0A 2WPVA 3FUHA 3SFZA 2RD0A 5C1DA 3HXCA 5ENNA 5LCWC 3LJNA 3FH5A 4BETA 1WDYA 3EDTB 1TN6A 2WXHA 5CERB 4J8YA 3CGHA 3MKQB 3ASGA 3J5QB 2J09A 3FUIA 4WNGA 4GA1A 4EPZA 1N94A 1FT1A 5LOZA 3VLFA 4Y6CA 3SBTB 3CV0A 3ENEA 3AG4E 3UTMA 3PZ3A 4GZ6A 3Q78A 3MZLB 1EF1C 2BKKB 2L0IA 3DBSA 2J4BA 3K9IA 4LERA 4ATZD 3IHYA 3OAWA 4U0ZA 3D9OA 3Q7AA 1H2VC 1W3BA 1H19A 3NBNB 2IY0C 2LXLA 4FHJA 4PDXA 4WUYA 3UT7A 2GROB 3IKOB 2YQ8A 4Q69A 1SA4A 3MGBA 4N5QA 3FUDA 3DEOA 4FC8A 3BQOA 4ANXA 4BX8A 4F7AA 4G2VA 1MJ0A 4GTRA 1E96B 1KPSB 4C9BB 5B3SE 5LP0A 4FULA 5JJ7A 2QYUA 3CVPA 2VJ8A 1QYMA 1IKND 3IHVA 1TJCA 4I2WA 3HXDA 3CHPA 4CT4A 2ZGGA 5ITZF 4ANWA 4PS8A 1LD8A 4HI9A 4EZJA 2VTBB 4MLPA 5EIBE 2DZNA 3D9IA 4GTSA 2I1JA 4FJYA 1D8DA 1EPUA 3ZHEA 2YINA 1OCOE 3ASNE 4BT9A 4E85A 5ENRD 3HIZA 3URZA 2IOSA 3DSSA 4GB9A 3ZVVA 1TNZA 1TNOA 5J08A 4TXPA 3DWLG 1WM5A 3S2AA 2J08A 3LKUA 5EX3A 5JJTA 1OWNA 4ILIA 4K5CA 1TR4A 3HXBA 4YDOA 3NB2A 1H2UA 5CBNA 3PE3A 4DUIA 3ONLA 2DYSE 3BEEA 2ZU6B 4FHKA 3HHMA 2Y0BG 4LNUD 5ARFA 3N71A 4HRLA 4A1SA 4UI9C 3GZSA 2IJGX 3Q73A 1JCRA 4WAFA 1Z3XA 3Q47B 3TWQA 3FUEA 3FUMA 5BW8C 5FQ6A 5CEDB 4HLLA 3LY8A 2EIJE 5JA4D 3SQVA 4GYOA 3P2BA 1LTXA 3FUJA 3C3OA 4GTMA 4KZCA 5CCMA 4ANVA 3HRAA 5EDSA 2AWIA 4O1PA 3RIBA 3V31A 4AM9A 1K1AA 4LRZA 4AEZC 3LDZA 4DLQA 2H6IA 1TN7A 5EYPF 3ZYMA 5HKPA 2IQCA 4X8QA 2BKGA 4L2YA 3FFLA 2BUGA 2MHKA 5KJLA 5B1BE 4N3AA 2ILRA 3AG3E 4L7TA 3MCXA 4DRXE 4GYWA 5E75A 1Z6TA 3X2QE 3E32A 3C3QA 2KXPC 4GU5A 5FWQA 3FH7A 4GA2A 2XRZA 2V0PA 5CEAA 2KC7A 3Q7FA 2XGSA 3EHMA 4HS2A 1HF8A 2QC9A 2KCVA 3UIOC 4FADA 3B7UX 1MX6A 3TWUA 3Q49B 3CK8A 4U8YD 3LS8A 3HXEA 5AQBA 4F1PA 4M7CA 3CKCA 3FP3A 2P9UG 3IXEA 1JWGA 3FU3A 1JWFA 2XGMA 1IHGA 2P2CP 3LY7A 2FBNA 4HRMB 4JEHA 2I1KA 4EBAA 1OY3D 4MRUA 1HXIA 4DPRA 3KSLA 1FCHA 5AN8A 2IO2C 3PZ2A 3FTSA 2L9BA 2L6JA 4CYMD 2DCPA 2R02A 5AQAA 2V4LA 2CFUA 3PVLA 4B93B 4U0SA 4I2ZA 2WMOA 3RRNB 4NIKA 1BLXB 4UI9J 1MZCA 2CG2A 4OAVB 3R7RA 4WWPA 4C48B 3GZ1A 2WQ7A 5EN5D 3U66A 3PZDA 4A1GA 3LYAA 4TUMA 2ZIRA 2OEVA 4BERA 2P9NG 2NSZA 3ML8A 3Q79A 3SZ7A 4XZ4A 2GRNB 4NACA 4PH4B 4AOFA 2J8SD 2WQHA 3EU5A 1OCRE 1RW2A 4FP7A 4U8VD 3JXJA 5D2MC 2XCBA 2EIME 1E8XA 3Q75A 2X38A 4DX1A 3F6QA 3V30A 2A4ZA 3KAEA 4BFRA 4RVBA 1VDYA 3OXGA 4B8AA 4APOA 5AYWD 4FU3A 2V5QC 4DLOA 3TWVA 4O1OA 3KEZA 4JXTA 4UWGA 4N3CA 1ZB1A 4UUCA 3VTXA 5FZRA 2R17C 2WXGA 1OUVA 2QFCA 1NFIE 4N2QA 1SQMA 5G2NA 3UXGA 2GW1A 3PDNA 4GAAA 5HI7A 3CEQA 1E8ZA 1HU3A 4B8CB 4RLYA 1H6KA 3ABME 1BD8A 2KZTA 5ENTD 4LCTA 4DX6D 1N4QA 3Q4AB 1SVXA 1N95A 4KBQA 4H7YA 3PH0C 3DRAA 3LVQE 4BTBA 5AJDA 2WXQA 3L13A 3DSTA 2J49A 3ABLE 1OWOA 3SGHA 2Q7FA 1NI1A 3SHFA 4HOTA 4AXHA 3OXLA 2Y69E 2GRQB 1NZNA 2WXOA 3CSFA 4J0UA 4JZYA 3QOUA 4U07A 3DXKG 5FQ4A 3AS4A 3FHEA 2PM6A 3CVYA 2OV8A 1FVFA 3ML9A 2RFAA 2A5EA 3JYSA 4JHKA 3HVEA 2A5UA 2EINE 1NP7A 1TNYA 1OCZE 4KZ0A 2AJAA 1N11A 2FEZA 4CCAA 5AJLA 3APFA 4R7LA 5KNGA 5DIZA 1HG2A 5G04C 3TXNA 3CHQA
chains in the Genus database with same CATH topology
1HFAA 4GB9A 3SNXA 5BT1A 3ZVVA 5FJYA 4OVUA 4XI9A 3R9AB 3PNTB 1X5BA 4TV3A 5J08A 2I9CA 4M3OA 4HOQA 4FA6A 4U0UA 3G2WA 2NXPA 3O48A 2IONA 4GZ5A 1WM5A 4HXIA 1UN9A 3S2AA 1OWMA 4I17A 2J08A 3L22A 3LKUA 5EX3A 5JJTA 4TUUA 1OWNA 2LAHA 2R5SA 3PUKA 3QWWA 4ILIA 1KT0A 1SZAA 5D0OD 5CMYA 1UJKA 4G1TA 3JQ0A 3ZYKA 5JHBA 1HE8A 1H2UA 4BT8A 3PE3A 2I2OA 5G55A 3QNKA 4HOSA 3ONLA 3TG4A 3BEEA 2YHCA 3JCKC 5KJKA 2ZU6B 4AJWA 4FHKA 3HHMA 4JVSA 5ARFA 4UWHA 2BTDA 1U3DA 3N71A 2WMNA 4J8SA 3PS6A 4XE0A 4A1SA 3DPDA 4DI3A 2XPZA 4UI9C 2XRYA 1NA0A 3GZSA 2IJGX 2OVFA 4N3BA 4RSYA 4WWNA 4WAFA 3CVUA 2X6FA 1Z3XA 1P5QA 3Q47B 2CFZA 3FUEA 3FUMA 2VGYA 2R59A 5JHAA 3D9NA 5EX0A 3FU6A 3TAXA 3UQ3A 4OYSA 5BW8C 5FQ6A 1TJFA 3ASFA 1HS6A 3L16A 1QNFA 2CHXA 4W9RA 2IOLA 3B7SA 1ZBPA 3LY8A 2WXNA 2LAIA 4G25A 2X6KA 5A6CA 3JQ1A 4HFGA 4GYOA 2VSYA 3FULA 3P2BA 4V3IA 1Z3YA 2AW6A 3KD7A 4I6EA 4HOUA 3D9MA 3FUJA 4KZCA 4WNFA 5CCMA 2WXIA 4ANVA 5M72A 5EDSA 2AWIA 3TG5A 3VLEA 3UUXA 3RIBA 2PQNA 4CRWA 5FZQA 4AM9A 2DBAA 5FQ8A 4LRZA 2WB2A 2Y4UA 3U3WA 4ATGA 2WXPA 4AEZC 1QQEA 3PRZA 5E76A 4XKBA 3ZRHA 3Q15A 3LDZA 3TL5A 4DLQA 3PNLB 1QZ2A 4RG6A 2YNQA 5EKQD 3ZYMA 4AY5A 4LEUA 3EIJA 5HQ8A 1Y8MA 3PE4A 1N52A 3QWVA 4I9EA 3CR3A 3ZPJA 1JPLA 1GW6A 2HO1A 2IQCA 3GW4A 4U63A 1UN8A 3RO3A 3FTVA 2E0IA 2VYIA 3LY9A 4L2YA 3FFLA 2NC9A 4K0RA 4O6FA 2WXLA 3RRUA 2BUGA 2MHKA 3FUFA 1WY6A 4XI0A 5KJLA 1HG5A 3FUNA 4Q94A 3QC1A 4ILHB 3MKQA 4I43A 4JA9A 4N3AA 3R7QA 3FTWA 2ILRA 1IQRA 1NA3A 4UQYA 4L7TA 1PAQA 1TEZA 2V8SE 3MCXA 4JPSA 4PS7A 3CQGB 3QK0A 3S7DA 5A23A 4GYWA 5E75A 1Z6TA 4GCNA 2AVPA 3ZGQA 3PUJA 5CCLA 3L17A 1YA0A 4ILGA 2OOEA 1H0AA 4OVVA 5LFAA 3U9WA 4AP2A 5BV0A 4GU5A 2XGOA 4JEUA 5FWQA 3MX3A 3FH7A 4GA2A 2Y4TA 4IYPA 2V0PA 2XRZA 4B89A 2AXZA 4I6GA 4F3VA 2VSOE 3FEYA 4DI4A 2XCCA 2KC7A 3QAQA 4A55A 4ACKA 4NQ0A 1E7VA 2IU1A 3FU0A 3RRMB 5BUZA 2XGSA 4EBAG 3HYMB 4QFVA 3TXMA 3EHMA 4XX5A 3SD5A 4HS2A 1IYGA 1HF8A 4UI9K 4CDRA 2AXVA 3FTYA 4MS6A 2KCVA 5D0QD 4B0ZA 4IULA 2UY1B 4GYYA 3UMVA 2E2EA 3CKBA 3FDHA 5DBKA 3QKYA 3RJVA 4WNEA 2WXMA 3ZHEB 4EQFA 2IF4A 3AU5A 4UWKA 4FADA 1E8YA 3B7UX 3UX4A 5FZSA 3Q5MA 3L6AA 3WXXA 1IQUA 4AY6A 1XNFA 3Q49B 5CHEE 3CK8A 2JLBA 3QJZA 3TJPA 3LS8A 5KJNA 4JC8A 4NRHB 4UQXA 3ZN3A 3EHNA 2V5FA 2VGXB 1ZU2A 5A7DB 4JA7A 3IBEA 1DNPA 4ME2A 4I9CA 2LO6A 5FQ7A 3CKCA 3FP3A 1JWGA 3RU0A 3KS2A 1E8WA 3FU3A 3CVWA 1JWFA 2LNIA 2XGMA 3I4GA 3S7JA 1A17A 2MOWA 2EQXA 5G05J 1IHGA 1L5JA 2FO7A 3LY7A 1EDUA 2FBNA 3D9LA 4JEHA 2I1KA 4PS3A 4EBAA 4MRUA 4KVOA 4I1AA 1HXIA 3QDNA 3CVNA 4DPRA 3CVQA 4J6IA 3S7FA 5G05C 4FLHA 1FCHA 2C0MA 3SI5A 4AIFA 1H2TC 1E90A 3D9PA 2MRIA 4CT0A 4KYOB 4XKCA 3FTSA 2L9BA 2L6JA 2HR2A 3OXFA 4AV7A 2WQ6A 3JUIA 2GRLA 2WVIA 3LVRE 4I6JA 2DCPA 2FF4A 2V4LA 2CHWA 4BY6A 2JEKA 2CFUA 1B89A 3NQPA 2C2LA 3PVLA 4CEMA 2KZTB 3MKRA 1PC2A 4U0SA 5T4YA 2HM8A 2WXJA 4G26A 2GRMA 4A3VA 3MA5A 2CG3A 4I2ZA 4B94A 1HO8A 4BSXA 2WMOA 4GA0A 3RRNB 2PL2A 2ONDA 3FWVA 3GYZA 3SF4A 4F53A 4URKA 4UI9J 2CG2A 4D10C 4JW1A 3CHOA 4CGWA 5KJMA 4FJZA 3FU5A 3G2TA 4CDMA 3R7RA 4DK5A 3VTYA 1ELKA 4WWPA 4CGVA 4N5CA 3CVLA 5ARGA 3GZ1A 4EECA 2P58C 3B13A 2VGXA 2WQ7A 3ZIMA 3I5PA 2GGFA 3RKVA 3L08A 4J8EA 3RK6A 4EZKA 3AS8A 3CHSA 3ZXSA 3PZDA 4A1GA 3U66A 3LYAA 4MKTA 3FEXA 4YVOA 4WWOA 4CDNA 3UT4A 2L0TB 4PUCA 5AENA 2NSZA 3O4ZA 2VSNA 3MEKA 3ML8A 3SZ7A 2KM4A 4XZ4A 4BWRA 4FLBA 5ANRA 2J9QA 2FI7A 3T5XA 4C0EA 4HVBA 4NACA 4PH4B 4AOFA 4C0MA 1LF8A 2WQHA 2I6HA 4GMLA 3VLDA 5T8IA 2XEVA 5FT9A 3ASHA 3FUKA 3EJNA 5JJ6A 5KCMA 3BG0B 4FP7A 3ESKA 4GZCA 3LCAA 4GPKA 3D9JA 4DJAA 2XCBA 1E8XA 1FVHA 3PEUB 1OWLA 4LUNU 4GCOA 3E4BA 3CIAA 2HYZA 1UG3A 2AXUA 3T8MA 2WM9A 4GMJA 2XHEA 4KVMA 2PM7A 2X38A 3ASDA 5LCWJ 4HORA 3CHRA 2FULA 2WPVA 3PREA 3FUHA 3SFZA 2A4ZA 4L23A 2RD0A 3KAEA 3QWPA 5C1DA 5ENNA 3G2VA 5LCWC 3ZYLA 1KLXA 1N54A 3CK7A 5J90A 3I3NA 2VTBA 2LSVA 3L54A 3MV3B 2RG8A 4BFRA 2XPYA 3IEGA 3NZSA 5C2YA 4RVBA 3QB2A 4JHJA 3FH5A 1VDYA 3OXGA 4B8AA 1EYHA 4YNDA 4APOA 1JUQA 3EDTB 1OWPA 3CK9A 1KT1A 2WXHA 1UJJA 5AYWD 4FU3A 3CGHA 5BPPA 3AS5A 2VQ2A 3S7BA 4BX9A 4DLOA 5BV1A 3LJ3A 3LEWA 3MKQB 1ELRA 1WAO1 2KCKA 3ASGA 4U04A 2UWJG 2J09A 4E6HA 3KEZA 5ANLA 3FUIA 3HDXA 4JXTA 4UWGA 4Y6WA 4N3CA 4WNGA 3VTXA 3P1UA 3GZ2A 5FZRA 4GA1A 2VSXE 4EPZA 3OTNA 4L2LA 5LOZA 2R17C 3VLFA 3TGOA 2WXGA 1OUVA 2QFCA 3MJWA 4H7XA 4Y6CA 3ULQA 3C98A 2IFUA 3SBTB 4N2QA 1PY1A 3CV0A 3ENEA 1SQMA 5G2NA 4GZ6A 2GW1A 3AU4A 3PDNA 4GAAA 3MZLB 5HI7A 1U3CA 3CEQA 2DIWA 1EF1C 3NF1A 3ONKA 2J07A 4YVQC 3FH8A 4KT6B 4GZDA 2L0IA 1E8ZA 2J4BA 2X6HA 1HU3A 3DBSA 3K9IA 3NZUA 4G24A 1S0PA 3ZW3A 3I4RB 4LERA 4B8CB 3FTXA 3G2SA 4P29A 1H6KA 2PZIA 5FTPA 3IHYA 3OAWA 2KZTA 5BNWA 4A3TA 1ELWA 4I1OB 4JL0A 4LCTA 4U0ZA 4WNDA 5AIJA 3D9OA 4KBQA 3Q4AB 3CVVA 4ANUA 4H7YA 3APCA 3PH0C 1H2VC 1W3BA 4I1MA 3LVQE 4UWFA 3CLJA 4NURA 3D3MA 2WXFA 4BTBA 1H19A 2WXRA 5AJDA 4IRUA 2WXQA 1HZ4A 3L13A 4FHJA 3LPZA 2OVBA 4PDXA 4WUYA 3U64A 3APDA 3FTUA 3IKOB 3G2UA 3UT7A 2YQ8A 4Q69A 2Y3AA 3CVXA 2J49A 1OWOA 3MGBA 3FUDA 4GZ3A 3SGHA 2WXKA 5G04J 3RO2A 4FC8A 4ANXA 3URZA 2Q7FA 3B7TA 3SHFA 3ZEFA 2PQRA 5T3RA 3UT8A 4AXHA 4BX8A 4F7AA 4Q96A 4HOTA 4G2VA 2XPIA 3OXLA 3T5VA 1E7UA 3FTZA 4G11A 2QY7A 3BG1B 1MHQA 4L1BA 1E96B 4J8DA 4UQZA 2C0LA 4C9BB 4U8HA 4EZLA 4TRQA 2KATA 4F1SA 1NZNA 2WXOA 4RG9A 3CSFA 5LP0A 4J0UA 4JZYA 3QOUA 4FULA 4U07A 5FQ4A 4XIFA 5JJ7A 3EIQC 3AS4A 2LSUA 4UWLA 4APFA 3CVPA 1DVPA 3FHEA 3ZFWA 2PM6A 3CVYA 5CMWA 1INZA 2OV8A 2VJ8A 1MQSA 2BF0X 2YHEA 4KXKB 4ABNA 4HLEA 3IHVA 3PEVB 1TJCA 4KMOA 4I2WA 3SBSA 1XGWA 1FVFA 3CHPA 4CT4A 1SZ9A 4ANWA 3D9KA 3FY4A 3B7RL 4PS8A 3ML9A 4N2SA 2KCLA 4JHKA 3JYSA 4EZJA 3HVEA 2A5UA 3MYVA 1NP7A 4IN3B 2VTBB 2X6JA 3QARA 4MLPA 4KZ0A 3ZYQA 3ESLA 4J8FA 4K03A 4ACLA 3CHMA 2FEZA 3D9IA 2I1JA 4FJYA 4JHRA 4BTAA 4CCAA 3MV2B 3LXUX 2XQ0A 1EPUA 3APFA 5AJLA 5LX8A 4R7LA 2UY1A 4N39A 2X6IA 1HH8A 3U4TA 3CSTA 3ZHEA 2X3MA 2YINA 3IV0A 2M63A 1Y6IA 1BPOA 3CQCB 4G23A 1HX8A 5DIZA 1HG2A 3HVEB 5G04C 4BT9A 3TXNA 4E85A 4AVXA 2CHZA 2J4DA 3CHQA 3HIZA 3UPVA 1UW4B 2IOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYW A;  3K9I A;  3VTY A;  4G24 A;  4GCN A;  2AVP A;  5FJY A;  3ZGQ A;  5BT1 A;  4CGV A;  4N5C A;  5CCL A;  1YA0 A;  4XI9 A;  3R9A B;  2OOE A;  3CVL A;  5ARG A;  2PZI A;  3GZ1 A;  5FTP A;  4HOQ A;  2P58 C;  5BNW A;  2VGX A;  4U0U A;  1ELW A;  2XGO A;  4JL0 A;  4U0Z A;  4WND A;  3O48 A;  3RKV A;  4GA2 A;  2Y4T A;  4KBQ A;  3Q4A B;  4GZ5 A;  1WM5 A;  4H7Y A;  4J8E A;  4F3V A;  3AS8 A;  1W3B A;  2KC7 A;  2XCC A;  4I17 A;  3LYA A;  3LKU A;  5EX3 A;  5JJT A;  4EQF A;  4NQ0 A;  4YVO A;  4BTB A;  2R5S A;  3QWW A;  2XGS A;  1KT0 A;  3HYM B;  1HZ4 A;  5D0O D;  4G1T A;  1IYG A;  2VSN A;  3LPZ A;  3MEK A;  4WUY A;  3SZ7 A;  4UI9 K;  4BWR A;  4BT8 A;  4CDR A;  2YQ8 A;  2J9Q A;  2FI7 A;  3PE3 A;  4HOS A;  3TG4 A;  3BEE A;  2YHC A;  2KCV A;  5D0Q D;  5KJK A;  4GZ3 A;  2UY1 B;  2WQH A;  4GYY A;  2I6H A;  2E2E A;  3CKB A;  5DBK A;  5G04 J;  3QKY A;  2XEV A;  4WNE A;  5FT9 A;  5ARF A;  3RJV A;  3ZHE B;  3ASH A;  2Q7F A;  2IF4 A;  3N71 A;  5JJ6 A;  4A1S A;  2PQR A;  3ESK A;  4HOT A;  4UI9 C;  1NA0 A;  4N3B A;  3LCA A;  2XPI A;  3OXL A;  4G2V A;  4GPK A;  5FZS A;  2XCB A;  3Q5M A;  3WXX A;  1P5Q A;  3Q47 B;  4AY6 A;  1XNF A;  3Q49 B;  4GCO A;  1E96 B;  2VGY A;  3E4B A;  3CK8 A;  4J8D A;  2C0L A;  2HYZ A;  2JLB A;  4UQZ A;  5CHE E;  5EX0 A;  2KAT A;  4HOR A;  3ASD A;  1NZN A;  3TAX A;  5LCW J;  4RG9 A;  5KJN A;  3UQ3 A;  5BW8 C;  4NRH B;  4UQX A;  3ZN3 A;  4J0U A;  2V5F A;  2WPV A;  3ASF A;  3QOU A;  4U07 A;  2VGX B;  1ZU2 A;  4XIF A;  4W9R A;  3KAE A;  3AS4 A;  4JA7 A;  2LSU A;  3QWP A;  5A7D B;  5C1D A;  4ME2 A;  4I9C A;  3CVP A;  1ZBP A;  3LY8 A;  5LCW C;  4G25 A;  5A6C A;  1KLX A;  3CKC A;  3CK7 A;  3FP3 A;  3ZFW A;  3RU0 A;  2LSV A;  3KS2 A;  2VSY A;  3MV3 B;  4GYO A;  3KD7 A;  2LNI A;  2XGM A;  3IEG A;  4HOU A;  3S7J A;  4KXK B;  1A17 A;  4ABN A;  5G05 J;  1IHG A;  4WNF A;  1TJC A;  3OXG A;  5CCM A;  5M72 A;  2FO7 A;  3LY7 A;  2FBN A;  4YND A;  4APO A;  4I2W A;  3TG5 A;  5JJ7 A;  3EDT B;  3CK9 A;  1KT1 A;  3RIB A;  3UUX A;  2PQN A;  4I1A A;  1HXI A;  3QDN A;  3CVN A;  5FZQ A;  5AYW D;  4AM9 A;  3AS5 A;  3CVQ A;  2DBA A;  2VQ2 A;  5G05 C;  3RO2 A;  2KCL A;  2Y4U A;  3S7B A;  3S7F A;  1FCH A;  2C0M A;  3U3W A;  4N2S A;  4AIF A;  3JYS A;  1QQE A;  3Q15 A;  4IN3 B;  1WAO 1;  1ELR A;  2KCK A;  3ASG A;  4U04 A;  2UWJ G;  1QZ2 A;  4KYO B;  4RG6 A;  5EKQ D;  2L6J A;  2HR2 A;  3OXF A;  4AY5 A;  4LEU A;  4Y6W A;  4J8F A;  5HQ8 A;  4N3C A;  4WNG A;  1Y8M A;  3PE4 A;  3QWV A;  4I9E A;  3VTX A;  2FF4 A;  3GZ2 A;  4GA1 A;  5FZR A;  3ZPJ A;  2FEZ A;  2HO1 A;  3GW4 A;  1B89 A;  2C2L A;  3RO3 A;  3MKR A;  4JHR A;  4BTA A;  1PC2 A;  3MV2 B;  2VYI A;  3LY9 A;  3TGO A;  1OUV A;  2NC9 A;  2QFC A;  3FFL A;  4H7X A;  4O6F A;  4Y6C A;  2UY1 A;  4U0S A;  4N39 A;  2BUG A;  2MHK A;  2IFU A;  4XI0 A;  1HH8 A;  3ULQ A;  3U4T A;  3CV0 A;  4G26 A;  3ZHE A;  5KJL A;  3MA5 A;  4I2Z A;  4B94 A;  4GA0 A;  3SF4 A;  4GZ6 A;  2PL2 A;  2OND A;  3FWV A;  3GYZ A;  2GW1 A;  4G23 A;  3PDN A;  4UI9 J;  4JA9 A;  5DIZ A;  5G04 C;  4N3A A;  5HI7 A;  4BT9 A;  4N2Q A;  3CEQ A;  4CGW A;  1NA3 A;  3NF1 A;  4UQY A;  4YVQ C;  5KJM A;  3UPV A;  3URZ A;  3S7D A; 
#chains in the Genus database with same CATH topology
 1HFA A;  3SNX A;  5BT1 A;  5FJY A;  3R9A B;  4HOQ A;  2LXM A;  3G2W A;  4RQI A;  4LNB A;  5AQ9 A;  3ULY A;  4GZ5 A;  5KBA A;  3L22 A;  3EUV A;  4TUU A;  3PUK A;  3QWW A;  5D0O D;  5CMY A;  5H7P A;  4G1T A;  3JQ0 A;  5JHB A;  1HE8 A;  1N4P A;  3UIN C;  4JVS A;  1U3D A;  1UOH A;  4J8S A;  3DPD A;  4AV7 A;  4WWN A;  4N3B A;  2OVF A;  2CFZ A;  4ZFH A;  5JMN D;  2F8X K;  2ETB A;  3UQ3 A;  4OYS A;  3ASF A;  1QNF A;  5D66 A;  1ZBP A;  2LAI A;  1OXJ A;  3JQ1 A;  1N0R A;  4I6E A;  3D9M A;  1OCC E;  2H6G A;  4WNF A;  2WXI A;  3DSU A;  3W9F A;  2Y4U A;  3U3W A;  2PNN A;  3ZRH A;  3TL5 A;  4LEU A;  3EIJ A;  3SO8 A;  1Y8M A;  3QWV A;  1GW6 A;  5ENO D;  3FTV A;  2NC9 A;  4K0R A;  4O6F A;  4XI0 A;  3QC1 A;  3MKQ A;  4I43 A;  4BES A;  4UQY A;  1TEZ A;  1PAQ A;  2P9S G;  2AVP A;  4G8L A;  5CCL A;  3L17 A;  4ILG A;  5LFA A;  1BI7 B;  5BV0 A;  1JCS A;  2XGO A;  3MX3 A;  2IEJ A;  4B89 A;  4F3V A;  1V55 E;  4ACK A;  1SA5 A;  2IU1 A;  5BUZ A;  3HYM B;  1IYG A;  1S70 B;  2H6H A;  2AXV A;  1DCE A;  3FTY A;  2UY1 B;  2E2E A;  5DBK A;  2WXM A;  2IF4 A;  2EIK E;  3TWX A;  2DWZ A;  2ZXW E;  1E8Y A;  3UX4 A;  3Q5M A;  1IQU A;  4JC8 A;  2V5F A;  1OT8 A;  2VGX B;  4U7E B;  4JA7 A;  1DNP A;  4ME2 A;  4I9C A;  1D9S A;  5FQ7 A;  3KEA A;  3KS2 A;  3CVW A;  3WG7 E;  3S7J A;  4GTT A;  2EQX A;  3EU9 A;  5G05 J;  3V79 K;  2IO3 C;  1EDU A;  3D9L A;  4I1A A;  3CVN A;  3S7F A;  5G05 C;  3ASO E;  1H2T C;  4KYO B;  4XKC A;  3OXF A;  2HR2 A;  3LVR E;  1B89 A;  3NQP A;  2KZT B;  4A3V A;  4URK A;  4FJZ A;  3FU5 A;  4U95 D;  4CDM A;  3UKU G;  4HRN A;  3VTY A;  4N5C A;  3CVL A;  2P58 C;  2VGX A;  3ZIM A;  4J8E A;  3RK6 A;  4EZK A;  3ULE G;  5HS0 A;  4CDN A;  1D8E A;  4PUC A;  5AEN A;  3MEK A;  4BWR A;  3ABK E;  3T5X A;  1LF8 A;  3VLD A;  2XEV A;  3BG0 B;  4DJA A;  4GCO A;  3T8M A;  2XEN A;  1SW6 A;  2XHE A;  4GMJ A;  2PM7 A;  1S63 A;  3ASD A;  4HOR A;  2FUL A;  2P9P G;  3UM1 A;  4L23 A;  1KZP A;  3J5P A;  3QWP A;  2VTB A;  5J90 A;  3CK7 A;  3MV3 B;  2RG8 A;  2VGE A;  3IEG A;  3NZS A;  3ZKJ A;  3QB2 A;  1EYH A;  4YND A;  5IY5 E;  1JUQ A;  3CK9 A;  4YDW A;  3V2O A;  1UJJ A;  1A5E A;  3AS5 A;  3LJ3 A;  3LEW A;  1N0Q A;  1ELR A;  1WAO 1;  2DVW A;  3HDX A;  3DSX A;  3TGO A;  3MJW A;  4H7X A;  3DPY A;  3C98 A;  1PY1 A;  1TNB A;  1QBQ A;  5KNH D;  3AU4 A;  1U3C A;  3ONK A;  2J07 A;  3FH8 A;  4KT6 B;  1BU9 A;  4GZD A;  3NZU A;  4G24 A;  3ZW3 A;  4HNA D;  5FTP A;  5BNW A;  4A3T A;  4WND A;  4A63 B;  3APC A;  4UWF A;  3CLJ A;  4NUR A;  3D3M A;  1HZ4 A;  2R03 A;  3ISM C;  3U64 A;  3APD A;  3FTU A;  3G2U A;  3JXI A;  3CVX A;  4L9P A;  3ZEF A;  4BSZ B;  3UT8 A;  4Q96 A;  3T5V A;  1E7U A;  2QY7 A;  4HQD A;  1MHQ A;  5ENS D;  4L1B A;  4UQZ A;  2C0L A;  4U8H A;  4EZL A;  4TRQ A;  4F1S A;  4RG9 A;  1FPP A;  2LSU A;  4UWL A;  4APF A;  1Q2Z A;  4LNG A;  2BF0 X;  3NOG D;  2YHE A;  4ABN A;  4HLE A;  4GTQ A;  4KMO A;  3SBS A;  1XGW A;  3FY4 A;  3B7R L;  2KCL A;  3MYV A;  4IN3 B;  5EIL A;  2X6J A;  3TWW A;  3ESL A;  4J8F A;  1MX4 A;  4K03 A;  4ACL A;  3ZNG A;  3CHM A;  5CRV A;  3C3R A;  4JHR A;  3Q9N C;  4BTA A;  2UY1 A;  4N39 A;  1HH8 A;  3U4T A;  3B95 A;  3IV0 A;  1BPO A;  4G23 A;  3HVE B;  3W9G A;  3UI2 A;  4K5A B;  3UPV A;  1UW4 B;  2V4H C;  4XI9 A;  4F6R D;  3PNT B;  4FA6 A;  2XS1 A;  1O5M A;  3O48 A;  2QZA A;  4HXI A;  3B7B A;  2QYJ A;  1H6P A;  2R5S A;  1NL4 A;  1SZA A;  4HB5 A;  4GPM A;  1AWC B;  1UJK A;  2B6C A;  3ZYK A;  2I2O A;  5G55 A;  3QNK A;  5KJK A;  3JCK C;  1DCQ A;  4XEI G;  2BTD A;  2WMN A;  3PS6 A;  4ZHB A;  4DI3 A;  2OEW A;  2XPZ A;  4RSY A;  3CVU A;  2X6F A;  2VGY A;  3D9N A;  5EX0 A;  2CHX A;  4W9R A;  2X6K A;  2VSY A;  3FUL A;  4V3I A;  1Z3Y A;  2AW6 A;  3AG1 E;  1YMP A;  3VLE A;  2PQN A;  5FZQ A;  4GMR A;  2DBA A;  5FQ8 A;  1DC2 A;  1Z5S C;  1QQE A;  4XKB A;  3Q15 A;  4EHM A;  3BU8 A;  5EKQ D;  2YNQ A;  4AY5 A;  2RKK A;  5HQ8 A;  4I9E A;  4DX7 D;  3CR3 A;  3ZPJ A;  1JPL A;  3C72 A;  1UN8 A;  3RO3 A;  2E0I A;  3LY9 A;  3RRU A;  3FUN A;  4Q94 A;  4JA9 A;  3R7Q A;  3FTW A;  1IQR A;  1NA3 A;  1YYH A;  4JPS A;  3QK0 A;  3ZGQ A;  1K8K G;  5KWD A;  2OOE A;  3DSV A;  3U9W A;  4HBD A;  2Y4T A;  2AXZ A;  2VSO E;  4DI4 A;  3QAQ A;  4A55 A;  4NQ0 A;  2RFM A;  4EBA G;  4QFV A;  2ETC A;  4XX5 A;  3SD5 A;  4UI9 K;  4MS6 A;  4GYY A;  3CKB A;  4EQF A;  3QKY A;  3RJV A;  4WNE A;  3ZHE B;  2F0Y A;  3AU5 A;  3RSE G;  5FZS A;  1XNF A;  2GRP B;  5CHE E;  2XZT G;  3TJP A;  4UQX A;  3EHN A;  5A7D B;  1ZU2 A;  2XEH A;  3EHQ A;  3T8K A;  4YDY A;  3RU0 A;  1E8W A;  5EID A;  2LNI A;  3I4G A;  3E30 A;  1IXV A;  4DX5 D;  2NYJ A;  4O60 A;  3BUA A;  3QDN A;  3CVQ A;  4FLH A;  2C0M A;  4LSZ E;  3D9P A;  2MRI A;  1H6O A;  5AAR A;  3JUI A;  1LD7 A;  2WVI A;  2P9K G;  4I6J A;  2CHW A;  4BY6 A;  3MKR A;  1PC2 A;  2HM8 A;  4G26 A;  2GRM A;  2CG3 A;  4B94 A;  2PL2 A;  2OND A;  3FWV A;  3GYZ A;  2XEE A;  4JW1 A;  2GRR B;  3CHO A;  1U2V G;  4CGW A;  5KJM A;  3G2T A;  2LUH A;  4DK5 A;  1ELK A;  4GTO A;  3ZU7 B;  3Q9U C;  2GGF A;  3RKV A;  3L08 A;  3CHS A;  4MBG A;  3FEX A;  4WWO A;  2P9L G;  2F8Y A;  3UT4 A;  4JB8 P;  4FLB A;  2J9Q A;  4G8K A;  1O1S A;  4HVB A;  3FUK A;  5KCM A;  4GZC A;  4GPK A;  2H6F A;  3D9J A;  4LUN U;  3CIA A;  2HYZ A;  2WM9 A;  3TWR A;  1K3Z D;  5AAO A;  3PRE A;  3UM3 A;  3G2V A;  1TN8 A;  3ZYL A;  1KLX A;  1N54 A;  1MYO A;  3I3N A;  3L9T A;  2LSV A;  3L54 A;  2XPY A;  3ZUV B;  5C2Y A;  1YCS B;  4JHJ A;  1V54 E;  3SFX A;  1N4R A;  2P9I G;  4QQI A;  1OWP A;  1KT1 A;  3TWS A;  5BPP A;  3HG0 D;  2VQ2 A;  3S7B A;  4BX9 A;  5BV1 A;  2MYO A;  2KCK A;  4U04 A;  2UWJ G;  4E6H A;  5ANL A;  4Y6W A;  5BXO A;  4OAU C;  3P1U A;  4JD2 G;  3GZ2 A;  2VSX E;  3OTN A;  2R05 A;  4L2L A;  3ULQ A;  2IFU A;  1G3N B;  3EHR A;  2DIW A;  3NF1 A;  4YVQ C;  2FO1 E;  2X6H A;  4TXQ A;  1S0P A;  3I4R B;  3FTX A;  3G2S A;  3T9K A;  4P29 A;  5CRU A;  2PZI A;  3AG2 E;  1ELW A;  4I1O B;  4JL0 A;  5AIJ A;  2DZO A;  3CVV A;  2Y1L E;  4ANU A;  3L82 A;  5ENQ D;  3DXM G;  5FIO A;  4I1M A;  4J7W A;  2WXF A;  2WXR A;  4IRU A;  3TWT A;  3LPZ A;  2OVB A;  2Y3A A;  3C5R A;  1O1R A;  4GZ3 A;  2WXK A;  5G04 J;  3RO2 A;  4CZ2 D;  3B7T A;  2PQR A;  5BXU A;  5T3R A;  4YDE A;  2XPI A;  3FTZ A;  4G11 A;  3BG1 B;  1N4S A;  5B1A E;  4J8D A;  3UM0 A;  2KAT A;  4XIF A;  3EIQ C;  1DVP A;  3ZFW A;  5CMW A;  1INZ A;  1MQS A;  2DYR E;  4KXK B;  3PZ1 A;  3PEV B;  5CEC B;  1SZ9 A;  3UIP C;  3D9K A;  3AJI A;  1K1B A;  4N2S A;  3DSW A;  3UKR G;  3QAR A;  3ZYQ A;  3MV2 B;  3LXU X;  2XQ0 A;  5LX8 A;  2X6I A;  3E37 A;  2OCC E;  4TXR A;  3CST A;  2X3M A;  3PZ4 A;  2M63 A;  1Y6I A;  3CQC B;  1HX8 A;  1WG0 A;  5CBO A;  4AVX A;  2CHZ A;  2J4D A;  3ZXP A;  3NOC D;  4OVU A;  1S64 A;  1X5B A;  4TV3 A;  2I9C A;  4M3O A;  4U0U A;  3V2X A;  2NXP A;  2ION A;  3NAW A;  1UN9 A;  1OWM A;  4I17 A;  2LAH A;  1KT0 A;  4BT8 A;  4HOS A;  3TG4 A;  2YHC A;  4AJW A;  4UWH A;  4XE0 A;  2XRY A;  1NA0 A;  4DX2 A;  1KZO A;  1P5Q A;  2R59 A;  5JHA A;  3FU6 A;  3TAX A;  2B0O E;  3DEP A;  4BEP A;  1JCQ A;  1TJF A;  1HS6 A;  3L16 A;  2IOL A;  3B7S A;  1FT2 A;  2WXN A;  4G25 A;  5A6C A;  4HFG A;  3KD7 A;  4HOU A;  1TYQ G;  5M72 A;  2JAB A;  1MX2 A;  3TG5 A;  2L6B A;  3UUX A;  4CRW A;  3E34 A;  2WB2 A;  4ATG A;  2WXP A;  3PRZ A;  4LG6 A;  5E76 A;  4U96 D;  3PNL B;  1QZ2 A;  4GTV A;  4RG6 A;  3PE4 A;  1N52 A;  3RAU A;  2HO1 A;  3GW4 A;  4U63 A;  3SY2 A;  2VYI A;  2KBX A;  2WXL A;  3FUF A;  1WY6 A;  1HG5 A;  4ILH B;  2ETA A;  2V8S E;  4PS7 A;  5A23 A;  3CQG B;  3S7D A;  5HRY A;  3E33 A;  4K5B A;  4GCN A;  3PUJ A;  1YA0 A;  1H0A A;  4OVV A;  4AP2 A;  4JEU A;  4IYP A;  4I6G A;  3FEY A;  2XCC A;  1E7V A;  3RRM B;  3FU0 A;  3TXM A;  2BED A;  4CDR A;  2ZIS A;  2ZGD A;  5D0Q D;  4B0Z A;  4IUL A;  3UMV A;  3FDH A;  4UWK A;  1IHB A;  3WXX A;  3L6A A;  2XZD G;  4AY6 A;  2JLB A;  3QJZ A;  5ENP D;  5KJN A;  4NRH B;  3ZN3 A;  3IBE A;  2LO6 A;  2F37 A;  1A17 A;  2MOW A;  1L5J A;  2FO7 A;  4PS3 A;  5EYL A;  4KVO A;  1X81 A;  4J6I A;  3SI5 A;  4AIF A;  3SFY A;  1E90 A;  3KSQ A;  4CT0 A;  4HI8 A;  2WQ6 A;  1TNU A;  1RZ4 A;  2GRL A;  1N9A A;  2FF4 A;  2JEK A;  1AP7 A;  2C2L A;  4CEM A;  3JUE A;  5T4Y A;  2WXJ A;  3MA5 A;  4BSX A;  1HO8 A;  4GA0 A;  3SF4 A;  4F53 A;  4D10 C;  3UM2 A;  3R9M A;  4CGV A;  5ARG A;  2R2L A;  4EEC A;  3B13 A;  1BI8 B;  1O1T A;  3I5P A;  4GTP A;  3AS8 A;  3ZXS A;  4Z68 A;  4MKT A;  4YVO A;  5AQ7 A;  2L0T B;  3O4Z A;  2VSN A;  2KM4 A;  5ANR A;  2FI7 A;  4C0E A;  3HXF A;  4C0M A;  2I6H A;  4GML A;  5T8I A;  5FT9 A;  3ASH A;  3EJN A;  5JJ6 A;  2XS8 A;  3ESK A;  5FIN A;  3LCA A;  1FVH A;  3PEU B;  1OWL A;  3D9H A;  3E4B A;  1UG3 A;  2AXU A;  2EIL E;  4KVM A;  5LCW J;  3CHR A;  3AAA C;  2HE0 A;  2WPV A;  3FUH A;  3SFZ A;  2RD0 A;  5C1D A;  3HXC A;  5ENN A;  5LCW C;  3LJN A;  3FH5 A;  4BET A;  1WDY A;  3EDT B;  1TN6 A;  2WXH A;  5CER B;  4J8Y A;  3CGH A;  3MKQ B;  3ASG A;  3J5Q B;  2J09 A;  3FUI A;  4WNG A;  4GA1 A;  4EPZ A;  1N94 A;  1FT1 A;  5LOZ A;  3VLF A;  4Y6C A;  3SBT B;  3CV0 A;  3ENE A;  3AG4 E;  3UTM A;  3PZ3 A;  4GZ6 A;  3Q78 A;  3MZL B;  1EF1 C;  2BKK B;  2L0I A;  3DBS A;  2J4B A;  3K9I A;  4LER A;  4ATZ D;  3IHY A;  3OAW A;  4U0Z A;  3D9O A;  3Q7A A;  1H2V C;  1W3B A;  1H19 A;  3NBN B;  2IY0 C;  2LXL A;  4FHJ A;  4PDX A;  4WUY A;  3UT7 A;  2GRO B;  3IKO B;  2YQ8 A;  4Q69 A;  1SA4 A;  3MGB A;  4N5Q A;  3FUD A;  3DEO A;  4FC8 A;  3BQO A;  4ANX A;  4BX8 A;  4F7A A;  4G2V A;  1MJ0 A;  4GTR A;  1E96 B;  1KPS B;  4C9B B;  5B3S E;  5LP0 A;  4FUL A;  5JJ7 A;  2QYU A;  3CVP A;  2VJ8 A;  1QYM A;  1IKN D;  3IHV A;  1TJC A;  4I2W A;  3HXD A;  3CHP A;  4CT4 A;  2ZGG A;  5ITZ F;  4ANW A;  4PS8 A;  1LD8 A;  4HI9 A;  4EZJ A;  2VTB B;  4MLP A;  5EIB E;  2DZN A;  3D9I A;  4GTS A;  2I1J A;  4FJY A;  1D8D A;  1EPU A;  3ZHE A;  2YIN A;  1OCO E;  3ASN E;  4BT9 A;  4E85 A;  5ENR D;  3HIZ A;  3URZ A;  2IOS A;  3DSS A;  4GB9 A;  3ZVV A;  1TNZ A;  1TNO A;  5J08 A;  4TXP A;  3DWL G;  1WM5 A;  3S2A A;  2J08 A;  3LKU A;  5EX3 A;  5JJT A;  1OWN A;  4ILI A;  4K5C A;  1TR4 A;  3HXB A;  4YDO A;  3NB2 A;  1H2U A;  5CBN A;  3PE3 A;  4DUI A;  3ONL A;  2DYS E;  3BEE A;  2ZU6 B;  4FHK A;  3HHM A;  2Y0B G;  4LNU D;  5ARF A;  3N71 A;  4HRL A;  4A1S A;  4UI9 C;  3GZS A;  2IJG X;  3Q73 A;  1JCR A;  4WAF A;  1Z3X A;  3Q47 B;  3TWQ A;  3FUE A;  3FUM A;  5BW8 C;  5FQ6 A;  5CED B;  4HLL A;  3LY8 A;  2EIJ E;  5JA4 D;  3SQV A;  4GYO A;  3P2B A;  1LTX A;  3FUJ A;  3C3O A;  4GTM A;  4KZC A;  5CCM A;  4ANV A;  3HRA A;  5EDS A;  2AWI A;  4O1P A;  3RIB A;  3V31 A;  4AM9 A;  1K1A A;  4LRZ A;  4AEZ C;  3LDZ A;  4DLQ A;  2H6I A;  1TN7 A;  5EYP F;  3ZYM A;  5HKP A;  2IQC A;  4X8Q A;  2BKG A;  4L2Y A;  3FFL A;  2BUG A;  2MHK A;  5KJL A;  5B1B E;  4N3A A;  2ILR A;  3AG3 E;  4L7T A;  3MCX A;  4DRX E;  4GYW A;  5E75 A;  1Z6T A;  3X2Q E;  3E32 A;  3C3Q A;  2KXP C;  4GU5 A;  5FWQ A;  3FH7 A;  4GA2 A;  2XRZ A;  2V0P A;  5CEA A;  2KC7 A;  3Q7F A;  2XGS A;  3EHM A;  4HS2 A;  1HF8 A;  2QC9 A;  2KCV A;  3UIO C;  4FAD A;  3B7U X;  1MX6 A;  3TWU A;  3Q49 B;  3CK8 A;  4U8Y D;  3LS8 A;  3HXE A;  5AQB A;  4F1P A;  4M7C A;  3CKC A;  3FP3 A;  2P9U G;  3IXE A;  1JWG A;  3FU3 A;  1JWF A;  2XGM A;  1IHG A;  2P2C P;  3LY7 A;  2FBN A;  4HRM B;  4JEH A;  2I1K A;  4EBA A;  1OY3 D;  4MRU A;  1HXI A;  4DPR A;  3KSL A;  1FCH A;  5AN8 A;  2IO2 C;  3PZ2 A;  3FTS A;  2L9B A;  2L6J A;  4CYM D;  2DCP A;  2R02 A;  5AQA A;  2V4L A;  2CFU A;  3PVL A;  4B93 B;  4U0S A;  4I2Z A;  2WMO A;  3RRN B;  4NIK A;  1BLX B;  4UI9 J;  1MZC A;  2CG2 A;  4OAV B;  3R7R A;  4WWP A;  4C48 B;  3GZ1 A;  2WQ7 A;  5EN5 D;  3U66 A;  3PZD A;  4A1G A;  3LYA A;  4TUM A;  2ZIR A;  2OEV A;  4BER A;  2P9N G;  2NSZ A;  3ML8 A;  3Q79 A;  3SZ7 A;  4XZ4 A;  2GRN B;  4NAC A;  4PH4 B;  4AOF A;  2J8S D;  2WQH A;  3EU5 A;  1OCR E;  1RW2 A;  4FP7 A;  4U8V D;  3JXJ A;  5D2M C;  2XCB A;  2EIM E;  1E8X A;  3Q75 A;  2X38 A;  4DX1 A;  3F6Q A;  3V30 A;  2A4Z A;  3KAE A;  4BFR A;  4RVB A;  1VDY A;  3OXG A;  4B8A A;  4APO A;  5AYW D;  4FU3 A;  2V5Q C;  4DLO A;  3TWV A;  4O1O A;  3KEZ A;  4JXT A;  4UWG A;  4N3C A;  1ZB1 A;  4UUC A;  3VTX A;  5FZR A;  2R17 C;  2WXG A;  1OUV A;  2QFC A;  1NFI E;  4N2Q A;  1SQM A;  5G2N A;  3UXG A;  2GW1 A;  3PDN A;  4GAA A;  5HI7 A;  3CEQ A;  1E8Z A;  1HU3 A;  4B8C B;  4RLY A;  1H6K A;  3ABM E;  1BD8 A;  2KZT A;  5ENT D;  4LCT A;  4DX6 D;  1N4Q A;  3Q4A B;  1SVX A;  1N95 A;  4KBQ A;  4H7Y A;  3PH0 C;  3DRA A;  3LVQ E;  4BTB A;  5AJD A;  2WXQ A;  3L13 A;  3DST A;  2J49 A;  3ABL E;  1OWO A;  3SGH A;  2Q7F A;  1NI1 A;  3SHF A;  4HOT A;  4AXH A;  3OXL A;  2Y69 E;  2GRQ B;  1NZN A;  2WXO A;  3CSF A;  4J0U A;  4JZY A;  3QOU A;  4U07 A;  3DXK G;  5FQ4 A;  3AS4 A;  3FHE A;  2PM6 A;  3CVY A;  2OV8 A;  1FVF A;  3ML9 A;  2RFA A;  2A5E A;  3JYS A;  4JHK A;  3HVE A;  2A5U A;  2EIN E;  1NP7 A;  1TNY A;  1OCZ E;  4KZ0 A;  2AJA A;  1N11 A;  2FEZ A;  4CCA A;  5AJL A;  3APF A;  4R7L A;  5KNG A;  5DIZ A;  1HG2 A;  5G04 C;  3TXN A;  3CHQ A; 
#chains in the Genus database with same CATH homology
 1HFA A;  4GB9 A;  3SNX A;  5BT1 A;  3ZVV A;  5FJY A;  4OVU A;  4XI9 A;  3R9A B;  3PNT B;  1X5B A;  4TV3 A;  5J08 A;  2I9C A;  4M3O A;  4HOQ A;  4FA6 A;  4U0U A;  3G2W A;  2NXP A;  3O48 A;  2ION A;  4GZ5 A;  1WM5 A;  4HXI A;  1UN9 A;  3S2A A;  1OWM A;  4I17 A;  2J08 A;  3L22 A;  3LKU A;  5EX3 A;  5JJT A;  4TUU A;  1OWN A;  2LAH A;  2R5S A;  3PUK A;  3QWW A;  4ILI A;  1KT0 A;  1SZA A;  5D0O D;  5CMY A;  1UJK A;  4G1T A;  3JQ0 A;  3ZYK A;  5JHB A;  1HE8 A;  1H2U A;  4BT8 A;  3PE3 A;  2I2O A;  5G55 A;  3QNK A;  4HOS A;  3ONL A;  3TG4 A;  3BEE A;  2YHC A;  3JCK C;  5KJK A;  2ZU6 B;  4AJW A;  4FHK A;  3HHM A;  4JVS A;  5ARF A;  4UWH A;  2BTD A;  1U3D A;  3N71 A;  2WMN A;  4J8S A;  3PS6 A;  4XE0 A;  4A1S A;  3DPD A;  4DI3 A;  2XPZ A;  4UI9 C;  2XRY A;  1NA0 A;  3GZS A;  2IJG X;  2OVF A;  4N3B A;  4RSY A;  4WWN A;  4WAF A;  3CVU A;  2X6F A;  1Z3X A;  1P5Q A;  3Q47 B;  2CFZ A;  3FUE A;  3FUM A;  2VGY A;  2R59 A;  5JHA A;  3D9N A;  5EX0 A;  3FU6 A;  3TAX A;  3UQ3 A;  4OYS A;  5BW8 C;  5FQ6 A;  1TJF A;  3ASF A;  1HS6 A;  3L16 A;  1QNF A;  2CHX A;  4W9R A;  2IOL A;  3B7S A;  1ZBP A;  3LY8 A;  2WXN A;  2LAI A;  4G25 A;  2X6K A;  5A6C A;  3JQ1 A;  4HFG A;  4GYO A;  2VSY A;  3FUL A;  3P2B A;  4V3I A;  1Z3Y A;  2AW6 A;  3KD7 A;  4I6E A;  4HOU A;  3D9M A;  3FUJ A;  4KZC A;  4WNF A;  5CCM A;  2WXI A;  4ANV A;  5M72 A;  5EDS A;  2AWI A;  3TG5 A;  3VLE A;  3UUX A;  3RIB A;  2PQN A;  4CRW A;  5FZQ A;  4AM9 A;  2DBA A;  5FQ8 A;  4LRZ A;  2WB2 A;  2Y4U A;  3U3W A;  4ATG A;  2WXP A;  4AEZ C;  1QQE A;  3PRZ A;  5E76 A;  4XKB A;  3ZRH A;  3Q15 A;  3LDZ A;  3TL5 A;  4DLQ A;  3PNL B;  1QZ2 A;  4RG6 A;  2YNQ A;  5EKQ D;  3ZYM A;  4AY5 A;  4LEU A;  3EIJ A;  5HQ8 A;  1Y8M A;  3PE4 A;  1N52 A;  3QWV A;  4I9E A;  3CR3 A;  3ZPJ A;  1JPL A;  1GW6 A;  2HO1 A;  2IQC A;  3GW4 A;  4U63 A;  1UN8 A;  3RO3 A;  3FTV A;  2E0I A;  2VYI A;  3LY9 A;  4L2Y A;  3FFL A;  2NC9 A;  4K0R A;  4O6F A;  2WXL A;  3RRU A;  2BUG A;  2MHK A;  3FUF A;  1WY6 A;  4XI0 A;  5KJL A;  1HG5 A;  3FUN A;  4Q94 A;  3QC1 A;  4ILH B;  3MKQ A;  4I43 A;  4JA9 A;  4N3A A;  3R7Q A;  3FTW A;  2ILR A;  1IQR A;  1NA3 A;  4UQY A;  4L7T A;  1PAQ A;  1TEZ A;  2V8S E;  3MCX A;  4JPS A;  4PS7 A;  3CQG B;  3QK0 A;  3S7D A;  5A23 A;  4GYW A;  5E75 A;  1Z6T A;  4GCN A;  2AVP A;  3ZGQ A;  3PUJ A;  5CCL A;  3L17 A;  1YA0 A;  4ILG A;  2OOE A;  1H0A A;  4OVV A;  5LFA A;  3U9W A;  4AP2 A;  5BV0 A;  4GU5 A;  2XGO A;  4JEU A;  5FWQ A;  3MX3 A;  3FH7 A;  4GA2 A;  2Y4T A;  4IYP A;  2V0P A;  2XRZ A;  4B89 A;  2AXZ A;  4I6G A;  4F3V A;  2VSO E;  3FEY A;  4DI4 A;  2XCC A;  2KC7 A;  3QAQ A;  4A55 A;  4ACK A;  4NQ0 A;  1E7V A;  2IU1 A;  3FU0 A;  3RRM B;  5BUZ A;  2XGS A;  4EBA G;  3HYM B;  4QFV A;  3TXM A;  3EHM A;  4XX5 A;  3SD5 A;  4HS2 A;  1IYG A;  1HF8 A;  4UI9 K;  4CDR A;  2AXV A;  3FTY A;  4MS6 A;  2KCV A;  5D0Q D;  4B0Z A;  4IUL A;  2UY1 B;  4GYY A;  3UMV A;  2E2E A;  3CKB A;  3FDH A;  5DBK A;  3QKY A;  3RJV A;  4WNE A;  2WXM A;  3ZHE B;  4EQF A;  2IF4 A;  3AU5 A;  4UWK A;  4FAD A;  1E8Y A;  3B7U X;  3UX4 A;  5FZS A;  3Q5M A;  3L6A A;  3WXX A;  1IQU A;  4AY6 A;  1XNF A;  3Q49 B;  5CHE E;  3CK8 A;  2JLB A;  3QJZ A;  3TJP A;  3LS8 A;  5KJN A;  4JC8 A;  4NRH B;  4UQX A;  3ZN3 A;  3EHN A;  2V5F A;  2VGX B;  1ZU2 A;  5A7D B;  4JA7 A;  3IBE A;  1DNP A;  4ME2 A;  4I9C A;  2LO6 A;  5FQ7 A;  3CKC A;  3FP3 A;  1JWG A;  3RU0 A;  3KS2 A;  1E8W A;  3FU3 A;  3CVW A;  1JWF A;  2LNI A;  2XGM A;  3I4G A;  3S7J A;  1A17 A;  2MOW A;  2EQX A;  5G05 J;  1IHG A;  1L5J A;  2FO7 A;  3LY7 A;  1EDU A;  2FBN A;  3D9L A;  4JEH A;  2I1K A;  4PS3 A;  4EBA A;  4MRU A;  4KVO A;  4I1A A;  1HXI A;  3QDN A;  3CVN A;  4DPR A;  3CVQ A;  4J6I A;  3S7F A;  5G05 C;  4FLH A;  1FCH A;  2C0M A;  3SI5 A;  4AIF A;  1H2T C;  1E90 A;  3D9P A;  2MRI A;  4CT0 A;  4KYO B;  4XKC A;  3FTS A;  2L9B A;  2L6J A;  2HR2 A;  3OXF A;  4AV7 A;  2WQ6 A;  3JUI A;  2GRL A;  2WVI A;  3LVR E;  4I6J A;  2DCP A;  2FF4 A;  2V4L A;  2CHW A;  4BY6 A;  2JEK A;  2CFU A;  1B89 A;  3NQP A;  2C2L A;  3PVL A;  4CEM A;  2KZT B;  3MKR A;  1PC2 A;  4U0S A;  5T4Y A;  2HM8 A;  2WXJ A;  4G26 A;  2GRM A;  4A3V A;  3MA5 A;  2CG3 A;  4I2Z A;  4B94 A;  1HO8 A;  4BSX A;  2WMO A;  4GA0 A;  3RRN B;  2PL2 A;  2OND A;  3FWV A;  3GYZ A;  3SF4 A;  4F53 A;  4URK A;  4UI9 J;  2CG2 A;  4D10 C;  4JW1 A;  3CHO A;  4CGW A;  5KJM A;  4FJZ A;  3FU5 A;  3G2T A;  4CDM A;  3R7R A;  4DK5 A;  3VTY A;  1ELK A;  4WWP A;  4CGV A;  4N5C A;  3CVL A;  5ARG A;  3GZ1 A;  4EEC A;  2P58 C;  3B13 A;  2VGX A;  2WQ7 A;  3ZIM A;  3I5P A;  2GGF A;  3RKV A;  3L08 A;  4J8E A;  3RK6 A;  4EZK A;  3AS8 A;  3CHS A;  3ZXS A;  3PZD A;  4A1G A;  3U66 A;  3LYA A;  4MKT A;  3FEX A;  4YVO A;  4WWO A;  4CDN A;  3UT4 A;  2L0T B;  4PUC A;  5AEN A;  2NSZ A;  3O4Z A;  2VSN A;  3MEK A;  3ML8 A;  3SZ7 A;  2KM4 A;  4XZ4 A;  4BWR A;  4FLB A;  5ANR A;  2J9Q A;  2FI7 A;  3T5X A;  4C0E A;  4HVB A;  4NAC A;  4PH4 B;  4AOF A;  4C0M A;  1LF8 A;  2WQH A;  2I6H A;  4GML A;  3VLD A;  5T8I A;  2XEV A;  5FT9 A;  3ASH A;  3FUK A;  3EJN A;  5JJ6 A;  5KCM A;  3BG0 B;  4FP7 A;  3ESK A;  4GZC A;  3LCA A;  4GPK A;  3D9J A;  4DJA A;  2XCB A;  1E8X A;  1FVH A;  3PEU B;  1OWL A;  4LUN U;  4GCO A;  3E4B A;  3CIA A;  2HYZ A;  1UG3 A;  2AXU A;  3T8M A;  2WM9 A;  4GMJ A;  2XHE A;  4KVM A;  2PM7 A;  2X38 A;  3ASD A;  5LCW J;  4HOR A;  3CHR A;  2FUL A;  2WPV A;  3PRE A;  3FUH A;  3SFZ A;  2A4Z A;  4L23 A;  2RD0 A;  3KAE A;  3QWP A;  5C1D A;  5ENN A;  3G2V A;  5LCW C;  3ZYL A;  1KLX A;  1N54 A;  3CK7 A;  5J90 A;  3I3N A;  2VTB A;  2LSV A;  3L54 A;  3MV3 B;  2RG8 A;  4BFR A;  2XPY A;  3IEG A;  3NZS A;  5C2Y A;  4RVB A;  3QB2 A;  4JHJ A;  3FH5 A;  1VDY A;  3OXG A;  4B8A A;  1EYH A;  4YND A;  4APO A;  1JUQ A;  3EDT B;  1OWP A;  3CK9 A;  1KT1 A;  2WXH A;  1UJJ A;  5AYW D;  4FU3 A;  3CGH A;  5BPP A;  3AS5 A;  2VQ2 A;  3S7B A;  4BX9 A;  4DLO A;  5BV1 A;  3LJ3 A;  3LEW A;  3MKQ B;  1ELR A;  1WAO 1;  2KCK A;  3ASG A;  4U04 A;  2UWJ G;  2J09 A;  4E6H A;  3KEZ A;  5ANL A;  3FUI A;  3HDX A;  4JXT A;  4UWG A;  4Y6W A;  4N3C A;  4WNG A;  3VTX A;  3P1U A;  3GZ2 A;  5FZR A;  4GA1 A;  2VSX E;  4EPZ A;  3OTN A;  4L2L A;  5LOZ A;  2R17 C;  3VLF A;  3TGO A;  2WXG A;  1OUV A;  2QFC A;  3MJW A;  4H7X A;  4Y6C A;  3ULQ A;  3C98 A;  2IFU A;  3SBT B;  4N2Q A;  1PY1 A;  3CV0 A;  3ENE A;  1SQM A;  5G2N A;  4GZ6 A;  2GW1 A;  3AU4 A;  3PDN A;  4GAA A;  3MZL B;  5HI7 A;  1U3C A;  3CEQ A;  2DIW A;  1EF1 C;  3NF1 A;  3ONK A;  2J07 A;  4YVQ C;  3FH8 A;  4KT6 B;  4GZD A;  2L0I A;  1E8Z A;  2J4B A;  2X6H A;  1HU3 A;  3DBS A;  3K9I A;  3NZU A;  4G24 A;  1S0P A;  3ZW3 A;  3I4R B;  4LER A;  4B8C B;  3FTX A;  3G2S A;  4P29 A;  1H6K A;  2PZI A;  5FTP A;  3IHY A;  3OAW A;  2KZT A;  5BNW A;  4A3T A;  1ELW A;  4I1O B;  4JL0 A;  4LCT A;  4U0Z A;  4WND A;  5AIJ A;  3D9O A;  4KBQ A;  3Q4A B;  3CVV A;  4ANU A;  4H7Y A;  3APC A;  3PH0 C;  1H2V C;  1W3B A;  4I1M A;  3LVQ E;  4UWF A;  3CLJ A;  4NUR A;  3D3M A;  2WXF A;  4BTB A;  1H19 A;  2WXR A;  5AJD A;  4IRU A;  2WXQ A;  1HZ4 A;  3L13 A;  4FHJ A;  3LPZ A;  2OVB A;  4PDX A;  4WUY A;  3U64 A;  3APD A;  3FTU A;  3IKO B;  3G2U A;  3UT7 A;  2YQ8 A;  4Q69 A;  2Y3A A;  3CVX A;  2J49 A;  1OWO A;  3MGB A;  3FUD A;  4GZ3 A;  3SGH A;  2WXK A;  5G04 J;  3RO2 A;  4FC8 A;  4ANX A;  3URZ A;  2Q7F A;  3B7T A;  3SHF A;  3ZEF A;  2PQR A;  5T3R A;  3UT8 A;  4AXH A;  4BX8 A;  4F7A A;  4Q96 A;  4HOT A;  4G2V A;  2XPI A;  3OXL A;  3T5V A;  1E7U A;  3FTZ A;  4G11 A;  2QY7 A;  3BG1 B;  1MHQ A;  4L1B A;  1E96 B;  4J8D A;  4UQZ A;  2C0L A;  4C9B B;  4U8H A;  4EZL A;  4TRQ A;  2KAT A;  4F1S A;  1NZN A;  2WXO A;  4RG9 A;  3CSF A;  5LP0 A;  4J0U A;  4JZY A;  3QOU A;  4FUL A;  4U07 A;  5FQ4 A;  4XIF A;  5JJ7 A;  3EIQ C;  3AS4 A;  2LSU A;  4UWL A;  4APF A;  3CVP A;  1DVP A;  3FHE A;  3ZFW A;  2PM6 A;  3CVY A;  5CMW A;  1INZ A;  2OV8 A;  2VJ8 A;  1MQS A;  2BF0 X;  2YHE A;  4KXK B;  4ABN A;  4HLE A;  3IHV A;  3PEV B;  1TJC A;  4KMO A;  4I2W A;  3SBS A;  1XGW A;  1FVF A;  3CHP A;  4CT4 A;  1SZ9 A;  4ANW A;  3D9K A;  3FY4 A;  3B7R L;  4PS8 A;  3ML9 A;  4N2S A;  2KCL A;  4JHK A;  3JYS A;  4EZJ A;  3HVE A;  2A5U A;  3MYV A;  1NP7 A;  4IN3 B;  2VTB B;  2X6J A;  3QAR A;  4MLP A;  4KZ0 A;  3ZYQ A;  3ESL A;  4J8F A;  4K03 A;  4ACL A;  3CHM A;  2FEZ A;  3D9I A;  2I1J A;  4FJY A;  4JHR A;  4BTA A;  4CCA A;  3MV2 B;  3LXU X;  2XQ0 A;  1EPU A;  3APF A;  5AJL A;  5LX8 A;  4R7L A;  2UY1 A;  4N39 A;  2X6I A;  1HH8 A;  3U4T A;  3CST A;  3ZHE A;  2X3M A;  2YIN A;  3IV0 A;  2M63 A;  1Y6I A;  1BPO A;  3CQC B;  4G23 A;  1HX8 A;  5DIZ A;  1HG2 A;  3HVE B;  5G04 C;  4BT9 A;  3TXN A;  4E85 A;  4AVX A;  2CHZ A;  2J4D A;  3CHQ A;  3HIZ A;  3UPV A;  1UW4 B;  2IOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...