5CEDB

Penicillin g acylated bd3459 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
194
structure length
194
Chain Sequence
GKSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus hd100
molecule tags Hydrolase
molecule keywords Bd3459
total genus 67
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cedB00
2XZDG 5HS0A 2ETAA 4U96D 5KBAA 2ZGDA 3TWVA 4K5AB 2FO1E 1K1AA 1BU9A 4UUCA 5EIDA 1WG0A 1A5EA 3EU9A 5FINA 1DCQA 1UOHA 4LNUD 3T9KA 1K3ZD 5ENQD 4DX1A 4DX5D 5CECB 3Q9NC 4DUIA 2V4HC 3TWSA 2ETBA 5AQBA 1S70B 4U95D 3TWRA 2V5QC 2Y1LE 5CERB 4HLLA 1BI8B 2RFAA 3W9GA 3JXIA 5ENRD 3B7BA 4BETA 2L6BA 1D9SA 1MX2A 4HI9A 5CEAA 4RLYA 4DX6D 2F8XK 2MYOA 1YCSB 3TWWA 4BEPA 4J8YA 5KNHD 5CEDB 2JABA 4CZ2D 5FIOA 4GPMA 2XEHA 4HBDA 1IKND 3T8KA 3UXGA 4U8YD 4A63B 5EILA 2ZGGA 5AQ7A 2ETCA 2PNNA 3ZUVB 1N0RA 3IXEA 4GMRA 5EYPF 3TWQA 4DRXE 4HRNA 3EHRA 1YMPA 4ATZD 2NYJA 2QC9A 1OT8A 1N11A 1OY3D 2A5EA 2F8YA 3B95A 4O1OA 2F37A 1SVXA 5EN5D 5AAOA 3J5QB 4LG6A 5AARA 1IHBA 4BESA 5JA4D 4BERA 5ENSD 1G3NB 3NBNB 2HE0A 3NOGD 2AJAA 3DEOA 4DX2A 3UTMA 1SW6A 4HRMB 4CYMD 1AP7A 2BKGA 4J7WA 1AWCB 5EIBE 4OAVB 2P2CP 2DZNA 3EHQA 3F6QA 4QFVA 1BD8A 3V31A 2Y0BG 2B0OE 3Q9UC 4F1PA 4G8LA 2XZTG 4O1PA 4HNAD 4YDYA 5AQ9A 3V30A 3ZNGA 4C48B 4LSZE 3TWUA 2KXPC 4G8KA 3UI2A 3V79K 1WDYA 4OAUC 4N5QA 3DEPA 1YYHA 3J5PA 2QYJA 1IXVA 5ENPD 3V2XA 2DWZA 2XEEA 2XENA 1MYOA 3KEAA 4JB8P 5BXOA 3ZU7B 1BLXB 4HI8A 5EYLA 3V2OA 3TWXA 5ITZF 3D9HA 2VGEA 3HG0D 4HB5A 5CBOA 4F6RD 5CBNA 4K5CA 1TR4A 4Z68A 2DVWA 5JMND 1DC2A 2DZOA 2BKKB 4O60A 4U8VD 5ENTD 3ZKJA 5BXUA 3C5RA 5AQAA 3W9FA 1MX4A 1MJ0A 3JUEA 4HQDA 4QQIA 1MX6A 5KNGA 5ENOD 4ZFHA 1NFIE 4NIKA 5KWDA 4K5BA 3NOCD 3AJIA 4YDWA 2J8SD 1N0QA 3JXJA 3HRAA 1K1BA 4TUMA 5HKPA 1BI7B 4HRLA 4DX7D 4ZHBA 3TWTA 3AAAC 2KBXA 5AN8A 3SO8A 3LJNA 4BSZB 1QYMA 5D66A 2RFMA 5HRYA 4B93B
chains in the Genus database with same CATH superfamily
4U96D 5KBAA 5M72A 4N3AA 2XCCA 2KATA 3ISMC 1EDUA 1A5EA 1DCQA 3E30A 3CQCB 4EBAG 5EX3A 2AXUA 2EQXA 4ILHB 3OAWA 4U95D 2R02A 3TWRA 4DPRA 2V5QC 2RFAA 3D9KA 1D9SA 4AV7A 2F8XK 1Q2ZA 4KVMA 2JABA 2R5SA 5G04J 4DI4A 5KJLA 1H2TC 3T8KA 3LY8A 1QZ2A 4PS8A 4GMRA 3Q7FA 3SD5A 3ASOE 1V54E 4HOQA 3G2UA 3NQPA 4UI9J 2HE0A 3NOGD 3SBSA 3Q15A 1NP7A 2LAHA 4BTAA 1AWCB 3E4BA 3DWLG 4N2QA 1LF8A 3ASGA 3OXLA 2H6HA 3Q5MA 1O1RA 5EX0A 3CVWA 4AXHA 3UT7A 4AJWA 2WQ7A 4GMJA 2DWZA 1HE8A 1O1SA 5AYWD 2EINE 3T8MA 3HG0D 2L0TB 3OTNA 3SFZA 1DC2A 2XCBA 1BPOA 3FY4A 5AQAA 3TG5A 5J90A 2RKKA 3FH7A 1BI7B 1SA5A 3DSUA 5AN8A 2VGYA 3LJNA 2X38A 4KXKB 4X8QA 5C1DA 4K5AB 3ZXSA 4R7LA 3GZ1A 2VJ8A 1NA3A 2IO2C 3QNKA 1N95A 2VTBA 1E8YA 2IY0C 3MCXA 3VLFA 5CCLA 3CVXA 3FUNA 1GW6A 3ZRHA 2R05A 3D9IA 4HBDA 3UXGA 4A63B 2WXOA 2VTBB 3I3NA 3L9TA 4W9RA 3IHYA 4XI9A 5T8IA 4O1OA 5EN5D 1H6KA 2CHXA 2IJGX 2ILRA 4N3CA 3L54A 4GTRA 1VDYA 3LVRE 1KLXA 3Q9UC 3FUFA 4LNGA 3FFLA 3DEPA 3DRAA 2XENA 3MGBA 5DBKA 4LUNU 5BT1A 5T3RA 2DVWA 2F0YA 1HG2A 4JD2G 2NSZA 2WPVA 3AJIA 4B8CB 2FO7A 4TUMA 2C2LA 4G24A 5JJ7A 2KBXA 2RFMA 4BTBA 3QARA 1L5JA 2WVIA 4KZ0A 3QAQA 4L23A 3B7UX 3RIBA 5ENQD 3HXBA 2XGSA 2IOSA 3FU5A 3FH5A 4O6FA 3DXMG 4FC8A 3UKUG 4AY6A 3CHRA 4AVXA 1NL4A 2EILE 4RG6A 3QWWA 3URZA 4D10C 3ULYA 1UN8A 3C72A 4JHRA 5AAOA 4NRHB 1HFAA 3G2VA 3FEYA 3R9MA 1N52A 4B0ZA 3RU0A 1HF8A 5EIBE 1NA0A 3DSTA 2DZNA 2E2EA 4EHMA 3CEQA 4N5QA 5T4YA 5FTPA 3SQVA 4J8EA 4HI8A 3UM3A 2Y4TA 4XI0A 2AW6A 3U9WA 2XQ0A 2J4DA 5JJTA 1OCRE 2J8SD 1FT1A 3NAWA 4GMLA 3ENEA 4WNGA 1FVFA 1TEZA 4G1TA 4EBAA 3NZSA 4GZ3A 2WXGA 2VGXB 4DX5D 2R2LA 3BG1B 3B7SA 3ONLA 3CHSA 3P2BA 2PL2A 1NI1A 4J8YA 3B13A 5CMYA 1OXJA 4GA2A 1Z3YA 3KSQA 1OWPA 2XPIA 2PQNA 3CSFA 1DCEA 1H0AA 4JEUA 1K8KG 3HXCA 4XKBA 1P5QA 1N4PA 4U0SA 2HM8A 3LYAA 2GRQB 3DSWA 1Y8MA 4F1PA 3ZNGA 3JCKC 3UI2A 1WDYA 4OAUC 1YYHA 1KT0A 3PREA 2XHEA 2IU1A 4E6HA 2P9SG 3FU3A 1TNOA 3SZ7A 2DZOA 5D2MC 2PQRA 4O60A 2RG8A 3CSTA 3L22A 2WQ6A 2KZTA 3FU0A 3ESLA 1EPUA 3NOCD 2BF0X 4UI9K 2VSOE 3ZHEB 1FT2A 3BEEA 3PNTB 3CVPA 4DJAA 4J8FA 4YDOA 3UM2A 3HXEA 4CGVA 3HXFA 3L6AA 4JC8A 4GYWA 3ZIMA 4G11A 3EJNA 3AG3E 3EU9A 1SZ9A 4JHKA 2VSXE 3MV3B 3L16A 3W9GA 1JUQA 2L6BA 5CRUA 4RLYA 3TWWA 5BPPA 3ZGQA 1QQEA 3I5PA 5ARFA 2P9PG 4JHJA 1FCHA 2ETCA 5CCMA 3SF4A 3EUVA 1YMPA 5A6CA 3ZEFA 4V3IA 3Q73A 5JA4D 4BERA 4N5CA 3PZ2A 1G3NB 4I9EA 3DEOA 3UIOC 3RKVA 4B94A 3PE3A 4FJYA 3AS8A 3RO2A 1PAQA 4BFRA 1E96B 1SZAA 3LCAA 3LDZA 3V2XA 3SHFA 5G2NA 3CK7A 2HYZA 5ITZF 1H6OA 2VGEA 4Q94A 4F6RD 4K5CA 4N2SA 5CRVA 4U8VD 1Z3XA 4WWPA 5FQ8A 4MBGA 1TN6A 2LSUA 3QKYA 3ZN3A 1N54A 5FZRA 4N39A 3TWVA 1E8WA 2FO1E 3NF1A 2XPZA 2GW1A 5EIDA 2WXJA 2OVFA 1E90A 3ASNE 4CCAA 4F1SA 3VTYA 3EHMA 2WMOA 3FULA 1S70B 4UWLA 4BT9A 3R7QA 1MX2A 2VGXA 3UUXA 2MYOA 4L7TA 5BV1A 1TYQG 3GW4A 4HS2A 3TG4A 3APDA 3CV0A 4CZ2D 2PM7A 2I1JA 5HQ8A 2VSYA 3LS8A 4YVQC 3CHQA 4GTQA 1SVXA 2Y69E 3AS5A 4HFGA 3CHMA 2OOEA 3QC1A 4OVUA 3D9JA 3U64A 3ZYLA 5KJMA 2XPYA 4Q69A 5C2YA 3UM0A 4TXPA 1QNFA 1IXVA 4PS7A 5FJYA 4Y6CA 2NC9A 5BXOA 4GCOA 3S7JA 3FH8A 4APOA 2H6FA 4I2WA 3CIAA 4GA0A 4EZLA 5ENTD 3ZKJA 3X2QE 4HQDA 5FZSA 4RVBA 4GYYA 4FU3A 3L13A 3AAAC 1KT1A 2FI7A 4APFA 5FWQA 4KT6B 2ETAA 4E85A 3G2SA 2J08A 3E34A 5CMWA 2M63A 1U3DA 3CQGB 4ANUA 4NURA 3U3WA 3LEWA 3PZ4A 3CKBA 2CHZA 2YQ8A 3R9AB 5E76A 3JYSA 4DLOA 3HVEA 4I6JA 2UY1B 2DYSE 4DK5A 4JVSA 2GROB 1TNZA 4GTVA 3FDHA 2BTDA 4LG6A 3MV2B 4L2LA 4FHKA 5ENSD 2CHWA 4DX2A 1JCQA 2RD0A 3N71A 2H6GA 3Q78A 2IONA 3APFA 2LXMA 4L9PA 3FUMA 4URKA 4GB9A 4GZCA 4G8LA 3VTXA 5B1BE 2BEDA 3SBTB 2DBAA 4HOTA 3BG0B 1KZPA 3ABLE 1N4SA 4U07A 5EYLA 2CG3A 4JW1A 4HB5A 4JEHA 4F53A 4K0RA 2C0MA 1MZCA 3DXKG 3TXNA 3GYZA 2DCPA 4JXTA 4L1BA 4AIFA 1N4QA 1INZA 3RAUA 2J07A 4ACKA 4JA9A 3L82A 4K5BA 3Q75A 1V55E 4A3VA 1K1BA 4DX7D 1EYHA 4PUCA 1JCRA 5HRYA 3AU4A 2X6IA 3DPYA 2YHEA 1U3CA 5FQ6A 3FTZA 4CT0A 4RG9A 2OVBA 4GTSA 1WG0A 2GRMA 4CDNA 2V4LA 4DLQA 1DVPA 3ASFA 3B7RL 3C3OA 4KVOA 2V4HC 2ZISA 3UPVA 3ZYMA 4U63A 4ATGA 5CEDB 5KJKA 1HX8A 1OWMA 3Q4AB 1S63A 1UN9A 2YINA 2X3MA 4UQYA 2AXZA 3ULEG 3CKCA 4WWNA 3FHEA 4XZ4A 3UTMA 4U0UA 1OWOA 4G25A 3UT4A 1IYGA 5G04C 3PRZA 2Y0BG 2KXPC 4HORA 3CVYA 1TNUA 1Z5SC 3ZHEA 3C98A 3RK6A 3FTUA 4J6IA 3LPZA 4Y6WA 5AJLA 3DSVA 4QQIA 4GYOA 4JA7A 3FUEA 4EZJA 2WMNA 1JWGA 5JHAA 3ULQA 5ANLA 1XGWA 3I4RB 3IV0A 4U8HA 3AS4A 3TXMA 1BU9A 3EHNA 3GZSA 2WXMA 3RRMB 2AXVA 4GZDA 5CHEE 4NQ0A 3Q9NC 4DUIA 1XNFA 4BY6A 3UX4A 2R17C 1BI8B 3FEXA 5ENRD 1YCSB 1HXIA 2YHCA 1TJCA 5FIOA 5ARGA 1E8ZA 2CFZA 2J4BA 1TN8A 4MKTA 3ABKE 1EF1C 1W3BA 3TWQA 1SA4A 5ANRA 2LAIA 2QC9A 1JWFA 3J5QB 4L2YA 3G2WA 2B6CA 5G05J 1H2VC 4LNBA 2KCVA 4A1GA 4G2VA 1BD8A 1N4RA 4LERA 4I17A 3CVUA 5FZQA 3U4TA 4G23A 2FULA 2X6FA 2A4ZA 2XEEA 2KCKA 3IHVA 4YVOA 3PS6A 3UM1A 2I9CA 1S64A 3DSSA 3QWPA 4K03A 1OWLA 3SFYA 5D0OD 4GU5A 3QK0A 3CGHA 2L9BA 1QYMA 2I6HA 1SQMA 3APCA 4ANWA 3L17A 1A17A 4CDMA 3FUJA 3PNLB 3L08A 3UT8A 3T9KA 1D8EA 3QJZA 2ETBA 3PUKA 4OVVA 2I1KA 5CERB 1OWNA 1S0PA 3B7BA 2WXRA 4F7AA 3LY7A 3ZYQA 3PVLA 4U8YD 5B1AE 5AQ7A 2NXPA 4AOFA 3DBSA 1JPLA 4MS6A 5AARA 4LRZA 4GTPA 2AVPA 3ML9A 3GZ2A 5G05C 4CRWA 3F6QA 1OCOE 2V0PA 4C48B 1O1TA 2AWIA 1B89A 4C0MA 4FADA 4TRQA 1NZNA 1X81A 4JB8P 4U04A 2R03A 2WB2A 4GPKA 3D9HA 4GTTA 4HOUA 4WUYA 1KPSB 2V5FA 4GAAA 3U66A 3MJWA 2L0IA 3JUEA 1MJ0A 2J9QA 2WXIA 4ILGA 2P9NG 5G55A 4XEIG 4RQIA 3BQOA 3MEKA 3R7RA 4FULA 4LEUA 4AEZC 4AM9A 5FINA 2P58C 3NZUA 5HI7A 2ZU6B 2WQHA 1HO8A 3ZPJA 1N94A 4BSXA 2X6JA 5ENNA 3JQ0A 3TL5A 2HO1A 4GZ6A 3FTWA 5LOZA 2R59A 4CGWA 2MHKA 4M3OA 4CT4A 3C3QA 3E33A 2CFUA 3ASHA 4YDEA 4ATZD 1OT8A 2F8YA 3T5XA 3ZVVA 3HXDA 3CLJA 2OEWA 5DIZA 3T5VA 2WXHA 4BT8A 2P9UG 2KM4A 3Q49B 1JCSA 3V31A 3LJ3A 4C0EA 3FP3A 2DIWA 2XZTG 4O1PA 3UINC 4XE0A 3BU8A 2GRNB 4I2ZA 3Q7AA 3EIJA 4A3TA 2FEZA 5EKQD 3ESKA 3MA5A 5EDSA 2XGOA 5BW8C 4HLEA 1DNPA 1MX4A 3S7FA 3FUHA 3FU6A 5H7PA 2GRPB 1N0QA 3JXJA 5BV0A 4I1AA 1ZB1A 5D66A 3FTVA 1E7UA 4JL0A 3WG7E 2UWJG 5HS0A 4JZYA 2OEVA 3UQ3A 2VYIA 3CVVA 1UG3A 3HIZA 3FTYA 4RSYA 3CVNA 1TNYA 3O4ZA 4WAFA 4CEMA 3AG4E 3SNXA 4EQFA 2UY1A 3MKQB 1HU3A 3ZXPA 4BETA 1D8DA 2ZXWE 4B8AA 3DSXA 3O48A 4HVBA 3ASDA 2HR2A 4U7EB 4UWHA 2L6JA 2VSNA 3MX3A 2XEHA 4UWFA 2ZGGA 3RJVA 3ZUVB 4DRXE 4LCTA 2NYJA 3B95A 2A5EA 2P9IG 4IYPA 2BUGA 1HH8A 3HVEB 5FT9A 3CK9A 3RSEG 3SGHA 3C3RA 4CYMD 2PM6A 2OCCE 3S7BA 2BKGA 4I6EA 4OAVB 2Y3AA 3OXGA 3KEZA 5AQ9A 4YDYA 4ME2A 3AG1E 2A5UA 5A7DB 1PY1A 3J5PA 3QB2A 2E0IA 3KAEA 5CBNA 1TN7A 2GRLA 3QOUA 3C5RA 1H6PA 4ZFHA 1RZ4A 1NFIE 1U2VG 1O5MA 3TWTA 2C0LA 2IF4A 3FUKA 1E8XA 1ELKA 3VLEA 4B93B 4AY5A 2Q7FA 2EIKE 3MKQA 2JLBA 3I4GA 1OCCE 2LXLA 4P29A 2XRZA 1UOHA 3HYMB 1HG5A 4DX1A 3LXUX 5CECB 4GTMA 4UQZA 4MRUA 3BUAA 3AU5A 5CEAA 2QFCA 2VQ2A 3TGOA 4I9CA 2P9LG 2PNNA 3PH0C 2QZAA 1KZOA 3PZ3A 1IHBA 4BESA 3NB2A 4XX5A 4H7YA 3JUIA 4PS3A 3B7TA 2AJAA 4IULA 3JQ1A 3QDNA 2ZIRA 4EECA 4F3VA 3TWUA 4G8KA 3Q79A 3V79K 5LCWC 2QYJA 4FLBA 2OV8A 3Q47B 1BLXB 4EPZA 3S7DA 4FP7A 3W9FA 3RO3A 4NIKA 3HRAA 4UWKA 5HKPA 4HRLA 3IEGA 3FUDA 3ZFWA 4HXIA 4C9BB 4BSZB 2MOWA 3IKOB 1Z6TA 1UJKA 4TXRA 1HS6A 3OXFA 1E7VA 1OUVA 2ONDA 3DPDA 4JPSA 3ZW3A 4UUCA 2XEVA 4IRUA 5KCMA 1PC2A 2FF4A 2WXFA 4PDXA 2LNIA 3K9IA 4XIFA 3UMVA 2YNQA 3RRUA 4BEPA 3ABME 3FWVA 2I2OA 4WWOA 3PUJA 1UW4B 3D3MA 1H2UA 3LKUA 3IXEA 5EYPF 4ABNA 3G2TA 4AP2A 2XS1A 3HHMA 1WAO1 3D9NA 2QY7A 4ANXA 1SW6A 4XKCA 2H6IA 4J7WA 3S2AA 4MLPA 2P2CP 3EHQA 4TXQA 2B0OE 2WXKA 1WY6A 2KZTB 4HNAD 3V30A 4FA6A 1FPPA 3CHPA 3P1UA 3CVQA 3KSLA 5LCWJ 3D9LA 4FLHA 2X6HA 2LSVA 4HOSA 5JMND 5JJ6A 2BKKB 3EDTB 2JEKA 2EIJE 5KNGA 1MX6A 1QBQA 2WXQA 5ENOD 4EZKA 5J08A 3SY2A 3LVQE 2WXNA 4FJZA 4J0UA 4I1MA 2XRYA 4OYSA 4B89A 2XZDG 5B3SE 4N3BA 3TAXA 4WNEA 1K1AA 5D0QD 3PZDA 4GCNA 3D9PA 4LNUD 1H19A 2GRRB 3VLDA 2Y4UA 3TWSA 5FQ7A 5AQBA 4BWRA 2Y1LE 4U0ZA 4DX6D 4G26A 4FHJA 4KBQA 1IQUA 1IKND 5AENA 5EILA 2IO3C 3KS2A 4A1SA 3EHRA 4H7XA 2KC7A 1OY3D 2F37A 3PE4A 4I6GA 4UWGA 3MYVA 2J09A 3CK8A 4UI9C 1MHQA 4ACLA 3CVLA 4J8DA 3TJPA 3E37A 2IQCA 3CR3A 1MQSA 5KJNA 3SI5A 3PZ1A 4LSZE 4GZ5A 3ML8A 3PEUB 5LFAA 3AG2E 3KEAA 5IY5E 3ZYKA 4WNFA 1TJFA 3V2OA 3WXXA 4Z68A 4TUUA 2XS8A 5BXUA 2IEJA 5AJDA 3QWVA 4KZCA 3D9OA 4M7CA 4YDWA 1LD8A 4Q96A 4ZHBA 3FTXA 4A55A 4NACA 3SO8A 3FUIA 2PZIA 3MKRA 5A23A 5FQ4A 4I43A 2ZGDA 2V8SE 2MRIA 2KCLA 3SFXA 3EIQC 4IN3B 1K3ZD 3E32A 2GGFA 1YA0A 3LY9A 3PEVB 3D9MA 3UKRG 2WXPA 4HLLA 2XGMA 3JXIA 2LUHA 4HI9A 1ELRA 1FVHA 5AIJA 3CHOA 3FTSA 3EU5A 5KNHD 1ELWA 1Y6IA 4DI3A 4GA1A 4GPMA 4UQXA 2EIME 1ZBPA 4GTOA 1N0RA 4KMOA 4HRNA 3MZLB 5E75A 1N11A 3HDXA 1IQRA 2P9KG 2IFUA 2WXLA 3NBNB 5JHBA 1LD7A 2WM9A 2IOLA 4HRMB 5BNWA 3ONKA 1X5BA 1AP7A 4TV3A 4ILIA 4BX9A 2DYRE 4QFVA 1IHGA 1HZ4A 1UJJA 2CG2A 4YNDA 2X6KA 1TNBA 1ZU2A 2LO6A 4I1OB 5ENPD 2FBNA 4WNDA 1MYOA 1LTXA 3ZU7B 4BX8A 5LX8A 3KD7A 3TWXA 5LP0A 5CBOA 2J49A 1N9AA 1TR4A 3RRNB 4CDRA 2QYUA 1WM5A 3IBEA 4J8SA 5KWDA 1RW2A 4KYOB 4PH4B 4ANVA 3PDNA 5BUZA 1OCZE 3UIPC
chains in the Genus database with same CATH topology
2XZDG 5HS0A 2ETAA 4U96D 5KBAA 2ZGDA 3TWVA 4K5AB 2FO1E 1K1AA 1BU9A 4UUCA 5EIDA 1WG0A 1A5EA 3EU9A 5FINA 1DCQA 1UOHA 4LNUD 3T9KA 1K3ZD 5ENQD 4DX1A 4DX5D 5CECB 3Q9NC 4DUIA 2V4HC 3TWSA 2ETBA 5AQBA 1S70B 4U95D 3TWRA 2V5QC 2Y1LE 5CERB 4HLLA 1BI8B 2RFAA 3W9GA 3JXIA 5ENRD 3B7BA 4BETA 2L6BA 1D9SA 1MX2A 4HI9A 5CEAA 4RLYA 4DX6D 2F8XK 2MYOA 1YCSB 3TWWA 4BEPA 4J8YA 5KNHD 5CEDB 2JABA 4CZ2D 5FIOA 4GPMA 2XEHA 4HBDA 1IKND 3T8KA 3UXGA 4U8YD 4A63B 5EILA 2ZGGA 5AQ7A 2ETCA 2PNNA 3ZUVB 1N0RA 3IXEA 4GMRA 5EYPF 3TWQA 4DRXE 4HRNA 3EHRA 1YMPA 4ATZD 2NYJA 2QC9A 1OT8A 1N11A 1OY3D 2A5EA 2F8YA 3B95A 4O1OA 2F37A 1SVXA 5EN5D 5AAOA 3J5QB 4LG6A 5AARA 1IHBA 4BESA 5JA4D 4BERA 5ENSD 1G3NB 3NBNB 2HE0A 3NOGD 2AJAA 3DEOA 4DX2A 3UTMA 1SW6A 4HRMB 4CYMD 1AP7A 2BKGA 4J7WA 1AWCB 5EIBE 4OAVB 2P2CP 2DZNA 3EHQA 3F6QA 4QFVA 1BD8A 3V31A 2Y0BG 2B0OE 3Q9UC 4F1PA 4G8LA 2XZTG 4O1PA 4HNAD 4YDYA 5AQ9A 3V30A 3ZNGA 4C48B 4LSZE 3TWUA 2KXPC 4G8KA 3UI2A 3V79K 1WDYA 4OAUC 4N5QA 3DEPA 1YYHA 3J5PA 2QYJA 1IXVA 5ENPD 3V2XA 2DWZA 2XEEA 2XENA 1MYOA 3KEAA 4JB8P 5BXOA 3ZU7B 1BLXB 4HI8A 5EYLA 3V2OA 3TWXA 5ITZF 3D9HA 2VGEA 3HG0D 4HB5A 5CBOA 4F6RD 5CBNA 4K5CA 1TR4A 4Z68A 2DVWA 5JMND 1DC2A 2DZOA 2BKKB 4O60A 4U8VD 5ENTD 3ZKJA 5BXUA 3C5RA 5AQAA 3W9FA 1MX4A 1MJ0A 3JUEA 4HQDA 4QQIA 1MX6A 5KNGA 5ENOD 4ZFHA 1NFIE 4NIKA 5KWDA 4K5BA 3NOCD 3AJIA 4YDWA 2J8SD 1N0QA 3JXJA 3HRAA 1K1BA 4TUMA 5HKPA 1BI7B 4HRLA 4DX7D 4ZHBA 3TWTA 3AAAC 2KBXA 5AN8A 3SO8A 3LJNA 4BSZB 1QYMA 5D66A 2RFMA 5HRYA 4B93B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZD G;  5HS0 A;  2ETA A;  4U96 D;  5KBA A;  2ZGD A;  3TWV A;  4K5A B;  2FO1 E;  1K1A A;  1BU9 A;  4UUC A;  5EID A;  1WG0 A;  1A5E A;  3EU9 A;  5FIN A;  1DCQ A;  1UOH A;  4LNU D;  3T9K A;  1K3Z D;  5ENQ D;  4DX1 A;  4DX5 D;  5CEC B;  3Q9N C;  4DUI A;  2V4H C;  3TWS A;  2ETB A;  5AQB A;  1S70 B;  4U95 D;  3TWR A;  2V5Q C;  2Y1L E;  5CER B;  4HLL A;  1BI8 B;  2RFA A;  3W9G A;  3JXI A;  5ENR D;  3B7B A;  4BET A;  2L6B A;  1D9S A;  1MX2 A;  4HI9 A;  5CEA A;  4RLY A;  4DX6 D;  2F8X K;  2MYO A;  1YCS B;  3TWW A;  4BEP A;  4J8Y A;  5KNH D;  5CED B;  2JAB A;  4CZ2 D;  5FIO A;  4GPM A;  2XEH A;  4HBD A;  1IKN D;  3T8K A;  3UXG A;  4U8Y D;  4A63 B;  5EIL A;  2ZGG A;  5AQ7 A;  2ETC A;  2PNN A;  3ZUV B;  1N0R A;  3IXE A;  4GMR A;  5EYP F;  3TWQ A;  4DRX E;  4HRN A;  3EHR A;  1YMP A;  4ATZ D;  2NYJ A;  2QC9 A;  1OT8 A;  1N11 A;  1OY3 D;  2A5E A;  2F8Y A;  3B95 A;  4O1O A;  2F37 A;  1SVX A;  5EN5 D;  5AAO A;  3J5Q B;  4LG6 A;  5AAR A;  1IHB A;  4BES A;  5JA4 D;  4BER A;  5ENS D;  1G3N B;  3NBN B;  2HE0 A;  3NOG D;  2AJA A;  3DEO A;  4DX2 A;  3UTM A;  1SW6 A;  4HRM B;  4CYM D;  1AP7 A;  2BKG A;  4J7W A;  1AWC B;  5EIB E;  4OAV B;  2P2C P;  2DZN A;  3EHQ A;  3F6Q A;  4QFV A;  1BD8 A;  3V31 A;  2Y0B G;  2B0O E;  3Q9U C;  4F1P A;  4G8L A;  2XZT G;  4O1P A;  4HNA D;  4YDY A;  5AQ9 A;  3V30 A;  3ZNG A;  4C48 B;  4LSZ E;  3TWU A;  2KXP C;  4G8K A;  3UI2 A;  3V79 K;  1WDY A;  4OAU C;  4N5Q A;  3DEP A;  1YYH A;  3J5P A;  2QYJ A;  1IXV A;  5ENP D;  3V2X A;  2DWZ A;  2XEE A;  2XEN A;  1MYO A;  3KEA A;  4JB8 P;  5BXO A;  3ZU7 B;  1BLX B;  4HI8 A;  5EYL A;  3V2O A;  3TWX A;  5ITZ F;  3D9H A;  2VGE A;  3HG0 D;  4HB5 A;  5CBO A;  4F6R D;  5CBN A;  4K5C A;  1TR4 A;  4Z68 A;  2DVW A;  5JMN D;  1DC2 A;  2DZO A;  2BKK B;  4O60 A;  4U8V D;  5ENT D;  3ZKJ A;  5BXU A;  3C5R A;  5AQA A;  3W9F A;  1MX4 A;  1MJ0 A;  3JUE A;  4HQD A;  4QQI A;  1MX6 A;  5KNG A;  5ENO D;  4ZFH A;  1NFI E;  4NIK A;  5KWD A;  4K5B A;  3NOC D;  3AJI A;  4YDW A;  2J8S D;  1N0Q A;  3JXJ A;  3HRA A;  1K1B A;  4TUM A;  5HKP A;  1BI7 B;  4HRL A;  4DX7 D;  4ZHB A;  3TWT A;  3AAA C;  2KBX A;  5AN8 A;  3SO8 A;  3LJN A;  4BSZ B;  1QYM A;  5D66 A;  2RFM A;  5HRY A;  4B93 B; 
#chains in the Genus database with same CATH topology
 4U96 D;  5KBA A;  5M72 A;  4N3A A;  2XCC A;  2KAT A;  3ISM C;  1EDU A;  1A5E A;  1DCQ A;  3E30 A;  3CQC B;  4EBA G;  5EX3 A;  2AXU A;  2EQX A;  4ILH B;  3OAW A;  4U95 D;  2R02 A;  3TWR A;  4DPR A;  2V5Q C;  2RFA A;  3D9K A;  1D9S A;  4AV7 A;  2F8X K;  1Q2Z A;  4KVM A;  2JAB A;  2R5S A;  5G04 J;  4DI4 A;  5KJL A;  1H2T C;  3T8K A;  3LY8 A;  1QZ2 A;  4PS8 A;  4GMR A;  3Q7F A;  3SD5 A;  3ASO E;  1V54 E;  4HOQ A;  3G2U A;  3NQP A;  4UI9 J;  2HE0 A;  3NOG D;  3SBS A;  3Q15 A;  1NP7 A;  2LAH A;  4BTA A;  1AWC B;  3E4B A;  3DWL G;  4N2Q A;  1LF8 A;  3ASG A;  3OXL A;  2H6H A;  3Q5M A;  1O1R A;  5EX0 A;  3CVW A;  4AXH A;  3UT7 A;  4AJW A;  2WQ7 A;  4GMJ A;  2DWZ A;  1HE8 A;  1O1S A;  5AYW D;  2EIN E;  3T8M A;  3HG0 D;  2L0T B;  3OTN A;  3SFZ A;  1DC2 A;  2XCB A;  1BPO A;  3FY4 A;  5AQA A;  3TG5 A;  5J90 A;  2RKK A;  3FH7 A;  1BI7 B;  1SA5 A;  3DSU A;  5AN8 A;  2VGY A;  3LJN A;  2X38 A;  4KXK B;  4X8Q A;  5C1D A;  4K5A B;  3ZXS A;  4R7L A;  3GZ1 A;  2VJ8 A;  1NA3 A;  2IO2 C;  3QNK A;  1N95 A;  2VTB A;  1E8Y A;  2IY0 C;  3MCX A;  3VLF A;  5CCL A;  3CVX A;  3FUN A;  1GW6 A;  3ZRH A;  2R05 A;  3D9I A;  4HBD A;  3UXG A;  4A63 B;  2WXO A;  2VTB B;  3I3N A;  3L9T A;  4W9R A;  3IHY A;  4XI9 A;  5T8I A;  4O1O A;  5EN5 D;  1H6K A;  2CHX A;  2IJG X;  2ILR A;  4N3C A;  3L54 A;  4GTR A;  1VDY A;  3LVR E;  1KLX A;  3Q9U C;  3FUF A;  4LNG A;  3FFL A;  3DEP A;  3DRA A;  2XEN A;  3MGB A;  5DBK A;  4LUN U;  5BT1 A;  5T3R A;  2DVW A;  2F0Y A;  1HG2 A;  4JD2 G;  2NSZ A;  2WPV A;  3AJI A;  4B8C B;  2FO7 A;  4TUM A;  2C2L A;  4G24 A;  5JJ7 A;  2KBX A;  2RFM A;  4BTB A;  3QAR A;  1L5J A;  2WVI A;  4KZ0 A;  3QAQ A;  4L23 A;  3B7U X;  3RIB A;  5ENQ D;  3HXB A;  2XGS A;  2IOS A;  3FU5 A;  3FH5 A;  4O6F A;  3DXM G;  4FC8 A;  3UKU G;  4AY6 A;  3CHR A;  4AVX A;  1NL4 A;  2EIL E;  4RG6 A;  3QWW A;  3URZ A;  4D10 C;  3ULY A;  1UN8 A;  3C72 A;  4JHR A;  5AAO A;  4NRH B;  1HFA A;  3G2V A;  3FEY A;  3R9M A;  1N52 A;  4B0Z A;  3RU0 A;  1HF8 A;  5EIB E;  1NA0 A;  3DST A;  2DZN A;  2E2E A;  4EHM A;  3CEQ A;  4N5Q A;  5T4Y A;  5FTP A;  3SQV A;  4J8E A;  4HI8 A;  3UM3 A;  2Y4T A;  4XI0 A;  2AW6 A;  3U9W A;  2XQ0 A;  2J4D A;  5JJT A;  1OCR E;  2J8S D;  1FT1 A;  3NAW A;  4GML A;  3ENE A;  4WNG A;  1FVF A;  1TEZ A;  4G1T A;  4EBA A;  3NZS A;  4GZ3 A;  2WXG A;  2VGX B;  4DX5 D;  2R2L A;  3BG1 B;  3B7S A;  3ONL A;  3CHS A;  3P2B A;  2PL2 A;  1NI1 A;  4J8Y A;  3B13 A;  5CMY A;  1OXJ A;  4GA2 A;  1Z3Y A;  3KSQ A;  1OWP A;  2XPI A;  2PQN A;  3CSF A;  1DCE A;  1H0A A;  4JEU A;  1K8K G;  3HXC A;  4XKB A;  1P5Q A;  1N4P A;  4U0S A;  2HM8 A;  3LYA A;  2GRQ B;  3DSW A;  1Y8M A;  4F1P A;  3ZNG A;  3JCK C;  3UI2 A;  1WDY A;  4OAU C;  1YYH A;  1KT0 A;  3PRE A;  2XHE A;  2IU1 A;  4E6H A;  2P9S G;  3FU3 A;  1TNO A;  3SZ7 A;  2DZO A;  5D2M C;  2PQR A;  4O60 A;  2RG8 A;  3CST A;  3L22 A;  2WQ6 A;  2KZT A;  3FU0 A;  3ESL A;  1EPU A;  3NOC D;  2BF0 X;  4UI9 K;  2VSO E;  3ZHE B;  1FT2 A;  3BEE A;  3PNT B;  3CVP A;  4DJA A;  4J8F A;  4YDO A;  3UM2 A;  3HXE A;  4CGV A;  3HXF A;  3L6A A;  4JC8 A;  4GYW A;  3ZIM A;  4G11 A;  3EJN A;  3AG3 E;  3EU9 A;  1SZ9 A;  4JHK A;  2VSX E;  3MV3 B;  3L16 A;  3W9G A;  1JUQ A;  2L6B A;  5CRU A;  4RLY A;  3TWW A;  5BPP A;  3ZGQ A;  1QQE A;  3I5P A;  5ARF A;  2P9P G;  4JHJ A;  1FCH A;  2ETC A;  5CCM A;  3SF4 A;  3EUV A;  1YMP A;  5A6C A;  3ZEF A;  4V3I A;  3Q73 A;  5JA4 D;  4BER A;  4N5C A;  3PZ2 A;  1G3N B;  4I9E A;  3DEO A;  3UIO C;  3RKV A;  4B94 A;  3PE3 A;  4FJY A;  3AS8 A;  3RO2 A;  1PAQ A;  4BFR A;  1E96 B;  1SZA A;  3LCA A;  3LDZ A;  3V2X A;  3SHF A;  5G2N A;  3CK7 A;  2HYZ A;  5ITZ F;  1H6O A;  2VGE A;  4Q94 A;  4F6R D;  4K5C A;  4N2S A;  5CRV A;  4U8V D;  1Z3X A;  4WWP A;  5FQ8 A;  4MBG A;  1TN6 A;  2LSU A;  3QKY A;  3ZN3 A;  1N54 A;  5FZR A;  4N39 A;  3TWV A;  1E8W A;  2FO1 E;  3NF1 A;  2XPZ A;  2GW1 A;  5EID A;  2WXJ A;  2OVF A;  1E90 A;  3ASN E;  4CCA A;  4F1S A;  3VTY A;  3EHM A;  2WMO A;  3FUL A;  1S70 B;  4UWL A;  4BT9 A;  3R7Q A;  1MX2 A;  2VGX A;  3UUX A;  2MYO A;  4L7T A;  5BV1 A;  1TYQ G;  3GW4 A;  4HS2 A;  3TG4 A;  3APD A;  3CV0 A;  4CZ2 D;  2PM7 A;  2I1J A;  5HQ8 A;  2VSY A;  3LS8 A;  4YVQ C;  3CHQ A;  4GTQ A;  1SVX A;  2Y69 E;  3AS5 A;  4HFG A;  3CHM A;  2OOE A;  3QC1 A;  4OVU A;  3D9J A;  3U64 A;  3ZYL A;  5KJM A;  2XPY A;  4Q69 A;  5C2Y A;  3UM0 A;  4TXP A;  1QNF A;  1IXV A;  4PS7 A;  5FJY A;  4Y6C A;  2NC9 A;  5BXO A;  4GCO A;  3S7J A;  3FH8 A;  4APO A;  2H6F A;  4I2W A;  3CIA A;  4GA0 A;  4EZL A;  5ENT D;  3ZKJ A;  3X2Q E;  4HQD A;  5FZS A;  4RVB A;  4GYY A;  4FU3 A;  3L13 A;  3AAA C;  1KT1 A;  2FI7 A;  4APF A;  5FWQ A;  4KT6 B;  2ETA A;  4E85 A;  3G2S A;  2J08 A;  3E34 A;  5CMW A;  2M63 A;  1U3D A;  3CQG B;  4ANU A;  4NUR A;  3U3W A;  3LEW A;  3PZ4 A;  3CKB A;  2CHZ A;  2YQ8 A;  3R9A B;  5E76 A;  3JYS A;  4DLO A;  3HVE A;  4I6J A;  2UY1 B;  2DYS E;  4DK5 A;  4JVS A;  2GRO B;  1TNZ A;  4GTV A;  3FDH A;  2BTD A;  4LG6 A;  3MV2 B;  4L2L A;  4FHK A;  5ENS D;  2CHW A;  4DX2 A;  1JCQ A;  2RD0 A;  3N71 A;  2H6G A;  3Q78 A;  2ION A;  3APF A;  2LXM A;  4L9P A;  3FUM A;  4URK A;  4GB9 A;  4GZC A;  4G8L A;  3VTX A;  5B1B E;  2BED A;  3SBT B;  2DBA A;  4HOT A;  3BG0 B;  1KZP A;  3ABL E;  1N4S A;  4U07 A;  5EYL A;  2CG3 A;  4JW1 A;  4HB5 A;  4JEH A;  4F53 A;  4K0R A;  2C0M A;  1MZC A;  3DXK G;  3TXN A;  3GYZ A;  2DCP A;  4JXT A;  4L1B A;  4AIF A;  1N4Q A;  1INZ A;  3RAU A;  2J07 A;  4ACK A;  4JA9 A;  3L82 A;  4K5B A;  3Q75 A;  1V55 E;  4A3V A;  1K1B A;  4DX7 D;  1EYH A;  4PUC A;  1JCR A;  5HRY A;  3AU4 A;  2X6I A;  3DPY A;  2YHE A;  1U3C A;  5FQ6 A;  3FTZ A;  4CT0 A;  4RG9 A;  2OVB A;  4GTS A;  1WG0 A;  2GRM A;  4CDN A;  2V4L A;  4DLQ A;  1DVP A;  3ASF A;  3B7R L;  3C3O A;  4KVO A;  2V4H C;  2ZIS A;  3UPV A;  3ZYM A;  4U63 A;  4ATG A;  5CED B;  5KJK A;  1HX8 A;  1OWM A;  3Q4A B;  1S63 A;  1UN9 A;  2YIN A;  2X3M A;  4UQY A;  2AXZ A;  3ULE G;  3CKC A;  4WWN A;  3FHE A;  4XZ4 A;  3UTM A;  4U0U A;  1OWO A;  4G25 A;  3UT4 A;  1IYG A;  5G04 C;  3PRZ A;  2Y0B G;  2KXP C;  4HOR A;  3CVY A;  1TNU A;  1Z5S C;  3ZHE A;  3C98 A;  3RK6 A;  3FTU A;  4J6I A;  3LPZ A;  4Y6W A;  5AJL A;  3DSV A;  4QQI A;  4GYO A;  4JA7 A;  3FUE A;  4EZJ A;  2WMN A;  1JWG A;  5JHA A;  3ULQ A;  5ANL A;  1XGW A;  3I4R B;  3IV0 A;  4U8H A;  3AS4 A;  3TXM A;  1BU9 A;  3EHN A;  3GZS A;  2WXM A;  3RRM B;  2AXV A;  4GZD A;  5CHE E;  4NQ0 A;  3Q9N C;  4DUI A;  1XNF A;  4BY6 A;  3UX4 A;  2R17 C;  1BI8 B;  3FEX A;  5ENR D;  1YCS B;  1HXI A;  2YHC A;  1TJC A;  5FIO A;  5ARG A;  1E8Z A;  2CFZ A;  2J4B A;  1TN8 A;  4MKT A;  3ABK E;  1EF1 C;  1W3B A;  3TWQ A;  1SA4 A;  5ANR A;  2LAI A;  2QC9 A;  1JWF A;  3J5Q B;  4L2Y A;  3G2W A;  2B6C A;  5G05 J;  1H2V C;  4LNB A;  2KCV A;  4A1G A;  4G2V A;  1BD8 A;  1N4R A;  4LER A;  4I17 A;  3CVU A;  5FZQ A;  3U4T A;  4G23 A;  2FUL A;  2X6F A;  2A4Z A;  2XEE A;  2KCK A;  3IHV A;  4YVO A;  3PS6 A;  3UM1 A;  2I9C A;  1S64 A;  3DSS A;  3QWP A;  4K03 A;  1OWL A;  3SFY A;  5D0O D;  4GU5 A;  3QK0 A;  3CGH A;  2L9B A;  1QYM A;  2I6H A;  1SQM A;  3APC A;  4ANW A;  3L17 A;  1A17 A;  4CDM A;  3FUJ A;  3PNL B;  3L08 A;  3UT8 A;  3T9K A;  1D8E A;  3QJZ A;  2ETB A;  3PUK A;  4OVV A;  2I1K A;  5CER B;  1OWN A;  1S0P A;  3B7B A;  2WXR A;  4F7A A;  3LY7 A;  3ZYQ A;  3PVL A;  4U8Y D;  5B1A E;  5AQ7 A;  2NXP A;  4AOF A;  3DBS A;  1JPL A;  4MS6 A;  5AAR A;  4LRZ A;  4GTP A;  2AVP A;  3ML9 A;  3GZ2 A;  5G05 C;  4CRW A;  3F6Q A;  1OCO E;  2V0P A;  4C48 B;  1O1T A;  2AWI A;  1B89 A;  4C0M A;  4FAD A;  4TRQ A;  1NZN A;  1X81 A;  4JB8 P;  4U04 A;  2R03 A;  2WB2 A;  4GPK A;  3D9H A;  4GTT A;  4HOU A;  4WUY A;  1KPS B;  2V5F A;  4GAA A;  3U66 A;  3MJW A;  2L0I A;  3JUE A;  1MJ0 A;  2J9Q A;  2WXI A;  4ILG A;  2P9N G;  5G55 A;  4XEI G;  4RQI A;  3BQO A;  3MEK A;  3R7R A;  4FUL A;  4LEU A;  4AEZ C;  4AM9 A;  5FIN A;  2P58 C;  3NZU A;  5HI7 A;  2ZU6 B;  2WQH A;  1HO8 A;  3ZPJ A;  1N94 A;  4BSX A;  2X6J A;  5ENN A;  3JQ0 A;  3TL5 A;  2HO1 A;  4GZ6 A;  3FTW A;  5LOZ A;  2R59 A;  4CGW A;  2MHK A;  4M3O A;  4CT4 A;  3C3Q A;  3E33 A;  2CFU A;  3ASH A;  4YDE A;  4ATZ D;  1OT8 A;  2F8Y A;  3T5X A;  3ZVV A;  3HXD A;  3CLJ A;  2OEW A;  5DIZ A;  3T5V A;  2WXH A;  4BT8 A;  2P9U G;  2KM4 A;  3Q49 B;  1JCS A;  3V31 A;  3LJ3 A;  4C0E A;  3FP3 A;  2DIW A;  2XZT G;  4O1P A;  3UIN C;  4XE0 A;  3BU8 A;  2GRN B;  4I2Z A;  3Q7A A;  3EIJ A;  4A3T A;  2FEZ A;  5EKQ D;  3ESK A;  3MA5 A;  5EDS A;  2XGO A;  5BW8 C;  4HLE A;  1DNP A;  1MX4 A;  3S7F A;  3FUH A;  3FU6 A;  5H7P A;  2GRP B;  1N0Q A;  3JXJ A;  5BV0 A;  4I1A A;  1ZB1 A;  5D66 A;  3FTV A;  1E7U A;  4JL0 A;  3WG7 E;  2UWJ G;  5HS0 A;  4JZY A;  2OEV A;  3UQ3 A;  2VYI A;  3CVV A;  1UG3 A;  3HIZ A;  3FTY A;  4RSY A;  3CVN A;  1TNY A;  3O4Z A;  4WAF A;  4CEM A;  3AG4 E;  3SNX A;  4EQF A;  2UY1 A;  3MKQ B;  1HU3 A;  3ZXP A;  4BET A;  1D8D A;  2ZXW E;  4B8A A;  3DSX A;  3O48 A;  4HVB A;  3ASD A;  2HR2 A;  4U7E B;  4UWH A;  2L6J A;  2VSN A;  3MX3 A;  2XEH A;  4UWF A;  2ZGG A;  3RJV A;  3ZUV B;  4DRX E;  4LCT A;  2NYJ A;  3B95 A;  2A5E A;  2P9I G;  4IYP A;  2BUG A;  1HH8 A;  3HVE B;  5FT9 A;  3CK9 A;  3RSE G;  3SGH A;  3C3R A;  4CYM D;  2PM6 A;  2OCC E;  3S7B A;  2BKG A;  4I6E A;  4OAV B;  2Y3A A;  3OXG A;  3KEZ A;  5AQ9 A;  4YDY A;  4ME2 A;  3AG1 E;  2A5U A;  5A7D B;  1PY1 A;  3J5P A;  3QB2 A;  2E0I A;  3KAE A;  5CBN A;  1TN7 A;  2GRL A;  3QOU A;  3C5R A;  1H6P A;  4ZFH A;  1RZ4 A;  1NFI E;  1U2V G;  1O5M A;  3TWT A;  2C0L A;  2IF4 A;  3FUK A;  1E8X A;  1ELK A;  3VLE A;  4B93 B;  4AY5 A;  2Q7F A;  2EIK E;  3MKQ A;  2JLB A;  3I4G A;  1OCC E;  2LXL A;  4P29 A;  2XRZ A;  1UOH A;  3HYM B;  1HG5 A;  4DX1 A;  3LXU X;  5CEC B;  4GTM A;  4UQZ A;  4MRU A;  3BUA A;  3AU5 A;  5CEA A;  2QFC A;  2VQ2 A;  3TGO A;  4I9C A;  2P9L G;  2PNN A;  3PH0 C;  2QZA A;  1KZO A;  3PZ3 A;  1IHB A;  4BES A;  3NB2 A;  4XX5 A;  4H7Y A;  3JUI A;  4PS3 A;  3B7T A;  2AJA A;  4IUL A;  3JQ1 A;  3QDN A;  2ZIR A;  4EEC A;  4F3V A;  3TWU A;  4G8K A;  3Q79 A;  3V79 K;  5LCW C;  2QYJ A;  4FLB A;  2OV8 A;  3Q47 B;  1BLX B;  4EPZ A;  3S7D A;  4FP7 A;  3W9F A;  3RO3 A;  4NIK A;  3HRA A;  4UWK A;  5HKP A;  4HRL A;  3IEG A;  3FUD A;  3ZFW A;  4HXI A;  4C9B B;  4BSZ B;  2MOW A;  3IKO B;  1Z6T A;  1UJK A;  4TXR A;  1HS6 A;  3OXF A;  1E7V A;  1OUV A;  2OND A;  3DPD A;  4JPS A;  3ZW3 A;  4UUC A;  2XEV A;  4IRU A;  5KCM A;  1PC2 A;  2FF4 A;  2WXF A;  4PDX A;  2LNI A;  3K9I A;  4XIF A;  3UMV A;  2YNQ A;  3RRU A;  4BEP A;  3ABM E;  3FWV A;  2I2O A;  4WWO A;  3PUJ A;  1UW4 B;  3D3M A;  1H2U A;  3LKU A;  3IXE A;  5EYP F;  4ABN A;  3G2T A;  4AP2 A;  2XS1 A;  3HHM A;  1WAO 1;  3D9N A;  2QY7 A;  4ANX A;  1SW6 A;  4XKC A;  2H6I A;  4J7W A;  3S2A A;  4MLP A;  2P2C P;  3EHQ A;  4TXQ A;  2B0O E;  2WXK A;  1WY6 A;  2KZT B;  4HNA D;  3V30 A;  4FA6 A;  1FPP A;  3CHP A;  3P1U A;  3CVQ A;  3KSL A;  5LCW J;  3D9L A;  4FLH A;  2X6H A;  2LSV A;  4HOS A;  5JMN D;  5JJ6 A;  2BKK B;  3EDT B;  2JEK A;  2EIJ E;  5KNG A;  1MX6 A;  1QBQ A;  2WXQ A;  5ENO D;  4EZK A;  5J08 A;  3SY2 A;  3LVQ E;  2WXN A;  4FJZ A;  4J0U A;  4I1M A;  2XRY A;  4OYS A;  4B89 A;  2XZD G;  5B3S E;  4N3B A;  3TAX A;  4WNE A;  1K1A A;  5D0Q D;  3PZD A;  4GCN A;  3D9P A;  4LNU D;  1H19 A;  2GRR B;  3VLD A;  2Y4U A;  3TWS A;  5FQ7 A;  5AQB A;  4BWR A;  2Y1L E;  4U0Z A;  4DX6 D;  4G26 A;  4FHJ A;  4KBQ A;  1IQU A;  1IKN D;  5AEN A;  5EIL A;  2IO3 C;  3KS2 A;  4A1S A;  3EHR A;  4H7X A;  2KC7 A;  1OY3 D;  2F37 A;  3PE4 A;  4I6G A;  4UWG A;  3MYV A;  2J09 A;  3CK8 A;  4UI9 C;  1MHQ A;  4ACL A;  3CVL A;  4J8D A;  3TJP A;  3E37 A;  2IQC A;  3CR3 A;  1MQS A;  5KJN A;  3SI5 A;  3PZ1 A;  4LSZ E;  4GZ5 A;  3ML8 A;  3PEU B;  5LFA A;  3AG2 E;  3KEA A;  5IY5 E;  3ZYK A;  4WNF A;  1TJF A;  3V2O A;  3WXX A;  4Z68 A;  4TUU A;  2XS8 A;  5BXU A;  2IEJ A;  5AJD A;  3QWV A;  4KZC A;  3D9O A;  4M7C A;  4YDW A;  1LD8 A;  4Q96 A;  4ZHB A;  3FTX A;  4A55 A;  4NAC A;  3SO8 A;  3FUI A;  2PZI A;  3MKR A;  5A23 A;  5FQ4 A;  4I43 A;  2ZGD A;  2V8S E;  2MRI A;  2KCL A;  3SFX A;  3EIQ C;  4IN3 B;  1K3Z D;  3E32 A;  2GGF A;  1YA0 A;  3LY9 A;  3PEV B;  3D9M A;  3UKR G;  2WXP A;  4HLL A;  2XGM A;  3JXI A;  2LUH A;  4HI9 A;  1ELR A;  1FVH A;  5AIJ A;  3CHO A;  3FTS A;  3EU5 A;  5KNH D;  1ELW A;  1Y6I A;  4DI3 A;  4GA1 A;  4GPM A;  4UQX A;  2EIM E;  1ZBP A;  4GTO A;  1N0R A;  4KMO A;  4HRN A;  3MZL B;  5E75 A;  1N11 A;  3HDX A;  1IQR A;  2P9K G;  2IFU A;  2WXL A;  3NBN B;  5JHB A;  1LD7 A;  2WM9 A;  2IOL A;  4HRM B;  5BNW A;  3ONK A;  1X5B A;  1AP7 A;  4TV3 A;  4ILI A;  4BX9 A;  2DYR E;  4QFV A;  1IHG A;  1HZ4 A;  1UJJ A;  2CG2 A;  4YND A;  2X6K A;  1TNB A;  1ZU2 A;  2LO6 A;  4I1O B;  5ENP D;  2FBN A;  4WND A;  1MYO A;  1LTX A;  3ZU7 B;  4BX8 A;  5LX8 A;  3KD7 A;  3TWX A;  5LP0 A;  5CBO A;  2J49 A;  1N9A A;  1TR4 A;  3RRN B;  4CDR A;  2QYU A;  1WM5 A;  3IBE A;  4J8S A;  5KWD A;  1RW2 A;  4KYO B;  4PH4 B;  4ANV A;  3PDN A;  5BUZ A;  1OCZ E;  3UIP C; 
#chains in the Genus database with same CATH homology
 2XZD G;  5HS0 A;  2ETA A;  4U96 D;  5KBA A;  2ZGD A;  3TWV A;  4K5A B;  2FO1 E;  1K1A A;  1BU9 A;  4UUC A;  5EID A;  1WG0 A;  1A5E A;  3EU9 A;  5FIN A;  1DCQ A;  1UOH A;  4LNU D;  3T9K A;  1K3Z D;  5ENQ D;  4DX1 A;  4DX5 D;  5CEC B;  3Q9N C;  4DUI A;  2V4H C;  3TWS A;  2ETB A;  5AQB A;  1S70 B;  4U95 D;  3TWR A;  2V5Q C;  2Y1L E;  5CER B;  4HLL A;  1BI8 B;  2RFA A;  3W9G A;  3JXI A;  5ENR D;  3B7B A;  4BET A;  2L6B A;  1D9S A;  1MX2 A;  4HI9 A;  5CEA A;  4RLY A;  4DX6 D;  2F8X K;  2MYO A;  1YCS B;  3TWW A;  4BEP A;  4J8Y A;  5KNH D;  5CED B;  2JAB A;  4CZ2 D;  5FIO A;  4GPM A;  2XEH A;  4HBD A;  1IKN D;  3T8K A;  3UXG A;  4U8Y D;  4A63 B;  5EIL A;  2ZGG A;  5AQ7 A;  2ETC A;  2PNN A;  3ZUV B;  1N0R A;  3IXE A;  4GMR A;  5EYP F;  3TWQ A;  4DRX E;  4HRN A;  3EHR A;  1YMP A;  4ATZ D;  2NYJ A;  2QC9 A;  1OT8 A;  1N11 A;  1OY3 D;  2A5E A;  2F8Y A;  3B95 A;  4O1O A;  2F37 A;  1SVX A;  5EN5 D;  5AAO A;  3J5Q B;  4LG6 A;  5AAR A;  1IHB A;  4BES A;  5JA4 D;  4BER A;  5ENS D;  1G3N B;  3NBN B;  2HE0 A;  3NOG D;  2AJA A;  3DEO A;  4DX2 A;  3UTM A;  1SW6 A;  4HRM B;  4CYM D;  1AP7 A;  2BKG A;  4J7W A;  1AWC B;  5EIB E;  4OAV B;  2P2C P;  2DZN A;  3EHQ A;  3F6Q A;  4QFV A;  1BD8 A;  3V31 A;  2Y0B G;  2B0O E;  3Q9U C;  4F1P A;  4G8L A;  2XZT G;  4O1P A;  4HNA D;  4YDY A;  5AQ9 A;  3V30 A;  3ZNG A;  4C48 B;  4LSZ E;  3TWU A;  2KXP C;  4G8K A;  3UI2 A;  3V79 K;  1WDY A;  4OAU C;  4N5Q A;  3DEP A;  1YYH A;  3J5P A;  2QYJ A;  1IXV A;  5ENP D;  3V2X A;  2DWZ A;  2XEE A;  2XEN A;  1MYO A;  3KEA A;  4JB8 P;  5BXO A;  3ZU7 B;  1BLX B;  4HI8 A;  5EYL A;  3V2O A;  3TWX A;  5ITZ F;  3D9H A;  2VGE A;  3HG0 D;  4HB5 A;  5CBO A;  4F6R D;  5CBN A;  4K5C A;  1TR4 A;  4Z68 A;  2DVW A;  5JMN D;  1DC2 A;  2DZO A;  2BKK B;  4O60 A;  4U8V D;  5ENT D;  3ZKJ A;  5BXU A;  3C5R A;  5AQA A;  3W9F A;  1MX4 A;  1MJ0 A;  3JUE A;  4HQD A;  4QQI A;  1MX6 A;  5KNG A;  5ENO D;  4ZFH A;  1NFI E;  4NIK A;  5KWD A;  4K5B A;  3NOC D;  3AJI A;  4YDW A;  2J8S D;  1N0Q A;  3JXJ A;  3HRA A;  1K1B A;  4TUM A;  5HKP A;  1BI7 B;  4HRL A;  4DX7 D;  4ZHB A;  3TWT A;  3AAA C;  2KBX A;  5AN8 A;  3SO8 A;  3LJN A;  4BSZ B;  1QYM A;  5D66 A;  2RFM A;  5HRY A;  4B93 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...