5CEDB

Penicillin g acylated bd3459 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
194
structure length
194
Chain Sequence
GKSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus hd100
molecule tags Hydrolase
molecule keywords Bd3459
total genus 67
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cedB00
1WDYA 5HKPA 1IXVA 4BERA 2ZGGA 4DX5D 1MJ0A 4HI9A 4DX1A 4F6RD 4QQIA 3AJIA 4QFVA 4BSZB 3J5QB 5ENPD 4HNAD 2DWZA 4K5AB 3ZU7B 1IHBA 2HE0A 1MX2A 3EU9A 2QC9A 5KBAA 1UOHA 2A5EA 5AQ9A 3TWWA 1BI7B 2XEHA 2DZOA 4HBDA 4YDYA 3UTMA 5ITZF 1IKND 1OT8A 2B0OE 3JXIA 4U8YD 2Y1LE 3W9FA 5EIBE 5BXUA 2FO1E 1A5EA 4DUIA 4U95D 5KWDA 2QYJA 3ZUVB 2XENA 5CECB 4U8VD 3B7BA 4ZHBA 2L6BA 3V2XA 5EYPF 2V5QC 1K1BA 2XZDG 3JUEA 3NOGD 3V79K 4HRLA 1K1AA 2BKKB 2RFMA 4K5BA 4JB8P 1N0RA 4UUCA 5ENOD 1OY3D 5AN8A 5EIDA 4Z68A 4BEPA 4LG6A 1K3ZD 2KBXA 1S70B 3DEPA 4DRXE 1YCSB 3EHQA 4ZFHA 5ENQD 3TWRA 5FIOA 5CBOA 2J8SD 3V2OA 5CEDB 4J7WA 5JA4D 4HQDA 5CEAA 4HI8A 4HRMB 2XZTG 3T8KA 3SO8A 5BXOA 4LNUD 3IXEA 5ENTD 5AQ7A 5KNHD 2NYJA 3V30A 4ATZD 3JXJA 5ENSD 5D66A 5JMND 5KNGA 2F8XK 4BETA 4J8YA 2DZNA 3C5RA 3TWSA 3TWQA 4CZ2D 5AARA 3NBNB 4HB5A 4O1OA 4GPMA 1DC2A 2Y0BG 1BI8B 2ETBA 1N0QA 4F1PA 1DCQA 1BU9A 3D9HA 4LSZE 2F37A 5FINA 1SVXA 2AJAA 1WG0A 2KXPC 4G8KA 1MX6A 5EILA 2DVWA 1SW6A 4U96D 3HG0D 1YMPA 3LJNA 4TUMA 4C48B 4B93B 2P2CP 4DX7D 2ETCA 5AAOA 2F8YA 2XEEA 1MX4A 2RFAA 4BESA 3ZKJA 3TWVA 5HS0A 1QYMA 3F6QA 4O1PA 3UXGA 4A63B 2JABA 1YYHA 1MYOA 5AQAA 3W9GA 4OAUC 3TWXA 1AP7A 3AAAC 2BKGA 1TR4A 3EHRA 4O60A 4GMRA 1N11A 3J5PA 3HRAA 3V31A 3T9KA 3B95A 2V4HC 4DX2A 2VGEA 5ENRD 4DX6D 3Q9NC 3DEOA 5EYLA 5AQBA 3TWUA 4N5QA 3ZNGA 5HRYA 4G8LA 3NOCD 4OAVB 4CYMD 4YDWA 2ZGDA 4RLYA 3TWTA 5EN5D 1G3NB 3KEAA 4NIKA 1NFIE 4K5CA 5CERB 1BD8A 2ETAA 1BLXB 3Q9UC 2MYOA 2PNNA 5CBNA 4HRNA 1AWCB 3UI2A 1D9SA 4HLLA
chains in the Genus database with same CATH superfamily
3S7JA 1UN9A 2ZGGA 3SFXA 4DX1A 2OCCE 3LXUX 3AJIA 4BSZB 1E90A 3EU9A 3B7UX 3AS5A 3JQ0A 3ENEA 4UWLA 3L82A 1FCHA 1E96B 4I6EA 4JZYA 2Y1LE 5BXUA 2EIKE 1P5QA 2V4LA 4RG6A 4KZ0A 3FUJA 1PY1A 2GGFA 4TXPA 2XZDG 2MHKA 4D10C 3ABKE 2CHWA 3UPVA 4XEIG 2WXIA 3UKUG 1N4QA 2OOEA 4I1AA 4GU5A 4HOUA 4BTAA 3EHQA 3AG4E 1SZAA 4HRMB 2QZAA 3FUEA 4PUCA 5D0QD 5B1AE 4CGWA 1O1TA 4AEZC 4GA2A 3Q4AB 2DBAA 4GPMA 1E8XA 3C72A 3Q73A 1DCQA 5FINA 3L16A 3S2AA 1YA0A 2P9PG 3LJNA 3LPZA 4AP2A 4I1MA 3MZLB 4O1PA 3FEYA 4ILIA 3CVXA 2IO3C 4GMRA 2AWIA 5AQBA 3RJVA 4IN3B 5FWQA 3U66A 3CVVA 2PQNA 1OWNA 1ZB1A 3KSQA 3U9WA 2ETAA 2Y3AA 5ARFA 1HS6A 1WDYA 3FU0A 3FU6A 2H6IA 2EINE 4FHJA 2UWJG 4XKCA 2UY1A 4BT8A 3HXDA 4FLBA 3SBSA 4RG9A 5EDSA 3CHSA 4M3OA 5CECB 3KEZA 3RSEG 1OWPA 4HVBA 2WXJA 4JXTA 3MJWA 4LG6A 2ONDA 1JCSA 2XGSA 5FIOA 3HHMA 2LAHA 3ASDA 5D66A 3NZSA 2P9LG 3D9NA 2R17C 5E75A 1A17A 2VTBA 5AYWD 4BWRA 5D0OD 3U64A 3HXBA 4BSXA 1MX6A 4EZJA 5LOZA 2GRLA 1U2VG 4C48B 1DCEA 5HS0A 3MV2B 3RO3A 1E8YA 2JABA 2BTDA 1Y6IA 1TR4A 4FU3A 3B95A 3ULQA 1TNZA 4PDXA 3I4GA 1JWFA 1ELKA 3FWVA 4Q69A 5HQ8A 3KEAA 4GTRA 2WXOA 1BLXB 2EIJE 2PNNA 3PS6A 5ANRA 1H6OA 3E33A 4DI3A 3K9IA 3UINC 3LKUA 4P29A 3EDTB 4UI9C 3PZDA 3FTUA 2E0IA 5D2MC 2DIWA 4U04A 2DZOA 4ME2A 3D9PA 4JHKA 5KWDA 4EBAA 3Q7AA 4KMOA 3RO2A 4ZHBA 3CVYA 2VGXA 3RRNB 4APOA 1K1AA 2X6FA 1SZ9A 1JCQA 3FTXA 4NQ0A 5JJ7A 4Z68A 4UWHA 4BEPA 3FEXA 1K3ZD 1D8EA 1NP7A 2JEKA 3V2OA 3PUJA 1N52A 3SO8A 3KAEA 1LF8A 3EHMA 3JCKC 4U07A 3D9MA 2LNIA 4WNGA 1FT1A 2IFUA 3RK6A 3TXMA 2P9NG 3ABLE 2VSYA 2VJ8A 1EPUA 3GZ2A 3TWVA 3ASHA 4EZKA 3DSVA 3W9GA 4GA1A 2H6HA 3J5PA 1E8WA 3ZPJA 4G2VA 3Q9NC 5EYLA 2X6JA 3MYVA 4YDEA 1Z5SC 5BW8C 2WMNA 4G25A 4WNFA 3ML9A 1UJJA 3TG4A 4HI9A 1QZ2A 4QFVA 5BT1A 3ZXSA 3DBSA 1HO8A 2IO2C 3G2WA 3SD5A 3UX4A 4U8YD 3AU4A 4B94A 2H6GA 4UWFA 4EPZA 2KZTB 3CKCA 3PH0C 2OV8A 2GRQB 4V3IA 1H0AA 3AS8A 3CKBA 3HDXA 1OY3D 3UT7A 3R9AB 4OVVA 2HYZA 1INZA 1S70B 3SFZA 4TXRA 2J8SD 4GTMA 4AIFA 4HQDA 5T4YA 3CHQA 4LRZA 4A55A 2XZTG 3E37A 1WAO1 2EQXA 1N4RA 4XZ4A 2NYJA 5G04J 3VLDA 2Q7FA 4I1OB 1S64A 2VSXE 3O4ZA 2VQ2A 4O1OA 3JQ1A 5LCWJ 2ETBA 5EKQD 4G8KA 3SBTB 3B7SA 3UMVA 2DVWA 1SW6A 1TN7A 4RVBA 2AVPA 3FTWA 3BU8A 3PUKA 3F6QA 3NB2A 3DSTA 3PDNA 3FTZA 4I17A 5LP0A 3ZIMA 4I6JA 1NZNA 1N54A 3FDHA 3S7DA 1ELRA 2L9BA 4ILHB 1MHQA 3SGHA 4GTVA 3JYSA 4KXKB 4GTQA 4AOFA 3J5QB 2HE0A 1MZCA 5AQ9A 1O5MA 4XIFA 4DPRA 4DUIA 4U95D 3TXNA 2J07A 4TRQA 3DWLG 3R9MA 3AG3E 3JUEA 4JB8P 3CVNA 3HXEA 2PZIA 3KSLA 3ZHEA 3DXKG 3P2BA 4FADA 1BPOA 1HXIA 3CIAA 4U7EB 3TWRA 3ML8A 4FULA 3LCAA 5BXOA 4LUNU 3IXEA 5CHEE 3JUIA 3ZYMA 1H19A 4ANUA 3Q15A 5CCMA 2I9CA 3CVWA 4YNDA 3CHOA 5FTPA 3NAWA 1DVPA 2Y69E 4EZLA 2VYIA 1KT0A 3LYAA 1Q2ZA 4DX7D 2ETCA 2XCBA 3OXLA 3HXCA 1TJCA 4A63B 1JPLA 4N2QA 4KVMA 3HRAA 2WB2A 3MX3A 2MRIA 2CFUA 3G2TA 2XQ0A 4BY6A 3MKQB 3PZ4A 1TNUA 4I2WA 3FH5A 2FULA 3D9IA 1IQRA 4LNBA 1MJ0A 4QQIA 2WXLA 3D9OA 4GMLA 2A5EA 3G2SA 2XEHA 4HBDA 3N71A 3NQPA 1O1SA 4G11A 5BUZA 4EQFA 3W9FA 2XHEA 3QK0A 3ABME 2FO1E 2QYJA 3ZUVB 5LX8A 4HOSA 4N3CA 5EYPF 4L1BA 3EHNA 1H6PA 2XCCA 4B89A 3LS8A 3KD7A 4U8HA 3QAQA 5IY5E 1TN6A 3IV0A 4DRXE 3OTNA 2OVBA 3ESKA 2P9IG 4JEUA 4LNUD 4ATZD 3V30A 5AJDA 3FH7A 4NURA 1U3CA 1S63A 4CZ2D 4JHJA 3E34A 1HZ4A 3PZ3A 4UWKA 2Y0BG 2CFZA 1TYQG 3HIZA 1K8KG 4UWGA 1EDUA 3HG0D 3BQOA 2RFAA 4ANVA 1SQMA 4UQZA 1AP7A 2KCVA 3ASOE 1N11A 4WNEA 1QBQA 4IYPA 3SFYA 2R59A 4RLYA 4MKTA 5CERB 1PC2A 2IY0C 4GZCA 5CBNA 4HOTA 2WXNA 2I1KA 4HLLA 3MGBA 3RKVA 4ATGA 3QC1A 2QC9A 5KBAA 1TN8A 3FUKA 3PE3A 4DJAA 2WXHA 1OCZE 4IULA 1IYGA 1FVHA 3E30A 4XI9A 3ZYKA 4C0MA 2XENA 4U8VD 3UM2A 3D3MA 2RFMA 4KBQA 4GYYA 4GMJA 3UM1A 3S7FA 4DK5A 2XPYA 2H6FA 3RU0A 2GRPB 4ACKA 2YHEA 1UJKA 4R7LA 5CEDB 2C0MA 3E32A 3CVPA 3RRUA 4HOQA 4A3VA 5CCLA 2QFCA 4AV7A 3GW4A 4LSZE 3BUAA 3ZW3A 4UQYA 3CQGB 3MA5A 4B93B 3ESLA 3PREA 2KCKA 4BESA 4FLHA 1XNFA 3UXGA 4OAUC 2GROB 1OWLA 4L9PA 3ZFWA 2DYRE 2VGEA 4M7CA 3FTYA 3Q75A 4A1SA 2C2LA 4ANWA 1G3NB 4X8QA 2IOLA 4KT6B 1L5JA 3L22A 2AXVA 1LD8A 2HM8A 5C2YA 3ZEFA 3TGOA 3FY4A 4FP7A 3LVQE 3TWWA 1IQUA 4K0RA 4I9EA 4Y6WA 5G05C 3JXIA 2L0IA 2CHZA 4PS7A 2WM9A 3ISMC 4F1SA 5C1DA 3EUVA 4KVOA 1K1BA 1H2UA 3BG0B 3PE4A 2VTBB 3LEWA 2WXQA 3DSUA 3GZSA 2ZXWE 5AIJA 3T5VA 5J90A 1SA4A 2FEZA 2IQCA 4J7WA 3PNLB 1N4SA 5ENTD 3LJ3A 5JMND 3B13A 3HXFA 3UM3A 4BETA 2IEJA 2BEDA 3LY7A 4N39A 1N94A 4LERA 3MKQA 1HF8A 5JHBA 1WY6A 3HYMB 5FQ6A 2BUGA 4U0UA 3I3NA 1YMPA 1DNPA 5LFAA 1ELWA 2F8YA 5FJYA 3ZKJA 3L13A 4L7TA 4Q96A 3DSSA 3TWXA 4KYOB 2WXPA 3FUIA 2DYSE 4DX6D 2GRMA 1TEZA 2J9QA 3X2QE 3HVEA 4K03A 5ARGA 1NFIE 1NA3A 2WQHA 3UI2A 3WG7E 3AU5A 4J8SA 4JEHA 1HE8A 2DWZA 2WXMA 4EHMA 4O6FA 5G55A 3CVUA 4CT4A 5M72A 1HFAA 3V2XA 2V5QC 3IEGA 3R7RA 1N0RA 3APDA 3CQCB 3LY9A 3ZYQA 3SQVA 4MBGA 5ENQD 4JA9A 1KT1A 5BPPA 3ZXPA 2LO6A 3T8MA 1HG2A 4BT9A 5FZQA 5KNGA 5JJ6A 2DCPA 3FTVA 4JL0A 3ASFA 4AVXA 4B8CB 4CGVA 1BI8B 1BU9A 4TXQA 3D9HA 2WXKA 5E76A 4U96D 4AM9A 1UG3A 4AXHA 2CHXA 4JW1A 1LD7A 4JPSA 3FULA 1QYMA 3PZ2A 4J6IA 1KLXA 2X3MA 3Q5MA 5ENRD 3FHEA 3TJPA 4GZ5A 3CGHA 4G8LA 4OAVB 2I2OA 4CRWA 5EN5D 3DSXA 3LDZA 1OUVA 5JHAA 4GTOA 2M63A 3LY8A 2MYOA 3CR3A 2R03A 1D9SA 5HKPA 1IXVA 4DX5D 5KJNA 3S7BA 3NZUA 3FUMA 4N3BA 1BI7B 3AG2E 1O1RA 1HH8A 3ZVVA 1IKND 4NRHB 5T8IA 1A5EA 4G24A 4L23A 3UT8A 3APCA 1PAQA 3R7QA 2RD0A 3CEQA 4G26A 3ZRHA 4WWOA 5KJMA 2XGMA 4AY6A 2B6CA 3VTYA 1X81A 5ENOD 3CHRA 4JA7A 1S0PA 1TJFA 2A5UA 2OVFA 4PS8A 2WPVA 3SZ7A 5LCWC 2J4DA 1NL4A 2QYUA 2ZISA 1HU3A 2PQRA 3JXJA 2Y4TA 3FP3A 3C5RA 2GW1A 3MKRA 3L08A 4E6HA 2ILRA 1DC2A 4FHKA 4MS6A 2ZU6B 4DLQA 4WNDA 2AJAA 3E4BA 4DI4A 4ANXA 2L0TB 4GZDA 3ZHEB 5DBKA 1H2VC 2X6IA 4GCNA 3L9TA 4EBAG 4OVUA 1H6KA 4FA6A 5KJLA 3PNTB 2V4HC 2UY1B 4MLPA 1GW6A 2YINA 2ZGDA 4BX8A 2LUHA 3PZ1A 1JWGA 4A3TA 2EILE 2FBNA 3UT4A 3CHMA 4O60A 4F6RD 3ZGQA 3UIOC 3CVQA 4ILGA 3Q47B 2C0LA 2R02A 5B1BE 3CK8A 2WVIA 2AXUA 3ASNE 5CRUA 3NOGD 1HX8A 5T3RA 4EECA 4K5BA 3IHVA 5EIDA 4GYOA 3SHFA 4LEUA 3DRAA 1YCSB 3B7RL 5CBOA 3OXFA 3EU5A 4U0ZA 1NI1A 4C0EA 1HG5A 3VLFA 2J08A 3ASGA 2F8XK 3TWQA 4NACA 5BV0A 3Q79A 3ONLA 2RKKA 3QWWA 2VGXB 4CT0A 3ULEG 4JVSA 2F37A 3FFLA 2WXGA 4CDNA 3WXXA 3QARA 3OAWA 5AENA 2LXMA 3QWPA 2RG8A 4HORA 1FPPA 3Q7FA 3D9JA 4BX9A 2KZTA 3P1UA 4E85A 2EIME 3RAUA 2HR2A 3QB2A 2VSNA 5FQ4A 1BD8A 3IBEA 3Q9UC 2LSUA 4GPKA 3C98A 4H7XA 3ONKA 3FU5A 3MEKA 1Z3YA 4TV3A 3LVRE 3ZU7B 3RIBA 3T5XA 2IJGX 3TL5A 3UTMA 2XEVA 5BV1A 1OT8A 2B0OE 3SY2A 3OXGA 2I1JA 3MCXA 4GTTA 4H7YA 3I5PA 3QJZA 2XS1A 3UM0A 4WWPA 3RRMB 4FJZA 4CDMA 2OEWA 4MRUA 3DPYA 4RQIA 2GRNB 2VGYA 4ZFHA 1JCRA 4Y6CA 1TNBA 4J8DA 5JA4D 1W3BA 4GTPA 5CEAA 3DXMG 4KZCA 3D9LA 2Y4UA 3KS2A 5ENSD 2XGOA 4GA0A 4WUYA 3DSWA 4XE0A 3FH8A 4HS2A 1SVXA 3QWVA 4JD2G 2X6KA 1RW2A 2KATA 2P2CP 4F7AA 1N4PA 2PM6A 2P58C 3EHRA 4GTSA 3ZYLA 2QY7A 3TWUA 2R2LA 2KM4A 2KC7A 1AWCB 2ZIRA 1RZ4A 4Q94A 5H7PA 3CHPA 4UQXA 2PL2A 4K5AB 4I43A 1IHBA 3C3RA 5EX0A 2LSVA 3BEEA 5A6CA 5EIBE 3NF1A 3U3WA 4J8FA 3I4RB 4TUUA 3UUXA 2WXRA 3CV0A 2L6BA 1N95A 2BKKB 5AN8A 5G05J 3L17A 2WMOA 4A1GA 4DLOA 2R5SA 4GCOA 1OCOE 5AQ7A 4B0ZA 5FQ8A 5KNHD 3L54A 4N5CA 2FO7A 1KPSB 1KZOA 1OCRE 2E2EA 3IKOB 4LNGA 3SF4A 3NBNB 2CG2A 2YHCA 4GYWA 1IHGA 2KXPC 1WG0A 4IRUA 4GZ6A 4RSYA 2NSZA 5HI7A 2XRZA 2WQ7A 2LAIA 1E7UA 5AAOA 2VSOE 2F0YA 1TNOA 4BFRA 1MYOA 3AAAC 4UI9J 4W9RA 4DX2A 1NA0A 3AS4A 3ZNGA 3Q49B 3NOCD 4CYMD 4BTBA 2IF4A 2BF0X 1WM5A 4LCTA 3HVEB 3CSTA 2XS8A 4I6GA 4HRNA 1FVFA 4BERA 1FT2A 3PRZA 4OYSA 4I2ZA 4PH4B 2R05A 1MQSA 3VLEA 4U63A 2L6JA 5KCMA 1H2TC 1ZBPA 3UQ3A 4J8EA 5FZRA 5BNWA 1X5BA 1TNYA 1XGWA 2AW6A 4ABNA 4CCAA 5B3SE 1KZPA 2I6HA 2P9KG 1Z3XA 5AJLA 4J8YA 3Q78A 3TWSA 4GB9A 2YNQA 1QQEA 5AARA 4HB5A 1U3DA 4U0SA 2J09A 5ENNA 4N3AA 5EX3A 3U4TA 3TAXA 4TUMA 4F53A 5J08A 4N2SA 2MOWA 3EIJA 5AQAA 3FUDA 3T9KA 3AG1E 4JHRA 3EJNA 4N5QA 4AJWA 2CG3A 3TG5A 5FQ7A 2V0PA 3TWTA 4NIKA 4CDRA 3FU3A 4YVOA 2OEVA 3C3QA 3B7TA 4CEMA 3BG1B 2FF4A 4JC8A 5ENPD 4HNAD 1OWMA 2AXZA 5G2NA 3IHYA 4YDYA 2J49A 4ACLA 1EYHA 2NC9A 2XPIA 4FJYA 5CMYA 4YDOA 3B7BA 4WAFA 4WWNA 4B8AA 3QKYA 3ZN3A 4UUCA 4HLEA 1V55E 1E7VA 4I9CA 1UW4B 4XI0A 2HO1A 3DPDA 1UN8A 4HI8A 3FUFA 3T8KA 4GZ3A 4XKBA 2KCLA 5CMWA 5A23A 4HXIA 5DIZA 1JUQA 3G2UA 2LXLA 1SA5A 3QOUA 1V54E 3FUHA 2P9SG 4APFA 4AY5A 2IU1A 3D9KA 1OCCE 1Z6TA 3CK7A 2J4BA 4F3VA 1E8ZA 1YYHA 4L2YA 3VTXA 3V31A 2NXPA 2A4ZA 4L2LA 3SI5A 2V5FA 3G2VA 3GZ1A 3O48A 1OXJA 2YQ8A 4UI9K 3QDNA 3C3OA 1MX2A 4J0UA 1UOHA 5A7DB 1LTXA 5ITZF 3PEUB 4GAAA 3CLJA 3ULYA 1ZU2A 4PS3A 2JLBA 3CVLA 3CSFA 3V79K 5JJTA 4FC8A 4HRLA 3GYZA 2WXFA 2WQ6A 2KBXA 3DEPA 1B89A 5CRVA 2XPZA 3PVLA 3L6AA 4C9BB 5G04C 3UIPC 5ANLA 2DZNA 3FTSA 3URZA 3APFA 2V8SE 4G1TA 2GRRB 2P9UG 1OWOA 4F1PA 1N0QA 3EIQC 4XX5A 1EF1C 5EILA 5FZSA 2IOSA 2XEEA 5FT9A 1MX4A 3SNXA 3CK9A 1D8DA 3QNKA 1N9AA 4HFGA 2BKGA 4G23A 2X6HA 3FUNA 3DEOA 1VDYA 4YVQC 1QNFA 5KJKA 5HRYA 2XRYA 4YDWA 2PM7A 3PEVB 2IONA 4URKA 1Y8MA 2X38A 4K5CA 3MV3B 2FI7A 3UKRG
chains in the Genus database with same CATH topology
1WDYA 5HKPA 1IXVA 4BERA 2ZGGA 4DX5D 1MJ0A 4HI9A 4DX1A 4F6RD 4QQIA 3AJIA 4QFVA 4BSZB 3J5QB 5ENPD 4HNAD 2DWZA 4K5AB 3ZU7B 1IHBA 2HE0A 1MX2A 3EU9A 2QC9A 5KBAA 1UOHA 2A5EA 5AQ9A 3TWWA 1BI7B 2XEHA 2DZOA 4HBDA 4YDYA 3UTMA 5ITZF 1IKND 1OT8A 2B0OE 3JXIA 4U8YD 2Y1LE 3W9FA 5EIBE 5BXUA 2FO1E 1A5EA 4DUIA 4U95D 5KWDA 2QYJA 3ZUVB 2XENA 5CECB 4U8VD 3B7BA 4ZHBA 2L6BA 3V2XA 5EYPF 2V5QC 1K1BA 2XZDG 3JUEA 3NOGD 3V79K 4HRLA 1K1AA 2BKKB 2RFMA 4K5BA 4JB8P 1N0RA 4UUCA 5ENOD 1OY3D 5AN8A 5EIDA 4Z68A 4BEPA 4LG6A 1K3ZD 2KBXA 1S70B 3DEPA 4DRXE 1YCSB 3EHQA 4ZFHA 5ENQD 3TWRA 5FIOA 5CBOA 2J8SD 3V2OA 5CEDB 4J7WA 5JA4D 4HQDA 5CEAA 4HI8A 4HRMB 2XZTG 3T8KA 3SO8A 5BXOA 4LNUD 3IXEA 5ENTD 5AQ7A 5KNHD 2NYJA 3V30A 4ATZD 3JXJA 5ENSD 5D66A 5JMND 5KNGA 2F8XK 4BETA 4J8YA 2DZNA 3C5RA 3TWSA 3TWQA 4CZ2D 5AARA 3NBNB 4HB5A 4O1OA 4GPMA 1DC2A 2Y0BG 1BI8B 2ETBA 1N0QA 4F1PA 1DCQA 1BU9A 3D9HA 4LSZE 2F37A 5FINA 1SVXA 2AJAA 1WG0A 2KXPC 4G8KA 1MX6A 5EILA 2DVWA 1SW6A 4U96D 3HG0D 1YMPA 3LJNA 4TUMA 4C48B 4B93B 2P2CP 4DX7D 2ETCA 5AAOA 2F8YA 2XEEA 1MX4A 2RFAA 4BESA 3ZKJA 3TWVA 5HS0A 1QYMA 3F6QA 4O1PA 3UXGA 4A63B 2JABA 1YYHA 1MYOA 5AQAA 3W9GA 4OAUC 3TWXA 1AP7A 3AAAC 2BKGA 1TR4A 3EHRA 4O60A 4GMRA 1N11A 3J5PA 3HRAA 3V31A 3T9KA 3B95A 2V4HC 4DX2A 2VGEA 5ENRD 4DX6D 3Q9NC 3DEOA 5EYLA 5AQBA 3TWUA 4N5QA 3ZNGA 5HRYA 4G8LA 3NOCD 4OAVB 4CYMD 4YDWA 2ZGDA 4RLYA 3TWTA 5EN5D 1G3NB 3KEAA 4NIKA 1NFIE 4K5CA 5CERB 1BD8A 2ETAA 1BLXB 3Q9UC 2MYOA 2PNNA 5CBNA 4HRNA 1AWCB 3UI2A 1D9SA 4HLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDY A;  5HKP A;  1IXV A;  4BER A;  2ZGG A;  4DX5 D;  1MJ0 A;  4HI9 A;  4DX1 A;  4F6R D;  4QQI A;  3AJI A;  4QFV A;  4BSZ B;  3J5Q B;  5ENP D;  4HNA D;  2DWZ A;  4K5A B;  3ZU7 B;  1IHB A;  2HE0 A;  1MX2 A;  3EU9 A;  2QC9 A;  5KBA A;  1UOH A;  2A5E A;  5AQ9 A;  3TWW A;  1BI7 B;  2XEH A;  2DZO A;  4HBD A;  4YDY A;  3UTM A;  5ITZ F;  1IKN D;  1OT8 A;  2B0O E;  3JXI A;  4U8Y D;  2Y1L E;  3W9F A;  5EIB E;  5BXU A;  2FO1 E;  1A5E A;  4DUI A;  4U95 D;  5KWD A;  2QYJ A;  3ZUV B;  2XEN A;  5CEC B;  4U8V D;  3B7B A;  4ZHB A;  2L6B A;  3V2X A;  5EYP F;  2V5Q C;  1K1B A;  2XZD G;  3JUE A;  3NOG D;  3V79 K;  4HRL A;  1K1A A;  2BKK B;  2RFM A;  4K5B A;  4JB8 P;  1N0R A;  4UUC A;  5ENO D;  1OY3 D;  5AN8 A;  5EID A;  4Z68 A;  4BEP A;  4LG6 A;  1K3Z D;  2KBX A;  1S70 B;  3DEP A;  4DRX E;  1YCS B;  3EHQ A;  4ZFH A;  5ENQ D;  3TWR A;  5FIO A;  5CBO A;  2J8S D;  3V2O A;  5CED B;  4J7W A;  5JA4 D;  4HQD A;  5CEA A;  4HI8 A;  4HRM B;  2XZT G;  3T8K A;  3SO8 A;  5BXO A;  4LNU D;  3IXE A;  5ENT D;  5AQ7 A;  5KNH D;  2NYJ A;  3V30 A;  4ATZ D;  3JXJ A;  5ENS D;  5D66 A;  5JMN D;  5KNG A;  2F8X K;  4BET A;  4J8Y A;  2DZN A;  3C5R A;  3TWS A;  3TWQ A;  4CZ2 D;  5AAR A;  3NBN B;  4HB5 A;  4O1O A;  4GPM A;  1DC2 A;  2Y0B G;  1BI8 B;  2ETB A;  1N0Q A;  4F1P A;  1DCQ A;  1BU9 A;  3D9H A;  4LSZ E;  2F37 A;  5FIN A;  1SVX A;  2AJA A;  1WG0 A;  2KXP C;  4G8K A;  1MX6 A;  5EIL A;  2DVW A;  1SW6 A;  4U96 D;  3HG0 D;  1YMP A;  3LJN A;  4TUM A;  4C48 B;  4B93 B;  2P2C P;  4DX7 D;  2ETC A;  5AAO A;  2F8Y A;  2XEE A;  1MX4 A;  2RFA A;  4BES A;  3ZKJ A;  3TWV A;  5HS0 A;  1QYM A;  3F6Q A;  4O1P A;  3UXG A;  4A63 B;  2JAB A;  1YYH A;  1MYO A;  5AQA A;  3W9G A;  4OAU C;  3TWX A;  1AP7 A;  3AAA C;  2BKG A;  1TR4 A;  3EHR A;  4O60 A;  4GMR A;  1N11 A;  3J5P A;  3HRA A;  3V31 A;  3T9K A;  3B95 A;  2V4H C;  4DX2 A;  2VGE A;  5ENR D;  4DX6 D;  3Q9N C;  3DEO A;  5EYL A;  5AQB A;  3TWU A;  4N5Q A;  3ZNG A;  5HRY A;  4G8L A;  3NOC D;  4OAV B;  4CYM D;  4YDW A;  2ZGD A;  4RLY A;  3TWT A;  5EN5 D;  1G3N B;  3KEA A;  4NIK A;  1NFI E;  4K5C A;  5CER B;  1BD8 A;  2ETA A;  1BLX B;  3Q9U C;  2MYO A;  2PNN A;  5CBN A;  4HRN A;  1AWC B;  3UI2 A;  1D9S A;  4HLL A; 
#chains in the Genus database with same CATH topology
 3S7J A;  1UN9 A;  2ZGG A;  3SFX A;  4DX1 A;  2OCC E;  3LXU X;  3AJI A;  4BSZ B;  1E90 A;  3EU9 A;  3B7U X;  3AS5 A;  3JQ0 A;  3ENE A;  4UWL A;  3L82 A;  1FCH A;  1E96 B;  4I6E A;  4JZY A;  2Y1L E;  5BXU A;  2EIK E;  1P5Q A;  2V4L A;  4RG6 A;  4KZ0 A;  3FUJ A;  1PY1 A;  2GGF A;  4TXP A;  2XZD G;  2MHK A;  4D10 C;  3ABK E;  2CHW A;  3UPV A;  4XEI G;  2WXI A;  3UKU G;  1N4Q A;  2OOE A;  4I1A A;  4GU5 A;  4HOU A;  4BTA A;  3EHQ A;  3AG4 E;  1SZA A;  4HRM B;  2QZA A;  3FUE A;  4PUC A;  5D0Q D;  5B1A E;  4CGW A;  1O1T A;  4AEZ C;  4GA2 A;  3Q4A B;  2DBA A;  4GPM A;  1E8X A;  3C72 A;  3Q73 A;  1DCQ A;  5FIN A;  3L16 A;  3S2A A;  1YA0 A;  2P9P G;  3LJN A;  3LPZ A;  4AP2 A;  4I1M A;  3MZL B;  4O1P A;  3FEY A;  4ILI A;  3CVX A;  2IO3 C;  4GMR A;  2AWI A;  5AQB A;  3RJV A;  4IN3 B;  5FWQ A;  3U66 A;  3CVV A;  2PQN A;  1OWN A;  1ZB1 A;  3KSQ A;  3U9W A;  2ETA A;  2Y3A A;  5ARF A;  1HS6 A;  1WDY A;  3FU0 A;  3FU6 A;  2H6I A;  2EIN E;  4FHJ A;  2UWJ G;  4XKC A;  2UY1 A;  4BT8 A;  3HXD A;  4FLB A;  3SBS A;  4RG9 A;  5EDS A;  3CHS A;  4M3O A;  5CEC B;  3KEZ A;  3RSE G;  1OWP A;  4HVB A;  2WXJ A;  4JXT A;  3MJW A;  4LG6 A;  2OND A;  1JCS A;  2XGS A;  5FIO A;  3HHM A;  2LAH A;  3ASD A;  5D66 A;  3NZS A;  2P9L G;  3D9N A;  2R17 C;  5E75 A;  1A17 A;  2VTB A;  5AYW D;  4BWR A;  5D0O D;  3U64 A;  3HXB A;  4BSX A;  1MX6 A;  4EZJ A;  5LOZ A;  2GRL A;  1U2V G;  4C48 B;  1DCE A;  5HS0 A;  3MV2 B;  3RO3 A;  1E8Y A;  2JAB A;  2BTD A;  1Y6I A;  1TR4 A;  4FU3 A;  3B95 A;  3ULQ A;  1TNZ A;  4PDX A;  3I4G A;  1JWF A;  1ELK A;  3FWV A;  4Q69 A;  5HQ8 A;  3KEA A;  4GTR A;  2WXO A;  1BLX B;  2EIJ E;  2PNN A;  3PS6 A;  5ANR A;  1H6O A;  3E33 A;  4DI3 A;  3K9I A;  3UIN C;  3LKU A;  4P29 A;  3EDT B;  4UI9 C;  3PZD A;  3FTU A;  2E0I A;  5D2M C;  2DIW A;  4U04 A;  2DZO A;  4ME2 A;  3D9P A;  4JHK A;  5KWD A;  4EBA A;  3Q7A A;  4KMO A;  3RO2 A;  4ZHB A;  3CVY A;  2VGX A;  3RRN B;  4APO A;  1K1A A;  2X6F A;  1SZ9 A;  1JCQ A;  3FTX A;  4NQ0 A;  5JJ7 A;  4Z68 A;  4UWH A;  4BEP A;  3FEX A;  1K3Z D;  1D8E A;  1NP7 A;  2JEK A;  3V2O A;  3PUJ A;  1N52 A;  3SO8 A;  3KAE A;  1LF8 A;  3EHM A;  3JCK C;  4U07 A;  3D9M A;  2LNI A;  4WNG A;  1FT1 A;  2IFU A;  3RK6 A;  3TXM A;  2P9N G;  3ABL E;  2VSY A;  2VJ8 A;  1EPU A;  3GZ2 A;  3TWV A;  3ASH A;  4EZK A;  3DSV A;  3W9G A;  4GA1 A;  2H6H A;  3J5P A;  1E8W A;  3ZPJ A;  4G2V A;  3Q9N C;  5EYL A;  2X6J A;  3MYV A;  4YDE A;  1Z5S C;  5BW8 C;  2WMN A;  4G25 A;  4WNF A;  3ML9 A;  1UJJ A;  3TG4 A;  4HI9 A;  1QZ2 A;  4QFV A;  5BT1 A;  3ZXS A;  3DBS A;  1HO8 A;  2IO2 C;  3G2W A;  3SD5 A;  3UX4 A;  4U8Y D;  3AU4 A;  4B94 A;  2H6G A;  4UWF A;  4EPZ A;  2KZT B;  3CKC A;  3PH0 C;  2OV8 A;  2GRQ B;  4V3I A;  1H0A A;  3AS8 A;  3CKB A;  3HDX A;  1OY3 D;  3UT7 A;  3R9A B;  4OVV A;  2HYZ A;  1INZ A;  1S70 B;  3SFZ A;  4TXR A;  2J8S D;  4GTM A;  4AIF A;  4HQD A;  5T4Y A;  3CHQ A;  4LRZ A;  4A55 A;  2XZT G;  3E37 A;  1WAO 1;  2EQX A;  1N4R A;  4XZ4 A;  2NYJ A;  5G04 J;  3VLD A;  2Q7F A;  4I1O B;  1S64 A;  2VSX E;  3O4Z A;  2VQ2 A;  4O1O A;  3JQ1 A;  5LCW J;  2ETB A;  5EKQ D;  4G8K A;  3SBT B;  3B7S A;  3UMV A;  2DVW A;  1SW6 A;  1TN7 A;  4RVB A;  2AVP A;  3FTW A;  3BU8 A;  3PUK A;  3F6Q A;  3NB2 A;  3DST A;  3PDN A;  3FTZ A;  4I17 A;  5LP0 A;  3ZIM A;  4I6J A;  1NZN A;  1N54 A;  3FDH A;  3S7D A;  1ELR A;  2L9B A;  4ILH B;  1MHQ A;  3SGH A;  4GTV A;  3JYS A;  4KXK B;  4GTQ A;  4AOF A;  3J5Q B;  2HE0 A;  1MZC A;  5AQ9 A;  1O5M A;  4XIF A;  4DPR A;  4DUI A;  4U95 D;  3TXN A;  2J07 A;  4TRQ A;  3DWL G;  3R9M A;  3AG3 E;  3JUE A;  4JB8 P;  3CVN A;  3HXE A;  2PZI A;  3KSL A;  3ZHE A;  3DXK G;  3P2B A;  4FAD A;  1BPO A;  1HXI A;  3CIA A;  4U7E B;  3TWR A;  3ML8 A;  4FUL A;  3LCA A;  5BXO A;  4LUN U;  3IXE A;  5CHE E;  3JUI A;  3ZYM A;  1H19 A;  4ANU A;  3Q15 A;  5CCM A;  2I9C A;  3CVW A;  4YND A;  3CHO A;  5FTP A;  3NAW A;  1DVP A;  2Y69 E;  4EZL A;  2VYI A;  1KT0 A;  3LYA A;  1Q2Z A;  4DX7 D;  2ETC A;  2XCB A;  3OXL A;  3HXC A;  1TJC A;  4A63 B;  1JPL A;  4N2Q A;  4KVM A;  3HRA A;  2WB2 A;  3MX3 A;  2MRI A;  2CFU A;  3G2T A;  2XQ0 A;  4BY6 A;  3MKQ B;  3PZ4 A;  1TNU A;  4I2W A;  3FH5 A;  2FUL A;  3D9I A;  1IQR A;  4LNB A;  1MJ0 A;  4QQI A;  2WXL A;  3D9O A;  4GML A;  2A5E A;  3G2S A;  2XEH A;  4HBD A;  3N71 A;  3NQP A;  1O1S A;  4G11 A;  5BUZ A;  4EQF A;  3W9F A;  2XHE A;  3QK0 A;  3ABM E;  2FO1 E;  2QYJ A;  3ZUV B;  5LX8 A;  4HOS A;  4N3C A;  5EYP F;  4L1B A;  3EHN A;  1H6P A;  2XCC A;  4B89 A;  3LS8 A;  3KD7 A;  4U8H A;  3QAQ A;  5IY5 E;  1TN6 A;  3IV0 A;  4DRX E;  3OTN A;  2OVB A;  3ESK A;  2P9I G;  4JEU A;  4LNU D;  4ATZ D;  3V30 A;  5AJD A;  3FH7 A;  4NUR A;  1U3C A;  1S63 A;  4CZ2 D;  4JHJ A;  3E34 A;  1HZ4 A;  3PZ3 A;  4UWK A;  2Y0B G;  2CFZ A;  1TYQ G;  3HIZ A;  1K8K G;  4UWG A;  1EDU A;  3HG0 D;  3BQO A;  2RFA A;  4ANV A;  1SQM A;  4UQZ A;  1AP7 A;  2KCV A;  3ASO E;  1N11 A;  4WNE A;  1QBQ A;  4IYP A;  3SFY A;  2R59 A;  4RLY A;  4MKT A;  5CER B;  1PC2 A;  2IY0 C;  4GZC A;  5CBN A;  4HOT A;  2WXN A;  2I1K A;  4HLL A;  3MGB A;  3RKV A;  4ATG A;  3QC1 A;  2QC9 A;  5KBA A;  1TN8 A;  3FUK A;  3PE3 A;  4DJA A;  2WXH A;  1OCZ E;  4IUL A;  1IYG A;  1FVH A;  3E30 A;  4XI9 A;  3ZYK A;  4C0M A;  2XEN A;  4U8V D;  3UM2 A;  3D3M A;  2RFM A;  4KBQ A;  4GYY A;  4GMJ A;  3UM1 A;  3S7F A;  4DK5 A;  2XPY A;  2H6F A;  3RU0 A;  2GRP B;  4ACK A;  2YHE A;  1UJK A;  4R7L A;  5CED B;  2C0M A;  3E32 A;  3CVP A;  3RRU A;  4HOQ A;  4A3V A;  5CCL A;  2QFC A;  4AV7 A;  3GW4 A;  4LSZ E;  3BUA A;  3ZW3 A;  4UQY A;  3CQG B;  3MA5 A;  4B93 B;  3ESL A;  3PRE A;  2KCK A;  4BES A;  4FLH A;  1XNF A;  3UXG A;  4OAU C;  2GRO B;  1OWL A;  4L9P A;  3ZFW A;  2DYR E;  2VGE A;  4M7C A;  3FTY A;  3Q75 A;  4A1S A;  2C2L A;  4ANW A;  1G3N B;  4X8Q A;  2IOL A;  4KT6 B;  1L5J A;  3L22 A;  2AXV A;  1LD8 A;  2HM8 A;  5C2Y A;  3ZEF A;  3TGO A;  3FY4 A;  4FP7 A;  3LVQ E;  3TWW A;  1IQU A;  4K0R A;  4I9E A;  4Y6W A;  5G05 C;  3JXI A;  2L0I A;  2CHZ A;  4PS7 A;  2WM9 A;  3ISM C;  4F1S A;  5C1D A;  3EUV A;  4KVO A;  1K1B A;  1H2U A;  3BG0 B;  3PE4 A;  2VTB B;  3LEW A;  2WXQ A;  3DSU A;  3GZS A;  2ZXW E;  5AIJ A;  3T5V A;  5J90 A;  1SA4 A;  2FEZ A;  2IQC A;  4J7W A;  3PNL B;  1N4S A;  5ENT D;  3LJ3 A;  5JMN D;  3B13 A;  3HXF A;  3UM3 A;  4BET A;  2IEJ A;  2BED A;  3LY7 A;  4N39 A;  1N94 A;  4LER A;  3MKQ A;  1HF8 A;  5JHB A;  1WY6 A;  3HYM B;  5FQ6 A;  2BUG A;  4U0U A;  3I3N A;  1YMP A;  1DNP A;  5LFA A;  1ELW A;  2F8Y A;  5FJY A;  3ZKJ A;  3L13 A;  4L7T A;  4Q96 A;  3DSS A;  3TWX A;  4KYO B;  2WXP A;  3FUI A;  2DYS E;  4DX6 D;  2GRM A;  1TEZ A;  2J9Q A;  3X2Q E;  3HVE A;  4K03 A;  5ARG A;  1NFI E;  1NA3 A;  2WQH A;  3UI2 A;  3WG7 E;  3AU5 A;  4J8S A;  4JEH A;  1HE8 A;  2DWZ A;  2WXM A;  4EHM A;  4O6F A;  5G55 A;  3CVU A;  4CT4 A;  5M72 A;  1HFA A;  3V2X A;  2V5Q C;  3IEG A;  3R7R A;  1N0R A;  3APD A;  3CQC B;  3LY9 A;  3ZYQ A;  3SQV A;  4MBG A;  5ENQ D;  4JA9 A;  1KT1 A;  5BPP A;  3ZXP A;  2LO6 A;  3T8M A;  1HG2 A;  4BT9 A;  5FZQ A;  5KNG A;  5JJ6 A;  2DCP A;  3FTV A;  4JL0 A;  3ASF A;  4AVX A;  4B8C B;  4CGV A;  1BI8 B;  1BU9 A;  4TXQ A;  3D9H A;  2WXK A;  5E76 A;  4U96 D;  4AM9 A;  1UG3 A;  4AXH A;  2CHX A;  4JW1 A;  1LD7 A;  4JPS A;  3FUL A;  1QYM A;  3PZ2 A;  4J6I A;  1KLX A;  2X3M A;  3Q5M A;  5ENR D;  3FHE A;  3TJP A;  4GZ5 A;  3CGH A;  4G8L A;  4OAV B;  2I2O A;  4CRW A;  5EN5 D;  3DSX A;  3LDZ A;  1OUV A;  5JHA A;  4GTO A;  2M63 A;  3LY8 A;  2MYO A;  3CR3 A;  2R03 A;  1D9S A;  5HKP A;  1IXV A;  4DX5 D;  5KJN A;  3S7B A;  3NZU A;  3FUM A;  4N3B A;  1BI7 B;  3AG2 E;  1O1R A;  1HH8 A;  3ZVV A;  1IKN D;  4NRH B;  5T8I A;  1A5E A;  4G24 A;  4L23 A;  3UT8 A;  3APC A;  1PAQ A;  3R7Q A;  2RD0 A;  3CEQ A;  4G26 A;  3ZRH A;  4WWO A;  5KJM A;  2XGM A;  4AY6 A;  2B6C A;  3VTY A;  1X81 A;  5ENO D;  3CHR A;  4JA7 A;  1S0P A;  1TJF A;  2A5U A;  2OVF A;  4PS8 A;  2WPV A;  3SZ7 A;  5LCW C;  2J4D A;  1NL4 A;  2QYU A;  2ZIS A;  1HU3 A;  2PQR A;  3JXJ A;  2Y4T A;  3FP3 A;  3C5R A;  2GW1 A;  3MKR A;  3L08 A;  4E6H A;  2ILR A;  1DC2 A;  4FHK A;  4MS6 A;  2ZU6 B;  4DLQ A;  4WND A;  2AJA A;  3E4B A;  4DI4 A;  4ANX A;  2L0T B;  4GZD A;  3ZHE B;  5DBK A;  1H2V C;  2X6I A;  4GCN A;  3L9T A;  4EBA G;  4OVU A;  1H6K A;  4FA6 A;  5KJL A;  3PNT B;  2V4H C;  2UY1 B;  4MLP A;  1GW6 A;  2YIN A;  2ZGD A;  4BX8 A;  2LUH A;  3PZ1 A;  1JWG A;  4A3T A;  2EIL E;  2FBN A;  3UT4 A;  3CHM A;  4O60 A;  4F6R D;  3ZGQ A;  3UIO C;  3CVQ A;  4ILG A;  3Q47 B;  2C0L A;  2R02 A;  5B1B E;  3CK8 A;  2WVI A;  2AXU A;  3ASN E;  5CRU A;  3NOG D;  1HX8 A;  5T3R A;  4EEC A;  4K5B A;  3IHV A;  5EID A;  4GYO A;  3SHF A;  4LEU A;  3DRA A;  1YCS B;  3B7R L;  5CBO A;  3OXF A;  3EU5 A;  4U0Z A;  1NI1 A;  4C0E A;  1HG5 A;  3VLF A;  2J08 A;  3ASG A;  2F8X K;  3TWQ A;  4NAC A;  5BV0 A;  3Q79 A;  3ONL A;  2RKK A;  3QWW A;  2VGX B;  4CT0 A;  3ULE G;  4JVS A;  2F37 A;  3FFL A;  2WXG A;  4CDN A;  3WXX A;  3QAR A;  3OAW A;  5AEN A;  2LXM A;  3QWP A;  2RG8 A;  4HOR A;  1FPP A;  3Q7F A;  3D9J A;  4BX9 A;  2KZT A;  3P1U A;  4E85 A;  2EIM E;  3RAU A;  2HR2 A;  3QB2 A;  2VSN A;  5FQ4 A;  1BD8 A;  3IBE A;  3Q9U C;  2LSU A;  4GPK A;  3C98 A;  4H7X A;  3ONK A;  3FU5 A;  3MEK A;  1Z3Y A;  4TV3 A;  3LVR E;  3ZU7 B;  3RIB A;  3T5X A;  2IJG X;  3TL5 A;  3UTM A;  2XEV A;  5BV1 A;  1OT8 A;  2B0O E;  3SY2 A;  3OXG A;  2I1J A;  3MCX A;  4GTT A;  4H7Y A;  3I5P A;  3QJZ A;  2XS1 A;  3UM0 A;  4WWP A;  3RRM B;  4FJZ A;  4CDM A;  2OEW A;  4MRU A;  3DPY A;  4RQI A;  2GRN B;  2VGY A;  4ZFH A;  1JCR A;  4Y6C A;  1TNB A;  4J8D A;  5JA4 D;  1W3B A;  4GTP A;  5CEA A;  3DXM G;  4KZC A;  3D9L A;  2Y4U A;  3KS2 A;  5ENS D;  2XGO A;  4GA0 A;  4WUY A;  3DSW A;  4XE0 A;  3FH8 A;  4HS2 A;  1SVX A;  3QWV A;  4JD2 G;  2X6K A;  1RW2 A;  2KAT A;  2P2C P;  4F7A A;  1N4P A;  2PM6 A;  2P58 C;  3EHR A;  4GTS A;  3ZYL A;  2QY7 A;  3TWU A;  2R2L A;  2KM4 A;  2KC7 A;  1AWC B;  2ZIR A;  1RZ4 A;  4Q94 A;  5H7P A;  3CHP A;  4UQX A;  2PL2 A;  4K5A B;  4I43 A;  1IHB A;  3C3R A;  5EX0 A;  2LSV A;  3BEE A;  5A6C A;  5EIB E;  3NF1 A;  3U3W A;  4J8F A;  3I4R B;  4TUU A;  3UUX A;  2WXR A;  3CV0 A;  2L6B A;  1N95 A;  2BKK B;  5AN8 A;  5G05 J;  3L17 A;  2WMO A;  4A1G A;  4DLO A;  2R5S A;  4GCO A;  1OCO E;  5AQ7 A;  4B0Z A;  5FQ8 A;  5KNH D;  3L54 A;  4N5C A;  2FO7 A;  1KPS B;  1KZO A;  1OCR E;  2E2E A;  3IKO B;  4LNG A;  3SF4 A;  3NBN B;  2CG2 A;  2YHC A;  4GYW A;  1IHG A;  2KXP C;  1WG0 A;  4IRU A;  4GZ6 A;  4RSY A;  2NSZ A;  5HI7 A;  2XRZ A;  2WQ7 A;  2LAI A;  1E7U A;  5AAO A;  2VSO E;  2F0Y A;  1TNO A;  4BFR A;  1MYO A;  3AAA C;  4UI9 J;  4W9R A;  4DX2 A;  1NA0 A;  3AS4 A;  3ZNG A;  3Q49 B;  3NOC D;  4CYM D;  4BTB A;  2IF4 A;  2BF0 X;  1WM5 A;  4LCT A;  3HVE B;  3CST A;  2XS8 A;  4I6G A;  4HRN A;  1FVF A;  4BER A;  1FT2 A;  3PRZ A;  4OYS A;  4I2Z A;  4PH4 B;  2R05 A;  1MQS A;  3VLE A;  4U63 A;  2L6J A;  5KCM A;  1H2T C;  1ZBP A;  3UQ3 A;  4J8E A;  5FZR A;  5BNW A;  1X5B A;  1TNY A;  1XGW A;  2AW6 A;  4ABN A;  4CCA A;  5B3S E;  1KZP A;  2I6H A;  2P9K G;  1Z3X A;  5AJL A;  4J8Y A;  3Q78 A;  3TWS A;  4GB9 A;  2YNQ A;  1QQE A;  5AAR A;  4HB5 A;  1U3D A;  4U0S A;  2J09 A;  5ENN A;  4N3A A;  5EX3 A;  3U4T A;  3TAX A;  4TUM A;  4F53 A;  5J08 A;  4N2S A;  2MOW A;  3EIJ A;  5AQA A;  3FUD A;  3T9K A;  3AG1 E;  4JHR A;  3EJN A;  4N5Q A;  4AJW A;  2CG3 A;  3TG5 A;  5FQ7 A;  2V0P A;  3TWT A;  4NIK A;  4CDR A;  3FU3 A;  4YVO A;  2OEV A;  3C3Q A;  3B7T A;  4CEM A;  3BG1 B;  2FF4 A;  4JC8 A;  5ENP D;  4HNA D;  1OWM A;  2AXZ A;  5G2N A;  3IHY A;  4YDY A;  2J49 A;  4ACL A;  1EYH A;  2NC9 A;  2XPI A;  4FJY A;  5CMY A;  4YDO A;  3B7B A;  4WAF A;  4WWN A;  4B8A A;  3QKY A;  3ZN3 A;  4UUC A;  4HLE A;  1V55 E;  1E7V A;  4I9C A;  1UW4 B;  4XI0 A;  2HO1 A;  3DPD A;  1UN8 A;  4HI8 A;  3FUF A;  3T8K A;  4GZ3 A;  4XKB A;  2KCL A;  5CMW A;  5A23 A;  4HXI A;  5DIZ A;  1JUQ A;  3G2U A;  2LXL A;  1SA5 A;  3QOU A;  1V54 E;  3FUH A;  2P9S G;  4APF A;  4AY5 A;  2IU1 A;  3D9K A;  1OCC E;  1Z6T A;  3CK7 A;  2J4B A;  4F3V A;  1E8Z A;  1YYH A;  4L2Y A;  3VTX A;  3V31 A;  2NXP A;  2A4Z A;  4L2L A;  3SI5 A;  2V5F A;  3G2V A;  3GZ1 A;  3O48 A;  1OXJ A;  2YQ8 A;  4UI9 K;  3QDN A;  3C3O A;  1MX2 A;  4J0U A;  1UOH A;  5A7D B;  1LTX A;  5ITZ F;  3PEU B;  4GAA A;  3CLJ A;  3ULY A;  1ZU2 A;  4PS3 A;  2JLB A;  3CVL A;  3CSF A;  3V79 K;  5JJT A;  4FC8 A;  4HRL A;  3GYZ A;  2WXF A;  2WQ6 A;  2KBX A;  3DEP A;  1B89 A;  5CRV A;  2XPZ A;  3PVL A;  3L6A A;  4C9B B;  5G04 C;  3UIP C;  5ANL A;  2DZN A;  3FTS A;  3URZ A;  3APF A;  2V8S E;  4G1T A;  2GRR B;  2P9U G;  1OWO A;  4F1P A;  1N0Q A;  3EIQ C;  4XX5 A;  1EF1 C;  5EIL A;  5FZS A;  2IOS A;  2XEE A;  5FT9 A;  1MX4 A;  3SNX A;  3CK9 A;  1D8D A;  3QNK A;  1N9A A;  4HFG A;  2BKG A;  4G23 A;  2X6H A;  3FUN A;  3DEO A;  1VDY A;  4YVQ C;  1QNF A;  5KJK A;  5HRY A;  2XRY A;  4YDW A;  2PM7 A;  3PEV B;  2ION A;  4URK A;  1Y8M A;  2X38 A;  4K5C A;  3MV3 B;  2FI7 A;  3UKR G; 
#chains in the Genus database with same CATH homology
 1WDY A;  5HKP A;  1IXV A;  4BER A;  2ZGG A;  4DX5 D;  1MJ0 A;  4HI9 A;  4DX1 A;  4F6R D;  4QQI A;  3AJI A;  4QFV A;  4BSZ B;  3J5Q B;  5ENP D;  4HNA D;  2DWZ A;  4K5A B;  3ZU7 B;  1IHB A;  2HE0 A;  1MX2 A;  3EU9 A;  2QC9 A;  5KBA A;  1UOH A;  2A5E A;  5AQ9 A;  3TWW A;  1BI7 B;  2XEH A;  2DZO A;  4HBD A;  4YDY A;  3UTM A;  5ITZ F;  1IKN D;  1OT8 A;  2B0O E;  3JXI A;  4U8Y D;  2Y1L E;  3W9F A;  5EIB E;  5BXU A;  2FO1 E;  1A5E A;  4DUI A;  4U95 D;  5KWD A;  2QYJ A;  3ZUV B;  2XEN A;  5CEC B;  4U8V D;  3B7B A;  4ZHB A;  2L6B A;  3V2X A;  5EYP F;  2V5Q C;  1K1B A;  2XZD G;  3JUE A;  3NOG D;  3V79 K;  4HRL A;  1K1A A;  2BKK B;  2RFM A;  4K5B A;  4JB8 P;  1N0R A;  4UUC A;  5ENO D;  1OY3 D;  5AN8 A;  5EID A;  4Z68 A;  4BEP A;  4LG6 A;  1K3Z D;  2KBX A;  1S70 B;  3DEP A;  4DRX E;  1YCS B;  3EHQ A;  4ZFH A;  5ENQ D;  3TWR A;  5FIO A;  5CBO A;  2J8S D;  3V2O A;  5CED B;  4J7W A;  5JA4 D;  4HQD A;  5CEA A;  4HI8 A;  4HRM B;  2XZT G;  3T8K A;  3SO8 A;  5BXO A;  4LNU D;  3IXE A;  5ENT D;  5AQ7 A;  5KNH D;  2NYJ A;  3V30 A;  4ATZ D;  3JXJ A;  5ENS D;  5D66 A;  5JMN D;  5KNG A;  2F8X K;  4BET A;  4J8Y A;  2DZN A;  3C5R A;  3TWS A;  3TWQ A;  4CZ2 D;  5AAR A;  3NBN B;  4HB5 A;  4O1O A;  4GPM A;  1DC2 A;  2Y0B G;  1BI8 B;  2ETB A;  1N0Q A;  4F1P A;  1DCQ A;  1BU9 A;  3D9H A;  4LSZ E;  2F37 A;  5FIN A;  1SVX A;  2AJA A;  1WG0 A;  2KXP C;  4G8K A;  1MX6 A;  5EIL A;  2DVW A;  1SW6 A;  4U96 D;  3HG0 D;  1YMP A;  3LJN A;  4TUM A;  4C48 B;  4B93 B;  2P2C P;  4DX7 D;  2ETC A;  5AAO A;  2F8Y A;  2XEE A;  1MX4 A;  2RFA A;  4BES A;  3ZKJ A;  3TWV A;  5HS0 A;  1QYM A;  3F6Q A;  4O1P A;  3UXG A;  4A63 B;  2JAB A;  1YYH A;  1MYO A;  5AQA A;  3W9G A;  4OAU C;  3TWX A;  1AP7 A;  3AAA C;  2BKG A;  1TR4 A;  3EHR A;  4O60 A;  4GMR A;  1N11 A;  3J5P A;  3HRA A;  3V31 A;  3T9K A;  3B95 A;  2V4H C;  4DX2 A;  2VGE A;  5ENR D;  4DX6 D;  3Q9N C;  3DEO A;  5EYL A;  5AQB A;  3TWU A;  4N5Q A;  3ZNG A;  5HRY A;  4G8L A;  3NOC D;  4OAV B;  4CYM D;  4YDW A;  2ZGD A;  4RLY A;  3TWT A;  5EN5 D;  1G3N B;  3KEA A;  4NIK A;  1NFI E;  4K5C A;  5CER B;  1BD8 A;  2ETA A;  1BLX B;  3Q9U C;  2MYO A;  2PNN A;  5CBN A;  4HRN A;  1AWC B;  3UI2 A;  1D9S A;  4HLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...