5CEDB

Penicillin g acylated bd3459 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
194
structure length
194
Chain Sequence
GKSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus hd100
molecule tags Hydrolase
total genus 67
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cedB00
5AQ9A 2AJAA 4GPMA 2RFAA 3HG0D 2NYJA 3NOCD 2JABA 5CECB 2PNNA 1MJ0A 1MX4A 5FIOA 2F8XK 5KNHD 5CEAA 4DX2A 2ETCA 1IHBA 4DUIA 4OAVB 4GMRA 4J7WA 2XZTG 4YDYA 3EHQA 4G8LA 3TWTA 3SO8A 5CBNA 4HB5A 3TWUA 1DC2A 2Y1LE 1WDYA 2F8YA 3Q9NC 4JB8P 3Q9UC 4DX7D 2P2CP 5ENOD 4LNUD 4N5QA 2XENA 3JXJA 4CZ2D 3HRAA 3JXIA 1MX2A 4K5BA 3EHRA 5CBOA 1OT8A 5AN8A 5KNGA 5HRYA 3TWVA 2FO1E 3JUEA 1BU9A 1BI7B 4U8VD 2VGEA 4HRLA 5ENPD 3ZNGA 2QYJA 4HQDA 1BI8B 1UOHA 3TWSA 2MYOA 5EIBE 1N0QA 4A63B 4BEPA 3TWXA 5CERB 5KBAA 3UXGA 4K5CA 5ENQD 5ENSD 2HE0A 3AAAC 5ITZF 1K1BA 3IXEA 4U95D 4BESA 2KXPC 2XEEA 1IXVA 4QFVA 2J8SD 1N11A 1DCQA 3KEAA 5EN5D 3T9KA 2Y0BG 1SW6A 4TUMA 2DWZA 3B7BA 5CEDB 4HI9A 4HRNA 1S70B 2A5EA 3W9FA 4ZFHA 3TWQA 5HS0A 4F6RD 4HRMB 3ZUVB 4OAUC 1N0RA 2RFMA 3C5RA 3F6QA 3LJNA 1BLXB 4O60A 4DX6D 1BD8A 4K5AB 1YMPA 4O1PA 3ZKJA 5AAOA 4QQIA 4C48B 4G8KA 2ETBA 4O1OA 2ZGGA 5D66A 4DX1A 2B0OE 2DVWA 4HBDA 4U8YD 5EIDA 5AQ7A 5HKPA 2BKGA 3TWWA 5FINA 1D9SA 3TWRA 4BSZB 4HI8A 4NIKA 1QYMA 2V4HC 3D9HA 5EYLA 1MX6A 2DZNA 1G3NB 4YDWA 1YCSB 2XZDG 4U96D 3V30A 4UUCA 4CYMD 1YYHA 3DEOA 4DRXE 3NBNB 3EU9A 4RLYA 3T8KA 3NOGD 3W9GA 4HNAD 3V79K 5AARA 2BKKB 1TR4A 2XEHA 3ZU7B 4B93B 4F1PA 5ENRD 1K1AA 4Z68A 3B95A 2DZOA 5BXOA 2ETAA 2V5QC 4J8YA 5BXUA 3J5PA 3UI2A 4BERA 4DX5D 3AJIA 2KBXA 3J5QB 4ZHBA 2F37A 3V2OA 2QC9A 4HLLA 3V31A 5AQAA 5ENTD 2ZGDA 3UTMA 4LSZE 3DEPA 5EYPF 1K3ZD 4ATZD 5JA4D 5EILA 1IKND 1AWCB 1WG0A 1A5EA 5KWDA 1AP7A 5AQBA 2L6BA 1OY3D 5JMND 4BETA 3V2XA 4LG6A 1MYOA 1NFIE 1SVXA
chains in the Genus database with same CATH superfamily
2AJAA 3T8MA 5E76A 1D8EA 2JABA 3CV0A 2FULA 3EHQA 2J09A 5B3SE 3UIOC 2Y1LE 3ZGQA 3C3OA 2P2CP 2XENA 3DPDA 3FUHA 3NZUA 4CDNA 4JHJA 4K5BA 3EHRA 2J08A 2DBAA 4L9PA 2AWIA 3CK9A 1L5JA 4B0ZA 3PS6A 5ANRA 1UOHA 1HG5A 4U0SA 5CERB 5KCMA 2I9CA 1FVFA 4H7XA 1FVHA 1NI1A 4U95D 3AG1E 3DBSA 3NAWA 2UY1A 3D3MA 3U4TA 3ENEA 3P2BA 2PM7A 1SZ9A 4IULA 1E8XA 1KLXA 4KMOA 2XRZA 2ZU6B 5A7DB 3PUKA 3LEWA 3PUJA 4N3CA 2GRRB 3QK0A 3TGOA 4HBDA 4U8YD 2I1JA 4GAAA 4BSZB 3L16A 2V4HC 2I1KA 3SZ7A 2J07A 3D9JA 4UUCA 5HQ8A 4GTRA 3QAQA 2P9KG 3ZYKA 2WPVA 4GA0A 3V79K 1SZAA 3CVWA 5BXOA 4F1SA 4ANXA 4DX5D 4O6FA 2WQ7A 2QC9A 3VLEA 3FHEA 3OAWA 2R03A 3FFLA 2KCLA 4TUUA 4KYOB 5IY5E 3DXKG 4LSZE 4DK5A 3IKOB 3EUVA 3ASFA 4DLOA 1IHGA 3QWPA 2P9NG 3MZLB 4A3TA 1IHBA 3CQGB 4DUIA 5LOZA 3ABLE 1HXIA 1OCOE 3MJWA 5CMWA 2VGYA 1N52A 3ML9A 5FQ7A 3D9KA 3NZSA 4HRLA 1HFAA 3AS4A 5ARGA 1K1BA 1ZBPA 3HVEB 1OXJA 2XS1A 3MYVA 1DCQA 4GZ5A 1SW6A 3PE3A 4Q94A 4FADA 4LERA 2RKKA 2OOEA 4G1TA 2XGMA 4K5AB 5AENA 3CKBA 4X8QA 4DLQA 4U04A 5D66A 2XQ0A 5KJKA 4WNEA 3FH5A 2AXVA 2H6IA 4NIKA 2EIME 1QNFA 2ILRA 3ESLA 3APCA 4PUCA 3EIQC 4DRXE 4L2LA 3CHRA 3EU5A 1N4SA 1TR4A 1TNOA 3LY8A 2B6CA 3I3NA 3ZEFA 3CHMA 3ZRHA 3E30A 4J8EA 5BPPA 3KSLA 1OWLA 1UJKA 5AQBA 1NFIE 5AQ9A 2CFZA 3KSQA 3ABME 3DSUA 4DX2A 4OAVB 1S0PA 1Z6TA 5D2MC 3FEXA 3LY7A 2M63A 3JQ1A 3S2AA 3Q9NC 4DX7D 3JYSA 4N2SA 1H6OA 2OEWA 2WMNA 3UKUG 1KT1A 3LJ3A 5FQ6A 4GTTA 4E6HA 2FI7A 1N11A 3Q78A 4M3OA 2DWZA 3E32A 4U8HA 2VTBB 2V5FA 2A5EA 2KM4A 4RQIA 1JWFA 4FU3A 2FBNA 3CIAA 4O1PA 4RG6A 5AJDA 4TV3A 4O1OA 4BFRA 3N71A 3FY4A 1ELRA 5KJLA 4AV7A 4GMJA 3L17A 3DSTA 2P9UG 5AARA 1INZA 2IJGX 2V5QC 4G24A 2OV8A 3V2OA 3FUIA 4WWOA 3UQ3A 2CHZA 4C0EA 3GW4A 2GW1A 2V4LA 1WG0A 5BT1A 4UI9K 4PH4B 4IRUA 2XPZA 4I1AA 5FIOA 4GTSA 1N4RA 4FJYA 5T8IA 3L82A 5ENOD 3QOUA 2UY1B 2ZXWE 2EIKE 1NP7A 2WXFA 2XGSA 3SY2A 4FJZA 3S7DA 4P29A 3CHOA 4A55A 4ILIA 2LSUA 4XKCA 2CG2A 3KAEA 5ANLA 2VYIA 2IQCA 5J08A 2VGXA 4GA1A 5FWQA 4DI3A 4UWKA 5EX0A 2Y69E 2ZGGA 3SFZA 1O5MA 3FEYA 3MV3B 5AJLA 5FT9A 3PRZA 3SHFA 3ULEG 2YINA 3B7TA 3BG1B 4UI9J 5EYLA 3PNTB 5ENRD 3AU4A 1HS6A 2IFUA 3TAXA 4GTPA 4HLLA 1RZ4A 5DBKA 2L9BA 4CGVA 4XX5A 3CK8A 3E37A 2OCCE 3CLJA 3SGHA 2IU1A 3L6AA 4IN3B 2H6HA 4GU5A 5CEAA 1DC2A 3VTXA 1TJFA 2LSVA 5FQ4A 3QB2A 2EIJE 4I2WA 4UI9C 4J0UA 2VSNA 3LS8A 4I6EA 1ZU2A 4PS7A 3I4RB 3DSVA 3ESKA 5H7PA 3APFA 2HR2A 1A17A 3SD5A 2PQRA 2UWJG 4B8CB 4UQYA 1Q2ZA 4GTQA 1XNFA 2EQXA 3TWWA 4KT6B 2NSZA 4AIFA 2LO6A 3B13A 4WNDA 2HYZA 4BTBA 4GTVA 3PE4A 4HOUA 1N95A 3UT8A 4V3IA 3SFXA 3NOGD 3CVQA 5A23A 2J4DA 3QKYA 5CRUA 4KVOA 2Y4TA 3FUDA 3RAUA 3HXBA 1PY1A 2KBXA 4B94A 1HE8A 4XI9A 3FUJA 4ANVA 2OVBA 3KEZA 4EZKA 1IKND 4FC8A 3ULYA 3CVYA 5KWDA 1AP7A 4EZJA 3S7BA 4FULA 5KJNA 1TN6A 2YNQA 3URZA 3HG0D 1JCRA 2ETCA 4OVUA 4TXQA 3D9MA 4XEIG 5JJTA 3RK6A 2WXMA 2J9QA 3VLDA 3DSXA 5FQ8A 4JA7A 4A1GA 2QYJA 2X6JA 2FF4A 3L22A 2P9IG 2QY7A 3FU0A 2GRPB 3D9LA 4BWRA 1WAO1 3IXEA 3ZYLA 4BESA 2XGOA 2PL2A 3PZ2A 3B7BA 1OUVA 3QNKA 1P5QA 2RG8A 3B7SA 4K0RA 1Z5SC 1TNZA 1BD8A 3LDZA 5T4YA 4C48B 4ILHB 4NQ0A 3HYMB 4RG9A 3ZW3A 1E96B 3EDTB 3FTSA 2X3MA 3ZFWA 3R9MA 1O1SA 4M7CA 2DYSE 2LXLA 4HOSA 4G11A 4AM9A 4L1BA 4XKBA 1YCSB 4CYMD 2QZAA 2WXLA 3PH0C 2GRNB 2AXZA 4YVOA 4U63A 4GYYA 3BU8A 3DSSA 4J8DA 3OXFA 4EQFA 2LUHA 1V55E 2R2LA 2HO1A 2LAIA 3ABKE 5CCLA 3D9NA 2CHXA 3FU3A 3KD7A 4I9CA 1VDYA 3SI5A 3FH7A 4APFA 1MYOA 3SNXA 5M72A 4WUYA 1H2TC 4TXRA 3NOCD 3NQPA 3RRUA 5KNHD 2XEVA 4G8LA 3O4ZA 1SA4A 4HXIA 3TWUA 4I1MA 3UKRG 4NRHB 2VSYA 3JXIA 3T5VA 2FO1E 3ASGA 5ENPD 2WB2A 1OWNA 1S64A 5EIBE 4BEPA 2VGXB 2IF4A 1N9AA 1HF8A 1H2UA 2X6HA 2BUGA 3RKVA 4UWGA 4MLPA 4FLBA 5FZQA 5AAOA 1MQSA 3C72A 5FZRA 4Y6WA 2B0OE 3UM3A 4EPZA 3L54A 4BX9A 4DI4A 4GZCA 2R5SA 3VTYA 4PDXA 2WXNA 2XZDG 3EU9A 3PVLA 2BKKB 4CDMA 1DNPA 4F1PA 4JPSA 2AVPA 3UT4A 1XGWA 4UWLA 2KZTA 3ASDA 3UTMA 3CSTA 5JA4D 5EILA 3T5XA 4FHJA 3GZ2A 4XZ4A 3ISMC 3HIZA 3UPVA 2YHEA 3TWTA 2IONA 3G2UA 2F8YA 4CZ2D 1MX2A 2Y4UA 4L23A 4BSXA 4XI0A 4J8FA 3R7QA 3G2WA 3Q47B 4JEHA 4FLHA 3ZNGA 5LX8A 1BI8B 2GGFA 3R7RA 3UXGA 2HE0A 2WXIA 1UN8A 2BTDA 3P1UA 3FTWA 5EN5D 4H7YA 4U0ZA 3NB2A 1LTXA 1IYGA 5EX3A 3Q7FA 4HRNA 4ZFHA 5HS0A 4HRMB 3C5RA 2R17C 2WVIA 2ZISA 3UM0A 4NURA 4N39A 5EIDA 3TJPA 3WXXA 1DCEA 1OCCE 1E8ZA 4ABNA 4WWNA 3FTZA 3OXLA 4B89A 2NXPA 1TN7A 4TXPA 2ONDA 4JXTA 1E7UA 3B95A 5JJ6A 4J8YA 3UI2A 4BERA 3QARA 3R9AB 2GRMA 1U3DA 3D9IA 3UUXA 1W3BA 4Q96A 1K3ZD 1A5EA 3B7UX 4JL0A 1B89A 4LG6A 3LXUX 3UINC 2MOWA 3EHNA 4GPMA 4JD2G 3IHYA 1V54E 2PNNA 4IYPA 3RJVA 4JC8A 3CHPA 3Q49B 3RO3A 1HO8A 4GPKA 3CSFA 3MX3A 3HXDA 3S7JA 1OT8A 1HZ4A 1N0QA 4KVMA 5G04J 5ENSD 3Q15A 3IV0A 5B1BE 2KXPC 3CVNA 3G2VA 2Y0BG 4GZ3A 4RVBA 3PZ4A 1N4QA 4OAUC 4MRUA 5A6CA 3ZYMA 4BT9A 5FJYA 3CVXA 4O60A 1KPSB 1MZCA 3ASOE 4E85A 4WWPA 3FTYA 3ZYQA 2H6GA 4GA2A 1BPOA 1E90A 1N4PA 3G2SA 4AY6A 2BEDA 1QYMA 3PNLB 4RLYA 3AG2E 3UX4A 1ZB1A 4UWFA 4Z68A 3LCAA 2DZOA 1K8KG 1DVPA 3I5PA 5CMYA 5G04C 3CEQA 2FEZA 3HHMA 3ASNE 1QZ2A 1JPLA 3OTNA 4GMLA 4G2VA 2RFAA 5CECB 2KATA 1MX4A 3GYZA 2X6KA 3RU0A 4EECA 2F0YA 4N5QA 4W9RA 5CBOA 1FPPA 3D9OA 3DPYA 4HQDA 3Q75A 1LD8A 1H2VC 2VSOE 3SQVA 3C3RA 4BT8A 5BUZA 5CRVA 4BTAA 1OWPA 3UT7A 3X2QE 4KZCA 4CT4A 3BG0B 4JHRA 4MS6A 5CEDB 3PZDA 1S70B 3W9FA 3TWQA 3MCXA 3QWVA 2YHCA 4AXHA 4G25A 2RFMA 5C2YA 3TXMA 5BNWA 3F6QA 4LEUA 2AW6A 2I6HA 2L0IA 1HG2A 4GCOA 2VJ8A 3ZXSA 3E4BA 3LYAA 3BQOA 3AG4E 4HI8A 3D9HA 4CDRA 4U96D 2KZTB 4ANUA 1KZPA 3T8KA 4U07A 3ZU7B 3CK7A 5G2NA 1O1RA 5FTPA 4JA9A 1EPUA 1KT0A 4U0UA 3MKRA 1TYQG 2L6BA 2XHEA 4DPRA 2E2EA 3S7FA 4JVSA 3CR3A 4HOQA 3BEEA 4N3AA 1MJ0A 3TL5A 4J7WA 4YDYA 5LCWJ 4JZYA 3JUIA 4ATGA 4GTOA 5CBNA 2WM9A 4KXKB 3Q9UC 4LNUD 3HRAA 5BV1A 4HVBA 2X38A 4LNBA 5HRYA 4PS8A 1JCQA 2C0LA 3CVLA 5ARFA 2V8SE 3FUFA 3TWXA 1H0AA 5ENNA 5JJ7A 3K9IA 3NF1A 5LP0A 2X6IA 5D0OD 4GB9A 4WNFA 2P58C 2Q7FA 3U66A 3ZN3A 2EINE 3QDNA 4OYSA 4DJAA 2KCKA 4J6IA 4QQIA 3CGHA 3L13A 5AQ7A 5FINA 1UN9A 4I6JA 4HOTA 3EHMA 1UJJA 5KJMA 5LCWC 5BV0A 3MKQA 4FA6A 4C0MA 5FZSA 3HXEA 1MHQA 3U3WA 3ZVVA 5DIZA 4JEUA 3Q73A 4B93B 1K1AA 3DWLG 3RRNB 3J5PA 3AJIA 2F37A 2E0IA 3SF4A 4A1SA 4ANWA 3DEPA 3CVVA 1E8WA 2I2OA 3DXMG 2XPYA 1NZNA 4EBAG 1HU3A 1SVXA 5D0QD 3O48A 2WXGA 3SBTB 3QJZA 3FWVA 3ZPJA 1WDYA 4JB8P 3FU5A 3ONKA 4XIFA 4HS2A 2VGEA 1NA3A 2MYOA 3SFYA 3FTVA 4L7TA 4UQZA 1Z3XA 4QFVA 5EDSA 4TUMA 1FCHA 3HXCA 4HLEA 3ZUVB 3LJNA 2XCCA 4LRZA 2KCVA 4JHKA 3CKCA 2A4ZA 3ZKJA 4AP2A 2VQ2A 2PZIA 4BX8A 4DX1A 3LPZA 1LD7A 2DVWA 2WXPA 2BKGA 2MHKA 1HH8A 1PAQA 3TWRA 4LNGA 4URKA 2J4BA 5BW8C 1MX6A 4A3VA 1G3NB 3RIBA 4NACA 4YDWA 3PDNA 3NBNB 4PS3A 1LF8A 3C3QA 1QBQA 2A5UA 1O1TA 3FUMA 1OCRE 3C98A 3LVRE 2WXJA 2WXKA 3LKUA 2LNIA 4D10C 1AWCB 3ZHEA 3TG5A 1OY3D 4BETA 1S63A 3UM1A 4CCAA 5HI7A 2C2LA 4APOA 1H19A 2WXQA 4WAFA 3ONLA 3SO8A 1Y8MA 2RD0A 2DCPA 3CVPA 3TXNA 2V0PA 3Q7AA 3JUEA 4U8VD 3U64A 3PEVB 4GZ6A 3CHSA 2ZIRA 3AAAC 5ITZF 2XEEA 1IXVA 3T9KA 1IQRA 5AYWD 2IY0C 4UWHA 1TNBA 2HM8A 1ELWA 4F6RD 2C0MA 3Q4AB 3D9PA 2IO3C 3I4GA 1WM5A 3PREA 2WXHA 1H6KA 3L9TA 1NL4A 3OXGA 1N94A 2X6FA 2R05A 5JHAA 3MGBA 1E8YA 3ML8A 1GW6A 3FUKA 4YDOA 2OVFA 3MEKA 4YDEA 2WMOA 3RSEG 4HNAD 4LCTA 3E33A 5C1DA 4ZHBA 3G2TA 2IOSA 3CQCB 2EILE 4I43A 3AU5A 4MKTA 1X5BA 4B8AA 2P9PG 4AJWA 1E7VA 5JMND 3V2XA 1JWGA 2BF0X 4BY6A 1RW2A 1UW4B 2F8XK 2P9SG 4GMRA 1Z3YA 3DRAA 3FP3A 3QC1A 2GRLA 4HB5A 2DYRE 3JXJA 3FU6A 3GZSA 2CHWA 5AN8A 4KBQA 4ILGA 3TG4A 1TNYA 4K5CA 1H6PA 4I17A 1SQMA 4G26A 4CRWA 4U7EB 2JLBA 3IHVA 4N3BA 1KZOA 4WNGA 1QQEA 4UQXA 1ELKA 3LY9A 4GYWA 1FT1A 3Q79A 3MKQB 5AIJA 2L6JA 2QFCA 5HKPA 4GYOA 1Y6IA 4I6GA 1WY6A 1U3CA 3VLFA 4L2YA 5G55A 3V30A 1YYHA 4AY5A 4F7AA 4RSYA 4ACLA 1EDUA 4EBAA 2VSXE 2XEHA 4HORA 2ETAA 4CT0A 3AS8A 3MA5A 2GRQB 4N5CA 3V31A 2IEJA 1EF1C 2ZGDA 3KS2A 2R59A 4ATZD 3GZ1A 3FTXA 4I9EA 3HDXA 4GCNA 3PZ3A 4J8SA 3L08A 3LVQE 3CVUA 2NYJA 3AS5A 2XZTG 4C9BB 4ACKA 4F53A 2LAHA 1TNUA 3ZXPA 4AOFA 1IQUA 5EKQD 1SA5A 2XCBA 5KNGA 3TWVA 1BI7B 3UIPC 3HXFA 4Y6CA 4A63B 5KBAA 5ENQD 2WXRA 2P9LG 4CGWA 3FUEA 4HI9A 1OCZE 3FH8A 2IO2C 1U2VG 4YNDA 1BLXB 3HVEA 4TRQA 3RO2A 2GROB 2Y3AA 4G8KA 1JCSA 2DIWA 2WQHA 4MBGA 3PZ1A 1D9SA 2IOLA 4LUNU 1X81A 3APDA 1UG3A 2DZNA 2KC7A 3DEOA 5JHBA 2XRYA 4HFGA 2PM6A 1FT2A 3FUNA 3W9GA 3PEUB 1OWOA 5J90A 2JEKA 3ZHEB 5BXUA 4K03A 1EYHA 5LFAA 4EHMA 3EIJA 3FDHA 4AEZC 3CHQA 4F3VA 3FTUA 3IBEA 1TN8A 5EYPF 4GTMA 1JUQA 4FP7A 1HX8A 3AG3E 2MRIA 3UMVA 2WQ6A 2YQ8A 2J49A 2H6FA 1TEZA 4Q69A 5B1AE 4JW1A 3EJNA 4OVVA 5G05J 2QYUA 1N54A 3MV2B 1BU9A 1PC2A 3TWSA 1D8DA 1TJCA 4I1OB 2CFUA 4GZDA 3SBSA 1NA0A 3FULA 2OEVA 2WXOA 3QWWA 4FHKA 2L0TB 3U9WA 2J8SD 3KEAA 2FO7A 5CHEE 2AXUA 1N0RA 4AVXA 5CCMA 4DX6D 4EZLA 1YMPA 2ETBA 4KZ0A 4YVQC 2R02A 2VTBA 4ME2A 4CEMA 3DSWA 3Q5MA 1OWMA 3JCKC 2XS8A 2XPIA 5E75A 3RRMB 3E34A 4I2ZA 5G05C 4XE0A 2PQNA 2NC9A 3BUAA 2CG3A 4G23A 3J5QB 3B7RL 3WG7E 3ASHA 5AQAA 1YA0A 5ENTD 3JQ0A 3ULQA 2LXMA 4N2QA 5T3RA 3ZIMA 3UM2A 4R7LA 3IEGA
chains in the Genus database with same CATH topology
5AQ9A 2AJAA 4GPMA 2RFAA 3HG0D 2NYJA 3NOCD 2JABA 5CECB 2PNNA 1MJ0A 1MX4A 5FIOA 2F8XK 5KNHD 5CEAA 4DX2A 2ETCA 1IHBA 4DUIA 4OAVB 4GMRA 4J7WA 2XZTG 4YDYA 3EHQA 4G8LA 3TWTA 3SO8A 5CBNA 4HB5A 3TWUA 1DC2A 2Y1LE 1WDYA 2F8YA 3Q9NC 4JB8P 3Q9UC 4DX7D 2P2CP 5ENOD 4LNUD 4N5QA 2XENA 3JXJA 4CZ2D 3HRAA 3JXIA 1MX2A 4K5BA 3EHRA 5CBOA 1OT8A 5AN8A 5KNGA 5HRYA 3TWVA 2FO1E 3JUEA 1BU9A 1BI7B 4U8VD 2VGEA 4HRLA 5ENPD 3ZNGA 2QYJA 4HQDA 1BI8B 1UOHA 3TWSA 2MYOA 5EIBE 1N0QA 4A63B 4BEPA 3TWXA 5CERB 5KBAA 3UXGA 4K5CA 5ENQD 5ENSD 2HE0A 3AAAC 5ITZF 1K1BA 3IXEA 4U95D 4BESA 2KXPC 2XEEA 1IXVA 4QFVA 2J8SD 1N11A 1DCQA 3KEAA 5EN5D 3T9KA 2Y0BG 1SW6A 4TUMA 2DWZA 3B7BA 5CEDB 4HI9A 4HRNA 1S70B 2A5EA 3W9FA 4ZFHA 3TWQA 5HS0A 4F6RD 4HRMB 3ZUVB 4OAUC 1N0RA 2RFMA 3C5RA 3F6QA 3LJNA 1BLXB 4O60A 4DX6D 1BD8A 4K5AB 1YMPA 4O1PA 3ZKJA 5AAOA 4QQIA 4C48B 4G8KA 2ETBA 4O1OA 2ZGGA 5D66A 4DX1A 2B0OE 2DVWA 4HBDA 4U8YD 5EIDA 5AQ7A 5HKPA 2BKGA 3TWWA 5FINA 1D9SA 3TWRA 4BSZB 4HI8A 4NIKA 1QYMA 2V4HC 3D9HA 5EYLA 1MX6A 2DZNA 1G3NB 4YDWA 1YCSB 2XZDG 4U96D 3V30A 4UUCA 4CYMD 1YYHA 3DEOA 4DRXE 3NBNB 3EU9A 4RLYA 3T8KA 3NOGD 3W9GA 4HNAD 3V79K 5AARA 2BKKB 1TR4A 2XEHA 3ZU7B 4B93B 4F1PA 5ENRD 1K1AA 4Z68A 3B95A 2DZOA 5BXOA 2ETAA 2V5QC 4J8YA 5BXUA 3J5PA 3UI2A 4BERA 4DX5D 3AJIA 2KBXA 3J5QB 4ZHBA 2F37A 3V2OA 2QC9A 4HLLA 3V31A 5AQAA 5ENTD 2ZGDA 3UTMA 4LSZE 3DEPA 5EYPF 1K3ZD 4ATZD 5JA4D 5EILA 1IKND 1AWCB 1WG0A 1A5EA 5KWDA 1AP7A 5AQBA 2L6BA 1OY3D 5JMND 4BETA 3V2XA 4LG6A 1MYOA 1NFIE 1SVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQ9 A;  2AJA A;  4GPM A;  2RFA A;  3HG0 D;  2NYJ A;  3NOC D;  2JAB A;  5CEC B;  2PNN A;  1MJ0 A;  1MX4 A;  5FIO A;  2F8X K;  5KNH D;  5CEA A;  4DX2 A;  2ETC A;  1IHB A;  4DUI A;  4OAV B;  4GMR A;  4J7W A;  2XZT G;  4YDY A;  3EHQ A;  4G8L A;  3TWT A;  3SO8 A;  5CBN A;  4HB5 A;  3TWU A;  1DC2 A;  2Y1L E;  1WDY A;  2F8Y A;  3Q9N C;  4JB8 P;  3Q9U C;  4DX7 D;  2P2C P;  5ENO D;  4LNU D;  4N5Q A;  2XEN A;  3JXJ A;  4CZ2 D;  3HRA A;  3JXI A;  1MX2 A;  4K5B A;  3EHR A;  5CBO A;  1OT8 A;  5AN8 A;  5KNG A;  5HRY A;  3TWV A;  2FO1 E;  3JUE A;  1BU9 A;  1BI7 B;  4U8V D;  2VGE A;  4HRL A;  5ENP D;  3ZNG A;  2QYJ A;  4HQD A;  1BI8 B;  1UOH A;  3TWS A;  2MYO A;  5EIB E;  1N0Q A;  4A63 B;  4BEP A;  3TWX A;  5CER B;  5KBA A;  3UXG A;  4K5C A;  5ENQ D;  5ENS D;  2HE0 A;  3AAA C;  5ITZ F;  1K1B A;  3IXE A;  4U95 D;  4BES A;  2KXP C;  2XEE A;  1IXV A;  4QFV A;  2J8S D;  1N11 A;  1DCQ A;  3KEA A;  5EN5 D;  3T9K A;  2Y0B G;  1SW6 A;  4TUM A;  2DWZ A;  3B7B A;  5CED B;  4HI9 A;  4HRN A;  1S70 B;  2A5E A;  3W9F A;  4ZFH A;  3TWQ A;  5HS0 A;  4F6R D;  4HRM B;  3ZUV B;  4OAU C;  1N0R A;  2RFM A;  3C5R A;  3F6Q A;  3LJN A;  1BLX B;  4O60 A;  4DX6 D;  1BD8 A;  4K5A B;  1YMP A;  4O1P A;  3ZKJ A;  5AAO A;  4QQI A;  4C48 B;  4G8K A;  2ETB A;  4O1O A;  2ZGG A;  5D66 A;  4DX1 A;  2B0O E;  2DVW A;  4HBD A;  4U8Y D;  5EID A;  5AQ7 A;  5HKP A;  2BKG A;  3TWW A;  5FIN A;  1D9S A;  3TWR A;  4BSZ B;  4HI8 A;  4NIK A;  1QYM A;  2V4H C;  3D9H A;  5EYL A;  1MX6 A;  2DZN A;  1G3N B;  4YDW A;  1YCS B;  2XZD G;  4U96 D;  3V30 A;  4UUC A;  4CYM D;  1YYH A;  3DEO A;  4DRX E;  3NBN B;  3EU9 A;  4RLY A;  3T8K A;  3NOG D;  3W9G A;  4HNA D;  3V79 K;  5AAR A;  2BKK B;  1TR4 A;  2XEH A;  3ZU7 B;  4B93 B;  4F1P A;  5ENR D;  1K1A A;  4Z68 A;  3B95 A;  2DZO A;  5BXO A;  2ETA A;  2V5Q C;  4J8Y A;  5BXU A;  3J5P A;  3UI2 A;  4BER A;  4DX5 D;  3AJI A;  2KBX A;  3J5Q B;  4ZHB A;  2F37 A;  3V2O A;  2QC9 A;  4HLL A;  3V31 A;  5AQA A;  5ENT D;  2ZGD A;  3UTM A;  4LSZ E;  3DEP A;  5EYP F;  1K3Z D;  4ATZ D;  5JA4 D;  5EIL A;  1IKN D;  1AWC B;  1WG0 A;  1A5E A;  5KWD A;  1AP7 A;  5AQB A;  2L6B A;  1OY3 D;  5JMN D;  4BET A;  3V2X A;  4LG6 A;  1MYO A;  1NFI E;  1SVX A; 
#chains in the Genus database with same CATH topology
 2AJA A;  3T8M A;  5E76 A;  1D8E A;  2JAB A;  3CV0 A;  2FUL A;  3EHQ A;  2J09 A;  5B3S E;  3UIO C;  2Y1L E;  3ZGQ A;  3C3O A;  2P2C P;  2XEN A;  3DPD A;  3FUH A;  3NZU A;  4CDN A;  4JHJ A;  4K5B A;  3EHR A;  2J08 A;  2DBA A;  4L9P A;  2AWI A;  3CK9 A;  1L5J A;  4B0Z A;  3PS6 A;  5ANR A;  1UOH A;  1HG5 A;  4U0S A;  5CER B;  5KCM A;  2I9C A;  1FVF A;  4H7X A;  1FVH A;  1NI1 A;  4U95 D;  3AG1 E;  3DBS A;  3NAW A;  2UY1 A;  3D3M A;  3U4T A;  3ENE A;  3P2B A;  2PM7 A;  1SZ9 A;  4IUL A;  1E8X A;  1KLX A;  4KMO A;  2XRZ A;  2ZU6 B;  5A7D B;  3PUK A;  3LEW A;  3PUJ A;  4N3C A;  2GRR B;  3QK0 A;  3TGO A;  4HBD A;  4U8Y D;  2I1J A;  4GAA A;  4BSZ B;  3L16 A;  2V4H C;  2I1K A;  3SZ7 A;  2J07 A;  3D9J A;  4UUC A;  5HQ8 A;  4GTR A;  3QAQ A;  2P9K G;  3ZYK A;  2WPV A;  4GA0 A;  3V79 K;  1SZA A;  3CVW A;  5BXO A;  4F1S A;  4ANX A;  4DX5 D;  4O6F A;  2WQ7 A;  2QC9 A;  3VLE A;  3FHE A;  3OAW A;  2R03 A;  3FFL A;  2KCL A;  4TUU A;  4KYO B;  5IY5 E;  3DXK G;  4LSZ E;  4DK5 A;  3IKO B;  3EUV A;  3ASF A;  4DLO A;  1IHG A;  3QWP A;  2P9N G;  3MZL B;  4A3T A;  1IHB A;  3CQG B;  4DUI A;  5LOZ A;  3ABL E;  1HXI A;  1OCO E;  3MJW A;  5CMW A;  2VGY A;  1N52 A;  3ML9 A;  5FQ7 A;  3D9K A;  3NZS A;  4HRL A;  1HFA A;  3AS4 A;  5ARG A;  1K1B A;  1ZBP A;  3HVE B;  1OXJ A;  2XS1 A;  3MYV A;  1DCQ A;  4GZ5 A;  1SW6 A;  3PE3 A;  4Q94 A;  4FAD A;  4LER A;  2RKK A;  2OOE A;  4G1T A;  2XGM A;  4K5A B;  5AEN A;  3CKB A;  4X8Q A;  4DLQ A;  4U04 A;  5D66 A;  2XQ0 A;  5KJK A;  4WNE A;  3FH5 A;  2AXV A;  2H6I A;  4NIK A;  2EIM E;  1QNF A;  2ILR A;  3ESL A;  3APC A;  4PUC A;  3EIQ C;  4DRX E;  4L2L A;  3CHR A;  3EU5 A;  1N4S A;  1TR4 A;  1TNO A;  3LY8 A;  2B6C A;  3I3N A;  3ZEF A;  3CHM A;  3ZRH A;  3E30 A;  4J8E A;  5BPP A;  3KSL A;  1OWL A;  1UJK A;  5AQB A;  1NFI E;  5AQ9 A;  2CFZ A;  3KSQ A;  3ABM E;  3DSU A;  4DX2 A;  4OAV B;  1S0P A;  1Z6T A;  5D2M C;  3FEX A;  3LY7 A;  2M63 A;  3JQ1 A;  3S2A A;  3Q9N C;  4DX7 D;  3JYS A;  4N2S A;  1H6O A;  2OEW A;  2WMN A;  3UKU G;  1KT1 A;  3LJ3 A;  5FQ6 A;  4GTT A;  4E6H A;  2FI7 A;  1N11 A;  3Q78 A;  4M3O A;  2DWZ A;  3E32 A;  4U8H A;  2VTB B;  2V5F A;  2A5E A;  2KM4 A;  4RQI A;  1JWF A;  4FU3 A;  2FBN A;  3CIA A;  4O1P A;  4RG6 A;  5AJD A;  4TV3 A;  4O1O A;  4BFR A;  3N71 A;  3FY4 A;  1ELR A;  5KJL A;  4AV7 A;  4GMJ A;  3L17 A;  3DST A;  2P9U G;  5AAR A;  1INZ A;  2IJG X;  2V5Q C;  4G24 A;  2OV8 A;  3V2O A;  3FUI A;  4WWO A;  3UQ3 A;  2CHZ A;  4C0E A;  3GW4 A;  2GW1 A;  2V4L A;  1WG0 A;  5BT1 A;  4UI9 K;  4PH4 B;  4IRU A;  2XPZ A;  4I1A A;  5FIO A;  4GTS A;  1N4R A;  4FJY A;  5T8I A;  3L82 A;  5ENO D;  3QOU A;  2UY1 B;  2ZXW E;  2EIK E;  1NP7 A;  2WXF A;  2XGS A;  3SY2 A;  4FJZ A;  3S7D A;  4P29 A;  3CHO A;  4A55 A;  4ILI A;  2LSU A;  4XKC A;  2CG2 A;  3KAE A;  5ANL A;  2VYI A;  2IQC A;  5J08 A;  2VGX A;  4GA1 A;  5FWQ A;  4DI3 A;  4UWK A;  5EX0 A;  2Y69 E;  2ZGG A;  3SFZ A;  1O5M A;  3FEY A;  3MV3 B;  5AJL A;  5FT9 A;  3PRZ A;  3SHF A;  3ULE G;  2YIN A;  3B7T A;  3BG1 B;  4UI9 J;  5EYL A;  3PNT B;  5ENR D;  3AU4 A;  1HS6 A;  2IFU A;  3TAX A;  4GTP A;  4HLL A;  1RZ4 A;  5DBK A;  2L9B A;  4CGV A;  4XX5 A;  3CK8 A;  3E37 A;  2OCC E;  3CLJ A;  3SGH A;  2IU1 A;  3L6A A;  4IN3 B;  2H6H A;  4GU5 A;  5CEA A;  1DC2 A;  3VTX A;  1TJF A;  2LSV A;  5FQ4 A;  3QB2 A;  2EIJ E;  4I2W A;  4UI9 C;  4J0U A;  2VSN A;  3LS8 A;  4I6E A;  1ZU2 A;  4PS7 A;  3I4R B;  3DSV A;  3ESK A;  5H7P A;  3APF A;  2HR2 A;  1A17 A;  3SD5 A;  2PQR A;  2UWJ G;  4B8C B;  4UQY A;  1Q2Z A;  4GTQ A;  1XNF A;  2EQX A;  3TWW A;  4KT6 B;  2NSZ A;  4AIF A;  2LO6 A;  3B13 A;  4WND A;  2HYZ A;  4BTB A;  4GTV A;  3PE4 A;  4HOU A;  1N95 A;  3UT8 A;  4V3I A;  3SFX A;  3NOG D;  3CVQ A;  5A23 A;  2J4D A;  3QKY A;  5CRU A;  4KVO A;  2Y4T A;  3FUD A;  3RAU A;  3HXB A;  1PY1 A;  2KBX A;  4B94 A;  1HE8 A;  4XI9 A;  3FUJ A;  4ANV A;  2OVB A;  3KEZ A;  4EZK A;  1IKN D;  4FC8 A;  3ULY A;  3CVY A;  5KWD A;  1AP7 A;  4EZJ A;  3S7B A;  4FUL A;  5KJN A;  1TN6 A;  2YNQ A;  3URZ A;  3HG0 D;  1JCR A;  2ETC A;  4OVU A;  4TXQ A;  3D9M A;  4XEI G;  5JJT A;  3RK6 A;  2WXM A;  2J9Q A;  3VLD A;  3DSX A;  5FQ8 A;  4JA7 A;  4A1G A;  2QYJ A;  2X6J A;  2FF4 A;  3L22 A;  2P9I G;  2QY7 A;  3FU0 A;  2GRP B;  3D9L A;  4BWR A;  1WAO 1;  3IXE A;  3ZYL A;  4BES A;  2XGO A;  2PL2 A;  3PZ2 A;  3B7B A;  1OUV A;  3QNK A;  1P5Q A;  2RG8 A;  3B7S A;  4K0R A;  1Z5S C;  1TNZ A;  1BD8 A;  3LDZ A;  5T4Y A;  4C48 B;  4ILH B;  4NQ0 A;  3HYM B;  4RG9 A;  3ZW3 A;  1E96 B;  3EDT B;  3FTS A;  2X3M A;  3ZFW A;  3R9M A;  1O1S A;  4M7C A;  2DYS E;  2LXL A;  4HOS A;  4G11 A;  4AM9 A;  4L1B A;  4XKB A;  1YCS B;  4CYM D;  2QZA A;  2WXL A;  3PH0 C;  2GRN B;  2AXZ A;  4YVO A;  4U63 A;  4GYY A;  3BU8 A;  3DSS A;  4J8D A;  3OXF A;  4EQF A;  2LUH A;  1V55 E;  2R2L A;  2HO1 A;  2LAI A;  3ABK E;  5CCL A;  3D9N A;  2CHX A;  3FU3 A;  3KD7 A;  4I9C A;  1VDY A;  3SI5 A;  3FH7 A;  4APF A;  1MYO A;  3SNX A;  5M72 A;  4WUY A;  1H2T C;  4TXR A;  3NOC D;  3NQP A;  3RRU A;  5KNH D;  2XEV A;  4G8L A;  3O4Z A;  1SA4 A;  4HXI A;  3TWU A;  4I1M A;  3UKR G;  4NRH B;  2VSY A;  3JXI A;  3T5V A;  2FO1 E;  3ASG A;  5ENP D;  2WB2 A;  1OWN A;  1S64 A;  5EIB E;  4BEP A;  2VGX B;  2IF4 A;  1N9A A;  1HF8 A;  1H2U A;  2X6H A;  2BUG A;  3RKV A;  4UWG A;  4MLP A;  4FLB A;  5FZQ A;  5AAO A;  1MQS A;  3C72 A;  5FZR A;  4Y6W A;  2B0O E;  3UM3 A;  4EPZ A;  3L54 A;  4BX9 A;  4DI4 A;  4GZC A;  2R5S A;  3VTY A;  4PDX A;  2WXN A;  2XZD G;  3EU9 A;  3PVL A;  2BKK B;  4CDM A;  1DNP A;  4F1P A;  4JPS A;  2AVP A;  3UT4 A;  1XGW A;  4UWL A;  2KZT A;  3ASD A;  3UTM A;  3CST A;  5JA4 D;  5EIL A;  3T5X A;  4FHJ A;  3GZ2 A;  4XZ4 A;  3ISM C;  3HIZ A;  3UPV A;  2YHE A;  3TWT A;  2ION A;  3G2U A;  2F8Y A;  4CZ2 D;  1MX2 A;  2Y4U A;  4L23 A;  4BSX A;  4XI0 A;  4J8F A;  3R7Q A;  3G2W A;  3Q47 B;  4JEH A;  4FLH A;  3ZNG A;  5LX8 A;  1BI8 B;  2GGF A;  3R7R A;  3UXG A;  2HE0 A;  2WXI A;  1UN8 A;  2BTD A;  3P1U A;  3FTW A;  5EN5 D;  4H7Y A;  4U0Z A;  3NB2 A;  1LTX A;  1IYG A;  5EX3 A;  3Q7F A;  4HRN A;  4ZFH A;  5HS0 A;  4HRM B;  3C5R A;  2R17 C;  2WVI A;  2ZIS A;  3UM0 A;  4NUR A;  4N39 A;  5EID A;  3TJP A;  3WXX A;  1DCE A;  1OCC E;  1E8Z A;  4ABN A;  4WWN A;  3FTZ A;  3OXL A;  4B89 A;  2NXP A;  1TN7 A;  4TXP A;  2OND A;  4JXT A;  1E7U A;  3B95 A;  5JJ6 A;  4J8Y A;  3UI2 A;  4BER A;  3QAR A;  3R9A B;  2GRM A;  1U3D A;  3D9I A;  3UUX A;  1W3B A;  4Q96 A;  1K3Z D;  1A5E A;  3B7U X;  4JL0 A;  1B89 A;  4LG6 A;  3LXU X;  3UIN C;  2MOW A;  3EHN A;  4GPM A;  4JD2 G;  3IHY A;  1V54 E;  2PNN A;  4IYP A;  3RJV A;  4JC8 A;  3CHP A;  3Q49 B;  3RO3 A;  1HO8 A;  4GPK A;  3CSF A;  3MX3 A;  3HXD A;  3S7J A;  1OT8 A;  1HZ4 A;  1N0Q A;  4KVM A;  5G04 J;  5ENS D;  3Q15 A;  3IV0 A;  5B1B E;  2KXP C;  3CVN A;  3G2V A;  2Y0B G;  4GZ3 A;  4RVB A;  3PZ4 A;  1N4Q A;  4OAU C;  4MRU A;  5A6C A;  3ZYM A;  4BT9 A;  5FJY A;  3CVX A;  4O60 A;  1KPS B;  1MZC A;  3ASO E;  4E85 A;  4WWP A;  3FTY A;  3ZYQ A;  2H6G A;  4GA2 A;  1BPO A;  1E90 A;  1N4P A;  3G2S A;  4AY6 A;  2BED A;  1QYM A;  3PNL B;  4RLY A;  3AG2 E;  3UX4 A;  1ZB1 A;  4UWF A;  4Z68 A;  3LCA A;  2DZO A;  1K8K G;  1DVP A;  3I5P A;  5CMY A;  5G04 C;  3CEQ A;  2FEZ A;  3HHM A;  3ASN E;  1QZ2 A;  1JPL A;  3OTN A;  4GML A;  4G2V A;  2RFA A;  5CEC B;  2KAT A;  1MX4 A;  3GYZ A;  2X6K A;  3RU0 A;  4EEC A;  2F0Y A;  4N5Q A;  4W9R A;  5CBO A;  1FPP A;  3D9O A;  3DPY A;  4HQD A;  3Q75 A;  1LD8 A;  1H2V C;  2VSO E;  3SQV A;  3C3R A;  4BT8 A;  5BUZ A;  5CRV A;  4BTA A;  1OWP A;  3UT7 A;  3X2Q E;  4KZC A;  4CT4 A;  3BG0 B;  4JHR A;  4MS6 A;  5CED B;  3PZD A;  1S70 B;  3W9F A;  3TWQ A;  3MCX A;  3QWV A;  2YHC A;  4AXH A;  4G25 A;  2RFM A;  5C2Y A;  3TXM A;  5BNW A;  3F6Q A;  4LEU A;  2AW6 A;  2I6H A;  2L0I A;  1HG2 A;  4GCO A;  2VJ8 A;  3ZXS A;  3E4B A;  3LYA A;  3BQO A;  3AG4 E;  4HI8 A;  3D9H A;  4CDR A;  4U96 D;  2KZT B;  4ANU A;  1KZP A;  3T8K A;  4U07 A;  3ZU7 B;  3CK7 A;  5G2N A;  1O1R A;  5FTP A;  4JA9 A;  1EPU A;  1KT0 A;  4U0U A;  3MKR A;  1TYQ G;  2L6B A;  2XHE A;  4DPR A;  2E2E A;  3S7F A;  4JVS A;  3CR3 A;  4HOQ A;  3BEE A;  4N3A A;  1MJ0 A;  3TL5 A;  4J7W A;  4YDY A;  5LCW J;  4JZY A;  3JUI A;  4ATG A;  4GTO A;  5CBN A;  2WM9 A;  4KXK B;  3Q9U C;  4LNU D;  3HRA A;  5BV1 A;  4HVB A;  2X38 A;  4LNB A;  5HRY A;  4PS8 A;  1JCQ A;  2C0L A;  3CVL A;  5ARF A;  2V8S E;  3FUF A;  3TWX A;  1H0A A;  5ENN A;  5JJ7 A;  3K9I A;  3NF1 A;  5LP0 A;  2X6I A;  5D0O D;  4GB9 A;  4WNF A;  2P58 C;  2Q7F A;  3U66 A;  3ZN3 A;  2EIN E;  3QDN A;  4OYS A;  4DJA A;  2KCK A;  4J6I A;  4QQI A;  3CGH A;  3L13 A;  5AQ7 A;  5FIN A;  1UN9 A;  4I6J A;  4HOT A;  3EHM A;  1UJJ A;  5KJM A;  5LCW C;  5BV0 A;  3MKQ A;  4FA6 A;  4C0M A;  5FZS A;  3HXE A;  1MHQ A;  3U3W A;  3ZVV A;  5DIZ A;  4JEU A;  3Q73 A;  4B93 B;  1K1A A;  3DWL G;  3RRN B;  3J5P A;  3AJI A;  2F37 A;  2E0I A;  3SF4 A;  4A1S A;  4ANW A;  3DEP A;  3CVV A;  1E8W A;  2I2O A;  3DXM G;  2XPY A;  1NZN A;  4EBA G;  1HU3 A;  1SVX A;  5D0Q D;  3O48 A;  2WXG A;  3SBT B;  3QJZ A;  3FWV A;  3ZPJ A;  1WDY A;  4JB8 P;  3FU5 A;  3ONK A;  4XIF A;  4HS2 A;  2VGE A;  1NA3 A;  2MYO A;  3SFY A;  3FTV A;  4L7T A;  4UQZ A;  1Z3X A;  4QFV A;  5EDS A;  4TUM A;  1FCH A;  3HXC A;  4HLE A;  3ZUV B;  3LJN A;  2XCC A;  4LRZ A;  2KCV A;  4JHK A;  3CKC A;  2A4Z A;  3ZKJ A;  4AP2 A;  2VQ2 A;  2PZI A;  4BX8 A;  4DX1 A;  3LPZ A;  1LD7 A;  2DVW A;  2WXP A;  2BKG A;  2MHK A;  1HH8 A;  1PAQ A;  3TWR A;  4LNG A;  4URK A;  2J4B A;  5BW8 C;  1MX6 A;  4A3V A;  1G3N B;  3RIB A;  4NAC A;  4YDW A;  3PDN A;  3NBN B;  4PS3 A;  1LF8 A;  3C3Q A;  1QBQ A;  2A5U A;  1O1T A;  3FUM A;  1OCR E;  3C98 A;  3LVR E;  2WXJ A;  2WXK A;  3LKU A;  2LNI A;  4D10 C;  1AWC B;  3ZHE A;  3TG5 A;  1OY3 D;  4BET A;  1S63 A;  3UM1 A;  4CCA A;  5HI7 A;  2C2L A;  4APO A;  1H19 A;  2WXQ A;  4WAF A;  3ONL A;  3SO8 A;  1Y8M A;  2RD0 A;  2DCP A;  3CVP A;  3TXN A;  2V0P A;  3Q7A A;  3JUE A;  4U8V D;  3U64 A;  3PEV B;  4GZ6 A;  3CHS A;  2ZIR A;  3AAA C;  5ITZ F;  2XEE A;  1IXV A;  3T9K A;  1IQR A;  5AYW D;  2IY0 C;  4UWH A;  1TNB A;  2HM8 A;  1ELW A;  4F6R D;  2C0M A;  3Q4A B;  3D9P A;  2IO3 C;  3I4G A;  1WM5 A;  3PRE A;  2WXH A;  1H6K A;  3L9T A;  1NL4 A;  3OXG A;  1N94 A;  2X6F A;  2R05 A;  5JHA A;  3MGB A;  1E8Y A;  3ML8 A;  1GW6 A;  3FUK A;  4YDO A;  2OVF A;  3MEK A;  4YDE A;  2WMO A;  3RSE G;  4HNA D;  4LCT A;  3E33 A;  5C1D A;  4ZHB A;  3G2T A;  2IOS A;  3CQC B;  2EIL E;  4I43 A;  3AU5 A;  4MKT A;  1X5B A;  4B8A A;  2P9P G;  4AJW A;  1E7V A;  5JMN D;  3V2X A;  1JWG A;  2BF0 X;  4BY6 A;  1RW2 A;  1UW4 B;  2F8X K;  2P9S G;  4GMR A;  1Z3Y A;  3DRA A;  3FP3 A;  3QC1 A;  2GRL A;  4HB5 A;  2DYR E;  3JXJ A;  3FU6 A;  3GZS A;  2CHW A;  5AN8 A;  4KBQ A;  4ILG A;  3TG4 A;  1TNY A;  4K5C A;  1H6P A;  4I17 A;  1SQM A;  4G26 A;  4CRW A;  4U7E B;  2JLB A;  3IHV A;  4N3B A;  1KZO A;  4WNG A;  1QQE A;  4UQX A;  1ELK A;  3LY9 A;  4GYW A;  1FT1 A;  3Q79 A;  3MKQ B;  5AIJ A;  2L6J A;  2QFC A;  5HKP A;  4GYO A;  1Y6I A;  4I6G A;  1WY6 A;  1U3C A;  3VLF A;  4L2Y A;  5G55 A;  3V30 A;  1YYH A;  4AY5 A;  4F7A A;  4RSY A;  4ACL A;  1EDU A;  4EBA A;  2VSX E;  2XEH A;  4HOR A;  2ETA A;  4CT0 A;  3AS8 A;  3MA5 A;  2GRQ B;  4N5C A;  3V31 A;  2IEJ A;  1EF1 C;  2ZGD A;  3KS2 A;  2R59 A;  4ATZ D;  3GZ1 A;  3FTX A;  4I9E A;  3HDX A;  4GCN A;  3PZ3 A;  4J8S A;  3L08 A;  3LVQ E;  3CVU A;  2NYJ A;  3AS5 A;  2XZT G;  4C9B B;  4ACK A;  4F53 A;  2LAH A;  1TNU A;  3ZXP A;  4AOF A;  1IQU A;  5EKQ D;  1SA5 A;  2XCB A;  5KNG A;  3TWV A;  1BI7 B;  3UIP C;  3HXF A;  4Y6C A;  4A63 B;  5KBA A;  5ENQ D;  2WXR A;  2P9L G;  4CGW A;  3FUE A;  4HI9 A;  1OCZ E;  3FH8 A;  2IO2 C;  1U2V G;  4YND A;  1BLX B;  3HVE A;  4TRQ A;  3RO2 A;  2GRO B;  2Y3A A;  4G8K A;  1JCS A;  2DIW A;  2WQH A;  4MBG A;  3PZ1 A;  1D9S A;  2IOL A;  4LUN U;  1X81 A;  3APD A;  1UG3 A;  2DZN A;  2KC7 A;  3DEO A;  5JHB A;  2XRY A;  4HFG A;  2PM6 A;  1FT2 A;  3FUN A;  3W9G A;  3PEU B;  1OWO A;  5J90 A;  2JEK A;  3ZHE B;  5BXU A;  4K03 A;  1EYH A;  5LFA A;  4EHM A;  3EIJ A;  3FDH A;  4AEZ C;  3CHQ A;  4F3V A;  3FTU A;  3IBE A;  1TN8 A;  5EYP F;  4GTM A;  1JUQ A;  4FP7 A;  1HX8 A;  3AG3 E;  2MRI A;  3UMV A;  2WQ6 A;  2YQ8 A;  2J49 A;  2H6F A;  1TEZ A;  4Q69 A;  5B1A E;  4JW1 A;  3EJN A;  4OVV A;  5G05 J;  2QYU A;  1N54 A;  3MV2 B;  1BU9 A;  1PC2 A;  3TWS A;  1D8D A;  1TJC A;  4I1O B;  2CFU A;  4GZD A;  3SBS A;  1NA0 A;  3FUL A;  2OEV A;  2WXO A;  3QWW A;  4FHK A;  2L0T B;  3U9W A;  2J8S D;  3KEA A;  2FO7 A;  5CHE E;  2AXU A;  1N0R A;  4AVX A;  5CCM A;  4DX6 D;  4EZL A;  1YMP A;  2ETB A;  4KZ0 A;  4YVQ C;  2R02 A;  2VTB A;  4ME2 A;  4CEM A;  3DSW A;  3Q5M A;  1OWM A;  3JCK C;  2XS8 A;  2XPI A;  5E75 A;  3RRM B;  3E34 A;  4I2Z A;  5G05 C;  4XE0 A;  2PQN A;  2NC9 A;  3BUA A;  2CG3 A;  4G23 A;  3J5Q B;  3B7R L;  3WG7 E;  3ASH A;  5AQA A;  1YA0 A;  5ENT D;  3JQ0 A;  3ULQ A;  2LXM A;  4N2Q A;  5T3R A;  3ZIM A;  3UM2 A;  4R7L A;  3IEG A; 
#chains in the Genus database with same CATH homology
 5AQ9 A;  2AJA A;  4GPM A;  2RFA A;  3HG0 D;  2NYJ A;  3NOC D;  2JAB A;  5CEC B;  2PNN A;  1MJ0 A;  1MX4 A;  5FIO A;  2F8X K;  5KNH D;  5CEA A;  4DX2 A;  2ETC A;  1IHB A;  4DUI A;  4OAV B;  4GMR A;  4J7W A;  2XZT G;  4YDY A;  3EHQ A;  4G8L A;  3TWT A;  3SO8 A;  5CBN A;  4HB5 A;  3TWU A;  1DC2 A;  2Y1L E;  1WDY A;  2F8Y A;  3Q9N C;  4JB8 P;  3Q9U C;  4DX7 D;  2P2C P;  5ENO D;  4LNU D;  4N5Q A;  2XEN A;  3JXJ A;  4CZ2 D;  3HRA A;  3JXI A;  1MX2 A;  4K5B A;  3EHR A;  5CBO A;  1OT8 A;  5AN8 A;  5KNG A;  5HRY A;  3TWV A;  2FO1 E;  3JUE A;  1BU9 A;  1BI7 B;  4U8V D;  2VGE A;  4HRL A;  5ENP D;  3ZNG A;  2QYJ A;  4HQD A;  1BI8 B;  1UOH A;  3TWS A;  2MYO A;  5EIB E;  1N0Q A;  4A63 B;  4BEP A;  3TWX A;  5CER B;  5KBA A;  3UXG A;  4K5C A;  5ENQ D;  5ENS D;  2HE0 A;  3AAA C;  5ITZ F;  1K1B A;  3IXE A;  4U95 D;  4BES A;  2KXP C;  2XEE A;  1IXV A;  4QFV A;  2J8S D;  1N11 A;  1DCQ A;  3KEA A;  5EN5 D;  3T9K A;  2Y0B G;  1SW6 A;  4TUM A;  2DWZ A;  3B7B A;  5CED B;  4HI9 A;  4HRN A;  1S70 B;  2A5E A;  3W9F A;  4ZFH A;  3TWQ A;  5HS0 A;  4F6R D;  4HRM B;  3ZUV B;  4OAU C;  1N0R A;  2RFM A;  3C5R A;  3F6Q A;  3LJN A;  1BLX B;  4O60 A;  4DX6 D;  1BD8 A;  4K5A B;  1YMP A;  4O1P A;  3ZKJ A;  5AAO A;  4QQI A;  4C48 B;  4G8K A;  2ETB A;  4O1O A;  2ZGG A;  5D66 A;  4DX1 A;  2B0O E;  2DVW A;  4HBD A;  4U8Y D;  5EID A;  5AQ7 A;  5HKP A;  2BKG A;  3TWW A;  5FIN A;  1D9S A;  3TWR A;  4BSZ B;  4HI8 A;  4NIK A;  1QYM A;  2V4H C;  3D9H A;  5EYL A;  1MX6 A;  2DZN A;  1G3N B;  4YDW A;  1YCS B;  2XZD G;  4U96 D;  3V30 A;  4UUC A;  4CYM D;  1YYH A;  3DEO A;  4DRX E;  3NBN B;  3EU9 A;  4RLY A;  3T8K A;  3NOG D;  3W9G A;  4HNA D;  3V79 K;  5AAR A;  2BKK B;  1TR4 A;  2XEH A;  3ZU7 B;  4B93 B;  4F1P A;  5ENR D;  1K1A A;  4Z68 A;  3B95 A;  2DZO A;  5BXO A;  2ETA A;  2V5Q C;  4J8Y A;  5BXU A;  3J5P A;  3UI2 A;  4BER A;  4DX5 D;  3AJI A;  2KBX A;  3J5Q B;  4ZHB A;  2F37 A;  3V2O A;  2QC9 A;  4HLL A;  3V31 A;  5AQA A;  5ENT D;  2ZGD A;  3UTM A;  4LSZ E;  3DEP A;  5EYP F;  1K3Z D;  4ATZ D;  5JA4 D;  5EIL A;  1IKN D;  1AWC B;  1WG0 A;  1A5E A;  5KWD A;  1AP7 A;  5AQB A;  2L6B A;  1OY3 D;  5JMN D;  4BET A;  3V2X A;  4LG6 A;  1MYO A;  1NFI E;  1SVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...