2JLBA

Xanthomonas campestris putative ogt (xcc0866), complex with udp- glcnac phosphonate analogue
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCC0866
total genus 212
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2jlbA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2jlbA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jlbA02
2HO1A 4UI9K 3MRXA 3S7FA 5D00A 4RELA 1HLFA 4LDPA 4RBNA 3Q5MA 1P2BA 2C4MA 3L7BA 3MT8A 3IEGA 5DU2A 5D01A 3S7DA 3MS7A 3EBPA 1E4OA 3LY7A 5BW8C 2PL2A 3K9IA 3TG4A 3E3NA 2Y4UA 3MV2B 4I1AA 3CK9A 2XCCA 2UY1B 3ZCVA 5ARFA 2GT1A 3LCAA 3T3GA 5LCWC 3MRVA 3AS4A 4IN3B 3EDTB 2ONDA 2R68A 4EL0A 2FETA 4N2QA 3LYAA 1UQUA 2SKDA 4N3CA 1UQTA 4F9FA 5C1DA 2PRIA 4B94A 1UZUA 1P2GA 1WV0A 3T5TA 4UI9J 4BQIA 3HYMB 2G9VA 1BX3A 3EBOA 3C48A 1E96B 2IV7A 3OXGA 1OUVA 1WAO1 4J0UA 1PSWA 2H1FA 3CKBA 2GPAA 5ARGA 1IIRA 4GYWA 1QKJA 3G2HA 2QN3A 3C4VA 1NA0A 2V5FA 3CVNA 3KS2A 1AXRA 1L6IA 2LSVA 1C3JA 1B89A 3UPVA 1ELRA 4HOSA 3N71A 2YQ8A 4BFCA 4GCNA 3CVLA 2ECPA 3ULQA 2XGMA 2XCIA 1NZNA 1PN3A 2ACVA 4I2ZA 3ZCUA 2QFCA 5EX3A 2QRPA 3BEOA 2AVPA 3CVPA 3L7CA 3Q49B 2X6RA 1L5RA 5KJNA 1LWOA 5TMBA 3GZ1A 3ZHEA 1K06A 3LY8A 2UY1A 3IA7A 3HBMA 2E2EA 4PQGA 4F3VA 1Y8MA 1HH8A 3S27A 5I45A 2AV6A 3RJVA 5JTUA 1H5UA 3SZ7A 3BCRA 4GZ5A 3WADA 2LNIA 1FA9A 3BEEA 3FWVA 3RO3A 4UI9C 4RIGA 5JTTA 3CEJA 3GYZA 3AS5A 1WW3A 4M7PA 2XA1A 4G24A 2AMVA 1KT0A 1L5SA 3DDWA 3Q4AB 4EKEA 1PYGA 2IYFA 2HY7A 3OTHA 2QLNA 3TAXA 3G2JA 1FCHA 3GW4A 1FTQA 4U07A 3RT1A 3HBJA 2FFRA 4NEQA 4MI6A 1V4VA 3ASGA 4WADA 3S7BA 1GPBA 1RZUA 4N9WA 5BT1A 4RIEA 4UQZA 4WNEA 3RKVA 4U0UA 1WUTA 2XA9A 1C8LA 2QN9A 4XI9A 2GPBA 5BNWA 2FI7A 1JEJA 2R4TA 5FT9A 4N5CA 4CGVA 3QHPA 5TMDA 3JYSA 2X0EA 2VYIA 3TGOA 4X7MA 2G9QA 1P4HA 3WXXA 3TOVA 1GG8A 5KJMA 1L5WA 1FU4A 1ABBA 3T3DA 4CTNA 3RU0A 3TSAA 3U3WA 2YHCA 4WNGA 3NPAA 3CUWA 3G2NA 3MQFA 4N39A 3L01A 3T3EA 3MTBA 2G9RA 4KBQA 2XA2A 2X6QA 3NAZA 4ME2A 1FU8A 5KJKA 3ZCPA 3ZCRA 3URZA 4YVQC 1P5QA 1L7XA 3CVQA 1W3BA 5DIZA 4N3AA 2XPIA 3CX4A 4KQ2A 2F3UA 2LSUA 1AHPA 3S28A 3QKWA 4O6FA 3L7DA 4M83A 1JIVA 3HBNA 2QRMA 3NCHA 4YI5A 5EKQD 3COPA 1SXPA 5D0OD 3T7DA 2VQ2A 4G26A 1NVKA 4MHSA 3OT5A 2PZIA 3CEQA 4MICA 3QDNA 2GM9A 2GJ4A 3G2LA 3L79A 3Q15A 1PNVA 4HOUA 2BFWA 3KD7A 3CK7A 1HXIA 2OOEA 2XEVA 3ZPJA 4FKZA 4EL5A 5G05J 3TG5A 3MTDA 4CGWA 2GEJA 3NP9A 3O3CA 2VCEA 3DZCA 2IUYA 2IEGA 4X7PA 4EJ2A 3FROA 5EX0A 2ACWA 4M60A 3PDNA 2F3SA 3ZGQA 5M72A 3GZ2A 4GZ3A 3GPBA 3S2UA 1NOJA 3ASFA 3MKRA 5A6CA 4GCOA 1FC0A 3H4IA 4CTMA 2PYIA 4HOTA 1NZFA 4A1SA 2XCUA 4J8EA 4AY5A 3U4TA 4WNDA 2J9QA 4ABNA 4GPKA 1P4JA 4HWGA 5LQDA 3ZFWA 4N2SA 3S7JA 3QOUA 4NRHB 1P2DA 1WW2A 1GGNA 1EXVA 2NC9A 2H1HA 7GPBA 3WAGA 3OTGA 4BT8A 2OFFA 3ZCQA 2HR2A 1L5QA 1XL1A 4AM9A 1QZ2A 5IKPA 4KQMA 1Y6GA 5G05C 3L7AA 1SXQA 1ZBPA 1XNFA 5TVGA 4RG6A 4YI3A 2BISA 2VGXB 2C2LA 1GPAA 1YA0A 1IXYA 4Y6WA 3BD8A 3UQ3A 2F3PA 1Z62A 1GFZA 4G1TA 1XOIA 1K08A 2QRHA 1RZVA 4J8FA 5JJ7A 3MBOA 2F3QA 2KCKA 2VG8A 1ELWA 4JA9A 4XI0A 2FF5A 1XV5A 2AW3A 4NESA 1TJCA 4GZ6A 3DDSA 2GEKA 4G25A 6GPBA 3OKPA 4RG9A 3E3OA 3O48A 3VDNB 4BQEA 2R5SA 3MTAA 3UYKA 1JIXA 3D0QA 1F0KA 1IYGA 3C4QA 4REMA 1P29A 1VGVA 3QKYA 2QZSA 4WUYA 2KATA 1EM6A 2IYAA 2QN8A 3H4TA 4CDRA 3S29A 3WC4A 1QM5A 2QNBA 3DD1A 4JL0A 3NP7A 1E1YA 2GPNA 2X0FA 1PC2A 4J8DA 3MEKA 3PE3A 3Q3HA 2VGXA 5FTPA 1YGPA 3BCUA 2Y4TA 4AN4A 4H7YA 4CTOA 5KJLA 4W9RA 4RIIA 1JG6A 3BDAA 1M5RA 2F9FA 4AMBA 5G04C 4HORA 3AMVA 2SKCA 2VCHA 1RRVA 3OY7A 9GPBA 3FFLA 2QRGA 4GA2A 2XGSA 5AYWD 2WTXA 2C0LA 2ATIA 3ZCSA 4AY6A 8GPBA 1FTWA 4GA1A 3E3LA 2PYDA 1O6CA 3ESKA 2Q7FA 1NZDA 1L5VA 2DBAA 3KAEA 1QQEA 1JIUA 3E4BA 2XMPA 4BQFA 3VDMA 1FU7A 4GYOA 3ZCTA 5ENZA 2C1ZA 4H7XA 5CCMA 5JJ6A 2JLBA 4WHMA 1GZ5A 4UQXA 3G2KA 5HXAA 4I9CA 4N3BA 2Q6VA 3ASHA 3IAAA 3RHZA 4YNDA 3VUEA 3CUTA 2JJMA 4EKYA 3Q3IA 2YJNA 4MI9A 5G04J 4L22A 3VTXA 5FZSA 2PRJA 4MI3A 4GA0A 2P58C 2BGTA 1Z8DA 2IF4A 4EQFA 5D0QD 2FEZA 4NQ0A 3BCSA 1Y8ZA 3S0JA 4G2VA 3RIBA 4YVOA 1WUYA 2C0MA 5JJTA 3FP3A 2IV3A 3SF4A 4U0SA 2P6PA 2G9UA 2X0DA 3G2IA 1NOKA 4APOA 5GPBA 2QLLA 1FTYA 1NA3A 2KS6A 2ASVA 3BD7A 4WACA 3UYLA 4W6QA 4X6LA 4F96A 4KYOB 2KCLA 5CHEE 2R4UA 4BTAA 2UWJG 3MS4A 2VGYA 3MV3B 5DXFA 4Z5XA 2MHKA 4XIFA 1Z6PA 1A8IA 3OY2A 2PQRA 3OTIA 2BGUA 4I9EA 3CUVA 3QWVA 2VSYA 1IHGA 2ZB2A 3MT7A 3Q3EA 1KLXA 2GW1A 4RENA 2JZCA 3NC4A 2R66A 1ZU2A 2O6LA 2IFUA 1B4DA 1F6DA 1NOIA 1FS4A 3MSCA 2KC7A 3RSCA 2WQHA 5DBKA 1HZ4A 4KQ1A 1WV1A 2QLMA 5FZRA 3ZN3A 3NB0A 4AIFA 3D0RA 4G23A 2IEIA 1WM5A 1LWNA 3QWPA 3UUXA 1GPYA 3T3IA 5TMEA 3Q47B 3ASDA 4I17A 2WPVA 2PQNA 3T3HA 3VTYA 5LCWJ 4LEUA 4KXKB 1NLMA 2IW1A 4HLNA 3SYMA 1A17A 1KT1A 5HI7A 3HBFA 3OKAA 4GYYA 4AMGA 1C50A 2SKEA 4X7RA 2FF4A 5CCLA 3MA5A 5A7DB 3CUYA 3MS2A 5HQ8A 4RIHA 2VSNA 3OKCA 3LPZA 4NC9A 1J39A 1C8KA 3BD6A 3AS8A 5FJYA 4LEIA 4MRAA 3MRTA 4U04A 2QN1A 2QRQA 4GPBA 4JHRA 4YUAA 3RSZA 4MHOA 3SYRA 3R9AB 3CKCA 3CV3A 5IKOA 2HYZA 4I2WA 1P4GA 4WNFA 4FZRA 3LKUA 4BTBA 2QN2A 3OXLA 4F97A 3OXFA 2AZDA 4U0ZA 5FZQA 1Y6FA 3PE4A 1KTIA 5DLDA 3CEHA 2I6HA 3RO2A 2R60A 2C1XA 4UQYA 3CUUA 3MT9A 1XKXA 4BWRA 4JA7A 1XL0A 3CK8A 2FO7A 3NF1A 2FBNA 1XC7A 1Z6QA 2C9ZA 2PQ6A 2KCVA 3GUHA 3CEMA 2L6JA 2XGOA 4HOQA 1JG7A 3D1JA 1YA6A 3ZHEB 2BUGA 3QWWA 4G2TA 4BT9A 4Y6CA 2QN7A 3CV0A 4RIFA 3LY9A 4QLBA 3VUFA 2XCBA
chains in the Genus database with same CATH superfamily
3PEVB 4K9KA 4RTNA 5JSYA 1QFXA 2ILVA 1VE6A 2OPHA 3ROXA 4TRQA 3SDSA 1C9NA 1TCUA 3SIXA 1ZUIA 4Q6BA 2WJ3A 2GRLA 5JJLA 2WA2A 1T36B 4DCVA 4UUBA 1VMKA 2A0FA 1Q0PA 3ZHRA 4WSOA 3Q5MA 2CHWA 3G1TA 2J33A 4GMFA 4OXQA 4Q47A 5AENA 2P2YA 3IEGA 1QHYA 3A2MA 4HNVA 3LW8A 2XTAA 3HH8A 4JHJA 4QXQA 5LSAA 4NJEB 4H2DA 1O2DA 2CFCA 1BEEA 1T5TA 2PPVA 4OI2A 2KM4A 2FP3A 3GT0A 4WN9B 5CUQA 1UN8A 1DLJA 1LQUA 4QFCA 3FULA 1Q12A 4NPHA 5H83A 3JYOA 1XYYA 3B2NA 4IDHA 1EK1A 2M6SA 3LSTA 2IYZA 4G37A 4B3DA 3G5LA 5LCWC 1TYZA 2W6ZA 2WXRA 2G09A 4GMDA 2B92A 1FLVA 2B0JA 2J0VA 4PHGA 4R8MA 1TJPB 2X0KA 1VBMA 4A03A 2J3MA 3IIKA 2I2OA 3RUIA 1EZZA 1J0EA 2V8BA 1I3OA 4C07A 4D82A 3LBFA 4F4JA 2GVNA 3L92A 1JDUA 2ZJ6A 3JU3A 5A7GA 5LNK6 2EYQA 1X80A 5JAMA 2HSGA 2REXB 1U81A 3FA2A 3C16C 1U3WA 3HNPA 2GN0A 2H1FA 1TKBA 1TECE 4TKUB 4G67A 5IEBA 1OYWA 1VPEA 2WHRA 3ZQUA 1FPMA 2QK4A 2W2KA 3L8MA 4BJ3A 2ZGVA 4HB5A 3NEJA 3PDJA 3WQSB 4FFOA 1X94A 3A25A 3OF5A 2LSVA 2XYHA 3D9NA 2XWPA 1H2ZA 3BILA 4QDTA 4LTMA 4WLFA 1IN5A 2O50A 1N2EA 1J25A 2XOKA 2D8MA 3BH0A 3FUFA 3B9RA 3HWRA 1CFZA 2AVNA 3W4KA 3KZXA 1ZR4A 4TLMB 1H69A 1Q2XA 4JVLA 4QDXA 2ZRIA 2YOFA 4TLDA 3HCPA 4M9UA 3KKQA 4IQ0A 1YQEA 4GGPA 5KSYA 2ZWAA 4D79A 1GUAA 5HKLA 2ON6A 5JHGB 2XENA 3K7EA 2GRMA 5BQOA 4KSBA 3DZFA 2P9UG 2WTAA 5CJPA 4ZEOA 2H29A 1EHIA 1Q0RA 1XXLA 2QAJA 4Q37A 1WF3A 4P22A 3RG2A 4DA6A 1YVEI 2DHCA 2FTKE 1K7XB 3AI3A 3QY9A 4MW5A 1QFJA 4N5HX 4NZZA 3DHNA 2GSWA 3RC2A 1KI1A 3CRW1 4YJFA 1Q14A 3GJTA 4NECA 4INZA 1DXHA 4EKNB 5AW6A 1HQDA 1NJFA 5H8WA 3PCTA 1JSRA 5LQNA 2AXUA 1GQSA 1DIOB 3GYZA 1PI3A 1X14A 2XEHA 1T5DX 2CGEA 2CLSA 4GGOA 2F67A 4HAXA 1DX4A 3OEYA 5DOVA 2EEZA 2DCMA 3A1DA 2AS0A 2AC7A 2O7QA 1ZGGA 1QV9A 2I99A 2WRZA 4P86A 5FWDA 3RWMB 1T0BA 3PQ6A 4C5BA 3FTEA 3OPYA 3UWMA 1G2OA 1DIAA 2LP4Y 4XR4A 2FZ4A 1T4CA 1UM9A 4S0ZA 1XDBA 2P2ZA 3AB3A 3DXYA 3GW4A 4PYMA 5JAIA 4WESB 3T3PB 2B98A 2EBFX 5F3DA 4C7OB 1QH0A 2IXEA 4WTOA 3KEGA 1XEXA 1U7OA 3CF6R 1GZUA 5AQAA 4U4AA 4TKVA 3L0IB 2VSQA 1THTA 3AG5A 5A1TA 2C7BA 4U7TB 4ZAFA 4EMBA 3F9RA 3TM5A 2JD1A 2KZTA 3UCEA 1J70A 2WIDA 2QTWB 3VTZA 4WNEA 4EY6A 2Q1TA 3ABZA 3T4XA 3UHOA 4EHDA 5IF9A 2HMYB 5ERXA 3GK3A 3AP1A 3DV0A 4V1CI 1QIHA 2ORED 4TX1A 1C9EA 5D3ZA 1MA3A 4J76A 4QGSA 1J07A 1A5ZA 3A9UA 4K6OA 2CK3A 1JPJA 3T0GA 4MK4A 3PGJA 1ISRA 3HA3A 3HJCA 2QTVB 3ZVVA 1NWHA 4KTVE 2DHDA 3GVHA 1Z18A 3HNOA 1GTRA 5CNMA 4QT0A 4K86A 3I2JA 3K2BA 4EGJA 5FWYA 2IXBA 3U3WA 4BFRA 1MAVA 1GARA 2ST1A 3KB2A 3H1EA 4HLDA 4X24A 4XWGA 1CR1A 3TPFA 2QD5A 3AUKA 3OOSA 3WZMA 4DZTA 3PEYA 2XF2A 4LJAA 4UATA 5I7WA 2WTEA 4TRRA 3ZLUA 2VK2A 2DY0A 3JARB 2BFMA 1OLSB 4UM9D 4ME2A 1G8MA 1QH9A 1HU3A 2G7ZA 1K7SN 2B0CA 2WSYB 1INZA 2I0FA 3FYHA 3AU4A 3MPOA 3STXA 3ZV6A 1C3XA 1KU0A 2WJ4A 1OD6A 2JBWA 1GEGA 1LPAB 1R74A 3OLCX 4HOYA 3O73A 1M6YA 2AMLA 5LJLA 2B1GA 2DKNA 4NENA 1CP2A 3EGIA 1KDOA 1GKKA 3QUQA 4POOA 4NCXA 3CZRA 1VZ2A 5T8IA 4JLWA 1JSXA 4LE2A 3F1KA 2O8DA 4GAEA 4NMHA 1L4MA 4OIFA 2D7DA 2XE4A 1CRZA 3H5LA 2QTRA 1V25A 2X40A 3HADA 3F8SA 4KE7A 3BMCA 4TSRA 5HSGA 4ER5A 2JGEA 1TGVA 2L82A 3ZHZA 4ZT7A 3UAWA 2YJ6A 2GJ4A 2PZGA 1E66A 1H66A 2ZB3A 3DC7A 4JU8A 5JFTA 2VJDA 4K9NA 1XR3A 2EOAA 4D9GA 3QE9Y 2G3YA 1ZGZA 3I04A 3UATA 3RIXA 1F7VA 3UIPC 2WW8A 1L5NA 2OOEA 5KU1A 5JAHA 4WLVA 3PKIA 2UV8A 2DUNA 2FN8A 2WJIA 3PFNA 4R9RA 3VZDA 4YJ3B 3PLAE 4RTRA 2X38A 4Z54A 3CHSA 1TYBE 5DK4A 3EODA 1HFWA 3F0TA 1EFPB 4JH0A 4X7PA 3TAUA 1EXNA 2QTHA 4HXFB 4X60A 1NFFA 2FPUA 2ZRQA 3TFWA 3IMEA 2GN8A 2YCBA 2NTJA 3QV2A 1T9GR 4CODB 5HBGA 3HUFA 2WWXA 2PO5A 2QTBA 3IMKA 4PLPA 4CKEA 4H0NA 4YV7A 2VSXE 4DDUA 3PDIB 4YNBA 1LJLA 2A0XA 4Q24A 4OKSA 3IAXA 1WLSA 4MB2A 4WI1A 4XGQA 1QVZA 3O3OB 1X87A 5FQOA 2I29A 2HSEA 3PXXA 4QRDA 3OPYB 4YK7A 3TRFA 1FNBA 3FNHA 3GMIA 1FNNA 1OTXA 3A70A 4NYJQ 4BE9A 3FYUC 4DILA 3ZFWA 1E63A 2A57A 3ZUGA 4J1TC 3ENNA 1P2DA 1JWFA 1XLVA 2BKAA 2IU6A 1EWYA 4MO2A 5LC1A 2E3JA 1JKMA 1M1UA 4M53A 4PTYA 4GSLA 4DCMA 1ZSYA 2ZYVX 1UPUA 2IPOA 3BK1A 2WIFA 5KPJA 3CLUD 3DJFA 4G1VA 3TLZA 5JS6A 1ZHOA 1XRRA 1VJ0A 4R2LA 4G0MA 4FD2A 3ISTA 4YMHA 1G8JA 5CEFA 3KSQA 2GCOA 4LHYA 5C8ZA 1RAEA 2IHVA 3L0ZA 1GSHA 1RI1A 2C7GA 4UHFA 1KQNA 3VYRB 3ZYZA 4DB4A 1N78A 4BIMA 1Q92A 2VYNA 2XKBA 2X9GA 3TLYA 4K5QA 4NNJA 1YNSA 4DV1B 1DO8A 2V9PA 4JKYA 4L3WA 4BQSA 1IPHA 2ZRBA 1FP4B 1KEVA 1Y3BE 4GRIA 1WDKA 1IVYA 1Q91A 2C4KA 2EJTA 3G8AA 3N5KA 4OBXA 1TMKA 3OMXA 3RLFA 4KWCA 4FP9A 3UJBA 2J8SD 3UI2A 4G8KA 4X97A 4PC2A 2ZAIA 5CVEA 4DUGD 1ISIA 2YQ4A 4QTTB 4Z1OA 3Q7PA 4AF7A 4D3DA 3AGQA 3ZHVA 2FDRA 2RI1A 5BN4B 1SBNE 2I4TA 2K4MA 1ZH8A 1CVLA 3WQQA 1T0HB 1N6HA 4L75A 2DEUA 4J6EA 4J94A 4YAWA 3V2UA 5ESWA 2R5FA 3NRJA 2F59A 4BQEA 3JALB 4AUMA 1O4VA 3AETA 3GEPA 1YZQA 4JJAA 4BWFB 4CFSA 4TSFA 1T9DA 2QL7A 2ZR8A 5GOTA 4B9AA 4P7FA 1Z0AA 2QZSA 4D9EA 6REQA 1GLGA 2A5UA 1TZMA 2CDAA 3RYHB 3BKXA 2HWXA 3SWWA 1F38A 3K9QO 4LMBA 1K4YA 1UM8A 1E32A 3AZQA 1YKFA 1E3TA 3EULA 5A04A 3M82A 1DCEA 4H60A 1IHUA 3M4JA 1Z7WA 4FZJA 4JXKA 4WOJA 1C1XA 4HFNA 1HDRA 1L4BA 1BKDR 2I6FA 3MEKA 3JUEA 4FR5A 4X9XA 3LCMA 1FJ2A 1NU8A 3CX8A 3K6RA 1TU3A 4BXOB 4TRNA 4KR3A 1ANKA 3KIPA 4H7YA 2WXMA 4AN4A 4EEXA 1XALA 4D25A 1F2VA 2J3QA 4X90A 3SK0A 5H9WA 4JGGA 3AMVA 3D8BA 2DR3A 2PS9A 1D2NA 4XVQA 2GYUA 3RIYA 3T12A 5A4AA 3FFLA 5LP0A 2WE7A 4OSOA 3KE8A 3SC6A 5IFLA 1EZ1A 3TLXA 1KIFA 3LU1A 1L7VC 1QAQA 5B7PA 4CEIB 4AY6A 2XUGA 3TRIA 2QZAA 4QE3A 4N0EA 2CDRA 2E6UX 1P45A 2OENG 2X8LA 4LKOA 1PJRA 3RVBA 1JVBA 1X15A 1RYEA 3RSEG 1NZDA 3KCQA 4QVGA 3WGNA 2ZIRA 1J8QA 4R1QA 3WTCA 1XD9A 1F06A 3HCWA 2XMPA 4CMGA 4LQ4A 4BQFA 2UYHA 3CG4A 1CQZA 3OF3A 1Q1EA 2FN9A 4I9CA 5HP4A 4DNFA 4ZOLB 1PZEA 4QATA 3R6DA 3AUXA 1KYTA 4BLWA 1WCIB 3RC3A 1X13A 3R5SA 4K05A 2BF7A 4I6JA 1NC1A 1U0SY 2QVZX 5E7MA 1JF8A 4E4RA 4F06A 1LS6A 5TC4A 2PX5A 4QAJA 3LPCA 2RKOA 4MS6A 3ZIAA 2Z9DA 5E1DA 2LE0A 3OCXA 2QROA 2Q9AA 2ZANA 3I0NA 3EVNA 5IDYA 3FTPA 3DULA 4H17A 3RLIA 3TIXB 3RIBA 4YVOA 3COZA 4KMRA 4D8XA 1GIAA 3SR4A 3EPPA 4QYSA 5I3CA 3MWDB 1SKYE 3ENWA 4BEWA 5JJCA 4B6EA 3UBMA 4D0GA 2PCJA 3OZGA 4C3ZA 2XJ9A 5BY2A 1J90A 5DP1A 3N2ZB 5EWMB 1JMKC 3G2IA 5REQA 1IDN1 1QIFA 3AHCA 3VMMA 2WUFA 3GUVA 3OFKA 3CNOA 2C3OA 3BWXA 2AFHB 3KUCA 3R6LA 1ISHA 3SNHA 4BV9A 5M3BA 1KDZA 3UBTA 3GOQA 1U7PA 1O54A 1ZWKA 4H7IA 3MV3B 4Z5XA 3PSHA 1W59A 3S2EA 1A8QA 3OAAA 2CFZA 1J6UA 1SBCA 4QREA 1GZ4A 1PWYE 2ECKA 3IO3A 5NLLA 1L7MA 3SVZA 1I6LA 4PGFA 4MWEA 4F2HA 1XPOA 1QH8B 1UPBA 3NHZA 4WZBB 3L0YA 2QVBA 5INTA 2PUFA 4ZV9A 3B2QA 4IGKA 3WFZA 3C98A 4ZXPA 5KOHA 1FS6A 2FV8A 3HJBA 4P2BA 3ECSA 3FUDA 1ST3A 2QMOA 3STUA 5KOHB 2A30A 5F21A 3ZHCA 3J80A 4P1ZA 1OH8A 2B36A 2IC5A 3KWLA 2WWFA 1U0HC 5KYTA 4J29A 3NGMA 4TKUA 3LL7A 4KQEA 4AG3A 4JX8A 3JXIA 1ULBA 1E8XA 4RL4A 4DCUA 4ZK2A 2I4NA 4C4YA 1H2AS 4YLYA 4QM6A 5C5EA 5CYGA 4X63A 4HI9A 3CZQA 4NYIR 4DLXA 3W2FA 4O3FA 3S44A 1NUQA 3UJAA 3UM0A 2QVCA 4OV6B 1LPBB 2H51A 2JBHA 5EHQA 4GYYA 5A4MS 4ZALA 4D9NA 2EJCA 3C3DA 4UNSA 1NHWA 2D8AA 1KPSB 2QGZA 3MA5A 4IRUA 3W8EA 3UAOA 3JYPA 2ZSEA 3G6WA 4AWXA 2ZKLA 3AY6A 4JLMA 2P35A 1NL4A 3L5KA 3ADBA 4WZ6A 3BMCB 4WJKB 3GJSA 1EDOA 5B1DA 4DMKA 3Q7TA 3B20A 2HBRA 3ASYA 2R62A 4BMNA 4IINA 4N7BA 5B53A 4ALNA 1YC2A 4PO8A 5LFAA 3W3AA 3CTPA 3OWXA 3U4IA 3L8HA 2EINE 4Q4AA 4FT4A 5DCLA 3SDBA 3OXLA 1D8DA 2C61A 2XZOA 4L27A 3NHYA 1I2DA 1NVAA 2NUAA 5FZQA 1TJ3A 4KV7A 1ZN8A 4IEFB 1PT9A 2PD4A 3OQJA 4UM8B 3WWEA 1NNEA 2XOKD 1X81A 1MDFA 3QV1A 4LYAA 3BE8A 4PZDA 4QDZA 3TDKA 3V32A 2WWGA 3ZWOA 3ASVA 4RTQA 1F1JA 1MO2A 3MT9A 1XTQA 3B52X 1DWPA 4H7DA 1PJBA 3GLVA 4E5VA 2I8LA 4IWYA 3OTNA 2HI0A 1GPJA 3TW0A 1DKMA 2NUTA 4JA7A 1I24A 3JQFC 4NL4H 3UA4A 1CFJA 3W06A 5L3SB 1UADA 3JWIA 4IYJA 1R0BA 4IQ4A 3C6MA 1GL3A 2ET6A 2NGRA 1P80A 2PRZA 2VN8A 1L8QA 3CLTC 3PKZA 4JEIA 4EYGA 4CL2A 1ZMOA 5JY6A 1AHHA 5EZSA 2NMVA 2VJYA 2XB8A 2ZIUB 4YAFA 3M6FA 3IALA 5I7SA 3QC1A 4BPRA 4O59O 4XPIA 1MHPA 2UKDA 4MVWA 4WFQA 1IE3A 1Q1QA 4HAOA 2BLNA 5EKXA 3VTKA 4EB8A 5JT1A 3GI1A 2HA3A 1TDJA 2VPIA 1Q84A 2D00A 4UCXA 5IDXA 3BJRA 3MJSA 1OA1A 5CG2A 3E58A 4LNAA 4V0ME 4V38A 5BSKA 2W4QA 3S7FA 4Z68A 2NXWA 3QX3A 4M0CA 5J2TB 1M1NB 3NBFA 3R4VA 1IZ9A 5LB4A 5ERYA 3NYQA 2ATEA 3PC8A 2B82A 2DFPA 4F12A 1MG0A 1RADA 2JAWA 4G0QA 1M2OB 3SFTA 5EYPA 4G0ZA 4QQNA 4OHWA 2CYBA 3L6AA 1XZDA 3PLNA 3K9GA 5DU2A 5F1PA 3NIGB 3EBPA 1AVTA 1SZJG 5DE3A 3W5JA 1AQJA 5BW8C 3G5AA 1J0XO 2BFDA 2PX6A 4IHJB 2YASA 4ZU3A 4LJ4A 5B3AA 3DEPA 2V55B 4V0KA 3KHTA 4EW1A 2Z2KA 4ZN6A 1M6NA 1R9GA 3IILA 1MOPA 2X1LA 5IASA 2RGEA 4TWIA 9ABPA 1DBVO 2PKCA 1RHRA 4L5BA 4CR6A 1DAMA 2F9LA 2GDZA 2I1KA 2JGRA 2W6ID 2XEDA 1QG4A 3PPVA 1WG8A 4FGWA 4Z9YA 5KSWB 3O8RA 4WZBA 1NGSA 1RWNA 4RPKA 2G9ZA 4HLCA 1YC5A 1JIKA 4BVAA 4PRKA 1VHWA 1C0LA 2FG7C 5K8VA 3W8RA 1LUAA 1UC4B 4TTTS 3X1DA 3NB2A 1KHTA 1IVNA 2GXUA 2H52A 2FE4A 1CBUA 3K0CC 3VO1A 3JQGB 3ZDEA 2ZR9A 5I7FA 4BY6A 2EGHA 4WNYA 5BXUA 3TOXA 4DUYB 4GL2A 2Y66A 4PLCA 3TI7A 3I30X 4B3XA 3ITKA 4N65A 2REOA 1ZH0A 3NBKA 1KDVA 2HPAA 3GJQA 1XZFA 4LAFA 2H85A 4BBZA 5JSUA 3ZXIA 3GRKA 2PH1A 2J3HA 4J7AA 3LGAA 3I4RB 5DHTA 5B64A 1GGKA 2B25A 2RH9B 3DZBA 4WDRA 3SSAA 3HXBA 1KBOA 3LPLA 2FHPA 2VF7A 5CK5A 1FZQA 3W77A 3AG6A 4WBXC 1JT9A 5H4GA 1NF8A 4ZZ2A 4BO8A 1DXYA 1K7FB 1Y9AA 1B89A 2ZIGA 3LT2A 4II2A 4KXXA 1HT0A 3LFHA 4V24A 4AURA 3LNCA 1Z5SC 4GCNA 4MLCA 2JFNA 2BZ0A 2C5SA 1O6ZA 1V8DA 3AJDA 1WZIA 3QE2A 4NS1A 4Q3EA 2XCIA 4AO6A 4I6EA 2PCLA 2UZAA 1PN3A 2EU8A 3A6KA 4FEEA 4JITA 3L4BC 2XQGA 2BTQB 5CW2A 4UEOA 4KLRA 3PFGA 4A0FA 4KCGA 3H3FA 3JAWB 4ZP1A 5HOEA 4RTMA 5EMMA 3L9WA 1KS9A 3QAQA 1U94A 3HB5X 4CEHA 4GKAA 4CG2A 1MABB 3PKJA 5ENQD 4RD3A 1TQHA 4BYGA 5CBKA 2BGJA 2VNJA 3CB2A 3JUIA 1P7ZA 1PTKA 4GTPA 3EHEA 4S2EA 3HVIA 5C37A 4ML3A 1LSUA 4A91A 1N5IA 1JLSA 2VRCA 3SLRA 5EP1A 1Z3CA 1CUJA 3HYLA 1UFOA 2Q4TA 3R7FA 1W2GA 5ICSA 5JRJA 2ISQA 1ZD9A 1E1CA 3P9PA 3N70A 4G1MB 4QUAA 3SZUA 5B1YA 3TG2A 3B12A 4H9GA 4KKXB 2D1TA 4BO5A 5KCMA 1RCTE 2O07A 4B93B 2OV4A 2WINI 3PGA1 1L1FA 2P91A 1R0YA 1RMQA 1E2JA 4M7PA 4HNAA 4QODA 1FDRA 1ZM3A 4G24A 2CFRA 2VHYA 4RHCA 3QVLA 2P90A 1IHOA 3IDAA 4KFUA 4G4SP 3QXSA 2IBSA 3KLNA 4YGXB 1VA4A 3ZX5A 1OZAA 1AD2A 4YJ3F 1ARZA 2GGSA 3L8CA 4GUDA 4ZOCA 2NPIA 3TAXA 5FI5A 3M6UA 1GZDA 3RIEA 5AI9A 2C9CA 3QVOA 1T9ZA 2GD2A 5DBOA 4WWOA 1SUSA 3QXHA 3A6ZA 1T8RA 1PHPA 1OIWA 1AN9A 3NMUF 1V95A 3IDQA 4PPFA 4D8TA 4AP9A 1NC3A 1MO4A 3ACDA 4WADA 1QR2A 2XNSA 1YQUA 3EQ7A 4KKVA 3PXGA 1ZJ6A 4MWZA 1UOOA 3PX7A 1NPYA 1RBMA 4TLCA 3SD7A 4XE0A 1GL6A 1E3LA 2QN9A 2ENWA 3ZRHA 3L1HA 2YCLA 5JXWA 1QU3A 3EEOA 1L2TA 4XEHA 3EA0A 2D74A 2FPMA 5GONA 4L02A 1EVJA 2R4TA 1GZHB 2C2WA 2ODNA 2ZJAA 4I8XA 4QWMA 2LAHA 3D8HA 2IYUA 2W6PA 4II3A 5BVGA 3BE5A 2P4QA 3C3XA 1T91A 1O5MA 5F9FA 1ZN7A 2AA3A 3B9PA 5CHEA 3ISJA 3A1UA 1U0NA 3PXEA 4WZBE 1GG5A 3QE4A 4XUGB 4ZICA 5KVVA 1H4VB 4EG8A 1RXYA 4TGLA 3ZGVA 1OZFA 1SOWA 2YWDA 4MW0A 2A59A 4CTNA 2O54A 2BBTA 4R2HA 2EATA 3G2NA 4IHKA 2IK8A 4AYTA 1I1OA 2Q8PA 2J3IA 4Q1VA 5FIOA 5K8CA 2XA2A 1A98A 1V5WA 2J6BA 5THQA 4B5LA 1FU8A 1JA9A 2ZB4A 1WKBA 3K53A 1BMDA 4LDJA 2YXLA 3I37X 1N7HA 4CU5A 4EG4A 2ZJFA 1Q7EA 5EQDA 5H68A 1K4MA 2CFSA 3DDNA 3BHIA 3EUAA 4PSAA 2XQKA 1J49A 1O6GA 1TEHA 3LG2A 1P2SA 1GU7A 2LSUA 1P4RA 3OQ1A 4AFNA 1HURA 3FOBA 3WB0A 4CTJA 4BB5A 2FFQA 2XSZA 2WJAA 3FTXA 3HBNA 2EIHA 4IVQA 4YBRA 3T5BA 3ZNOA 4BYMA 4W5QA 4JV5B 1NJ8A 1ZCFA 2OAQ1 4OYRA 3G9XA 4X45A 1RXVA 2ZU6A 3LDHA 4BC1A 2ID8A 1ND6A 5CEJA 1MUUA 2ZU6B 1DEOA 2P4HX 3FKSD 4O4LA 3WJ7A 3DBOB 1S2GA 1B0ZA 3AFGA 5KYVA 1F0NA 3P9NA 3DTVA 2FR8C 2J0UA 2GETA 1M67A 3TSCA 2A35A 2QJOA 3OZSA 1DQPA 3CT4A 1DIGA 3AW8A 3QA3E 4GUAA 2FN7A 5IBQA 3SKVA 5AN8A 3DZCA 2BGNA 3L4JA 2Q3CA 1C7FA 4O2AA 3LS8A 1WB5A 2VKTA 5L4LA 1IXKA 1O8BA 5IJ0A 3GELA 4DMFA 4DARA 1UDWA 1JWBB 5EE9A 4MGEA 4TLEA 5DWDA 4YUXA 1PU2A 4LCJA 4MQFA 3F6PA 3WQRA 4HN2A 4MVYA 3A2KA 4M38A 1RWKA 3PNVA 4N18A 4RD1A 3KDSE 4WZAB 1KYIA 4FYVA 1QKKA 2QS9A 4X41A 3U4TA 3IV0A 1JJBA 2IXGA 4X8MA 4IKEA 3QKSB 1BFUA 4DPLA 1TPZA 1RFLA 2EZ9A 1Y3DE 4F9GA 2BFCB 2HCRA 3ZVRA 1PSDA 4EG1A 1O95C 2HR2A 4Q7KA 1TK9A 4LZOA 3L08A 2PLFA 5HMMA 3RS8A 1T10A 1G7RA 4LZLA 4PLHA 2VAXA 5K9ZA 4N01A 3HEMA 3JRWA 4TXHA 3BFJA 4LSWA 4EIWA 2K5UA 3B6IA 4BO2A 3GP5A 5KDLA 4I1SA 4GC9A 4GI7A 4YH1A 1XMVA 2BUAA 2NV6A 5KI6A 2B2XA 2V5UA 3WJ1A 4BP1A 4RQIA 3VNAA 1XYGA 4XJTA 4GG1A 2RB4A 3F3SA 3O2QB 3QNKA 3ABRB 4GICA 5TF4A 2B69A 4WXYB 4B73A 4GMJA 2R1TB 4BGDA 4ITVA 3FDZB 1PIWA 4ETWA 4TLAA 2REBA 3RHFA 2CFIA 1Z13A 2ZJ3A 3H1TA 3CZAA 3N2LA 4KITB 3K6JA 3NTQA 1N95A 4EAQA 1MH1A 2VG8A 3FN4A 4KOEC 3HCOA 5IUNC 2JHFA 4QYTA 3HP7A 1DMRA 5AO9A 1H2FA 2ZBGA 4R2XA 3M34A 4NESA 3BXGA 1NT4A 3HRIA 5TEWA 1MX4A 3B7WA 4C87A 3KEZA 1U7TA 3OECA 1Z5WA 3TJZA 5I9MA 4FNMA 4EB6B 3G8DA 1UWKA 4Q4DA 4CMKA 4D9KA 3S28A 2X2FA 1UJNA 1J33A 4RVNA 221PA 4DWWA 1ZKMA 1TJYA 2EKPA 3NYWA 2JS7A 1Y7LA 1BIFA 3I5PA 1A9ZA 1H3NA 1DOAA 4I8DA 1KO5A 1R50A 1ECGA 4KMOA 3S29A 2O2ZA 2EIKE 1Y5MA 1EVIA 3WC4A 2WKWA 3RAFC 3AC0A 5DYYA 2V54A 2OXIA 4J0CA 2SICE 2FJ0A 4WCFA 2OHXA 2CCJA 1JW9B 3JWPA 3DE7X 3P0HA 1QK4A 4ZEMA 1N0QA 4J8DA 3N8GA 2L0TB 5NULA 3WGOA 1U6KA 4B82A 1O5IA 2V7TA 3AU8A 1YGPA 2JGKA 4EMTA 3FLMA 3WWPA 4PC1A 1QB8A 4LTDA 3RTAA 2I62A 3LW7A 2B3TA 4EP1A 5FUBA 4LPKA 3TZLA 3TLCA 4G0OA 1T4DA 2XOXA 4UM5A 1KZ4A 5KX5A 4CM4A 2V0GA 5AYWD 2CUZA 2GAIA 421PA 2NSZA 1JH8A 1I6MA 1ODJA 2WP0A 2Y0DA 4PTZA 3AKZA 2AR9A 2F1JA 3DBHB 4ZGWA 1JKXA 2CVFA 1RJWA 1FUUA 4UAVA 4C22A 5IXSA 3IE1A 2CLHB 3I58A 5HCNA 3RTDA 3VU9B 2VWHA 4UNNA 1J2RA 2HNKA 2JRLA 3DHVA 2C3UA 2MSWA 1WZEA 3PENA 5FJJA 3E4BA 1NJGA 1PZXA 3T7EA 1HMPA 3GEEA 2ZYRA 5SY6A 5BV7A 1WZCA 1Z6GA 4M1QA 1GQ2A 1ST2A 1IXRC 4K03A 4X94A 1QE5A 2C54A 3O8OB 4IXNA 4UVEA 2PXCA 3BH6A 1G66A 1NF2A 1TNDA 1N7GA 2AMFA 2EG5A 2VDUE 2GRRB 1O6BA 1V48A 3HJNA 2EWWA 4RF2A 3ZCXA 4LRTB 2XUFA 1G16A 3SZ3A 2I7VA 4X8QA 3U0VA 1T6BY 5D0QD 3BCSA 3OCYA 1G3IA 4D45A 3BL5A 3ERCA 3H2YA 1QP7A 2P9ZA 4EA9A 5JRZA 1GAQA 1PE0A 3KVRA 4N6OA 4I8IA 1FPQA 3MW8A 3TIIA 1MGPA 5K0CA 3EXEB 2HLDA 4OAPA 2A8YA 2UXCB 1GWNA 5IBPA 3R74A 2W9XA 1E2QA 4XSHA 5ED4A 3ND8A 1ZI6A 5HRUA 2XX3A 4I4TA 5EYPB 4QOGA 2CJPA 1ML3A 3P0EA 4XM2A 4GKKB 4O60A 2DX7A 1SVXA 3DUFB 4HEA6 4MS3B 4UBKA 3TS1A 1I0IA 1UPAA 2C77A 1J7JA 1OGIA 3K8OE 3R77A 4H31A 4WLEA 1SZ9A 2B8EA 3NT5A 5FKJA 4Y6LA 4EYQA 5LOZA 2P4EA 4Y2JA 4ITUA 3JY6A 2ZUBA 2M2IA 4GYKA 4WAFA 3PX2A 3K6SB 2GYVA 4FCCA 2YYAA 1C9YA 3PL5A 3HA7A 3P94A 5JG7A 1MZVA 3CUVA 2DVMA 4ND5A 3V8QA 4FMDB 2WM8A 1Y37A 3BTSA 3OZCA 3UAVA 5HEKA 4HVCA 3S4YA 2FR0A 4C7XA 5FUYA 2G1PA 1ZCZA 4XB1A 3MJWA 2XQ0A 4QOJA 4PBTA 3RK1A 1ECFA 2FWAA 1IQPA 4FT2A 4PANA 5J5CA 3ZEAA 1DKOA 4O4IA 1VCMA 3BPSA 4MP3A 4OP2A 2XITA 4M7WA 4EY5A 1QC5A 1G21B 2GVZC 1LTHR 3P9ZA 4YP1A 2VT2A 3OCWA 3A2NA 3HL4A 5EWMA 1C3VA 1BD4A 3RABA 3GVCA 3IQXA 1LWNA 2D7CA 3E9YA 3DXKG 1U8FO 2EEPA 3G5MA 1VL1A 3AJAA 4TYMA 4MULA 5ENTD 3SSNA 4CLEA 2XXAB 5LX8A 4YDSA 3TNDA 1U4NA 4L8GA 3VKWA 5TLSA 2I03A 2GAFA 3AVTA 1MOQA 3W5HA 2ZLBA 2XT6A 3DM5A 5KNBH 3KSMA 3OKAA 2QORA 1P3Y1 3R7NA 1V3VA 3E2MA 1YOVB 3ODPA 2JEKA 3OJWA 1PJAA 1E7QA 2FF4A 2P2GA 3FPLA 3EH1A 3C8UA 3H6GA 4IIGA 1K8RA 1YQTA 3MCVA 3CUYA 1NP3A 2FP4B 4ZT3A 3E53A 1YDEA 3RGGA 3W6PA 1BE8A 1KWGA 3IIJA 4ETIA 4AVYA 5DMHA 3LPZA 5J4HA 5CM9C 5CCBA 3K70D 3DSRA 3E4CA 5JJIA 3AS8A 2QYJA 3SBTB 2CYAA 4ZT5A 1N6RA 1GQRA 3WLRA 4RZUA 1SH7A 3SLGA 1KH1A 1M34B 1ODFA 1R5NA 2DU8A 4FK8A 4OH7A 3JQBC 5CYPA 5FUWA 1UJBA 4HYEA 3UFXB 1D2RA 1V8PA 4P98A 1BVRA 4BX0A 4R0MA 5KQGA 2FEWB 1N2GA 1YS1X 2HCTA 2PTHA 1A9SA 3UJHA 2R65A 1X77A 2D5BA 3C85A 4UUPA 2ZAOA 1L5ZA 5IABA 1TQ8A 3WE7A 5JQWA 1ORIA 1Z0KA 1N8TA 4UWLA 2J9FB 4G97A 3HHPA 4Q02A 4D98A 5AQ1A 4JFAA 1PCXA 3RVRA 1E2UA 4LGMA 3CW9A 3NHWA 3RU2A 5HYVA 4OF4A 1MH9A 4FNGA 1CY0A 3FCSB 4JI3B 3WFIA 5B12A 5EXPA 5B4UA 5LIRA 1G17A 3VR6H 4OJQA 4NXMB 1E6LA 2OUKA 4OAVB 1PR4A 2WJGA 4TVBA 2HDWA 2OFWA 1Y1TA 4NQRA 5L6LB 1HYQA 3CR8A 3NR2A 3NF1A 4HQ6A 4DDMA 2WOJA 2UYCA 1FFDA 5I47A 2UUBB 2R97A 2Q8QA 2FSVC 2J8ZA 4CM8B 4KZPA 4B80A 2GLTA 4XTCS 3QVUA 1A04A 3BYZA 3D1JA 3PTZA 3EQ9A 1G9SA 1OKKA 2XPZA 1X7XA 1XEWY 3EVGA 3QYJA 4II7A 4V0LA 4XWYA 3VISA 7REQA 4BFZA 5KBAA 2Q2NA 3ESDA 4KACA 3TEFA 4C4PA 5KYKA 3FMFA 1R6AA 1BVUA 2XZTG 1UBFA 3NT4A 4H4EA 4N03A 4CMAA 1ZISA 2PUWA 1FVOA 4L78A 3GCWA 1IUOA 4G36A 1KEPA 2UZ3A 4OXNA 3AUUA 4PF1A 1UFQA 4GTVA 1CUUA 4ONEA 4E33A 3L7BA 4P33A 4GGMX 2NXCA 1KZ7B 3C87A 4DSUA 1CJBA 2ZYWX 3IHTA 4ZQIA 5AHWA 1U0EA 1DJMA 4S1TA 4MW1A 10MHA 1EP1B 2PZBA 1XQYA 1GR1A 3VDXA 5THKA 4AWAA 5K09A 3U48A 2YC4C 1C7RA 2PFKA 1Y9DA 4PWZA 4WESA 2B4YA 3U3MA 2JLQA 3TNLA 4G4IA 3KOZA 1T2UA 3P0JA 3B3JA 5CFLA 1ESDA 3QWIA 3ENEA 2BSAA 4HEQA 3R9MA 1GNPA 5D2MC 1W5AA 4CM9A 3AJRA 2GK4A 4N6GA 4OAOA 1H1TA 1KEKA 1U8XX 4LECA 1CE8B 3BMXA 2EJVA 3A1NA 4HEA1 3HVJA 5DRTA 3A27A 3D0OA 5G2OA 3QE0A 3DVLA 3AY0A 1WV0A 3MYYA 4TTVA 4RZQA 5AXDA 3KKNA 3V2GA 3R3ZA 2W8BB 2GNAA 3SBEA 1O1RA 2H1IA 3FJ1A 1A9QA 3OXGA 1DRVA 1OUVA 1WAO1 1MVNA 2B3DA 2VHVA 3DTVD 4Q00A 3WP1B 3KKOA 1TNYA 3RIGA 2H2AA 4RMHA 4AO7A 4LNUD 2FMUA 1PQPA 5LBTA 1N6OA 4H6VA 4EMSA 1A27A 4AROA 4FJ1A 1W8DA 2VUIB 1N5MA 2V5FA 5HKPA 1XEWX 2IXFA 3AERB 1R5JA 3C1UA 2GZ3A 3HXPA 2WABA 1QHNA 3SQLA 1J0BA 3T1HB 1GUBA 2V4UA 1PR5A 3ICPA 2Y1WA 3UJ3X 1EE9A 1B16A 3JPWA 4QG7A 3FNIA 4A6PA 1NQ5A 3GFGA 3CVLA 2I3ZA 5LP6A 2ZRFA 4APFA 4M7CA 5HUHA 3MMSA 1Y42X 4RKEA 2C2OA 2G07A 1I0LA 4G8JA 2I76A 4PZ9A 1VI6A 2OXFA 1W8IA 2VF4X 5IVKA 3L41A 3ZGOA 1DZ3A 1TAUA 2VJQA 4MRNA 4O1HA 5LQSA 1K06A 3DBLA 3O47A 1SCJA 4B8ZA 4DL9A 2KB0A 1D2GA 2V0PA 1B14A 2AOWA 2W2KB 3IA7A 4GEGA 4V2UA 4ABYA 1WL8A 4FPXA 1XO1A 4IZHA 4P58A 2A67A 3N2NA 4UHEA 1CEQA 1ETUA 3U1VA 3INNA 4W63A 1VJ5A 3EMKA 4YUWA 1EDUA 1BNCA 3BCRA 4NOKA 5PNTA 1WB6A 1GAJA 2IBMA 3NLLA 3VR3A 3E30A 1T5LA 4BJ5A 1LVUA 1IXSB 2BZSA 5JHBA 2XAUA 4J6IA 2BFPA 4NCKA 3AEXA 2PZKA 5K3DA 1JB9A 4UM7A 1SQ5A 5A9TA 2BMVA 2NU6B 3IUYA 4JK3A 4RESA 5EUMA 1USGA 4KT6B 3AHGA 5IJWA 4Q3OA 5C1BA 4DKJA 1I7LA 3HCCA 1KT0A 4BWGA 4JGIA 5JSHA 1RZRA 1CQXA 1JKJA 1YZUA 5ALVA 3ZIMA 4CM1A 4PLGA 4ZV7A 3EJWA 1DG9A 2G04A 4UREA 1JKJB 1K9SA 2WU4A 4KYTA 4ZZ1A 4DXAA 3NI2A 5ELXA 2BT4A 1H23A 1SPBS 2PL3A 3B1WA 1W87A 3OJCA 3ZKJA 1DAOA 4BASA 1POWA 1SCBA 4MI6A 4ZO9A 5FORA 4BGVA 1XJ5A 1OLXA 1Z15A 2PGXA 2SBTA 3KQOA 2ZQYA 4NOMA 3SVTA 3S7BA 3MUEA 4C05A 2BR3A 1ZW6A 1GPBA 2XVMA 3NTXA 2YWCA 4Z9FA 3V34A 1RZUA 4RSMA 4DCGA 3ZHUA 1NI4A 4UQZA 1AOXA 1EWTA 1FSZA 2YQZA 5G4LA 3D6FA 2CMGA 3T7KA 3G0OA 3L1KA 4ZVQA 3NBXX 3NBNB 2BEUA 4ZT6A 2LDBA 4YGYA 4BBPA 4D57A 4IFBA 4JUFA 5DM70 2Y92A 3RU3A 2I8AA 1Z07A 1KC3A 4PICA 2ZXWE 1FB5A 1P6UA 5GADl 1HTWA 2GESA 4CGVA 1Z38A 3KC2A 3HWWA 4A0HA 1U90A 3Q9LA 3Q40A 2VJLA 3IXLA 1T8TA 2Q4DA 1K98A 5L53A 2NZVG 2N1MA 3ACBA 4Z4EA 1DAKA 2RGDA 4L5CA 1LW7A 1DKPA 3JZFA 3PEFA 1DTWA 3T3DA 2CB0A 4J7CA 4DJAA 3QFRA 4EENA 2M63A 3O82A 1K1AA 1ILWA 1AGNA 1S8AA 3D3WB 2XMRA 4S1OA 2VK8A 3J5PA 2DRIA 3ZWQA 1TVKB 3L6CA 2FOIA 3QMMA 2P79A 4JVMA 4E11A 1AV6A 4PCLA 3C5RA 3FZNA 1P7WA 1TVKA 4FX5A 1JILA 5CDGA 1EUYA 3LKBA 5G1OA 1H4QA 3OH8A 1GFIA 2R17C 2PX0A 5EJ9A 4G9EA 1N6IA 2WTUA 5ILOA 1QONA 3AFNA 4E51A 4M36A 4U2BA 4TMTA 2OBXA 2AXQA 3A11A 2QUIA 3HDQA 1IEVA 4HS9A 4A55A 4QDUA 1NXPA 1JDJA 2FPGB 4NSNA 1XTZA 5CFRA 3H5AA 3IPAA 3NCHA 4YI5A 5EIBE 2DPHA 4JZKA 2XBLA 3A36A 4Y2YA 4Q7QA 3VQTA 3DSXA 1C81A 4ATNA 1DE0A 3C1AA 1XRJA 3DOJA 4GX1A 4JNKA 3LKVA 4A92A 2XAAA 2X5JO 3CURA 5AKLA 2W58A 4CMEC 3BQ9A 3KLPX 2ZYTX 2WPDA 4RQAA 4IVRA 3HNRA 5CDFE 1MHQA 4MMZB 4ZCLA 3V31A 1JFRA 3DH0A 3JQRA 4WV3A 3AY7A 3CQCB 1K5GA 3B5EA 1YV9A 3UEOA 1TF2A 3I2KA 4XX5A 2OV1A 2C2XA 3CLSC 5FNVF 5FPHA 5GVSA 1P91A 5HIMA 2PV7A 3C6YA 3KKLA 1N34B 1YZKA 1AKYA 3TKYA 2DSTA 5BNTA 1JHMA 1ZM2A 3EK2A 1Z6YA 1BWSA 5SYAA 4EJ6A 2RHRA 2YRFA 3G2MA 3M9LA 2QLTA 2C2GA 3N8HA 4G07A 3GPBA 4M0FA 4Q9DA 1SUCA 3KS9A 1R37A 3KTOA 3X44A 3LS2A 3O3MB 1Q5PA 5AW2A 1A8HA 1OLOA 3I1IA 4WL0A 4LUCA 3CXRA 4DDKA 4A73A 4RE6A 5BOSA 3PT9A 3ZW3A 4NE2A 1EX9A 4R51A 5FYQA 3FTFA 3IEMA 1D03A 1PZGA 3AOGA 3OJ0A 1CQJA 4R54A 1ZJ4A 2QV7A 3CJTA 3SCZA 1FMFA 4C3OB 2FQQA 2FK7A 2HLPA 3PS6A 5LQJA 2FB9A 1U3CA 2Z9BA 3FZEA 1UK6A 3HJAA 1H93A 1NXXA 2ILTA 3RC1A 4RQBA 5LA6A 4Q4AB 2C95A 2WMDA 4HB2A 5I7HA 4RFLA 3E61A 1RU3A 3RUCA 2ONZA 4XD7A 4BT8A 3FSGA 3L7OA 2FPSA 2O1EA 4TMFA 2QYTA 4WOBA 5CIWA 3BIXA 5T3UA 3VX4A 1IUNA 1T26A 1X2BA 2GA8A 3CWQA 3Q1LA 2V98A 4DJEC 4IGAA 5JMWA 3THYA 2FSPA 3OEHD 5ALUA 4PYOA 3OURA 3RUDA 1Y6GA 1HFAA 4M0MA 3AZOA 4WKOA 3DL7A 2ZT5A 4AICA 2BISA 3GAFA 3PUZA 4KNVA 4INAA 3VYWA 1RXEA 3KJIA 4EYSA 1E8YA 1T5SA 1G8FA 5IPFA 1NBEA 2GPYA 1T6ZA 1Y98A 2F3PA 4ARUA 1GGHA 4OATA 1P1CA 2EWMA 3NEPX 3JQ9C 4YCLA 4MR8B 1RKXA 4RVBA 1KYXA 1GL7A 3DEYX 3D4BA 2IY8A 2QRHA 3L8DA 4J8FA 3QLEA 4WGGA 5LP1A 2BF4A 2D62A 4FGLA 2QAIA 3CRZA 1AQNA 1ZFNA 4LFAB 1K7YA 2DTXA 4HQDA 2F37A 3MELA 4KAXA 4NBSA 3ZWAA 3K9FC 3EW9A 3QLJA 3N2YA 2MINB 3WMRA 3BF7A 4EO7A 2BH9A 3WRYC 4PE5B 5EXSA 2HRQA 3M89A 1TI7A 4KSCA 1M1YA 4V0RA 5DO9A 2R2LA 5FFNA 2Z9CA 3ZV3A 4BN5A 1LPNA 2Q29A 1G55A 4AMVA 1D5CA 3TWSA 4EGCB 4MB0A 3FOWA 4WOKA 3TJRA 3VNRA 1EM6A 1MB0A 3BWEA 3C3PA 3OUTA 2BGRA 3FPAA 3SQMA 1KEUA 1P7PA 4KR7A 2ZSJA 2WTBA 3CLTD 3AF5A 1WY7A 2YYYA 3TB4A 3KVNA 1ZRHA 4QGBA 4KXVA 2BR4A 2HWKA 3RYCA 3MMZA 4ZRMA 1OLUB 3D2AA 1Z4KA 3SICE 1JIQA 1W96A 5CFNA 3F7NA 2J07A 3PE3A 3DCYA 1KJYA 1XGKA 1ZU5A 4G0NA 5EMHA 4D0NA 3BGIA 4KB5A 1FP2A 2FH5B 2ATCA 3I9NA 3F67A 3INTA 3QEOA 4O8ZA 4TUYA 3TTVA 4HLEA 5IZCA 3RH0A 2BTEA 2CNOA 1ZIDA 2CCKA 5KTPA 1QAOA 3KYDB 4P3OA 1G9TA 4IL5A 4NAHA 1QVWA 4QRHA 4R8VA 4B3TB 4IFTA 3A3NA 3UUFA 1T43A 4QNMA 9GPBA 2NP6A 1RRVA 1OLSA 3L0BA 1KI4A 4MGIR 1U1FA 1FDTA 4K9MA 1KU6A 4DCJA 2XGSA 1Y6ZA 2HMSA 4AY2A 2X4LA 5JXJA 1ODKA 3NC1C 4JENA 2A9PA 4U39A 2NACA 1B8VA 3KPYA 3U7GA 2WBLC 3CX6A 1MC1A 1O6CA 1CEYA 1IAVA 4JDUA 3FWPA 3ESKA 2E9SA 1HSOA 1BDMA 1S9HA 2NZJA 4BFVA 5FUMA 1RHKA 2H16A 1MX5A 3VU3A 3M7IA 5A3JA 1ZRSA 3COVA 5KKNB 3DMYA 5IFKA 1XDGA 1NMSA 2QRKA 2GX6A 2Q9CA 1SBTA 1ZHFA 4I36A 3K9LA 4DWOA 4UZEA 1UEXC 4BO4A 3SI7A 3CRVA 3O8NA 2NU6A 4U8HA 1RRMA 5ECGC 2AEFA 3VUEA 4H7HA 1SKQA 2W2VA 4HRXA 5KJ6A 3BD9A 4MI3A 4OKNA 1RVDA 1DT3A 2C5FA 3UMFA 1AA6A 1OSNA 1G291 3JQ8B 4WNAB 1Y8ZA 1Q77A 2AN3A 4AK9A 3TR5A 2DP4E 1GEEA 2PFGA 1YB1A 1XA3A 1ZD2P 1N4PA 1NPTO 1PX2A 3LBHA 1EFPA 4HAUA 2C0MA 3UCXA 5T7BA 4BEPA 3UAZA 4JC0A 1M33A 3ZY6A 2WXKA 3SF4A 3NOXA 4NFHA 2DWUA 3VJMA 1NDUA 5DW0A 2H8GA 2YNMD 1IZ7A 1AQ6A 2BKXA 5MGBA 1S2DA 5AYVA 4O4HB 1NOKA 3KCNA 3K0CA 1SK9A 3BWMA 1IMOA 4EJSB 3OM8A 3WIUA 2WWYA 2BEUB 3GCDA 4TL6A 1FUIA 3KT0A 3EIXA 4W6QA 3W7BA 2PEZA 3LCVB 4XPIB 1WMBA 2IUTA 3FUKA 1CD5A 1U1GA 4OB7A 2H06A 4K2AA 1E7YA 2XUQA 2Y4NA 2GRQB 2ZI7A 3ECAA 4JBHA 4X6XA 3TSZA 1PTJC 4B48A 4YMUA 1N1MA 1X1EA 4RMJA 5KYYA 1JDBC 1XD2A 4C7BA 2O6LA 2J87A 4IFEA 4IWNA 3TTUA 4CMCA 3FWYA 4O0MA 5AKIA 2VRNA 3ETHA 3HVEA 4PO9A 2UZ4A 3HA2A 4C29A 1ES9A 2VDMB 2Z4TA 4D4LA 3R24A 2G0AA 4XZ3A 5BN3B 1WV1A 4IJWA 3ESAA 1IL0A 2CZQA 4JXTA 2HREA 4ZPJA 3RS2A 3K5HA 2DWZA 2J3LA 3FTQA 1XQ6A 3QVGB 2VHJA 4F6LA 4I17A 1WXWA 2X6KA 1ZBDA 2G6BA 2WT4A 2IKSA 5AUQA 4CDGA 2BFDB 4QLOA 4QTUB 5HFJA 3N2GA 4K5AB 4Q4CA 1A17A 2FSGA 2FW6A 4IV0A 5B37A 3USES 3B60A 1GKYA 3TX2A 3ADKA 1M6VB 2BOVA 2XUPA 3FF1A 1HO8A 1CZNA 1H5QA 2PHZA 2X6TA 3AF3A 3G89A 3QFTA 5DGIA 5IXJA 2D1QA 4MP6A 3U4HA 4CKBA 5MFZA 3U3ZA 3MCAA 4AWBA 2AXNA 3NDJA 4QHYA 1OXUA 2FUKA 3B9QA 4R8LA 5ALMA 2C99A 2QUAA 3M5CA 2JD2A 4D4HA 4IEIA 2W6JD 2E4VA 2EQAA 3BQMB 4P83A 4D8UA 1I1HA 2ZYDA 1P4GA 5A6VA 3T9CA 2HV9A 1M2NA 4G1CA 5ULLA 3H05A 1YXMA 3MZ0A 1F3OA 4Z9BA 1LNZA 5DCWA 3B8HA 1UWLA 4N1AA 3C6BA 4YP9A 3VOAA 3AL0C 4WFJA 1JFSA 2GRPB 4KRGA 1IEWA 2PKWA 5EILA 1A8UA 1BHQ1 1CYDA 1NBIA 3QPDA 4EUHA 4JI7B 4JJIA 3EDCA 5IYZA 2F1IA 3DW1X 3CUUA 4NZNA 2ZM5A 4Z99A 1DEAA 2G7MC 2JCBA 2W4IA 2WJ6A 3BRSA 3HY3A 3JRXA 3OZTA 3RVPA 5DBFA 4QTXA 2WJWA 4FMDF 3P0RA 4URZR 4CQLA 3PR1A 1L7OA 2JDID 4Q3CA 5HR5A 1EX7A 3H0EA 1Q0QA 1KPGA 3HKCA 2P78A 4S35A 3QOFA 3V1TC 2PQ6A 2QJWA 4GX2A 3F7MA 4XSVA 1PK7A 1TKAA 4BMSA 1HDYA 2PRYA 5I7OA 4HEHA 5E6SA 2MYPA 1YJAA 2LXNA 3TXNA 2K2QB 3HU5A 4GXNA 3A7EA 1OXBB 1JTFA 2ONKA 2WHPA 4PXSA 2P75A 1HPLA 1JHAA 2XCBA 2P2SA 3D9LA 1BQ4A 5FUVA 5JSZA 3ONWA 4GKJB 4BETA 2SECE 4FHEA 4RF4A 1BCRB 1CW2B 2QL6A 4TXRA 3K73O 2QPOA 3C39A 3R20A 3QHAA 3RSOA 2YOHA 4ICIA 3U7HB 4KUGA 3T4UA 4TWBA 1YCHA 3V1UA 4HVBA 4LERA 3KU1A 2AZXA 3M5DA 4YWJA 3PWSA 4C89A 4YPOA 2JLYA 1SO8A 1QK3A 2V6GA 3H4VA 3L0CA 4DE5A 1L7AA 1SCKA 1W85B 4HVTA 1YRBA 2DHRA 3FSEA 3VC2A 4DM7A 1XIVA 3ELWA 5JDCA 2FNAA 2Q4EA 1NUTA 2V7PA 2XCLA 3B1YA 2BKUA 2P6NA 4MTLA 4AQYB 4HDNA 3ZVMA 2P41A 1F0PA 2AFHE 4MPRA 4C1BA 4UTOA 5IG2A 1BPOA 4DSAA 1RRGA 4WJZA 3GLIE 1KY4A 3ANXA 2YJTD 3V1NA 2FEMA 3LYAA 2ZYIA 1TR4A 4F9FA 2C8VA 4M0EA 3NVMB 2PRIA 1D1QA 4DREA 5EKSA 3N6VA 3KLOA 2P9YA 1Z82A 4QQFA 3KKZA 3DE0X 621PA 2FMKA 2QSJA 3SM3A 4YACA 3KQMA 1P2VA 2V3WA 4HNQA 1CY8A 4Y6GB 4BBAA 4PW0A 4V0MA 5BNIA 1S3SA 4D81A 2JAPA 1W29A 3LRTA 2WQZA 4G63A 3TQSA 3RS9A 3TZHA 3W05A 2PLRA 2GPAA 1B42A 3GG9A 5HFAA 2ADFA 2FLKA 1KZGB 1GTVA 2A7QA 2QG4A 5KVQA 4AUNA 1NBHA 2ZTSA 1AHNA 3IPYA 1T1GA 3KS2A 3QKRA 1ORWA 5DW3A 4DR2B 3R8FA 3PEEA 4KFTA 2APJA 1LLFA 2DB3A 3DDOA 4LXIA 4J6FA 1THGA 4K6HA 5L7WA 5CD1A 3NU1A 1X42A 2O5EA 2IRWA 3HM2A 2C4UA 4L4UA 4Y2XA 3T1NA 3Q7AA 1ZD8A 3KSBC 3K70B 1KNQA 2PJUA 3BAFA 1QP0A 4QXOA 3ZYQA 2C9BA 1ISSA 3OWOA 2JAOA 5FBRB 3RF6A 3ZK7A 1X3SA 1V0JA 2RGAA 1W36C 3LA6A 3OJXA 5LQUA 3MMNA 3CVPA 3TFQA 4QXRA 1FX1A 5KJNA 1GHTA 2P9TA 1NJSA 4A63B 1BJTA 3LY8A 4GBJA 3P8ZA 2Z3ZA 5TXGA 1KVSA 3UTCA 1YCDA 4EUEA 2Y67A 1DKRA 4L57A 1OPXA 4WE3A 4JQOA 4XD2A 3JQQA 3G2TA 4HWPA 3ZWDA 5LOVF 3AJIA 3QA9A 3HKBB 3TUZC 3E3AA 3KLBA 1IY0A 3CLKA 4LXHA 3RARA 4NBRA 3ZDRA 1AH2A 4KE6A 3W6ZA 4RIGA 3ZYCA 2PUHA 3BWVA 4RW0A 4O25A 2AL7A 4ZPXA 3ZQ4A 3H0KA 5TPZA 4CMBA 1FP7A 1D1PA 4OU5A 2YY7A 3MWLA 5IK2A 3HB1A 3RYIA 4CR7A 3CSFA 1RRKA 3BZBA 3NATA 1ID1A 3OBBA 2DZOA 5F2EA 2UUAB 4CKCB 3SD5A 4PNPA 3HFJA 5ECDA 4WLUA 2XB9A 1TA0A 2ERXA 2FSUA 3CCFA 3MJVA 3DOHA 4FOOA 2HYIC 3T6KA 3ML9A 3FTUA 1FTQA 1KK2A 2FZKA 3N7TA 2P11A 2WXQA 2L69A 3HBJA 4O2AB 5EKDA 1LQTA 2Y1LE 1T0JB 3JVUA 1DMSA 3QITA 2BY4A 4OI4A 1MX3A 5AK3A 4XWOA 3ASGA 2LO6A 1SD5A 1TKRA 4M8NE 3PGXA 3KR0A 2DT8A 4JR2A 1W76A 4FQ8A 3DAPA 1P1FA 2EWVA 1TJ5A 2MWMA 4B7ZA 1BA3A 1QWOA 1K75A 1UMBA 4IDNA 4N7JA 3WLAA 4JI4B 4RKYA 2C31A 2GUWA 1X1BA 1RHMA 2R79A 5AARA 4XH9B 5KZMB 2HF8A 4BAZA 4HZUB 1N77A 3N39C 3AFOA 3HCFA 3KKEA 4JEHA 1W0KA 1DRKA 4N5CA 2O5CA 3C8ZA 3ASNE 1C9DB 5F33A 1JEEA 1KFKB 3Q5GA 3QXXA 3KVYA 4DHWA 3PJFA 5ALYA 1WABA 1JR4A 1UBSB 1XZGA 1BVHA 2WKPA 3MCZA 1SG0A 4G0UA 1E3MA 4H08A 2V0NA 2ZS9A 5JH7F 4GLFA 1MJFA 2NTVA 4LXTA 4QU9A 2VWQA 3M6VA 3OD5A 3RSLA 3WLNA 3NPMA 2I80A 3UCFA 4ZDKA 3MINA 5J2TA 5JHAA 4ILHB 4Z2AA 1E9CA 2A5JA 4WNGA 4YHHB 4V3IA 2EARA 1ODIA 2QHXA 3EJ6A 1E2BA 4PUCA 4I3HA 2EF0A 1YACA 1P1KA 2P9FA 1D5WA 2H7VA 3ET5A 4Q93A 3I6QA 3W2TA 4E5SA 4F60A 3K92A 3K9BA 2O1SA 1HF8A 2PFSA 2YNQA 2VH2A 3PA8A 3OIGA 4KP7A 3H1FA 1SB9A 1S96A 3REQA 2F62A 1VIMA 3S2AA 3H84A 1V8OA 4P8RA 4LNBA 2YWRA 3LT4A 1QE3A 3OIWA 1VLJA 3WB1A 2WXGA 4GI3A 2YV1A 3PV0A 1GAWA 1MVOA 4PQEA 5J4YA 3AVUA 1JA0A 4M83A 1W4LA 2YHIA 3ETCA 1P2FA 4TT3D 5B36A 2MU1A 3FYUA 2JCVA 2Q6TA 1PR6A 3EXAA 3FRIA 2VDKB 3H87A 3T7DA 3AGPA 4PLFA 4C6HA 3EW7A 3WWZA 4D26A 1ESNA 3DVQX 2YINC 1CNFA 1VKZA 3F74A 4OIMA 3QDNA 4R0NA 3NHBA 3TXAA 4UVGA 3ZBQA 1E9AA 3FNGA 5JAPA 2LGJA 4PSVA 1HRKA 2VSFA 4AOFA 1M3SA 2JGJA 4M3OA 5E4FA 4BPBA 4WLNA 1Y33E 1PRYA 2FZVA 4P29A 1MT3A 2G83A 5G05J 4FKZA 4OMCA 1J97A 2NZUG 5K6AA 3VSEA 1IXZA 1ZCBA 2YJGA 1J0CA 2CBZA 4P9NA 5AJYA 1R8SA 1RYHA 3FTVA 2XXAA 1EQ2A 4EJ2A 1EVQA 2QUJA 5JMPA 4F3TA 3B38A 2WZBA 4R98A 4MV9A 1FTGA 2IO2C 5BQ5A 2YBEA 4JVSA 5FOXA 3IULA 4GZ3A 1Y8RA 2JD0A 2WAOA 2XSZD 4MRRA 3DKVA 4OB6A 5A6CA 2JEOA 2P8SA 3D2BA 3GJ7A 1AU9A 1V26A 1GUZA 5KQRA 5EL0A 4DNQA 4E70A 2WSIA 4M9QA 4LJ9A 1Z68A 2CMDA 3HSKA 2C7OA 4M0LA 2RDMA 3ET4A 4N2SA 1KK0A 3JD4A 3D1LA 3HYCA 4PZ0A 2RGCA 3D2LA 1W93A 5G2NA 4RF5A 2D0DA 2IXDA 1EXDA 1JEYB 2WSSD 1QOQB 3Q3CA 2H9AA 4B4WA 4TWZA 4XM1A 3ZWWA 1KF0A 1GFWA 2UYGA 1QZ2A 4LNHA 5ITWA 1O0BA 4CKZA 3OQ6A 1KSJA 5FB3A 1EFRA 4RG6A 1E1KA 1JR2A 4BIIA 4HN9A 4FIDA 2WF8A 1PFQA 4OAUC 3U16A 4FCTA 3FSRA 1OAAA 3FUIA 4C0MA 4Q4JB 1I94B 4CLOB 2H48A 2ZIWB 3F4BA 1EB8A 3W5UA 3FTZA 2WAMA 5ETJA 2GASA 4EHIA 2QSZA 4XPZA 3HA5A 1E6UA 2AKYA 2R1VB 3SBXA 3WQHA 1A5AB 2AX4A 3L1IA 4KXQA 3DXFA 3MBOA 3GO4A 3ESCA 3TVDA 4ER7A 4EVSA 4JI0B 1FQJA 2J5RA 2ZBUA 4JNCA 4O8CA 2Z2IA 3HUUA 4JI5B 4AUKA 4D4IA 3IHVA 1XD2B 4FHJA 1V55E 1T2AA 4U7FA 3K72B 1TJCA 2R8YA 4NFLA 3TQIA 8AT1A 2BWJA 3LC0A 3DDSA 4ARZB 1YS9A 4C43A 3ZGZA 1E3WB 1XUOA 4QUDA 1KYQA 3RAEC 3RRXA 1V4NA 5K3FB 5B3JC 5JCPA 2M6RA 5JAQA 4IMPA 1FFWA 3AV0B 2GCEA 1O87A 4XX0B 5AVKA 2VZ0A 2P5UA 4NJMB 3W7AA 3LPNA 2HNAA 1E6KA 1EWVA 3ICCA 4Q3LA 3KHSA 3KRTA 3V5NA 1FFHA 5JU6A 3V7FA 2FOLA 1QUFA 1JWGA 1P39A 3RVLA 3LZCA 4YCJA 3PC3A 5B3SE 5FBLB 4JBLA 1PFWA 3A58B 3JWEA 3UAYA 5IAGA 3WNDA 1MZCA 5LLSA 4W7IA 4G11A 1CR2A 3GBSA 1E8NA 4M4SA 1SIBE 1PZHA 3WL7A 4BKOA 3W8NA 3U7RA 4Q34A 4Q9KA 1N52A 2ZIEA 4WOCA 1SBZA 2BEWB 1XN1A 2V8OA 4BSXA 2WKSA 2VGXA 1E5XA 3EMBA 3KR9A 1CQIA 3QH4A 2FPPA 1P5ZB 4MW2A 1LDMA 4GO1A 3P19A 5IYZF 3NM6B 4Y6RA 3ND7A 3OZWA 4AJWA 1QIDA 2C8KA 5C18A 4JLDA 2JATA 5EQFA 2GPJA 4MV1A 3CRQA 2ZVPX 5T4EA 4N5DA 4DVGA 2QD1A 1SXJC 4ND1A 3VHXB 4DB2A 1ZICA 3DE1X 1QHFA 3TQCA 3E9CA 1JV2B 2RHLA 4NMLA 1BN7A 1U8EA 3GLHB 5G0WA 8GPBA 3IEVA 2J9RA 3E3LA 3V2XA 4FZ5A 1UXKA 4MR7B 1QGAA 3T7JA 1P9LA 3RVJA 3L0SA 3GRYA 4BMVA 1VJTA 4IDPA 4ZCMA 4UULA 3GZTB 2HWYA 4AMUA 2XUKA 3ETEA 4P2GA 5CDUA 3UAXA 3K2EA 3L1UA 3CVWA 2FMHA 2P6MA 4M54A 4DV0B 1NYTA 1GZ5A 1TNZA 2OVBA 3EUVA 3ABIA 4ZDWA 4HGQA 4WA7A 4Y2TA 5JRDS 2KSQA 4XSGA 2TS1A 4JT8A 2XUZA 1EXMA 5HZHA 1Z4NA 2PU5A 4DBZA 5FFFA 3VHLB 5EPEA 4F1JA 5FZSA 4KVAA 1GU1A 4MEJA 2AN9A 2RC5A 4JYBA 4MYRA 3QARA 2COKA 2XZLA 1DBQA 5DI9A 3NM4A 4CV1A 4EHNA 5EP4A 3VKFA 4BOYA 3LXRA 1GZ6A 3QMPA 3V48A 4A8PA 3UMYA 3JAMA 3TWWA 1Q7TA 3FUNA 2MT9A 2XUAA 3BTOA 1P33A 4XX1A 3TVTA 7YASA 1C4KA 5E9JA 4RLFA 5JNVA 5KNDH 2JJYA 2OZLA 2GJSA 2XPCA 1Q21A 3KXLA 2EDCA 4UCFA 5C4IA 3BK7A 4FDVA 1UBJS 3TQOA 1JXMA 3A0UA 3G82C 1SZAA 2FPRA 2G28A 2HRDA 1G5IA 1QQ5A 3UWSA 1AO3A 1JAZA 1YVRA 4BO7A 5B3LA 4DQLA 4I50A 3UIOC 3VDMA 2NQ8A 1TA9A 3OEEA 4P4SA 1BU5A 5CA0A 1NA3A 1YRLA 2FUCA 4WACA 2VS1A 3LRXA 4D0LB 3IUNA 3K20A 4BJ6A 3E3MA 4RLSA 3AV3A 4JGBA 1B0UA 1CUZA 1JTVA 2B7LA 2C2MA 3B7BA 1N9KA 2G8NA 2GHIA 2XTMA 4U2KA 4YRBA 4BTAA 4MITA 5JLJA 2EFJA 2OCCE 2AF3C 2PZFA 4HHEA 4BY9E 2CVOA 1EJ6A 3C3BA 3OLZA 4V39A 3H86A 5K0NA 3IBGA 1OILA 2A0UA 2X3FA 3KEOA 3E34A 3Q3EA 1SIUA 5CRIA 4OSEA 2WLTA 2G4LA 3V1LA 5U1PA 4YMSA 4L2LA 3PYMA 3WG7E 4OUKX 3U37A 2OBNA 1H2TC 3C5WP 4Z0TA 1WTAA 1QTQA 3AO0B 2ZSAA 2BFFA 3C6QA 4B84A 1N0RA 1MQSA 4HNAD 1M8KA 2VDQB 2YXPX 5T8KC 3QPCA 2QLMA 1Z17A 2DGDA 1W30A 2TRSB 4G0XA 4B89A 3EXIA 3VR1A 4BE4A 3IOMA 1XVIA 1FW8A 4KUEA 2Q46A 3UPDA 2QYUA 3WK6A 4KRFA 5CBOA 3BA1A 4RVUA 1A5BB 1GPYA 3QW4B 2MSLA 5HVNA 4BO3A 3VH1A 3CIFA 4X1YA 4ZEXA 3QU4A 3UK0A 2FMFA 1HL7A 1QGUA 1KZ1A 2DLNA 2AR0A 4MDYA 3MUFA 2HQSA 4AZ3A 5JDIC 4XQEA 4LNUA 2B8JA 4RY9A 5JCZA 2CE7A 4ISBA 5EIXA 5EQJB 4BEVA 3GG2A 4UEWA 3EDRA 1HMYA 2WHQA 4TMKA 4Q01A 1WB4A 4HNSA 1SCIA 2ZIAA 4HDSA 2LCFA 3IODA 2H2WA 4EF5A 4MRMB 3BD6A 4YECA 2CHGA 3DEJA 1L5YA 5A23A 3I23A 3IEUA 4KHPB 4JHRA 2YN0A 4B9EA 5CIQA 4WN9A 3DEOA 2WMOA 2OY0A 3OP1A 1G7CA 3CO5A 4M99A 4DLZA 4BTBA 2QN2A 2X9VA 3FPGA 1ZL0A 1SVIA 1TZJA 2QJFA 3PDIA 3PL1A 3P9QA 4QYXA 5B4TA 1PVOA 1H4TA 3HYNA 1PT8A 4C04A 5HKKD 4BTVA 1Q95A 3UGTA 4JD2G 2QP4A 2V65A 4OHXA 1EBUA 3M4YA 4OXXA 3BICA 1X8XA 4HY3A 1CS4C 2F90A 3DFFA 2BGKA 4UQYA 2QJRA 3WGGA 3HXEA 5LZ5A 4E6EA 1KWKA 4KREA 2JFUA 2R87A 1XKXA 4B0PA 4PS7A 2BTQA 5CK4A 3A6HA 2Q6KA 3DG9A 4RA6A 1SNYA 4GI2A 3DWIA 3RWBA 3GT3A 3D02A 4NFSA 2VT7A 3T52A 3U62A 4TS9A 2A92A 2NNWB 3E9MA 4DT1A 4ZU1X 1O7JA 2HEIA 3UXHA 4P38A 1FYDA 1VGRA 4KQFA 5JD5A 4DIEA 3CRNA 3RK6A 2L6JA 1WD5A 5GZ1A 4CF7A 5JHHB 3E9ZA 4YYEA 1ZRMA 4BX8A 3ZHEB 3QWWA 2ARKA 1DUIA 3OIDA 4J4HA 2RG8A 1BDJA 5FUQA 5EXTA 2HF2A 1JHZA 4BKUA 2GJAA 3AKEA 1YZVA 2YY6A 3I32A 2FCRA 2F3RA 3C14C 5CVVA 4EGAA 4F2WA 5AW1A 1G4HA 2ZUDA 5JYCA 3MAAC 3Q9UA 1JSZA 4B8YA 4YJHA 4BXOA 9MHTA 1QWSA 2KBFA 2VKQA 3AOEA 4GPEA 5A71A 3GU3A 5LDGA 1GA6A 3NFYA 4MQEA 3IUQA 1M0SA 3DT6A 2XXBA 1ZJJA 4NI5A 5HQJA 2GCPA 4GSYA 4UTVA 3VZSA 3WIDA 5KTRA 4IFIA 1W5TA 1NVDA 4Y2HA 2XYPA 1V11A 4UU1A 1IRXA 1Y5NA 3WWDA 1VE3A 2WXFA 3CLRC 3ZDYB 2IP1A 1XPUA 4B85A 3U9TA 4FSHA 4I4CA 3VSBA 2NQ2C 4DJDC 4ZIRB 2VBIA 3ZCVA 3F47A 2IIPA 3IQEA 4OQ4A 4PX9A 5ARDA 1IATA 1OBVA 4P7BA 1Y5IA 4PNEA 4Z3KA 3ABQB 3E5NA 4MCJA 3VBCA 4ILEA 1ZD4A 2J08A 1I13A 1UQUA 1Z28A 4PLWA 5C1DA 1EFAA 4FC8A 2F8XK 2Z4RA 5AJWA 2HIGA 2IEYA 2VLBA 4IYRA 2Q5OA 2D3WA 1YYHA 1E96A 3KPJA 1CV2A 5FQNA 3PIRA 3U3RA 1Y80A 4KSYA 2BGMA 2OO7A 1MXHA 4AN0A 3CNHA 3BIFA 4FMCF 4KLAA 2OBLA 5KKAA 3UXYA 3HYRA 3RRMA 3QX8A 3CKBA 2H08A 1IJEA 2HFJA 1A8SA 4B3GA 2BKEA 2OZKA 1I8TA 4LBYA 3G2HA 2JIQA 5K8TA 1H42A 1S02A 2IVFA 1C9MA 2C2BA 1KKMA 2NU9A 2LIVA 1VPDA 4POAA 2C4VA 3UGQA 3BJEA 3SHOA 2O0KA 1ELRA 5CB0A 3KDPA 4PPQA 2YQ8A 3KD3A 3KOOA 3LUDA 3T4PA 4EKYA 4G3XA 2E5WA 4G5YA 4AC9A 2PL1A 1QIKA 1QVVA 3KSLA 4TZKA 3CVYA 2OUIA 1XAGA 3H6HA 1ZNXA 4LX0A 1YIDA 3L5OA 5HKOA 5M04A 2H6GA 1HFEL 2A5DA 5BSWA 4TN1A 2YJZA 4LFCB 1OVGA 3WIOA 3O84A 3D9IA 1PG2A 2ALJA 5LXTB 1KOFA 2GXQA 5D5QA 1P0CA 1LWOA 3BT7A 1KI2A 3I2IA 5CERB 2G71A 3LPDA 1MO3A 4DR7B 3E8MA 5HJ5A 4TV8B 3FHCB 5EESA 3O92A 5GONB 2F43B 3V4RA 4D3XA 3LPAA 1V9CA 3ND5A 3ETJA 1HT2E 1KXZA 1WXGA 4U0KA 2X3MA 2OP1A 4QJ4A 4IY1A 5J40A 4QJIA 3OFJA 1D9SA 3MJEA 2JJ8A 3FTNA 4TVKA 4ZO4A 2BL4A 1I6KA 4ZKDA 1IWBB 4GZ5A 4MUMA 4D7AA 1R1DA 1FA9A 2I4RA 1KAGA 2PU7A 5KINB 2MOWA 4TUMA 3F98A 2QMUA 5EE5B 3TKLA 4KWEA 3T7CA 4IS2A 4EPTA 3ZYMA 1HX7A 4YPFA 2XE6A 4MROA 4UFPA 5AHKA 1KAMA 2CL5A 3ZKWB 4CI9A 3U80A 2WIBA 1VDYA 1L5SA 3ICVA 5KPDA 2CHXA 1TYCA 3LQ4A 4B8WA 3EVZA 4EB3A 3I45A 2O7VA 4DQ0A 4LCEA 4P92A 2RJOA 1WF6A 4UFOA 3KALA 5LM3A 2P9IG 4RPJA 5EJFA 3EIQA 4RDHA 4DW8A 2MJLA 1ISMA 2IOQA 4R84A 3EOZA 4BMYA 3LAWA 3P2YA 4D41A 3I9JA 2BGGA 2FX5A 3LQQA 1GADO 2WYIA 1WKCA 2NWQA 1G5PA 1OGJA 4HXGA 1LU9A 3CW8X 4NYMQ 2XNHA 4YCBA 3TZCA 4CNQA 4EY4A 5EWJB 1L7NA 2GI4A 4EO9A 2O8CB 2J3KA 3I09A 3OOJA 4UDOA 2VPXA 2PXXA 1PQYA 2RJ3A 4FNAA 4QWWA 3SLKA 2NM0A 4BP3A 1BO6A 1C8LA 4W5WA 3RK4A 2NIPA 2R6JA 1PR0A 2WV9A 4W1QA 2CHZA 2WVIA 3NETA 1DGQA 4HUQA 3HZOA 4JI8B 1Y7TA 3NHFA 4XAQA 1F20A 1KI8A 1JEJA 2BGIA 1OE0A 1QDLB 3KAQA 2W6MA 4YCAA 1V39A 2AHOA 4JR0A 1QPZA 4D0RA 4AG5A 3D6NB 1X3LA 2ZI5A 1OIVA 1P0FA 2VDWA 4U7WA 2J3JA 1V43A 2ORVA 1D2CA 1GG8A 4AZVA 1HOXA 2FU5C 1XLTA 3BS4A 5JSQA 1HLGA 3L6UA 1P18A 1I2ZA 4DIMA 1XLTC 5BWOA 2X14A 2RMKA 4XVHA 3RM3A 2YDXA 2H63A 2AYYA 2CVHA 2R5NA 1G98A 4EZLA 2HJSA 1WVIA 4ZYXA 1Z75A 1H6AA 3GGJA 1TNOA 1TC2A 4PAWA 3ZV7A 1NXVA 5AOAA 5FTMA 3THRA 3N0WA 4DQVA 5I5EA 3QY0A 1SKYB 3URZA 4GL4A 3RRMB 4JYMA 1MX9A 3RUHA 4RY0A 3X2EA 4N3GA 1MNAA 1HE8A 3VZQA 4E22A 4J2HA 5L4SA 3EHRA 1M5TA 1TTPB 1JS1X 2ZDGA 2JA1A 3H16A 3NH6A 4C6TB 4KQ2A 5KEIA 3R23A 1TM3E 1N5DA 3CU5A 3TRKA 3DOFA 3ITDA 5AUNB 3G1UA 4YJ2B 1YFKA 1WWKA 4ZI2A 2BLLA 3RYTC 3KEAA 3T9AA 2HTFA 1HNNA 2R0QC 2C7RA 3E70C 4BQOA 2C59A 2C4WA 1L5MA 1S1MA 2BEJA 2E0IA 5CVJA 1SZCA 1CJSA 1RYNA 1WXQA 4AJ2A 3KYCA 4LHXA 4IV5A 1RVV1 3LJKA 3N3BC 3AAAC 2BFWA 4EX6A 2Q5HA 1NF9A 1QFZA 4RO0A 1YO6A 1NVVR 4I2VA 3K8YA 3MG9A 3VOBA 2QD2A 5F2KA 1QMGA 3IVAA 5AKYA 3BORA 3DD5A 1KERA 4UBNA 2H1VA 1TK3A 2X5NA 4URFA 3PGVA 2PO7A 4Z9AA 3QKTA 5H4HA 1RAHA 2X6JA 2CD9A 3BTUA 3I9KA 3R3UA 3TZKA 2AOUA 4ZGBA 1KETA 3FROA 2V9ZA 1UPCA 2Z2ZA 1QRUA 3PDNA 1WM1A 3DV9A 3MTQA 2N1BA 1YUNA 4IP0A 2V4HC 3BDIA 3MHTA 2JGIA 2UZ0A 2FEXA 3E5MA 1DAGA 2HA7A 5CR9A 2IX9A 2G80A 3TGPA 3WLMA 1RPTA 2DWQA 1NNSA 5TJHA 4CYMA 4DRZA 5KQPA 4X66B