2JLBA

Xanthomonas campestris putative ogt (xcc0866), complex with udp- glcnac phosphonate analogue
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCC0866
publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 212
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2jlbA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2jlbA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jlbA02
3S28A 4HLNA 2QN8A 1WW3A 3ZHEB 3CV0A 3NPAA 1L5WA 5TMDA 5LQDA 4RENA 4XI9A 3MS7A 2FETA 1JIUA 1P4GA 3MRTA 2F3QA 1ZBPA 3S7JA 4Z5XA 3BD8A 3G2LA 4IN3B 5DU2A 3SZ7A 4EQFA 4F97A 2IEGA 1WV0A 2QLLA 3CEQA 2C9ZA 3MKRA 3Q47B 2PQRA 4M83A 4EL0A 2OFFA 4BT9A 1Y8ZA 2X6QA 5ENZA 2L6JA 1KT1A 4WNGA 1P5QA 5G04C 5DXFA 3MS2A 2ATIA 4I1AA 4I2WA 1FC0A 4QLBA 1AXRA 5FJYA 1PC2A 3OXGA 2QRMA 5G05J 3LKUA 3PE4A 4XI0A 2LSUA 2GJ4A 5D00A 4AM9A 1JIVA 2C1ZA 1J39A 3BCUA 4PQGA 3CK9A 3HYMB 3CVQA 3VDNB 1Y6FA 2QRQA 2PQNA 2XMPA 2LNIA 4M7PA 4F3VA 4HOSA 3EBPA 3HBNA 1QZ2A 5JTUA 4G24A 1FU7A 4WUYA 3RT1A 4NC9A 4G26A 1GGNA 3N71A 3OY7A 3C4QA 1HXIA 2IW1A 4N2SA 2PYDA 3HBFA 2X0EA 5GPBA 4G2VA 1NLMA 3D0RA 4ME2A 4I9EA 3URZA 3MRVA 3OTHA 4BTAA 4L22A 2FI7A 4BQEA 3L79A 1YA0A 3ASFA 4MHSA 4GCOA 4YUAA 1M5RA 3FWVA 2C1XA 4I2ZA 3RU0A 5JJTA 4U0ZA 4UQZA 1HZ4A 1NOJA 4MI9A 4MI6A 4RIGA 4BFCA 3RHZA 4BQIA 1EXVA 4GZ3A 3FFLA 1NZDA 3Q3IA 2F3SA 3GPBA 2XA9A 1ZU2A 5LCWC 2G9RA 3OTGA 1XNFA 3G2IA 2C0LA 2DBAA 3AS5A 3MT9A 4WNEA 3IAAA 2BGTA 3QWVA 3TOVA 3T3HA 2WQHA 2KCVA 3Q15A 4KQ2A 3BDAA 1F0KA 3CUTA 4WADA 3T7DA 5FZSA 2X6RA 2IF4A 5FZRA 2ONDA 1L5VA 3Q4AB 3ZCPA 2HO1A 3U4TA 2GT1A 4KQ1A 9GPBA 4EKYA 2R5SA 2UWJG 3CK8A 5CCMA 5HQ8A 4JHRA 3S7BA 3O48A 1IYGA 2XA1A 2VQ2A 5ARFA 4LEIA 2R60A 5KJKA 5DIZA 2QN7A 3WC4A 2R68A 2QRHA 1NZFA 2AMVA 2VCEA 4N3BA 4BTBA 1UQUA 2Q6VA 5BW8C 3G2NA 2G9UA 3MT8A 4A1SA 3PDNA 1L5RA 2FF4A 4UI9K 1GPBA 3OKCA 5TVGA 1JG7A 4KYOB 3E4BA 2VYIA 4U04A 4AMGA 3ASGA 1C8KA 3LY7A 4APOA 3ZCRA 1WUTA 1PSWA 4GYYA 1E1YA 1KTIA 1P4JA 3COPA 4RIFA 3L7DA 4X6LA 1K08A 3NB0A 4G2TA 2BGUA 3S2UA 3S7DA 4GPKA 2ECPA 3E3OA 4WNFA 4YVOA 4M60A 4O6FA 4U0SA 2IUYA 4WNDA 3CUWA 1QM5A 2Y4UA 3LY8A 4B94A 4GA1A 4NQ0A 3UYKA 4MHOA 2QRPA 2QN2A 4GYWA 4HOUA 2GPNA 4NRHB 3U3WA 2Y4TA 1PNVA 5M72A 1NA0A 1GPAA 3CEMA 1VGVA 4MICA 1HH8A 2SKCA 3E3NA 3VUFA 2PZIA 5JTTA 2V5FA 2XGSA 3D0QA 5DBKA 3DD1A 3MA5A 3ZCVA 5FTPA 5ARGA 4JA9A 1F6DA 2IYFA 3CUVA 5JJ6A 4AMBA 4CGVA 4AY6A 3G2HA 4N2QA 1JEJA 7GPBA 5KJLA 3CKBA 4WACA 2R66A 2P58C 2KS6A 1SXQA 3MRXA 2PL2A 1XC7A 5CCLA 4J8FA 4U07A 1LWNA 3UPVA 2R4UA 3LPZA 2KCKA 4G23A 1YA6A 3MV3B 2PRIA 3UYLA 5EX3A 5DLDA 3C4VA 4X7RA 4X7PA 2J9QA 1WM5A 4HOQA 4CGWA 6GPBA 3TG5A 2IYAA 2QNBA 3S27A 1H5UA 3GW4A 3OY2A 1FA9A 4HWGA 2O6LA 4CDRA 1P2GA 3RSZA 3BD7A 3VTYA 1FCHA 3HBMA 2KCLA 3SYMA 3ZFWA 4UI9J 3CUUA 3ZN3A 4ABNA 4RIEA 3ZCUA 4U0UA 3VUEA 3K9IA 1XKXA 3S0JA 3MSCA 2QRGA 4NESA 4RBNA 2G9QA 3G2JA 4GZ5A 1AHPA 3BCRA 4GPBA 3BEEA 1GPYA 4F9FA 2FEZA 4HORA 3OKAA 2XCUA 3O3CA 3RKVA 1IXYA 3H4IA 3CVNA 2XEVA 2SKEA 3ASHA 1L6IA 2C0MA 2YJNA 4LEUA 3KAEA 4BQFA 1WUYA 4GA0A 2HY7A 2VCHA 3GUHA 3AS8A 5G05C 3ESKA 4N39A 3CKCA 3OT5A 3TGOA 3NC4A 2IV7A 2P6PA 2GW1A 4BWRA 3OKPA 4NEQA 1XOIA 3OTIA 2WTXA 5IKPA 2H1HA 1Z6PA 3NAZA 3QKYA 5A6CA 4EL5A 5JJ7A 3Q5MA 2FO7A 3T3GA 3NCHA 4AY5A 3DDSA 3Q3HA 3EBOA 3GZ2A 3R9AB 1JIXA 4N5CA 4GYOA 2VGYA 1ELWA 4GCNA 4WHMA 1OUVA 3L7BA 4FKZA 1W3BA 2JLBA 1FTWA 1NOIA 3ULQA 1RZVA 2GEKA 5EX0A 2HR2A 3MV2B 4BT8A 3AS4A 1XL0A 3G2KA 1O6CA 3H4TA 1L5QA 4EJ2A 3HBJA 1FTYA 1Z8DA 5G04J 2BUGA 4Y6CA 4I17A 3E3LA 4J8EA 5TMEA 4GA2A 2AW3A 2VSYA 8GPBA 3TG4A 4Y6WA 5D0OD 3ZCTA 3CX4A 2H1FA 3RIBA 4H7YA 3PE3A 3QDNA 3WADA 3OXLA 3CEHA 2R4TA 2G9VA 1NOKA 4CTOA 4RG9A 4KBQA 3MS4A 3FP3A 1JG6A 4RIIA 1XV5A 2X0DA 4CTNA 2VGXA 1B4DA 1GFZA 4H7XA 3D1JA 4RG6A 2HYZA 2ACWA 2F3UA 3DDWA 4KQMA 2MHKA 3EDTB 4J8DA 5C1DA 2LSVA 2F9FA 4XIFA 4UQYA 1RZUA 3C48A 1PYGA 1TJCA 2IV3A 3FROA 1A17A 3JYSA 1NA3A 1FU4A 4RELA 2OOEA 5A7DB 2AV6A 1ABBA 4AIFA 1XL1A 2ZB2A 1EM6A 2VSNA 3QKWA 2VGXB 5LCWJ 2GEJA 4YI3A 3AMVA 3CVPA 1P2BA 2IEIA 1L7XA 1Y6GA 1SXPA 2JZCA 3GZ1A 2JJMA 3UQ3A 3WXXA 1E4OA 1E96B 2XCCA 1Z62A 1FU8A 1IIRA 4LDPA 3LCAA 2GPAA 2FF5A 3RSCA 2GPBA 3T3DA 1FS4A 3GYZA 5HI7A 3BCSA 1UQTA 2QLMA 5D0QD 3L7AA 2XGMA 3UUXA 5TMBA 4YVQC 1C8LA 4HOTA 3ASDA 1HLFA 4N3CA 1P29A 1L5SA 1QKJA 3Q3EA 1RRVA 3RJVA 3TAXA 3LYAA 2BISA 5IKOA 4J0UA 3ZGQA 4N9WA 3L01A 4W9RA 4I9CA 1Z6QA 2AVPA 4MI3A 2C2LA 3QWPA 2QZSA 2YQ8A 1BX3A 1PN3A 3CV3A 3CEJA 3NP9A 1Y8MA 1NZNA 4G1TA 1FTQA 2ASVA 3DZCA 4YI5A 2PRJA 3T3IA 3VDMA 1IHGA 4JA7A 3RO2A 1P4HA 5KJNA 4AN4A 3MT7A 4G25A 5BNWA 2KATA 4X7MA 2NC9A 1QQEA 4W6QA 1B89A 3ZPJA 3IEGA 3T3EA 2XPIA 2F3PA 2I6HA 3KD7A 1C50A 4UQXA 5FT9A 2QN3A 5KJMA 1GZ5A 3MTBA 2X0FA 1WAO1 5CHEE 4F96A 2XA2A 4GZ6A 3KS2A 3QHPA 3ZCSA 3CVLA 2FFRA 5AYWD 2IFUA 3LY9A 2AZDA 1C3JA 1V4VA 3MTDA 4FZRA 4REMA 5HXAA 1A8IA 3SF4A 3CK7A 3Q49B 3SYRA 2XCBA 3OXFA 4YNDA 2XGOA 3NP7A 2SKDA 1ELRA 3WAGA 2QFCA 4MRAA 4UI9C 3T5TA 2FBNA 3RO3A 4N3AA 3MTAA 2E2EA 2UY1A 3BEOA 4RIHA 1UZUA 2KC7A 3MEKA 3S29A 4KXKB 3MQFA 3S7FA 5BT1A 3ZCQA 5I45A 5FZQA 1NVKA 2BFWA 2QN1A 1WV1A 3MBOA 1KT0A 1LWOA 2QN9A 3BD6A 2PQ6A 5EKQD 2QLNA 3ZHEA 2VG8A 1WW2A 2YHCA 2GM9A 3QWWA 2Q7FA 4CTMA 3TSAA 5D01A 4EKEA 1KLXA 1YGPA 2PYIA 2UY1B 1GG8A 2XCIA 2WPVA 3L7CA 4JL0A 3VTXA 3IA7A 3CUYA 1K06A 1P2DA 3QOUA 3NF1A 2ACVA 2C4MA
chains in the Genus database with same CATH superfamily
1FYFA 4TRNA 4CM9D 3PTLA 3G1TA 4FYJA 4KVOA 5EZ6B 4Q7EA 3ZWCA 4FYKA 4UWHA 1UZNA 2A5DA 3ZE9A 5EJ4A 4KN9S 3T4UA 2ETVA 3ONEA 1HNZB 3GG2A 3ZV6A 3S2EA 3FU5A 2ZPAA 3O4HA 1YDWA 4HYTA 1FNDA 3AZPA 1E1KA 1D5WA 1DO8A 4H18A 4D46A 3LWNA 3UHJA 1PQWA 3RT1A 3N71A 5DHFA 4IFBA 3WZMA 1Q6ZA 1PFYA 1WHSA 2TMKA 1DUSA 1GA4A 1ZYUA 3E33A 4UDYX 4PYQA 3VOTA 5ALFA 1K2WA 4Q96A 1FRQA 1Y9DA 2WINI 4YACA 5ARBA 1SBIA 4ZYXA 2HYIC 5JH7A 2PKWA 1XCMA 2C2BA 3KKMA 2B6HA 1OC2A 4ZDIA 4C7JA 4Y8VA 1V2HE 1EHIA 4D9NA 2J3LA 5ICMA 1NULA 1JMYA 4XH9B 3THYB 4PC6A 5CXXA 2H2AA 4MHOA 1FVHA 2CLOB 2D3TA 3AVYA 3UTDA 4IDOA 3ONKA 3I83A 4WWOA 4HPWA 3IVCA 4IIJB 2C1EA 3F74A 1SXJE 1A9QA 1SU6A 1YQDA 3QKUA 4N2QA 4X1IA 1OWPA 5FTNA 3W5SA 3EOAI 2FEMA 4IAOA 3IT0A 2J3HA 1MEEA 2DR3A 3TM5A 2F0YA 3LQFA 5KNDH 2C4NA 1IXKA 4LXHA 1X2BA 3DE7X 2Z3ZA 1JLSA 4MTCA 1ZK0A 1DAEA 5LA6F 1V48A 1DOZA 1VGQA 3VR6A 4QQKA 2XPCA 2BFFA 2CMDA 1NYTA 4LOLA 2IYRA 3PNKA 5DBIA 4U9UA 3ZFWA 4WBNF 5EGSA 3EW7A 3GLIA 4GTMA 3ZY3A 2QV7A 3CINA 5E1MA 3RKVA 1M0WA 5HM6A 3WYCA 5IBPA 1N9GB 3PZDA 3DE2X 3BG1B 4ETIA 3ELBA 3CKCA 4XM1A 4BCDA 5CLLA 5AKJA 4GOLD 1XAHA 1GZUA 5BWCA 3NWEA 1W29A 3UOAB 1ZNZA 1KI7A 2QVCA 5LP6A 2V7PA 3Q9NA 3MV2B 5AVWA 3CT6A 1CQIA 1G0NA 3LSYA 3E03A 4LAFA 5BN1A 3ZU6A 3ENKA 2GGSA 4BX3A 5FO1A 2JDID 3LCJA 2FZGA 2CLFB 4D25A 2BM0A 5FBLB 4N5IX 1MVNA 4K8RB 3WNVA 3HR4A 1NOKA 2NNLD 2ZRBA 4LPKA 2FMFA 4L28A 1B2RA 4O2LA 4IJ5A 1CJSA 3MCVA 4KQMA 4KG7A 1HOXA 4DLUA 5CH3A 5JAMA 1M6VA 4NIKA 1G8SA 4FZVA 1NM5A 2J7PD 2QI9C 3ECSA 2E82A 1XI2A 1ND5A 2AN1A 2X6TA 4PHGA 1FFYA 1TNDA 1XIVA 2VJMB 4CQMB 4EFLA 4TMZA 4NPHA 3P2JA 2FW8A 5D0QD 4PCLA 4R1TA 1AZLA 3OLQA 1GWNA 2A59A 1GHTA 5LXTF 3P0JA 1LI5A 1FTNA 3PPIA 1WY5A 3WL8A 3DVRX 1GL9B 4I8IA 2QVYX 2AQKA 2NC9A 4G8JA 4ZRNA 2PSDA 4MW4A 2EERA 4V0MA 1NFIE 4Q4JB 2I1VB 1WPRA 1H2BA 3ZCSA 3AGQA 4ZIRA 3UK0A 5AI5A 4N5HX 3B95A 2FQXA 4IHQA 2W6NA 4WOKA 3L84A 4A26A 3NOCD 5IJ9A 2H4ZA 4WFJA 4AF8A 1TQHA 4RQBA 1L4FA 3C3EA 2I3AA 3TTYA 3WDKA 1RWWA 1VKJA 1IATA 5CT6A 3TMKA 3UJ3X 3D8SA 4FMCB 2WD9A 2ZIUB 4NE7A 4KSCA 3WBKA 5AJDA 5FI5A 1GRRA 3BAFA 4RY8A 1YD7A 1U8YA 3TINA 1JLHA 2RGBA 3CNNA 2Q07A 3ABSB 2XYPA 3INYA 3G1UA 2GCPA 4ZAWA 2IOFA 3MS2A 1VSTA 1EJ6A 1NM5C 2DVWA 3NI2A 1C3OA 1N11A 1ZLXA 5FNVA 3OQ1A 1Z33A 4IINA 5CFLA 3CM0A 4EA7A 5E95A 1DIAA 5SZIA 4H7FA 3OURA 4Z0TA 3KJNA 4BFCA 4LXQA 3TZ6A 2YV3A 3ZLVA 5DW0A 4KXXA 2NPIA 3E8MA 4CQNA 1BOOA 4MQUA 4OYHA 2BUCA 3ITKA 3C3MA 4OUDB 2P3LA 2PUEA 2WV7A 4X85A 2JJ8A 1THGA 3GLGA 1EM8B 2Q6VA 1OI4A 4DG9A 3VH2A 1PL8A 5TQ0B 4FUTA 2BGIA 2BJHA 5EIXA 4R9VA 5T4YA 1JHAA 2GYUA 1VYHA 3LGAA 3OEHA 4MS1A 1YR1A 3IJ5A 2V7XA 4I5DA 3TLGA 4BBZA 4QDXA 5E2AA 5ALDA 5TMPA 5C81A 1WCIB 4HVAA 4P2GA 1NIPA 1WJGA 1PDOA 3GUVA 2EW1A 2QZJA 1ZOIA 1M1YE 4I66A 3WBJA 4JSRA 2WUVA 4EVIA 2CKDA 5K8LA 5K3FB 2I9KA 2J31A 2AF3C 3OZRA 5BVGA 4KO2S 1R0XA 4GB9A 2HWUA 4WLVA 1C1XA 4PYJA 2H6HA 1P2UA 4AJPA 2EG5A 4LRYA 3CWCA 1XGKA 2IQCA 4DYHA 1TU3A 2A86A 1P6QA 2HRRA 2OFXA 5TR9A 4Z53A 2FEZA 3PDWA 2BC9A 3IODA 5CRIA 3RYCA 1R9GA 5ALZA 5G05C 4DNOA 4BYGA 3M5PA 3C16C 1BU5A 2KM1A 4XEIG 3AFMA 5B1YA 3CCCA 3GZ2A 3R7QA 2L9BA 2ZUSA 1N5OX 3C6QA 2W2TA 1O95D 2A0FA 3PC4A 5CB6A 1C4XA 1TTHA 5FQ8A 1UADA 4BRSA 1MHTA 1QH8B 3RHTA 5BVHB 4HSGA 4HVLA 1WWKA 3LZDA 4KRFA 1AKQA 2PMFA 4GPD1 4ZMBA 1O9HA 1EFAA 2FPIB 5IULC 3C3OA 2C3MA 2XQ0A 4MOWA 1UBGA 2AD5A 2EFEB 2GK3A 1FU4A 4WCVA 3KUXA 2D2FA 2BT4A 4MMXB 2TSYB 2YRXA 1J4AA 4S35A 3P2YA 4OB7A 4URYR 3OI7A 2DQ4A 1EVYA 1TEVA 4D3XA 3OD1A 1P1JA 5L3SA 4RZHA 3DB1A 4BN5A 4N3CA 2X3UA 3AUAA 2V45A 4KO3S 4HH0A 1JQDA 5FOVA 1YBFA 3ILVA 3C85A 3HCNA 1X7ZA 2Y1GA 1JDZA 2KATA 4Q4DA 4LBWA 3T3EA 2CVFA 1UDRA 4QTYA 1CRWG 4X24A 1T1RA 5TT1A 4MO9A 4E32A 2RFLA 3DYVA 3DXYA 1OBHA 3KZVA 3LUBA 2IO3C 5HKKD 1OUMA 1P1KA 5DX0A 1L5LA 5FZQA 2BGNA 4YRPA 4GC9A 4WZBE 4UFPA 3MFYA 1NWHA 4PZAA 2WSSD 4Q05A 4GOOD 1PNOA 3DBVO 4U7PB 1PJ3A 4TLCA 2AOWA 1QUEA 2VPTA 3U3KA 2C2YA 4FU3A 3CLUC 1AKUA 4H7DA 2NLOA 3SOZA 4CV3A 4BFWA 4ZK6A 2C9ZA 3MKRA 1NQWA 3IFSA 1X1SA 5H59A 3ND6A 1KK3A 1SXJA 3ZR4B 4G97A 1YVRA 1V54E 1ADFA 5FJYA 3W3AH 2G7MC 1H0RA 2J1LA 3UEOA 4AM9A 3S99A 1SKYB 4KGVA 3P20A 2ETBA 3RJTA 121PA 4BZPA 2LNIA 4EF6A 4IV8A 1W5EA 3V7NA 3NHPA 3M6IA 4KWHA 4HQOA 3UGTA 1R2QA 2HRQA 3BE5A 5JNVA 1XTBA 3ND8A 2WG2A 2OLKA 4F06A 1NOJA 1UW4B 4V1CI 2O2GA 1P9OA 3TQIA 2X38A 2NTNA 3LCCA 3MRSA 1ZB1A 1TE2A 3DEPA 2B5OA 4BASA 4Z68A 2O1EA 1J0DA 3BXZA 3GZNA 3WNDA 1TN7A 4ZHSA 5KTOA 4YA6A 1PQUA 5ALUA 3N5KA 1CUHA 1NONA 1W2WB 1ZNWA 3VOBA 2D13A 2FI1A 5JYCA 3BFJA 5IW8A 3L05A 3VZDA 3LTEA 1E1RA 4ZODA 4D4IA 2IHNA 4EQ6A 2IBSA 3QVLA 4EHIA 1YQXA 3QEMA 2Y0BG 2FDRA 3RKRA 2GKSA 2WP8J 3E5HA 3JQDA 4BFXA 2Q4TA 2JJ2D 1NA0A 3KT8A 1AS2A 3VUFA 1BXGB 3U3DA 5G41A 1JMVA 1T1SA 1M73E 2C2WA 2JIDA 1U8UA 3BRWD 4FDVA 3ENWA 3O8RA 3ZXSA 3OECA 4WXYB 4IDHA 2ZXUA 3TMAA 1QFJA 4PYNA 4G2NA 1RQPA 2Q6IA 1YA6A 1SC3A 5J63A 1IBMB 3HXBA 5BWNA 2WD8A 1PFVA 3KPWA 1ONBA 5JSKA 4CEJA 3S27A 3F4BA 1U8ZA 5BNFA 4HQRA 3R9XA 2ZGVA 2CXTA 5LKAA 3ZCUA 2J0SA 3TSWA 3S0JA 3PS9A 2Q46A 4HEJA 5EVCA 2RAUA 4TQAA 4G01B 2XGJA 3GJZA 3E4DA 2VJ8A 3J5QB 1QH0A 3U16A 3DR5A 3ZV7A 3DW1X 3NHBA 4IIVA 3FPCA 1WD7A 3I1JA 3OZIA 2XXJA 5EYPF 5LZ2A 2YFYA 4I99A 3OIVA 1T10A 4ER3A 2Z5FA 4ZCIA 1U6KA 1FLVA 5TEWA 5ENOD 2V7BA 4YJFB 1BE6A 4UHDA 1VI2A 2OGUA 2QL5A 3A31A 3AR5A 2X41A 4I9UA 3TRDA 3ANTA 5JS2A 3SD7A 1MD9A 2HU8A 3IULA 4FADA 1Z08A 5CITA 3ZUVB 3TXNA 4DC0A 3EN0A 3GN2A 1T0JB 1Z5OA 3LC2O 3T35A 3FP3A 1G6HA 1QQTA 5CLJA 1JQLB 4ZZ1A 1ZD5A 3ZVVA 2BEUB 3ZY6A 2ZRIA 3AEQB 1RZUA 2NU8B 4ND7A 4MUYA 4W9NC 4I4TF 4RDXA 3PREA 5DOZA 4C22A 2BSXA 3H9UA 4KSBA 3HVKA 1Y6GA 2V7UA 2E87A 1KZYC 2R1VB 5FPKA 5FTWA 3SZOA 1Z2EA 1VJ5A 3SI5A 3ZE1B 1TCUA 3HADA 2MSWA 5LU8A 4DM7A 4H16A 4EARA 3VR0A 4BOYA 1WCV1 1GOTA 1WZCA 1KI2A 4V0RA 3G7UA 4N9WA 3L01A 3O5AA 4RO0A 3KLMX 4LMPA 2PU7A 1AX9A 3U7HB 1TM4E 4QODA 3VDMA 4F4IA 4R1QA 2PUAA 3MT7A 2QX4A 3H5WA 1QYMA 5ERXA 4RLYA 4KAFA 5BMVF 2IW3A 2BY4A 4ZEMA 5J4HA 4D26A 4JB2A 4CG1A 3DHVA 4XW2A 1FYDA 3B3FA 2YHSA 5CBOA 1XCJA 4RH0A 3OEYA 1NW8A 4KUHA 3GEIA 2UY1A 1BH6A 1PU2A 2NO0A 4J7XA 1LI7A 2JATA 3UFXB 4YJ3B 4C6TA 2H1WA 1XZCA 3K6RA 1N36B 1Q0QA 3HZHA 5ALKA 3RKSA 2J48A 1U8XX 3A6HA 4GZCA 1I94B 3A4IA 1FDUA 3LHFA 3V4ZA 5KBYA 1V5EA 1UPCA 1WPGA 2QSYA 5EZ5A 3NBNB 4DEYA 3MS7A 4ECAA 3E1SA 1PZGA 4DYVA 1BE1A 4AS1A 3AFIA 4JY7A 1NMXA 3SYNA 1QLJA 3W79A 3QNKA 1IM5A 1JX6A 4AG3A 3DVAB 2XCOA 2VPWA 1H3FA 2D2VA 1ZITA 4W5RA 1XPOA 4NXMB 1M1YA 4E88A 2LZ0A 1IY9A 4QKQA 3N2GA 2Y0PA 4AJKA 4FJYA 1OF1A 3UMYA 2OEVA 4UAVA 4LMBA 2GBIA 1CYDA 4FP9A 3WTCA 2AUTA 4N2SA 1A0OA 2FQYA 1CY7A 2W22A 3H1BA 3AB3A 3MGCA 3KJZA 4NDAA 5DHPA 3L16A 4MUKA 3ZDQA 3RTGA 5CEFA 3STWA 4Z9YA 3B9QA 4LBVA 4RD1A 2W90A 2POCA 3GRYA 4R8RA 5B57C 1SXJD 2BMEA 1MXFA 2MMGA 3GEBA 3MWGA 1V4BA 3L54A 3TI9A 3ZOKA 5CFZA 4BTBA 2ZJ6A 3DOFA 3NBZC 2GYYA 1V25A 1G2PA 4IFTA 3DE5X 1T3ZA 4C9BB 4LRUA 5KSOA 3DV9A 3NBMA 3D2CA 5JY1A 2CV2A 1JLKA 1E92A 2FK7A 5FWDA 3BCHA 3NRBA 2GN9A 4NS1A 1YZNA 1RXVA 1DG9A 3C24A 1D6NA 4MPJA 5E38A 1QVVA 3A6KA 2PKYX 3SP1A 1JLLB 4A6PA 2AFHA 3D3MA 4F8EA 2RDMA 2AJAA 4BFRA 4DZTA 3DUWA 4YPOA 1C3XA 2IXAA 2HSDA 5IXYA 3HRKA 4GPTA 5LDGA 3FAZA 3T4PA 2X8AA 3REOA 1E1RD 1FXUA 1THTA 1B6GA 3AJEA 4RSHA 4ABNA 4U0UA 3TXYA 4E11A 1GKLA 1G63A 3UKUG 4PIVA 3ELDA 3RUEA 4PSAA 1DEKA 4EHLA 4GA0A 1G8MA 4YQZA 1E3EA 2FUNB 2LUOA 2PAFA 3VPAA 3Q8XB 1JSZA 5A6CA 3ESXA 3ORHA 3Q8WA 5B1DA 2VGYA 3O4GA 4NYIQ 7MDHA 4BPRA 1H23A 2EFDB 4M7OA 2YTZA 3VLEA 4DJDC 3THXB 5LMNB 5F1PA 4I50F 3R3UA 5FWXB 3GNLA 5KX5F 2HIAA 1D3AA 2OV4A 3UC5A 3TGWA 3UMSA 1MOZA 1O1TA 2DQYA 5AI8A 3ZCTA 2J9FB 4FOTA 1R4NB 1R9NA 1MHPA 3LEWA 2QP3A 4X5OA 2EP8A 4EDFA 3C43A 4HGNA 2AEEA 2BKKB 1TADA 1ZU4A 1BX1A 4B6PA 4GEGA 3ODGA 1R10A 3UJCA 4WX2B 3IA2A 4H2DA 4OQLA 3I39X 1BU8A 4U7FA 3NEPX 5GMOA 1YRAA 1N4RA 3V42A 4R8VA 2PNFA 3G0IA 4BZWA 1PL6A 3HP1A 3EJNA 3CA8A 4Q39A 2IPLA 5AJWA 3DP7A 4L0DA 3N8KA 3GBSA 1QTIA 4HAXA 3TRHA 3CV3A 1X8JA 1TR4A 3KIPA 3P2OA 3PT9A 3ZI7A 2JAUA 3T7IA 4YGXB 4ZOLF 2FRXA 5DYIA 1QQEA 2PV7A 3NNSA 3NOOA 3KJXA 3LK7A 4R41A 1WMAA 3AXTA 1JHUA 1OOEA 1FFDA 2PT9A 3L41A 1MR3F 4YMWA 3T94A 1HU3A 1EIZA 4TTPA 4N8SA 3W1VA 1G2QA 5AM5A 3PI6A 3KKEA 1THMA 3UHPA 5DM70 4IS3A 3GLFB 3LUDA 1LPNA 4MRAA 4P33A 5FP0A 4HO1X 3UX4A 2XD9A 3UWDA 3K96A 2CL7X 2E55A 3TGPA 1IN6A 2ZUWA 3PVCA 4OD0A 3MJDA 5T4FA 5JROA 4U0JA 3S28A 3N07A 4UAUA 5AJYA 2JW5A 2P40A 2AHRA 2G88A 3O0TA 1Q0PA 4P29A 1XU9A 2V3WA 4RK7A 1W49A 5A9SA 1ILEA 3NNNA 1PY1A 3AEXA 2I4LA 3SGLA 4H17A 3DWIA 3T41A 4BMCA 3HNOA 1AUOA 4RKRA 4EZJA 3U2QA 1U65A 4E5UA 4C4ZA 5JJCA 4WZAE 5E3HA 1XTIA 3F97A 2YMMA 1OAKA 5E9QA 3TI7A 5I7EA 3L22A 1IPFA 1UPFA 5FH9A 1NP3A 3E9MA 1CDEA 2WB4A 3ZZUA 1BE8A 1G3RA 5LOZA 2PTHA 1K86A 3CUTA 1VG9B 4RETA 4EYKA 1NFQA 1XXHB 3DPIA 2I1KA 3GROA 1JH8A 2IC5A 3EQ8A 2AC4A 1GNRA 3DCIA 4TLAA 4HS2A 4W1RA 4K0RA 3PZ3A 2W6JA 3MAJA 4TVKA 3PYXA 3IXEA 4F7DA 3HKBA 5JXJA 3GWZA 1D04A 3ZU4A 4DDUA 2O7NA 2HX1A 1Z2CA 4M60A 3UVEA 4O6FA 5DP2A 1EIWA 4NQ0A 3DP9A 3DQZA 1G3NB 3WLJA 5CNKA 4LK2A 4PYKA 1H2HA 1E3IA 3VLFA 2PZIA 4YRRA 5BMVA 3ISVA 4K0KB 4D8WA 1HO3A 3D1VA 3H42B 2IPOA 1FFWA 3FR8A 3PWKA 3R5HA 4WNAA 5PNTA 1ZDMA 1YB4A 2ZQZA 3OPXA 1QRTA 2R05A 1QORA 2WTMA 4X7RA 1R0LA 1AUXA 4RTLA 3KJGA 1RJ9A 2J9QA 4JB0A 1K3ZD 2O7VA 3H99A 2YWCA 2GDJA 1RZRA 2PWAA 4LTMA 5CJPA 3WYGA 5HZGA 1UBJS 2OCLA 4PC1A 4OHVA 4RBNA 1EFLA 4Q18A 4DQUA 1ZOSA 2ERYA 1L5HA 5FOWA 1H69A 1FOEB 1XNGA 1QXSA 4DA4A 1RWMA 4GKKB 5EJ9A 2HIGA 4FHEA 2OESA 1N0HA 3IAUA 3QKYA 2A4MA 4N0MA 2WZQA 2OSVA 3PXGA 4EHAA 1JIXA 4QD3A 1JU4A 4KOAA 3H5TA 1HLPA 5FL7A 1E6UA 2PJRA 2PGNA 5JHHB 3OO1A 4Z0HO 3H4TA 2DQSA 4EEXA 4KLAA 4L2LA 3VYTB 3WB1A 1D7AA 2GM3A 2XUQA 4ANWA 3RVDA 4F92B 2NO7A 2XEHA 2TECE 4G8DA 2CC2A 3FN4A 4JP1A 4KR9A 3I12A 4H6PA 4Q93A 4FC7A 4CZ2D 3C4JA 3IAXA 2AW5A 4Z4CA 2J9RA 1B8PA 1JFLA 1T13A 4G5XA 3A26A 3GPLA 4ZYZA 2Y99A 3NTXA 2AR9A 1FSFA 2H4XA 2PH1A 1YBAA 4AIFA 5A7HA 1KI6A 1KY4A 4YFYA 2XCCA 3JVEA 5B53A 2B4QA 3TLEA 4ZEWA 2QLMA 3KSMA 1JEAA 1JKIA 5A04A 3T1HB 1TEZA 1N2OA 2RCYA 2NGRA 5JAPA 2RGXA 2NZXA 4BL5A 2V0CA 2IWHA 2P9FA 1AZWA 3LUHA 3S2FA 1I7NA 4ALIA 3FSGD 1XMJA 4Y9UA 4F6RA 4X8LA 1M6HA 1T5DX 1JHYA 1QZZA 3OOHA 3QYAA 2VDWB 3KS2A 1VL2A 1XO1A 5CM9C 4LISA 1V4VA 4UTPA 1RI5A 1PT5A 6REQB 1LTHR 1SZAA 2SKDA 3E7WA 5A5VA 4C0QC 1TT5B 3CHPA 1T25A 4C4AA 2P78A 2PKXA 5FI3A 4D9HA 4K9OA 3AP2A 3FGNA 4CF6A 4L8VA 3I5MA 4MSUA 2XOKD 4BP8A 2I78A 3KUDA 4RA6A 4ZT7A 2PGDA 1K6MA 4B7ZA 1PGQA 4GAEA 1QBKC 2V7WA 1TJPB 2V5VA 3P0HA 2OD7A 3EQZA 1GPH1 1Q3HA 5CNMA 1BXZA 4PAGA 1PJAA 2FFBA 3A9TA 2YNMA 4H4DA 4MS6A 2P91A 3DTVA 3VSBA 5HR5A 4UHEA 5TLSA 5B2FA 3CR3A 3ZEFA 4BMNA 1Z15A 2M1XA 3R7WA 4BB6A 4I50A 3RVMA 2GRJA 5KX5A 2AA3A 3HKDA 4B7UA 3FMPB 3A2LA 1BJKA 3I4RB 4L9SA 4LXUA 2IL1A 2WWWA 2MYNA 3PIIA 1Q1EA 3TL2A 2EJWA 5ITZF 3WLHA 1BO6A 4FC8A 2CFTA 4OGLA 3KTAA 3EUAA 1ZMBA 2NX2A 4P53A 5BR1A 3P9NA 2J9ZB 1E60A 3OEWA 2C4VA 3AV3A 2KBFA 2JEKA 3EZNA 3A2MA 4DV5B 3HCAA 4LCJA 3H05A 5ADHA 1NHWA 2Q8NA 2EQXA 4NOMA 2P79A 3PDNA 1U0TA 4ZT5A 5FBQB 2IA5A 2JVJA 3I6IA 4AF6A 4HQKA 2Q5EA 4BRZA 1IZYA 2D5CA 3HGMA 2FUEA 3RIEA 4UE6A 2CZGA 1XZPA 1BMDA 3MMXA 1OZAA 4LRQA 5TPWB 4O4LB 1OCRE 2OHFA 4WK4B 5ENQD 2XYVA 3MSXA 4TXMA 1D8AA 2VWQA 4F71A 2YNMC 4MS3B 3MCAA 1G9SA 2W6JD 4ZT6A 4D9EA 2Y93A 2XWJI 3TL3A 5JH7F 1RKBA 5BSTA 1M2EA 3TG5A 3IP9A 2WTAA 4LDNA 2ZJOA 3R24A 4IIDA 5I8ZA 1P5FA 1X14A 3EWIA 3H9QA 5FJIA 3OQNA 4EGJA 4N82A 1KYQA 1X9IA 4I2VA 5M34A 1IEWA 1F8XA 2HNBA 5F23A 4M9ZA 5J58A 3P96A 3K0FA 5DLEA 3GNQA 4HLDA 3D3JA 3KQNA 4I1SA 3WQQA 3GR6A 5BMOA 5DT2A 3RVJA 3MERA 4NE9A 2FPGB 4IV0A 2I1LA 3FDXA 3BZWA 3K30A 3M8KA 1XCOA 2A4KA 1HWYA 3LVFO 2VDVE 3DFMA 4HQ0A 3U17A 2A1TR 4PONA 4Y6WA 4HNTA 3ER8A 2AI1A 1YF3A 2FA9A 4YREA 4EX7A 4H31A 4QJ4A 1G8YA 2P9NG 4Q9NA 1K0UA 3D3NA 4EMTA 1OAAA 5TQVA 2A84A 3DDZX 3JQ0A 3HV2A 5M29A 2JEYA 5FEMA 1Y6IA 5BUQA 2FWJA 2H1CA 1NI4A 2VDJA 2OEWA 2JZOA 1DDIA 5FPHA 3OPMA 3RG2A 2GEFA 1SBZA 2DVMA 2JPDA 3PC2A 2XGMA 4WTOA 5LP6F 4ARCA 3WWCA 3KB2A 4WZAA 3P4YA 2IEJA 4ROSA 4R7LA 5CB4B 4TMYA 1JN0A 1KF0A 1GG5A 3NP9A 4M22A 3ASZA 2LCFA 2X2FA 5KOHA 1ID1A 3FYCA 1J21A 3QSGA 5JJ5A 3TK1A 5EIHA 2QN3A 2FGJA 3EXEA 4ZQIA 4D44A 4X6XA 3ZYKA 4ZCRA 4OMFG 3LECA 5HXAA 2XADA 2J32A 3Q49B 1VYUA 1FFBA 4A6DA 4J76A 2Q7XA 1W5BA 5ANRA 1BAPA 1YB2A 3T5MA 4JC4A 3HDVA 1LWOA 3FTFA 2PQ6A 3I05A 4AZ0A 4DLPA 1K4KA 2CJXA 4OG2A 4KAJA 2ON6A 5HQTA 1TA0A 2YWXA 4YLGA 1N4QA 2G40A 3FW1A 4E13A 5EQFA 4QATA 4TM7A 2F7SA 2AOUB 3MMSA 1JG2A 2V8BA 3SJCA 2C96A 2NU9A 1JKMA 5C3MA 1TQ8A 3OZVA 3LS2A 4ESHA 1YIDA 2CG3A 1G4HA 2PM7A 221PA 5C2JB 1DHTA 521PA 2QZ4A 1NRJB 3AONB 1Z73A 2N3ZA 2BFCB 1AU9A 1YFKA 2YS7A 5JNRA 5KJ1A 1T9HA 3C6BA 1E9SA 2QC9A 4XYBA 2RSLA 1B1AA 4UAGA 3ZTYA 2D2IA 4RHEA 3GJ7A 4CIVA 4MAMA 3CJRA 2Y1LE 4EH1A 4ODIA 1NN1A 3SNKA 1Y3IA 3U61B 3OY7A 4KW7A 3VKWA 2LWIA 3JWIA 1FX0A 3F6CA 2H4YA 2JDIA 1T5TA 4IDFA 3QUQA 3CN7A 4JYMA 3FF4A 4MIOA 2GD2A 3EIFA 1IY2A 4MH0R 4JVOA 2XQIA 3FD8A 2FQQA 3EVDA 4NG5A 4INJA 5EP4A 1H2ZA 4ALJA 3BERA 4NCNA 4ES6A 4JHRA 1P5HA 2G07A 2NZ2A 1YZVA 3N7TA 1T6XA 1IH8A 3AVVA 4W82A 1CEEA 2O57A 1MO5A 2GRPB 3ZGXA 3KWFA 3QVKA 2PA0A 1DPGA 4MUGA 5DK6A 4OL0A 5AYVA 3NT5A 2H48A 2X0NA 5CVDA 4CKCB 4HAWA 3GLVA 4MCIA 3U7JA 3PNYA 2XXAA 2YN2A 3A4NA 2L42A 2XZDA 3TCNA 1HDEA 5F33A 3X1WA 2PZKA 4EW1A 2GILA 1DRVA 3KSBC 3PFWO 1GUDA 4BO4A 3LPMA 1HBJA 4V2IA 4KWTA 3RADC 2CLKB 4URZR 2FTKE 2C92A 2I54A 3B70A 2KCKA 1H4VB 4FYMA 5HKLA 1A9SA 3NHKA 1HDRA 1MEOA 2A0UA 5DWQA 2WXLA 1Y1RA 2H9YA 4U6SA 3JQBA 3WNCA 3HA2A 3MJFA 4W4TA 1JEEA 4JYAB 1BQ4A 2A5EA 3UJBA 4XJVA 4KDEA 4RTJA 4ILIA 1F3LA 4GWKA 1DC8A 5E4TA 5AUNB 4GYJA 2KYRA 4MARA 1S9DA 3FTPA 2C0MA 1VJGA 1GTZA 1H42A 3TUZC 5JRDS 2J30A 3VR4D 3G3EA 3PIRA 4OFZA 3JY6A 1W93A 1UDWA 5K0GA 1W3BA 1RYNA 3MINB 4QSMA 3L8HA 4DHEA 2VDQB 2R03A 4XPIB 1U8FO 5G04J 3IHYA 3WGJA 5KPJA 3WRWA 1CVRA 3QHQA 4XB1A 2JGRA 5ITZA 2B3DA 2FLWA 2NTVA 2V6GA 2O4UX 2IS1A 1KMIY 2R6FA 2G9NA 1QC5B 4ARBA 1NATA 3SXPA 4GLJA 2ODPA 3RK0A 1IM8A 4N7BA 3SIPA 1A17A 2Q2QA 4RELA 2QVLA 2ZB2A 3CRVA 1NBME 1QTRA 5C1IA 1K1BA 3F6RA 4QOJA 1QRSA 1XRRA 2HR1A 5CM8B 1Z8NA 1G5QA 3ZG6A 4LWPA 2XODA 3HBLA 3D3KA 4BNFA 4Q69A 2QW0X 3QVJA 3GFBA 3R0ZA 2Z4SA 4M0FA 3F3SA 5DJ5A 2H17A 4LRZA 1Z4OA 2IOHA 3BREA 3T3IA 2ZRNA 4B75A 4AJEA 4TKUB 2ZRCA 1YR2A 5JXHA 5KHLB 2DHQA 5ES3A 1KZ4A 3OM8A 1RC0A 5CMLA 3E61A 3F6SA 5B36A 4C0BA 1BNCA 2MDTA 4MITA 2JFHA 2OP1A 2Y2VA 1RCFA 4QQIA 3N0RA 3MWFA 2ZYVX 4CT4B 3BEOA 2XD4A 2WXNA 1WB4A 3BWYA 2GUGA 2WT4A 1XQ6A 1A95A 1QQ5A 1EDDA 4EUSA 3B78A 4JT8A 1IULA 3CMMA 4NP6A 1WXHA 4EO4A 5U4QA 3ILHA 3RRMA 3TOZA 3ZHEB 2QMHA 1M5UA 2BFBA 4DQVA 1JIUA 3ANNA 2C5EA 3C3CA 4MV5A 3AVQA 2JF0A 3DT9A 3T38A 2XZTA 4V0KA 1DP4A 5FUYA 1QZ3A 1SBHA 1KIMA 4KMSA 3KQMA 3CK9A 3S2GA 4FFOA 1IK6A 1AA6A 1CB7A 2ORWA 4QJ5A 1NF9A 1U5AA 5K0SA 1O95A 3FBTA 4B8WA 1UKAA 1R12A 4KV7A 5CUQA 1XN1A 3Q0EA 5CEJA 4KVZA 4C0XA 2OV8A 3LFHA 5G1PA 3HKCA 1G3MA 1CRLA 3T3HA 5GZ3A 5DTQA 4V38A 3HCCA 9GPBA 4QQNA 1CT9A 2F64A 4O4IA 4B47A 3BMQB 1MNAA 4EG5A 2ZVDA 1U0HC 3C5RA 3BDIA 4FK8A 3O92A 1WMEA 1M1UA 2F1KA 1SXGA 4WAFA 1T9ZA 1RM0A 3QBVA 4I6JA 3PXAA 1AKVA 4QQFA 4PNPA 5D85A 2ILVA 3UFBA 4JU8A 1K66A 3G9XA 3ENNA 4DBLC 4XQ9A 2H6IA 3UKDA 2P2CP 5FXMA 4PV7A 1AHHA 5D7BA 5HP4A 2VQEB 1QIKA 5J43A 4HDNA 2GQ0A 3Q0TA 4CKEB 2G08A 3BE4A 1C0LA 4A6XA 3D4NA 4WW0A 1IOVA 3GUZA 5D3MA 3ZWWA 4RGYA 1QMGA 2ZPTX 1L2TA 5EE1A 3KOXA 4HWSA 3JQQA 3QARA 5EJFA 5D86A 3AL3A 3UXEA 1Y9JA 5LR6A 1NW4A 1UOOA 5HKKA 1QYVA 2PO7A 2VTBB 3WGTA 3K15A 1J5XA 2REOA 4KODA 1O95C 3EHDA 4E09A 4C4PA 4LY6A 2WSSA 1IXYA 1S96A 4GMRA 3TEMA 2XE4A 1BS1A 3L17A 4BY6A 4G5SA 2A94A 1MQ8B 1JILA 4MR8B 2I80A 3OTIA 4XQGA 2BFEA 5GV8A 3ROKA 4GF5A 2HCBA 4D6XA 4CEMA 4RCVA 1B0AA 3C87A 3P9IA 5EMNA 4OGKA 5DVZA 1CUAA 1UXGA 3ZOZA 5C8YB 3UT6A 5KJEA 1DTEA 2DETA 3CLVA 5JWHA 2D06A 2X3YA 2VA8A 5LP6C 1GCGA 2WM8A 4O2BA 1ZHHA 3Q9NC 1O8CA 5LUAA 5ALMA 4LBZA 1TRKA 2QF7A 2XTZA 4US0R 4HLUA 5DO9A 2ZB8A 4RZSA 4YJHB 1TYBE 2YQZA 4ITUA 3T0FA 3C3BA 1M7GA 3CRQA 1PI3A 4FWBA 3WIVA 2IV3A 3G02A 5J90A 5F73A 3DHYA 2VYNA 3FYDA 5LYYA 1DBIA 1M2KA 3FOFC 2DY0A 3CB4A 4YRKA 4D0GA 4YDWA 4B6SA 5HRAA 1DFGA 1Q5PA 3ZIMA 1G41A 3KCNA 4CETA 3DSSA 1YVPA 9ATCA 5ERGB 1EGQA 1XJCA 4R1UA 4MR7A 1IMJA 3PF9A 4PZYA 4I19A 4BATA 2Y1LA 1MXHA 4S1WA 3TIFA 4LTNA 4DBZA 5IHXA 2ZW9A 3AEUB 3L82B 3ZX5A 3C5WP 4ND8B 5KEIA 2O7SA 4P4NA 2JJ2A 1XRSB 8ABPA 5C51B 4GI2A 4D6PA 3A05A 1Z5UA 3EXG2 3P27A 5BXQC 2PBFA 1PJBA 3LBIA 3BRWA 4DI4A 1S70B 3WYDA 4ZZ2A 3DPYA 3IERA 1XHFA 3WA6A 4K7JA 3OZEA 4QVIA 2FSPA 3MBOA 2E4AA 5HTKA 1XZFA 1XVAA 2A35A 5FOTA 4TQUS 1QP8A 1QHHA 2XCIA 4HDMA 2ZVPX 3VTXA 4GQIA 4PLVA 1CVLA 3ESLA 5LQSA 5HCUA 1IOWA 2WM3A 4B43A 2VZ0A 4QYXA 3CF4A 3PGKA 7ABPA 3MRTA 2IY0C 1BFKA 5E6RA 3NIDB 3SFZA 3VC7A 1V11B 2C61A 3GD5A 4W8GA 2LXMA 3AF0A 4I0WB 4BE9A 4Q3NA 3PU6A 2JAQA 1VI6A 2Z2KA 4N3GA 4XWGA 1EFRD 1MA0A 4MR9B 1ZINA 4YYEA 4C0AC 4D6YA 4E5DA 4EBBA 1AKTA 3V2GA 4EHDA 4R8SA 1NVEA 4TTJA 1QK3A 5KTTA 3URZA 5FOXA 4NOKA 1S3IA 5H5JA 1EYHA 4RD2A 1GQQA 1DZ3A 3KZOA 2MR6A 1A4IA 3QENA 2WHPA 4GP9A 3L6DA 1ZK3A 1EGHA 3PNLB 4WNEA 5JOQA 4B2PA 4IIYA 4F56A 5H8WA 1F8YA 5CEAA 4CIWA 5TQJA 5T57A 4BN0A 3M6LA 4JB8P 5E0KB 3I04M 3E30A 1L7DA 5JT1A 3EGVA 4RKYA 3SN6A 5CA1B 1E77A 1SWVA 4ZO9A 1EG2A 1ZKMA 1WBJB 3ASGA 4G0WA 4HVTA 1G6Q1 4ZVVA 4L5AA 2HN9A 4CKXA 2O0LA 2RHWA 2A5JA 1MBZA 1ZXLA 4RL4A 2GZ3A 3ORRA 2VOEA 4MVXA 2L2QA 1VGVA 3OIYA 3WL7A 1XRMA 1VHQA 4D0LB 3RW9A 3MPOA 1WNFA 5ENDA 4B3GA 1EVJA 3UPUA 5ARGA 5CBPA 3A28A 1QTNA 2IHYA 4IOLA 4KO4S 3SSOA 3LG2A 1BVYF 1JSLA 1GG9A 3FMIA 2R4UA 1WEHA 2YS6A 2VSFA 4UZEA 5JD6A 4F2HA 3RRZA 4HDSB 1X70A 5C53B 5EUBA 2M98A 2PUJA 5A06A 4Z1MD 5JISA 1WQ3A 1G5IA 3F4LA 3B7TA 5KVCA 4F9FA 1NXTA 3NG1A 1T34A 3I2FA 1QX4A 3KPJA 3ABIA 5DBFA 2DH5A 4AUNA 1AQIA 1YR8A 2PS3A 3NC4A 5F5NA 3LUCA 2ZAYA 3DSXA 4XPZA 1QPGA 3LX6A 3ZKAA 3ZLTA 3Q3HA 3FTQA 1GU0A 1FFGA 2VDUE 2Q9CA 2C2HA 1KZ7B 4BWVA 4GCNA 4JKIA 1JMKC 2VLBA 5LL6P 5EP2A 2FWIA 1DJMA 1FP4B 1ZCBA 2P2NA 3JALA 1JE0A 3QUTA 1ESDA 1Y4ZA 4AD8A 3ZJ4A 1VBKA 3KEQA 3SIRA 2X9QA 4QUKA 2FW7A 3BVPA 4KFRA 1MX6A 3JYPA 2UUOA 1OY3D 1GCUA 4ACAA 3B3QA 2V8SE 3JVVA 4D2IA 2BHRA 4EFKA 3CKMA 1SA0A 2QPAA 4HNVA 4DHWA 2F9FA 5COAA 1D4FA 3HRAA 3FX2A 2VK1A 2K2WA 4F0JA 3RTAA 3WGYA 5KVSA 4IBOA 2JHFA 5ITSA 4OO3A 1ZXBA 2O07A 2HMVA 4B4UA 2XNSA 2YWHA 5JXGA 1FFEA 2GX6A 3AU5A 5TV2A 1C8LA 2AH5A 4DVGA 3CLJA 2B2NA 2ZROA 3OD5A 2NZJA 4HX5A 1T2DA 2NYUA 5AK0A 2M6LA 4C43A 2SBTA 2GLTA 1DXHA 5EINA 3ACBA 2B37A 3MB8A 2IRWA 4PGMA 2SHKA 4FYVA 3TIGA 3UMVA 2VYND 3Q3GE 1N2IA 4O2AA 1WCWA 3GAAA 1RYHA 1PWEA 4KHZA 3G0CA 3OT1A 3TZHA 2F1IA 4J7AA 3PCXA 2BAGA 2ZS8A 1JHRA 5I45A 3GBPA 4BEBA 4LOIA 4NV1A 4KVAA 3QWIA 2BEVB 4BS9A 3U4DA 3Q7AA 1BDJA 5JY6A 4BLQA 5JSZA 3DCNA 3UO8B 2ETCA 3KB8A 3NF1A 4D0RA 2CYBA 3AEKA 3K0KA 3SBDA 1NXQA 4JD2G 4GI3A 1XWWA 1A9OA 1XLWA 3A1TA 5JPCA 2X6QA 2I8AA 4K6MA 5JANA 3OO0A 2P4QA 4XKJA 5B64A 3COZA 3F9IA 1PC2A 4PQEA 3F5DA 1OYVA 1XNHA 1ZP6A 1FXSA 4B7XA 1G8JA 1SXJC 2WTBA 5ENTD 4L74A 2PZEA 4PCVA 5KMGA 1NR7A 1ZK4A 3L92A 1UDXA 5EKXA 2PKCA 1ENOA 3RNLA 1XDDA 2QMOA 3CC8A 1ODJA 1ZRSA 2GZ2A 1R6VA 5BPPA 3H8SA 4ZPXA 3UWOA 4LSZE 1C2TA 2ZIWB 3KALA 4FNGA 4R5MA 4CIXA 1PHRA 4LNUB 4GOJA 4CMIA 2P9GA 2OBLA 3U31A 5LCXA 3AY3A 1U2QA 2DB3A 1B43A 4G0MA 3R6LA 2Q1YA 5ALYA 3JQ8B 2QMUA 3GLTA 5F51A 2BGKA 1UOHA 3C6MA 3QBEA 2ZFUA 1P39A 3JRNA 2V96A 2EX0A 1QFMA 4DSTA 4IGIA 721PA 1RWNA 4CUJA 2UXBB 3C3PA 1KZPA 1FDRA 1HH8A 4RKFA 2OK7A 2W2KB 3D0QA 3I0ZA 1KEEB 1H1LA 4JLMA 4JUBA 2IY8A 2AKYA 3WIEA 4WCFB 5DLPA 3OU7A 2HA4A 1J8YF 5AK3A 3JZDA 3GWGA 4ZDJA 1NUQA 3G89A 3PDHA 2FZEA 4NHEA 5JSUA 4F6CA 4ZVPA 1MA3A 2C9BA 4MKTA 4QXOA 5A02A 5ED0A 3FPSA 1IDN1 3R5FA 3GHHA 3QEAZ 2V5QC 3RHSA 1TM3E 4HB0A 1UC8A 4Y2VA 3K0SA 4WZ6A 3CH4B 4BQFA 4IDEA 3M6WA 1OXSC 5B4TA 4OREX 2DIWA 3UQYS 4N5DA 5DHQA 2ZRFA 4Q4HA 3MWDB 1K6EA 4P82A 1NBMD 3HUTA 1Y1TA 2N75A 4HNAD 1SCKA 3U44B 2POQX 3UIEA 2PSEA 3NUGA 3TNDA 1F8UA 2XDWA 2VPZA 4U9IS 2Y77A 1E8NA 2YXLA 3ZWYA 2XEXA 1C9MA 2G9VA 5C7IO 4Y2GA 2EARA 4I4NA 1YZ3A 1FB5A 3KL2A 4R16A 4M8IA 4R2JA 2QR5A 2VPQA 4G3XA 2O5RA 2XBUA 3OICA 4FR5A 3KD2A 4GOKA 3ETEA 1N78A 4CM4B 1TJCA 1OB5A 3KSDO 3W2GA 5H0IA 5LVAA 4YMUA 2IEIA 3RKUA 4EY7A 4G5HA 5CNIA 3P1JA 1PR1A 3WJ7A 4WKNA 1KK2A 4M0MA 4Q3AA 3OM0A 1DAPA 3AVUA 4JCCA 4KXLA 2JCXA 1L1EA 1XJWA 1Z6QA 2YV2A 1AD2A 2MYPA 3RABA 4AN4A 4KFCA 3RUCA 2QQ5A 1C50A 2ATVA 4UQXA 3NM5A 2EOAA 4QYIA 3BMNB 3RO7A 1MUUA 2A67A 5TE9A 5AIAA 4CLRA 2YC2C 1OFTA 4PVDA 3KYDA 4RESA 4ZYVA 1DUIA 4A4DA 4KQGA 5THKA 2P65A 4JJ4A 4FFLA 1L9XA 1L0BA 1EKXA 3R3XA 2OV3A 1U9ZA 1QHGA 3R2JA 2D8AA 4YALA 2PJDA 5L9AA 1ISMA 5DHRA 5AM3A 4ID3A 4W63A 3UJDA 4N6GA 2TRSB 1QFYA 2H6FA 5FFNA 3PKZA 2PVPA 4OVKA 3X2SA 3C15C 1V39A 5DM2A 4B3RB 2ZYAA 2PWZA 4UMDA 4ESVA 2CBXA 2X1VA 2W70A 1GU1A 2H54A 3LPNA 5M7EA 1BN7A 2QMQA 2WVAA 3RWMB 4K8OA 2ZVJA 1VCHA 3HWRA 3PICA 5AM1A 3HHPA 3WLLA 1BROA 3E9YA 3UAVA 1J39A 2ZEJA 2WA2A 3G9QA 2PX6A 1COZA 3QOYA 3MZLB 1DRKA 2RG7A 4KR3A 1DFIA 4UASA 3IXLA 3VI3B 1JTEA 1NT2A 5AW9A 4D99A 3DLCA 4NECA 4JUIA 4F5YA 3ZK7A 2X4GA 2J8SD 4HKTA 2YXNA 4ICIA 4NBKA 3VR6H 2EBUA 1VMDA 1LLCA 1XYGA 3BDAA 4CZ2A 2CVZA 2PIDA 1FP7A 2HLNA 4U8GA 3JQEA 5GZ1A 5AW7A 3U80A 2Z6UA 3UJNA 4O4HF 2XA1A 3CVYA 3ZV5A 2XTNA 5ARFA 2DCUA 4R68A 5ILGA 4KBFA 3GGCA 1OHHA 1C7ZA 5AI6A 1H2EA 4N7RA 4Q82A 3PHHA 1C1HA 2VP5A 4X1YA 5K0ZA 5LZ4A 1QIIA 4QLOA 1V8PA 3SFVA 1E4VA 3CBGA 4OXXA 5SYAA 1EJ0A 1EF1C 4WZBA 1KPIA 5JS7A 3MTIA 2OCDA 1A69A 3UATA 3DZBA 4R2KA 3V8EA 2DM6A 4R2WA 1X74A 3FSGA 4A0SA 2RGYA 5IN4A 4WPGA 4OV6B 5FAXA 2ZR8A 1PK8A 2BLNA 2FMUA 4W7SA 3KJEA 1YVEI 2G1PA 5ES4B 3HO6A 1Z34A 3RTEA 5JFTA 3BH6A 4W7HA 2XJ4A 4B31A 2FU5C 2F8XK 2DWCA 2XOKA 1FW8A 1NF3A 1PZXA 3W8FA 3OQPA 3RUIA 2GTPA 4EVSA 2AWIA 5D3QA 4Y0AA 1OQAA 3CHQA 2AL7A 2O2XA 5AKZA 4Y3UA 5IKPA 3RLFA 5ITWA 5JEEA 2WQZA 1YS4A 2HXGA 4PG5A 2D5AA 3HVUA 1VL5A 2BE7A 4GO1A 2OAGA 3RVRA 1SHUX 1OIWA 5HQ3B 5AOBA 4CWAA 2BGJA 2BONA 3U4IA 4POOA 3SF8B 1PGJA 2K7FA 4QWWA 5JZBA 2J0QA 2YIDA 3NJ4A 1TZKA 2GZMA 5DYYA 3EWNA 5K51A 2IZ7A 4ZRDA 3BIXA 1J00A 4I1OB 4AL4A 4AZWA 3R76A 1BCRA 1YVUA 4GXRA 1PHPA 1PR3A 1VHDA 1PT6A 4LECA 5DPMA 5HS4A 2D1QA 3BXFA 2B61A 4EHFA 4M1OA 3OM9A 3IQFA 1HGXA 1CUUA 3I1YA 4CFZA 4XWWA 1GKYA 3FU3A 3IGFA 1S8FA 3V3KA 4NCKA 1BW9B 1FBTA 2Y66A 3GRZA 1C9NA 1D2GA 2NXPA 4LJAA 4Z49A 1DADA 4F86A 2MSEB 1V3UA 4MQMA 1TGYA 3QLUA 1FZQA 4J0CA 4CV0A 5AQ7A 2OZLA 3TX2A 1KI3A 3D81A 1RXCA 3RBZA 4B9AA 2ZXFA 4MWEA 3V7WA 4KAXA 1DC2A 2JAXA 4EHJA 1KSGA 3ZHVA 5IRCD 4HFGA 4YIKA 1PQYA 2IUEA 3ZE7A 1KXZA 3K2EA 5C18A 4KUGA 1V9LA 1YR3A 2VRNA 1KH1A 4TLEA 3CH5A 1NF8A 3A6EA 2NSYA 2XCSB 3BXGA 4J0QA 1YIOA 1YRHA 2FKNA 1QFXA 1B15A 2KJQA 4FZJA 4Y6GB 3ZWKA 2A5UA 1Y98A 1QLHA 3WWDA 2BE9A 4HNUA 1R0BA 5D87A 4UC0A 2XEEA 1QV9A 1U1IA 4N40A 1W36B 1G8KA 2GCGA 3ZGZA 4TWRA 4YRAA 3CPEA 4BC0A 3EARA 3ESBA 1L7MA 4FN4A 1G3UA 1FFHA 3DE1X 1UZAA 3AZOA 3LKUA 4PN3A 1JALA 3E37A 2BR3A 1U3DA 1UH5A 1N6KA 3GF4A 3VMFA 3NONA 4KXQA 3U49A 4L85A 2I6GA 3TFOA 2R25B 4PGGA 2WU0A 3AHEA 3B6IA 3QYPA 2CXHA 4EYEA 2OR3A 3OTHA 3T3OA 1LTXA 1P1BA 3GPCA 1KAHA 4PX5A 1X1RA 3ABRB 1KDRA 4FR2A 3QWVA 5LZ7A 4WOJA 2WJ3A 1PSZA 4RF4A 2WYHA 5EIWA 3PZBA 4ZVSA 4TT8A 3AF1A 4BU1A 1H4SA 4UTVA 1F2UB 4RXMA 2FHPA 2WRZA 1WSWA 4MEJA 3M4XA 3QMVA 4ZN6A 4YHBA 3S1AB 4IVNA 2Y4OA 1JW9B 3H17A 3SYLA 4B3JA 2H9AA 4AJJA 1CFZA 1H5NA 3S2UA 3N8DA 4ZA2A 4Y9SA 2O4CA 3CUWA 3ELUA 5CB8A 2ZZNA 4TL8A 3NTOA 1CIJA 2IU4A 4GG1A 1UMBB 1JCQA 4GR4A 4EECA 4LFAB 1A82A 4YN3A 1OV4A 4MXDA 2FPLA 5FTLA 1UK8A 4LUCA 2C5FA 3RJ9A 5AKXA 1VJTA 5EJ5A 3M83A 4JLBA 4B33A 2FLKA 3VTFA 6CHYA 1JWLA 4Z9XA 1CBUA 1OHHD 2AR7A 4L7QA 4JU9A 5JWRA 4MWCA 1N5MA 4OAPA 3JWPA 1JQ5A 4Q6WA 1TQ6A 4Z7NB 2DKOA 3CHSA 1U5BA 5ESRA 2X5JO 2FWBA 3U37A 1XTRA 1XCGB 4JQSA 3ASHA 4BZZA 5DNEA 1HQKA 2ZTSA 3ESKA 3RFUA 2FYTA 3L8YA 1VRWA 3TKYA 4FYWA 4LGCA 1ORHA 2P9YA 2AJ8A 3HB7A 1B8UA 2WMOA 3G2PA 9MHTA 2CDCA 1QFZA 1A2KC 1YJQA 3FKQA 3WS7A 1DWUA 3P5SA 2JI4A 4HUQA 4MDHA 1Z6XA 1XRJA 4XVUA 2PXCA 1F48A 3UB4A 5KTYA 4TKVA 3EOZA 1RBYA 3WADA 5K2OA 3W9BA 2V0GA 4CEIA 2WFLB 3MS4A 4P4TA 3C98A 3N6VA 4LYAA 3GOHA 3RS0A 1TQ2A 1T8PA 4RK4A 1PR9A 4FFWA 3Q2OA 2ZYRA 2IPXA 3U1BA 1W5SA 4O4HA 1P0MA 1DBQA 5BSGA 3NBUA 4ZAZA 3GZ1A 3AX6A 4PQFA 1DSSG 1RLUA 4BKQA 1XZEA 4JA0A 1P0IA 4CR6A 3N8HA 4Z4FA 2EQBA 2W8BB 1QS0A 4LNGA 2PDAA 4LDRA 4TTIA 2OK8A 1S2DA 1CUEA 1V9CA 3EGXB 3GD7A 3GHYA 4WZZA 4ZZ3A 1P80A 2WOOA 1PFWA 3UY4A 4IIXA 2OENG 4GZLA 5FB3A 3NHRA 3TBFA 4TMTA 3MCZA 4UU0A 3NWPA 3U4AA 1Z26A 2PBZA 5CCEA 1BMFA 2D62A 4I4LA 1S01A 1R9JA 2X0FA 1GUZA 1OZFA 4RH1A 1LUAA 3NBFA 3QVVA 3FXAA 4RWZA 3O2NA 2OMKA 3OSUA 4P7FA 4HWPA 3S44A 2I7DA 4CBVA 2PMWB 3GL9A 4ARUA 4BLOA 5FTJA 1T2FA 2HMAA 3ILXA 4JT9A 3DFKA 3IE2A 2WIDA 2OHGA 1C30B 5C8DA 3O91A 3DC7A 1A7JA 1FRZA 1ZBDA 1S4QA 2P1DA 1SWWA 2ACVA 4ZV4A 5I4IA 5HIIA 4NBLA 2NP6A 5F5XA 1TC1A 2YJ3A 1A96A 1YS2X 4J03A 1D2CA 2CDBA 2P2ZA 4B46A 4AJ9A 3CEQA 4CCWA 4UQOA 1Z3XA 1Y8ZA 2WMNB 2X6KA 4ZDWA 3VR4A 1JI3A 3A9CA 3TW4A 4ENPA 1KNXA 3R3YA 3ZGLA 3FH7A 3QI7A 5JC1A 4I9HA 4EP1A 5DZSA 4MVJG 5K8UA 5KNBA 3CR3C 1SBQA 5IM5A 4AKGA 1PL0A 1YZTA 3EMDA 4G26A 2LAHA 4C04A 3ZNPA 2B7BA 3GPDG 1G64A 3IMCA 3ASFA 1GL6A 4D9GA 1UOQA 3K35A 4GZ3A 1Z4NA 1OX4B 2QQEA 3D9OA 5J1SB 1QH9A 3IAAA 1BHO1 1JECA 4M9SA 3QE9Y 2Z5GA 2X5XA 3TYXA 1IQ0A 3T54A 1CD5A 1G6KA 3A0UA 3TAHA 2IOQA 2ZXWE 1PTJA 3QGMA 1LQUA 1V1JA 3JARA 3AL0C 3ROXA 4MUBA 4M49A 1JUQA 1ZOLA 1C1DB 2A0KA 2Y67A 1JCSA 1HFJA 4QTZA 4X90A 3PVLA 1EDUA 3VYRB 1XALA 5L3VA 3IUEA 5JBNA 2ZI3A 1PEDA 4A0FA 1T2UA 3PHJA 2EEZA 1B93A 1SVMA 2XR1A 4DX7D 3U4MA 2O54A 4UBJA 1EDOA 2XSZD 3HBAA 1RE0A 1N57A 2ZE8A 3AUUA 3KT6A 3P52A 1UT8A 2NNWB 4OH1A 2YHUA 4S1PA 3BDVA 2QLTA 5LB2A 4NZYA 2A5GA 3ZU2A 2YMQA 4HATA 4M87A 2GMWA 4IIGA 1OE0A 3ENEA 4U07A 3G0DA 1OD6A 3RS9A 4O4IF 5KDDA 3FOWA 4UM8B 1KBQA 5A5FA 3HR7A 1GL3A 1PLLA 5EDSA 1YZKA 4HVBA 1H65A 2XLBA 1XMXA 4OI0A 1L4KA 4URXR 3LCMA 4BGEA 3SBOA 1T9CA 4GMLA 5AOCA 5CU7A 2OCBA 2O0KA 4G1CA 4OQZA 5BW6B 4DX6D 2EFJA 4JFAA 3K8QA 5ETJA 2GYWA 4XIYA 1DV1A 2P0EA 2FO7A 1XDSA 4KPYA 1PGNA 4UZFA 3RNOA 1PTJC 1RZ3A 1MX2A 3MTEA 3W5CA 2ZIGA 2R65A 1SZPA 1W25A 4Y6CA 3V80A 4HZUB 2F8SA 1GV1A 1N6PA 3RIBA 4NI5A 4JBYA 2H6GA 3M4NA 4OK5A 4EYGA 2DPXA 5CEEA 2QJOA 4HQLA 3H11B 1UMDB 4KITB 5IT4A 4OGFA 2GHRA 2VSNA 1UM9B 4H3KB 1R0WA 2PEYA 2VL7A 3ZLBA 3CXUA 1EHCA 4RPCA 3DDNA 3AVOA 4PY2A 5KYUA 1QG6A 3X2EA 1J8MF 3QTTA 2QY6A 5CCBA 2DP4E 3W5BA 4MV0A 3QEOA 4UUAA 1JT9A 3BGSA 3RS4A 4FIZA 4J8PA 4UWGA 1RTTA 3LLMA 2B3TA 3LUJA 5HFNA 2EBWA 4O2BF 1BE0A 4CR7A 3CONA 4XYLA 4QYWA 4EELA 1KC1A 4NTZA 4ZC1A 2W98A 3MTBA 3R20A 2JASA 3EK2A 1JKXA 1B42A 1GIAA 3I0MA 4CG0A 4CLOA 2W8ZA 4DDKA 1KP3A 4DV3B 3QBDA 1IFXA 3CYFA 1YS9A 2FN8A 1N0RA 4LC0A 3JQ1A 3RARA 2CJWB 3ONFA 2RGCA 4JJEA 3P2IA 2WDZA 2PYIA 1LPBB 1V5IA 1CSEE 3LA8A 1N6OA 4PSDA 5CGQB 5E4JA 3TWWA 4FOPA 5CYGA 3VHXA 3H84A 2X6FA 2OCYC 4DJFC 5G1NA 3F1KA 3JWEA 1BMFD 1F2TB 2DBVO 3CVVA 1OSNA 2BMWA 4FDMA 4MGZR 2L6BA 5DULA 5KBAA 4C07A 2AN4A 4AAYA 5CMYA 3GGOA 3PE6A 4NVRA 4HWTA 4BMXA 2PPLA 3GP8A 4MW7A 2ICAA 3FUWA 4CL8A 4BVEA 2XB8A 1VA5A 1DPFA 1YFLA 5FX2A 3ZHUA 2ZOSA 4ZQFA 4BLVA 1DZIA 4Y1GA 1UFVA 3BS4A 4YRZA 2PO5A 3MYRA 2H5LA 3C3QA 4B6FA 4IQGA 3D43A 3U4TA 2JI6A 3NWOA 3O1HB 4PWZA 2FXIA 2GPTA 4I7EA 1ESNA 5JAOA 3BH0A 3UIPC 3M6XA 3R0QA 4EG7A 2L17A 2FWRA 4PYOA 1FK8A 4V3CA 3TH5A 4WE3A 4QQRA 1S7CA 5KNBD 4QQ8A 2XZPA 3TQQA 4BKRA 4DB2A 4CM1A 4GAAA 4M99A 5EI5A 1NAIA 4RQTA 5LP1A 3HN7A 2UDPA 4X41A 1BS9A 1TMYA 3MG9A 2IE8A 1DWQA 1HYHA 1KYYA 3TB6A 4LJLA 5BXYA 3LT2A 1L7QA 4OBBA 4QDUA 2LDBA 5I7FA 5B30A 4N5MA 5HDBB 2RBKA 2DF8A 3HMKA 1ZHFA 5F9FA 1J07A 1GQYA 2VXCA 1CR1A 4RSRA 5LLDA 1PWYE 1WTCA 2BSQA 2XNHA 3JYQA 4PM4A 3IEKA 4DEXA 4KLCA 2RFMA 2BI7A 2IDMA 4CCAA 1YB5A 3A1CA 1NXXA 3D6MA 3JQBC 1RHJA 2FEWB 3P19A 4MEAA 2NU6B 1NZJA 3D6VA 1AMNA 4MKHA 5B1HA 4BVHA 3EHRA 4B80A 2JJYA 4N39A 2FZLA 2HTFA 3NIGB 4XRRA 3F96A 4LHXA 3VDXA 2EC5A 4LHZA 5EXEA 3F3YA 1DE0A 4TLDA 4YWJA 3G2WA 2NWQA 4ZU3A 2RHRA 2H7XA 3UPDA 1OJLA 1Z39A 1EFRA 2J5XA 3S5JA 3ZV3A 4OLBA 3M6VA 2TMYA 2FXVA 2AW3A 3NKFA 2NVBA 3GMDA 4TS9A 2IFTA 1GXSB 1O6BA 4EY8A 4JVSA 1QLWA 1DC6A 3ZYLA 1GNSA 2PRZA 3PUXA 1GUBA 1IIBA 4XDYA 1V3QE 5I48A 3MC1A 2R7KA 1I7LA 4TSKA 1FW6A 5E4FA 4AURA 3AKCA 1ECLA 3U9TA 2HJWA 2R8XA 3N7AA 4O0LA 3IKOB 1VLLA 3MCWA 1JHDA 4F5EA 1Y5NA 4ETMA 3RK6A 3CQCB 4TV8B 3LP6A 3TAXA 4JVMA 4DY6A 2ZZMA 1T1JA 3WYAA 5LYJB 1UJ6A 4IH1A 4LCBA 4YMIA 1EFDN 1CVIA 3PR3A 4KRGA 4R0MA 2X8JB 5CVUA 1TYAE 4XTCS 4E5SA 4JKYA 4ZK2A 2O2CA 3G6WA 5K0NA 3FUTA 3QHPA 4F21A 2OTCA 4MQEA 4RVUA 4KDRA 4Q03A 3HJGA 2DTDA 4KYTA 1BGXT 2FBNA 4QDTA 2RHHA 1JHOA 3UAGA 2REBA 4CTJA 3F0TA 3KQVA 1XNQB 1U7OA 4Z1OA 2ZTHA 1YGPA 4LN1A 1YI8A 1QHXA 4Z1MA 1ZC3A 4L23A 5JLAA 2LCQA 3FG9A 4QHTA 3D9QX 4G41A 3CV0A 1G42A 4OQYA 4JW1A 3PK0A 3UMRA 2BP7B 4DSZA 4CM6A 3QXHA 1TUBA 3FOEC 4OMDA 4O2AF 2NUTB 4RPLA 3OC6A 4XR4A 2VJQA 2QE6A 3VRHA 1P31A 3MCXA 4PNEA 3UMCA 4JIGA 1NQXA 4LXGA 1P3JA 1QNLA 3GH3A 3RC9A 3H3FA 3DO8A 3THRA 2MRIA 2A1UB 2B34A 2WQHA 2A58A 4IUBS 4EF4A 4HXIA 3U7GA 2ADFA 3TQSA 4HB4A 4NX2A 4L9AA 1E99A 3OCJA 4YIHA 5JEDA 4N3BA 3EMVA 2QLFA 3OJXA 2YYYA 5K0CA 2YNQA 3KUKA 2UXCB 5AUQA 2J9GA 5B7NA 1TVKB 2FEOA 4ZCSA 3JR3A 1SBTA 4A7PA 5A3VA 4OU5A 3UWPA 1DKLA 4RVOA 3T8MA 4L2YA 4NAUA 3LP5A 3U0VA 1G7RA 5JA4D 1Z5SC 4YRQA 4V02A 4LVNA 2AOTB 1FMLA 1N6HA 4NAVA 3ZCVA 1OBVA 2IYFA 4A8HA 2WWGA 3FGOA 1T3HA 3HA5A 1U7PA 4OB8A 5EGNA 3ZQJA 4KIFA 2WF6A 1RI2A 4RDIA 3GDGA 3UPVA 4WA7A 1ACLA 4I1PA 2DUNA 1O1SA 4OSOA 1NMYA 3WLTA 2VTKA 2VHUA 2CJPA 6YASA 1JJIA 2Q4RA 3RSZA 1ORWA 3PX3A 3ORSA 3OKFA 3M9WA 1KJQA 3TWQA 3KV1A 4INZA 2P5UA 4P3XA 4ANUA 3BZBA 2JFWA 3T7AA 3DJYA 2DPGA 2R87A 4EMUA 2NO1A 4RVGA 1Z5GA 1KZ9A 2W4MA 4TZ0A 1M6YA 2WTXA 4LVOA 2UZIR 4DRXB 3LL4A 2O1SA 2FR1A 1WZEA 5IUKC 4II3A 1ODKA 3H1GA 1YZUA 1LBSA 2QUJA 2XY4A 5HUHA 4U2DA 2HE0A 1OU4A 3C6YA 5C7LO 2J09A 1E1CB 2LXNA 4B81A 4X3OA 4ER6A 4GLOA 2YJ4A 3EVNA 4NQRA 5I3CA 1CZHA 1AKYA 4LNBA 3W5VA 1S0UA 2Q3CA 3PFCA 4R1LA 3IMFA 3J5PA 5D3KA 3EVCA 2VNHA 3C8UA 3GT4A 4HLUC 2F17A 4B85A 4YI3A 1HFWA 1XQVA 4M1MA 3TLJA 4OJYA 1U3CA 4PWYA 3X1YA 1C4KA 1T0BA 2J0UB 2FHSA 1S8AA 5DSXA 1EQAA 4UMVA 2C0QA 2ZXEA 1OX6A 4GM1A 3VKFA 4BYMA 5IKOA 1KZHA 3QOXA 4C3UA 1KVSA 5IF9A 3N75A 1NVTA 3N3AC 5IFKA 3N2IA 4YP0A 2ODTX 3AUXA 4DR4B 1I30A 4F3NA 4NY1A 2VQ6A 2OBYA 5B3JA 2HFJA 1Q1QA 1UIMA 4XB6B 2XA2A 1NLZA 2BD0A 4ETWA 4H9GA 4F4JA 1FFXB 4WINA 3D5EA 1O5TA 3QWHA 4PRLA 2P2GA 3A1FA 1KC3A 1W4ZA 2XMSA 1QO9A 4MA4A 1AGNA 4O25A 1FMJA 1BWSA 7AT1A 2P1ZA 4RORA 4GSKA 4FEYA 3VSEA 2QT9A 4KB5A 3DT6A 3O1JC 5TMDA 4XI9A 4FJ0A 4XSVA 4V03A 3H7IA 3I09A 2AG5A 4HV4A 4L57A 3ZXIA 1INLA 4P8RA 3Q47B 4P86A 4EPVA 5BOSB 4HGZA 4KQKA 1B3RA 3AG6A 2XXBA 1HE2A 2FG6C 3CRNA 2DKFA 2FRVA 3NXKA 4MUXA 4BRUA 3GA7A 4RMGA 1A1SA 1E69A 1NBMA 1VB3A 5KS2A 3CCFA 4HNAA 4AJNA 1YZQA 4ZCLA 4H60A 4JOQA 1Q16A 4HI9A 1SGWA 5ALEA 3BWXA 5AQ9A 3ZE8A 3CVOA 3X1XA 4EJFA 3MRVA 4GYKA 4WOCA 5A3RA 3OJEA 3V79K 3DTTA 2UUBB 2ZE5A 3QYJA 1EE1A 4ZU1X 1XVUA 3ZCXA 2R5SA 1T6NA 2O2IA 4AFNA 4GPMA 4JL6A 5KOIA 2HREA 3KOWA 2WXRA 2AZXA 4TTTS 2WKQA 5L3ZA 5BYBA 2RIPA 1O5IA 2BCGY 3H8JA 1CEXA 3CTPA 3V1TC 1HSOA 4EI2A 4QJIA 3KXLA 4TQGA 3ZBQA 3NGXA 3BFVA 2AKAB 3E3OA 3QVTA 3V00A 1G7TA 4ZI5A 3QPBA 1JKJA 1MEJA 1TMOA 4MEBA 2O23A 2O8FB 3UXHA 2DPMA 2ZP1A 4FHZA 1JEJA 1K63A 1NURA 4K87A 2B4TO 5B1IA 4ER7A 1OBCA 2VJAA 1TYQG 2C20A 1LD8A 3M4JA 4ERNA 5IMBA 3MOIA 1D4OA 1LDMA 2VZ9A 1KNQA 4DWOA 1Y1PA 3RS2A 6GPBA 2QE7A 3RE1A 1N2JA 1T0HB 2KZTA 1WY7A 1S9HA 3HUUA 2UZ1B 4RABA 1M2WA 4CJXA 3OZ7A 2GB4A 4I9FA 4EY3A 2Q28A 4D4GA 4OHPA 4G86A 1DMSA 2Z57A 1SR8A 1W1WA 3NDIA 1PCXA 3ZYMA 4MCJA 1HA3A 2P6UA 1MTOA 4LEUA 1FYXA 5K0EA 4MS4A 4G5FA 2H52A 2P9PG 1YU6A 3Q5EA 3T3MB 2XNJA 2WHXA 5CFQA 1I3LA 4HYYA 1TIPA 3B1XA 5FR2A 4JBIA 1YS7A 5EE3A 1J5EB 4YJ2B 1FJHA 3LPCA 2OV2A 4FS8A 3L0CA 5EWMB 3CEHA 1UK7A 1BHJA 2OXRA 2IZZA 2PNNA 1QGUB 4HX2A 1DCTA 4C0HA 3FJ1A 8AT1A 4OBEA 2DJ5A 1E4EB 4UOEA 3QWBA 3QMPA 3C48A 5BXUA 4GUAA 3A7EA 4MGHA 1N32B 3I23A 2GRUA 4RZQA 2ZSHA 4XIJA 1ZN8A 3TMYA 3L93A 4ND3A 5A4FS 4GW3A 4Q4CA 1LVHA 2GN6A 4WXMA 4BVAA 1RCUA 3KPVA 3L4SO 1WTAA 3GCWA 1Q77A 2BDEA 1QGED 4BNXA 2Y71A 3G2MA 2ANBA 3TZQA 3RYHA 3FNHA 4KXYA 5FCDA 1NU8A 1Z45A 3CIOA 1NLUA 2X6IA 2BEJA 3OAAD 3IUBA 1LPAB 2ZE6A 3TOSA 3IE1A 2P7HA 3TTXA 1UP6A 1VMAA 3PDUA 5DBHX 3WE7A 2ODAA 4NJEB 4OBWA 1SK9A 2XGOA 4P36A 3UK6A 3FDHA 3H6KA 1HEYA 2QJFA 5IYZB 4R54A 1I1OA 3ZRHA 3QG1A 4WFKA 3TNJA 4OQQA 3E22B 4CMCA 3PWTA 4GI1A 5DK4A 4PO3X 4K6FA 4H7HA 1WVGA 2OXCA 3IC5A 2PL5A 5HM8A 3DMDA 2UVPB 1C8VB 2AXEA 3PTAA 1JHQA 1EE2A 3M6FA 1EFKA 1WKVA 2QL6A 4WJKB 3KP1A 5CHYA 2I9CA 4JJ6A 2GO1A 3CG4A 3USZA 2ZM5A 4UTZA 2DSTA 2GXUA 4HDCA 3K2IA 1PJLA 2AFVA 3VR5A 4KQEA 1SHKA 1XMSA 4Z4QA 5BSWA 2WPDA 1IQRA 2UZAA 3PXBA 3TLZA 3RC2A 4LHEA 3CGGA 4NABA 2HDNB 4HAYA 5FQ6A 4GICA 2JCGA 3RF6A 3V5NA 4HDRA 1ADGA 3RBXA 2QJTA 5EXPA 3C7KA 4AJLA 3T52A 3D5TA 1D2EA 2OE2A 3KQTA 1FMCA 3RQIA 3FMOB 4RQIA 2HPHA 3G88A 3FZGA 1ORTA 2OOKA 4JI0B 5BV0A 1U7TA 3BSSA 3PQ2A 2R68A 2D1FA 1E2JA 1YQTA 1JA0A 3DM5A 3L0SA 3Q85A 2XVXA 1OLUA 2DC1A 4P1ZA 1WF6A 4LWZA 1YJAA 4LWQA 4WAUA 1BRMA 3V8PA 3VU9B 1FNSA 2B30A 1QP7A 2F43B 3LP8A 1QVRA 4ZPJA 4A03A 3GMTA 3P2KA 2YYZA 1QO7A 5FOUA 1CC1S 1FP6A 1HI9A 4RTQA 2BF4A 4GR5A 3ROFA 2MSLA 4B1FA 1WDWB 2XAAA 5C4MA 5REQA 2P4UA 2ENWA 5E6SB 2AW6A 4NZ9A 4A8JB 4F5ZA 4AY4A 2JABA 1T5BA 1V1MB 2NZUG 2CB9A 3H9BA 3C3YA 3D6TB 2GGFA 1QDLB 5HG0A 5LUBA 1IHOA 4S05A 2RCNA 5AI4A 5AVXA 1OXBB 3U56A 3EG9A 3N1UA 1PQPA 4N65A 3W34A 3GEMA 1AHPA 1KP2A 1MC1A 4JZKA 2R1UA 4XKCA 1X1EA 2JGJA 4M88A 2F9MA 3H2HA 1KETA 1S4MA 3AS8A 2FP3A 2WWFA 1DX9A 5EIFA 1Z6PA 1F5SA 5FTMA 1DG3A 3L6OO 3ZD8A 1BDMA 3D9LA 3PWSA 1X92A 1JS1X 4ZAXA 2KB0A 2C5SA 2VXOA 2P9UG 4Y6RA 4DV4B 4BT8A 2QE7D 3QLVA 1GP2A 4J7UA 3HSKA 2I3ZA 3RD5A 3L6RA 3TXAA 5AM4A 5KHOC 2Q1SA 1RRPA 1EVIA 4LGVA 1X9HA 3B7UX 4OHWA 1J8VA 4RVBA 1W0JA 1LVUA 3EUFA 3CNOA 2LAIA 1UBLS 4EX6A 3GH1A 4YAEA 1F06A 4J49A 1DC7A 5F77A 1NI3A 5B7PA 3MYVA 3Q78A 2HDHA 3R7BA 3WOHA 3K1AB 1VP9A 3DE4X 1H85A 1C7IA 3OX1A 1J0CA 3DNMA 4DXAA 5C3UA 1P9LA 4BIIA 3TE7A 2D0IA 4TTAA 2JGDA 3B6KA 1R4AA 1Y8QA 4U1RA 1GLNA 4K28A 4YASA 3RYIB 4HBDA 2YZ7A 3NHJA 2WJJA 2VH5R 1YB6A 2QTZA 3O8QA 1ZY2A 1TFRA 5F1KA 1GU7A 4GMHA 3QVUA 3HTXA 3AI7A 4BWYA 1W75A 3FTYA 5AUPB 3GDFA 3KZ1E 1ESMA 4OL9A 4G5QA 4PFSA 1R0RE 5LM3A 1EEHA 3K9QO 2V97A 5LQNA 1R74A 1BN6A 2Q4EA 3L8CA 2PA3A 5EL0A 5CYOA 3JATB 3F78A 5KQGA 2EBFX 3SHFA 1Y80A 5HOQA 5ABPA 1SQ0A 1TF7A 4DDMA 2WFMA 2BFPA 3FBWA 1H0AA 4PFQA 4EEZA 1J56A 2NUPA 3D9PA 2C03A 4Y2XA 4GECA 4ND1A 5FYDA 3PWZA 2MTBA 3I8OA 1UDBA 3A37A 3QY9A 2BFDA 2OFFA 4PH4B 4OQMA 3AEYA 2OYSA 3WXMA 4I2WA 2GRLA 3SHOA 3HZRA 1GZDA 3FVVA 1JIJA 4RKEA 2XMQA 2YKGA 1BYUA 3R5JA 1XJQA 2Q49A 2GCOB 3AKYA 1E63A 4NC9A 3TZLA 3HXCA 4F3RA 1KMQA 2FN9A 3M4ZA 5A71A 1NN0A 2WXHA 3F73A 2I1WA 3QVGB 1EMDA 4YUAA 1ZX1A 1Q19A 5IG2A 1KMNA 2J08A 2XEDA 3R40A 2GWRA 1X6VA 1ISIA 5ELXA 1VIYA 3NOQA 2X7JA 4LPSA 1BU9A 3NJRA 2B21A 4TS1A 2GRAA 4R3UC 2P9QA 4FMDF 1UL1X 4M8KA 3OTQA 5CLGA 1KJWA 3VR5D 1T9GS 4B6RA 1THZA 4J2OA 2XUKA 4UPDA 1WDYA 3BAZA 5BN4A 4U04A 2WPDD 5BSMA 5H16A 5CA0B 4LDJA 3HN2A 3JVIA 4DA8A 3A9SA 3RFVA 4RUKA 4BP9A 3A04A 1N5DA 3TLKA 4RVDA 5FFFA 1T0UA 4L8WB 4OU4A 4C78A 1URPA 3PUZA 4XSHA 2GPYA 5AI0A 4CTKA 3UNXA 3V8BA 3D6UA 4REQA 3AG2E 1E8MA 4R69A 1RYZA 5I5EA 2CXPA 3DV2A 4R5HA 1Z88A 1KMMA 3VPBA 2G63A 5T64A 1G2IA 3K70B 2ZJFA 4HRNA 2C4HA 3MRXA 1WQ1R 1W6UA 4OHCA 2NZ8A 2ZIVB 3FPEA 4DUYB 1G4UR 3OE5A 4AVYA 2OFWA 5FA6A 1VLMA 1ZJYA 5GVRA 5A6VA 2VH1A 2CNBA 1C81A 1U9YA 1Y7LA 2GO7A 3FCCA 4UAJA 4K6KA 2ZRGA 3UZUA 1PLKA 1A8SA 3PR1A