2JLBA

Xanthomonas campestris putative ogt (xcc0866), complex with udp- glcnac phosphonate analogue
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCC0866
total genus 212
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2jlbA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2jlbA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jlbA02
2PQRA 2BUGA 4G23A 3BCRA 4Y6CA 3L79A 3LCAA 2VSNA 4CTNA 4X7MA 3CUWA 3C48A 3OTGA 2ASVA 4RENA 2KC7A 4MI3A 4UQZA 3MV3B 2G9RA 2UY1A 5BNWA 4N5CA 3S0JA 2KATA 1HLFA 1GPBA 3RSCA 1IHGA 3QDNA 3Q47B 3ZGQA 3MTDA 3Q3IA 2R5SA 4NEQA 4RIEA 2C9ZA 4YUAA 1P2DA 2VCHA 4F97A 1NOIA 5FZSA 5BT1A 1GPYA 4JHRA 3MRTA 4CGVA 1NZDA 2XPIA 4X7RA 3MA5A 3MEKA 3DZCA 4APOA 5DLDA 1C8LA 3QWVA 4JL0A 5FJYA 5LQDA 3VUFA 4GPKA 3HBFA 4M60A 1JIVA 2C1ZA 3TAXA 2FBNA 2IYFA 1Z6QA 2BGUA 2DBAA 3OXGA 1PYGA 2GJ4A 3S7DA 4Y6WA 1FU4A 1L6IA 1P4HA 1XV5A 2P58C 1FCHA 3UPVA 1ABBA 1XC7A 2H1HA 3SYMA 1C8KA 4BQIA 2QLLA 3G2KA 1NVKA 1PNVA 4BT8A 4IN3B 2SKEA 2GPAA 2Q6VA 5TVGA 3LPZA 5AYWD 3RO2A 1GPAA 3ZCPA 1A17A 3FWVA 3CUUA 3TG4A 2FO7A 5FZQA 3MRVA 1Y8MA 3Q15A 1AXRA 1F6DA 4EL0A 4U0ZA 4I17A 1HH8A 3SZ7A 5C1DA 3MBOA 5TMBA 1L7XA 4U07A 2FEZA 5FZRA 3OKCA 3OY7A 1QM5A 1NZFA 4N39A 3KD7A 4GA1A 3MS4A 3RU0A 3RJVA 1W3BA 2VQ2A 4F3VA 3HBJA 1Y6FA 4GPBA 2YJNA 5D00A 3Q3EA 2C0LA 3TGOA 1WUYA 2BGTA 4F9FA 3EBPA 1JIXA 3L7DA 3S7JA 5GPBA 2WQHA 4EL5A 5I45A 4BTAA 3GYZA 3ASFA 3L7CA 4M83A 2OFFA 4WHMA 5DXFA 4MICA 2VGXA 3ZFWA 2XA9A 2PRIA 2AZDA 4WUYA 3BD6A 4GYWA 2I6HA 3KS2A 2VG8A 1WM5A 2LSUA 5LCWJ 1PC2A 4GYYA 1KT0A 2QLNA 4N2QA 5TMDA 3K9IA 3S2UA 4Z5XA 2AMVA 2QRGA 4EJ2A 3OXLA 2IEIA 2GPNA 3LY9A 2HR2A 1BX3A 1Z6PA 4EKEA 2PL2A 1JEJA 4J0UA 3AS8A 5KJLA 4HOTA 2G9VA 3NF1A 3HBMA 1FA9A 1FTWA 1L5VA 3T3GA 2R66A 2PYIA 3CKCA 2QRQA 2Y4TA 3RIBA 4RELA 4HOQA 3DD1A 4U0UA 2F3PA 3BCSA 5KJKA 3NC4A 5ENZA 2C0MA 1ZBPA 1Y8ZA 3EDTB 4GA0A 5G04J 4M7PA 4GYOA 2QLMA 4CTMA 3U4TA 1L5SA 3GZ1A 4XI0A 1Y6GA 5D01A 1E1YA 5JTUA 3ASHA 3TOVA 2XCUA 2GEJA 1K06A 4G24A 3CEMA 3QHPA 1SXPA 5EX0A 1NLMA 4AIFA 4A1SA 3JYSA 3OTIA 3BD7A 2FF5A 4CGWA 5A6CA 2C4MA 5CCMA 3BCUA 5TMEA 2JZCA 2IW1A 1P2GA 3E4BA 3FFLA 4N3BA 3NB0A 4AMGA 2XA2A 2YHCA 4YVQC 5JJ7A 8GPBA 5HQ8A 4AM9A 4KYOB 3ZN3A 4RIFA 2AW3A 1QZ2A 3RO3A 4MI6A 2G9UA 5D0OD 3MSCA 4RG9A 3S28A 3COPA 3MRXA 2QRMA 4H7YA 3PDNA 3AMVA 2X0DA 1UQUA 4HWGA 1NA0A 2XCCA 1XNFA 3ZCSA 4KBQA 4WNDA 3CKBA 4HORA 3MT9A 3CEJA 3LY7A 2GT1A 2XGSA 3Q49B 4YNDA 4BQFA 3CUYA 3DDSA 2Y4UA 3CK8A 2PRJA 5BW8C 1P4JA 2Q7FA 6GPBA 5A7DB 1ELRA 4BQEA 3VUEA 3WAGA 1XOIA 3Q5MA 1NZNA 1NA3A 4G26A 3T5TA 4NC9A 1KLXA 5DBKA 1L5RA 3BDAA 3CVQA 3MT8A 4LEUA 2G9QA 2AVPA 2C1XA 4WADA 1Z8DA 2R4TA 4N9WA 4PQGA 1UZUA 5IKPA 4WACA 3CVLA 5LCWC 4BFCA 4REMA 2XMPA 4W9RA 5FTPA 1GZ5A 3D0QA 4AY5A 1WV1A 3T7DA 3TG5A 2HYZA 3BEOA 3OKAA 3LY8A 2GW1A 3MTBA 4QLBA 4JA7A 1AHPA 4G1TA 1GFZA 3ZCTA 2PQNA 2VGXB 3LKUA 2IF4A 2GEKA 2FFRA 3RSZA 1F0KA 2R68A 1YA6A 1ZU2A 4JA9A 2KCLA 2JJMA 2ATIA 1WV0A 1IXYA 1IYGA 4GCNA 2X0EA 2F3QA 3ZCVA 1WAO1 5G04C 1RZUA 3GW4A 1C50A 2IUYA 4W6QA 3T3EA 3URZA 2BFWA 1KT1A 2HO1A 3QKYA 3OTHA 3N71A 2SKDA 3CV0A 2P6PA 2VGYA 2QN1A 2ACWA 4GCOA 1SXQA 2SKCA 2NC9A 3T3HA 4CTOA 3CK7A 1P5QA 3CUTA 2YQ8A 5CHEE 2QN8A 4UI9C 3L7AA 4RIGA 3O48A 3UQ3A 3ASGA 4ME2A 3H4TA 2H1FA 4AY6A 1E4OA 3OXFA 3GZ2A 4N3AA 5ARGA 1H5UA 1P2BA 1KTIA 2VYIA 2WTXA 1OUVA 4J8EA 3S27A 4J8DA 4J8FA 3OY2A 3ZCUA 3QWPA 1EXVA 2UWJG 3ZHEB 3WXXA 1E96B 5CCLA 5D0QD 5JJTA 4B94A 4LEIA 3WADA 2XEVA 3L7BA 4CDRA 4G2VA 2QN2A 3HBNA 2QN7A 3UYLA 1O6CA 3ZCQA 4I9CA 4WNGA 3ZCRA 3KAEA 2XA1A 2FI7A 3IEGA 4GZ5A 5JTTA 1QQEA 2JLBA 3VDNB 1V4VA 5G05J 1WW2A 4N2SA 4NESA 5EKQD 2PYDA 1FU7A 5G05C 3MQFA 1GGNA 1M5RA 2XGOA 1XL0A 2IV7A 4MHOA 4LDPA 3PE3A 4ABNA 4BWRA 4HLNA 1LWOA 1P4GA 2QN3A 2QNBA 4HOUA 3FP3A 1FTQA 4MRAA 2QRHA 2IYAA 3G2NA 3NPAA 1PSWA 3VDMA 3S7BA 3QKWA 3IA7A 2QZSA 3G2IA 4N3CA 1L5QA 1WW3A 2C2LA 4FZRA 3R9AB 4GZ6A 2X6RA 3D1JA 3UYKA 2F9FA 5KJMA 1JIUA 4YI3A 3D0RA 2XGMA 3G2LA 5EX3A 4UQYA 1GG8A 4YI5A 3IAAA 1YA0A 2ONDA 4L22A 2VCEA 3FROA 5KJNA 1YGPA 2QRPA 3NP9A 3S29A 2GM9A 3RKVA 4FKZA 3LYAA 3ZHEA 4AMBA 2V5FA 4WNEA 4GZ3A 3MKRA 3O3CA 3T3IA 5DIZA 2KCVA 5HI7A 3ULQA 3T3DA 2O6LA 3CVNA 4I1AA 1IIRA 3MS2A 3CEQA 2LSVA 1B4DA 3E3LA 2ACVA 7GPBA 3NP7A 1B89A 2WPVA 4KQ1A 4YVOA 4HOSA 2BISA 3C4QA 4KXKB 4I2WA 3GPBA 4GA2A 2KS6A 4G2TA 2ECPA 2F3SA 3CEHA 4EKYA 1QKJA 3E3NA 4UI9K 4MI9A 3NAZA 4UI9J 2XCBA 3AS4A 3PE4A 2LNIA 3G2HA 1RRVA 9GPBA 3VTYA 1JG7A 4RIIA 2ZB2A 4X7PA 4F96A 1A8IA 4O6FA 1XKXA 4H7XA 3WC4A 4NRHB 4BT9A 3MS7A 4RIHA 3OKPA 4X6LA 5HXAA 3CK9A 2F3UA 4UQXA 4WNFA 3CUVA 3ASDA 3AS5A 1UQTA 1HZ4A 1C3JA 3C4VA 3Q3HA 2X6QA 4MHSA 3CVPA 3H4IA 3QOUA 3GUHA 2UY1B 2PZIA 1Z62A 2R60A 4AN4A 5M72A 2QN9A 5FT9A 2GPBA 1FS4A 5JJ6A 3VTXA 3MV2B 1L5WA 3Q4AB 1HXIA 3U3WA 4I2ZA 4U0SA 5ARFA 1LWNA 2OOEA 2VSYA 3NCHA 3MTAA 3MT7A 4G25A 2IFUA 1NOJA 2IV3A 3ZPJA 4KQ2A 2FF4A 3CV3A 4NQ0A 4U04A 4RBNA 2AV6A 5IKOA 2MHKA 1K08A 2R4UA 1FU8A 1XL1A 2PQ6A 3OT5A 4BTBA 1J39A 1RZVA 2QFCA 5DU2A 1PN3A 2KCKA 3EBOA 3ESKA 2J9QA 3DDWA 3TSAA 3E3OA 4KQMA 1EM6A 4I9EA 4RG6A 3UUXA 3BD8A 3QWWA 3BEEA 3SF4A 1FTYA 1FC0A 1P29A 3RT1A 3RHZA 3SYRA 2IEGA 2HY7A 4XIFA 3S7FA 1NOKA 1WUTA 3L01A 2X0FA 2XCIA 3CX4A 1TJCA 3HYMB 1JG6A 4XI9A 4EQFA 1VGVA 2E2EA 1ELWA 2FETA 3G2JA 2L6JA
chains in the Genus database with same CATH superfamily
3K9HA 3RYFA 5AKJA 4LJ8A 3F73A 3KR1A 3K70C 2YRXA 3KPVA 5K6TA 2CC2A 2I71A 4X7MA 4I55A 4ZZ2A 4F5WA 2GVDC 1JFVA 4RM2A 2G5GX 3HJCA 3OTGA 1PD0A 3HU3A 3LSYA 4NH0A 3TG8A 5KEIA 3D6JA 1FP4B 1VL8A 1YJ5A 3NBXX 2ON6A 3HU1A 2RAUA 3VKFA 2C42A 4F2HA 3EXFB 4K0KB 3AU5A 4B3TB 4TXQA 2J9YB 4NABA 1VP9A 4NYJQ 3PNOA 4FYYA 1GPLA 3H97A 4N5CA 3C7CB 3TZLA 2EW1A 3V4SA 1W4ZA 4ENWA 2MSEB 4OBWA 2XYPA 3TLJA 3W8NA 5CDTA 3U6KA 1E7UA 2J5XA 5CIYA 3L6CA 3C1TA 1X13A 4ZANA 1UP7A 5FWAA 1FBNA 2D1QA 3A1WA 3WIEA 4CMIB 5JMND 5FZSA 1GPYA 1NF2A 1ZBDA 4JVSB 1FFXB 2AOUA 2Q9BA 1BCRB 1ZUD1 2RGCA 3GWZA 1ND6A 4MKFA 4W82A 4CGVA 5DM0A 3Q9UA 4ZOLA 1NZDA 2ID9A 3W2FA 4QOJA 1BGXT 5JS7A 5LSAA 4DT1A 5CA0F 4R69A 2WF6A 1TVMA 1BH2A 1DBQA 1ZO8A 3B3QA 2JASA 3ESQA 3ABQB 4KQCA 4P83A 4ZV7A 2OGSA 3X1JA 3ZHVA 4CEJB 2O8FB 2C2HA 1PIWA 3DFIA 3TLXA 3UJ6A 3DAPA 1XEXA 3I52A 1R6XA 2FSVC 5FOQA 1L1RA 2NU6B 4P81A 4NU5A 3EIQC 1TN7A 2OECA 2VH2A 3O4GA 2WA1A 3MLAA 2AEMA 1E1NA 3IBTA 5IMBA 3PEFA 1XD2A 2C61A 4M1SA 5K6AC 2DLNA 3TLKA 2JCVA 2QY9A 3D3EA 1ABBA 2C9DA 4QDTA 3G5LA 3D4LA 3SYMA 4Q0MA 1O89A 3KKLA 3L7JA 1CQJB 1BU9A 1WU8A 2PVCA 3CWZA 3JD4A 2QVZX 1R6BX 3LOUA 3DOEA 2Z9CA 3GZNA 3JQGB 1TVCA 2PT5A 3TWOA 5LP0A 1WVMA 2FN3A 4FC7A 2XF2A 2ZZKA 4V24A 5EVJA 2PWBA 3Q79A 5JLAA 1J0EA 2A9RA 2ACEA 3G85A 4WXRA 3ZXSA 2W2VA 4LJAA 1S2OA 2BKXA 3IHKA 3TNYA 1A1VA 3KWLA 3KOYA 4OK6A 2VZ8A 1JHZA 3NEPX 4K3VA 4QPZA 4WAUA 3PU6A 3VFDA 2VUHB 2XCRB 3PQEA 1UBHS 3OLYA 4PWZA 4EUFA 3TXXA 3GH1A 3S7TA 1NBAA 1JMVA 1N8NA 1SZPA 1KXZA 3DV9A 1OY1A 4M9CA 1DBRA 4GEGA 5FB3A 4AFNA 5HRAA 2PX0A 5JYCA 4JPSA 3BQ9A 3CH6A 3MUFA 2YINC 3B6KA 2WHEA 2W8BB 3JAWB 5ICCA 1XZAA 3FOFC 4YNBA 2X6IA 3TXAA 2P9LG 1ODKA 1ODFA 4ARCA 1D4AA 3RU0A 4MVCA 2V8SE 2WWIA 3FYTA 4I9FA 4D6PA 4ENTA 1CUEA 1SWWA 5BW6B 4ISCA 4LTDA 3VR5H 3I5PA 2BUAA 2ZFUA 1OYVA 4ZOQI 5CU7A 1W4BA 3D1LA 1W1IA 2IWRA 4YCDA 1P9WA 3GDOA 3PHCA 4AZ3A 2H3HA 2HDHA 5HUQA 1JFTA 3TIGA 3KHSA 1SUPA 4NRDA 4EPXA 1ECCA 1P73A 1IOVA 1Q0ZA 3L7CA 4J75A 5F21A 2X4GA 4NSNA 2XSZD 1DT3A 1FPMA 5E1BA 3QJZA 1C1XB 3UKRG 2ODPA 2JIMA 2FZCA 2NNLD 2JLQA 3SKVA 1SOUA 2EIJE 1JPVA 2AIRA 4UBMA 2RIRA 1ZM7A 3BD6A 3ORYA 3ZGYA 2X6TA 3KS2A 3IHLA 5M29A 2VC2B 1I6LA 2B8JA 2QPTA 4N5QA 1XCMA 3OLCX 1S1MA 1O03A 1PFUA 1QRAA 2FSVA 4DSOA 2NZVG 2BF7A 2QRGA 3HLYA 3OCUA 3BSSA 4LQCA 3H1PA 4BRZA 1H9AA 4QFCA 1F9AA 4M9QA 2V4HC 2NZ2A 2SECE 3I5XA 1YRHA 2Y2UA 1I4LD 2GRUA 4J3JA 4ER5A 4BL5A 1M7BA 3MZLB 1I01A 3AUUA 5E7IA 4U8VD 1EM8A 1EBFA 2O0HA 2QRQA 4XZ3A 2R79A 5AM3A 2IPLA 2PZAA 3IQWA 5KJKA 5JUWA 3FEXA 1UPFA 3PFHA 3W9YA 2QMEA 4P8RA 2XUKA 4Y2XA 5CPFA 4CIXA 3NHLA 3M1LA 4KR6A 3GJ3A 3GFBA 5FI0B 4OU5A 4D7AA 3L0DA 2AMLA 1HZZA 1JV2B 1WX1A 1VLZA 3D7RA 3HLKA 5U1PA 1E20A 4DBVO 1KF0A 3SK0A 5CECB 1NI5A 1TKCA 2B4TO 4JHKA 3MJSA 1X7GA 4N8EA 2LXLA 2LVBA 5EMNA 3R7WB 2HTFA 4DR3B 2G28A 3VLFA 4OAVB 1FNMA 2V74B 2VYFA 4AIFA 3JYSA 2XKKA 1N3YA 4WGGA 2ZK7A 5G0UA 1QP4A 1E2IA 2IU4A 4P93A 5G4KA 5T41A 5JRZA 4K8OA 4ETIA 5TMEA 3H86A 2Q1WA 2PA3A 3EG5A 1EE1A 4YXWA 2GBCA 2VHJA 4DB4A 1KH2A 1ADBA 3OQ6A 3T3PB 1W9HA 4G0XA 4EABA 1DSSG 2VJBA 5D3ZA 2NU8A 1ZK4A 3CGHA 4A8HA 4A8TA 3AC0A 1XTRA 3MPUA 3THWA 3A70A 2VA8A 1J9EA 4ABYA 2UYCA 4KGDA 1NM5C 3MUEA 2OZKA 3PS9A 3WNQA 3NWJA 3KXLA 3J81k 1GRNA 3Q2IA 4B40A 1BE1A 3BSFA 4M54A 2OCCE 4L8GA 3U31A 1AA6A 2PZJA 1WCXA 2X5NA 3TUZC 4NDZA 2JJ1A 1QPZA 1XD9A 5AVRA 4DL9A 5C52B 3BXPA 4OYSA 1YDEA 1R8XA 4D8YA 1JQKA 4YREA 4C01A 3R24A 1GPWB 4C4OA 1BHSA 3S2EA 3RU2A 5IH7A 1BGVA 4MQUA 5HMMA 2F90A 4AJKA 1WUJS 1I4DD 2AWNA 4ZJYA 2FLWA 2O8BA 2I1VB 5T3YA 3ZWWA 1GTMA 1Z74A 4M2LA 3CK8A 5B4UA 2EGGA 2JGKA 1PT6A 5D5QA 2DKOA 2W6PA 3OE5A 4MVJI 3H2IA 1N4RA 2IX3A 2CFIA 4N0MA 3I28A 4HJXA 1J5PA 1TNDA 3H99A 4PG6A 4RJ2A 4E11A 3W5VA 4I9GA 1G0OA 3BEDA 5KNCD 4BMYA 5BR8B 1IHBA 5ANRA 3BDAA 3EOBI 3DSRA 3GJRA 1IUKA 3U1VA 1YKSA 2J46A 4FCVA 4YDOA 3SC4A 5B58C 1H94A 5L6MB 2PZ8A 1HC7A 1U04A 1W0KD 2B3TA 3DCIA 3WIBA 3WIVA 4UWGA 2QX8A 2EKZA 1GUYA 1VKNA 1P9LA 1Y33E 1EF1C 3D8SA 2V4LA 3JSXA 4AP5A 3SSNA 4AYXA 4C6RA 3HN2A 2ID8A 5D2MC 4J9UE 4KAXA 1CY2A 3CF2A 4LMRA 1GQSA 2XZPA 1N8KA 3P9RA 1GL7A 4ZDKA 1QYWA 5K45A 3EZ6A 1JLSA 1Q74A 3WWCA 4D3FA 5ITZB 4GGPA 2ZJ3A 1V11A 1O0SA 1CUVA 2A0FA 2JIQA 3QNUA 4F3NA 2GW1A 1A77A 3V2OA 2QYHA 4GUDA 5G4LA 3WJ7A 4YQZA 3DBHB 1F06A 3K9QO 2ET6A 2GCNA 3AEKB 4J29A 1YA8A 3UUWA 5F2KA 4C0AC 2Q9AA 2BLLA 2F64A 1G6HA 1T24A 3OMLA 3W9SA 1RE1A 5FEMA 4EJMA 1DFGA 2Q3EA 1IXYA 4YO7A 1NASA 1ZRSA 3DLIA 1KSGA 2Z3WA 2ZPTX 2WQZA 3PITA 4RFLA 3B36A 4Z9AA 4JDUA 5DTJA 3WISA 2IK8A 4BE9A 4RS3A 1F2UA 1I33A 1FMFA 1ES9A 2P79A 3N39C 1SKYB 3UKUG 3SKYA 2WXNA 1A9SA 3H04A 1ZINA 3HGTA 5HKBA 4O4LF 4FB5A 4I81A 2V1UA 2WNSA 1SUDA 1ONOA 2VEOA 1JAXA 1YJCA 4I5DA 3ONWA 5DMHA 4DPLA 4XLLA 3V2HA 1BDHA 1FF9A 4KAJA 4PS7A 2Y9PB 1KI1A 3L7AA 5JXGA 3R7QA 3M7IA 4I3GA 4NZPA 4WCFA 1P45A 5FFNA 2W4QA 4X54A 3FNHA 2DYSE 1GU0A 1A8HA 1NMEA 3FGNA 3M33A 4FIDA 3BMQB 3WSVA 5LOVB 1JLMA 1OROA 3BN3A 3DB2A 4G65A 4X60A 3VISA 4CLOB 4CU5A 1H5UA 4GB9A 3RJ5A 3F4KA 1WXDA 3PUHA 4WKGA 1NVMB 4MS1A 4MIKA 3TZKA 1L7DA 4OH1A 7AT1A 2LV8A 1WPRA 4S0XA 1KI7A 1TOAA 2GMWA 4PPNA 2OYSA 5A4IS 1QFXA 1TN6A 2I1KA 2BHNA 4XKCA 1HORA 2GVZC 5REQA 1T29A 1XJQA 5A5VA 4ID9A 5BQPA 1YRYE 3R40A 1SCUA 3PGVA 1BFDA 3QLVA 3O8OA 4RVNA 2G1PA 4GKJB 3QMMA 1J0CA 4BJ5A 3IOYA 3CVXA 1V4NA 4WOBA 4Q9JA 2AN4A 1PJAA 1H22A 4UHJA 1UKVY 3TZHA 3AUSA 2HRQA 2YNMC 4H16A 5HF8A 1B42A 3AOGA 1KEEA 4RV4A 3SHTA 4F3RA 4K8RB 2O7QA 4Q1EA 1VIMA 4B4DA 2EVWX 16PKA 3KOWA 4GDMA 4JL6A 4DXDA 3OHPA 5BPHA 5KCZA 1NKTA 1SVXA 5LL6P 1M33A 4P38A 2QM3A 1R4NA 4MW5A 4I5EA 5I7VA 2Y0PA 4MKRA 3UWKA 3W3ZB 1NQTA 2X40A 2ONYA 2UYHA 3UHOA 3QOFA 1HURA 1KSFX 1IRXA 1PG0A 1WEHA 4MHOA 3E37A 3PE3A 5FDFA 1P61B 1U2DC 2FZLA 1II9A 3HSSA 3Q7PA 1Y6ZA 4FW8A 5EVCA 3ACCA 4KPFC 2GYWA 4B75A 5EIXA 2M63A 1Y4SA 4QYTA 4HOUA 1IQ0A 2QZZA 3EVEA 2Q3FA 4RK5A 1XDZA 4Z49A 3AF6A 1ZK3A 3QWAA 2G36A 4KDFA 2WD9A 2QKYA 2FULA 4M9XA 3S55A 4GICA 3LPDA 1W5SA 4NYMQ 1ISSA 5LCXA 3G2TA 1N2CB 1DAPA 4GZMA 1WD7A 1DQPA 1TJYA 4TYPA 4B4KA 4U2EA 5LBIA 4GMKA 3IHYA 2DAPA 3G89A 3UJ8A 5CHEA 1XKQA 2A33A 4ITRC 3I37X 5EHZA 5BR1A 3K71B 3NGLA 3DSTA 3Q9LA 4IRMA 3B1ZA 3SF8A 2GB4A 1KFKB 3VDQA 2BEVA 3FUKA 2QRPA 4NULA 4NL4H 3DV0A 4IIBA 5D5PA 3E4DA 3D7MA 3WJAA 1E0KA 4OP2A 1L5NA 3Q3JB 5HYVA 3N8IA 3K05A 3WLJA 4M1OA 4AS1A 2L9BA 1Y63A 4HAWA 4BX2A 5KYXB 2ZXUA 4S2UA 3CINA 3GNSA 3WGQA 2GCEA 2EIHA 2PIDA 1G2OA 2PQMA 1A4UA 1DT5A 2IXDA 2RHOA 5FHQA 2F4NA 3T3IA 2O59A 4Y9UA 1M2KA 2WB2A 2PLFA 3RO7A 3JALA 5FPHA 4DRXB 3JYLA 1O0CA 5AUNB 5BV0A 5CX4A 2IKQA 1L4KA 1B4DA 2DCPA 2PH1A 5G0WA 3FHEA 1HEUA 3K70D 4TZKA 1QP7A 1HYGA 1SRQA 3ASZA 5JD3A 3SVTA 3RADC 3R8FA 4UWKA 2P2CA 4LOHA 3OU7A 4OJQA 4QD3A 3CM0A 3GPBA 3UC9A 1DWPA 1K88A 5GZ6A 4ZJUA 2BKVA 5M04A 1K7SN 3E22B 4O4IB 4EKYA 1X94A 2YFYA 2BELA 3LT4A 1DMSA 3B82A 4Y2JA 5ALJA 4BO6A 1U0LA 1NVVQ 2B2XA 3M34A 3PE4A 1WCIB 1RJEA 2OHIA 4D79A 4JYAB 1YJAA 1JG7A 4FMDB 3MGBA 5EERA 4D8WA 1NJSA 2KZTA 1S0UA 1GL9B 3P97A 3Q8LA 1QUEA 4YCMA 4Q96A 4C0JA 5FQ4A 1OI2A 5HXAA 4KR0A 2CFUA 1YZ3A 3DMNA 4PYJA 3SQDA 5CCEA 5EKTA 3E5NA 3F8SA 3FNBA 4HADA 4KNVA 4PIPA 3PEVB 2B2CA 3TLZA 4LXTA 2KBEA 3FSJX 3L8GA 3S5JA 2H48A 3HGQA 5BORA 3JQGA 2NYAA 2R00C 4OHYA 1YHYA 3ESRA 1FP4A 3QBJA 4OG2A 1NVEA 4AS3A 2Q4RA 2QQ5A 2XTJA 1PJ2A 2JHFA 2RHTA 4IDNA 5ARCA 2ZRGA 5IAGA 1GU7A 4DBLE 2E4VA 2E18A 4XGKA 1DZIA 3QY9A 4B6PA 3GHYA 4BNIA 1DX9A 1SXJB 3I76A 3O4VA 4RTQA 4R1LA 1D6MA 2N46A 2SNIE 3QFHA 4PCVA 4YXWD 4R7GA 1YRWA 5AO9A 2QPLA 2VSYA 5J63A 5D84A 1Z68A 2XPCA 3WK7A 4G25A 1TJPB 1CF9A 3UHFA 4WZBA 4WKNA 1S2NA 2QDKA 4DNXA 4K46A 4MQEA 4KDEA 4MRPA 2H6HA 4O1HA 4YRGA 2PD4A 3AP2A 2EZ4A 3R9XB 3PC3A 1GUFA 1B6GA 2CHEA 3D4PA 2OMEA 4F9TA 4PZEA 1FXWF 1RS0A 4P84A 1PN3A 1SQ0A 1U5BA 5CR9A 3WQBA 4B6SA 4QQFA 1SVMA 4RJLA 1P9RA 4Y3UA 1ZA2A 2CEAA 4KDRA 5LNK6 4RKRA 3Q7IA 1N5DA 3H5NA 1VBFA 4ZMBA 2JIZD 4XDHA 4XIIA 2JI4A 3IXQA 1OXVA 3BBLA 1XGWA 1IXVA 1COZA 4WFJA 2PMBA 2D3WA 4EVQA 3ENVA 1TJCA 5FBZA 4ZPXA 1VBNA 3OZVA 4ZI5A 1I80A 4FONA 2NG1A 4I1MA 3U7HB 2XXAB 2AG6A 2FZKA 2NSYA 4PRKA 3SOPA 4LHXA 4GAEA 5AJDA 2DT5A 1K7FB 2N0SA 4PQEA 4G23A 3L79A 2PZGA 3LCAA 1GRVA 2WSMA 1HQDA 3AI2A 1A8SA 1OXMA 2Q3HA 3D31A 3R3VA 4EY5A 2VSNA 4N49A 1BOFA 4U2CA 3T5XA 1X1AA 3Q9SA 4EHKA 1ZLYA 3E1SA 3LA6A 1JFRA 1ZR2A 2ZI3A 3AKCA 3NLLA 2DY1A 2A1IA 1CZNA 2DPHA 3IE1A 4F4CA 4FR2A 4H1HA 4L3VA 4EYGA 2ILTA 4A26A 1LX6A 2F4VB 5I7EA 1TLFA 5EDSA 2DHQA 2PKRA 2AW6A 1U2ZA 3FFAA 5D5HA 2REQB 4QT4A 3PCTA 1XTKA 3B53X 2OFXA 1BU5A 4XFKA 2WWXA 4YRTA 2W93A 3RSCA 3FTXA 1UP6A 2JNWA 5EOVA 4B8YA 4BESA 2QN6A 1QXSA 3CF6R 3WGNA 2VAWA 3BRWD 4IDQA 1E79A 3IAFA 3STYA 1ZOPA 5A3VA 1K63A 2V3WA 3TWWA 1BD3A 1ADFA 4Z0PA 3SMQA 2CW5A 2HCJB 4JHRA 2C8JA 2WHRA 2OFWA 5D6OA 4O4JF 2A9OA 1Y9DA 3O1LA 3T99A 3ZDXB 3ROKA 4N5NA 4QXAA 3UT5A 2O4UX 2Z8YM 4RZQA 1Y7IA 3AL0C 4P7KA 3PVLA 1GKYA 2BM1A 2NYUA 1M2WA 2HA5A 4LJSA 4JL0A 2I3DA 2XAAA 3C97A 1CRLA 3CZCA 4QASA 3NHRA 5C35A 4PG7A 5BQXA 3GRPA 2BFEA 4UZSA 4U95D 1RHJA 4O60A 2QROA 4U3JA 3BXGA 4EPYA 2EBFX 2QQ0A 3OXGA 3QKRB 5F7ZA 3BK7A 3A3PA 5LZ5A 1AQLA 5KWVA 3GP8A 4KNYA 1RQ2A 3KQHA 2NO5A 4G36A 1P4HA 5K8TA 5CFNA 3G5TA 4F11A 1BU8A 3F90A 4GXTA 3VZSA 5ARBA 1BXGA 4J6EA 1D1QA 4WNAB 4GGOA 4RY2A 3VGJA 1M6NA 1VI6A 1J1IA 2VZ0A 1RKQA 2VTDA 2X3YA 2PS0A 4BKRA 4H7EA 4PYLA 2Q4OA 3COYA 4WERA 3MCUA 4I1VA 4K87A 5FNVB 2C9BA 3ZWQA 5L45A 1E9SA 3FOEC 3RO2A 5AM0A 1G5PA 1JR2A 3EC2A 2HZBA 2A3RA 3S40A 5CVDA 5SZHB 2PKXA 4FYVA 1Z6YA 3LLSA 4RKEA 1NN5A 2CLLB 2AUMA 2EQ5A 3LP5A 3T7IA 2R87A 2GXUA 3P0FA 2ZISA 2ZWOA 5FQNA 3TD6A 3KQQA 2O0LA 2FO7A 3DD5A 3SO8A 4H3KB 2VTBB 4UNNA 4J0FA 4EA7A 8ATCA 4JBNA 3M6UA 3JRXA 4RVGA 2ZIXB 5L95A 4IXNA 3IKJA 1GKIA 3UF0A 3TEMA 1EHCA 1ZJYA 3E2IA 3F5DA 1Z4IA 3HWWA 4BDTA 1OWNA 2Q9UA 4DNQA 2O8EA 4GI7A 5E7JA 2HYDA 3VAYA 4AY3A 3RJVA 4F3VA 2VQ2A 1QTIA 4WFKA 2KM1A 1YE3A 2YJNA 1M8KA 5IWCA 5KNHD 2C88A 4V0MA 1DC2A 2AXEA 1R4ZA 1RQPA 1Z3IX 3H9JA 4OFXA 5ALPA 3KOZA 3SJBA 4D26A 1YZVA 2N9UA 3OEHA 3W5HA 1KYTA 3W79A 3F4BA 1G7SA 1QVWA 3H7IA 4RTSA 421PA 5IJXA 1X1DA 2ZETA 1UCFA 3LS2A 3Q87B 4IX9A 1JEYB 4K5BA 1PK8A 4X8HA 3WYCA 4US2R 5AW2A 1N95A 3KKKA 1NC1A 4PXSA 3G9ZA 3JD3A 2B94A 2VQSA 3G17A 4AWXA 1U7DA 3IELA 1XEWX 5MDHA 5JAMA 1QK4A 2ETXA 2VG8A 4BMPB 4X20B 2FRVA 3DR5A 4I50A 3ZVRA 3T1YB 3AUKA 4H08A 4KQJA 5EIEA 1GEEA 5TMDA 3TTTA 2GEFA 4JI3B 3TRHA 2EZTA 2PBRA 4HRXA 2HLDD 1M2OB 2XNDD 1KBOA 2IEIA 4EJ2A 2HQOA 2WIKA 1AJEA 2YXNA 3RYHB 3OJCA 3QQPA 4YUXA 3TOXA 4HNAD 3KZ1E 5D3KA 1BQ3A 2LWIA 1XNJA 3FYUA 2XZDG 5CB8A 4DFDA 5EPOA 3SXUA 2VK2A 5KDDA 1X38A 5MN5A 1O97C 3FSGA 1ELOA 1K1AA 1A7JA 3AQIA 3MIIA 5FH9A 4G0VA 5C1OA 4EBAA 1XJWA 4HZGA 2Y4TA 4PDXA 1T8SA 3HDGA 4KN8A 4PC2A 1BXRB 2LW7A 2EEPA 2DWOA 4KMSA 1Y8ZA 2R44A 1TADA 5TT1A 1VFNA 3CSFA 1PR4A 3CNQS 4ND7A 1Z5OA 2R1TB 5G04J 1F8XA 4CQLB 2QLMA 3KLOA 5HWSA 1EFPA 3S8MA 2GETA 2UVQA 4DC0A 2ORYA 1JQEA 3ET5A 4LXUA 4DV7B 2WXGA 1E64A 2QD4A 2XCUA 1JBKA 4MKHA 2BGMA 2W71A 3FZNA 3WJ1A 4F4IA 5A5EA 3D9IA 2PMWB 1LVGA 1RD4A 2UVPB 3B7GA 2R8EA 3A1UA 1H2FA 1X9HA 4IJQA 4L9PA 5EX0A 4OXYA 3M6WA 3IKVA 1L8AA 2Q27A 4FLHA 1UZNA 1E2KA 2JH8A 3H3XA 4ZCSA 3TB4A 4FA6A 4PLGA 3ZKWB 5LXTB 1R88A 2ADOA 1L0BA 2HX1A 3NALA 4OAOA 4DA9A 3PPIA 1D0SA 4C08A 3KNZA 1NU6A 3VH4A 3HTXA 3JQ6A 4UNRA 2IW1A 1I10A 3E4BA 2F1HA 4O6VA 1WUIS 2WD7B 5FI5A 4ZALA 3JWJA 1LLFA 3T7CA 2XWSA 3FKSA 3FTFA 4E1VA 1MD9A 2WI8A 3TWXA 2J3LA 3GRAA 2ES4A 4JBIA 3FUHA 4EECA 3KR2A 4II3A 3ONKA 1AKQA 2ZRIA 5C2JB 1TF2A 1CVLA 2ZJ5A 4KYIB 2GAIA 2W2XA 3I2KA 1NX9A 2BDEA 4HWOA 4KACA 4UBIA 3WDLA 4DV5B 4MUJA 5BNFA 4RHUA 2WF8A 3JZIA 2M6LA 3HRKA 1KVQA 1OZ0A 4JUAA 3AMVA 4HQNA 4Z7QB 2ZE8A 4PRYA 3OUZA 1GGKA 5IK2A 2DBYA 3O83A 3OJ0A 4MKZA 2VDWA 3CTMA 2XUFA 2C82A 3B20A 1B0AA 1Q1QA 2WLSA 3MNFA 1MFZA 4AP9A 3SQVA 4CRWB 2EWVA 3WHIA 4L9AA 2AUTA 5DWVA 2F8TA 1HQKA 2ZJOA 3CUYA 2Q5JA 3FKJA 3PE6A 5KTPA 2H2WA 3SCZA 4R05A 3QV2A 1NY6A 4RGBA 4OXKA 3L8HA 1IAQA 1TO1E 3DUFA 5CXQA 2FLVA 2YMMA 1LPMA 3Q5MA 3IIEA 2W6NA 2LUOA 3CRZA 1TZMA 2G1AA 2JFOA 3NGMA 2ZJFA 4XX0B 4BFZA 3HJTA 4WY5A 4ZHQF 1KFEB 5F2EA 1DTEA 2ZT6A 2AX4A 2QSZA 4ZGWA 2IBTA 4M1ZA 4EI8A 4JJ6A 4DCUA 3LPCA 3QVKA 2JIDA 1QQ5A 2G17A 3B52X 1G8KA 4FE7A 5CYPA 1JS1X 1IN6A 4FFSA 3E7PA 4Q24A 3CVLA 5LCWC 5KOYA 4YV2A 8ADHA 2QW1A 2YWGA 2DU8A 4J1SA 4AUMA 5C46F 4QT0A 1E2PA 1EBBA 3KOUA 3N6XA 3IKLA 4R9UC 3I8XA 3CBGA 4WTOA 2ECOA 2QX7A 3VU9B 4WKOA 3ZUGA 3MJEA 3ZY5A 4YP7A 5HKOA 3DZGA 3FNGA 3R6GA 3LY8A 3V2XA 1H5NA 2AI1A 2JFWA 2Y6UA 3V4ZA 3WY9A 1X5BA 2B5WA 1EWTA 4B09A 4FGSA 3V1TC 3IOCA 4B7ZA 4JLPA 1Z36A 3WL6A 4KO3S 5COAA 5KO2A 5DOVA 2VGXB 2EDCA 5IPFA 4E2WA 2YDXA 3DFKA 1WEKA 1R4NB 1XTZA 1YA6A 1N2IA 4DMHA 5DYGA 3DE2X 3BK1A 3VDRA 3KCNA 4IW3B 2BFMA 2EHDA 2OHFA 3AYZB 3GG2A 5AK5A 3F5SA 2OQVA 4KQ6A 1CNEA 5FBLB 7REQB 4L0DA 1ZP6A 4Y2VA 2H4XA 1K97A 3OTHA 4ZQEA 1LPSA 4D3XA 3DLAA 4FLEA 5ELMA 2VJNA 4PANA 4Q34A 5A71A 1YCSB 1EU1A 4U9IS 1CVRA 4X91A 3D3KA 3RUDA 3BUAA 1B15A 2BHSA 3H2HA 4LXQA 4R81A 5T8KA 3SXJA 2V3CC 4H60A 4DLYA 1RYHA 2ZWVA 3HVUA 3UQ3A 3LPNA 1SBYA 1XXHE 3H4TA 1FSFA 4YUZA 5D86A 3T0IA 1WB4A 1YVRA 4FDLA 5EPUA 3CONA 2JGLA 4BV9A 4AO7A 1OBVA 1JDSA 1VKJA 1ODTC 1YDMA 2XVMA 4C7BA 1OUVA 1XTPA 3U49A 1PJQA 1LB1B 3MQ2A 4BEWA 3I0MA 2HMUA 4F85A 4H6VA 3UG6A 1C9MA 2YMPA 4XW2A 3K1YA 3ZCUA 2ZI5A 3OZRA 4D0NA 1HTWA 5BSKA 5CDFA 3R77A 5DZSA 2JFYA 3GYGA 3OHSX 4MGKR 1G7TA 4R9NA 2JBWA 2D8AA 2QUZA 1MRSA 2F43A 3KJGA 2I6QA 3DQQA 1QC5A 3FETA 5F64A 1WD5A 3GLHA 3SC2B 5H02A 5A02A 4B3RB 6ABPA 5CMWA 5EUCA 4E5SA 5H81A 3W6NA 4H9GA 4ODIA 4ZV4A 2Q41A 1LQUA 3IT2A 3CSDA 1QIFA 1VPLA 4KXXA 4D8UA 5KHOC 1WAMA 4DLSA 2D0OB 1QQEA 3GRKA 4Y6GB 3GD5A 1MG0A 1VLQA 3IIMA 4FT4A 1SU7A 2AG5A 3C85A 4KC0A 2NXPA 4Y0AA 4PM4A 4ER6A 5HK8A 1OZFA 4B8WA 3G8AA 5GM1A 3ZWMA 3SFVA 4TKZA 4NJEA 3TB6A 3DNFA 4N65A 1K5DA 4YRDA 5I7AA 1T2NA 2QM7A 1TM7E 1LXCA 2H0QA 3O7WA 5IHPA 3VNUA 1J1UA 1KI6B 4WKPA 5GADl 4BWRA 4HLNA 4JQOA 3ZIDA 3ZKAA 2WT9A 4JLJA 1SKQA 2LPMA 5BN3B 4MVJG 4C20A 5CBPA 1CRZA 1CS4C 4KMRA 3UBTA 4CQMB 1PLJA 3PUKA 2HT6A 3ZIAD 4BFLA 4OHPA 3ZN2A 3RFCA 4JHLA 3LQ4A 4MW0A 4BO7A 2GS9A 4NS4A 4EBAG 5CLHA 3RNOA 3W9GA 1Z2NX 3HMQA 2W6JA 4ESOA 4FZRA 4RX1A 5E6RB 1W2GA 4E5PA 3MMXA 2X6RA 3BSYA 4G0YA 4B71A 2FUEA 2OXTA 4JP8A 1T8WA 5JT1A 3J80A 4G01B 4RTNA 1FXUA 2OD9A 1JZTA 3QU5A 3THXA 3OM1A 3FTEA 2ONDA 2DBRA 2WQ6A 1MJGA 2FE1A 3E9QA 3PGJA 3QHAA 4C04A 3TTVA 3ZOZA 2ZVJA 1MDFA 1YGPA 3IC5A 2FN4A 2GXSA 1GA1A 1NVFA 2QXTA 4XTRA 4L73A 2K4MA 4M49A 1JT2A 2A88A 4ZVNA 5TQ0B 3W77A 1JPLA 2DQYA 2W0MA 1MT3A 2AQHA 2CJFA 2ZQ5A 4LS3A 2ZJ0A 1ZVJA 4R0MA 3NASA 4X66B 4LZNA 4YJ3F 5G41A 2OXCA 2DEUA 2ZUBA 2IDMA 4JBWA 1EQ2A 1KS9A 2XCOA 2F1OA 1Z6TA 2GHTA 2HF2A 1UBUS 1R5NA 1LPBB 3Q10A 1OBOA 2J08A 2R2LA 1V8OA 1J9ZA 2OV8A 3LT5A 2OYCA 1DINA 2DR2A 5F2OA 1H3EA 1B89A 4J7UA 1SUBA 4KQ1A 4WZAE 2ZYIA 1K6JA 1EVJA 2ICAA 4NONA 3ETDA 4C7JA 3BGDA 1QG2A 1QF6A 3KQNA 3TW0A 2ZKLA 3CY6A 4Z4GA 1D2MA 3BFVA 4W5HA 1D2NA 4B93B 2HGZA 3ABLE 2PEZA 3G7UA 3P4YA 3ROZA 5LDDC 4PINA 1E1KA 5C51B 4CLXA 1X77A 1R7RA 3IESA 1LBIA 1P80A 4U7TB 4DSZA 4WJLA 3MGKA 2Z0MA 1D9ZA 1J99A 1GZDA 1TQ2A 3Q78A 3DMTC 3NM5A 3UJDA 4ZICA 1PFKA 3WB9A 1P81A 1XKXA 5JAOA 3CZ9A 4HUQB 4JLOA 3CQGB 3MG9A 3WGLA 3GW8A 4PLCA 3I5AA 3WRWA 5G1PA 3ASDA 1UQTA 2Z58A 3DW1X 2UVDA 5JZMA 1IQRA 4MHSA 2F1IA 2AEJA 2F8MA 3C6MA 3ETGA 2XQFA 2BSAA 3NPMA 3QV1A 3R7WA 1ZJJA 3PR1A 3MWYW 4A7PA 4MW7A 3VR4D 1F7VA 2OBFA 3B70A 1N5IA 2QN9A 2F0YA 2CJYA 1MJFA 2XNCA 1FFHA 1FT1A 2WXOA 2V7WA 1IIBA 2BP7B 3RARA 4A0FA 2I1WA 1VJTA 1LW6E 1PFYA 2R4QA 4PLZA 4YACA 3RVMA 2R02A 2P2ZA 2ZIWB 3I4GA 1ZXBA 4PFQA 2VWHA 3MV2B 3Q4AB 3L82B 2H9YA 4QTUB 5SY6A 3OIUA 1VHLA 2EF1A 2A1TS 4QUKA 4PPGA 1SUEA 1Z0IA 3NCHA 3OF2A 1FP7A 4N03A 3RRFA 1T26A 2YBEA 1C1HA 3BWCA 2TMKA 4ZT4A 1QVRA 4A0SA 3HP4A 3QKIA 4Q9DA 2JGDB 4FIZA 2MR6A 1G64A 4MI1A 1G9XA 1SBNE 2HOQA 3RKSA 4AJPA 1SCDA 3D3JA 2CXRA 4LYHA 2OV3A 3WWDA 4BNVA 1BWQA 5IZ4A 1XL1A 2W4IA 8OHMA 3EPKA 1E0DA 2PU5A 4MX8A 2EZUA 4OA5A 5EP4A 5FRDA 4LVCA 4BO1A 3LBIA 2WKSA 1X2EA 4WK4B 5J1TB 2GK6A 1XEWY 5LUAA 2CLSA 2QZAA 3QWWA 2GRAA 1FC0A 3LKZA 3ZVVA 1T3TA 3IP1A 4GZLA 3PHGA 5REQB 3UXMA 2D2IA 3YASA 1GYRA 3TNFA 3H9BA 2PVSA 4REOA 3V97A 3LPLA 3ZQKA 3ANTA 1HT1E 2W2OA 1DOHA 2QUHA 1JU3A 1J2EA 1G42A 1SZCA 2WVGA 3H05A 1QTQA 221PA 1T9CA 5AJXA 1RYNA 3TRDA 1I3OA 2BUGA 2A5YB 4WEQA 1I30A 1IB0A 4IMIB 5GGXA 3U3DA 4ZN6A 3L7KA 5CH5A 1CG6A 1R1DA 4QAJA 2HA7A 2P9EA 2QOEA 1T5HX 4B82A 2J8ZA 3BXZA 4D4LA 1GTRA 4WRRA 4ZVPA 4LYFA 2I2WA 1RJDA 4RHTA 1UK9A 5B6JA 4D8TA 3V4VB 2ID7A 3GJ6A 3C1UA 5BT9A 5CA0A 2VWPA 1P18A 3DDNA 4IQ8A 5KYKA 1ZFNA 1YU9A 1C0IA 1ATZA 1QX3A 4LAFA 1AKNA 1GGEA 1JR6A 1R5OA 3ZXXA 3TLYA 3ANNA 2FX5A 3GMTA 5CDHA 1QK5A 2JCYA 1AD2A 5ENSD 2WWHA 3WI7A 3PFCA 3GELA 2WPNA 1MX3A 1AVTA 2H3EA 4GH5A 4KTTE 4UEOA 4WDQA 4BY6A 1WETA 3IV6A 3L4JA 1E2MA 3IPCA 3C5EA 4P80A 1Z6AA 1UN9A 1NOIA 1N75A 1QYMA 2PUBA 2HSDA 1XB2A 4ZFHA 4MEBA 4Z4QA 10MHA 2IXBA 2ACKA 2X7JA 1TCVA 2WQ7A 1R3UA 2V3VA 4EOGA 2DRIA 1NJ5A 3MA5A 1N8SA 1VBKA 3RUAA 2PVPA 2NUPB 1C8LA 4DC1A 1QTNA 3TI7A 4NH4A 4XDYA 5IF9A 1EWQA 4D3DA 1FRZA 2CLFB 3DKKA 3PQ3A 4TTJA 1FTSA 5ECDA 4D02A 3OQIA 1CUIA 3O8QA 4D10C 1NBOA 2FUG1 3ITEA 4IMRA 2QZ9A 3I5UA 3E3MA 4M60A 4R5HA 3UXYA 1T8YA 3ZX4A 5INTA 4EUEA 3OEEA 3D9NA 3PUVA 1DHTA 2YN2A 4WPGA 1VP3A 2C5EA 4KRXA 5FKJA 1BHQ1 1Q1AA 1WJGA 2QVGA 4YJ2F 1RKBA 1YZQA 4LZPA 3WRVA 4OI0A 3CSTA 2XWJI 1U3TA 2VOJA 5ILOA 4JT8A 1SD1A 4ZRNA 3F6BX 4U7WA 3E5RA 4AULA 3G2KA 5IYZA 5A2QA 4FJ1A 1YB4A 4B2PA 4QUBA 4CTJA 1UKYA 4ALLA 1Y1QA 2ZULA 4GPAA 4O4JB 3VZCA 3HO6A 3L4KA 1RI4A 1X7XA 4UE2A 2DZOA 3PYLA 4W4TA 4MUFA 2WE8A 3JQFA 4B9EA 4Z2AA 1KBZA 1T4MA 1BN6A 2IYXA 2J31A 3MINA 4J0HA 5HIMA 4U7FA 5JNRA 2WFLB 2VEDA 5DI3A 4RVOA 4W6ZA 2DIWA 4DDTA 1LX7A 2ZE5A 2H1LA 1LF5A 1OJ7A 4GTSA 4IZ6A 4NLLA 5HCUA 5JMWA 3K70B 4UHHA 2X5KO 1RLIA 3H2GA 4OQNA 3FYDA 1RVV1 3I61A 1E1QA 5TMBA 3AYXB 5D7NA 5K3AA 3HK2A 4H7FA 2GGFA 1EXWA 5JCOA 1OFUA 4HHEA 2A58A 1AKTA 3FPAA 1MAAA 3I83A 2IYRA 2VS1A 1IMOA 1L5ZA 4YDYA 1UPUA 4Q3AA 4G5XA 4ZQHA 4C0HA 4YRNA 1XA4A 3DVSX 4NEHB 4EBBA 5BMOA 2QMQA 3MD0A 4US1R 1RJ9B 4HUJA 3H2KA 2BGTA 1JHMA 1FDWA 3I3NA 1JIXA 4KSYA 1HF3A 3WMWA 5I4BA 1NVGA 2FDRA 4FQ8A 4HMOA 2YV5A 5AOVA 1NDHA 4DQKA 3JQ7A 3FPBA 2C4KA 2OFFA 1DFIA 1KEPA 3P2IA 5FPSA 1IHYA 4P4SB 4TLCA 5DSZA 3PSHA 5LDGA 5T57A 1PBNA 3KEAA 3Q7QA 4LWPA 1KI8A 1Z3YA 3MKQB 1Z35A 2I1LA 4ZZ1A 1Q6ZA 1D6NA 2J0QA 2XW6A 4WLNA 3H5WA 1EFTA 4YJGB 3RIEA 1KOJA 4LDJA 4EGFA 4HAVA 4MVJE 3VR3D 3EC1A 4ZT3A 3DF9A 3Q3CA 3VPCA 4ARVA 3IEMA 4FC6A 3BJMA 3P1JA 3QE0A 1LNZA 4B84A 1Y1LA 1B43A 1YDFA 5KKCA 5M7EA 4K9DA 4GP9A 1OTYA 1JKXA 1T2AA 1BEUB 4U2BA 4E51A 3O4IA 1Z5VA 3EGDA 2GYVA 4EI7A 2WWRA 3GMIA 1F1JA 2QX9A 1IQUA 5YASA 3C98A 1UBTS 3ND6A 2VR1A 1M34A 5CB0A 1U2EA 1X80B 2OP1A 1K7XB 1EFRD 3PDIB 4L5BA 4BNDB 4COOA 3DLBA 1DEKA 1RYZA 3CRRA 4OQQA 4L2LA 2DFLA 1R5BA 3MAAC 4ERNA 2OAP1 1FIUA 3MMSA 2HREA 2A94A 1ENYA 1GPKA 1RJ9A 2VPWA 4P36A 4PHHA 3LEWA 1Z7WA 2L18A 5FTWA 3AU8A 3IVCA 1BYIA 4TV9B 3NHPA 1GCAA 3ZGVA 2R11A 2RJNA 2V9PA 2YZ7A 5BQ5A 4ZCTA 5LBUA 2CE2X 2O0KA 3CT4A 1N4DA 3F78A 5GV8A 4ZJZA 3EGEA 2I03A 3NBUA 4PS0A 4QREA 1GSOA 1TDJA 3CHRA 4NE7A 5A04A 5JTUA 3FCSB 1NMYA 3JQ9C 4LDAA 5E9WA 2PFGA 1XMVA 5SY9A 3NI2A 3BKWA 1XPRA 3H7AA 5DCWA 3NIGB 1UUFA 4PO8A 2GHQA 1JZSA 2P9FA 5K0FA 1NRJB 3ZWDA 1ZMTA 4CMAA 5ECGC 2YRWA 1NLMA 4DIOA 5GWXA 2RD2A 3T7JA 1JIKA 1U7UA 5A9SB 4HI8A 3UAYA 5FADA 2WY2D 2KZTB 3W90A 1WB9A 3AKDA 4JT9A 2X1HA 2P5YA 1V96A 2V4MA 3N9IA 5EL0A 1GVHA 1NN1A 2IF0A 2JZCA 2FJ0A 5CX1A 5ESXA 4O5AA 1L1FA 3EQ9A 2IWHA 5AD1A 4EHIA 2QE7A 1ZNYA 2Z98A 1RTTA 3FFLA 1ULTA 3E9YA 3F6YA 2H85A 3FVTA 1T2UA 1WLYA 3NBKA 2B8WA 4KW7A 4U4AA 5K0ZA 3WDKA 1XU9A 4D82A 3T1TA 1YQQA 1CJKC 3A7EA 4JLKA 4XYEA 5FAKA 3ICEA 4HSGA 4JR2A 3JYOA 3IR7A 4YMVA 2D2VA 3S2ZA 1QZ2A 3LCVB 4Z8YA 5HK9A 4TVOA 5MFZA 3MFYA 1A82A 1T8PA 3EIHA 2YCBA 1QR6A 3K2EA 4A0RA 4W7HA 3EGVA 1E9AA 5EINA 3LG2A 1JN0A 1Y4UA 4QBGB 2HXGA 4BECA 4DGSA 1C7IA 3REGA 1KPSB 5IUNC 1T8RA 3RG8A 2A5JA 1N2ZA 3R7DA 3GEEA 4BNZA 3K1ZA 4KU4A 3ZWPA 4H15A 1ZM3A 3NKVA 3LLCA 3SHWA 2NXNA 1GUDA 3DPUA 4BBAA 5D3MB 2GZ1A 2OA0A 3ESDA 3FFBA 2X6KA 1QO9A 3KFXA 2GRQB 2VAMA 4OHFA 4MLZA 4RNCA 1EGAA 1ELRA 1SCBA 3JYPA 4JT4A 4L8FA 1RKVA 1JDBB 3S4YA 1QIHA 4A16A 3PX2A 3U7GA 5B37A 2JGMA 2W37A 3OI7A 4OMDA 1Z47A 1X3LA 2UUPA 4AO6A 1QH1A 1YL7A 2JD1A 3CVQA 2H1CA 4JN6B 5GV7A 4LE0A 4KFSA 1T3GA 1U2TA 3FDXA 5CYFA 3MMZA 3UQZA 1BA3A 4CUKA 4EEXA 2CV1A 3KHKA 4WOJA 4WADA 4BRSA 3U9TA 2WF7A 4XIYA 5CMYA 2PLNA 3A3KA 1PYOA 4BP8A 721PA 1OFUX 4PONA 3U60B 2O8CB 5BN4A 1PKEA 3ZVMA 3JQ9A 3E34A 1II8B 1UL1X 1G63A 3GV0A 4ND6A 1PP4A 1PT9A 2CLHB 3K7EA 4MP8A 3RDPA 3U17A 3VI4B 2FQYA 3RF7A 4E33A 4PGHA 3GJYA 4OGKA 1IBKB 3UK0A 5ER9A 5IEBA 5DYWA 2WG0A 2YZ2A 1TAGA 1E2JA 1T36B 1AG9A 1EI9A 3PQ7A 2WLTA 4QWMA 5BO5A 5BQFA 3A9UA 3KSBC 3E8SA 1U3VA 1GFZA 2J30A 4ANVA 3V6LA 1NSTA 2XS1A 1NVXQ 3EYAA 1GT6A 1TZKA 1K3FA 3E82A 3HRHA 2IF4A 3RFVA 2VDQB 1F0KA 2FZVA 4MVJH 2ZKIA 5DNEA 3ND7A 4ZARA 5A9SA 4JA9A 1V5GA 3E0XA 3UWSA 2I1JA 1XTVA 4JJKA 2QG6A 3RM3A 5JH7F 5DX0A 4OHZA 4G2NA 4UC0A 4QQ8A 4WA7A 1N94A 5G04C 3SNXA 2WHPA 3NX4A 5KZMB 4YA6A 1DAKA 2C78A 3JZMA 4KMMA 5IFLA 1ZCBA 2EJBA 3UHPA 1Q95A 1FFWA 1TU4A 1PSDA 5D87A 4B6JA 3G6WA 4WMLA 1K27A 1DU4A 5JPDA 4Q1BA 5FFFA 4LCJA 1ABEA 1JU9A 2IT1A 4D9GA 2VNKA 4UUQA 1P5QA 3K6JA 3KZKA 5DHRA 3ZX5A 4FFNA 2REXB 3GEBA 1PJLA 1E3WA 1ZOSA 1NSYA 2AN3A 2HJ9A 4YWJA 3O48A 1GPJA 3SY8A 1LJ8A 2I7TA 1AGRA 4IYJA 3TUJC 4KO1S 1T1SA 3A2NA 4JOBA 1EG2A 2OBYA 4GLOA 3FG9A 4JELA 5HFJA 3R0XA 3ROQA 3SFTA 1R8JA 3I4FA 1UM9B 2WFLA 4RJIA 4X1IB 1QG6A 2FY8A 3UW3A 4XWTA 1GGVA 5EN4A 3W4KA 4BFWA 5C32A 1Q7TA 2EX0A 4YRRA 4D44A 4DDWA 3EJWA 4C87A 5LFAA 3KT0A 4KI0A 2ZWMA 4F7WA 1EP2B 2OR3A 4KVOA 1KH1A 1I4OA 1PS8A 2AOTA 3Q75A 2QTBA 3C15C 4HPXB 5ECYA 5CVTA 1QYXA 2YNMA 2I0FA 5CFZA 3EGXA 3HHPA 2B7BA 3ZCRA 1ZNWA 3KAEA 5A4DA 2X7HA 2XA1A 2Z2KA 1TAQA 3KEZA 4CZ2D 3GRUA 3FPLA 1LY1A 1OBFO 1JR3D 4EKIA 1KP2A 4GR9A 5JVDF 1MX4A 1G3IA 2QTAA 3OQPA 2J9RA 1UC5B 1DRUA 1ODIA 2B20A 3EZLA 4KODA 5FPQA 5ILQA 2K7FA 1SIOA 5KREA 1IN7A 5K01A 1UOHA 1FZQA 4RLFA 1E60A 5DLYA 1G2IA 4HXGA 1SH7A 1UMDA 1N9KA 4XEIG 1Y3IA 3UPDA 2FQQA 3U09A 3CHQA 1XX6A 2PSSA 3WMXA 2XT0A 4DLBA 4L78A 3W5SA 4G4JA 1JHPA 4D45A 2DVMA 4WZ6A 4DZRA 2LTAA 4CV1A 1IZ7A 3HVJA 5FNZA 5EILA 1G60A 4I19A 1PSWA 3WL7A 3KT6A 3LSTA 5IT9A 2QZSA 4IVNA 4ZAXA 4ZAVA 4LNHA 4MS4A 4BEJA 3FMOB 3EIQA 4QARA 1XZGA 3C3CA 3R9AB 5F9MA 1CK4A 1SHLA 2GAOA 2E6KA 5DK6A 1V8FA 3LGAA 3PXCX 3JQAA 3MFQA 4OQZA 4FBMA 4BTLA 4F3KA 3AETA 4HVLA 2OXEA 4JQYA 3CNLA 4R2KA 3IMCA 3U62A 3C8UA 1WABA 3PZRA 5BMVB 1E59A 1KMIY 3CLSC 1VA5A 4UWHA 3WK9A 1XNQB 1U0OC 1HZJA 3HVIA 4CM3A 2AN1A 4ILEA 4RS4A 3FGZA 5E3HA 1R64A 1PE0A 2WJVA 3C24A 2X0IA 1OLXB 2O2CA 4V1CB 3TVYA 1IN4A 1IC6A 3P2JA 2PT6A 2YUIA 4H0NA 4Y2PA 4B7XA 5THXA 5BWOA 3DTYA 3KOXA 1NW6A 4JLBA 4LY6A 3H8SA 1OAKA 3G5MA 1VZ2A 3QLTA 1Z4PX 3C3YA 5LZ7A 3VYVA 3GCDA 1ZONA 3BJZA 3UY4A 3ZJ5A 1SIWA 1SQMA 1LEHA 1TVKB 3H6KA 2VDVE 2J6HA 3L6BA 4QYWA 3VC2A 2CKMA 3OX2A 4LZZA 4A73A 2XCQA 5AESA 5LP6A 1NYLA 1N6LA 4XJSA 3C4QA 1HO3A 1GYQA 2VPIA 1AUXA 1RXIA 3K0FB 4LHZA 2NUPA 1C3OA 5JMPA 4EZEA 2JLWA 3HO1A 3NW9A 4O8ZA 4ARZB 4YRIA 2JAXA 3CVJA 3JX9A 4TWAA 1JKIA 1YQDA 4BVJA 2PN1A 4GGMX 3MGGA 1N1GA 3FH7A 4QLAA 4RVSA 2ODBA 5DRTA 2Q2VA 3T35A 1RRVA 1IK6A 3K4QA 3CQCB 1C30B 3AWIA 3PQFA 3QVSA 4JYCA 3DAGA 1W2HA 5EZQA 3WXBA 3ZIUA 3MB5A 4KIJA 1QS0B 4CM1A 4TZ0A 2A0KA 1FX0A 1PT8A 1XPJA 4AP2A 3CB4A 2GZHA 2HSWA 3JARA 5DV9A 1HZ4A 3CHSA 3NTVA 2FWNA 1ACLA 3A31A 3GI1A 2X6QA 3FUEA 4J2HA 4TRRA 3QVOA 5LYJA 5I7RA 3SX2A 3RI3A 1TMOA 3AGQA 2PZBA 1RQLA 1SXJC 1VCIA 2GFHA 3IT0A 3AY6A 4RJJA 3TI9A 4BOYA 5ADWA 3BWEA 2XKJE 2Q4BA 5HS6A 5IN4A 4NCAA 1UZMA 1QH8A 3DS8A 1XLTC 4G09A 1WXWA 1DBSA 3A1EA 3DE5X 4JB3A 3T5DA 1T2DA 4EYQA 4HEQA 2EQXA 1SC1A 4OHOA 4XEHA 4O0LA 2FMHA 3AIIA 4NU8X 4XOUA 2Y05A 2EJWA 1VC2A 3ETCA 5EWJB 4CKCA 5GVSA 3WHPA 4KIUA 2IFUA 1DCEA 5C34B 3QPUA 3DVLA 3TECE 2OKCA 5HBRA 2QY7A 4RBNA 1QKIA 1U11A 3S99A 2AV6A 4B45A 1NUAA 2NZJA 2Y99A 3D9LA 2Y69E 3W9FA 3QGMA 4NFHA 2J0VA 3RUFA 3HP7A 4WUTA 1U90A 2HHAA 3LLVA 4AJ9A 2C2MA 4UFPA 3EG9B 3ZWVA 1W5BA 3DDWA 2BR3A 4HB5A 1W2WB 3CSSA 3RVBA 1EZ4A 3GUZA 3ZU6A 1Z07A 2JH3A 4A1OA 1SUAA 1M0WA 1MPXA 2G1KA 2NGRA 3D43A 2VJKA 3A6HA 4N8SA 3RHZA 4DCSA 1Z7GA 3EHDA 1QP0A 3S7FA 4C0XA 4FEEA 2XEEA 2B6NA 5G0VA 5NLLA 2BFCA 3EIEA 3T9FA 2Q1XA 3HWRA 4TTRA 2PWZA 1X81A 2ZBRA 4HVCA 5IDWA 5BUQA 2P11A 3U3ZA 1P33A 3SIWA 4LMAA 4RQIA 1YZLA 4YP6A 4PXYA 2Q6IA 2NTVA 2TRSB 4EO9A 5C8DA 1TYEB 2YQZA 1MEEA 3TDMA 3O8CA 5TEWA 3PL1A 2QSUA 1WDYA 3LLMA 1G8SA 1JHOA 1TA0A 3ZS9A 1TNBA 1V8DA 5EIWA 5CHYA 5K0TA 4D0SA 3CISA 4D56A 1XVTA 2WHQA 3QEJA 2WSSD 1O9BA 1NVAA 2CFZA 1QZZA 1UBSB 2PFSA 4HNRA 1QLHA 2ZUEA 4ZVRA 4GMDA 3L1HA 4XQCA 4BCCA 3IDAA 4OLHA 1BMFD 2AT1A 3O2SB 1GM5A 3GLQA 3N2KB 3R75A 1GPBA 1EX6A 3I9V6 2P3LA 2QTLA 1N7HA 1PVDA 1S8FA 3WKEA 1E94E 1NXSA 4F4DA 5CXUA 2IIPA 4WCFC 1G291 4U8HA 2B82A 4US0R 3GG9A 4ZKEA 1AMOA 2EL7A 3H2ZA 4IULA 1OLSB 1TC1A 3EISA 4R41A 5HR5A 1YFLA 4P29A 1M6EX 2YN0A 2J3QA 2YHIB 3BDVA 1U8UA 1CJTC 2Q5EA 1RXWA 1MW8X 3VKHA 1XSEA 1WF6A 1LI7A 5KJCA 1L7EA 2V7QD 5DLDA 4GQBA 3KEFA 4FGKA 5KWEA 2VJLA 2ONZA 2H29A 5ICFA 5H16A 1G9SA 1WDTA 2CLCX 3NBAA 1ZW6A 2ZRNA 4DHEA 3U26A 3NWBA 4LBWA 1FUIA 2I6SA 1DPFA 3ILXA 1D1TA 1P1JA 4H6WA 4XYMA 4AVYA 3LXXA 3EIXA 4HDRA 3H16A 2YYZA 1G4UR 2DBAA 1RHKA 3A0RB 3DFZA 2BDTA 3G2MA 5EE9A 1FFGA 1JWAB 1AMUA 3Q5DA 1YMPA 1CUAA 1I9CA 1KYYA 1SCNE 1XKLA 2CB9A 2MSCB 3W5AA 2VXCA 3PVSA 5DHFA 4S1TA 5EJ2A 4L4UA 5JSZA 1Q0QA 4CNBA 4IEIA 3RVRA 4XX5A 3CLHA 1OPRA 3N2NA 4MW2A 3N8HA 2F7SA 3QKTA 3VYSB 2YVUA 1H69A 2CJXA 1J21A 3LUBA 3SS8A 1ZK0A 5TVGA 3K6SB 4AMYA 4BBZA 1NXOA 2BHRA 4BX9A 4WAFA 3TQRA 5AYWD 3IP9A 3P0IA 3E1KA 5C9ZA 1UMKA 1PZXA 1Z0SA 1EK1A 2EIXA 3SQWA 3IEVA 3FWVA 4J7AA 1SULA 4BHTA 1U8YA 1U9IC 2OESA 3BC1A 4HNSA 1LDEA 1KVUA 1W6RA 2GEUA 3HNRA 5LP6F 3C74A 5J1SB 1F9EA 5BV1A 2A92A 2HU2A 2OO3A 4WV3A 1D9SA 1BVUA 2NU9B 1X19A 2SCUB 1MO4A 2FEPA 3FUCA 1KK1A 3GY0A 5C1DA 1QJCA 5FV4A 2IOHA 4DMGA 5LQUA 2GZAA 1D2AA 2YXBA 4R1OA 4DS3A 2R1VB 3FTSA 1X7HA 3IBCA 1LK7A 3K5IA 4UFOA 3ZEAA 3V8MA 2X38A 1ZIXA 2J6IA 4CQLA 4TMFA 5FWDA 2JLUA 1HY3A 2QP4A 3DDHA 4CM4A 4E2FA 4IS3A 2BMFA 5IBQA 1KEZA 2FMXA 3L92A 3HR8A 5CGZA 5AM5A 1EGHA 1M2FA 2B92A 4L4SA 3EBPA 1KJ8A 4G56A 2FEMA 4NACA 4X45A 4NY1A 2ZAYA 4E0BA 4Z4HA 3HJFA 5L3ZA 5I45A 2H54A 2P2DA 4IX1A 2A9VA 3P52A 3UMMA 4K5AB 2WU8A 4LGVA 4X1KA 1JKJB 3ADKA 1DG9A 4UJ3A 2H6GA 3Q3GE 4MOWA 3H3FA 1NNSA 1UKBA 4M0DA 4Q4HA 5TNXA 3VU8A 1WMEA 5DTMA 2HRBA 3CGGA 4J90A 4MV3A 1WM5A 1X1SA 3WLPA 1RM4A 1PC2A 1N5JA 1CJVC 2VDLB 3JW8A 2C4UA 1W88A 1RZRA 3SFXA 4CV2A 3RKUA 1UZAA 5JZSA 3U1TA 2GPNA 3UW1A 4ARZA 4LQ4A 5H4GA 5AKIA 1MB9A 2ZWIA 3OLVA 5KJEA 1LQTA 4DLNA 1IY2A 5HM6A 1RM0A 4G4SP 1Z63A 2WXHA 2X8JA 1K2VN 4AKTA 5DULA 5CD9A 1ML4A 4HOTA 3JY6A 4LYAA 2FPPB 1XVLA 3VR5D 2IYQA 2VJOA 2P0AA 3WA7A 2DWPA 3KXDA 2CDNA 2PYIA 3ORSA 2EWMA 1UOPA 3FOWA 2BGNA 2B6CA 3RIBA 2COEA 2G7ZA 3UJHA 1VJRA 2ZIUB 2HSZA 3IAM1 4QUAA 1IBRA 5LVAA 1E0AA 1F60A 2BFDB 1P17A 3I58A 4GUAA 1J42A 3WZ2A 2D1RA 3QJGA 5IXSA 4KXYA 3DBSA 2CK3D 1QBKC 4GTVA 3MMNA 1ZITA 4L8WB 4OHWA 2P0EA 4Q1CA 3RVSA 4W5RA 4NE9A 2O8EB 1E1YA 2OILA 2ORVA 4IWYA 3SS9X 4ZXPA 3B1JA 4DK5A 3NZUA 2PU7A 3LFUA 4AUKA 4Q02A 2QD2A 3ROTA 3VNAA 2VAVA 1FYDA 3HVKA 4DADA 1GG9A 2LKCA 3E58A 4F60A 1RAAA 1UPXA 3K20A 2X9NA 2JIPA 2FPRA 4LZWA 3NC0C 4WDRA 3VSDA 3PZ4A 5BY2A 4UOQA 1KIFA 5B57C 1Q2ZA 2GDJA 3PP8A 4FFLA 1QV7A 4PG4A 5CYGA 1A9XA 2A6PA 1RLTA 1INLA 5A3JA 1QHSA 5DHTA 1DO8A 2ZITA 3TTWA 1IWBB 3F0TA 4FNAA 4HAYA 3ONFA 3CUKA 3RAEC 2HD4A 1TYQG 2AW3A 4B89A 5DYNA 1JDPA 4MJ7A 2FX3A 5AVKA 4JMPA 2DLDA 2QXUA 1YQUA 2RH5A 5CYOA 1EVIA 4QEKA 3MSCA 2BJVA 2RHJA 3S28A 1Y8CA 4XWYA 5L3SA 4H7YA 1IULA 2XZTG 3QOXA 2BTOA 3ZHQA 3LXMA 3GFTA 1RMTA 3VDXA 1ND5A 2E1PA 3ANYB 3WLNA 3JVUA 4JGGA 2B30A 3CRQA 1TUGA 4GE0A 3RODA 1IY8A 4KBQA 1E9EA 3EDRA 4WNDA 1X2BA 1WVGA 4TX1A 3TRJA 2EYQA 4HORA 3N2KA 3O8DA 5JANA 1GTVA 2H2HA 3CEJA 2UVPA 2BOVA 3PGLA 4YJDA 1G20E 1Y3HA 3B60A 4GVLA 2CXTA 1EP9A 3T5AA 1TJFA 1K7CA 1Q7GA 1YACA 2BEUA 5D2CA 3SP1A 1KE1A 3BGIA 2EQBA 4JA2A 1KAHA 3T8KA 1U63A 3M83A 1QO0A 2JRCA 4NQZA 4DA0A 2ZTUA 3JQ1A 1GAQA 2AVNA 1BXRA 2OCDA 5DTRA 5B64A 3U4QB 3C6KA 4DCOA 2PM6A 2JDIA 3BIXA 1UM9A 4MLCA 5E6UB 1GL6A 3ZNPA 3E7FA 2IO2C 1U28C 2HV9A 3OJLA 3QI7A 4JJAA 3T3OA 2NVUB 1DEOA 2C1XA 1QZUA 2FNAA 1UZUA 2PBFA 3KZVA 2REBA 1FLDA 1UWCA 1B3RA 1LA2A 4B6GA 1E1CB 1MOZA 1UBEA 3PXEA 3J5QB 3OCCA 4KPEC 2JIOA 3L1KA 5AJVB 3GU3A 5ES3A 4EATA 1YAJA 2RG1A 1WV1A 3EODA 4URHA 3S2FA 2M6KA 3WE7A 1CRPA 3Q0EA 4F1KA 4BFYA 1AKEA 2FW7A 1J20A 1PG5A 4X20A 4CL2A 4U2DA 1AZWA 2ERXA 4WNCA 3RVKA 1UMDB 1IJFA 1JDUA 1H6BA 1AQIA 1CB7A 2NX2A 5I9MA 2WSBA 5A6SA 3SYNA 1XQ1A 4G1EB 1Q77A 4GBJA 4LRYA 1ORIA 3GRZA 2CZCA 2Q3BA 2XTZA 1KQ3A 3T5CA 3GBSA 1SUIA 4OHUA 2XRYA 4KL8S 2RH8A 4I2NA 1PZHA 3A1CA 4ID3A 4P08A 3VR2D 1JXAA 4C22A 1RE0A 2HWYA 2GF9A 2IIQA 4G0PA 1TCAA 2QP3A 1EVLA 1A5AB 1MH1A 5KNCH 4PSKA 3UKDA 3EGXB 3L8ZA 2OGUA 4HQKA 2H8KA 3C8MA 1AXGA 1T9GS 2PLAA 5ALSA 2ZYVX 3BTSA 3LX8A 5EKDA 4IOJA 1JDNA 1LVUA 1XPOA 1FDRA 2Z57A 2ESRA 2VJMA 3L05A 4KQ9A 3VO9A 4C7XA 1PDVA 3O8LA 4CTOA 1AB5A 3OPMA 1ESEA 4HTFA 1T2EA 2ENUA 1Z7EA 2BM8A 3PXBA 5AQEA 4XXHA 4YDEA 3TZ6A 4DLXA 4CTMA 1SUSA 3A58B 4DMMA 1E4OA 1N0WA 2CCJA 3KUXA 4Y1GA 5K8LA 2PHZA 1OAOA 3VR6A 3KLNA 1GR1A 1TYAE 4C2UA 1KRXA 3ELYA 2IKSA 3QMPA 5FUWA 1W59A 1RLJA 4QPCA 1L7RA 3ZRHA 3HHEA 3SEQA 3A6PC 3FU0A 2C07A 3KB6A 2XECA 1XXHB 3MT0A 1ZR4A 4URVR 1ZGGA 3EEOA 1SBZA 1Z2PX 5TV2A 4F2GA 3EF0A 3GPLA 1B6SA 2C5LA 3GPCA 3KVNA 4Z7NB 2QN2A 1C81A 1X9IA 5CM2Z 3UYLA 4HV4A 1O6CA 1MA3A 3LCJA 3WFZA 5LDHA 1E3IA 5D3MA 3CW8X 3A1FA 4DMKA 1C3OB 5TS2A 4I9HA 5EHIA 1S02A 2DE0X 3IYLW 4IIJA 4YUVA 4BLUA 3B7UX 3HACA 4GZ5A 5JTTA 1A71A 5LP6B 3D3QA 4UAJA 3IODA 5GINE 4QKQA 4RADA 1V1MA 4ZC8A 3DOHA 3HCDA 1D1PA 3BH0A 4D3SA 1DOZA 5B2FA 3TLCA 3ODPA 1GGNA 3D6TB 4QVIA 2FUKA 4K2AA 2QTZA 5LIPA 1IN5A 2VDMB 1LWOA 3LK6A 2QN3A 4R31A 5C4MA 1TTTA 1XF9A 1QQ6A 1KNXA 2H8GA 3KJFA 1E18A 4JI5B 2XQVA 2FDCA 1TCUA 3VSCA 1MLDA 4I0WB 3GR6A 3FU5A 1JALA 4H18A 4CCYA 3GQVA 4B3XA 1LBTA 1Q0HA 3JRWA 3SJZA 4B3DA 1Z4OA 2ZWAA 5IJ0B 5L4NA 3HDHA 2JZOA 3W8DA 2QG9A 3UMSA 3OQOA 3RSQA 4OQDA 2HW8A 2Q21A 3M4ZA 1WW3A 2R6CA 3FR8A 3FOCA 1MXFA 1Q92A 4B43A 5K8VA 3UYKA 3U44A 4HDSA 3D8TA 4RPJA 2X13A 4TUYF 1XRQA 2Y2VA 4XR4A 3IAM6 4PPQA 3L17A 4YI5A 3RRMA 3MWDA 2NNWB 4AK9A 3PHBE 2FEWB 3QWHA 4ILIA 2VCEA 4L6AA 3NFYA 1VG8A 3DMPA 4WY8A 1T5TA 1W93A 2WUVA 3I9V1 3N76A 3NP9A 4JYBA 2FG5A 2CLIB 5HE8A 3TN7A 1S2DA 3IVAA 5DBEX 3D5TA 5ESDA 4UTNA 1JU4A 1I5RA 3PUJA 1W0CA 4FKZA 4ABTA 2XADA 4BUJA 4INZA 3ORQA 1AZLA 1G20A 1G8HA 1G8MA 1KBQA 3HXTA 2FWPA 5JI2E 1F7UA 1QU2A 4M87A 2RB5A 3ORHA 2V4ZA 2OZPA 2KCVA 2XUAA 1LF0A 5AN8A 3BAFA 1A7KA 2IXEA 4Z86A 3DE3X 4OGGA 4X5OA 5AW4A 4CXMA 4AX4A 1M0TA 4RORA 5HDBB 4UARA 1U28A 3WMRA 1ZEMA 1OF1A 2G7MC 3SGHA 3DPYA 3NP7A 2HNBA 2VT2A 2F59A 3GJ8A 4R8VA 3A4IA 5J59A 1R15A 1NN3A 3E6AA 4M0PA 1VHDA 2WJIA 3V3KA 3L5KA 4FQ7A 3GPIA 3CLTC 4MVJD 3PLAE 2L2QA 2WZCA 4MQBA 3IAHA 4RU1A 1MB0A 4TMTA 5EKSA 1CB0A 6YASA 2O7NA 3KU1A 1FMLA 5HZMA 2C31A 3B7RL 1E6CA 3NV9A 4H27A 4UI9J 5KU1A 1C2YA 2GHIA 1NE2A 5EUBA 1MBZA 3ZLVA 2XVXA 4EK9A 2GOYA 4J1TC 2ZXFA 4J0CA 3HXFA 3ZEIA 4UM9B 4YUWA 4PYMA 4U5XA 4YJGA 1YDHA 4OMUA 5FL7D 1PL7A 2V6BA 1I24A 3CF4G 4NRHB 3ENWA 3QTLA 2AXPA 3AI1A 3KYJB 2Z95A 4R1QA 4RIHA 3NHAA 2FSUA 2NV0A 3HS3A 1QFZA 2QI9F 2ZB7A 2ZCUA 1EUZA 4LY9A 1BGWA 2ATXA 4OX9Y 4R2LA 4NZNA 4M8KA 4HGRA 3AIOA 1R10A 1TQDA 2PZIA 1Y34E 2GCGA 4OK5A 1QHYA 5FV7A 4XCVA 5DMXA 4JB8A 2UUCB 3C72A 1O7JA 2DH5A 3F4LA 4ZQBA 3V4PB 4MUBA 5T67A 1OVMA 4FUQA 2PO5A 2VHXA 5KSPA 2V5AA 4UM8B 2AMFA 1U9JA 5F35A 3INRA 4F8YA 1M54A 2G3YA 1Z12A 1XZJA 3O0TA 1CLEA 3U3WA 4TV9A 4I43A 4I2ZA 4NZ9A 4TL8A 1LWNA 3LBNA 5JYEA 4E4TA 2OOEA 3ETJA 3HY3A 3MTAA 3KJQA 3K9GA 4IMJB 2ZTVA 4WX2B 3LKBA 6LDHA 5HKAA 3F6EX 4F3TA 3MTQA 1MU0A 2UYQA 2W9XA 3DV2A 3H75A 4WKCA 3M3DA 4PZ0A 3OO0A 1R4MB 2YOHA 3K9FC 1JBQA 3T54A 4JASB 2XI4A 5LIRA 1RZVA 2YY6A 3H5OA 5SYAA 4HNVA 1BKDR 3PJGA 4RMHA 5DU2A 4LF4B 3K53A 2W6CX 3IQFA 2DQKA 3QE2A 2J9QA 2BBSA 2WJPA 3IMEA 1BDJA 1NJ6A 5G40A 4E94A 5BOSB 2VA9A 3LVBA 2ZYDA 4DV1B 4HI0E 2OPBA 4YRSA 2CV2A 4MWSA 3Q7AA 4NECA 4Y98A 1PCXA 2C9MA 3OZGA 3L8YA 4JP3A 1XN4A 3CMMA 1N5RA 1WQ4A 2CYCA 2O8CA 1SC4A 1CU1A 1G21B 1PTKA 4BX8A 1DRVA 1ZHHA 3LS8A 2VQFB 1QONA 1CP3A 3DBHA 2PQRA 5IRCD 2C00A 1V48A 4URZR 5B3SE 3D6HA 1M83A 1SHUX 1WF3A 4YR9A 3FRHA 4KQIA 2WU1A 2I9CA 1NMXA 2V5VA 5FUQA 2NUAA 3JUIA 2G08A 3N8DA 1MG5A 1G7CA 2QRVA 4BWFB 2ZRKA 1YOVB 3DVRX 3K9WA 5EZYA 3CQ9A 4KZKA 3EN0A 2YWJA 4C0MA 3KSMA 3M4XA 5KVVA 2CG3A 1E3LA 1P1FA 2PGJA 2WDZA 5JW6A 4QM6A 5C5DA 2UXDB 1PT7A 1Z6ZA 4II2A 1PZFA 1MAUA 4UUOA 1COWD 5ENQD 1KKLA 1N0IA 2R6FA 1GGJA 2I4LA 3LY5A 3QDNA 3BHIA 4Y2TA 3IVMA 4JOCA 3U4IA 3VPBA 2YFKA 1EAMA 5DBFA 1T9HA 4DYDA 3HR7A 4HEJA 4WN3A 5FWXB 4J76A 2FTKE 1CUSA 4DOMA 2I8CA 2NOAA 3QX3A 1XLUA 4CHTA 1ADYA 4LF6B 4MDFA 4EUSA 3N0WA 5F73A 3M4YA 2V6JA 4AZVA 4Y2HA 3FTPA 1SU8A 4AIIA 2A5EA 3GT0A 2RGAA 3D1VA 3DZBA 2O48X 1F17A 4QNRA 1W52X 5E9JA 1UJNA 1NL3A 3EUAA 1DQRA 2QSJA 4K6HA 3NOXA 4HL6A 4FKBA 4TL9A 3Q9NA 5F3RA 1LRLA 5AT1A 4CG1A 3VUFA 4GPKA 5CK4A 4E4YA 3HBFA 5MFPA 2H5IA 1JB9A 1UJ4A 2CMKA 5D1NA 1FFYA 4ZPJA 1VE3A 4JCCA 4PPYA 2FBNA 4L76A 3VGPA 4KWIA 3FDFA 4Z1MA 5KYWA 4TN1A 3O1JC 2NUBA 4E6EA 1LBEA 1M1YB 1WNFA 2NZYA 3OQIB 5JWHA 4E7PA 5JQGA 1ONBA 5I7SA 3GJXC 2IHKA 1KOGA 3HXEA 1IXSB 4ZT2A 3NWEA 5KYUA 3TRKA 2OG1A 1VCMA 1JIIA 2P6OA 4HCJA 3K6KA 4QJIA 1NVKA 4Q9LA 4BT8A 2OY0A 4TQ9A 1ZGJA 2J5RA 3GP5A 3V1MA 5J47A 3Q85A 1T1IA 3GJ0A 2AJTA 5E0KB 2D1FA 4PFSA 1KI3A 1DIBA 1F8GA 4F5DA 2N42A 4WFIA 1BE8A 3QUSA 4B5KA 1GTSA 3OEED 4EFMA 3L49A 3HDJA 4BVLA 1KPIA 5TVKA 2IYPA 2ZBUA 1OV6A 4HK4A 4U39A 5B4TA 2AJBA 4BUZA 3V7FA 4CPDA 1ORRA 1TLLA 2H07A 2OQRA 3HXLA 4FFBA 3OZEA 5I9NA 1X80A 3I9NA 2Z5VA 2OAGA 2X5OA 3GJ5A 2BPOA 3P8ZA 4KVZA 4YRLA 1NGSA 2IL1A 1B8PA 2IOFK 3AHGA 3EIOA 4ZVVA 5B1DA 1NQVA 1QM5A 1EWVA 4N39A 3A25A 4ZMSA 3TL2A 1Y9AA 4C88A 2IHJA 4UNQA 1H23A 4ENUA 5CIQA 1LLCA 5B3AA 3AOEA 4LJYA 3U7EB 3R5KA 3MWLA 4X24A 3JVVA 6ADHA 2P67A 1T25A 3ACBA 1AUOA 3WGZA 4FI3C 3ZDEA 1QQ7A 5TS3A 3AU4A 1JQDA 3Q0IA 4CFSA 3B7TA 1NFIE 5IM4F 3GLGB 1PJRA 2BGKA 2QMZA 1RI1A 2GA8A 4CGYA 4CZ2A 1GGHA 3LYUA 1AXEA 2PQ0A 3A0UA 3ZNOA 5EIFA 1G8GA 2I29A 2P2YA 3RG2A 1KZ6A 1ZL2A 1UPBA 2H4FA 3E1GA 2WXIA 2Z2XA 5EUMA 2RK3A 2AR9A 3CA8A 5CJ2A 1C8BA 4RA9B 2WXRA 4IO0A 4TWRA 4GYYA 1SWVA 1U8XX 3U9WA 2VUUA 4BDSA 1QAOA 1BKYA 4KG7A 5KYGA 1E96A 1ZKMA 4MUAA 4BMSA 3IVRA 3DO5A 1IPEA 4K86A 1PS9A 1B8VA 2EXXA 2H92A 3CG0A 3MHPA 4K6FA 1N5KA 3CXUA 4HLQB 1RYYA 5BSGA 2QMHA 2FYTA 4PR3A 4EF6A 3I2GA 1SC9A 3M0EA 1WG8A 3QPDA 4PUCA 1BTOA 2GLTA 3DYIA 2JGDA 4JNKA 5CT9A 4RZXA 5K3CA 1O2DA 1ESZA 1KVRA 3E9NA 5EE3A 4KDCA 1VG9B 1MX5A 3IS3A 1L5VA 3GAFA 3OIYA 3FPGA 4Q15A 1SVUA 1Z4QA 2CGEA 5E1MA 1TW3A 4RELA 1FPQA 3GHHA 3HKDA 4GMHA 4IKPA 2G8NA 2BMVA 3OOWA 4IIHA 3PG5A 5DT9A 3RH0A 5CFMA 3D4NA 4NENA 3THYB 4GYOA 1GPDG 2PX3A 3AJDA 4HFNA 2C3OA 4P54A 2PS1A 4JP1A 2EJTA 4R9RA 5DNDA 3QHQA 4C21A 4LNGA 1JA0A 1L4FA 4KQWA 4BVAA 1ZSVA 2R7MA 3HYCA 3HDQA 2EATA 3GUCA 3QEMB 3OJWA 3U4DA 1U2PA 1K06A 3HB0A 3MJ4A 5JRJA 2PM8A 1TJNA 1GPMA 2O5EA 3JQAB 4TXNA 2POCA 3LMKA 3OICA 2VF4X 2QGFA 2Z30A 1AUVA 1JNXX 3E8XA 4OQ4A 3ESBA 3OTIA 2KW5A 3ZDYB 3FH8A 3PJDA 5D7BA 4O4HA 4JLAA 1OOEA 1CUDA 2ZRMA 1BIFA 5A03A 4W5NA 3W6PA 1XUOA 3SI5A 3GF4A 3PPXA 3SI7A 2J3JA 3CEPB 5EZYB 1Z15A 5ITZA 3L5OA 2Q1UA 4TLBA 3ANXA 4FHGA 1Z56C 2XE4A 4NX2A 4AM9A 2NUAB