2JLBA

Xanthomonas campestris putative ogt (xcc0866), complex with udp- glcnac phosphonate analogue
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
548
structure length
548
Chain Sequence
b'QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCC0866
publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 212
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2jlbA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2jlbA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jlbA02
3BD6A 3BEOA 1E4OA 3Q5MA 2BISA 2GEJA 2QZSA 2X0FA 4MRAA 5EKQD 3S7DA 4U0ZA 5FZSA 3L79A 5G05J 3UYLA 3CUYA 3S0JA 1IIRA 3MKRA 2AVPA 2Y4UA 4N9WA 5D01A 4RIGA 3CV0A 2F9FA 3VDMA 2UWJG 3RO3A 1VGVA 1LWOA 3VTXA 1Z62A 4GZ3A 4AIFA 2JJMA 3GUHA 4EKEA 1A17A 3MEKA 4AM9A 3HBNA 3ASFA 3RSCA 2IEIA 4JHRA 3MTDA 5CHEE 4F9FA 4Y6WA 2FETA 3Q4AB 1Z6QA 2QN9A 4U0UA 1KTIA 2GPNA 3MTBA 4NESA 4KBQA 1WUYA 1J39A 1B89A 3T3HA 4X6LA 1L5WA 1QKJA 4AMBA 3AS5A 3OT5A 3MQFA 3ZFWA 3FROA 3IAAA 3TSAA 3NC4A 2DBAA 3BD8A 1YA6A 2JLBA 4HLNA 2C2LA 4A1SA 1HXIA 2BFWA 3AMVA 2FEZA 1P2GA 2HO1A 1WAO1 2FF4A 2GW1A 2KCVA 1EM6A 1Y8ZA 1P2BA 1AHPA 3LY9A 3VUEA 2LSVA 3EDTB 1NOKA 3AS8A 4CTNA 2G9VA 3G2HA 2FF5A 3BCUA 5JJ7A 4YVOA 3L7AA 4X7RA 4N3CA 1LWNA 4YUAA 3ZCPA 3WAGA 2QLNA 2IV7A 3QWPA 1F6DA 1NA3A 2SKDA 3CEMA 4RIIA 3CVLA 3ZCTA 3CV3A 1XV5A 2XA2A 4HOUA 4GYWA 4Y6CA 5KJNA 2ATIA 4G2TA 3ZN3A 4YI3A 2UY1B 4X7MA 4BQFA 1W3BA 3OXLA 2C9ZA 3G2JA 3SYMA 2H1FA 2H1HA 5KJKA 3PDNA 1C8LA 5LCWC 1YGPA 3CX4A 3KD7A 1Y8MA 1WUTA 4CDRA 3C4QA 2IUYA 2YQ8A 3HBMA 1TJCA 3MV2B 3LCAA 2IFUA 4N5CA 1RZVA 4N39A 2QRGA 4YVQC 1K08A 4AY6A 1XC7A 3Q49B 4GA1A 3LY8A 4HOTA 4LDPA 4M7PA 5D0QD 3ZCQA 2AMVA 4I9EA 2XPIA 4I1AA 4N2QA 2QN7A 4U07A 2PYIA 5G04C 2IV3A 4EJ2A 3S7FA 5LCWJ 4PQGA 4AN4A 3PE4A 4XIFA 4KQMA 1C8KA 1PSWA 2ECPA 2NC9A 2QN1A 3MA5A 3HBFA 5DU2A 3L7DA 2C1XA 2G9QA 4AMGA 3RSZA 3NF1A 5D00A 1P4GA 3S27A 3MS7A 2AV6A 4JA7A 3ESKA 3ZPJA 1L5QA 3CVPA 3L7BA 1FU7A 5G05C 3LY7A 4BT9A 1O6CA 2P6PA 1IHGA 4I9CA 1Z8DA 4L22A 2OFFA 5G04J 1FC0A 4F97A 3CK9A 2ONDA 1C3JA 2VCHA 1FCHA 2QN3A 1XL0A 3MRXA 2VQ2A 3SZ7A 1WV1A 3DD1A 2G9RA 3RT1A 3FWVA 1P29A 3NB0A 2XA9A 4MI3A 4YI5A 3H4IA 3ZGQA 4CGVA 3E3NA 3GZ2A 1UQUA 1SXPA 2C0MA 3RO2A 5HQ8A 1C50A 1JG6A 5IKOA 2AZDA 4H7XA 5DBKA 3RU0A 4WADA 2C4MA 1Z6PA 3BDAA 3CK7A 1H5UA 1EXVA 4GYYA 1NA0A 5ARGA 1OUVA 1UQTA 3MBOA 3S2UA 2QN2A 3OTGA 5D0OD 1L5SA 3FFLA 3CVQA 5EX0A 2R68A 2GM9A 3E3OA 2E2EA 3KAEA 4KQ2A 2X0EA 4AY5A 5KJLA 3MRVA 3VDNB 2IEGA 3OY2A 2R4TA 2UY1A 4APOA 5LQDA 4UI9J 3ULQA 4WNDA 3T7DA 3SF4A 4U04A 3TGOA 2QRQA 1WV0A 4BTBA 4GCNA 2XA1A 1P4HA 3MV3B 3LYAA 1NOIA 3AS4A 1L6IA 1BX3A 5TVGA 4KYOB 3WC4A 1QM5A 3NP9A 3GYZA 2X6QA 1SXQA 4GYOA 2PRJA 3NAZA 4RIEA 3ZCRA 3D0RA 1HLFA 8GPBA 5FJYA 1RRVA 3R9AB 4N2SA 1XKXA 1V4VA 1B4DA 1GGNA 4RG9A 1KT0A 3L01A 2PL2A 3U4TA 3G2KA 4J8EA 2XEVA 4RELA 5C1DA 5BT1A 1M5RA 2F3QA 2G9UA 3CEJA 4KQ1A 3CKBA 2KATA 1L5RA 4O6FA 2GJ4A 3G2IA 3Q3EA 3O48A 2XCBA 3LPZA 1UZUA 3NPAA 1FA9A 4CTMA 3Q47B 4RENA 5JTTA 4G25A 3RHZA 2V5FA 1HH8A 3Q15A 4UQYA 2FO7A 3SYRA 3T3EA 3OKAA 4GPBA 5BNWA 3BCSA 3BD7A 5JJ6A 3BEEA 1JIXA 3N71A 4EL0A 5TMBA 4ME2A 5M72A 2HYZA 1WW2A 4UQZA 4G24A 3TAXA 4RBNA 3BCRA 4UQXA 1ELWA 3LKUA 4U0SA 5IKPA 2OOEA 3EBPA 3G2NA 3UYKA 2C1ZA 3CVNA 3RJVA 3S7BA 3ASGA 2JZCA 2SKEA 1ZBPA 2F3SA 2L6JA 4WNGA 2IW1A 2YHCA 3Q3HA 3S29A 3ZCVA 2ZB2A 4BFCA 5JTUA 1RZUA 4B94A 2C0LA 4LEIA 1XOIA 1AXRA 5DLDA 2QLMA 4G2VA 2XGOA 4N3AA 2VG8A 4RIHA 3T3IA 3U3WA 2MHKA 3OKCA 3ZHEB 4LEUA 3CEQA 3OKPA 5A6CA 5BW8C 3Q3IA 3OTHA 4HOQA 1XL1A 5JJTA 2XCIA 5TMDA 3ASHA 3TG5A 4MHSA 1QQEA 4MICA 4CGWA 2VGXB 1P5QA 4NC9A 3G2LA 3QHPA 3WXXA 3RKVA 3C4VA 3IA7A 2VYIA 7GPBA 3L7CA 4WHMA 1XNFA 2ACVA 3D0QA 1F0KA 3GZ1A 4W9RA 5A7DB 1E96B 5FZQA 3OXGA 4XI0A 1NVKA 3CEHA 3DDWA 1A8IA 1NOJA 2Q6VA 3CKCA 5ARFA 3O3CA 2LNIA 2LSUA 4UI9C 2AW3A 3C48A 5EX3A 2FBNA 4HWGA 5HXAA 3CUWA 1FTWA 1PNVA 4RIFA 3MS4A 4MHOA 4X7PA 2F3UA 2VCEA 3CUVA 4HOSA 4NEQA 3VUFA 3T5TA 3H4TA 3MT7A 1FU8A 3UPVA 3T3GA 2KC7A 4GZ6A 1Y6GA 1GPYA 4BT8A 4HORA 3PE3A 9GPBA 4W6QA 1JIVA 4G1TA 1JIUA 2QFCA 3DDSA 2XCUA 3MRTA 1NZNA 2HR2A 5CCLA 2J9QA 1NZDA 5I45A 1GPAA 2PRIA 4XI9A 5GPBA 3IEGA 4JA9A 4N3BA 4WACA 4I17A 4J8FA 2R60A 2R66A 2FI7A 2SKCA 1P4JA 4GA2A 3D1JA 4EQFA 3S28A 4JL0A 4BWRA 3GPBA 1PYGA 3MS2A 4M83A 4I2WA 4NQ0A 3ZCUA 4EKYA 4F3VA 1ABBA 1ELRA 1FTQA 5KJMA 4ABNA 2GT1A 2VSYA 5FZRA 4IN3B 1KLXA 5HI7A 3QKWA 5AYWD 2ASVA 2BUGA 4EL5A 2IF4A 3DZCA 3ZHEA 1NZFA 1K06A 2R5SA 4M60A 2ACWA 3UUXA 2QLLA 4MI6A 4H7YA 4BQIA 2KS6A 4G23A 4REMA 3CUUA 1YA0A 3QKYA 2VGXA 3T3DA 2PQRA 3QWVA 2GPBA 2BGUA 1PC2A 2O6LA 5ENZA 3QOUA 3S7JA 1WW3A 2XCCA 4WNEA 3URZA 2PYDA 3RIBA 1QZ2A 1GZ5A 2GPAA 3GW4A 4I2ZA 3OTIA 1WM5A 3FP3A 2KCKA 4FKZA 1P2DA 2X6RA 1GG8A 2Y4TA 2HY7A 2X0DA 4F96A 5TMEA 2P58C 2PZIA 3CUTA 3MT9A 3COPA 3QDNA 2IYFA 5DXFA 3OXFA 3JYSA 3MTAA 6GPBA 2GEKA 4J0UA 1FTYA 2XGMA 4GA0A 1GPBA 4UI9K 3HYMB 1IXYA 2VSNA 2XMPA 2VGYA 2QNBA 4CTOA 3K9IA 1IYGA 3ZCSA 4G26A 3ASDA 1JG7A 2PQNA 3CK8A 5FTPA 2YJNA 1Y6FA 2PQ6A 2I6HA 1ZU2A 2WPVA 4MI9A 3MSCA 4GPKA 4YNDA 2QRHA 1E1YA 4GZ5A 1L7XA 3HBJA 5DIZA 3VTYA 3OY7A 2IYAA 3MT8A 1JEJA 2KCLA 3TOVA 5CCMA 4QLBA 2XGSA 1FU4A 1NLMA 2QRPA 4WNFA 4GCOA 1GFZA 1PN3A 1FS4A 3E4BA 4WUYA 1HZ4A 1KT1A 2R4UA 1L5VA 4KXKB 3WADA 3E3LA 2WTXA 3TG4A 2F3PA 3NCHA 4NRHB 4RG6A 4J8DA 2BGTA 5FT9A 3NP7A 2FFRA 2QN8A 2QRMA 3EBOA 4BQEA 4FZRA 2WQHA 3UQ3A 3KS2A 4Z5XA 3QWWA 4BTAA 2Q7FA
chains in the Genus database with same CATH superfamily
2ZUUA 4XJVA 2R8YA 2DCUA 1XGKA 1NBOA 2HM8A 3K20A 1GEEA 3SMVA 2YHAA 4WCFC 3E5HA 2HMTA 1VRWA 1WL8A 4DLVA 1RD4A 2CV2A 1JHRA 4BX8A 3RAJA 4LV6A 3DBRA 3FAKA 4O2AF 5GGXA 4I1SA 5ENNA 5E3IA 1OFUX 1NQXA 3EJ6A 3SYNA 4CF4A 2DTEA 5BQFA 1K66A 2OBLA 2J4DA 2MSEB 4GI2A 4U96D 1KKMA 2KHZA 2FZ4A 3CEMA 2FPPA 3CV3A 3IA2A 4BKMA 2EJCA 4N0QA 1QORA 4MJXA 1NW9B 4OHCA 1FBTA 1B00A 3DT6A 5IEBA 5DIFA 1L1FA 2QMOA 4UEOA 2B4AA 1G5TA 4KTTE 4ZA2A 3UNXA 5EJ5A 4CIXA 2Z2ZA 4X8MA 2IFUA 2OC4A 1TD9A 4HYTA 3OIFA 4S1NA 1NHWA 4E11A 2XI4A 4C7VA 4FNMA 1CCWA 4I1AA 1ONNA 2I2DA 4HVTA 3EDMA 3MJFA 1UEXC 4XWYA 3WGLA 1CT9A 1A88A 2B6NA 3MA5A 4FJ2A 1BG6A 4GOJA 3MS7A 3TNYA 4KLAA 3IKJA 4YREA 1G8GA 4C7BA 3ZZ1A 4YP5A 2BSXA 5G04J 4DT1B 4CIDA 4BKUA 2GNPA 1AGNA 1V37A 1G8FA 1XB2A 2Q3JA 2XDAA 3WTBA 1ZH2A 7AT1A 2C0MA 4L6IA 2EZUA 4OHUA 3DD5A 3GT3A 2HI0A 2AD5A 2ZKIA 5HOQA 4QC2A 4LYGA 4Q7EA 1ECGA 2NSYA 1QGZA 4Q82A 4RDHA 3APCA 1SUSA 1E5DA 2QX6A 1PS8A 4BLSA 2DPLA 3MYYA 3BUAA 1DJLA 3SIPA 3SVZA 1W5TA 3KVYA 1F0NA 2HSGA 3Q7IA 3DTNA 2FSFA 2D0PB 3OQ1A 2SCUB 3TR5A 1Z3XA 4QGFA 4NOJA 5IDXA 4CEHB 1KO5A 4KQ1A 1ID1A 1K7EB 2QOEA 4MS6A 2VSXE 5I7AA 3TUIC 4BUCA 4RENA 1HDGO 1AKWA 4UQYA 3Q0EA 1L5JA 1VE1A 4AJPA 2NZ2A 4K9KA 4XD7A 4DR5B 1PL0A 5DHQA 3SVTA 2P2DA 4ZMRA 4U0SA 2WKRA 1TF2A 3IILA 2GAAA 2QUJA 2XBUA 5JTUA 4WOBA 1MX9A 3TMAA 3OO1A 5H8WA 2IH2A 4Q3AA 4E6PA 4AS2A 1HM5A 3HDHA 3HJCA 1PJRA 4G4SO 5ALHA 4O4LB 3WZ2A 2W6IA 3KOOA 2A84A 5MFPA 4KVOA 3OF5A 4Q3NA 1EE1A 3PYLA 1N0IA 3SHOA 4D9FA 4FHZA 3LDHA 3U3KA 1ZPDA 1ZRNA 1PK8A 2HU7A 2I8AA 3TR0A 2C3MA 4EB6B 1Z34A 5E9JA 5GAJA 3FWZA 1ZUNA 4H77A 5AKHA 5KZMB 2PA0A 1O95D 2LUOA 3CLVA 1T3SA 2P8JA 3PS9A 4RTJA 2C2BA 4L16A 4RV5A 3B1FA 4GDFA 4TXPA 3E9ZA 2R5SA 3UHOA 1KOJA 3SBDA 3PHGA 5JHHB 1E3WA 3BMCA 5H9WA 2JFXA 1E3JA 2IU0A 1YBVA 4A3VA 3SM9A 3BC1A 1KI4A 4QVIA 3OCUA 2O2EA 4C2AA 2ZSAA 1LBEA 3OPYB 1RQNA 3EC1A 2D5CA 2H52A 1QG2A 1SHLA 1OVGA 1GOTA 4D02A 2VNJA 2WWXA 4N01A 1H2FA 5ESRA 4DWOA 4QQRA 3EIOA 3VSCA 4U7FA 1RI4A 5T5QA 1WXGA 2BRUA 4BQEA 4EHBA 3BJIC 3K8ZA 5DCUA 1UZNA 2LXNA 4ZOLB 3BEOA 4ILIA 3G5MA 2NVUB 2FUEA 1I6WA 3VYTB 3AHEA 4D10C 5J59A 3VSAA 1D5CA 2I7CA 2OAP1 2VUUA 2VNSA 1JUDA 1K3TA 2VJKA 3GJTA 1VJCA 3LQRA 3TEMA 5CFLA 5BR4A 1EIWA 5FQ6A 5EQDA 1BS2A 3I2GA 1JPLA 3CM0A 4Q3LA 4I3FA 3W8EA 3D3JA 2QX9A 5SICE 3TSAA 4PBSA 4YJ2F 1D4OA 5FFNA 3ZXSA 2ZULA 3K1AA 1E79A 1OLOA 4AJJA 1FFHA 1M2KA 3A9CA 3D3EA 4OAVB 3QXHA 1KRHA 2RHWA 2ZU0C 4BZZA 4LQDA 2FP4A 2C3OA 2Z9BA 2XADA 3TRJA 1M1YA 3U2QA 7ADHA 3K32A 2WU0A 3NTOA 3ZD7A 4BESA 2QW0X 2XYGA 4JBNA 4EHAA 2C82A 2O8VA 3U7QB 3ZYLA 1CP3A 2C88A 2GDJA 4DEVA 5LCWJ 3PIDA 3IQGX 4JBIA 4WBNB 2IUUA 4GOLD 1L5QA 2ZPUA 4JIMA 2WF6A 4XM0A 4ACKA 2BI8A 2WAYA 3OIUA 5E7IA 1A95A 3LWBA 1TJ4A 3O0TA 2WM9A 1NLYA 4GAAA 2FG5A 5BMVF 2QYTA 5FBKA 4M3NA 3HN2A 4ZYXA 4F4UA 3MBOA 2IYOA 1X42A 2KZTA 1IQPA 2GN8A 1EE9A 1MXFA 1P0IA 1FYWA 4NYIR 4LRSB 4IFEA 4I9NA 2DF8A 1YH3A 4TVBA 4C21A 5CFZA 5E4JA 1UJMA 1PV1A 5TVGA 2QVZX 3OFSA 3LA8A 2HJWA 4CQLA 4RHCA 2WJAA 1JTFA 3WQRA 1RKBA 4OO3A 1N2IA 4N2SA 4HFRA 2A92A 4GS5A 3EXHB 4YMLA 1T0BA 2FXVA 1Q6YA 1SOUA 4EJ0A 1KEKA 3P7MA 2WIDA 1XTRA 1U65A 1Z5NA 1XXHA 4JSRA 4H0CA 2A9FA 4JQCA 3DQZA 3BMQA 1DVPA 5K9ZA 4U7PB 1V6AA 4L0QA 5CT9A 4E2ZA 4I1UA 3DFUA 1FMTA 1T10A 2OA0A 3CS3A 2ETVA 3SIXA 1N1EA 4U00A 3OTOB 3AHDA 2VPYA 5A3RA 3O31A 2Y8EA 4C3OB 1BW9B 3IA7A 3RLIA 4IXTA 2BBSA 3DEJA 2J9YB 5LCXA 5JALA 3FOEC 1JG1A 3UB2A 2YR0A 4R2MA 2OE2A 4GBGA 4ZT3A 2JGIA 1LVGA 4H7KA 1OXSC 1L5FA 4LXXA 1OILA 1XCJA 2HK9A 4RVOA 5KYWA 4H6VA 4FU3A 5CCDA 1G19A 1Y3FE 2P6UA 4BE7B 3EQ7A 4DV7B 1CY6A 1K7XB 4TV9F 1ORIA 2YUIA 5CYOA 1YL7A 2GZRA 3FDFA 5CA0F 2PO7A 1GGEA 2V58A 4UHHA 1ZEJA 5CHEA 4J0DA 3GEBA 2PU5A 1M67A 1F8FA 3PDJA 4F1PA 1O97C 3OHPA 4NCNA 1H23A 1QIDA 2GPAA 4AJ4A 5JCZA 3E58A 4YRCA 2R7LA 4WCDA 4MVYA 5A0TA 5CBOA 2ZK7A 3AYZB 4O3FA 2BMJA 3TTXA 4HQ6A 2JHPA 5IH7A 4DLLA 3ZCSA 2YJNA 4U2KA 1UWKA 1HE4A 5F5NA 1MLDA 1CUYA 1YJBA 1Y8RA 3AF2A 3VKVA 3O4FA 1JSLA 3F2VA 5AN8A 1FT1A 2R4UA 1RWVA 2C7GA 4KMRA 4ND5A 2V5AA 3RH0A 4ZODA 3TXNA 3SXPA 4Z5XA 5T64A 1E94E 4PYQA 4MA5A 2VA8A 4KREA 2ZIWB 4A91A 5KMGA 4NBVA 1O9HA 1IN4A 4MVJP 4WNAB 1PT8A 4JHRA 5EKUA 2XWPA 3DBLA 2QTVA 3K5IA 1Z56C 3CLUD 2ODWA 4X0EA 4U6NA 1OFIA 1AHPA 2TYSB 3AIIA 3T7EA 3MGKA 2UYYA 3AI1A 4NZOA 4ETWA 1XR3A 3MYVA 5HE8A 2KBXA 3FHLA 5HQ3B 2VDPB 2WMOA 1NQVA 2J7PA 2NT3A 3HZHA 1CQWA 3VZCA 1KZ7B 7MDHA 2NNWB 1G18A 2RSLA 5FBVB 3HCOA 1RBZA 4AWXA 1IK6A 5HJ5A 2OAEA 4JYCA 1D6JA 5I9SA 5AI4A 5L45A 1B8VA 1K3FA 4QFDA 3W6ZA 3SSNA 1BKYA 4WK0B 4HNGA 1XEXB 1SVKA 2AJAA 1A5SB 2B8EA 4QEDA 1Z9BA 3KJFA 1DTSA 1R0RE 2VP0A 1TYQG 3RKUA 2FZLA 3D3WA 1NNI1 3UICA 1PJ3A 5EMHA 3CG0A 3DGFC 5KOJB 3K0FB 5HHTA 1IN1A 1ZVKA 4RSGA 1CJCA 5ERXA 3R41A 3NHMA 4GM4A 3CVQA 1Q7RA 2A6PA 1IEXA 2O8NA 4NENB 3U4QA 4CL0A 1PR2A 3M6VA 4XOUA 2XNCA 1YDFA 3V8RA 2QYHA 3RC9A 2WYUA 4ZDKA 4EENA 3CO0S 3I04A 3DM5A 4XYBA 2X22A 4AMZA 1K4MA 3IOBA 1OE0A 4UARA 2C83A 5J1SB 1J5EB 1Y8AA 4HS2A 4FILA 3HI4A 2REQB 2V96A 2H51A 1TEXA 1GL9B 1PYDA 1J70A 5JJ6A 1E8MA 1PTJC 1K27A 2QN6A 2A9OA 5MN4A 4CM1A 3INGA 3L82A 1IQRA 3RIGA 4BLVA 2L19A 4I6GA 1VYUA 4X00A 3FYDA 1PJCA 4LEIA 1IMOA 5J4HA 3SQXA 5T6BA 3IOMA 1TAGA 4RA6A 1WZIA 1IB0A 4KRFA 1L7RA 1E0JA 1CETA 1VL8A 4G6ZA 2ZSIA 4GC9A 4J1SA 4E33A 5EL0A 3DLHA 1MQAA 5JHGB 3EGIA 1X77A 2J31A 3JALA 5KNCA 3BTSA 1X7YB 3MJEA 4YQEA 3WB2A 1SOWA 1QF9A 2X4GA 2VNAA 3EGWA 4ZO7A 3BJRA 2AGVA 3CNQS 4DMKA 1N7HA 4P81A 3AONB 2PV7A 1HKUA 4ZV9A 5IF9A 2QFCA 1MMFB 1TAQA 1BYIA 4TTQA 5F2NA 3WP0A 3HDJA 4BB6A 2DHCA 4D9BA 1BMFD 3C5HA 5IZ4A 1RQLA 4YJHB 1G9XA 2JI8A 5JC8A 5HBGA 2JGNA 1MGOA 3C1UA 1FFWA 1TU4A 1P1HA 4J76A 3RFXA 5HI7A 5JIBA 4RD4A 2CFRA 2CK3D 2BLLA 3NZEA 5CB4B 3NG1A 2AE1A 2D06A 2G80A 2JGLA 1TVMA 4IS2A 2GPBA 4KWHA 4XQ0A 3B1VA 2XDQA 4UBJA 4TUUA 3CW9A 3WO1A 1E7MA 3IPAA 5COQA 3NOXA 4QGGA 1Y5RA 4IDBA 1TO6A 2D1TA 1JB1A 1FFCA 1SUCA 3ISMC 1DIHA 4P5DA 5IMBA 4UI9K 3H2HA 3RS4A 5L95A 2ZRPA 2Q5HA 3UY4A 1FXWA 1E0KA 4I55F 3C6QA 3ESYA 3NOVA 4LYEA 4KXVA 1XJQA 2WXOA 4H15A 3HWRA 5LIPA 1T8UA 3TPFA 4RTRA 2C07A 1R0XA 2VWHA 4XE5A 2WSBA 4R05A 3CXUA 2XXJA 1O94C 2YZMA 3LL4A 2DVWA 1NXTA 3I5AA 2AUMA 4X60A 4C4OA 3N86A 3RYHB 4EHDA 4FLHA 1COWA 3V79K 1ZUHA 4YALA 5GY7A 2JJQA 2AWOA 2ID7A 1Z22A 1K8QA 3CNEA 3H1BA 1DC2A 1VE6A 4TXHA 3JQAB 1JDNA 3MJHA 5CM9C 3OF2A 1RM5A 2ZYGA 1YHZA 1H94A 1YJ5A 4FFSA 4ENQA 2BIFA 2BONA 1UODA 5T67A 3ICPA 3EQ2A 4B6OA 3K9WA 1II0A 3T15A 4FFBA 4LSGA 4Z49A 4K8OA 3AF1A 3LHIA 2ZB8A 2YWFA 4LV8B 1VPEA 2QD5A 5ALJA 1N9GA 4IZHA 4O4JA 3ICVA 1XPJA 2PFGA 4Z4CA 3ZWAA 3B1ZA 3LCAA 1F4VA 2GBFA 4PNEA 3F4KA 2KB0A 4YWHA 1M2HA 1UOPA 2PUHA 3OJWA 5KC8A 3PNQA 3E7FA 1QXSA 5KSZA 4RFSB 5LUBA 2PY6A 2QF7A 4GICA 3RARA 3VH2A 1J2RA 4PGFA 5JYDA 3T4XA 3G8BA 1RYNA 4G07A 1G2QA 3MF4A 3PLAE 1BEUB 2ZTUA 2P41A 4HO1X 3CVYA 1PL8A 3CJRA 3GRCA 3LCCA 3HNRA 4CZ2D 4FBMA 4D2IA 2POCA 4L6CA 3LX8A 4AQDA 3DKRA 1QIMA 2YZ7A 1LBHA 3WV4A 1BHO1 1XWWA 3RAGA 1OV6A 3QENA 1AHIA 2JIOA 4PR0A 2BKEA 2CXQA 4TLAA 3P0EA 3HVHA 1RTKA 1Z83A 3W6UA 3K73O 1N2GA 4X62B 3ULQA 1ADCA 2AUTA 3MUOA 3KYDB 2UUBB 2XA1A 3ZLUA 1M1YE 4BQSA 3HRKA 4C20A 4WEOA 5HMLA 2GBGA 4PAOA 1RYMA 2PRJA 4MSUA 3ABLE 4FMDB 3EAFA 3DZHA 3RBAA 5C1PA 1AO0A 1TPYA 3QBDA 4HVCA 1EJBA 2LP4Y 3PQ6A 1J06A 1EVIA 4MEAA 5KPJA 3ELWA 4TMKA 5JEDA 1XNQB 3EK2A 3Q2IA 3SOPA 4UVIA 5G4KA 3GMTA 2OZLB 1XD8A 1FTSA 1FQWA 3HFJA 4BY9E 1XLTC 1HLPA 2OBBA 4L8WB 4C6RA 2REOA 1XHEA 1JDUA 3Q3VA 1IBCA 2FJPA 3PX2A 1LF0A 4G4GA 4QVKA 5CPBA 1W2GA 4BNGA 1HTTA 2CL5A 4LF9B 1HO3A 3CGGA 5ECWA 2EKBA 4LNUA 4S1WA 3DOUA 3ITDA 3UWPA 1R00A 1U9CA 3A28A 4BGDA 1OZGA 5CYGA 1LPMA 3TE6A 1ULAA 4NMXB 1ULZA 4K26A 3T7IA 5LIRA 1OH6A 1SCIA 2YMQA 3VHRA 2R751 3RTGA 4HOSA 4G5GA 1Q14A 1ZM3A 2C7PA 1M6VB 2ZREA 4HBGA 3UXGA 1XAIA 2Q3MA 2MU1A 2EKLA 3HA3A 3H5AA 2NQ2C 3FW1A 2J9QA 5HGXA 1NZDA 1CZNA 1CUVA 2PG3A 2OHOA 2PMKA 2LE0A 2PKCA 2XXAA 5AT1A 2ZSJA 1GNVA 4KLZA 1G2PA 4HOYA 3QBEA 1XXHE 2JFBA 3OTWA 3VNSA 4KW7A 5M7EA 3KE8A 3RVOA 1XIVA 1I0IA 3HUEA 1DAPA 3SEQA 3CLJA 3LH5A 3VGPA 1TJPB 2C94A 3U16A 2GF2A 3GLRA 3OA2A 2DUUA 4XCVA 3RTCA 3LF1A 3GVIA 4HXYA 1HYEA 3CINA 1J8FA 2Z1NA 4J0UA 1SIWA 2CVQA 5K3CA 4MI1A 3O03A 5KNDH 1N6HA 3L9XA 2PZBA 3N75A 1EK2A 4XKJA 4ZALA 1T4CA 4RTOA 3IYLW 4ONEA 1P1KA 3DWLG 3IBCA 1K92A 1QO9A 1FFXA 2CXPA 1ORVA 5DM1A 1T2CA 5E6SB 4V0LA 3ZD6A 3BB3A 3SHTA 2OG2A 1D2AA 4OJNA 2K2WA 5LBIA 2PBLA 3E3LA 3CHPA 4GBMA 2R6JA 3QF4B 4CRWB 4MO2A 2VAXA 1IHPA 4X6YA 4FOLA 4C0WA 4QPCA 2Q8PA 3REQA 4EPRA 3MGAA 4RIGA 1Z0AA 4AMYA 4DB2A 2XEHA 1AC5A 1QONA 5CHEE 2PFSA 1YS9A 4QGBA 2W7TA 5AHWA 3INYA 1WUYA 1C3EA 4FS3A 3EGXB 2PWAA 3LFUA 4UPDA 4BGEA 3FCOA 1I1OA 3QYJA 3M7IA 2YOGA 3L41A 1SBZA 3QBVA 3QRWA 4G5SA 2WJZB 1E8DA 2H1SA 5FHRA 1QIJA 5HRYA 4P54A 1Z7YA 2J5KA 4UJ3A 1RMQA 1ZR2A 3LECA 1JAIA 2BHNA 4BQFA 1IBMB 3M4NA 2RKOA 4YWJA 4CDRA 3P2EA 2HRRA 1TTPB 1Q0RA 1K75A 5B3JC 5HRUA 2JI6A 4ZCLA 1HE5A 3UTMA 1SCDA 3ENZA 3VYRB 1W34A 1XZMA 3GCWA 2PDAA 4ZK2A 1P9LA 4BEPA 4D3ZA 1QH1A 1T4MA 5AW4A 3U09A 2BMEA 4LFAB 1LTKA 1X1EA 1Y9ZA 2G28A 4F97A 2P30A 4BFLA 1J0EA 4PWZA 3B70A 5K03A 5HKBA 1JDZA 1JR2A 3QSGA 1U3WA 4EBAA 3FWVA 4NPCA 5IFLA 3PF8A 5DNUA 4O0MA 1X9HA 4ZC1A 3IPYA 3NT2A 4CL3A 3MBKA 2PO5A 2FEXA 4ZVMA 4PN3A 3C16C 1JEQB 1Q0UA 3B5IA 3T7DA 3SF4A 2PL3A 1KJNA 3TKLA 2DZNA 2BYTA 1TEZA 2D2FA 4GYJA 4E22A 4E12A 1YQUA 2XOKD 4JEUA 5K8CA 1RXUA 1RCFA 1NUHA 2C04A 3AHGA 2WJWA 1GGHA 4NY1A 5FFMA 4YGYA 1H6PA 4YCSA 2WD7B 4BC0A 2XQKA 3UWDA 1RNLA 3AZPA 4EYQA 3LV8A 2VIIA 3ZYCA 4JH0A 1QDLB 4OPMA 3MMZA 5FNVA 1EVZA 1ECLA 1PD0A 1CUDA 4DLKA 5J2TA 3D4LA 1PU2A 1U7OA 2V74B 3L2OB 1SHZA 2WQ7A 4ASUA 3PJDA 3G2UA 5ETJA 2YHEA 4WX2B 3C43A 1T9KA 1ZWKA 1SUPA 1XTBA 3CGHA 3QAQA 3GEPA 3CEHA 4PBTA 1T5OA 2ZM5A 2XSZD 2BCGY 3DM9B 4IEIA 4XJSA 2ZRCA 3KKLA 5DNEA 1U7HA 2VSOA 3WYFA 2JVJA 2AXZA 3T5TA 1GPKA 2NVBA 2XPZA 5C8ZA 4C4RA 1PEYA 1JPJA 3HVIA 3GD5A 4RQTA 3PGA1 4FB4A 4MS1B 2G9NA 2AXVA 5F77A 3DYIA 3MFQA 4JWKA 3I53A 1G3QA 4NJEB 2E4XA 5DTRA 3JUEA 1CZRA 3QG5A 5CLJA 5BRNA 4IGFA 3VU9B 5K0ZA 5FZRA 4I5GA 4W5WA 4DJ5X 3LW8A 3N7TA 2ZS9A 1GL3A 3CUUA 2ZYVX 3W4KA 4HTFA 2YWHA 4I4TB 2Q3EA 3FFXA 3I9KA 3DAHA 2NUAA 3KCQA 2PA3A 3WYNA 1TZ2A 2IRWA 2JS7A 4JKIA 1IK4A 2X15A 2VJLA 5HS4A 4U3JB 4P93A 5REQB 3M0EA 3PT9A 2AFHB 5KVVA 1JG7A 4P2GA 3A2MA 4F1WA 2B61A 4FBGA 2Q0HA 3GH1A 1SZDA 1VHLA 2I5PO 2VSXA 4JJAA 4H6XA 2IONA 3IKTA 3ZE9A 5IJ9B 2FRDC 5JARA 3FJOA 5EHXA 3ZDZB 4F46A 4GTRA 4EUEA 1GYPA 4R4JA 3TLGB 1ZNXA 3HGQA 3ZBPA 5G05J 2PS1A 4EK9A 2D0IA 3DRAA 5EJ6A 2I2BA 3SQLA 2BDTA 1GPJA 1V1RA 4MRVA 4HEQA 3BBLA 2I6UA 4PU0A 1Z6QA 4UVDA 4CF6A 3JPYA 1Y5MA 1L5WA 4URZR 2WV9A 3AS5A 1BSVA 2YWJA 5CJ2A 4LYDA 2GXAA 4P7JA 2ZANA 3UN1A 4P3YA 1PR1A 2CF5A 2B2NA 2GO1A 5FTNA 2P1DA 2VJOA 3IQWA 4J6FA 5B3LA 4J0CA 1LPPA 3MA0A 3A7DA 2PHZA 1J5PA 1OCCE 1OV4A 1ZD2P 2IX9A 4LWOA 4BHTA 4YUAA 4KV7A 4ENWA 1W0CA 4NH0A 3QU7A 4XDHA 4RPIA 2NPIA 4QNNA 4X1YB 1U2PA 1U1FA 1R5JA 1C9YA 1TL7C 3D6MA 1B6GA 1PV2A 1Q1ZA 4RJTA 1ECJA 4GA1A 5AM1A 3JAWA 5LQJA 4IYRA 1ZZEA 2G08A 4U07A 4RYLA 4RZSA 2XZLA 4WLUA 1TW3A 1I7QB 1OU4A 1B2LA 3UKOA 1FL9A 4C7JA 1FX0A 2QD4A 2EJBA 1PF7E 1UJ4A 3WLKX 2R59A 3K1TA 1G6OA 1Q92A 4KQJA 4Q4AA 2VCHA 4FGUA 2B83A 4MA4A 3I01M 3QVGA 2I4IA 4C3UA 2XMGA 2ORVA 1H5UA 2I1KA 3CISA 3AM3A 5I5EA 3ZU6A 2O2ZA 3V8NA 2EQBA 5H83A 2BFDB 3HACA 1NASA 4OMCA 5HDBB 3TGOA 2YVLA 2QTRA 2FWMX 3ON5A 4DCCA 1IRIA 4CM9D 3MILA 2OPHA 3E22A 5D3QA 3Q3CA 4RVFA 2OV6A 1Y9DA 2V1XA 2A5FA 1TVKA 1Y4SA 4OQEA 3IPXA 3WKAA 1WCIB 5KEIA 1MNQA 1TJYA 1C29B 1A9YA 4KGDA 3B13A 4MV3A 1UZUA 3W34A 3W2GA 4KUGA 4RVHA 2D74A 3A3KA 5G53C 1VCIA 2FGKA 5EZYF 3EVCA 4YUYA 1UPFA 2OEWA 2GEBA 3SI5A 1WABA 3G02A 2FZWA 3WLAA 5JDIA 4OGWA 1NDQA 4UHKA 3UT7A 4Y1GA 1R0KA 3C8MA 4H1WA 2Y6VA 2JFFA 4DIUA 4AXHA 1ORWA 3LXXA 3VPGA 2E5FA 1REQA 5HNKA 1BE6A 1JJAA 3PDHA 4RF2A 2QL5A 4FFVA 4NDNE 2WSLA 5JG7A 3M70A 4JEHA 1YUBA 3GJ7A 3LUCA 1WS6A 3L8ZA 4TXLA 1NJSA 3S5UA 2ZSKA 4HI0E 3V8EA 5LDGA 4OQNA 1TA9A 1AXEA 2WC1A 4AJWA 3RRMA 1CQPA 1FXSA 4ECEA 4N3BA 4I17A 2OM6A 2Z08A 3PJRA 3QYFA 3ER8A 1V8PA 2IXBA 4AWAA 3Q7RA 2WMNA 2P67A 3E70C 4WVFA 1E4EA 1Y3CE 3RVBA 5JNTA 2ASVA 3F1LA 4RWEA 3V5NA 3GLFA 3JYLA 3CF0A 3ZKWA 5I7UA 1AK1A 2UYCA 3F3SA 4B3FX 1UMBB 3WLRA 3EGVA 4EKGA 2GM3A 3UMFA 3LGXA 2WVAA 2Y0PA 1GYRA 3NOOA 4G8DA 2VATA 4PHGA 3A27A 2V9ZA 4XTCS 5JS7A 1F5SA 3G8YA 3PR2B 1GCGA 5TPWA 4J0KA 1JSRA 3L8EA 1O94D 4GZ5A 4ABTA 3ESDA 2DY0A 3OY7A 2JEOA 4OXNA 3E3AA 5INTA 4CMAA 3X2SA 2E55A 3F98A 2YV3A 3T0FA 1NYQA 2GK6A 4LV5B 4BB0A 3FM9A 2P5TB 4M7CA 1KR2A 1Y5IA 5LM3A 4ZCTA 1FP2A 1GZ3A 5C5CA 5G1NA 1CVRA 1RWKA 1BMTA 2XTNA 4L4SA 4KZ0A 4CDGA 3E9QA 5LP6B 5JQGA 1Z4LA 4MQMA 4FLEA 3Q7TA 2ZZKA 4LSMA 2F43B 3QE3A 2SNIE 3A4VA 3CHYA 4MCIA 4LI3X 4YRIA 1NE2A 1TTTA 2RB5A 2E4ZA 2VJAA 4EW6A 4ZPJA 2FPSA 3KSZO 4US0R 2H1RA 4C04A 2I6TA 1S2LA 4D0RA 2QGFA 4UZFA 3R4CA 5HUQA 1ATIA 4GNRA 3JYNA 1QGYA 5BP7A 1E62A 3PD0A 3ZN3A 1PRYA 2PNNA 2NUPB 2BMAA 4PGGA 1Q21A 2M9MA 3AR6A 4CUJA 1ZRHA 1HZJA 3GQBA 4AIIA 1SZCA 3U3DA 5LU8A 2II6A 4QBTA 2OGUA 1PG2A 4RKWA 1Z73A 2X7XA 4ZVTA 4R8LA 5K8LA 5K6AA 2H5JA 3ELBA 4UWHA 1O96B 4BNUA 3MWLA 5LSAA 2QL9A 2Y05A 5DRYA 2J1LA 3ZDEA 4M0UA 4PSUA 5IWAB 3OZEA 2FR1A 2B6HA 2QQGA 1NFRA 4EBAG 5HILA 4R69A 4RHTA 2BHLA 4P83A 1TNOA 4NYMQ 3C3RA 2PGDA 4C7OB 1LU9A 3RUDA 4DF3A 4E14A 3ULKA 3BYZA 4RSMA 4B1FA 4HRYA 1I94B 2UY1A 1FEZA 4X85A 5SY6A 4XCXA 3IQZA 1DE0A 1TVEA 1K0FA 2N47A 1N92A 5KWIA 2WOOA 3OJOA 1XVAA 4YJFA 3DEYX 5LB4A 3ZE6A 4IQ4A 3NU1A 2VXBA 4DDVA 2PSDA 1SNYA 2YFYA 3V4SA 4QFCA 3CZ5A 3HKCB 1YHNA 2X5NA 1P2FA 1U4OA 5ENQD 4J75A 2YQ4A 3T5CA 1JLRA 3WRVA 3ZDQA 2HZ7A 1YJXA 2KJQA 3N9IA 3I6MA 4LDNA 4RZ3A 3GP5A 1N2EA 3RGWS 2YX1A 4DX5D 3BJZA 3OKCA 3TLXA 5LOVB 4LQLA 1X70A 2RGNC 1GNQA 2BEUB 5GOTA 3FB1A 3Q8KA 1RRPA 1U94A 2PAAA 4LPSA 3QX8A 5F2OA 3P9KA 3RVQA 3DP9A 3VJLA 1GSHA 5EX3A 4UM8B 4R2KA 2ZEJA 4ER3A 1RLMA 2LKDA 4ENPA 4BQOA 4PLZA 4GZMA 5CA1A 2IEYA 2ZG6A 4NV0A 4ENUA 1MORA 1WETA 1V3QE 4CLOA 4A8JB 2Y2VA 2DJ5A 1GPAA 1MPTA 1LZLA 1ND6A 3GLIA 4UEKA 4ZC8A 3EVZA 2AG0A 4MULA 3BS4A 2XTAA 3T06B 3TFOA 1QYCA 4TS3A 4B81A 1SVIA 4KNWA 3FSJX 4M6WA 4RLYA 3QW4B 3EHRA 2BDUA 5B1HA 3DVAB 1OUMA 5DBEX 3OOSA 2OWEA 1Z4JA 4MI6A 1ADGA 1KAEA 2VGXA 4Q4JB 1NLFA 3D4OA 3RJ9A 1XLWA 3A1VA 1PVDA 4ZYZA 1A7AA 4E70A 4CEJA 2FOXA 4C4SA 5I9BA 3UB3A 1VLQA 4GPAA 2BOVA 2WPVA 2C5HA 5EIBE 5CR9A 2VSOE 5D1HA 2HWXA 3B6EA 1L7XA 4NLLA 1U11A 4HS9A 4TVKA 3QLJA 3L6AA 3AUTA 1T91A 3V2OA 1PZMA 1UXIA 2CYCA 4MWOA 2PLNA 3IE0A 3ZY3A 2XUKA 3UT5B 4BTAA 4NECA 5TQ0B 4N0MA 2C9DA 5DN6A 4AG5A 4PLCA 1NONA 4G0PA 3E8MA 3H0KA 1SKYE 1ISIA 3PC8C 5DTQA 3EOBI 1OGYA 5DLPA 1WNTA 2VDUE 4BKPA 4YFVA 2FN4A 2IPLA 4N3NA 1BE1A 1OZFA 3NC4A 1TTQB 3LX5A 1PLLA 4KP7A 2C61A 4TTJA 2FX5A 5LP0A 2PUBA 5HUHA 1ZJJA 2ALJA 3OZXA 4R8MA 5A0VA 4LHEA 1TEVA 2D3WA 1T2EA 4INPA 5BN4B 2RDMA 1WXDA 1L5MA 4KYIB 1G5QA 1JWFA 3DMTA 4DLAA 1Z38A 1KIAA 4YPOA 1V11A 1J2TA 4CV2A 4Q18A 4UUMA 4G2TA 4WKCA 2HRQA 3I3SR 4X5OA 3KSQA 3CW8X 4KGVA 2CLHB 4F38A 4NPHA 4G0ZA 1WZUA 1EP9A 3GRAA 2IYWA 4PZ9A 3DTVA 5CBPA 4AUNA 2NQTA 4L72A 4WSOA 4YHHB 1JA9A 1XZPA 1YZHA 4TKZA 3L7KA 1PSWA 1IQUA 1Z0SA 4JP5A 4REQA 3GLSA 4F7WA 3NUGA 1TM7E 2Z56A 2FPOA 2PXAA 4NURA 2NZXA 1KDZA 4JHXA 1VMEA 1KAHA 1VPWA 1MFZA 4F71A 2R8PA 2ZWOA 3SZ7A 2YASA 3V34A 4PHHA 3IJEB 2L6BA 4AO6A 2R8OA 4TT8A 4HCJA 3MOSA 5ALFA 3EEYA 4PLHA 3FFLA 2WG2A 3R9MA 2E2EA 2X0EA 2KBEA 2IE0A 3E1GA 3KG2A 1MJ5A 2B92A 1O89A 2FP3A 3OAAD 4GWKA 4XUGB 1ZP6A 4DIOA 3MJWA 3BFPA 1FPQA 4ZVVA 1SA0A 3UXMA 1QM5A 3UJPA 5KOYA 4MGKR 2A3NA 1X14A 3LPNA 1JR6A 1T5LA 4K9RA 3FUIA 5J47A 4GTSA 3I4GA 3N0TA 5THKA 1W19A 2GX6A 4RAOA 3KLBA 1L5RA 1KMMA 2WT9A 4ESHA 4L75A 1X9GA 2F1OA 2AI2A 2IHTA 4BUJA 1B26A 4IIJB 4BV2A 3S7BA 3EE6A 4C3ZA 3ASGA 1B15A 1GKYA 2CFSA 3N70A 1NNUA 3H11B 5DCWA 3GZNA 5JAMA 2YXPX 4HGYA 1U0NA 2D6FA 4WE3A 3PV0A 2Z4RA 4CGWA 5IJ0B 1B1AA 1C3LA 3OD5A 4L5IA 2HUPA 4OF4A 2NXCA 5GZ6A 4OQLA 5JYEA 1TZBA 3DQQA 2I4RA 3GGSA 2XF8A 1KETA 4UEQA 1EP2B 2QSYA 5AWFC 2GCOA 4JHLA 4L9PA 1QE0A 4MINA 4DNXA 2TRSB 1JHYA 5C2JB 3QZUA 3KV3O 5DZSA 5BRAA 1Z35A 1F60A 4NATA 3JQ8B 2F17A 1BRTA 3T9EA 3AU8A 2IL1A 4BO0A 2ZBQA 3FYUC 5JEEA 1C8BA 3TXYA 2B8JA 1QUEA 4BBPA 4JYZA 1ZXBA 3H1AA 5KHOC 2VJMA 2FSSA 3MJ4A 2CHVA 5KVAA 1XVIA 3T5MA 1NX6A 3KTOA 4M60A 2Y76A 1VMDA 2QAGA 1I7NA 4EYOA 2RD0A 5ITSA 1UWCA 1IM8A 3U4MA 3LBYA 2BGUA 2W8BA 3ZWKA 1RHQA 2PMCA 5FWAA 2AG8A 2ZRJA 3M1AA 3GPIA 5IMSA 1SRQA 2HY7A 3ZNQA 3PWKA 4HPWA 4YV7A 4ML3A 5TVKA 1RLUA 4L4ZA 4YDQA 2W2VA 4EJFA 4LYJA 1TLFA 3CSTA 1V5FA 4J8SA 4RF4A 1UC8A 4OGKA 4GCOA 2OBNA 2G1UA 4PN7A 1HZ4A 3DB2A 4MQFB 1EESA 3E48A 4KO2S 4F8EA 5BNTA 3PSAA 1W8DA 4JJIA 1VB3A 2PE5A 4ZGWA 3UA4A 3KKKA 2H4XA 2JIZA 4H31A 4EJSA 3FTSA 3S8EA 3GVCA 4CM4A 5FWYB 5IWCA 3WIUA 3D5TA 4EFDA 1XZDA 3LPMA 3GLFE 3EN0A 2GPNA 2H2GA 3MTBA 4M88A 3ZUVB 1QKJA 5J63A 1DDGA 3S2YA 2WXLA 4DCGA 5DYYA 5FV4A 2BN4A 1ODFA 3BAFA 1EX1A 3TJRA 2XLCA 3ZV5A 2J3MA 5TMPA 2H7YA 2FO1E 3NONA 2R1ZA 3PL1A 4IHAA 5KJ6A 3DVRX 3HWWA 2F59A 4ZANA 3L4BC 3ZH2A 3PK0A 3UV3A 1FLNA 1N5DA 4R3UC 3AT1A 2QUBA 3ABRB 1P2UA 3AWIA 1UKVY 4F45A 4CW7A 1OAOA 1TZJA 2ZVJA 5F3RA 1ZFNA 3IQFA 5JS6A 4XE0A 3TCXB 4MIOA 5E75A 1UQRA 3C3WA 1MX1A 2J85A 3B2NA 4XLTA 3SG0A 4XVQA 4N03A 2B4KA 2HPHA 1I8TA 2EX1A 2RAUA 3HKBA 1C3JA 1UDCA 2LD4A 2Q3DA 5F4BA 4NBWA 1UQUA 1VMAA 1K9SA 1UMDA 3ZRHA 3JVUA 2C98A 5CUQA 4WA8A 5BORA 3ISTA 3S40A 1XCBA 2VHTA 3AO0B 1OLUA 2R2GA 5KYVA 4G0XA 3PNBA 4ZVKA 3ROEA 3QEMA 5B4UA 1P0PA 4GUDA 2J8SD 1Q1BA 1OCOE 1EK5A 4MCHA 3NJRA 2BCEA 3PNLB 3BRQA 3SEAA 3GVHA 4Y30A 1NJ2A 5F3DA 1PFYA 1RI1A 3U7IA 5AAOA 3KFXA 4GPEA 1M5RA 3R7DA 4H08A 1Z4MA 2Z09A 4EBBA 5I7OA 3KHUA 4Q4HB 2ZPAA 5DJ5A 4KN5A 5L3QB 1TYBE 2RAFA 3JQ7A 2QY9A 1QBGA 4UXHA 2Q0XA 1WXQA 3WRYA 3AYXB 1GZ6A 3QPVA 3E4DA 3LF2A 1C0PA 1A5TA 5JANA 1RACA 1T3HA 4F7AA 1PAQA 3ZHEB 4CMBA 2E87A 1JEAA 4PZ0A 2C5EA 3WICA 4FYPA 4E5SA 5FO0A 3L7CA 1P77A 2QMZA 1IN8A 1JN0A 1YZ3A 1SQFA 4XZ3A 4UI9C 3TQFA 1XMJA 2AR0A 2R8BA 3GWZA 5DF1A 3TL2A 4L23A 3GD7A 2XDYA 1UJNA 4XVUA 1CG6A 4W5TA 2CLIB 2GRMA 3ER9A 1U0EA 1WBBA 3OUTA 4MPTA 4C0MA 5BYKA 3M2TA 1K7CA 1TQ4A 1XNJA 2B7CA 3HKEB 4NNPA 4O1PA 3EMVA 4C4XA 3GJ5A 5KWJA 1AKUA 3SNXA 2QLLA 2ZROA 1UBGA 3M3PA 2VTVA 1P9NA 1QH0A 3LK7A 2O20A 4DNPA 1UBRS 2I9CA 1I9GA 3T5BA 2X3MA 1B8NA 3U3JA 1P2DA 3QQ5A 4M9ZA 4H7HA 1ZOOA 1EFHA 1H4VB 2WJGA 3SC3A 4ENSA 1UBUS 4C7MA 2VDWA 3K9IA 4EG0A 3EIQA 3LT4A 3NBYC 2F55A 2X2OA 3DE7X 1WXXA 1ISGA 4J49A 1K9VF 2CBZA 4YCAA 1FUIA 3GQVA 4POOA 5GJVC 4L1BA 4Q3OA 1BHQ1 6AT1A 3DO6A 3NO4A 3QYPA 3T8KA 4US2R 4W82A 4GUAA 3WK5A 3B5JA 3GLIE 3ZHCA 4CG1A 2PUDA 5C0OE 1PUJA 5JBQA 2HUNA 4EAAA 2PAFA 4ZVSA 1AN9A 2Y4UA 1E3TA 4RV4A 1I5RA 3GYBA 1BC5A 3B9RA 3IBTA 1CY4A 1XRMA 3X1DA 2ZR0A 3DBOB 1J39A 3MW8A 1QKIA 4IHQA 5GONB 1PJQA 4RD6A 1ULBA 4URKA 2PUTA 2VYNA 3TM4A 4IIGA 4BVAA 3TW8A 4TXNA 2O2HA 3K9QO 1ABFA 5FL3A 2O8BB 4PVDA 1YQDA 3DHNA 4NEGA 4E5MA 1XDUA 2D2XA 1RKUA 2CXSA 4JJ7A 4O4LA 3TW0A 4C01A 1E8YA 3W5UA 5AVUA 2PGXA 2VXOA 4WGGA 4A4DA 1QLHA 2AXPA 3QE2A 1H1LB 2G72A 2OFWA 4KN6A 1T9ZA 1YBAA 4ND2A 4B6PA 1MX6A 2J4FA 4QPDA 1AGRA 3F3MA 1U80A 3M6XA 3NEYA 3BKXA 3R7NA 1OXBB 3WNCA 4ZIRB 1UT6A 1VJTA 3RSEG 4MYCA 2X41A 1WCV1 3BXEA 1O6CA 5ICSA 3CH6A 2RC6A 3AF0A 2IYNA 2WU8A 3FH0A 4PNPA 1F0PA 2ZYDA 2P27A 2F8MA 3C3PA 2ANBA 1A2OA 3NB0A 5BV8A 4HDKB 2DG2A 1PQUA 4H7XA 5JZOA 2Z2XA 3GDWA 3TR6A 1Y3HA 4GDMA 5BVHB 3NTQA 5L6MB 4F3CA 2FPIA 3IMCA 3DMFA 1G8PA 3N2ZB 1YD7A 2HDOA 3KQMA 5K3OA 4R2XA 4RANA 3FYSA 3OPYA 1ZCFA 4XQGA 3V4RA 1OF1A 3DPUA 2WAAA 2X6QA 3CX6A 3OCXA 3P45A 5CDFA 3AJAA 4NZZA 4EPXA 3B7RL 5A5VA 2X7JA 4RABA 2C42A 1M83A 2JK1A 2AC7A 4HUQB 4TYMA 1VI2A 2ZIXB 2YC2C 1SVSA 4M1SA 1YASA 3RFUA 1GARA 1T2UA 2YY7A 4ZOLA 4NOLA 4X44A 1WPXA 2VTEA 3SFYA 2JASA 2AVDA 4TKVA 3WIBA 4OA5A 4KVGA 3DULA 1TZMA 5EI5A 2LDBA 4IV0A 2AJBA 4PANA 2KXPC 1X8JA 2V7BA 2PGIA 5C9ZA 3ZEAA 4DCNA 2Q2WA 5AM4A 1P1CA 4Q34A 5BVGA 2Z30A 1D2CA 1U1GA 3N6XA 3FR7A 2A7QA 1QK3A 3RS5A 2NQ8A 3LX4A 2QUZA 3C48A 1CUBA 3P5SA 4GZLA 4PVCA 3A6ZA 2VTDA 5IJZA 1V71A 3HKDB 3HYLA 3T3GA 1JKJB 2Q1TA 2WVIA 3FU5A 5B1DA 4PS7A 2IT1A 3EWAA 1DG9A 4ZQHA 5DHSA 3UPDA 1A7JA 1Y37A 1X9IA 3EY9A 4GXRA 3FNQA 3FLMA 1XDGA 2IZ6A 3ZCUA 1DX6A 2A5JA 3ZTTA 3HGTA 3OU6A 1T43A 3LFTA 4ROTA 4HADA 3VNBA 1JPVA 4AB1A 4P35A 6ADHA 3E2PA 1NVFA 1JAZA 2IYRA 3ZI4A 4N41A 1W7AA 2ODEA 4NH4A 1MN6A 4N5HX 1R4MA 2ZUWA 2V5UA 5CFQA 1BKSB 1KEZA 3WMEA 1U6IA 1SOAA 2JLUA 4JNCA 2VSNA 3ABSB 1KY4A 2JAXA 2WZCA 3FULA 2RGRA 2PQ6A 4PRLA 1SKMA 3QTBA 5DIZA 4TUYA 3SZ3A 5ANRB 1IRXA 2W6JA 4IQ8A 3DMRA 1ZOPA 3DR3A 5K6RA 5HZKA 2GNOA 4P7BA 1EJ2A 3STXA 3FTQA 3H1GA 1H4QA 4TQAA 1I0ZA 4NE9A 4J16C 2BKXA 3PI6A 3GZTB 3NX4A 3EXHA 1A0OA 3WWZA 5BSFA 5I51A 5FJJA 3G68A 3VHXA 2ZETA 3LKVA 5I9NA 4GKBA 1ID8A 3GUHA 1MOSA 1W5FA 4Y6WA 5KTTA 1MVNA 4S05A 4ZTUB 2CUTA 1YDWA 1L5NA 3ZW8A 4KCGA 3C74A 4CT5A 3HB4X 3HXPA 4G97A 1EGHA 2V4UA 1H6CA 2QS9A 4MLDA 1T5HX 4RCZA 4JEIA 4WMLA 3IQIX 4QL3A 4N3CA 2YN4A 1Z0DA 4BFZA 1KU6A 1A3CA 1GTZA 3M8KA 1Y3BE 4X93A 2WJPA 3ZNOA 3G49A 4WWNA 1XP5A 1W5AA 1J8QA 2VNHA 1W96A 1QU3A 4WLVA 3C4QA 1ZX1A 1TJCA 2QWXA 1OAAA 3UCFA 1JR3D 2XTZA 2W48A 3NWBA 3IT0A 4L8GA 2V0CA 1EWVA 5AXDA 2QYJA 5B30A 1W4CA 1KPHA 2YBDA 1P39A 1DEKA 1C8KA 4ARZB 2DPHA 1Z26A 1VLVA 1D9ZA 1A9PA 4B3CA 4BMYA 4QQFA 3AL2A 1S63A 4I1YA 1R8YA 4RYDA 1KI3A 1MT3A 3SMQA 1QWSA 3KJXA 4MROA 4DWWA 5CVUA 5LN1A 4EEXA 1FCHA 3B7UX 2Z5FA 3CIAA 4F6LA 5HQ8A 2AC2A 3PKJA 1MJNA 4LHZA 4MHTA 4DUZB 4R2LA 1N8NA 3LE8A 4D4HA 5GOZA 3EH1A 1X80A 1GSOA 5F33A 3MCTA 2R6DA 4U04A 3NJ8A 2XQJA 5JD4A 5B6JA 3T1TA 5AVOA 2ROQA 4J2HA 4E07A 1KAQA 3NVMB 2F1KA 4GLOA 3ULYA 1UJBA 5KYUB 1NVMB 3VVBA 2CL6X 2IO2C 3PC6A 4Y98A 1MB0A 3PHBE 3GN1A 4U2EA 2PMWB 1UOEA 4J4TA 4PQRA 4G81A 3ILVA 4DMLA 4YJGB 3R3UA 1YFJA 5J90A 1IUPA 4KXMA 1AK9A 3FCCA 4FHFA 1ZBPA 3C41J 1L7AA 5F5LA 1YRWA 2IW1A 3S29A 5CDHA 3JATB 1V7ZA 3T0GA 4WNAA 3Q5DA 4FOPA 4WI1A 4FGZA 3WHLA 1DBVO 2XHZA 3OEED 3H8WA 4RIHA 3R0QA 2DY1A 3QXGA 1QZTA 1U3DA 1VL1A 2CL7X 4WT7A 4CQMB 2ES4A 1I1HA 3C4VA 2FU5C 4B74A 2ZPTX 4G5OA 2H9AA 4HV4A 1C7FA 1YGYA 1H4TA 5HRCA 4N1AA 4R2WA 1QCYA 4B6QA 4QXOA 2HZBA 1GQOA 3B12A 1EDUA 2WTNA 3MS4A 4N0DA 3TI9A 4DR6B 3TWVA 1WRBA 3F7MA 3AUSA 4HZUA 1SQMA 3SYLA 3AX6A 5HQJA 3I2IA 1YB2A 4WNIA 3NHFA 4GPMA 3N2EA 5DGHA 3RV4A 3TDMA 3UOAB 2HGSA 3OQJA 4MR8B 1NULA 1CZUA 4UUCA 3T4UA 1OR8A 2WF8A 1P9WA 3UC5A 3GJ6A 2D54A 4ZTZB 2AXNA 3GA0A 4LF4B 4MRUA 3ICQB 3C45A 3T7CA 1SC1A 4C6HA 4R8KA 5A9SB 4BFSA 2B2CA 3T3PB 3CBGA 4I2ZA 3VAAA 1EYZA 3RRJA 4LWQA 4GU5A 2EIJE 1V47A 1RJ9B 2F48A 3B3FA 4FFPA 4M1EA 3TQOA 1KY2A 1L4MA 2J0UB 1ZBQA 4XH9B 1RZ4A 2PQNA 2XLBA 2A5YB 4QICA 4OLJA 4GPKA 2ONZA 3X44A 3V7YA 2B8WA 1H1TA 3OE1A 2ZAIA 3HCRA 3TX2A 2VF8A 1W1IA 1UKZA 4XJXA 1SQ0A 2KE5A 5CU7A 3DUWA 3LCVB 3AM5A 3TOZA 3R44A 2YS7A 4DCUA 1M34B 3IXLA 3GPLA 3HCPA 1XT6A 4JW1A 2RGDA 1E9BA 1LWOA 3UA3A 4P6VF 2QE7A 4V0QA 3KB6A 3K6SA 2RH4A 4OP2A 1KJWA 3DS8A 3T5GA 2PT9A 3GY0A 5CD9A 2FEZA 2ZR9A 2PT7A 4DCMA 4MITA 1X1QA 2LR0A 2PH1A 1DINA 2EFJA 2QLNA 3R4VA 1KNQA 4ALIA 4MEJA 2P9UG 4DR2B 5U4XA 1TZCA 3G2JA 4Z7NB 1EFVB 4CDMA 3PHLA 3IIEA 2NYUA 3HO1A 4TS9A 3TW4A 5JNSA 1VYVA 5L4SA 3QMVA 1X7YA 3G2WA 4N39A 2NSLA 2XIJA 4AY6A 1YMUA 5AH0A 3U7HB 1KXJA 2HBQA 4RLFA 1PQWA 2FSPA 1G7TA 5DWQA 2QM7A 3L5OA 2VDOB 3AWDA 1KZPA 1U63A 1T8RA 2MSLA 1N57A 2ZKLA 2WD8A 4LTDA 3LT0A 4ZZIA 4D74A 2YHIB 3N6VA 2JC3A 5JNVA 5CB4A 3JASB 3G5TA 2IYZA 4UM9D 1T35A 2IS6A 1Z2PX 3RRUA 3APDA 1KO1A 3LPAA 1WQ1R 4K0RA 3KZMA 1A7KA 4L2YA 3URMA 2JFQA 1ZD4A 1ZNYA 2VQSA 3ESQA 1OXVA 3QEBZ 1NMEA 4ZOAA 3WIOA 3HDQA 4XGIA 2W11A 4ENRA 3ORYA 1D8TA 4MK4A 1NWHA 2AG6A 4Q1BA 4RY9A 3PHJA 1CJTC 5HKKA 3VDQA 1SBTA 1O97D 3U1BA 2PUGA 1U3CA 4MYTA 1W4AA 4O6FA 5FL7A 4LCTA 4NCBA 3AEUB 5C8YB 2GPJA 2NU8A 2QT9A 2WY2D 3OE7D 3Q0TA 3BEEA 2ZI5A 1RZ3A 3CU5A 5DM70 2G76A 2V4MA 3G2NA 3QSYA 3F7NA 4RLQA 4DYVA 3IMEA 1GQFA 2GPSA 2CSXA 2I8CA 5FKJA 4UWFA 5BXYA 1JFFA 3VTFA 3B78A 3CEQA 4JB8A 3GFPA 4JV5B 3EPLA 1ORHA 3BWYA 4RTLA 1XTTA 1JE0A 2V7EA 3QIVA 4EKIA 1WKCA 4UM5A 4QOEA 3OIVA 3APFA 1R12A 2WWVD 1T0PA 1ELOA 1VIVA 4I2VA 1V39A 3C7KA 2PVSA 3ENNA 5DBHX 4UPVA 3PRYA 4HMQA 2DKFA 2W6MA 1XQ6A 2B99A 4R2JA 2I03A 4Y67A 4OTZA 5JJCA 3ESZA 3D9OA 5CDFE 5TIIA 4YRTA 4CM8B 1JIVA 5ABPA 1JLLA 4M7OA 1JKIA 2FCRA 3CVVA 1AMUA 4S2UA 3EQ8A 4RFSA 4TWAA 5TT1A 4NQ0A 1EBUA 4FDLA 4R3NA 4ZCRA 3V4ZA 3HS3A 4BO1A 1AKQA 5JS8A 3EXEA 3WGJA 2ZJ8A 4M1ZA 4DV3B 3UW1A 3I92A 1IH8A 1JNXX 3IVCA 3P9CA 2JCVA 2VZEA 1R0WA 4Y6OA 3R7FA 1U7DA 3AUJB 3QOUA 4L8VA 4BU1A 4ZJZA 3F6EX 4OFZA 821PA 3KYIB 2FJ0A 2DBYA 2WR8A 2CE7A 5L3VA 3RM3A 3P0IA 4C88A 3KYJB 1CVLA 3SYKA 4A27A 3UJ7A 3KHSA 1UXJA 2RHJA 3L0YA 2B35A 4UE2A 2RKBA 1GQQA 5LPNA 1U8UA 3WDLA 1R2QA 4YV2A 1CERA 2EDCA 1NATA 3FGZA 5G3ZA 3LUGA 1U2RA 2PKEA 3DZKA 1DOHA 4MWDA 4KQXA 4B75A 3QEOA 4NOKA 4IGEA 1EUDA 1J7KA 1UKYA 1VHWA 5JVDF 5KNDD 2QVLA 3R5TA 4FONA 1N5LA 5J4LA 1YR7A 3TZ6A 3N0VA 4WLEA 2X23A 3PJGA 3BD6A 1IMJA 1P17A 2PNJA 4DMRA 4OUKX 2VQFB 5D01A 2Q6IA 2OZLA 2JLXA 1E6MA 3LKBA 3P9SA 5H02A 5IVKA 3S6JA 4QWMA 2VT6A 1IONA 2QNIA 4ZO6A 2TS1A 1H65A 2XDWA 1RRMA 2XY4A 2R48A 3I9FA 2R8XA 4LBZA 3PQ8A 3SFTA 4DZZA 2WF7A 4F84A 3PZ1A 1DRUA 1IHOA 1WCYA 1NFIE 3BFVA 2RJ3A 1NRJB 4BWVA 4UJ5A 4Q6BA 5DXJA 4XKBA 2WXIA 4TSKA 5KYXA 1LLCA 3LIPA 1LS6A 3AKCA 1FDTA 1N0HA 4BIMA 3PG5A 1IZ8A 1W3BA 1E8ZA 2VF5X 4RVDA 4EYKA 4OL9A 1K5GA 1NUUA 5CNMA 4FZVA 5LYJA 1JHUA 5JI2E 1FNCA 1RZVA 2Q28A 3E1KA 4MS4A 3OC6A 1M6VA 3F6SA 4XEHA 3F9RA 4M2LA 3UKRG 1K97A 5DYIA 5EYLA 1W0KA 2CNLA 4J94A 3F5DA 2RHLA 2IIVA 1K88A 3R0XA 1MX5A 4Y7DA 3M6MD 4JMLA 1GPH1 1NPYA 2C2OA 2PJDA 3UGTA 3G0OA 5D84A 3ZQ6A 1SH7A 2JFVA 3GMSA 2XNDA 3FOBA 5HZGA 3FZYA 5CLQA 3IBEA 2ZVDA 3BE6A 1ND5A 5FUQA 3EXIB 5JOQA 4BXOA 4AG3A 4KRYA 5KS2A 3OLQA 3OQMA 4U8HA 5HK8A 3KUUA 2W2OA 1I6LA 3STUA 3JQGB 2NZWA 3UJ9A 2YY6A 1W4BA 3KCNA 4HBDA 1Z5PA 4ZEVA 2C4WA 2V7QD 3HO8A 1MIHA 3AR5A 1DWQA 5BOSB 3QFTA 4G9BA 5L8VA 5AVWA 1GGMA 1GL7A 5E6SA 4MKZA 4NNOA 4HXEB 4AJ1A 2ZBFA 3A3YA 3VPFA 1EB8A 4ZT6A 4DCSA 4RHYA 3KSDO 5F51A 3QITA 2Y99A 3KYCB 4B6EA 3DO8A 1N0VC 1GT6A 4M0DA 4EWLA 4XD2A 4MW1A 1QZ3A 5DXAA 4BV8A 1MOPA 1N3LA 1ICIA 4KXUA 3ZDAA 2NXPA 1KVTA 5KNLA 2IZ0A 1YDMA 5DNAA 1OQAA 5DGCA 4BMNA 5HKLA 4L6AA 3QNMA 3TZLA 3M4ZA 2PD6A 1KOGA 2V98A 3G85A 2MSDB 4KMMA 4R41A 1H0KA 2ZYTX 5C18A 1N6PA 4EP1A 2DHDA 3D6AA 4LVNA 4CT0A 2B1GA 1X7WB 4HFGA 1HDIA 3BMXA 4ZYYA 2CNDA 3E9EA 3THXB 1OZ0A 3PPWA 3D8HA 1KHTA 2BEVB 2O3TA 5F12A 2QU7A 1C1YA 1VKZA 4GKVA 1M2JA 2LW7A 3BIXA 1GLVA 3FHOA 5TARA 1OKKD 2A5UA 4BWRA 2FN9A 2ZSFA 1V35A 4UUPA 1BNCA 1BGXT 1KQNA 2JAOA 3LQ4A 5AYWD 4XRRA 1W93A 2W2LD 2OORC 4GNKA 4IVNA 1KNXA 4JP2A 3MTJA 2YDXA 5EZ6B 1IBKB 2BKUA 3TUJC 2QVYX 2NTVA 4AP2A 3KP1A 3MZ0A 1V45E 4IDQA 3KQLA 3P9YA 4URVR 4NU8X 4RMGA 5AK0A 3QA9A 2NO5A 4LBYA 2V03A 4DKXA 1R6TA 1AQYA 2NZYA 3NV7A 3KU4A 4EI9A 3IUPA 621PA 1TNYA 2IOYA 3EF3A 4XYGA 3WWCA 1I3CA 3QX3A 3VTYA 5K3EA 2DPGA 3FUUA 3ONKA 5CEJA 3F6YA 1BPOA 1ZD8A 1VRVA 3T7TA 1NPDA 1T36A 1QKKA 1UC9A 1PDVA 3WAJA 2PWPA 5LQMA 4TMZA 1V8FA 3NBMA 2FQYA 3R7AA 5KBAA 4GXTA 2QZSA 3N2IA 5EKQD 4GX2A 4C7XA 4A0FA 4K6CA 3MKRA 3SR0A 1GWNA 3LT5A 1VKHA 1UZMA 3K72B 1W4RA 1F8XA 1CDEA 1YCDA 2R6AA 2POQX 2PZMA 4IZIA 5JH7B 1ZITA 1QQBA 1UKCA 1L3IA 1UC4B 3IKMB 4YAFA 4YRMA 3QOXA 2HO1A 3CT6A 3VR3A 4ZV4A 3ER6A 2HADA 5ITZF 1Q7TA 1EKXA 3LNTA 1X7GA 5JDCA 5CW1A 4Q9HA 1OI2A 1UBOS 3ONDA 4HLUC 3EZ9A 4A15A 2V4HC 4C89A 1XA4A 2OQRA 2WRZA 2O2GA 4XA8A 1U7TA 3WGNA 3AR4A 3QVWA 2OHVA 1U0GA 2F6RA 4UW9A 3GELA 5ICGA 3LSYA 3EASA 3NHZA 2RGYA 1D3AA 3DLCA 1EJ6A 2XEXA 4GSLA 2YYYA 5DM4A 2DU8A 3WHKA 4ALNA 5M34A 1VI5A 2B3DA 2DECA 5BN5A 3R09A 4KVMA 4JHKA 1C4OA 4ZAGA 5BW4A 1Z0FA 4NJEA 2VBGA 1EP1B 4KE6A 3TQRA 2EV9A 3VU9A 3GO4A 1E1RD 4YV0A 1KRWA 4KE9A 1C50A 1ISPA 5JPDA 1TM4E 4YT5A 1PZHA 3ZVKA 5GGYA 1LC0A 5D0OD 4IIYA 1O1TA 4O2AB 3I8OA 4EGJA 3M4XA 2XMDA 1F2VA 3F6QA 4KVZA 1CUGA 5ALGA 3ADOA 2XMRA 1YR1A 2C9CA 4MZXA 4JVMA 4EF4A 1NBIA 5REQA 5FBRB 2Y2UA 4C9BB 3ABOB 1FP4B 2ZUBA 4OI0A 3ELDA 1EVKA 2WG0A 5FTMA 2HWWA 4F2HA 5H9VA 4U2BA 2RK3A 4WZ6A 2CFIA 3AHFA 4ESEA 2BGNA 4S24A 1JG2A 4HWPA 4YAWA 1UEIA 2I34A 3DKPA 3HYCA 5CG2A 3SC2B 5JQWA 3A1TA 1XI2A 1Q11A 4P4SB 3V1UA 2UKDA 1Z5OA 3CE6A 2LRHA 4UREA 3I04M 4P84A 3EFBA 3H2JA 3FNRA 4CFYA 2G88A 1JLHA 3VR0A 2G1JA 3ZV3A 2GRRB 4MUHA 2JI7A 4L7TA 1H9BA 2XCIA 2AWNA 4DIEA 4LBWA 5EJ7A 1M10A 3E61A 4NMHA 3WJ7A 2QQFA 4EDHA 1Z17A 4CKBB 5FI3A 4JDPA 5ALYA 3J7AC 2Q3FA 3C3XA 4RE5A 1CFJA 5A5DA 1L1RA 4AULA 2KC7A 4MCAA 3MINB 4D0LB 4G0NA 1VSBA 1QFMA 4CG0A 1L1QA 4R98A 3ZJTA 2VO1A 2J09A 1T1RA 2COKA 2C77A 4J8FA 2PX8A 4JWTA 1E2DA 4X6UA 3U0VA 2QRVA 3GT0A 5EFOA 3DSRA 3W9BA 2P0EA 4DMUB 5E8RA 1R5BA 2VDKB 3B9PA 2AE2A 3OMXA 2EFYA 2ONKA 4NIMA 1IYZA 1GYQA 3IULA 3C7AA 1JVBA 1YE5A 1Y5NA 2XE4A 4UUQA 1S02A 2NU9B 1OGIA 2GFQA 3DZ8A 2A0KA 3SLGA 3AG2E 3FA2A 1ESCA 3TG2A 3D9IA 4ND6A 3K6KA 3PUIA 1X7ZB 3BGWA 4XPIA 2MYTA 2XJ4A 1RP1A 3JRXA 5JS1A 1XMOB 3R23A 1K8KG 1DRKA 3D6HA 1T1IA 4BNYA 3BKWA 4CEIB 2HF2A 2REXB 2I6XA 1B6SA 3E4BA 4WUYA 3X1KA 2D5IA 5BSMA 3ED1A 2R86A 2P4HX 2BKKB 1IN5A 4AT1A 2WW8A 3NCHA 5JO9A 4S0XA 1WCIA 4QQ8A 3L5KA 4X24A 3FNBA 3MT0A 4I99A 5TB5A 4DJEC 4JI0B 1CIVA 1BFDA 3SF8A 3K5PA 1YB5A 5HS6A 3DMGA 2UWJG 3HCWA 4JLNA 4KHZA 2I87A 2E2WA 4RPKA 1L8XA 2UUAB 2VRCD 5C34B 1NDHA 1X1AA 3T52A 1K5PA 5J9FA 2HYIC 5EQTA 4L73A 2KCVA 3PENA 1Z6YA 4JBWA 4EVQA 2I4TA 3T5AA 5KC9A 3K1JA 3QI7A 4JLOA 3RRYA 3D9JA 4Y6LA 4OHZA 1S96A 3MCAA 3NMUF 4MWSA 3KDSE 3BRCA 1G20B 4I5DA 5ENRD 2ATIA 1JHMA 3D9NA 1K6IA 2QV7A 3BXZA 4DLXA 1NBMD 1A2BA 3G0CA 4D9KA 2E4AA 4HMOA 3QFFA 3QIAA 3D6UA 3RWMB 1CHDA 4BMOB 2HWUA 3L9TA 4CLEA 2B30A 3J5QB 1U81A 4M21A 3AI3A 3HDGA 1PT6A 4YUWA 5EP4A 1ACJA 4N7JA 3AQ4A 4LDAA 4U8YD 1UK7A 5C7OO 1U4SA 1VL0A 3VGJA 4BMCA 2XW6A 4CYMD 4RK4A 4UAGA 3EIJA 2N9UA 2CNBA 4LOIA 3HY3A 3BRSA 1XRRA 5FOSA 1S2OA 4YX9A 2XR1A 3WKBA 1DRVA 2VL7A 3JRWA 5I9IA 4QTYA 3E30A 4X64B 3DNMA 3MGBA 3H9JA 3S2GA 2MYPA 3D3NA 4YJ2B 2R68A 1MAVA 4HQDA 1OJLA 2BZ0A 3MOGA 1AQUA 1PY1A 3IDAA 2BGGA 5AIBA 4I50F 2E4YA 3R3YA 4GI1A 2EQXA 4FC8A 4BP3A 5HZHA 1PJTA 2WIFA 3DAGA 4AJKA 3PFCA 3CNHA 4DAOA 4C0LA 2Z8XA 3I39X 4UEWA 3DKIA 1RT9A 2VKTA 2VT2A 3S8YA 3NOCD 3AKEA 1NI4B 2XEVA 3CF4A 3GFVA 2O9JA 3UHAA 2XRYA 4OP3A 1LZKA 4I1VA 1N2OA 3NYIA 1M1NA 4RV9A 4MRRA 3AY3A 1QQ5A 3PQ4A 3QFRA 3A6GA 2R6GA 1K63A 3RJVA 1J49A 5LL6P 4L0CA 1VLLA 5AICA 4KFUA 1Q7GA 2C99A 4YP9A 3RKSA 4UBLA 1WHSB 1V3VA 2CW5A 5CNJA 5CT8A 4L51A 4GTOA 4B17A 4DBZA 5JD6A 2AB0A 2I8LA 4BNXA 2ZDGA 3LZ6A 4IJ6A 3OICA 3M49A 2AW3A 1DTEA 1O8CA 4LJ7A 4Q03A 5AW0A 2NYVA 4ALLA 4AAYA 4TZ6A 3KOMA 3JWEA 2ICAA 1LNQA 3Q8LA 3E9CA 1EEXB 3EGDB 1GL6A 1SC9A 2BR4A 1SCQA 2F9MA 3AIOA 3AEKB 2V8BA 1BXKA 3DDHA 3ZXPA 4KVFA 1KDRA 2R66A 2XVZA 3CF2A 1CUWA 1AXGA 2DIWA 3VNAA 2A59A 3TL5A 2OCBA 4EKYA 1ECFA 4BQNA 1FTQA 1N75A 1UOOA 3CO5A 5E1OA 1O96A 3VAZA 2ZWAA 5IKEA 4D9GA 5EYPB 1DQZA 3AFOA 4BVLA 3RTAA 4NACA 3F0TA 2QG4A 3NATA 2O5CA 2HBYA 3BOSA 3MUEA 4UTNA 2P9IG 2O6LA 2C95A 1NMYA 3DZFA 3SD5A 2BE9A 1Z39A 4NMMA 3FRHA 3OUUA 3TD2A 2IPAB 1E61A 2PZIA 4KPGA 4LERA 1SULA 3D81A 4YHBA 4BKOA 3O9VA 3EODA 4YAIA 3HXOA 2WIGA 1QZZA 2V45A 3A6KA 5FQ7A 1ZVJA 2ZIZA 3KSMA 3SHWA 2I0FA 4IJWA 5KSOA 4GGMX 3HCFA 3O21A 3E37A 4TRJA 5A4JA 3ANLA 2NV2B 5A5EA 3H6GA 1RC0A 5IJWA 2O5RA 4OSEA 4W9MC 4WZBB 2WJYA 1D6MA 4X61A 5IC4A 3FSGA 4TV9B 2YHUA 2RHCA 5CA0B 2R7NA 4QEZA 5AVQA 4JBLA 1MT0A 3K94A 2PX3A 3RJ5A 5MF6A 4FDUA 3IO3A 3BSYA 4BGUA 1R15A 1GZSA 3PEUB 1H6OA 2G77B 2FF7A 4HH1A 2LSVA 3SLRA 3OPQA 2GFHA 2H2DA 2BEUA 5IYZA 4CDNA 4QDZA 3B8HA 1KZHA 1S2GA 4YMHA 3O4GA 4W7IA 2JIQA 2HHLA 2V59A 1OA1A 1FSZA 1GNSA 4R1TA 5FOQA 4TWRA 4ZHQB 5A7FA 5FA8A 1R88A 2ZTSA 1B0UA 5IAGA 3LXRA 4QOHA 1KZGB 2H9YA 5CNIA 4LDPA 2YUTA 2HRDA 1ADFA 2QN7A 3Q10A 4A8JA 1PR6A 2C1XA 2VUTA 1UR5A 4BX3A 4DRXB 4NMWA 2O3JA 1CY7A 3PA6A 3K09C 5FR1A 3EEBA 3D2BA 5FI1B 1X87A 1L5LA 5A4AA 3N3AC 4JY7A 4TKMA 4E15A 1YC2A 1B0ZA 2HFKA 1FNDA 2DVMA 3G7SA 4DLWA 4WNCA 1ODKA 3KXKA 2DKNA 3NHUA 3FRIA 5FBQB 4ZYTA 1X94A 4WL0A 1YZTA 3TZCA 3T12A 1O6GA 1D04A 3W2IA 2YJGA 3U62A 2CMKA 1AUPA 5GM2A 5SYNA 4CM6A 4NFHA 1YQGA 1U2VG 4BAGA 3IPCA 1NQUA 2OBFA 4QKQA 2FE1A 4JDUA 2P9TA 3LUFA 4DT1A 1SC6A 3HVJA 3C98A 1POXA 2L69A 3RDPA 5A04A 3ECCA 3TXXA 1WU8A 4B6FA 5TMBA 5TQ0A 3EDQA 1KYQA 2ZQYA 3EBPA 1ZGHA 4JN6B 3CRVA 2V6JA 2YHCA 4DUGD 4RNCA 1Q16A 4AS1A 1JILA 4JFRA 4L3OA 5FLEX 2ZRFA 2VG8A 3BE5A 4KXQA 4F86A 3IXQA 3EPJA 5J2UF 4FZJA 4PFJA 4A3TA 2P68A 4YRBA 5HRAA 1NXQA 1YR9A 3DOJA 3I72A 2PGNA 4JLWA 3CKKA 1QRUA 2LNIA 1AU9A 3AV0B 5CDTA 3P32A 1RLOA 3EVNA 5HK9A 3CSDA 2SCUA 3A4LA 2YNQA 2ZS7A 4CEHA 3ZKJA 1A9QA 3QPAA 3SQOA 3LTEA 3MRTA 3QVMA 2XQGA 2DTXA 4Y1RB 3PRJA 4IH9A 2CHQA 1AF4A 2VJNA 2G4CA 1TADA 3CZCA 3L6DA 3KD3A 3USZA 4CU5A 3UI2A 1J9ZA 1CYDA 2NTJA 3FNGA 2PPVA 1UWLA 3DT9A 4QUJA 3U17A 5M04A 1WZEA 1KIFA 4K2HA 2IY0C 4URUR 5B2ZA 5E6RB 2K7FA 4DQUA 1QDUA 3OXFA 3O0DA 4H35A 1F8YA 4X3PA 1FTYA 1JZTA 2OCGA 3WGGA 3CPSA 4DYHA 1T9DA 2D1QA 5IAKA 4A55A 2O8FB 3N8GA 3GZ4A 2ILRA 2BSAA 5G02A 4EB6A 1SBCA 2X9QA 1APBA 2FMTA 4RM3A 4HN9A 4MARA 4MR9B 3VH1A 2P6OA 1TRKA 4LHSA 3LQFA 2GD0A 2H11A 3NP7A 2QN8A 1WDWB 3NQ41 4MYRA 3FVRA 2GZ2A 4PLWA 1H3FA 1PKXA 4KQHA 4MYDA 4PYLA 2B36A 2ZBUA 2OAQ1 2R1UA 1MO6A 4HDOB 3HJNA 3DHVA 3F74A 2W4MA 3NXSA 1C1XB 1U8FO 2O0JA 3LY9A 2WM3A 3NHAA 1NMZA 3RU7A 2P6RA 3IVGA 3MD9A 4Q1CA 3ZE7A 4PRYA 3VBEA 4ENVA 5KU1A 1HT0A 2XUHA 1D1TA 4D81A 4Q3KA 1SCNE 4QYWA 2RIRA 1QH9A 3CX4A 2QL6A 3UK6A 1U9IA 5LLTA 3B52X 4E1AA 1CUSA 1T2DA 5KTKA 4ZAZA 4YCJA 2NVUA 1CZHA 4BO2A 1IXZA 2GM5A 4JR0A 4YAUA 1OOEA 4EI8A 2PCJA 5DK4A 1SO8A 4OB6A 3PD7A 1O5IA 4ERNA 2PZFA 1X2BA 5H81A 2PUJA 3WWEA 3Q88A 4RESA 4AG6A 1ZNQO 1OI3A 2QLBA 1E9VA 5BSTA 4KFRA 2VH1A 1BGVA 2G9RA 3ASYA 3EU9A 2VP5A 4CN8A 5DGTA 1YZVA 2CXOA 3NWEA 3KLOA 3W6PA 3IIIA 2GROB 1H2YA 1IJKA 5B1YA 1CEQA 3BK2A 3KALA 1NFFA 5DNDA 4JUCA 1DB3A 1NVWQ 3P0RA 5LQDA 1CS4C 2O2IA 2A5DA 8ABPA 4YCLA 3K9BA 5K3BA 2O0MA 2H6HA 1COZA 3AY6A 1GRRA 4YRFA 1JQKA 3LUHA 3U7QA 1LF8A 1QF6A 5FJYA 3BFXA 1ML3A 1X1CA 5IXJA 3DEFA 2AN5A 1NQTA 3WGTA 1PGPA 3EISA 4A9AA 1Z2OX 2A58A 4X97A 4WBNA 3H84A 2GZHA 5C1BA 2NPOA 3LCRA 5A03A 5KWSA 2KATA 3PSHA 1NM5C 5TNXA 2Z6UA 4IMIB 3WGZA 4DJFC 3CUKA 1DAFA 2WE8A 4WFQA 5DTIA 2BP7B 4D8VA 2EFDB 3RTDA 1YS1X 1VHJA 2LPMA 4LJRA 4W63A 4BN0A 1A27A 2I6FA 2X6FA 5FWYA 4ZQFA 3A3PA 3FU3A 1ATZA 3LW7A 3EAQA 3D4BA 4K5AB 3L0SA 4DV6B 5KKNB 3FUHA 4GTMA 5CDGA 2X0KA 4UU0A 3RKVA 3JYPA 3V48A 3BUSA 1YOVB 4MJ7A 3O3CA 4DA0A 3RRNB 2UYGA 2BGJA 3WGKA 1YBHA 3FJYA 3ZUPA 2CF6A 3B6MA 3TI7A 1P0QA 4BP8A 4Z0HO 4YA6A 3AH8A 1OXUA 4GZ6A 2LXLA 3CQCB 5FQOA 2IP2A 3JD1A 2PRIA 3B8EA 2IUFA 3ZQKA 1E2EA 2R0QC 3TYXA 4GZDA 2OFXA 2CY0A 1NNEA 1Q7BA 1DP4A 2P9EA 4OHYA 2XB9A 1V5GA 5AW7A 4TKUB 4GGOA 2J5XA 5EERA 2HMWA 4DA9A 5I47A 2WXHA 3L4SO 3KTFA 2A30A 4EFNA 4DL9A 3ZH9B 2MWMA 1BW9A 1BFUA 1WW3A 2XCCA 3URZA 2HF7A 3VR4A 1W49A 5G0UA 1L5KA 5AKKA 1LDGA 1RADA 2QNBA 4YH1A 3B1XA 3SR4A 4NU6A 1F7UA 3I73A 3RAEC 3V4FA 1LV7A 3PTZA 3V7UA 3QMWA 3R7QA 2FB9A 3PUXA 1XCLA 1V3UA 6REQB 1GAEO 1QPBA 1PWHA 3P4UA 4NE2A 4YVFA 5JWHA 4S1OA 4E85A 2WTBA 3ZWXA 1L4KA 3K5WA 5A9TA 3JR7A 4MKXA 2AS0A 5JSYA 1VECA 4Q4HA 4QAJA 3SDZA 4S1VA 2JEKA 2ECQA 4R71A 4GOOD 4M8KA 4F6RD 2GYVA 1OREA 3OX4A 1YL6A 4RGVA 4GMHA 4KJZA 3C3YA 5SY4A 2GW1A 1R10A 1WDLA 2ODAA 4FE7A 5KB3A 1JQDA 2HHCA 3PNVA 4XB1A 1XMVA 1YULA 4IDEA 1O5OA 3HVUA 1RCTE 2ISQA 4OHPA 2IFTA 4EG8A 5IKMA 4RK5A 2HA0A 1XDDA 2FPUA 1WTCA 2QRGA 4IO1A 3TIXB 3V00A 2PSHA 1WUJS 2IH4A 2C96A 2XEEA 1EFUA 3I1FA 3MXOA 3B85A 2QHXA 3I9V1 3ZVLA 1DZ3A 1G6KA 4HXIA 3D4NA 1EJ0A 1FX1A 3ETHA 1T24A 4FLMA 4XIJA 1MRNA 2Q41A 2YZGA 4AKHA 3WP1B 5IUJC 2MSWA 3HKEA 3OIYA 1YU9A 1UBTS 3ROKA 3FPHA 4B7CA