4I6JA

A ubiquitin ligase-substrate complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
507
structure length
503
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cryptochrome-2
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
total genus 170
structure length 503
sequence length 507
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6jA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6jA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6jA01
1EJ2A 1GPMA 1JHDA 2O8VA 3CVWA 1RQGA 5EKDA 3IMGA 4KPUB 2AZXA 2CV0A 2A1TS 3M5WA 1VLHA 1O94D 4EGAA 5LM3A 2A1UA 2DUMA 1QJCA 3P0JA 1NUPA 3SEZA 1PFWA 2ZUFA 5K0TA 1N75A 4WSOA 1M8FA 2GOYA 1N78A 4MUHA 3MUEA 1IQ0A 1EXDA 1H3NA 2WSIA 3L93A 4MUKA 1ILEA 2J4DA 1G8HA 1JGTA 4AS1A 4MVXA 4MW7A 1IHOA 4QREA 3TQIA 4MUJA 4MW0A 3KT6A 1JECA 1J09A 3TQOA 2RD2A 1V8FA 1GAXA 2A84A 3X1JA 4G6ZA 4F4HA 1H3EA 3S3TA 1O96A 3QE4A 2R5WA 1O95C 4U63A 3FOCA 2WQ6A 2QTRA 3CVUA 4MWBA 4I6JA 1KQNA 2B7LA 3CLSC 3FHJA 4OUDB 1EUQA 1EFVA 2YY5A 4PBSA 1NYLA 3ZXIA 2A1TR 2QUJA 3IVCA 3TS1A 2RE8A 1X8XA 4GU5A 2A7XA 3U1VA 1F4LA 4WNYA 1I6MA 3RK0A 4K0RA 3KFLA 1MAUA 3HFJA 1M8PA 1K4MA 1XJQA 2PZ8A 4ZCSA 1Q19A 1ZJWA 2DEUA 3A05A 3H9CA 3AG6A 3N2YA 4XFJA 3L92A 3IMCA 4MWCA 1EUYA 1U3CA 4NATA 3ILVA 3A2KA 4DDKA 3PNBA 4S1OA 3TZEA 3PNYA 4G5YA 3NV7A 3ZJTA 2HGZA 4Q93A 3SP1A 1R6UA 1EFPA 1LI7A 1VL2A 4EF6A 1YUMA 3ZIUA 3CLRD 2JANA 1ZH0A 2E0IA 1X6VA 2QUIA 2DERA 1I6LA 1O5TA 4MW9A 5KHAA 1U3DA 4HK4A 5H7XA 2ZUEA 4GRIA 4MWDA 4U8HA 5LFAA 3COZA 3SYTA 1R6XA 2CT8A 4EG5A 5FO1A 1N3LA 2V0GA 5F23A 1OWNA 1U7XA 2DPLA 3CLUC 4JXXA 1A8HA 3OP1A 2J07A 2ZP1A 2QJOA 1S4MA 4H3SA 5FNZA 3COWA 3IVGA 3IDFA 4MVYA 3IOEA 2VTBB 5DASA 2J5BA 3IVXA 3CLUD 1WXIA 1PFYA 3DPIA 4MW6A 2A4MA 1NUSA 4ZCTA 1M8JA 4HPWA 2IELA 4UZFA 1N2BA 5H16A 1IRXA 1JMVA 2CYBA 1Q15A 2E89A 2EJCA 4MUIA 1TYBE 3FY4A 2J08A 2CUZA 4KR6A 1M8GA 3D6VA 2A1UB 3FETA 3CR8A 1ZH6A 4J76A 3A4IA 1WXFA 5FO0A 1QRTA 1O94C 1Y42X 1VBNA 1JIKA 3KT3A 3JXEA 1KAMA 5DK4A 1MB2A 1XNHA 4QRDA 4XFDA 2D13A 3Q10A 1J21A 3H05A 3ISJA 1GZUA 2Z08A 4ZT3A 2PIDA 1G8GA 3RJZA 4MUNA 1IVSA 1I2DA 1U7DA 2CV2A 4L2IA 2CV1A 3HV0A 3UC5A 3HL4A 1Q77A 4NZPA 2X1MA 4RPIA 2A86A 3OTWA 3AG5A 4BWVA 1O96B 1IQRA 4ZT6A 1N1DA 4ARIA 3KT0A 2O5RA 2PZBA 2HMAA 3Q12A 1N2JA 1M8KA 2PFSA 4EFKA 3ELBA 1JZSA 4ND6A 3GUZA 2CYAA 3P0IA 1MBZA 3IUEA 1ZUNA 1BS2A 1IFXA 4JZYA 3CVVA 2QJFA 4JXZA 2YXNA 3NBAA 4OJMX 3IUBA 1GTSA 1M83A 1QU2A 1OBCA 4MW1A 5HG0A 2DETA 2QTNA 1MC1A 1U0BB 1OWPA 1H1TA 1O0BA 1QRUA 3G59A 2Z3VA 3FIUA 1O0CA 4CQNA 2HZ7A 4JYZA 3HGMA 1T6YA 2H2AA 1QNFA 3PNVA 1K97A 1B6TA 4KPUA 3MLBA 3HMQA 4HJXA 4P2BA 3FWKA 1EFPB 4MULA 1KP2A 1COZA 1TQ8A 1MJHA 4MUFA 1F7UA 3LE8A 5K0SA 4CDNA 3AKZA 2A88A 1KH2A 1PFVA 1K4KA 3BL5A 3DLAA 1XNJA 1NUQA 3D6UA 1KKUA 3CLRC 4HJRA 4MLPA 1JEDA 1KORA 2DR2A 2EL7A 1GTRA 2AKEA 4MW4A 5J58A 4UZEA 3TZLA 3ND6A 1MB9A 3K32A 4YMIA 3IMEA 4EG7A 4J75A 1WXGA 3KT8A 4K03A 1TYAE 2YWCA 4TS1A 4R2MA 4YBRA 1QQTA 4ZCQA 1O6BA 3X1MA 2G36A 1QRSA 4ARCA 2GM3A 3FI0A 2CSXA 4YP5A 3VRHA 3IODA 1JEEA 1J1ZA 4CT0A 4Q16A 1NI5A 1VBMA 3SDBA 4ZT5A 1N2EA 1G8FA 1YULA 1N2GA 4RUKA 2QUKA 5J5AA 3CLTC 1DNPA 3LCJA 3N8HA 4KR7A 2JAXA 1OWLA 5TEVA 1GN8A 3FH0A 2XRZA 1GLNA 4AQ7A 1FFYA 1OD6A 5J59A 1F7VA 3UY4A 1NUTA 3CLTD 4MUEA 3ZJUA 3ND5A 1ULHA 5KWVA 4DNXA 1KQOA 3AIIA 4R0NA 1YIDA 4NAHA 1WXHA 2C5SA 1JILA 4MW2A 4ZT7A 4I6EA 1NURA 3NBKA 1O97D 1M1ZA 1TFUA 3IOCA 1LI5A 4DDHA 2QUHA 3CVXA 4MWEA 1Q11A 1KH1A 2X0KA 3AFHA 3DO8A 3P0HA 4MVWA 1J1UA 1N2OA 4EG1A 2YWBA 4ZT2A 4I6GA 4YP7A 4YP6A 3UOWA 2BTEA 1PFUA 1YUNA 1IQUA 1EFVB 4MVCA 3VGJA 4NDAA 2D54A 3X1KA 2QTMA 3ND7A 3SZGA 5IJXA 3COYA 1WXEA 1KH3A 3FNRA 1VBKA 1MRZA 2NSYA 2X3FA 1N77A 2E18A 3GMIA 2Z09A 3TNJA 1NP7A 1UFVA 3COVA 2VXOA 1WZ2A 1KAQA 4ND7A 1J20A 4DDMA 2NZ2A 1KP3A 4QBTA 3PRHA 2JA2A 1NUUA 1MOPA 2WB2A 1CT9A 1N2HA 1NSYA 2X1LA 3VU8A 3IH5A 1T6XA 2PG3A 3CA8A 2H29A 1TEZA 5LLTA 3F3MA 1NZJA 3FDXA 3SZ3A 3MMXA 1WY5A 2WQ7A 3N9IA 4ZCPA 4EG6A 3N05A 2BYTA 5TEWA 3ZGZA 4EG8A 1I6KA 2E21A 2V0CA 1SURA 3G5AA 3H97A 4U7JA 5TGTA 3DV2A 2TS1A 3ZXSA 4X0EA 1O95D 2GKSA 1G59A 4XSVA 1FYDA 1H3FA 3IOBA 4ZT4A 3RHSA 5HUHA 2PXHA 3CLSD 4EG3A 3H9BA 3G6KA 3UMVA 1KQPA 1WOYA 3QTBA 2J09A 1T9GS 4DLPA 4E1AA 1YI8A 5KCMA 3QTTA 2D5BA 4OUDA 2CFOA 1WQ3A 1IH8A 1J70A 4NX2A 2DXIA 5AHWA 1PG2A 5BNZA 4DJAA 1XNGA 4KKVA 1KR2A 1OBHA 3MLAA 3P52A 2OV4A 4EG4A 1MAWA 3CVYA 1QTQA 1N2IA 4G5FA 3I05A 2IP1A 3UK2A 1OWOA 2CYCA 2IJGX 3K9WA 4KR9A 2QJTA 1F9AA 4DE5A 1D2RA 4PBTA 3ZUGA 3H99A 2DLCX 4L2IB 1JIJA 4MQ6A 5IHXA 3C8ZA 1HYBA 2PZAA 4F3RA 4CDMA 1WJGA 4MW5A 3RBAA 1O97C 5TS2A 3MXTA 3GLVA 1EE1A 3A04A 2I1LA 3Q4GA 3RK1A 5HUJA 3ZJVA 2AG6A 1YIAA 4PBRA 3LOQA 1R6TA 4ZCRA 4R2LA 1T6ZA 3E27A 3PXUA 1JIIA 1T9GR 1WQ4A 3FG9A 1JZQA 3AL0C 3HZRA 4MAFA 1P7PA 4FZJA 1V47A 2OQ2A 2XRYA 5DEOA 4JFAA 4MUGA 4PY2A 1PG0A 5DB4A 1QU3A 3INNA 1TYCA 1LW7A 1TYDE 3SEQA 1OWMA 2VTBA 1K92A 5JBNA 3RFFA 1WKBA 4A91A 4NAUA
chains in the Genus database with same CATH superfamily
1B3RA 3IR7A 2BN4A 1NUHA 3C3QA 3HO1A 4DM7A 1YQDA 3X1YA 5IJ0A 2C54A 2XEVA 5AIBA 1SG0A 1A9XB 2O59A 3ZRHA 5JNLA 2FPKA 1HLGA 4MW0A 5H3HA 3SC2B 3PP8A 3HZZA 3DVAB 1H2XA 1JHYA 4FCVA 3FYDA 3MS4A 1WHSA 4JHRA 4MWBA 1BHJA 4HT3B 1SCKA 1CV2A 2FWMX 3KX2A 4H3HB 3HJTA 4JT8A 4GU5A 1CUFA 2FSGA 4HOYA 4TV8A 3MCZA 4W5RA 3QNMA 2AL7A 1S3FA 4IF6A 1J2RA 5DT2A 1SVUA 3IQFA 4Y1FA 4D44A 3QEMB 2Q4TA 5A4JA 4GMRA 2HFKA 4KK3A 1R6XA 3UJ6A 4KQMA 2H57A 2X5OA 5HKAA 3EPLA 1GPNA 4DA6A 4PXAA 3LLMA 1L8QA 3ZWQA 5EKSA 2ZM6B 1QHYA 1N1MA 3NVAA 1K27A 3I01A 4BLTA 4RDCA 2CNDA 1TYBE 4Z3OA 4BKOA 1ZH6A 2PSEA 1U9IA 2JI9A 5DMXA 3I83A 4GPD1 4IFTA 4CGVA 3F4BA 3OE1A 4LRSB 1P19A 4EYEA 3T3OA 1PLJA 2ZVPX 5CBPB 5I7UA 3FTCA 1CUSA 2V8BA 4TM8A 2CV2A 3OHPA 3P9XA 4KI0A 2D2FA 4LGVA 1TU4A 1W85B 2ZWVA 2ODPA 2RB5A 1TRKA 1P75A 1PV2A 1CJBA 4GHWA 5BVHA 5FFMA 1F48A 1QU2A 3K4PA 2JBAA 4NBVA 3QTLA 1H1TA 4GWGA 1YJBA 1T2VA 1XTZA 2I7XA 4H77A 3WIUA 1PJLA 1QO9A 4Z0HO 5ES3A 2KI5A 1U1EA 3GAFA 4YQEA 3V5NA 4ENSA 1GITA 3QUSA 4WESA 5FT9A 5K9ZA 3AT1A 1IMOA 2FKNA 2GJKA 1VJ1A 1EEXB 4MWGA 5DGTA 4AJJA 4ZANA 1V3QE 3WKAA 1JS1X 1VMEA 3FJ1A 5LJIA 4Q9NA 2P27A 3SQVA 2BGLA 2K6GA 4GC9A 3OVMA 4GXNA 4XWKA 2YQ5A 5BWOA 3W9GA 2VPXA 3UGKA 2VYND 3R5HA 3CRZA 5HCNA 5KJEA 3UMCA 3GHHA 1JQLB 1U1DA 1VB5A 5JNWA 4X61A 1NR5A 4Q94A 2ZTLA 2WBLC 3FOZA 1IAVA 3WMXA 3KL4A 4YLEA 3B9PA 4JJKA 1SUPA 2C7RA 3CLHA 1NF8A 3DCJA 4D6XA 1E9BA 4LYEA 4QJ4A 5EAIA 2ECKA 2BFDA 3RJMA 1U2VG 1TCVA 3D3WB 1EFVB 4EBAA 1BFUA 3VM6A 1C7EA 5INTA 4TWIA 3GGDA 4MYCA 1QTRA 3FGZA 2X22A 2QGFA 2O0HA 1FBNA 3SQLA 2FMHA 4XA8A 5EIBE 3HCPA 1BYIA 1D8EA 3IUMA 3CSDA 1R6BX 3UQ3A 1P0QA 5IZCC 3I30X 2Y1GA 5MN6A 2ZGGA 3TD9A 2XEEA 5ELMA 2Y71A 3G8DA 4N6OA 2ZBUA 1Y3BE 2OOKA 4IJKA 4MKTA 1KGSA 3RAFC 3IAXA 4MR9A 5KDOA 5JNUA 1FFBA 3HA7A 4KYIB 4ESOA 1T9GS 1ZQ1A 2DR3A 4UWLA 2R2AA 1QM5A 1L4NA 1VHDA 2BHSA 1IH8A 1VG9B 4EAQA 1YBFA 3WTBA 3O38A 3PI7A 5AVSA 3CTPA 3Q98A 2J7KA 5DYIA 3LCMA 4KO3S 3K1AB 3LOUA 2AG1A 3ESQA 3TQTA 3DF7A 4URFA 1U6JA 3BGWA 4GDMA 2HJGA 3AUUA 3HEBA 1E9AA 3NBUA 3GLGE 2G8NA 2H1LA 2PZEA 4JJZA 1YR1A 1T4BA 4BUCA 2P65A 2W11A 4GTSA 3LWDA 3E22A 3IE0A 1VTKA 4BP8A 5HK8A 2G5TA 3KXPA 3BT7A 2OD9A 4P7FA 3C5CA 5DLPA 5MF6A 1EAMA 2WQHA 1ZD3A 4H0FA 2HSZA 4CYMD 3RANA 3QFRA 2WB4A 5DX0A 1D0VA 4NIKA 3R3XA 2A84A 1I7PA 1YONA 2V6JA 4HC4A 1IK6A 2JATA 4OUDB 5GJWC 4ILKA 2H4HA 1XBTA 3GYGA 2WILA 3TKYA 2IU4A 4LE0A 5DBHX 5ANRB 3V4ZA 4U00A 3KHUA 2XE7A 5BNIA 5DGCA 5D2CA 2XCOA 4OXXA 5J5CA 5LQUA 3NHAA 2B69A 3COZA 9GPBA 1GT6A 1VPLA 4BZZA 2HPVA 2YY7A 1RNLA 2QTFA 1WXIA 3O4IA 2I2DA 2Q0QA 3BXPA 1M8JA 2AS0A 3WADA 2GWRA 3S8MA 3NAZA 5EHGA 1MQAA 5BOSA 1DWPA 5F2EA 1H8EA 1E7VA 3Q15C 1OZAA 4KVZA 1QCYA 4M2LA 6REQA 3V2IA 2HWKA 2UYCA 3FYUA 4AKSA 1IVSA 5F4ZA 1MFPA 3EXIB 4ZDIA 3RAPR 1ZNZA 1E2IA 4WD3A 4ZO9A 2ZT5A 1UFOA 2A7QA 4UOZA 1D4OA 1T15A 1PSZA 2MOKA 2Q99A 2NSHA 3A6GA 2E1PA 2DRIA 3TIGA 4AJ4A 4TL9A 5KKAA 2X4IA 4N03A 1QSGA 2NU7A 1YZNA 1Y33E 4JLDA 3BUAA 3B20A 2DBRA 3E7FA 3DMFA 2XMZA 3W1EA 5KVAA 4CUJA 1ZM7A 3KT8A 3WICA 4RLFA 4PNEA 1GKUB 2CMDA 3EWIA 1AS0A 4QTZA 4JUIA 4UBMA 2VTDA 2LW7A 5DM4A 4EW1A 2LWIA 3ZWYA 3TPCA 1XZBA 5EE1A 1H2TC 5LBTA 3OT1A 2VJYA 2R6CA 4IDPA 1GCGA 4BN0A 3P2YA 2XPZA 1CQJB 4LHYA 1AKYA 2DAPA 3WYAA 4HWKA 1ZUHA 1SUWA 3CU5A 2Q2QA 4MWEA 3PCTA 4JI5B 3UV6A 3PQ6A 2REQB 5JISA 5I9LA 1EDDA 4WFKA 2DH5A 2Z09A 1U2RA 5CIYA 4W5WA 3UWKA 2C8LA 2D1YA 1JBKA 4C7OA 2Q4EA 3TAUA 2YZMA 5A6SA 4G86A 2FEOA 3A3YA 5DK6A 1XLVA 1HWYA 2CZCA 3VNRA 3PVZA 1PZEA 2DGDA 1E1YA 4H59A 3A4VA 2C20A 4ZAGA 1C1DB 1CLUA 1U0NA 3KLPX 4R1OA 2YOGA 4FYWA 4M83A 5H9WA 2XDQA 2PU7A 4K2HA 1ZWLA 3BAZA 4FFMA 4YV2A 3OHMA 3JAWB 1W6RA 3O9VA 1NBMD 4IJVA 4RDHA 4CIVA 3E2PA 1W7AA 1M6YA 2H1IA 3E9QA 3IESA 3IJPA 2GNAA 3P4YA 4K5AB 1WEKA 2AOTA 4Y0AA 5ALWA 4O4HF 5KOIA 1JIJA 4UUAA 3TCXB 2PUFA 1MW9X 3LQ4A 3ESZA 4MQFA 4EENA 1CIVA 3LK6A 3AJEA 3H5NA 3PD0A 5H5JA 3HO8A 4EG0A 3B6MA 2NGRA 1CUAA 1OWMA 1HH4A 4WH0A 3WLPA 4EHBA 1JHDA 4NCHA 1XZCA 4GUAA 4EPVA 3AEKA 4IV5A 4U04A 2VDVE 3VHXA 3OCJA 2J30A 3W2IA 4FXPA 2V7EA 3L93A 4Q1BA 1MAVA 4DUGD 1QHFA 2V98A 3E7DA 1P3Y1 3U49A 3B7PA 3NF1A 2AVDA 2B4TO 4OHPA 2ZJ7A 4JV5B 5K3OA 3VA7A 4NOJA 4R81A 3S29A 1L4UA 2HOQA 4E5MA 4DYVA 1UBOS 3RM3A 3FWYA 2Y1OA 3EOAI 1KZHA 5DIFA 3DE1X 4CLOB 4KUHA 4X9XA 3BKWA 4KMRA 2WPVA 3GZJA 1LLUA 4YC7A 1BCSB 4S2EA 4PAQA 1LW6E 3A28A 1CQXA 3V80A 1ESDA 1LI7A 2JVIA 3S70A 3DDUA 2IYXA 3HJRA 3Q3GE 1H05A 2QE7A 5AM4A 4KUEA 4KV9A 4IR7A 1SUBA 1FUUA 4O0MA 4LHEA 2WPNA 4DLAA 2A30A 4YAUA 5ITWA 3K2QA 1Z5SC 3LC7O 4UQOA 1Q1GA 3NJRA 4LHXA 4US1R 1SA4A 2P0EA 3I1YA 1EUCA 4BO4A 3T15A 3FTXA 5FO0A 2VXCA 1UJ4A 1H6OA 5DK4A 4FFBB 4G37A 4CTMA 3GEDA 2PR7A 1NYQA 3KUUA 3FNBA 2A94A 2O1XA 5DCYA 1DAOA 3DE3X 5KO2A 1BHQ1 3BRCA 2VGEA 1G7CA 2J3KA 3UB4A 4Z4QA 4DIMA 3RF7A 1WZIA 3PVCA 3RNOA 4HTFB 3FIUA 1G63A 5DSZA 3VNBA 2EEZA 1JLHA 1T5TA 2Y68A 2XIJA 4B33A 5L4SA 5IEBA 1OLUB 3OSZA 3CB2A 3AONB 5DPMA 4RHYA 3AUTA 2Z2YA 3QFSA 3S2GA 2BZ0A 4TROA 4J7CA 1NX6A 3GZ1A 2QKYA 2W2LA 4Q4AB 4M1OA 3ZWXA 1T10A 1Y8RA 1YRYE 2XNCA 3ENNA 3IIKA 4QXRA 2WWVD 1YL6A 4MYHA 1UIMA 3FF4A 4WXPA 2K7FA 1TYEB 1L4MA 1T0JB 2G3YA 2NXNA 3JRWA 3CH6A 1DWQA 2HTFA 3ZHTA 1BWRA 3MTBA 3L7OA 1R16A 5A3VA 4I6EA 1G6HA 1P5FA 4RZ2A 1O95A 3Q9LA 1QFMA 2M6LA 5TQJA 4QECA 2EJBA 2GAOA 3JWHA 4URHA 4DILA 4I6GA 4YP6A 5JHBA 1PR0A 5SZIA 1PL7A 2GAIA 3IT3A 2D0IA 4UQYA 1M5TA 2IBSA 3QI7A 4XM0A 1N77A 5DI3A 5IWAB 1HC7A 1TNDA 1OU0A 4XGNA 1FFCA 4D6YA 4PS7A 4H27A 3VR5D 5KS2A 1Y0BA 5CDGA 1GO2A 3WY9A 5LVAA 4DJTA 1CUEA 4ND5A 1HY3A 3ER8A 4V0MA 4FQ7A 1K6MA 5TVKA 3K09A 4QKQA 4UWGA 1ELKA 4LSWA 5FLXA 4BX8A 3ASFA 1IJEA 4KN8A 1E4YA 4BVJA 3TL6A 1NZDA 1KFCB 1MGOA 3CPJB 1G8KA 1JEQB 4EHNA 3K9WA 1WUJS 2H48A 5BWNA 4MQ6A 2XGSA 2ILVA 3M89A 4BXOB 4UBNA 3OTIA 2HV8A 4CHGA 2V4LA 3SM3A 2ZCJA 2F3PA 3E6AA 1YMQA 2IA5A 4GA2A 2UY1B 4RJ2A 1XCJA 4MWSA 1DFHA 4L7QA 2A1TS 3BGVA 4PLPA 4GR4A 4CNBA 1EVZA 1ZGBA 2EKDA 4U8VD 4TZTA 1HG5A 2B5WA 2H6HA 1XZAA 4Q1CA 4HWTA 2YWDA 3D8TA 1H3NA 3E58A 3FNFA 2HHJA 1TJNA 4WNEA 4HGNA 1A5BB 2V5AA 4Q4DA 4BNUA 2HREA 2Y1KA 2Q3HA 4JCOA 1F12A 5LN1A 5FH9A 4ZCMA 1XAGA 3TNLA 1QYMA 1OZGA 4NESA 2O8DB 3ZHEA 4QA9A 1ATZA 3SXUA 5AT1A 4TV8F 2H2FA 1Z5ZA 4ZRNA 2VT2A 1DTEA 5AYWD 4MI3A 1GP2A 3PWTA 4KREA 4I43A 4M8NE 3IHTA 3ZYLA 5HCUA 2QU7A 2P1RA 2CWDA 1P2FA 2EKZA 3A6FA 3FSRA 3OBBA 2J0SA 3X43A 3IVGA 1ZH8A 2GETA 5F2KA 4A23A 3AESA 3FWNA 4KUGA 5KJ1A 2BTDA 4I4IA 1TT5B 4BLUA 4H4EA 4W5TA 4CEJB 3AU5A 4OQZA 1FT2A 3O2QB 3N8DA 4TYNA 5L6MB 3OT4A 4DR5B 1G6Q1 2VUSA 3CE9A 1MZPA 4GT1A 1ODJA 5LJLA 3AHFA 2N3ZA 4M8KA 3F49S 3IVRA 1J8YF 1HG1A 1PE0A 4XH9B 1U8CB 2ZIGA 3ZK9A 3SEAA 3RVLA 4P31A 2FVXA 3IT1A 3D81A 2DHCA 3BD7A 1V41E 4N65A 2V45A 4JQSA 1VLMA 5M34A 4RQTA 3QUQA 3DEKA 4U5XA 1CNMA 3CINA 2ZITA 2IIVA 3PA6A 1JXAA 3GQVA 1JFRA 1VYTA 2YVKA 5C1OA 3N2GB 2BWJA 1D2GA 2OHOA 2XCSB 4U2KA 3WISA 5IJAA 5KJMA 3OE5A 5EUBA 3ER9A 3RRFA 2ZCUA 4QASA 2X1HA 2X76A 4BN5A 3APFA 2PLRA 4G81A 3LCJA 2WTNA 2WNHA 4GKVA 2C2MA 2P11A 4TLMB 5G3YA 4IY1A 3CKLA 3GDHA 1E4EB 3GZNB 1UBFA 1FFDA 3T12A 3OPYA 1XTKA 2QVXX 2IU3A 4U8YD 1DG1G 4FU0A 3GG9A 4PYMA 3CCBA 3KQUA 2BCGY 5FTMA 4J6FA 2JH3A 2OBBA 2J32A 2ACVA 5CM8B 4YFYA 2RKBA 1VMKA 4UTXA 5G55A 5IUKC 2QUZA 4C0HA 4O1PA 3BXGA 2VPIA 4L50A 4XARA 5IFLA 4O4LA 4F1SA 1QO0D 3HDYA 1MX2A 3TRHA 3I9LA 5AJHA 4ANUA 2FULA 4B6RA 1DRKA 3WKCA 3E37A 5G02A 4O2RA 3A7DA 2FLWA 1GFIA 2J0EA 4OY3A 2H5IA 4IH9A 1GPAA 3FBGA 2DY0A 2YZ7A 2F8YA 3D3EA 4UPDA 3ZW9A 1BC5A 4NZ9A 2HU2A 1DJLA 1PQPA 3EUFA 1KQPA 3OF2A 3VV2A 1FXUA 4IQFA 2IXEA 1Z7YA 5LMZA 2P9UG 1Z6XA 4F92B 5D66A 3N2IA 2E4UA 1LBTA 2GS9A 1JE0A 5FA8A 3G0BA 1ZKMA 1VPWA 4F3RA 2Z8XA 3E9EA 4A73A 4TVSA 4L5AA 2RI0A 4DJFC 3EW7A 2WMNA 3AHGA 1HDCA 2OCGA 4Q34A 1ADBA 3LYHA 2RHWA 4TMZA 3CCCA 1IQPA 1YRWA 4M7OA 4Q66C 2PWPA 3VPXA 5DHPA 4IZOA 5BSGA 1TMOA 3CKBA 4LXXA 1KJQA 1FYWA 5B55A 4PSAA 2CUTA 1P62B 1OYOA 1P0PA 4JK3A 2EYUA 4WBXC 4CZ2A 4AN0A 2DE0X 1Z2AA 3K15A 1OFVA 3D6NB 2EBUA 3D9KA 1G2PA 1HZJA 2GEBA 4HZUB 3ESCA 2QPOA 4F4HA 2EL9A 3SJ7A 2YJTD 4OIFA 3WGQA 2AB0A 3L08A 4NCBA 4MDYA 5C53B 4MWOA 3BXZA 1T1JA 1XJQA 3L8MA 1UK7A 1RIIA 2ASEA 4UULA 3SAJA 1RJWA 2AFIB 3T6KA 4KVGA 4S2UA 5CITA 2ZUEA 2ZETA 1ZK4A 5BYBA 1X9GA 5TQVA 3MJVA 4HUQA 2YIJA 1YFJA 2ORED 1NY6A 4DR3B 4YCDA 4Q21A 5IANA 5I8WA 1ECCA 3B89A 3CRNA 5DTJA 2C84A 1KFJB 3TMYA 4E21A 2VP4A 1M2VA 2AH5A 4PCVA 1CW2B 3VISA 3I04M 2E9SA 1XHFA 1TK2A 2JZNA 4UEQA 1A4IA 4BYGA 1H4VB 3M4YA 2BF0X 1Q7CA 4HWOA 1IN7A 4DADA 3UC5A 1GZ3A 2Q1UA 5EERA 2P62A 4FHKA 1VP9A 3X1XA 4NE9A 1G20B 2G1JA 1NBMA 3R3VA 2R8YA 3HVJA 2BMFA 1KFKB 2QYUA 1IZ0A 5SY9A 4Q82A 3JATA 1CY1A 4OL9A 3W9FA 4LSZA 1E6KA 4HOTA 5A23A 2CDNA 3PDHA 5E38A 3V8NA 5KYXB 1H4TA 1N9GA 5B58T 2CFUA 1PJTA 1JDBC 2R3SA 4GGOA 1VE5A 2KZTB 3TSWA 4MUFA 4H35A 1NL4A 2OILA 3AKZA 3VBCA 1M73E 1KDOA 3ZY4A 3KOWA 3Q8WA 3DEYX 4OAPA 3WXBA 5I7EA 3OZXA 4IUCS 4UPEA 3LW8A 1OFGA 1GR0A 3ST7A 3VR0A 1Z38A 4A8JB 5FEMA 1AUVA 4DJDC 5D87A 4WMLA 4R1NA 5BT1A 4KAAA 5FOWA 2VTVA 1Q0QA 3Q0IA 4D4JA 1JA0A 2R6AA 2PY6A 4TQUS 4DUGA 1P7YA 4ZAVA 2P30A 2WYUA 4LY0A 3QOYA 3TTUA 2GCPA 1JAHA 3C39A 4OLBA 1CDDA 1QVAA 4TUYA 4OFWA 2A9OA 3IV7A 2R2GA 5B7PA 2GEKA 4Q48A 4E5NA 2XR1A 5IF3A 3AVYA 2NUPA 4DLUA 3PGA1 2VK8A 5D00A 2PT9A 3K8ZA 3NASA 3VZRA 3EC2A 1U3UA 1LQTA 1DIHA 2D74A 4YRIA 3T4XA 1DC6A 4ON9A 1DUVG 2ZSFA 1T1GA 4DV6B 3F9CA 2ORVA 4HTAA 3RSGA 1YS9A 1GSHA 3IAM6 4D56A 4FR0A 4QYWA 1Y9AA 4CG2A 3HI4A 1PW7A 4Z99A 1C0EA 4UATA 2Z57A 3NIFB 2RJNA 2CXRA 4ZWNA 3IAS1 1P1RA 5HKOA 4MS1A 4PXYA 5IASA 5F73A 3L0BA 4N5DA 1G59A 4Q7KA 1SHUX 1KDVA 3AR3A 3S5UA 5K3BA 2Q3CA 3PPXA 1A97A 3CMMA 1OBHA 3MLAA 1V6CA 1EP1B 3V42A 3GUUA 1Z2EA 1D8DA 4NULA 4FJYA 3JQ7A 2ID4A 2F9FA 1F9AA 3UFXA 3C3XA 5F9HA 2MINA 1NVMB 3FTSA 1MN6A 4J4TA 1U8TA 1NIJA 4JJIA 1P8JA 3RUFA 2X86A 3C8DA 4BVFA 1JEYB 1KPGA 3KEAA 3HZRA 3PR3A 1T4MA 2IE8A 1IMJA 3HADA 3E1SA 4RQUA 2WM2A 1ZSVA 3N1UA 5CHEE 1C9EA 1WP9A 2A1UA 1IVNA 1JJVA 4Q01A 1BFKA 1FMLA 5DEIA 4O5OA 3Q6IA 2KC7A 2XT6A 1AQYA 1GSOA 4LECA 1RZ4A 3DAOA 3ZU5A 3IP8A 3GPLA 3VPFA 1D5WA 2O2ZA 5IN4A 1F2UA 4AMZA 2C82A 1JPVA 4BO0A 5IX8A 3OLZA 2NU6B 3CEMA 2R5WA 1DKLA 5FV7A 3F2VA 2ECOA 4JI8B 3Q4AB 3GLHB 3V55A 4B75A 5CW2A 1XP5A 3EUEA 4E88A 3S2AA 3JD4A 4ZODA 3ZHUA 1NTOA 3RVSA 3DRAA 4R9RA 4IOLA 4JOSA 4CF5A 4ZPJA 1VRWA 2FRDA 3LZCA 4LVNA 1D07A 1ZOSA 2G76A 4PRLA 1CUDA 3HYLA 5U4XA 1CZRA 3QENA 4M86A 4DV3B 1HM5A 3TTYA 1FW6A 1U3DA 1A7UA 2WF9A 4DREA 5LFAA 1UBJS 1Q3TA 3LQ1A 3EEQA 1T2UA 3SOZA 3WSTA 1EXNA 1PT7A 1OWNA 2YX1A 4CFZA 2HIAA 2PR2A 3UJBA 2QPAA 3QJYA 1SBTA 4JB0A 2TRSB 3BE8A 3F78A 5E8RA 3F5SA 4JOQA 4D0RA 4PZ0A 3MJWA 4OREX 3E2IA 3EVGA 3KJIA 4QQKA 1QAQA 1J23A 4N39A 3RREA 2Z5GA 2HGSA 2QD1A 4Q9AA 5EIBC 5FINA 3M1AA 2A86A 4UBKA 4WLNA 4HUTA 2WZCA 4TV9B 3MKQA 2JGDA 3SHFA 2F9MA 2QN7A 2IYZA 1ZUNA 4TYMA 3N0WA 2V4ZA 3NNDA 1V6AA 4N47A 1C30A 5JR3A 1RAFA 4LOIA 2OBMA 3PZ1A 2ZUVA 4Y6QA 3PQ3A 2VF4X 4II2A 3OZVA 3X2EA 2JH9A 2YJ6A 1W59A 1TNBA 1ZPDA 3C3RA 4WKOA 1X70A 2FHSA 3ZW7A 4V3CA 5IBRA 4GEKA 4KMOA 1N4RA 3KQLA 4TS1A 3BOSA 2J3JA 8LDHA 5KSPA 4Q4HB 2A6PA 1T9BA 2VT6A 4XB2A 4YIKA 5HHTA 3DSVA 5LDDC 5B30A 3F8SA 2I9PA 2W83A 1YD7A 5CH5A 3ZU3A 4B0PA 2PX3A 1F1JA 1DELA 5AVVA 3GHYA 4YV7A 3THXA 3ML9A 1QO7A 4BJ1A 4RH0A 3EXEA 5BSMA 1UBNA 4N5LA 2C7OA 4FKMA 5CT4A 1AHNA 5D3QA 4ZVMA 4AXXA 4FYIA 4HEHA 2M63A 4CUKA 4YCLA 1RKBA 4OYYA 1JSXA 2FCAA 1DKMA 1NRJB 3E34A 1LX6A 3ZDEA 2FPPA 4OGGA 2QRLA 1TZKA 3P94A 3MCTA 3O74A 2ZGDA 1GN9A 4HS9A 2FFJA 5DDIP 3GRYA 3PFCA 4WXMA 1O87A 4IDHA 4B3TB 3VAAA 1SZJG 2ZATA 4WERA 4X0EA 4Z0NA 3CE6A 4NHEA 4Q19A 5CLHA 1PG5A 2V0NA 4XUCA 2ATCA 5CT8A 2G1KA 2Q8PA 3OLYA 3TG2A 3FFAA 4PLVA 2H8KA 1SHKA 1OCZE 3IUNA 3ASHA 1YC2A 4KRXA 2FG6C 3M5PA 5AI9A 3R8FA 2OZLB 4B3XA 3E81A 1KZ1A 3LY5A 4HOUA 5EWMA 2QZJA 1AC5A 4ANVA 1B0UA 5CLFA 2WD8A 3F90A 4X20A 4RIHA 1B4DA 2IZ7A 4A4DA 3IPAA 1X7WA 2GYYA 2PSJA 3TW8A 1WDYA 3H5TA 4AMYA 1PT8A 1JZTA 1L4EA 3BE5A 2P77A 4PY2A 2JGKA 2JFGA 3PC4A 4C88A 3GJ8A 1ZR2A 1J5EB 1ZAYA 2BSXA 2OKCA 2FLKA 1V7PC 1NE7A 2IDMA 4N18A 4CVNA 2R5FA 2WT4A 1ABEA 2R2LA 1JBQA 2B5VA 1ZGGA 2ZBFA 2J6IA 1HV8A 6GPBA 1S8NA 1JR3A 2NX2A 1O9GA 4YEDA 1XPOA 5L95A 2VGXB 2OG1A 3M8KA 3W5BA 3OUTA 3VVLA 4Q7QA 2O3JA 4K9RA 5ELLA 3AR4A 1JPUA 2PQMA 5CDFA 4YYEA 1BRTA 4Y3UA 4HVCA 1YZYA 2J41A 4FMPA 2UUBB 4MICA 2R68A 1CJSA 1E0KA 3KFLA 3MMZA 1Z8HA 3EGOA 4IH1A 4WQMA 2OEPA 2QQEA 4JL6A 2BLLA 3ZQ6A 3BPSA 1LKZA 1ZH0A 4U39A 3RRYA 1H19A 4HK4A 5AW8A 4NMHA 2RGBA 3IULA 1DUSA 5AN8A 3AUAA 3ZXYA 2H0RA 2OBFA 1T43A 2G08A 3CN7A 2AR0A 3ROMA 1QO0A 4HQKA 3KR0A 3ESLA 2RIPA 3HXMA 1QYVA 4X71A 2CG2A 5KYWB 3EW9A 1VBNA 2WU0A 4BJ3A 3AF1A 1E9SA 3ORSA 5IXSA 2H18A 1IZ8A 2EX4A 3CH5A 4KOAA 2OFOA 1XVTA 1CE8B 1CG6A 2GJAA 3ZE6A 4UFNA 4OYLA 4FFOA 4TSFD 3EQ2A 2RIRA 4EFKA 2C3OA 2J5RA 5AM5A 1RJ9A 2QLMA 3Q73A 3R9WA 4YJ2B 4B6GA 3NVKI 4E5YA 2VTKA 4MW1A 2BE7A 3K9GA 3C3KA 4X6UA 4E2YA 2ICAA 2W43A 1CUXA 5FOVA 1KP2A 1F2TA 2F1HA 3WOVA 3I4CA 2AEMA 4K8RB 5DM70 4HJRA 2O2HA 4KSBA 2HPAA 4H7EA 4BV3A 3E18A 3SKYA 2R17C 5C2YA 1E18A 3FHTA 2C9OA 4A7PA 2DT5A 3VRHA 4GMXA 2F8LA 3ZY3A 2I29A 3UANA 2ZSKA 4N2QA 3PICA 1K7SN 3X2FA 4DZRA 1RRPA 5JD4A 4J8PA 4BGUA 1PVVA 4F3TA 3BIXA 4BUJA 2C9BA 3KEMA 1Y8MA 3BJMA 1G5PA 2PUJA 1THZA 4R8KA 4CRWA 5HXAA 4F11A 5JRZA 3KWJA 5J4HA 2A14A 1V1JA 4PTLA 3S7FA 3V7NA 3VC7A 1OH5A 4DR6B 3F2IA 1JVBA 4LKRA 4NOLA 2GK6A 1LPPA 1QGDA 3TO5A 2Q3MA 3NHJA 3CF0A 1JTEA 4P5EA 1HE8B 3G0DA 3N5CA 2P5UA 1R18A 4O4LF 3UMFA 1T9CA 4QBTA 4YY3B 4YI3A 1Z36A 4REMA 1DRVA 5B3JC 1QTIA 4BLPA 3GOQA 3A1TA 1N4QA 2R8XA 3C7DB 4DIFA 3PB3A 2XXAA 4W4TA 1REQB 1UXIA 1IWBB 4NG4A 2FW6A 3ZHBA 3WWZA 1AQLA 1O95D 3TWVA 1KA9H 3UXMA 3HJFA 3NYIA 3UMVA 2PCLA 4YPOA 1MVLA 4DT1A 3UUXA 5FL3A 5IVDA 3WX0A 3TG5A 5JROA 3DT6A 5FR1A 5CCEA 3L8ZA 3D5EA 3A1EA 3RTCA 1N11A 3BL8A 3PEUB 2H2GA 3R5FA 4BASA 2OV2A 3TK1A 4AY4A 1G5RA 4BNDA 4AWAA 1TIBA 3FB4A 3RVPA 2Y92A 3AJ8A 3VR6D 2P75A 4D5GA 2ZRKA 3R9IA 5FEUA 4O08A 3RODA 3TBFA 1TMYA 4HLNA 5ITZA 3PIIA 4DDVA 1XL0A 1WKBA 3IPRA 4R05A 5CCMA 4DMCA 2P9LG 4BBPA 2O8BA 4DIBA 2ZULA 5LSAA 5BOVA 1GKYA 5LLSA 2MMCA 1SXJE 2QD5A 2LXMA 2ILRA 3GFQA 4D96A 1K88A 3C8HA 2D7JA 4E6PA 1VI5A 4N82A 5FTWA 5KYGA 5EE9A 2HLPA 3EHRA 3U09A 1ISGA 1VRVA 1EXMA 2A3RA 3L4JA 3TI7A 4O1MA 2GM9A 4M1KA 1A77A 2PL3A 5AHOA 1MAUA 1NVBA 1B6SA 2VF5X 4U96D 4NQZA 3LT4A 1FS5A 3HY3A 3KRTA 1NJ5A 4G1BA 1Q1ZA 4J0KA 2PBLA 3C3EA 1HURA 3QLVC 1AZTA 5DX8A 1SBCA 1P74A 2Z2ZA 3VR5H 5JJKA 3V8EA 5FPTA 1NNEA 1N3LA 5TMEA 2H16A 2W0MA 3OP1A 4M9ZA 5D3MA 4BMDA 3KU4A 5FTPA 3PUHA 4LK3A 1GV0A 4WNAB 3AEYA 3L84A 1B8NA 5B3KA 5D7BA 4DX7D 1L7XA 2Z9BA 4L0QA 1Y4UA 2ADOA 2YVLA 3KEQA 2H11A 3Q5EA 1F38A 3RLIA 4IL5A 1JLLA 2C2BA 1L5HA 4RTLA 3EIQC 4RY2A 2JABA 1DKOA 3FDHA 1I24A 1HF8A 2DECA 4OJYA 3B1YA 5FAXA 3HB5X 1Z2PX 3FWHA 4UD2A 1YVUA 5DOZA 3P0FA 1JLRA 4DX5D 3CHOA 1U28A 2AE1A 2IHTA 3ZWCA 3AF4A 4LQCA 2HMTA 3MRXA 4CMIB 5ENSD 3ONNA 1O8BA 5IP5A 1WTCA 5ED0A 1EQ2A 3A3PA 5ADUS 1SBQA 4MWZA 5J58A 4FYMA 1FPMA 2ZU0C 4JX9A 1JI3A 2A5UA 2O2CA 2Y1FA 2AQKA 4LZOA 3B5IA 4HLLA 4OLHA 1G0OA 2WUDA 1P0CA 1OB5A 4UI9K 3RSHA 3LV8A 2OCKA 4HH0A 2WVHA 1KMHB 2YQ8A 1EUDA 5LD2B 2D4HA 4RV4A 4MEBA 4KTTE 4OHYA 4PX9A 1UDXA 3VAZA 2ALJA 1TUBB 2OHXA 3KHSA 3ITDA 4W7SA 1WV0A 1EESA 3CWZA 3MJDA 1J0XO 4TUYF 3F3KA 1V1RB 1KO1A 5L7TA 4Z53A 2PZFA 2QM0A 3L6EA 1P9LA 3BHMA 4N41A 2VYIA 2EF0A 1JHQA 4KXYA 3CR3C 2VDLB 3IXMA 3AG2E 3IHVA 1CF2O 5I5GA 4WCDA 2HSJA 1ILWA 1CU1A 1ZCAA 3L6RA 2E5FA 2LRHA 3BEDA 4APFA 5CA0B 1HE4A 1MJ5A 1UAAA 2GF2A 1PS0A 1I3LA 2CVZA 1T6XA 3Q5DA 3DGEC 2HB6A 4R98A 1XQXA 4UAVA 3WHKA 1Y5MA 1S2DA 1FMJA 4UXJA 4FFNA 2QNIA 1BH6A 4O8CA 5DU2A 2J33A 5CU7A 5JAOA 3IOBA 1TJ4A 1FNCA 1O6CA 1YSCA 4Q9HA 4M76B 3CT4A 3MJEA 5HGXA 4O02B 4DCNA 5FULA 1KXJA 3FUMA 4K0KB 3ETNA 3EYAA 5ENDA 3REQA 3RIXA 3O48A 4CE6A 2H1CA 2XYVA 4GPAA 2XA1A 4RHEA 1J4AA 4NV0A 4LA4A 5EN5D 4I50A 4XX0B 4FILA 1EX6A 1SMKA 3AL0C 1TZJA 4X7PA 1XPUA 2HM7A 3G1UA 4JFAA 3SSMA 1K92A 3E05A 5E6UA 3G02A 1EI9A 4TMXA 1MNQA 4KIUA 3GW8A 2B8JA 2NTEA 3NANA 4KI7A 2ZM5A 2OGSA 2WR8A 4INPA 4DDUA 4YS6A 3MXOA 2N1BA 3C6ZA 5CXSA 4RZUA 1LBQA 3W9BA 1FSFA 3A9TA 1OV4A 1M2EA 4R5MA 2XZTG 2WG2A 2M6RA 2RK6A 1DOHA 5SY4A 1K3FA 1TF7A 4QFCA 5LQSA 1NXXA 4U7EB 5CT9A 1F14A 3A2MA 1CS0B 5K7SA 4MRMB 1WVIA 1H2EA 3TI9A 1F6DA 2W8BA 2C61A 1OC4A 3FULA 1QORA 2XYGA 2I6XA 3GRCA 1L5FA 4CZ2D 1WHTB 3NOOA 2AXQA 3U3XA 1MC8A 2WP8J 1LTXA 2QQGA 3BX1A 1ZRHA 5AHKA 1NHGA 2RH4A 4LZZA 2VC2B 1MC4A 3Q75A 1OY1A 1R00A 1Q3HA 2BEKA 2AUNA 5K3EA 4URKA 1GWNA 5SY6A 4ALLA 4B4VA 3N75A 4X93A 3MILA 3DBLA 3VZPA 2VDNB 4Y8VA 4D10C 4C0MA 4YACA 3UYLA 4AJ9A 2C2ZA 3GFRA 3DV9A 4A0RA 4BSZB 4E08A 5JVDA 3K9NA 3FTNA 3VPSA 1CSEE 3S6JA 3GRUA 1M8KA 1U0OC 1U3FA 3VTZA 5BN3B 1OX4A 1BWSA 4BFSA 4B40A 4MV4A 5FPHA 4YMLA 4EECA 2YXNA 3TAHA 3N87A 4RD6A 2P6MA 4HLDA 1U9CA 2XMQA 1QGZA 3FOWA 3PR1A 4QBKA 3S2ZA 3QLUC 4OJKA 1PJ2A 2RC5A 3PJGA 3QA3E 1N5IA 3GCWA 5KAPA 3Q9NA 3SYMA 1E4VA 3N71A 5CDSA 3CURA 1F20A 3Q49B 4WKCA 4EG7A 5JNTA 3BH7A 4QQIA 2WYWA 2NUAA 2B3TA 4PGHA 1GW6A 1XQVA 3PZ2A 3BFPA 3UJAA 4LY3A 1P2BA 1MA3A 1FFXA 3HN7A 2H7CA 3EDTB 3TEMA 4MBGA 3OC6A 3ZWBA 4MKIA 1GLNA 3RSZA 5BWCA 3RU0A 2QV7A 2G09A 1N0HA 1XDUA 4R0NA 2GI4A 4QDTA 3WV5A 4BO9A 4GSLA 3TFQA 2PX0A 4QRIA 3DV0A 1ZQ9A 2QD2A 2R7MA 3AZQA 4EPTA 1DEHA 1Q0UA 1X1DA 1JX6A 2E4WA 1CEXA 1XLTC 4QFBA 4JX8A 4CF6A 3I2HA 1SKMA 5C1DA 4R4JA 5ESRA 1UPAA 2BFOA 4MP8A 2VRNA 2AUMA 1LSSA 3DDSA 4MV1A 4B71A 1P9NA 3IJRA 4QGSA 2NVUB 4FN5A 4B80A 1KE1A 2VAMA 3OJOA 3GEPA 2P9YA 3QWWA 3DWFA 4BFXA 5BQXA 4F1PA 3SHVA 2WSLA 3VHRA 1ZHOA 1FTSA 4QBGB 1KSHA 1MEEA 3QXCA 1H1LA 1J5XA 3H8VA 4NECA 3Q8XB 2KB0A 2HV9A 2LCIA 2X9VA 2Z6QA 4ANWA 2Q50A 5IVIA 5BNZA 2BZGA 1X7YA 2HDNB 5L7WA 1S02A 4AMBA 2BF4A 4QAJA 4TSFA 1DIAA 4UZSA 1IJFA 4E3ZA 3P2JA 5E1MA 2WTMA 2J9YB 1ZOIA 2GLXA 3UJ9A 4PZDA 3SIXA 1U3VA 3GNTA 3ZJVA 3AVPA 2QORA 4X8HA 1N6KA 3FSGD 1Z8NA 2D1TA 4Z4CA 3O4VA 3UAGA 1BD4A 5KOHB 4LWPA 2I76A 3OPXA 3LCAA 1U81A 3L8YA 1JQKA 3R4VA 3A1CA 2C4HA 2NSDA 1B14A 3QFHA 4LJ5A 5A0TA 1NXPA 4H7JA 1IAQA 3W0LB 4G9EA 4MR7B 2AI3A 2ZUUA 4Q1EA 1L7NA 3KKMA 4E31A 3SDZA 4PYKA 3G9QA 3WGUA 1ZU4A 1FUYB 3M70A 3GG2A 1AUOA 2QAIA 3S3TA 3QE4A 5HWSA 4EHFA 3S2UA 1E3WB 4D3SA 1TB4A 2NC9A 3BWEA 1QZ2A 1WAO1 4JNCA 4TRMA 4Y2HA 3NBFA 3IVCA 4KG7A 1FFEA 2IX9A 4FN4A 1NAHA 5HI7A 2VJMA 4U9HS 4ENVA 1J9ZA 5KJLA 4QU5A 4H7KA 4C05A 3H1BA 5FQ6A 1WUKS 2NPOA 4GPMA 1R5OA 3QEAZ 2GRUA 3NUZA 1KQ3A 3K0AB 3ONFA 2FFQA 4NKRA 3PA8A 5K1ZA 4PC3A 4RBNA 2MYOA 2ODNA 4CCYB 3TVDA 3ZOKA 2O2DA 1CYDA 1U31A 4G5RA 2WKQA 2V5FA 1IHPA 1MX5A 4EPYA 1W1IA 3JTMA 1JIKA 4Q0MA 4BU0A 2RI1A 1LPAB 1Z5GA 4Q05A 5KNHD 1II0A 4NBSA 4PPGA 4JLOA 4J9UE 1YDMA 3E0QA 3JQRA 2UUOA 1O96B 1WP4A 3V32A 1CZNA 5FQ4A 3ID6C 3MV2B 4CM4B 3JRXA 1CUYA 1DQSA 3CSTA 1ST3A 4DLKA 4IMPA 3Q9UA 4EKEA 4HRYA 4Q5IA 5BMVF 1DOAA 2GM5A 3ITNA 2YV5A 1V7CA 5CTJA 4FTWA 2P6NA 3CUYA 3TDMA 1SVNA 1QX4A 2VP5A 3CNNA 4QOEA 3ABZA 1W49A 1K4KA 4RD1A 1F17A 3VR6A 5BYKA 1HZZA 2FN3A 1DC4A 2P5TB 2GYWA 3F6EX 3TR0A 4GI2A 3OCWA 3NVMB 3UIPC 2IOYA 1YASA 1MO3A 4BS9A 3ADCA 3GFPA 2D0OB 3ESYA 1GDTA 3LKUA 3WWOA 4I99A 5FR2A 1T8TA 3KCQA 4Q16A 4JKOA 1P1BA 4Q4LA 2FO1E 4DI3A 3HABA 2P2ZA 3MMSA 2H1FA 3ZOZA 3QE2A 4ARSA 3T9FA 1DBVO 1Y8ZA 4LQLA 2P1ZA 1J90A 5KWVA 3NC4A 4FM9A 1MORA 4LUCA 2CBGA 4IGFA 5ECWA 4C7KA 3KKQA 1FOEB 4QQFA 5IU6A 3NBNB 3GGCA 3K1JA 1MYOA 5HIIA 1X8LA 2IOFA 3THWB 1BN7A 3COJA 3TLMA 3JQ1A 4QOHA 4M0PA 1N7HA 4EK9A 1JTVA 4XEIG 5FLEX 1G42A 1U8FO 3MJHA 1WZ2A 4EQFA 3R7RA 3LY9A 3LJNA 3E1KA 4N5CA 3CXRA 3RC2A 2ZZNA 2FGJA 2OMEA 1ZZEA 3ZCRA 4I7EA 5AW2A 1DPGA 3T7CA 3RCBA 2E5WA 2GXAA 1JFVA 4LTDA 3R9XB 4MUAA 1FZQA 1RHRA 1STOA 4WOKA 3VVCA 3RJVA 2TS1A 2KXPC 3UMGA 4GYJA 1ZRMA 3RO7A 1B26A 2QZ9A 3E9ZA 4UWHA 3SC4A 4YNDA 2ODBA 3PC8C 3LX4A 3GJ6A 2IHNA 3KUCA 3A1SA 2FB9A 2OBLA 1MXHA 3TRJA 4R1QA 1XEWX 1ZOOA 4CIXA 3LLCA 3RF6A 3IHKA 4G2TA 4S35A 4L57A 3OO0A 1JB1A 2Y99A 4PBTA 1R9GA 3AWIA 4FYVA 1ZAKA 2FSUA 4F4IA 2WTAA 5C7IO 3FSEA 3G0OA 4LZWA 3GYZA 3GQBA 3AFIA 4RFSA 1F8GA 4IIJB 1XV5A 3E15A 1VHWA 1PJCA 4D82A 3IEVA 2FPIB 3GUHA 4DC1A 1E59A 1H93A 5DM60 2BMVA 3LQ2A 3ZEIA 4RVUA 5JBQA 1GPMA 5ITZF 4B6EA 3EMBA 5TPWB 1YQWA 2A57A 4CR7A 1EJ0A 3TCNA 1BX1A 3O2JA 4FMBB 5LOZA 3D0OA 5ALXA 1MU0A 2RI6A 4PZLA 5CM9C 4L6IA 1KXZA 4AXHA 1W34A 2ZRPA 4E46A 1OT8A 2R8ZA 4FNAA 4R2KA 4QUJA 1TJYA 5C51B 3AIMA 2QTRA 3V6LA 2R00C 3OUZA 4POAA 1PUJA 2X58A 5COQA 5HA5A 3E4BA 5F5XA 1E96B 2PJDA 3HLTA 3ORYA 2LCQA 4GTVA 4ZJZA 3O4FA 4FP9A 4E5SA 4HI8A 4Y98A 3DZJA 3ACDA 2N1MA 1JR3D 2NVBA 4R54A 2G04A 4BV8A 2H9AA 1ODFA 4AWXA 1QXSA 2NO7A 5DHAA 3G13A 2RGRA 3JQGA 5DWVA 2ACWA 5D0QD 5KQGA 4G0NA 3WSWA 4PHHA 3WNCA 1G1AA 3HA3A 1X86B 3NFYA 4QDXA 1ECPA 3S44A 2A9VA 3BD8A 2R60A 4GR5A 4TPKA 5IMBA 2HF9A 6YASA 5EZYB 5IZCA 2H1WA 2GT1A 5TRTA 3MJSA 3F6BX 3VUEA 3CWCA 1E3SA 3PFIA 3M82A 3FWZA 3EXG1 1ZVQA 3LXUX 1T8YA 4MIKA 1V16A 2BHLA 3P4UA 3KEFA 5JE8A 5HBRA 4M7PA 4GMFA 3IOMA 2GZDA 3ZGYA 3P9SA 1DT5A 5FA5A 4G97A 1ID1A 2X9NA 2XEDA 1SQSA 3EIWA 5IJ9B 2DPXA 1CEQA 2JHPA 4D99A 4OVUA 3IAFA 4V0SA 1EG2A 1ISFA 3K1TA 2CW5A 3ETLA 3MT0A 5J2TA 4IIEA 4JA9A 5T4FA 3SKVA 1YVDA 2ZJ0A 1XF1A 1V11B 3IQHX 6CHYA 4HKTA 5A05A 3ND8A 1GUDA 1KEWA 3DZCA 2XCCA 4KDEA 1LDNA 2VFAA 2F1IA 3DWEX 1WD7A 1RJEA 5BRNA 1VG0B 1ZO8A 4EMUA 4C76A 4PPYA 2P8JA 3UWDA 1UOHA 3UWOA 2EBHX 5DOVA 1EGQA 2QUHA 2VJLA 4WZAA 1U2EA 3W78A 4YRMA 1OT3A 2AF4C 3HY6A 3PZ4A 5C8YA 2JARA 2WKSA 2A8YA 3G23A 5KQSA 5IJXA 5JJ6A 5KYUA 3SI5A 4JEIA 2Q3LA 1BHSA 5KBYA 4HAUA 2DKFA 1Z63A 1OF1A 4A3VA 5C46F 3HL0A 5B58C 1HNNA 4QDKA 2AKYA 1RM0A 2WHPA 1EK1A 5JYCA 1HMYA 2DIWA 1XFDA 1KYZA 3RYHB 5DNCA 2R8PA 4EYSA 3LHFA 4FHGA 3WKBA 4P8RA 2DQZA 4M0LA 1YB7A 1LVGA 4C6RA 4Z9BA 2ZQZA 2FGKA 3GZ4A 3JU3A 1BE1A 3G9XA 2OO7A 3LFHA 3MZ0A 4UWFA 2WI8A 3Q15A 1D2CA 4OH7A 4LYDA 5FCDA 1N7JA 5ALRA 2TMGA 2MR6A 4N5HX 4XE5A 4LRTB 3EXHB 1AH2A 2QSUA 1K8ZB 1O97C 4XCXA 3HDTA 1LTHR 3CQGB 2OXFA 2BE9A 1ZJYA 1MB4A 4JD2G 3W7BA 1KOLA 4I50F 3EPKA 4P29A 3QSYA 1F51E 2XRYA 1SB9A 1WU7A 5DB4A 2POCA 2IUSA 1L4FA 4QHYA 3JALA 5FJYA 2DFDA 1VI2A 1ISMA 4GQAA 1OFIA 3PNLA 1VLHA 4PYLA 4OQQA 4WJZA 4L4XA 4IIUA 1ADGA 4F9GA 3KP1A 2QBYA 3A14A 5E7IA 4QE3A 5B6PA 4FINA 4IHKA 1A8SA 9MHTA 1XTRA 3O8OA 2BI8A 1B23P 5IC5A 4EQ6B 2Z6UA 3KOOA 3NTOA 4HSEA 2CNKA 4WVFA 4WFJA 4OHFA 2WQ6A 3O1LA 4GMGA 2VHEA 4L8FA 5KTOA 1YOVB 1JUQA 1UPFA 1ICEA 1PUIA 1FRZA 4GP7A 2UYHA 1D2EA 3VO9A 4GTPA 2IDJA 1YQEA 4FYYA 5CW1A 4DRYA 3ABQB 1W25A 5DW3A 2J9FB 2OCIA 3UAVA 2DERA 2QUIA 4RPKA 3OFKA 2X14A 3ZCPA 2D2EA 5DHQA 2X0DA 4JBWA 1JQAA 4C01A 2XUGA 2W90A 1VKZA 2ZPUA 3E3MA 1T4CB 3VXKA 1AB6A 2D7DA 1SHJA 2W2TA 4TL7A 1BMFD 1HS6A 2BFBB 3E9RA 2JDID 3FKSA 2JAUA 4FUTA 5L45A 4IPTA 2WJHA 1XZDA 2Q28A 3RAEC 4ZEOA 2J87A 3TWXA 2Y0CA 2ZANA 1S89A 4NXMB 5CBNA 1TAHA 1XNHA 3EA0A 1AKQA 5JCOC 5JVDF 1X94A 4D5EA 3ZS8A 3DZBA 1AXGA 4ZT6A 3UJ3X 4F84A 1K8XB 1X2EA 3VR6H 2IYUA 3M6IA 1N6IA 2VJQA 5AJDA 2VEDA 3BU8A 3K6JA 1L5WA 2Q8QA 3Q7PA 2DLDA 5AKIA 2V4MA 1KVRA 1QH1B 2PGIA 5HUQA 4FW9A 4URVR 3HB4X 3DSSA 1PBNA 1U6KA 3RRMB 3A7EA 3TUZC 1UPUA 4HXIA 4M54A 4TMWA 3QMMA 4BLSA 4CMKA 4J7XA 3FSGA 2UVDA 4P0PB 2JAOA 4NCXA 4G9BA 3H17A 4NPCA 3OZTA 3ZDRA 4WCFC 4JZKA 4M9XA 4OV6B 3HPRA 4PCUA 4CF3A 1DXQA 4OL0A 1BGWA 1CUCA 3RUEA 3ZWWA 3MJRA 3VU9A 4ZGWA 1QZUA 1YJXA 3TSCA 3E8SA 1GPH1 4DR7B 1XFAA 2AC7A 5F1PA 2OCAA 2O7QA 3I6IA 4S1WA 4WGGA 3L77A 2LDXA 1ZVMA 2P0AA 4R8SA 4U6NA 1TM4E 2FK7A 3CNEA 1RJGA 4ZT7A 4CIWA 1O4VA 3TAXA 2Q6IA 1DJQA 1SXQA 2G0NA 4TVBA 3KXIA 3TIVA 2I6HA 1DDGA 2BH9A 2X2FA 4XCVA 3TN7A 2YNQA 4EZJA 3TRFA 1PSWA 2Y9MB 2YVUA 3ND7A 3WWDA 2OXRA 3LGSA 2QP3A 1XJWA 1Y80A 2YICA 2A59A 2RBKA 3CCFA 5TQ2A 1YRBA 3DCYA 1W9MA 1R3DA 2PG3A 4GECA 3ZQKA 2AFIE 1XLUA 3FDXA 4N49A 3KJNA 1P81A 2KBFA 3DZ8A 1ADJA 1E1QA 5LQAA 4DL9A 1X74A 2OSVA 3A6KA 4KVFA 4FWTA 1WOYA 4IXMA 1QCZA 1YKGA 5KI6A 2DBZA 4NRHB 1H6AA 3QYFA 1QVVA 3VDNB 1B16A 4IEEA 5AQEA 2NXWA 4Z9AA 5AOCA 2FJUA 1N2IA 3QI2A 2R6JA 1OWOA 2CYCA 2PT6A 4FNGA 4JI6B 2IUEA 3NDPA 2YXEA 2IXTA 5FTKA 4QOSA 2EKPA 1YA0A 1BG6A 1OIWA 2AZMA 3LF1A 2FF5A 4B6SA 4Z49A 1G20E 2GZMA 4MTCA 3ZBPA 4M53A 3QAQA 1TYCA 5HOQA 3BEEA 1UEJA 1N36B 1UMCA 4E5DA 3ITKA 2WU4A 1TRHA 4XUEA 2ZIXB 1LDBA 2YHAA 4L8WB 4GWLA 2ZRNA 2NQ8A 2DFTA 3AKEA 1EK5A 4W7HA 2ZE6A 5A4AA 3L0OA 4IJWA 2BKAA 2HUNA 3PEVA 4WKPA 1EFTA 2JEYA 4OAQA 2HT6A 1TPZA 1X3LA 2EX1A 3ASOE 4N7RA 1UBGA 3ZEFA 2GPSA 4MPDA 1JQJC 1FT1A 2YWEA 3L79A 2IZOA 4BKPA 3SO8A 2WE7A 1WW2A 1Q44A 1C8VB 3GGPA 1OC2A 3WYEA 3WP0A 2CHFA 5LOVB 3S1SA 4DS3A 1R0RE 4L0CA 3WGTA 3SR0A 1U1GA 3U40A 2H1HA 1R6UA 2XDYA 1YGYA 5DLEA 4FFWA 1GUZA 4PHFA 3HWSA 4GRIA 1NV9A 3TE6A 3SS7X 1NMSA 1AO3A 4LXUA 2JGJA 2GARA 5B2FA 2AR7A 2GKOA 3JWEA 4X44A 1DV2A 2XAAA 3LBNA 4FLEA 3DPIA 2HU8A 4HPWA 3LBAA 3MELA 4QBFA 3A6HA 4BE7B 3IHWA 1JALA 3KKKA 3SFVA 4G5QA 5B4VA 1N52A 4C7XA 5HR5A 1U9JA 1Y98A 3R0ZA 4AECA 1UM9A 4R0VA 4A27A 1LD3A 3JQBC 4PTYA 2VK4A 3ISJA 3E23A 3QB2A 3TLJA 1OJ7A 4A55A 4IDOA 3GN1A 4FYHA 4KXVA 4UAUA 1YDGA 4JMLA 2O0MA 4P7JA 1P4AA 4H6WA 3E53A 4RU1A 1N6PA 3PFNA 4TXLA 4AROA 5EE3A 4IGAA 2FI7A 4I1IA 4S3MA 2H2AA 1AU9A 4KP7A 1YDFA 1GRVA 1VMIA 1Y1SA 2ZSJA 4D57A 1N92A 3P20A 3SGLA 4JD5A 2YRXA 3DL7A 4HNRA 2KCVA 2G67A 4RFVA 4A1GA 4TUMA 1PFQA 3K2BA 2GRLA 5FOSA 1X39A 1NZNA 4S0XA 5CLLA 2H08A 4E22A 2RGXA 1E1CA 1XCPA 2QI9C 2AMFA 1WQ1R 3I09A 2NU8B 1P1HA 4B6OA 4AOFA 3I61A 5J5AA 2P9PG 2IW1A 3ISMC 4ME6A 2OCLA 3HCNA 3RFUA 3QSGA 4GWKA 4K26A 4Q03A 2IUUA 1EFRA 5K0JA 1HE5A 4BAGA 2ZYUX 2D06A 3FZQA 4MQEA 5CYPA 1NAIA 4F9EA 4EY4A 4J0CA 5L9AA 3K8YA 3AJRA 1Z2CA 5EYPB 4AKTA 3GEHA 1IN6A 2I4RA 1TA0A 2PXCA 3RYFB 1NFQA 3PIDA 1OA1A 3HDHA 3IV0A 3GLHE 3OCUA 3QEOA 3WLOA 3TNFA 3ZVNA 2XH8A 2Y66A 1P1CA 2KS6A 5EIHA 3SBOA 2HSDA 4Q1DA 3S7DA 1BX3A 1E8XA 3F6CA 5TPZA 4Q15A 3LPAA 4EHJA 3B7RL 4NIMA 3D02A 1GEEA 1P1IA 1AUPA 3N7TA 2PXHA 3C24A 1ABFA 4PIVA 2ZIAA 1E8DA 1XA0A 1ZJJA 1V8PA 1VXOA 4IS2A 1S8OA 5BSTA 4DLBA 3QU7A 3SX0A 3HEMA 3CQCB 1KRWA 3ZIDA 3FTQA 2I2FA 2BFFA 4MUMA 5KHLB 2EINE 1V9LA 1ZJ4A 4BQIA 3N7AA 2GA9A 1P7CA 3WQQA 3P5BA 2OPHA 2QAGB 4K40A 4XR9A 4XE0A 5IAOA 3U3JA 1K1AA 4CTNA 4IDQA 2XX3A 2OCYC 3D8HA 3IB3A 3L9WA 2CE7A 2L0IA 3A6DA 2UUCB 4JUBA 3AI7A 2ECFA 4AZTA 4O4IA 3G5MA 4XEHA 1DGQA 1X0VA 2AXEA 2LSVA 2BP7B 2DWUA 1E8NA 1IG3A 3EQ8A 3M3DA 1UC9A 5CNMA 4HAVA 5CB8A 4J4BA 1ILEA 2WZBA 3TZ6A 5BMVA 2Z95A 2R1ZA 2P69A 4YV0A 5AJVB 4EHKA 2RD2A 3ZWPA 3D64A 2Z6AA 1DEOA 4M8LA 3MJCA 4RS3A 3BMQA 2NO0A 3F7NA 4DQDA 4UTRA 4LDZA 4I1VA 1Y4AE 4QQRA 5IWCA 3B1FA 1Y9DA 2FSSA 4UEOA 1QLJA 4S24A 3MCAA 1YK1A 1ESNA 2I6QA 2ZJ6A 2KBEA 3N2NA 2BFEA 3SYTA 4JENA 1NULA 5J63A 2V0GA 3KR2A 3IDZA 3L7YA 2W6NA 1S8FA 4UTPA 1JT2A 1QHNA 2VXBA 1FX0B 5A06A 1VHLA 1DAFA 1M8GA 1XTSA 4PCAA 3ANSA 4EI2A 2GM4A 4RPGA 4I19A 4YAWA 2NQ2C 4RHCA 4PZ9A 3ZNOA 2E1RA 3ZE2B 4Z2YA 1HT2E 4JYAB 4KX5A 5K0CA 3AG5A 4AO6A 1YB4A 4G3XA 4PCLA 3U0BA 1SUFA 2HMSA 2D2IA 1OBCA 3P2BA 3QHPA 1PKEA 4PX5A 2BZ1A 3QWIA 4RV9A 4DV2B 2OWDA 1YQGA 4OMCA 2O7RA 2I6GA 2ATXA 2I99A 4RM2A 4IXDA 4GM4A 1WNFA 1QPZA 1TN7A 2QTLA 1HPLA 4Y6CA 5E6SA 4IEIA 2GJSA 3L1HA 3U7QA 3RFTA 1XDDA 3ELUA 1R4MA 1N6HA 1XEAA 5JAIA 4RXTA 2C77A 4L78A 4CR6A 4TYYA 1MHTA 2C31A 4G41A 4ANFA 5BPPA 4REQA 5J2TF 2F1KA 2RAFA 4M1WA 5LA6A 2IZ1A 2W70A 4OO3A 3LKZA 2XMGA 3JYQA 3UMYA 2VDKB 3PIRA 3I6QA 4B3JA 2XWBF 4BIIA 4G4GA 1E0JA 5FLYA 3RWBA 4F3KA 3ZU6A 1Y6QA 4BJ6A 2Y1WA 4NYMQ 3GOHA 5JI3E 1M34B 2IIQA 3BMOA 2BTEA 4OTZA 1H85A 4BFZA 4KO1S 4PFSA 1TAGA 5D3ZA 1SU7A 4HGOA 3ZWNA 4MUXA 4DHEA 5I7FA 1QGAA 5C8YF 3JQ8B 4HAZA 4FFSA 3VDXA 2PGLA 2JGEA 2JLWA 2PFKA 4YO7A 5HEKA 3TNJA 3U16A 2BEVB 2GFIA 3KV3O 5EJ4A 5EJIA 4DPRA 4QICA 2IPMA 3KHTA 1UJNA 4LJ6A 3L4BC 5HF6A 1CTQA 3DQPA 3OZCA 5KJCA 1L7PA 5D2MC 4FQ8A 3ZZ1A 1BMFA 2JDIA 1DJOA 1KPIA 3X44A 1JR6A 2FVYA 3T35A 3ZI7A 4DX1A 1BROA 3QVLA 4RHXA 3T9BA 3G2JA 3AEUA 3NKVA 1XAIA 4LW8A 2OCBA 2ZXWE 4RKRA 5E9JA 2SNIE 4ZC1A 4MJ7A 1T8RA 3D4NA 5HPYB 2VDWA 4ARBA 3S7ZA 1H0RA 1M2HA 4UQZA 3O21A 2VHZA 3O26A 2EW1A 4ZO7A 4M8IA 3RBAA 4FX5A 4J43A 1RXIA 4WHMA 3I2FA 2F00A 4G1MB 1C3OB 1RRVA 5LZ5A 1Z0DA 3PXEA 1SPBS 4E6EA 4I9UA 4QUAA 4EB6A 1VXRA 2ETBA 4C04A 2G8LA 4RA6B 4BMZA 4H7IA 1TPYA 4LF7B 5EJEA 3HH8A 2AVNA 3MMPA 1CK4A 1B8UA 3QUBA 3ZHZA 3QW2A 4J2OA 2FJ0A 5DRYA 3D7LA 4MUHA 4ZOEA 1PJBA 4GRAA 2P58C 4QGGA 1CF4A 3GFTA 4XWOA 5FOXA 3UOGA 2YN4A 2HM8A 1M6HA 4Q9IA 3L54A 3R23A 2ZTVA 2IONA 1KJIA 4CIBA 4EJSA 1DCEA 3C1AA 4IXTA 4M3NA 3SR3A 3ZW8A 3GVHA 421PA 1I5EA 4JYCA 2X4LA 3G9ZA 2EG9A 3L0SA 3EZXA 3ILVA 4TSRA 4BHTA 2FJPA 4TMFA 5HJ5A 4RGVA 2CHWA 1EP3B 4YA6A 4ZZ0A 4HUJA 3P9QA 1JH9A 1K8RA 1WX1A 3D9JA 1G38A 5F23A 1ZOPA 3C5RA 3SLKA 4LDJA 1K2VN 2FR1A 2JJ8A 5FWXA 1KMMA 4CM7A 1S4QA 2YVQA 3HQ4O 3N8GA 1U7PA 3WLMA 4LF8B 2EJUA 3TW6A 1X14A 1QWOA 3OC0A 3K5IA 1OTYA 1FSZA 3Q5MA 4PNHA 2EZ8A 5ALDA 5TMPA 3ZTWA 2PYIA 1CJMA 1A04A 3LLUA 1ZSNA 4PPNA 5DTRA 2R87A 4UFPA 3T5MA 4KWEA 2HMAA 3EF1A 3U44B 1ZVKA 3TF5A 2VHXA 3IAHA 4WN3A 1EKXA 2FMUA 5FZQA 2DWCA 3B2EA 3H6HA 2OESA 4ARZA 3BXOA 4LF6B 1OWPA 3G0GA 3DTVB 4ATGA 4MRUA 2F1RA 4HB5A 3H9UA 4PHGA 4Y2VA 3JCKC 1EWYA 2ANBA 5KNCD 4P92A 5KVVA 2YMPA 1Z56C 4U2CA 1DBSA 3HJAA 2GAFA 1PEYA 1TQ6A 4Z1OA 1MIOA 1XDWA 5EP3A 1BVHA 3IMEA 3QEBZ 1T0PA 1JAYA 1TYAE 4TWBA 2QVYX 1M6VA 4LEIA 2C5BA 4UM9B 5ALYA 4DEXA 3V1KA 4F2HA 2AC4A 3TRIA 1FJGB 4QU8A 2EX0A 3H5AA 4PH4B 3S5JA 3V7FA 3GDWA 1H65A 1YKFA 2CDCA 3DAPA 1TTPB 4JXTA 3O3OB 4HB2A 1XDSA 3PXDA 3ADDA 1ORHA 2I6UA 3KXKA 1EWQA 2IKQA 5K51A 4RSYA 1NNUA 3GRZA 1E9RA 5IC6A 3PJRA 2ZDGA 2WXHA 3B2NA 2VCYA 2PSDA 4KZCA 5IS2A 3GROA 4D4KA 2G28A 3AM1A 3LH5A 1SVOA 2XYRA 1FDWA 4MVWA 1AJEA 3L8GA 3A6ZA 1JSLA 4J3FA 3IEXA 2IU1A 2CD9A 1GTG1 2GZ2A 1XA4A 4Q7MB 1KH3A 3W6NA 4XKJA 2G4VA 3TIFA 1UFVA 3OM8A 1F2DA 2JNWA 5E1BA 3CF6R 4HQOA 3BM5A 2KATA 3WMFA 3CGHA 3QHAA 1E3QA 3K0FA 3HNPA 1Y81A 3TOVA 1HI9A 3D3QA 4J0JA 4CKBB 3A26A 3O91A 1JYEA 3IHYA 5IAEA 2QVLA 3TQQA 4G2VA 1E1LA 2PJUA 1I0ZA 3VBEA 1Q7BA 1E2MA 1X5BA 2XOEA 5AHWA 1K5HA 3D2LA 4QIHA 1RRFA 3ZI0A 2M98A 3I6YA 3ULEG 4B85A 2IIBA 1HT1E 2JK1A 2FEPA 4KR9A 4TKVA 1CC1S 2Q6OA 2EWMA 1FSGA 4OXRA 4MR8A 2IQCA 4JI7B 1Z29A 2AG6A 1I01A 1ULSA 2Y76A 1H66A 2HDHA 1T9GR 2ASVA 3RQIA 1L7OA 3OG9A 3SZUA 1M6NA 3KOXA 5EZ5A 4HVTA 5L3ZA 2QQ0A 1YDWA 1X77A 1TUEA 5IKXA 1WUIS 1ECJA 3TEFA 4TXMA 2WU3A 5F64A 1WW3A 4Z5XA 2WSIA 16PKA 3TLGA 4AS1A 4W1SA 3NHPA 2ZZMA 1S63A 3AR2A 4ZQHA 5IHPA 5LWQA 3VYVA 1V26A 1I4EB 1VDZA 4W1RA 5G1PA 3G2LA 1BWPA 5EXPA 5BSHA 3U61B 2GEJA 3WNQA 2DFVA 3VNVA 4G0OA 1Q2XA 1X9HA 4ZCSA 1U2QA 4XSGA 1QGED 1E69A 1PWZA 2YHEA 3MGKA 1N9ZA 1KEEA 3VMMA 5JZOA 4L7TA 3UT7A 3W6PA 1O1RA 1XVVA 2P40A 3T1TA 3HCDA 1A8HA 1INZA 1K7YA 5E95A 1WBBA 5K3DA 3B78A 4FP7A 4KE6A 5DASA 1XZEA 3OEWA 3QH4A 2WHEA 1NUSA 2IOFK 1K6XA 1Z39A 3O4GA 1CZUA 4YXFA 5AKYA 2YYYA 4XWWA 5REQB 5IG2A 3P97A 3VKVA 2CUKA 4JBLA 4C0AC 2PANA 13PKA 1LF0A 4L2IA 4ZQBA 2CXOA 1L5KA 3D6MA 1VYHA 3OU2A 1QC5A 4XWGA 5IEJA 4JI0B 3KZOA 4MMZB 3ZZNA 4Y6LA 2QU8A 1DG3A 3WL5A 2JLQA 4YJ3A 2VZEA 3FKSD 1ZLYA 2CXPA 4KACA 1Q2UA 2VNJA 1RRGA 3UXYA 1FE8A 5L3VA 2ACEA 3G89A 3FVRA 3DLAA 1TADA 1NOKA 5I4KA 2XVMA 4CLEA 5U4QA 3OIUA 4I55F 3UJPA 1KLXA 1TNYA 3DB2A 4K9OA 3B1KA 4BE4A 3T5GA 1U2ZA 2QC9A 5CB6A 1ULUA 3CSUA 3DE4X 4EGCB 3V6MA 4TRQA 5EGNA 2QG6A 1VIVA 4RUKA 4IIXA 3SK0A 5AQ7A 4UBIA 3OFSA 3WAGA 1UFRA 2FTKE 4I81A 1QH9A 2YJ4A 4XGRA 3KYIB 2A9QA 2A0FA 3DMYA 3U3DA 4WNDA 3L01A 3PPIA 1OW3B 3V4PB 2W6IA 1Z5OA 2JS7A 1GXSB 2O05A 3FCEA 4IQ8A 4RW0A 1WETA 3NZEA 2IYOA 1E79D 4TM7A 4FS3A 4IV8A 5ILQA 1JXOA 1B76A 3ECCA 5GINE 4M99A 3B9BA 1BHO1 2YZKA 3K70B 1ZW6A 1NXQA 1JSZA 1ZC4A 4NVRA 3QP9A 2XADA 4RADA 4ETNA 2E6UX 3HLYA 3KTAB 1YGPA 4D02A 4JP1A 2NNLD 4I1YA 4R2WA 2B34A 3IERA 4OQPA 2WB2A 2X8BA 3PU6A 3O73A 3SX4A 1W75A 2P79A 1X7XA 4Y0NA 5K6AC 1DADA 3W5SA 2LE0A 4R83A 4CL3A 2VOEA 3QITA 3MYYA 3FUHA 1G5HA 5TC4A 1U9ZA 4KBGA 3ZXUB 5ENQD 1K68A 1N5JA 5ALJA 3AY0A 4B0ZA 3T5VA 3TR6A 4BNNA 3IKOB 1L0BA 4NFYA 4B8CB 4H0CA 1KEZA 2B83A 2GWHA 1QB8A 4MGEA 2XDAA 3F6SA 1ZKDA 4DB4A 1J25A 4U0SA 4B8YA 5GTDA 3P1UA 2HSGA 3BQNB 3FHLA 5JQGB 5MFZA 3HUFA 2YMMA 3TWUA 4TSKA 3OEED 5J40A 1L1EA 2Q1YA 3GYBA 5EWLA 4EZBA 3TLAA 4FULA 1AA9A 2RHLA 2EBFX 1L5NA 3JD2A 2ZRLA 4IHQA 1E1QD 3N3AC 4NCAA 4CQLB 5TDHA 2C5FA 1PG0A 5BW5A 3EGDA 1Z74A 1LW7A 4HEQA 4O4IF 1X1QA 3FROA 1ANKA 2F7SA 3AP2A 2MHCA 4BMNA 4XKCA 1EYHA 4S04A 4AY3A 1OCEA 4MJ3A 1XD2B 4WSOA 1E7WA 3O1IC 1LH0A 2X0FA 2ZBRA 3RSEG 3BWBA 1KC3A 3PKZA 4PHCA 1MCZA 4EPZA 3CHMA 4E51A 2WHXA 1VL8A 3H4TA 4BQPA 4JVSA 4HI0E 3MERA 3BSYA 3SQWA 3QVTA 4PBSA 2FRXA 3QG1A 2DPYA 2ZUWA 4AL4A 3EJ6A 3S68A 3WK8A 3UKDA 1GILA 4PZAA 2A3NA 3NOCD 4GZ5A 4RANA 5JANA 5EY5B 2ONZA 4Y2XA 4H6PA 3UO8B 2AWIA 1XN4A 2RFMA 3ZDDA 4C4TA 4OI2A 3WDMA 2C5HA 4XXHA 3ONKA 4I2WA 1OAAA 4IXNA 3Q3JB 1S01A 3DT9A 3W2TA 4F4CA 2CYBA 1DVRA 1EXWA 4RAOA 5AXBA 3ILSA 4OK6A 4R2JA 3JV7A 3TX6A 1B93A 4M1TA 5FI3A 4EKNB 4YRRA 1W94A 3ZNNA 1J06A 3R7LA 1PEAA 4YQZA 3P0IA 5AR1A 3F67A 4AIIA 2J4BA 2KW5A 2ZRJA 3LZ6A 4NOKA 3ZE7A 4MV9A 1T6YA 3VAYA 4UI9J 3FGOA 4W63A 2NXPA 3PH0C 3QKRB 1GGHA 3LE8A 4MI6A 3FUFA 3QDNA 4I1RA 1KH2A 2C4VA 3T8YA 1JJBA 1I2MA 3UKOA 3T7KA 5JJLA 1V71A 5M04A 1SCUB 2QR2A 2P4UA 4ITVA 3GC6A 4CF4A 2YL2A 2Q5CA 4KNVA 2LNIA 2A9FA 2OV1A 4IN3B 1C2YA 4IIDA 1N32B 3OCZA 1GNVA 4WKBA 2EFCB 2CSXA 4IO0A 2F48A 3RI3A 3EH2A 1DO8A 3GP8A 2N46A 3V97A 3ZJ5A 3C7CB 3BXFA 3WLJA 4KR7A 1GM5A 1W96A 5LA6F 4BZWA 1P91A 4B89A 4LRQA 4BO1A 1FFYA 1C1YA 4PQRA 5TQ0A 2EKLA 5JAHA 2NOAA 3KLMX 2PA3A 2ZISA 1CHDA 2WMOB 3EDOA 3HG0D 3CVPA 4W7IA 4C0BA 4JN6B 4TKMA 5FUXA 2RGYA 4QWMA 1ZD8A 4XB1A 1N8NA 1D6JA 3VYSB 3WWEA 4O59O 1EFHA 3GL9A 4QWWA 1K06A 5BUCA 1PF7E 3DMRA 3EWSA 5IK2D 2YHIB 3EVCA 2CXSA 5LZ4A 3FPSA 5EIDA 5I7AA 1C8KA 1ENPA 4LNUA 4AUNA 4LUNU 3N2LA 4XUGB 4HVAA 3QLVA 5KNDD 1I32A 1DBQA 3UK0A 3KB8A 4URWR 1EFRD 3BMNA 1DXYA 4HB3A 3JQFC 4QD3A 2BHNA 1GUFA 5EKXA 3SS8A 4ITUA 1QHXA 3E5RA 1W5TA 3KSLA 5FQNA 4JI2B 3BRSA 1DT3A 5L3RA 1PGNA 5BT9A 3EU9A 5LDHA 2OHGA 3KR1A 4D9FA 4FK8A 3AVOA 5LLDA 4R7LA 4DB2A 1JI0A 3NATA 2ZG6A 3QYAA 1KIMA 3EIQA 4DCSA 4Y2YA 4B34A 1COWD 1IN5A 1E3EA 2IKSA 1RI5A 1IY8A 4F45A 4HFNA 2GQ0A 1OXJA 1JL3A 1WCIA 3QXGA 2WJYA 1OPXA 1DBPA 5TPZD 4OJNA 2VNKA 4US0R 3AWDA 1YCDA 4A36A 3JQ9C 5FWYB 1Q16A 2XECA 4IDDA 3R6WA 3FZGA 5KNCA 5GMOA 2JVKA 3FOFC 5C4GB 2C95A 1OB2A 3SIWA 1KDTA 5KNGA 1P5JA 4OU5A 1NQOA 4R8LA 1J0AA 2MMGA 2ZYVX 3L02A 1UXGA 1IUPA 2XUKA 3QBTA 1IXVA 3P8ZA 4B3MB 3UX4A 1S1CA 3U3KA 1P77A 4G1TA 2FZLA 1D8AA 1WO8A 1F8XA 4KLAA 2XPYA 2G4CA 1OE0A 4WJLA 2RD0A 3RBXA 3TJMA 3PQ7A 3UCEA 4GMJA 3L7KA 1LV8A 2NLOA 3L82A 5I7VA 3WO0A 3N70A 3ZGNA 4YT4A 3BB4A 2A1TR 4KC0A 3UGTA 4PYJA 2GYVA 4I3FA 1KJ8A 3PHIA 2PZ8A 3AP3A 1QIMA 1ICIA 1NQ5A 2I7DA 3SP1A 4TVKA 1SB8A 4TKUB 4KJZA 1O5TA 3OP4A 4XPZA 3BGOS 1KWGA 5K0NA 1JRLA 6LDHA 2QMOA 4JDUA 3RT7A 1E58A 2M2IA 2PT5A 1TQ2A 5DBEX 4MA4A 1J99A 3SKXA 4MW6A 1SJ9A 2PWYA 4UZFA 1DIBA 1IRXA 4ZALA 4MHSA 3ETDA 1ONBA 1PW5A 3V4OA 3NT5A 2QRUA 2PEYA 1DEKA 3HDVA 3NEPX 1E1NA 1NPYA 2H4JA 4UE3S 3KKOA 4KB5A 4XWAA 3V4SA 1VA5A 1K7FB 3WIDA 1GGJA 1DTSA 2VO1A 2NV2B 5AP9A 2H2HA 1Z0UA 1Q1QA 1SK9A 4DWJA 1DWUA 1VDMA 3C45A 3LHKA 3P7MA 1VIAA 3FVTA 2MHKA 4O4JA 4WLFA 3L13A 3PHBE 4EF5A 3CK8A 3GGJA 3UIEA 4A6XA 4JEMA 3OU6A 3KDSE 2FETA 2QLFA 2FU5C 4GOND 3IPCA 3ZD7A 2PD6A 4IGKA 2VA9A 1OLXB 4XKBA 1U11A 4QXAA 2W2KB 4OP2A 4COOA 1L8OA 2DTEA 5F3DA 3BJRA 2OM2A 3CKYA 4OGKA 4YRJA 1Z13A 4H4DA 4BFVA 3L49A 2JHGA 4ABNA 3B1JA 3TKLA 3OXGA 3W5HA 1OHHD 5FPSA 3NI2A 5SYMA 3AH8A 3UJ7A 5JRJA 1KU6A 1FYXA 3PLRA 3LUCA 5CXQA 1QLHA 5KTKA 4MH0R 1XLWA 1XAJA 3U19A 3GLIB 3O8NA 3ZXPA 4HDAA 2R03A 4EIWA 4FEAA 1JEAA 1MIHA 1S7GA 1IIBA 4PQFA 1PZFA 1CZKA 5GJBA 3FVWA 3IS3A 5A0VA 4A1SA 3S2FA 3UJ8A 2IPAB 3KQOA 2BMWA 1I30A 2R0QC 1V45E 1IOZA 1YRHA 4RQBA 5A7HA 1PFUA 1U0HC 1A9TA 2X5NA 4GZMA 1RU3A 7REQA 4AN1A 2HEGA 3BG5A 4CKEA 4TQ9A 1NASA 1I0LA 5FNVB 4DUYB 1Y6ZA 5AJYA 3VO8A 5H80A 4RIFA 1IHUA 2P2SA 2ZBEA 4EKGA 1GT91 2Z2XA 1GSIA 1QCDA 3DHYA 1URPA 4RO0A 3OURA 3TWTA 3U4TA 1AGRA 4U9IS 1XMVA 4H7YA 1Y5RA 4NOMA 5F33A 3SBEA 2J09A 1DQNA 4GDFA 3GPBA 1XTUA 2PNFA 1JMKC 4QM7A 4IIGA 3NM5A 3FUEA 3BFXA 4RG9A 2ERXA 1W1UA 2CLSA 2IP1A 3EBOA 3R7B