4I6JA

A ubiquitin ligase-substrate complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
507
structure length
503
Chain Sequence
b'ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 170
structure length 503
sequence length 507
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6jA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6jA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6jA01
2AKEA 2PXHA 1IQUA 4MW5A 3G5AA 3ZIUA 4DLPA 1F7VA 1N2HA 1O5TA 2CUZA 1V47A 1OBHA 4R2LA 5IHXA 5KHAA 2J09A 1ILEA 2ZUEA 1GPMA 4L2IA 2CV0A 3A4IA 1A8HA 4XFDA 4MW0A 1IHOA 3RBAA 1IFXA 1NSYA 1O95C 4CQNA 1MJHA 3QTBA 3X1KA 1H1TA 5HUJA 2TS1A 5IJXA 4I6EA 1H3FA 1VL2A 1QU3A 3KT8A 1F9AA 4FZJA 1M8GA 2DR2A 1M8PA 2D54A 4MW1A 4ZCSA 4Q16A 2X1MA 3RK1A 2CV1A 1MOPA 3UC5A 3ZXIA 3P0JA 1XNGA 4MUJA 4OUDA 4UZFA 1WY5A 1GTRA 3COZA 1N2IA 3CA8A 1T9GS 2HMAA 3PRHA 1JEDA 4MAFA 4KR9A 4EFKA 2CYAA 4NZPA 1U0BB 3COWA 4AS1A 2Z3VA 3UMVA 1N3LA 2QJTA 2RD2A 3H9BA 3CLSD 3KT0A 4EG8A 5LM3A 3AL0C 4AQ7A 2J4DA 1NUPA 1J1UA 1M8KA 5H7XA 1R6XA 1QU2A 4ZT7A 1N75A 3CLUC 4MWDA 2JANA 3CVYA 2WQ7A 3INNA 4J76A 4JXZA 1NUSA 1JHDA 1K92A 2C5SA 1N2BA 1F7UA 4R2MA 4BWVA 4ARIA 1PFYA 3BL5A 3QTTA 1OD6A 4KR7A 1WKBA 2QTRA 3NBAA 3PNBA 2J5BA 3GMIA 4DNXA 1EUQA 2PZ8A 2E0IA 1RQGA 1JIKA 1M1ZA 1YUMA 3SEZA 1NUUA 3ELBA 4EG7A 2A1UB 3ZGZA 3H99A 3HZRA 1TYCA 1VBMA 4ZT5A 5J5AA 3CVUA 1LI7A 2HGZA 1R6UA 3F3MA 3MMXA 4MVXA 4CDMA 4NAHA 4E1AA 1WXEA 2A1TS 1EFVB 2D13A 2XRZA 1YIAA 1FFYA 1U7DA 3H97A 4NX2A 4CDNA 3N8HA 4TS1A 5DASA 1KH2A 4MVYA 3FG9A 3ZJVA 2WB2A 2WQ6A 4KKVA 2BYTA 1TYDE 1OWOA 1KH1A 1G8GA 3Q12A 1X8XA 1GLNA 3FIUA 3HL4A 4EG1A 3DPIA 4MWCA 4MW7A 4RUKA 1H3EA 3N2YA 4WSOA 2GKSA 2GM3A 3NV7A 1I6KA 2IELA 1XNJA 1M8FA 1Y42X 1Q11A 2CYBA 2BTEA 1J21A 3DO8A 4ARCA 3CLRD 5FNZA 5TGTA 3C8ZA 4NAUA 4MUEA 1B6TA 1MAWA 1T6XA 1NUTA 3CVWA 4I6JA 2YWBA 4MWBA 3E27A 4HK4A 3PNYA 1O0CA 3ZJUA 3FY4A 1T9GR 1OWNA 1WXHA 1COZA 3GUZA 3ISJA 3LE8A 3P0IA 3N05A 1KAQA 1JZSA 1TYBE 4XFJA 3M5WA 2E21A 1KR2A 1CT9A 1OWMA 1NUQA 4KPUB 1EFPB 4ZCQA 5DB4A 1WQ4A 2J08A 1KP2A 1WJGA 2PG3A 4ZT2A 1WZ2A 1TEZA 2VTBB 4F3RA 1DNPA 1SURA 1TQ8A 3D6UA 3AG5A 4MW2A 4MUHA 2Z09A 2OV4A 2QUKA 3IOCA 5H16A 4X0EA 3Q4GA 4MUGA 4F4HA 2CYCA 2B7LA 5F23A 4EG5A 3COVA 1PFWA 3FHJA 4S1OA 1QNFA 1M83A 1JEEA 1OBCA 4HJRA 3HFJA 1GN8A 3UY4A 1O97D 3TQIA 4J75A 5DK4A 1T6YA 4YBRA 3FETA 4KR6A 3A2KA 2J07A 2VXOA 3TZLA 5HG0A 3ND5A 3U1VA 2CSXA 4QBTA 1O97C 4YP6A 3HV0A 4MQ6A 1O6BA 2A1UA 4ZCRA 1MBZA 4DDKA 3L93A 3PNVA 1VLHA 2CV2A 1S4MA 3IMGA 1MB9A 3FWKA 1EJ2A 3IVXA 3CLSC 1PFUA 2PZBA 1EFVA 2JA2A 2H2AA 3IUEA 1J70A 3FNRA 4G5YA 1YI8A 1MC1A 3FOCA 1FYDA 2G36A 2JAXA 3VGJA 4GU5A 2EL7A 3RJZA 3L92A 1NURA 1N78A 2QUHA 4NATA 4YMIA 4YP7A 3OP1A 4QRDA 1EUYA 1VBKA 2A88A 1K97A 3VU8A 4H3SA 1KKUA 1QRUA 1QRTA 4DE5A 3D6VA 2A7XA 1GZUA 1O96B 3IVCA 3AKZA 1Q77A 4K03A 4OJMX 2QTMA 1ZH6A 1I6LA 3CLTD 4ND6A 3COYA 4Q93A 1MRZA 1PFVA 1ZH0A 4MUIA 3SP1A 3AFHA 1NP7A 2DERA 1QJCA 1Q15A 3KT3A 1J20A 4XSVA 1ULHA 3SEQA 2O8VA 4MW6A 1G8HA 1N2OA 3MLAA 4U63A 3A05A 1JIJA 3FH0A 1QTQA 1HYBA 1PG2A 4HJXA 1O0BA 4MVCA 1J1ZA 1JECA 1N77A 1QQTA 3NBKA 4JYZA 1KH3A 1D2RA 5K0TA 2AZXA 1ZUNA 1XNHA 1GAXA 2A86A 1EFPA 1MAUA 3KFLA 3IMCA 4KPUA 2A84A 1PG0A 2HZ7A 1J09A 4MW9A 3UK2A 2VTBA 3K32A 1NZJA 3H05A 2E18A 1U7XA 3FDXA 2PIDA 1YIDA 2NZ2A 5J59A 3SDBA 5FO0A 1KORA 3IDFA 2X1LA 1EE1A 5TEWA 1TFUA 3X1MA 3CLRC 2DPLA 4U8HA 1WXIA 1KQNA 1K4KA 1OWPA 1IH8A 2I1LA 3IUBA 3P52A 3VRHA 1P7PA 1F4LA 2IJGX 3TS1A 3UOWA 4MUNA 4PBTA 1LI5A 4ND7A 2R5WA 4MW4A 5FO1A 2QUIA 3A04A 2V0GA 4G5FA 4I6GA 4EG4A 5TEVA 3DV2A 1OWLA 2WSIA 3RFFA 1O95D 2V0CA 1NI5A 1NYLA 2QUJA 4UZEA 1Q19A 5J58A 3ZXSA 3K9WA 2E89A 3PXUA 3SZGA 4DJAA 3ILVA 3G6KA 1KAMA 1V8FA 4MUFA 3RK0A 1KP3A 4GRIA 1JMVA 1H3NA 3AG6A 3CVXA 2PZAA 2YWCA 2QJFA 1WQ3A 5LLTA 2ZP1A 4K0RA 1TYAE 3IH5A 5KWVA 4DDMA 2DXIA 4G6ZA 1IVSA 1JIIA 2ZUFA 3SZ3A 2PFSA 4WNYA 3KT6A 1O94D 2A4MA 4U7JA 5AHWA 2DETA 3GLVA 1JGTA 2A1TR 4L2IB 1ZJWA 4MUKA 2QJOA 1O96A 4P2BA 1G8FA 3FI0A 4DDHA 1LW7A 4RPIA 2QTNA 4HPWA 4EG6A 1MB2A 1O94C 3SYTA 3CLUD 4EG3A 4PY2A 3ZJTA 3IODA 2YXNA 1G59A 2GOYA 5DEOA 3ZUGA 4ZT6A 3HMQA 5TS2A 4CT0A 1IRXA 3IOEA 4MWEA 4OUDB 4EGAA 4QREA 3H9CA 3LOQA 3CVVA 3MUEA 4NDAA 2DEUA 1I6MA 3CR8A 4MVWA 3P0HA 3S3TA 4JFAA 2XRYA 4PBRA 3IOBA 2DUMA 2RE8A 1N2EA 2YY5A 4MLPA 5KCMA 1EXDA 1IQ0A 1XJQA 2OQ2A 1KQPA 4YP5A 3G59A 3MXTA 3RHSA 4ZT4A 4EF6A 3CLTC 3ND6A 1BS2A 1I2DA 5HUHA 4PBSA 3AIIA 3IMEA 3I05A 1IQRA 1WXGA 3N9IA 1UFVA 3LCJA 3ND7A 1T6ZA 1QRSA 3DLAA 1WOYA 3QE4A 1N2JA 1K4MA 2EJCA 2Z08A 1U3DA 3JXEA 5LFAA 1KQOA 1N1DA 3OTWA 2X0KA 2X3FA 2CFOA 4ZT3A 1U3CA 1YUNA 1VBNA 2H29A 2AG6A 2O5RA 1JZQA 1R6TA 3IVGA 4JZYA 3TZEA 4A91A 1N2GA 4R0NA 3TQOA 2CT8A 2D5BA 3MLBA 1M8JA 4MULA 4JXXA 1YULA 5JBNA 1X6VA 3TNJA 5BNZA 1JILA 2IP1A 3X1JA 5EKDA 2DLCX 4ZCPA 3Q10A 4ZCTA 3HGMA 5K0SA 1WXFA 1GTSA 2NSYA
chains in the Genus database with same CATH superfamily
3C3CA 4DREA 2I71A 4OB8A 1XU4A 2IYZA 2SCUB 3WGNA 4UHBA 5TMEA 1IB0A 1G60A 3UUEA 2ONDA 4JA0A 1AU9A 3P9NA 4Q9LA 1Y33E 2XUKA 1H3FA 2JAOA 3U7QA 4FK8A 2QZSA 4DUIA 5K4HA 4XPZA 4DMRA 1EIWA 5KTYA 5IF3A 1KVRA 1LDBA 5SY6A 2K2WA 3T12A 2I76A 1P1FA 3K3PA 3U49A 4AZVA 4OHFA 3TMAA 4V2UA 2GYWA 3K6KA 2W2XA 3CZ5A 2QTRA 4UNRA 4S2UA 4BNVA 4FBLA 2GXSA 1HY3A 1B3BA 3R9KA 16PKA 2G77B 1M67A 1CEEA 2QJWA 3RUFA 3L0SA 4FU0A 3QVOA 1NMZA 5DI3A 2LP4Y 1YV9A 5DGCA 2JJ2A 2FXVA 3PNLB 4NXNB 1XROA 3ZHQA 1M66A 2PUWA 4M0EA 3FTZA 2J0UA 1FRQA 4JT4A 4F6RA 1W2GA 2Q99A 2XA1A 3IUYA 5J4KA 3I6IA 2RIPA 4NENB 4HNRA 3ASYA 2AGVA 1M73E 1AKNA 1OBCA 1R3DA 4LJ6A 3BD8A 4N6GA 1RYMA 3GQVA 5GZ1A 3WL3A 1WG0A 3APCA 1E1CA 1TZCA 3S29A 1HLPA 4P3YA 3K1TA 2XOEA 3R2JA 4OREX 4ZV4A 1L5OA 4M6WB 3OFNA 1U3TA 1BMDA 4JLMA 1A7AA 3FOEC 3L82A 4GAAA 3W2FA 4RKRA 5E7MA 5IH3A 1NBMA 2H4WA 5T5QA 1VCNA 1I4WA 3PLRA 1JHRA 1MA0A 4M53A 1LV7A 3K5IA 3KC2A 3GJ3A 4C6RA 1IMJA 3T3IA 3BJRA 4RK4A 3J5PA 5A5VA 3ROKA 3GA0A 5CLQA 1RRFA 3FPSA 4YRGA 5HSGA 3B60A 5HKLA 4Z5XA 5JEEA 1EQUA 3CZCA 4KVGA 5DRYA 3MAGA 4EEKA 1TC2A 4Q05A 1XEWY 2X5OA 3PA6A 5CA1A 1NXTA 3NNNA 4EJSC 3H42B 2LTAA 4C7OB 4FR0A 2FX2A 3L2OB 3HPRA 2GN0A 2A9JA 2ST1A 1JEQA 1X81A 2OP1A 4QJBA 2B83A 1SQ0A 3W9FA 2Z58A 5L3QB 3D59A 3WLIA 5DX1A 2RHBA 3KOXA 4BLPA 5KVQA 4P0QB 4JDUA 3U1BA 1E3QA 5ULLA 3FPKA 2PZKA 2XTZA 3ILVA 1KO7A 3CZ9A 3LYAA 5TLSA 4EB0A 3CF6R 2X2OA 3DP9A 5JYDA 2QN3A 2JK1A 3W3ZB 1BS9A 1F2TA 4B45A 3R7WA 5EQDA 4YCSA 2H2DA 1GHTA 4Z3OA 1TQDA 4JU8A 4AF7A 2H52A 1P5RA 4KLNA 5CLHA 4FHZA 3I3SR 3ORQA 2D5AA 5JS8A 5EJ8A 3I6YA 2HADA 3IR7A 3DWFA 1XL0A 3SC2A 2F8YA 1TK3A 3CHQA 3DEAA 2C98A 5E75A 1E1RA 1E5DA 5AUNB 3ZQUA 3RUCA 1ZEJA 5HYVA 4E14A 4MO2A 2EJUA 3KR2A 4IIDA 4P82A 5KDDA 5GVRA 4LXGA 4FCVA 5IC6A 5CA0F 4B4OA 1FBTA 1QCCA 4NFHA 3DT8A 4Y98A 3H4TA 4D98A 3WK9A 4HY3A 4JLKA 2UUAB 4DXAA 4LMBA 1I1OA 4MP3A 1OFUA 5HQ3B 3OMWA 4R31A 4GZMA 4RZXA 5BYJA 3RS0A 3L4JA 4ZREA 1ZONA 4IMJB 1JMKC 3FWYA 1P6UA 4C7VA 4MW1A 2I9KA 2WXJA 3W2EA 4YRJA 2VDWB 4REQA 1FUEA 2IO2C 5LCXA 3LQQA 3LUPA 4AZTA 3P9RA 4DMFA 2QVXX 1SB9A 1D9SA 5BN4B 4AAYA 5T6MA 1O08A 3KT0A 4YDWA 4LGCA 1UEJA 2H5EA 2HUPA 3HV2A 1B8VA 2LGJA 1ULUA 5G02A 3AJAA 5TIIA 1JQ3A 1ZMTA 4NBSA 3EPHA 1DFGA 3BEDA 1QGOA 2QYOA 1PEYA 3DVSX 1LI7A 5HF8A 4NIKA 1CY4A 5GIOE 5FUMA 4RDCA 3TTXA 2FPXA 4YJ2F 3OURA 1JTVA 4UUPA 3O0TA 2C5GA 3CSTA 1BXRA 4PIMA 2XDAA 4N0DA 3ZVKA 3IV6A 2L0TB 1AUXA 4GA1A 2P30A 3DLHA 2VYND 3OOHA 4XWTA 1E9VA 2W9XA 2UVPA 1MENA 2P91A 3P97A 3FBGA 4FC6A 1M6YA 2ZYGA 3EA4A 4LZAA 1TECE 5L40A 5EE0A 1OCOE 3T7IA 2BRUA 2E2WA 1MD9A 4NEQA 1GKUB 3LHSA 2XGGA 4K9SA 3IKTA 5T57A 3DMYA 3G9UA 2EBWA 5FL7D 1BYIA 4DM3A 3U3MA 1HF3A 4BN0A 4C0XA 1SD5A 2R6R1 3QHPA 1TIKA 4DCUA 3W3AH 1A7UA 2EHJA 4BV8A 1O97C 4DLRA 3HV0A 3UQ3A 4GI1A 4GTTA 3VR5H 5IAJA 5B1BE 3R5SA 3E3NA 1C0EA 1JXOA 3B1ZA 4ZYTA 1SWWA 1NXWA 2ERYA 1QF6A 3SE0A 2X15A 4IQFA 3AUFA 1MT3A 3Q3HA 4Z8XA 2Q2QA 1D1TA 4GLLA 2ZIFA 1KHTA 4Z8YA 3BKWA 1ZDMA 5B4VA 4NY1A 4B48A 4KDFA 4MQ4A 1PFVA 5HZHA 1ODTC 1SULA 3IP1A 2FSIA 3TRFA 3ZDEA 4WLVA 1GPAA 5BO5A 1O0BA 2BIFA 3H8SA 3M1YA 3F73A 1FSPA 1KGSA 5L4NA 1YVRA 2OFPA 1PT5A 1GG8A 4IJMA 3L6OO 2Q5FA 4YRDA 1PT7A 1SUEA 3UIOC 2ZYVX 1B74A 5H1YA 4EY3A 4FYIA 3UCFA 2ZVDA 4LC0A 4MUNA 4MGKR 3D9QX 3EAFA 1ONPA 3THYA 1II9A 1MA3A 2AFHE 5JZ9A 1BDMA 2WSIA 1MJGM 1QO7A 4EL5A 5F2NA 4FE7A 5DHFA 2YWXA 1UBEA 3LGXA 1TYAE 4TWJA 2BMWA 2GZDA 2QWXA 4CCWA 2WZDA 2ZAIA 2I34A 4MUKA 3Q72A 1LJUA 3A9RA 2VYCA 3AFGA 3ELWA 4JHRA 2UZ3A 3RF7A 3AILA 1M5RA 3WYBA 4Z4EA 1V6SA 2QKYA 4JFAA 1P33A 3ZJ5A 4WNIA 4B83A 1N2EA 3U7EB 3WLPA 4F9FA 1NG9A 4DRXE 2ARKA 1KR5A 4QT4A 1U8ZA 3ZV3A 3DOFA 5EYPF 1KDVA 2AR0A 3ULQA 1FJHA 1NA0A 4QQIA 3M9XA 3PH0C 2J3IA 4RK0A 4XWAA 3KSBC 2GASA 3W6NA 4PR0A 3A31A 2YV2A 1Y7LA 4B7XA 1JU4A 2H4YA 2J0QA 5K8IA 1ZHFA 1UBUS 2ECOA 4HNGA 3M3HA 3GFGA 2FWPA 5CNIA 2C8KA 4BRZA 4G1FA 4EB3A 3U4QA 4M7WA 5L3SB 4CLRA 4RW0A 4JJIA 2C7VA 1W2WB 3UM3A 1MZCA 3I5AA 4MMXB 4MR8A 3PGA1 4R2LA 4M7PA 1UBCA 5ALHA 5KYWA 4EBFA 1SD1A 4UEWA 2QP3A 2OLEA 4ZZIA 5EYPA 4KGDA 4ZCSA 3EW7A 5AI0A 3IRVA 1CUYA 4YAEA 2PX6A 1DJMA 1T9GS 1THGA 3DPDA 1HDEA 5THXA 1TJFA 4N03A 1NZNA 3AOGA 2V6JA 2WT8A 2EIME 2ADOA 3R7FA 1RD4A 3BE5A 4BT8A 2AX4A 1QTIA 1KDYA 4YMHA 3PRYA 3ICCA 4I2VA 2JLBA 2ZRKA 1LDNA 1UXHA 4MVJF 4CCAA 4MP6A 4BV3A 3THSA 1ZCZA 4DLTA 2FWRA 1R9JA 2C8JA 5IY5E 4Q37A 2V7TA 4L72A 4BEPA 3RSSA 1PT8A 1WPXA 1WM5A 5E4JA 4CQLB 4UPEA 3NWJA 4AO6A 3RWOA 3N8HA 5HOQA 4P5PA 2IF2A 3K2EA 3R3ZA 4ISBA 4LIPD 4IRUB 4HO1X 4QOJA 4JP2A 5C2YA 4BDSA 3Q8KA 2EWVA 2V5FA 3ZWMA 4LDRA 2W8BA 4RF3A 1OFTA 1T9KA 3DAPA 3TYXA 4QTYA 3RFXA 3ZD8A 5EKXA 3FUWA 1YDMA 4AQYB 3RKVA 1RWVA 1COZA 4LHYA 3AR8A 2EKZA 2OENG 3NZEA 4HAVA 2ALJA 2YASA 5A9SA 2F43B 4ZQCB 5BW8A 1T3HA 4AZWA 4R3NA 3BT7A 2CUTA 4ZCMA 1Q95A 4HDOB 4G5HA 3OIFA 1VE3A 1CUHA 3VH2A 3BXEA 4QUKA 3ZVNA 3SMQA 1GUZA 3KWLA 421PA 4EUEA 5AM0A 2YWEA 3TW6A 1AKRA 3W5JA 1N0RA 1UM9B 4KRFA 3DAOA 4XLZA 4QELA 3SWWA 1T24A 2I3GA 2XADA 5CRUA 4QQNA 3DVAA 1G6OA 1DX4A 3STHA 4JT8A 3FLMA 3G2SA 2O2SA 2MSNA 3R0IA 2B6CA 3AJ9A 1EUCB 4DMUB 2VRCA 1Y63A 4K3VA 4BB0A 4R8MA 2OEWA 2DF8A 2COUA 4AXBA 3EVFA 2VF8A 2V45A 4IP0A 4TYWA 3W2GA 1MAUA 3SYNA 3HCBA 1NYTA 4FWIB 2J33A 2GVZC 1C1YA 3BIJA 1C7EA 1N9KA 4F8EA 1IZ9A 2Z1DA 3FPAA 4E3WA 1Y3BE 1M2GA 5CT5A 3LEWA 2CXUA 3N7TA 4KIGA 1JDZA 1G16A 1GZHB 3E6AA 4Y2QA 3BJEA 1FVHA 4C4AA 1JH8A 4HYQA 4KYUA 3EEIA 2VWPA 2YCLA 4CKWB 3FTVA 4US2R 3U7FB 2SKDA 1E6WA 2DXIA 4R2JA 3LC7O 1V8BA 2IX9A 2W90A 4EDHA 1GSAA 1OTHA 2PO7A 2GUWA 2O1XA 3EGIA 3LCCA 3QPUA 3KXLA 4NZ9A 2IZ1A 3EA0A 4V38A 2ZXUA 1Z0AA 1G59A 2P67A 4QYXA 1OROA 1SK8A 4C5BA 4FI3F 2OSBA 4TL6A 4CM7A 4J16C 3LQ4A 4JJEA 4WWHA 3B6MA 1LTKA 1EDEA 1SUSA 4EQZA 5GONF 4V0ME 4H16A 4G4SO 2XVXA 4PLPA 3BFVA 3WE7A 3JSXA 4KODA 4EQ6A 3R7QA 4I50A 1ELRA 1P4RA 2XZOA 3N2NA 1NYRA 5IASA 4NIMA 1NHGA 1EHYA 1JQDA 1N4DA 3K0FA 3GCGA 2I6SA 1INZA 4UUAA 3NWBA 1XF9A 1EFUA 4EPZA 3RTAA 1IZYA 1RPJA 3ESZA 3WL5A 5FJIA 3DBHA 4JA2A 1D8AA 4LRTB 1PJBA 4R0NA 1QV6A 4I9NA 1FT1A 1FTNA 5B7NA 1WDLA 3MGGA 3HIZA 1JXMA 1P6XA 1Y8CA 4G4JA 3B6EA 1P7YA 1M1YA 5GONA 4O4HF 1F8YA 5IHXA 3AVUA 2J09A 1B8UA 4K6FA 1F8UA 4YHHB 3C8DA 2WM3A 3ADOA 3FHLA 2CLLB 1YRQA 3JZFA 1RXCA 3L0OA 5F33A 3GGOA 3QU5A 3TG8A 1CFJA 4A27A 5I9LA 1KT0A 1RXUA 3BE4A 3Q9LA 5BT9A 2PAAA 4DM7A 4IZOA 1E6EA 1TUBB 3CLSD 4J90A 4CIDA 3T5GA 4LRWA 2DWZA 3EF3A 3OX2A 3ER9A 1U8UA 3ZEFA 1Z2CA 5DSZA 1XMOB 2BFEA 3R6GA 5DBHX 5BWNA 2OUIA 1JVSA 2IKQA 1ZGAA 3CH6A 3W90A 2Z6QA 2XTMA 4RVFA 5LB4A 1C2YA 1ZBDA 3OFVA 3ELBA 4M0LA 1YS4A 1SCUB 2X3YA 4V24A 1VBMA 3LIPA 3LKUA 2A5JA 4ENSA 1M2KA 3BTVA 4RLHA 3VJLA 1WSAA 3K0HA 2WMOA 4GMXA 2OBXA 2DZDA 3BC1A 5FOTA 2GBGA 5E1MA 4PU0A 3FUIA 1JLHA 1VI6A 2RAUA 3NHPA 1GADO 1XWIA 3GFPA 1U7OA 5C32A 1TCAA 1E3IA 4DC1A 4BVLA 2IPMA 1HI9A 4C4SA 3F78A 1E1NA 3KO8A 3B1KA 4CL0A 3JQAB 3Q0TA 1XQYA 4ITRC 3EDTB 3VGPA 1EX6A 4ZQHA 2YHEA 3TK1A 3BFJA 3Q5GA 1GCOA 2FEPA 3NGLA 2GESA 4LOAA 5I9MA 1QF7A 1A97A 1PGQA 1DG1G 1EI9A 3L5OA 1ZAKA 1FP7A 3SJ7A 3ER8A 4BGUA 2BBOA 4F38A 3PS9A 4GOJA 3A2KA 3HC7A 4YUVA 2F8LA 1O1SA 4H18A 3IILA 5DGHA 1G3RA 1ZKMA 3ND5A 1OIVA 3PNQA 2BLLA 1OC4A 1RXYA 3RE1A 5EJ6A 3MEQA 2YJ4A 3P2YA 3Q3IA 3ONNA 3C8UA 3LUKA 5ALNA 1UXGA 3MZ0A 3BWXA 2O8DA 2PBLA 3GEEA 2W11A 1LK5A 4ZJYA 2JCBA 2M6LA 2DP4E 3BG5A 1X7XB 3KEGA 1EWKA 1E6MA 2WWHA 3ABSB 1I6LA 3H2JA 1WHTA 2O0KA 1ZH0A 1VECA 1C1DB 3G0DA 3CUUA 2DERA 1A9XB 1P2GA 1CIPA 4L75A 5HCNA 4B7AA 3ONDA 2JK0A 4IG4A 5ESRA 1C8BA 1T9HA 2PZIA 1PDVA 2RG1A 2WXNA 1LF8A 2PIAA 1TB4A 3CTPA 1II8A 4D25A 1LFDB 4LFBB 1SKUA 1X80A 3AF3A 4RXUA 5J59A 3OETA 3U44A 2PQMA 1UL1X 4JJFA 2OM6A 2Q4TA 4QPCA 1TL7C 4M8LA 4ZO7A 4JBWA 5FDFA 1Z8NA 1M74A 3NS7A 4IOJA 3EDCA 2CLCX 2O0HA 4L08A 1BW9B 2C99A 4JS0A 5FOSA 1ISGA 10MHA 5E3HA 4RACA 3T3NA 1NV9A 1V9CA 3EMVA 2HQBA 4LY9A 3UGJA 1AX9A 2CXSA 4I5IA 3CZPA 5ADHA 1B0AA 3ZV5A 1QUFA 2BV3A 5I9TA 3NMUF 1L8AA 3QF4A 1Q21A 1E9SA 3P96A 2PKCA 3R9IA 2Q5IA 4ETWA 3S5JA 3QLUA 1IEVA 2C96A 5KI6A 4BB5A 3IKVA 5A4KA 4F4JA 4YMWA 4XVCA 4D9BA 4WKOA 5K0BA 3PDCA 3VKWA 5FQ4A 4TTTS 4TT8A 3MQ4A 4J1SA 4OHXA 1SKQA 3GDHA 4KI0A 2P9GA 3PVLA 4EJ6A 5D6NA 3K70C 1S1CA 5G3ZA 2BMAA 1YDWA 4B3GA 1HDZA 2AF4C 3KS2A 3HWX1 2O8EB 4R8KA 2FEZA 2C8VA 1GTVA 2IPOA 3L1UA 3IOMA 2EBHX 2QY6A 1SKAA 3K92A 3UJ6A 3MJ4A 1C9MA 3KB8A 3U09A 4ADSG 3M5PA 1UW4B 3V7YA 4ZIRB 1GL6A 2MSCB 2C2KA 3UMVA 4J49A 2J6HA 4MPPA 4ML3A 4M1YA 4QBIA 5B3JC 1JCQA 1KO5A 5KSWB 2FO7A 3JD2A 1UBMS 2HIAA 4WZAB 4CMAA 4BWVA 3D7RA 4BTBA 2WA2A 3G9TA 1EVIA 1EG2A 4RPCA 4E32A 5ALZA 1KFCB 3FVWA 1IZ8A 1RLUA 4JGBA 4CJXA 4BT9A 1OFHA 1L7OA 3K4HA 4BMDA 4Q82A 3IYLW 5HCIA 2C1XA 4G5GA 4D9MA 4LNGA 3KZXA 4ZQBA 1SBNE 1YIAA 2BD0A 2CNNA 2YW9A 4RS3A 5CXUA 3CEAA 2VGYA 3A6LA 3CEPB 1G8GA 4U1RA 4Y0AA 1TYZA 2DFVA 2I67A 5BWMA 4IVNA 3TPZA 2QV0A 5IM5A 5EWMA 3S7JA 2NYJA 2PCJA 1K7YA 2QG6A 1KDRA 2X40A 1NVBA 3FY4A 3AL2A 1YRYE 4O5AA 1UJKA 1YHZA 4RFSB 2JGDA 4YJDA 4XM0A 3QWHA 4WBXC 5D87A 3CHRA 2VTBB 4BC1A 4UBJA 4MUHA 1ENOA 4AT1A 3QAQA 1MQ9A 1QB8A 1E6LA 3PENA 2W6IA 4O63O 1NJ8A 5FA5A 1RAIA 3OLWA 2ZOSA 3MINB 1SXJA 3F9IA 5D85A 5JW6A 1DKQA 4HDCA 1BCSB 4R6XA 5JXWA 5HJ7A 3DW3X 3AESA 5LX8A 1HZJA 3DT9A 2XEVA 3JRNA 5HTKA 4BIMA 3KTAB 3TG2A 1UR5A 1U7UA 1L5JA 3Q88A 3PQ3A 2GEVA 4ACLA 3L7IA 3AYZB 4DUGD 2RJOA 2VG8A 2QXTA 2VR1A 1YUBA 4OKIA 3CB4A 3EOBI 4PG8A 1H93A 4XM1A 4U7WA 4P3OA 1ES9A 1I7PA 1U0SY 3NHRA 2NOAA 1B89A 1N2OA 1XZBA 2DY0A 1JA1A 5JPIA 2INGX 4AZ3B 4MLZA 2W83A 5IF9A 3NWEA 3JWGA 3PPIA 1U7PA 4DIKA 2JD2A 3RRMB 4G09A 3CH4B 3SI7A 1AB5A 3H5LA 3D6AA 3QXGA 2NZ2A 3U4CA 1EE1A 3MSCA 4MROA 4KSCA 5IPFA 3PHHA 4O3FA 4OQXA 2BKUA 1J5XA 2PWYA 5FYQA 4WKNA 3PWSA 2UUBB 3E1KA 5B30A 2H0QA 5LQAA 1FDRA 1Z08A 4WOKA 1ZJ5A 5KYXB 2Z0MA 2XNDA 4BQNA 5F77A 1C4XA 3ZKJA 4OEHA 3CE6A 3ESDA 2H5JA 3W04A 3VZPA 1L7VC 1BGXT 1H0KA 2XQGA 3CNHA 1OYOA 3IIMA 4J0IA 5A03A 2EP8A 1JHXA 3ZY6A 4LF8B 1XGKA 1AA6A 1J33A 1Q22A 3FUMA 2BR4A 2IYYA 2O7QA 5I4KA 4QJ3A 4DKJA 3H9CA 1YOVA 4GL2A 1U9YA 2QVYX 2C2ZA 1B23P 4P4SB 2C82A 4CUZA 2R8XA 1ZM7A 4QG3A 5H7PA 1D2AA 1YMVA 2D2IA 1XMJA 1J6UA 1SPXA 4EPYA 2PJZA 3RAJA 4YRSA 5JH7F 3M33A 2FVXA 3JXEA 1KQOA 3U0BA 3Q87B 4MZXA 1I94B 4JFRA 2YNQA 4D92A 1AQUA 2YHSA 3M4ZA 1JDPA 3E7XA 4KK3A 1Z0KA 2VK8A 1EWVA 1RW4A 2CT8A 4DUPA 2X4LA 1A5TA 3U13A 3C98A 2VQ2A 3WK8A 4QUBA 4D45A 1X86B 1T1SA 1SCDA 2FZ4A 4FULA 1VLLA 1LBSA 2CHQA 4FGJA 4I1RA 3L0YA 1O95C 4OH1A 4LTDA 1MX5A 4PZ9A 2IITA 1ISJA 3T1QA 4WWNA 3HB4X 5BR8B 2XH8A 3CA8A 2PKRA 4UQOA 3FF4A 4MZDA 2QI9C 4Q4JA 5K7SA 4J0GA 2NNLD 1JEYA 3DLBA 1S2LA 3OOEA 4QULA 5KVVA 2B4QA 3IBEA 2Q5JA 1ZMRA 1B8OA 4MMYB 5MDHA 3VTFA 3MWFA 2AUMA 1LK0A 4ARIA 1IOLA 1XTVA 2YQ8A 4CMEA 4P81A 1Z5VA 1LLCA 3VNSA 2PMWB 3BQOA 2WMNA 4FX5A 3T3DA 2FP4B 1H8HA 5CXXA 2PSFA 1NPDA 3E05A 3P2JA 4D81A 1VG8A 1JFSA 3KQNA 4CEHA 1JIUA 1AKEA 5EXXA 3UANA 4GM1A 4FE4A 3EZ7A 4WSOA 2HRQA 5J2UF 3A11A 1E7SA 3PSAA 3L4KA 3EBPA 1NZFA 1SQGA 2YWBA 3SO8A 2YDXA 4XLLA 3CRW1 3Q9NA 4G11A 3EVBA 4IF6A 2P9KG 4IV0A 2X5JO 5E6SB 1SC6A 5T4EA 5B36A 1BRTA 2WIBA 3IHWA 2I7DA 5F23A 3AM1A 2Q5QA 3M6IA 2JNWA 3LLVA 2POCA 1V11A 3BDVA 2B1JA 1KMQA 1TAQA 3UWPA 1OE0A 3HVIA 4KR6A 5LP6B 5KUTA 1IOVA 4Y30A 2OYCA 2IY9A 4DAOA 5JSYA 1DRWA 3CZ4A 1RAAA 4B4DA 4JHXA 1USGA 2CMGA 1MC5A 3K0EA 3UKRG 5I4IA 4J43A 1J70A 1E2LA 4MR9A 3SZRA 1YB5A 3LBAA 2X8JB 4FC8A 4DMMA 5I9NA 2B0CA 3IIIA 1TC1A 4PV7A 1QQ5A 3LPLA 1YA4A 4AM8A 1RKBA 1ENPA 3ER6A 3I34X 4C4ZA 1SOWA 3NAQA 4H7EA 1D9ZA 5T41A 2FEXA 4PLTA 1XHFA 3BUSA 4EX6A 2K4MA 3KAJA 1J42A 1F5NA 4EPRA 3CGHA 3BU8A 1JYEA 4UTVA 2HO4A 1DAPA 3RK4A 2Z4SA 2WP0A 2ZR7A 4OLBA 3H86A 3SX2A 3K9FC 3FYCA 1GTMA 5KU7A 3SBTB 2WZBA 2BR3A 2HDWA 4F12A 2R5WA 4LZWA 3D6HA 5IAEA 3FWPA 3S2SA 4YASA 2VH1A 1DAGA 4AN4A 3UM9A 4UVEA 2ZUUA 1L4LA 1OXKB 2Q1UA 4G65A 1TR4A 2C2XA 4MS1B 1YC2A 5GM1A 3ZD9A 1E2JA 1T5LA 1TVEA 4BESA 4RZ2A 2XIJA 5BWBA 4ZZ0A 2GBLA 1SGWA 5KYUA 5HKKD 4MSUA 3ULEG 2CB9A 5KQLA 5BXUA 2QG9A 4X1IA 1TRHA 5CFPA 2FJ0A 1BX3A 1X3SA 1SC4A 4C6HA 3AU9A 3IUPA 1UFOA 5DNWA 3EZ2A 1WXWA 2F7SA 4FIZA 3BWCA 5D7NA 4OAUC 1WZUA 3EQ9A 4JBXA 5AVRA 4RD2A 2PRKA 3RU9A 2K5UA 2HRDA 1VB5A 4ER0A 3A14A 2BF0X 2Z08A 3I42A 1G3UA 4B3IA 1I9GA 3JZMA 5M2QA 3N70A 1GNLA 1IY8A 1GAEO 5ALRA 1EK5A 5CIQA 2GPAA 4AJLA 3H11A 2GRNB 5ANLA 3G9QA 4UNQA 2Z8XA 3LWNA 1XWWA 1EA5A 4ROSA 5TQ0B 1NZDA 1R7RA 5E1BA 4YCBA 3AG3E 2PRYA 3IAM1 3EZFA 2E82A 5WRFA 2HEIA 5HGJA 3VU9A 2YUIA 4F6LA 3BF7A 2ZE8A 3H04A 4PFKA 3A06A 3TDNA 4IJVA 1YJQA 2GEKA 3K9NA 3PD7A 2BTQB 4IIUA 3T1HB 3HH8A 2LPMA 3EMKA 1AHPA 4ZEWA 4MARA 2D0IA 1YR2A 1U0BB 2WYOA 2NXPA 2JLCA 3WP1B 5CVVA 1WTCA 5FI5A 4XWYA 4CG2A 3WOVA 3FAKA 3ECAA 3JQRA 4IVPA 5CIYA 1WMBA 4ER3A 4IIJA 3R7LA 3RBZA 1QJ4A 2HCBA 3IUSA 4IR7A 5DHQA 1PFYA 1WUKS 2C3PA 2RI1A 5BQ5A 1ACJA 2EFGA 3ESBA 4E07A 1NUUA 4WNDA 4BJ1A 5GV7A 2L2QA 3SVZA 3CY6A 4CDMA 4JEIA 4O60A 1VIMA 4OPMA 3JQ0A 1R50A 3ZWQA 1ZCAA 4PLZA 3HFRA 4C20A 3JV7A 3KQOA 4EG1A 4DHEA 1EESA 3D8HA 4MWTA 3PFGA 1GR1A 5HKOA 4QWWA 3OOYA 5EUCA 1BI8B 5FZRA 4RXTA 1J9EA 1T1RA 2WPDD 4G36A 5BSTA 5AESA 4Q6WA 1CT9A 5AJYA 5ALEA 7ADHA 1X7YA 5CCXA 4BPBA 1NA3A 4JVSB 2HFKA 1GY8A 3OTIA 1UC9A 3STYA 2P5UA 2QRZA 1K7FB 3QA9A 5E7IA 3SNKA 4DIFA 1C3EA 4ZAWA 4J0EA 3DCJA 4L9RA 5EE3A 3GT3A 3PZ4A 1FYVA 1NXOA 4D6XA 4TWBA 4XI9A 1UH5A 5JARA 3AX6A 4JXTA 1J39A 1E9FA 4GWKA 4HVAA 4QQRA 3WGKA 4NNOA 1TTQB 1QBQA 4R5HA 4XIIA 2OYSA 5F5NA 4ON9A 4WLUA 1ECLA 2GF0A 2FPRA 1G8JA 4E5SA 1W88B 1PD0A 5D01A 4PLVA 5MN5A 2I4NA 4WQMA 2PR2A 5KINB 3VR3D 4BLQA 3TBFA 1Z7EA 2FDRA 4JBLA 3HFSA 3GPLA 3KZKA 1MJGA 4OXXA 3ZWBA 4U63A 1U8TA 4LNHA 4WXHA 3NIBA 1CEYA 2CLFB 2R1TB 3KP1A 1S3GA 3TQQA 1NM5A 3QEOA 2WJIA 3EPJA 4MGZR 1TKAA 3UJDA 1U7XA 3DWGA 4FYVA 2JFVA 1RWNA 1FFDA 1PQUA 3CLRC 4UQZA 2CJWA 1RLJA 5JAQA 4N0EA 2GR9A 3H0CA 5JJIA 4K46A 1DKLA 2JS7A 3L22A 4NE9A 4F2DA 2YOHA 4TN5A 2DC1A 1GARA 2Y68A 3ZHCA 4INAA 4BB6A 2RHMA 2VZLA 3CEQA 3NW9A 2Q7OE 1L4NA 3PDJA 2W2VA 4PFJA 3O4RA 1KJQA 3FLBA 4ES6A 1KS9A 1ZXBA 3CVOA 5FWXB 3UAVA 2VDMB 4L85A 2EQ5A 4ILEA 1VPEA 3UC9A 3E9CA 5DGDA 5JDCA 1DFHA 1NJGA 5KCZA 2R2AA 3S27A 1KI6A 4XSHA 1YIOA 3AGPA 1FRVA 1NNSA 2Y1XA 5CH8A 4R69A 2OQ2A 4U96D 4P08A 4D1YA 4MKXA 5E3IA 5D6OA 1TCUA 4LYEA 1BLXB 2EFEB 3HZHA 4B5KA 3LX4A 1TE2A 1NLZA 3FA2A 3PDIA 3U7GA 4RIFA 3TUIC 3JAKA 1VHDA 3I4LA 3V1MA 1SU7A 2ZSBA 4OP1A 2J8ZA 4ZAZA 1J0AA 1IM8A 2H3HA 3B52X 3CKLA 2KCLA 1F0PA 2XNSA 4L0DA 2BHSA 1VYUA 2XDWA 3VLDA 1OB2A 3L1VA 1QH1A 2VUHB 1FDIA 3B8HA 3JYHA 4HEA1 3C87A 5F64A 3ZPJA 1KMMA 1XUOA 2P77A 4QE3A 4ACAA 5KAPA 1ODCA 5FBKA 1MJHA 3O2SB 3V79K 4ENVA 2AH5A 2H2WA 1XCPA 1W34A 1HG0A 1BQEA 3GZSA 2X0RA 2HMAA 4GX2A 4QGSA 2Q21A 3T94A 5IFKA 1B73A 4R4JA 2PL9A 4P3KA 1KOJA 4RTOA 2Z9CA 4NR0A 2QTZA 4NU0A 2VF4X 1J0XO 3AHHA 4FHEA 4O2BB 1TJCA 3KSRA 1AN9A 4U0JA 3P5SA 5CA1F 1TD1A 4OJNA 4ZDWA 1SVKA 3DZBA 3ELDA 4RVDA 3GLIA 3NBAA 2X42A 5KQPA 1I1QB 3NC1C 1JS1X 1XRMA 3I04M 1YE8A 2WHPA 4GZLA 3E35A 1C4OA 2A1TS 2FQQA 1FW6A 1K27A 1OBOA 5GINE 1LC0A 2Y0DA 1NMQA 1VE7A 4GGPA 1CHNA 3MGBA 1LGYA 4O1PA 4ND5A 5JC8A 5COQA 3C97A 3N8NA 3WWDA 4D3YA 4D7AA 4F7WA 4R8RA 1BWRA 3ANLA 1W1UA 2AFIE 3F4LA 4A03A 4YDOA 3HR4A 3GI1A 5IDYA 1XU9A 4F9TA 1RXIA 1NI1A 3AG5A 3N53A 4IWNA 2EKQA 2ODWA 4G8CA 3CKCA 2PMDA 2GDZA 3BREA 4R8LA 3PYLA 2CVZA 1QV7A 1CY2A 1VB3A 4TRMA 1ZHHA 3R5KA 4J7CA 4QBTA 3WIBA 5ENPD 4EPVA 1ZI8A 3PP8A 4UHHA 1PVVA 1YZ3A 4RVHA 4E7PA 2Q2VA 2AXQA 4HAOA 3FNBA 1QMPA 4PONA 4FOOA 3CWCA 2GZAA 2VQFB 3MBOA 3OP1A 2AI3A 3HCOA 4F3CA 4KZCA 1N7GA 3PYXA 3VPAA 3AHCA 3V8QA 1DBRA 2RAVA 1QK5A 3UUWA 3TGLA 3NHSA 1P5QA 1Z39A 1TJYA 2VEDA 4M0FA 3CHSA 3MD0A 3RU0A 1Q57A 4KE8A 4B34A 4RK5A 4YO8A 1EDDA 1EFLA 3M4YA 1K5PA 1ORVA 1JVBA 2C9MA 1GAXA 3IMCA 1LRLA 4D9FA 4EHAA 4B4WA 4Q4AA 3EIQA 2OAGA 2WUGA 7REQB 3MRXA 3T4PA 4RHEA 3ETEA 1LZLA 3KALA 3NAMA 1CQWA 2I7TA 1X1CA 5AK3A 1K1EA 4OA8A 3R3JA 3AS8A 1O54A 3SM9A 4EA6A 1UT8A 4CDRA 3WWCA 3AK4A 4FFSA 4AN0A 4UTZA 1U2GC 3CVXA 2C7OA 3SJBA 3PIRA 1Z8FA 2GCPA 1QZZA 4NI5A 4AMUA 4PSCA 3GEBA 4YVFA 1TIBA 4A4DA 5L53A 2OHFA 1YNOA 1E63A 3EVDA 4QDZA 3TGWA 1E99A 4BNXA 4XW2A 3QC1A 5JSHA 4CMIA 3T5PA 3AHFA 5COBA 1SZJG 1DPGA 1IKND 5EXTA 1LI4A 1AE1A 1NKTA 5H0IA 1A2BA 1JB1A 5C7LO 1NNLA 4PHFA 2X6TA 3RRFA 2ZBDA 4PX2A 4OH7A 3GJXC 4G0XA 3HKBB 5K8TA 4EF6A 4KO1S 5T4HA 1AK1A 1A71A 3X2SA 3W8RA 1WM1A 1NW7A 2ID4A 4M8SA 1Y9ZA 2A5GA 1Z5ZA 4CKEA 3GLSA 5ERYA 5F5XA 3TINA 1YC5A 3BTOA 5TGDA 4QASA 1YFLA 2X19A 1JTFA 4MITA 5JSZB 2PZEA 3ZI4A 1HS6A 1N2GA 2O1EA 2QR3A 1R16A 4MWOA 1UINA 4WCFA 3MT7A 2VPIA 3SZMA 2IU4A 3DFKA 1IQUA 1W0CA 5ELXA 4HFNA 3I61A 1JSZA 3KJEA 4B6FA 3VPXA 5KBYA 3IQZA 3GMTA 4Q7MB 3GEHA 5DCWA 3LKBA 3UA4A 4N82A 5SYMA 1IFXA 2JFXA 3OZUA 2EZ9A 2UY1B 3EASA 4IJWA 4M0MA 5K3OA 4LYYA 3V33A 1NF2A 2F8TA 4ZU1X 2Q5CA 4PPYA 4JKIA 2Q2WA 5FTWA 4IMIB 1ODFA 3DFZA 4LZOA 2LXNA 2OZLA 3DVRX 4UWHA 1YR7A 4MQBA 2OD2A 1N7IA 3RV3A 2VNSA 5EZ5A 2PO5A 4D43A 1E2KA 1PNRA 2ECQA 1G5PA 3PNBA 1PDWA 2ODBA 3HVHA 2IBTA 2JIDA 3EXG2 2Z3WA 1X1AA 3SEZA 2NO9A 2FW6A 4YDSA 3DSTA 1Z5OA 4DHWA 4IO0A 4UASA 5HEKA 2AEJA 1G4AE 1H9AA 2WSSA 3R3HA 5CW2A 5JNUA 2MMGA 1M9NA 2ZWAA 4P7JA 4C2BA 2BUCA 3N6XA 1ZL0A 4AJ4A 4C6TA 2QXUA 3BK7A 4RHUA 2GPJA 3ETCA 1QIGA 1PV2A 4KHZA 2YRFA 2J5XA 3IP7A 2CHWA 2B5WA 2N1BA 1E64A 3AFOA 3PITA 2FEMA 2WOJA 5IH7A 3GJQA 2J59A 2LO6A 3TSAA 3NPAA 4NZOA 5DRTA 1NUHA 3L07A 3ZQ6A 4HQOA 5AJTA 4KQKA 3WYNA 3SAJA 2NU7A 5ERXA 3IAHA 3GGPA 2ZBEA 4YAOA 3CISA 4LZLA 1WV0A 2QTLA 1SXIA 5BSMA 1R0KA 3U26A 5EIXA 4R01A 2UZ1A 3QK0A 1BDHA 3GB9A 3TLEA 3HU2A 4N5CA 4AJOA 3E7PA 1K4YA 1JDBC 2I2OA 1O6BA 3FFBA 4N76A 4QGFA 4CM3A 1ZEMA 4OFBA 4URKA 4RQAA 1QBGA 4GYOA 1EFDN 2XKAA 1V41E 5TNXA 1FXWF 3DV0B 3IQXA 2JCGA 5AKEA 5IU6A 3T9CA 4R68A 2IF0A 4I2WA 4MQEB 3BGIA 2YIJA 4RPLA 4JB8A 4MUIA 2GPNA 2PGJA 3Q5MA 1Q1QA 2P68A 4NCIA 3M3PA 1SK9A 1V5EA 3NBZC 4JGGA 1GXSA 3EQ2A 4DGQA 4B6GA 1EB8A 1YQWA 3M6XA 2PEZA 3HVEA 3HXLA 4GKBA 4UW9A 1BYUA 4O4JA 4H7IA 4C1BA 1IH8A 3MJDA 1FXWA 4GYYA 3INGA 4QXRA 4X93A 2UWJG 2A0KA 4WKCA 2X5KO 3TZ6A 3DO5A 1NC1A 3OQ1A 3E7WA 1X2BA 3T8KA 3QP9A 4ME6A 1N8TA 1V8FA 1L2TA 3JPYA 3D3KA 5LBUA 4Q4LA 5FJJA 3ZWDA 3QYJA 1WZNA 1FSFA 3MUNA 3WJAA 4LDJA 1O94D 3U4IA 1YD7A 2X6QA 1A8IA 3TECE 2HQSA 4RH3A 3ASFA 3S8YA 5JJ7A 3A1NA 1K3ZD 2N0SA 2OXRA 3L06A 1XTRA 6REQB 1BGVA 4E22A 4TVBA 4B9EA 1UJBA 3KNZA 3FUUA 2OZKA 1K3FA 2NO5A 3BERA 1FYXA 2XMGA 3CX7A 2QMZA 1YA8A 2Z5FA 2GTPA 3GRFA 4EWLA 4GKVA 3MHTA 4I8XA 1OLUA 2HEGA 4TKVB 2AB0A 2NVOA 2WWRA 2QP4A 4ZJPA 2FQYA 4Z0TA 3DTVD 5EWJB 2OXFA 4HDNB 5FIOA 2BDTA 4O6VA 2ZJOA 3CJTA 3EQ7A 3FPGA 4DV1B 1ZJ6A 3Q10A 5KSOA 3D0RA 5KJFA 3HG0D 2DSTA 5LQSA 2GGFA 4PIVA 1NXQA 2HYIC 2VHUA 3VR6D 1PUJA 3BCUA 1SIBE 4AOFA 1PR1A 1DVPA 3HXDA 2IIQA 3AQIA 3QTBA 3P9PA 3KD2A 3PCXA 2JG3A 2ANBA 3UPUA 3V8MA 3UKUG 3REGA 3LJ3A 2GN8A 3TLGB 5IVDA 1KNQA 2WWWA 1QQAA 5FHRA 4JHKA 3JD4A 4EHKA 5LYJB 3WIOA 3TB6A 5DWVA 3AL0C 2C04A 1XJCA 3MVEA 3HZZA 3UXEA 3QZUA 5DKFA 4ILHB 3KAEA 2Q8PA 4PLHA 1DWUA 3KQMA 4MQ5A 3T52A 3KKNA 1XTZA 2ENUA 1BVYF 2O9JA 1M2OA 2E87A 1J0DA 1DC8A 1F38A 4ETIA 4Q7LA 2ZI7A 3D8SA 3C1TA 3WZLA 4FNGA 3O8NA 4ZK2A 1VZ3A 4NX2A 4O4LB 3ZPXA 3E1SA 4IKPA 4PSKA 1K63A 1BJTA 2NUBA 4KITB 1CR6A 4X85A 4D79A 2XF2A 3A4MA 1K1AA 1ONSA 1CUVA 1HT3A 1KJWA 1IOZA 2PYZA 4V0OA 2XCCA 3RW9A 1ONOA 3NM6B 4HL6A 5M7EA 4EKNB 2QYSA 1OX4B 4UUMA 1OWNA 4MDEA 3NTXA 1DIAA 2A7QA 3SSMA 1M7HA 5ARFA 4BAGA 3HN7A 1TEZA 3C14C 3BFKA 1EP1B 1QGAA 1Z5UA 1W9MA 2UUOA 4EF5A 3RM3A 5ENNA 1MB4A 4X0EA 2ZIGA 4I50F 4NJMA 3GJRA 4TV3A 4NPHA 1RPTA 4FR5A 2J5KA 3GEDA 5CYFA 4M3NA 2PR7A 3GPBA 3G2IA 2R62A 2J07A 2IGBA 1B4DA 1U3GA 2GM9A 1QHXA 2VP0A 2CSXA 5CD9A 4KVOA 4NQZA 3S4YA 3CWZA 3OHMA 2IXGA 4LTMA 4N4AA 1B6SA 2ZJYA 1IWOA 4QXAA 5C1PA 4HDSB 1FYDA 2WSBA 2ZRPA 4NCKA 1GQFA 4EVSA 4X7BA 1YAJA 1P2SA 1NVDA 3TAUA 2RARA 3UICA 5B7PA 3X1YA 1HEIA 1G0OA 3ONWA 5LU8A 3T95A 4HLUA 1DARA 1M5TA 4UARA 2XX3A 2BKVA 1YZTA 3K94A 1JHAA 5FQOA 4FADA 1QK3A 1D4AA 3MGAA 4HJXA 5DF1A 5K20A 5ALIA 2A86A 3GAMA 3D3QA 3VC1A 4JMLA 1H6AA 1PYOA 2VUUA 1I10A 2HR2A 4RVUA 1GSOA 4J0JA 1JF8A 4I55B 2WV9A 4MWGA 3SIRA 1C3VA 4UAVA 3KSMA 5KJKA 3GYGA 4A6XA 1C30B 3DEPA 2WC1A 2X3MA 1Q92A 1LLFA 2VDUE 3ZJ4A 3GFVA 3ROFA 2I2WA 4YV2A 3V3KA 1K7SN 5C1IA 4N39A 1KWKA 3VUFA 2PGNA 3JAWA 4O8ZA 1JVNA 1B0PA 3AHEA 2GLUA 1PU2A 1L7XA 2D8AA 1BCRB 3NNDA 3BIWA 4TZKA 2XJ4A 3H9UA 2IYQA 4XWOA 2R0QC 2BGWA 1PTJA 3WA7A 4EY4A 3N1UA 2JW5A 4K5CA 4GZ3A 2H31A 1Q44A 3V1NA 2W2OA 5F7ZA 3PC2A 1EA7A 4NNPA 4LXIA 4FZ5A 3ZEAA 1F3LA 2YQ4A 3IERA 2DEUA 3A1DA 5FIUA 4NTZA 5KQGA 5F51A 1Q0UA 1UZNA 1GM5A 3SN6A 2EIXA 5DYYA 3JXIA 1TPZA 4AM9A 1LFAA 1KXZA 4BRSA 4V1CA 2PM7A 2PNNA 2YZ7A 2VSYA 1M3SA 3EYWA 3TIGA 1FFWA 2BFDA 4ZT3A 4RV5A 1WEKA 4OHCA 1M1NB 4YMVA 2ETAA 4E70A 1IRIA 1JKJA 5K01A 4ER6A 1AGXA 4W9RA 1KS2A 4BNYA 3ZV7A 4N47A 5CMLA 4RDIA 1NIPA 5IEJA 1JR3D 5F2EA 3KUDA 1F7VA 2F59A 4UQXA 1Z5PA 3QUCA 4AXHA 4EI7A 3QVKA 5KYYA 2FX5A 3P9SA 4CW7A 4U7FA 2C78A 4CQMA 4RQIA 2IFUA 4NU8X 3NETA 1WY5A 3COZA 4WNGA 4HLDA 5BT1A 5JVDB 5ALTA 4EHNA 4NL4H 3QNWA 1QANA 2B98A 2VUIB 1HNXB 1ETHA 4EMBA 1P17A 3N3AC 3PE4A 3ZN3A 3DQZA 1J0CA 3OZRA 3TCKA 3UJPA 2ID7A 2JANA 3Q9UC 3HYTA 4CT4B 3OY2A 3LT2A 4KR7A 2KLBA 3GGSA 1DDGA 2PUTA 3ZGNA 4NG5A 5B53A 4RNDB 4N41A 1CWUA 5FTPA 4CWAA 4N3NA 2J3KA 3TOCA 3WB2A 5MF6A 2IDJA 5BT8A 3V4SA 3OQHA 4EJMA 2GYUA 2R8EA 3I2IA 4ETMA 3TR0A 2ZZKA 4KKVA 3WADA 1Z62A 2VSOE 5JBQA 3O8OB 1CUIA 1SCQA 2F8XK 5CMYA 1ZITA 2HWYA 3KAKA 4UMDA 4H7YA 1CQXA 2DG2A 4YWJA 2Q5LA 2OOKA 4I1UA 4D9EA 1CYEA 3W9UA 3M5WA 3ZDZB 3L08A 3RSCA 5EJ7A 4ASUD 1LSJA 4KLAA 1CUCA 1ULZA 1WQ4A 2AE2A 4R2WA 2KSQA 3EIXA 3TM4A 3U56A 5C8XA 1Z3YA 1XAHA 2PRZA 1H8ED 5K3CA 1OA1A 2F62A 3NYRA 1JBEA 3RDPA 4RANA 4H7FA 3ZWYA 4QEZA 3EG9A 3DOHA 3T0GA 3TZLA 1DG3A 5A62A 1J23A 4YROA 4TRQA 5A4DA 2GEUA 4ENRA 2VZ9A 2O3RA 3IB3A 4UQPA 1YJCA 1KT1A 3O74A 4EW6A 5D0OD 3BXFA 5CB4A 2X14A 1GTZA 2IW3A 1K2VN 5TXGA 2H1WA 4G01B 1V6AA 4CM8B 3VSCA 4UI9J 4UM9D 2R6HA 3IDZA 4OIMA 4HUJA 2QLFA 2O3TA 2YICA 4J94A 1PVOA 2GEJA 5IBCA 2FP3A 2AN3A 3ZHTA 2V74B 4ND1A 1QYRA 1OIXA 4W8OA 3ZGYA 4HB3A 3TTTA 3GLGB 3WFJA 4BZQA 4CF4A 3AVYA 2X4IA 5BPPA 1QGUA 4F4UA 2YL2A 1T6BY 2XYQA 3BE6A 1Y1TA 1THMA 4KPYA 2G5PA 3D4NA 1N36B 3VUEA 3ABQB 4D9IA 1LI5A 3HDYA 3UWSA 5B1SA 4EFDA 1GCUA 2EG5A 3KPJA 1EKXA 1N5OX 4EG4A 4DLUA 4RZIA 4MDHA 2Q49A 3TZCA 2P3OA 2CLMB 5MGBA 3WMXA 1TN8A 3HBJA 1FTWA 3R7SA 2ZITA 3SZUA 1P4SA 3O3CA 1XNFA 4CF6A 3U3DA 1OB5A 3UM1A 1AZWA 4B3FX 2ZSEA 3KYCB 4F5YA 1E3WA 3UMSA 2IYNA 3GX1A 2ILVA 2A0UA 4OI2A 2A9QA 1A4UA 2IIVA 3SYRA 3GLVA 4CTNA 4BJ3A 1TK9A 1QMGA 5C3UA 2L17A 2Q62A 5H59A 4BNZA 3R0XA 1UMKA 1GUAA 1RLMA 3E2MA 2AN9A 1DELA 3JZDA 1QLJA 1WSDA 1GGMA 1GGVA 3BXXA 4HTFB 3GT0A 3E81A 1VJCA 2WTBA 5JZVA 5EIDA 5LUBA 3VH1A 2ZEJA 3FCSB 3NASA 2Q28A 2AF3C 2WIFA 3UM0A 4KFSA 4ESOA 1QB7A 2XYRA 2VJQA 2NLOA 2W2KA 3MJSA 3ET4A 3W78A 4PYQA 2DJIA 3ONEA 2NO1A 1F6DA 3A7DA 1XXHA 3BM5A 2BP7A 3LUGA 3MW8A 1T4MA 4TMXA 3E3AA 3DNPA 2ZSFA 1KNXA 3E34A 4MW5A 1KEUA 1F8XA 2I6XA 3HCDA 2ZSKA 3UG6A 1VTKA 1FT2A 1USIA 4MGEA 3BWMA 2XMDA 2WUFA 1GPMA 4OLFA 3QWPA 2LKDA 1YBAA 2R00A 4HZGA 1G64A 1XEFA 3GEIA 3LPZA 5KNDA 1L7AA 5J4VA 1OY3D 2WU1A 1JSLA 5C37A 2FOLA 4KP7A 1ARZA 5KJLA 5D5PA 1BGWA 4EFKA 2X13A 1KYZA 1L4FA 2DTXA 2PFGA 1PEDA 4G0WA 1F2DA 2AI2A 4UVHA 3GNQA 3GT7A 3AM3A 2O2GA 2VLBA 1BEZA 4GSYA 4WY8A 1L1FA 4JYBA 4RBNA 3ZQKA 4AY6A 1S3IA 4ANFA 1WKBA 4IIFA 4N8EA 4GICA 4YMGA 1RNLA 2A1UB 1X3LA 4G2NA 4G86A 2ZANA 4LEIA 5IBPA 1R88A 2XWBF 3WDKA 3OLCX 1JSCA 3AIMA 2OHXA 1ID1A 5AVVA 3VJKA 3FG9A 4O1IA 1A8PA 1HG2A 1ZOPA 3ZHUA 1GZ6A 5BNWA 4TM8A 2QPAA 2FUEA 2M1XA 4YRTA 5FR2A 5TGTA 5AVWA 1NOKA 5FA8A 5KNCH 3ZY3A 3H19A 2X9NA 1LQUA 5ADWA 3UA3A 5I9SA 1S63A 2VHYA 2YS7A 2XZPA 2Z6AA 4L8LA 4EHFA 3EF0A 4TUYB 3DDWA 3UJ3X 2EFHB 1VSUA 4BNWA 2BF4A 3MV2B 3FNEA 3THWB 4F06A 1VHQA 1Z47A 4FSHA 2IXDA 4AP5A 3DFFA 1RYEA 1YJXA 2ZDHA 3QWWA 1IMOA 1K8XB 1NTRA 3GN2A 4GTVA 3FAZA 4UTRA 1O4WA 1H0RA 1VHWA 1E1DA 3G49A 2L42A 2EIHA 3L8MA 2KYRA 4HN2A 3TL6A 4YAWA 3MMNA 5JZMA 3WG7E 1XCJA 2IDZA 3A6PC 2C4VA 4LYDA 1AF4A 4UTOA 2Q4DA 4GOMD 4L8YA 1QAQA 1U9JA 4OK6A 1XV5A 5AM3A 1NGSA 4XVHA 4MYCA 1QHHA 4TSFD 2VRBA 4GMHA 3V8NA 2CJXA 5BSGA 4YQFA 3DXFA 3EU9A 1LDYA 1CLUA 3DRAA 4KQJA 3L7JA 3FH0A 4Y0NA 3NVMB 4BMSA 1SFRA 1XRJA 3NFRA 5GAJA 3KYDB 4MPRA 1WUHS 4TT3A 1BHQ1 4NBRA 3N5KA 4F4FA 4ILKA 2VDOB 5LNK6 3L6UA 1LX7A 1P7PA 5JMND 4PBTA 3VDNB 3GGGA 3RS7A 1XDZA 3KK0A 2CL6X 3GO4A 3PKZA 3KUUA 5AJXA 1IN8A 4R2HA 2OVFA 1A9PA 4JEHA 1NYLA 3CUEF 3ZDYB 5PGMA 2Q7XA 3WRYC 1TZJA 3NBFA 2G9NA 2G08A 4RLYA 5KWVA 4Q3BA 4G6ZA 2IV3A 4D57A 1Q1BA 4I1SA 5K0FA 5I7UA 3SMVA 2FZGA 1WB4A 4F84A 4GTRA 3RAUA 4LUCA 4RWEA 1E9BA 2QF7A 3DHYA 1UFRA 3AUAA 5ERGB 1RI1A 5DT9A 3NANA 3AH8A 4MPTA 2XY4A 2O59A 2W2QA 2JJYA 3IQDB 3QJ5A 4W99A 1FW8A 2Z9DA 3KJQA 1A5SB 1ML4A 4D10C 3ZE7A 5FPQA 4PDXA 1UBKS 4NHOA 1V1RA 1XCGB 2ZS7A 4FEYA 2AL7A 2IUFA 4HRVA 1AS0A 3EXFB 2VFAA 5B6IA 1UPCA 2O1SA 4XM2A 2PGLA 1R6TA 3GIWA 4Y6WA 3RIXA 2O2ZA 3SSNA 4DV6B 2W58A 1SQFA 3BA6A 3D9KA 3Q75A 3W5CA 4NDZA 1TMOA 2CLKB 4L27A 5HIJA 1KTIA 2IYEA 4BO8A 4DCNA 1K6JA 3ESQA 3O03A 1VMIA 4YIKA 2WF8A 1KJNA 3K0AB 1EZ1A 3I04A 5KTOA 3BL6A 1ZK3A 1KAOA 3HDHA 2FLKA 5GOTA 3EMDA 3RBVA 2XMSA 2XMCA 1CY0A 2O5CA 2ZRCA 1H94A 1YR6A 3FJYA 1J1UA 3KX2A 1UJJA 4PZEA 2QQ0A 3LA6A 4CIBA 5HIAA 5D3MB 1DJOA 4L6AA 3QV1A 4D0RA 1PC2A 4HGRA 2A33A 4RLSA 4PVDA 4HDKA 1RRGA 1QQBA 3CEMA 3ZHOA 4E1AA 1VMKA 4EHIA 4YCNA 3M0EA 1D4FA 1RU3A 5JMOA 3B1WA 1CJMA 3WGLA 4M1OA 1PT6A 2EHDA 4MS4A 1W19A 1XNJA 2NT4A 1XP5A 4ZI7F 3KELA 3CX6A 1GGEA 3UVEA 4PC1A 4CKCB 5A0TA 3SFXA 3ZHRA 2ONKA 2OO5A 2F00A 1NNI1 2NSHA 2HWXA 4OGLA 2ETBA 3LMKA 3L05A 1TYBE 2V58A 2W6NA 3QOFA 1XD2B 5IYZB 1FNNA 2VGEA 2NT3A 2B2CA 4R71A 4GDFA 1HURA 3WIUA 2ZYTX 2WG0A 2AJ8A 1UXIA 1PFKA 2ZUTA 2LSVA 3F6SA 3ICOA 1DJLA 4A8JC 5A71A 5A4IS 3OBBA 3T9AA 4NK4A 3R41A 5JYCA 3DC2A 4CEIA 3QG1A 4MS3A 3LDZA 5EXDA 4H17A 1FCHA 1J56A 1PQYA 1G98A 4RA9B 2VNJA 4I9HA 5JSQA 3PB3A 4DC9A 1HDCA 4GI3A 4ZI7A 4XX0A 1NJFA 3W9BA 4FGWA 1ECJA 1W6RA 4FB4A 3KJFA 2XE7A 4F0JA 5BQXA 4ZVMA 3K72B 3A8TA 1UCFA 1IXVA 3SY2A 2DBQA 4D56A 4MINA 4Z0PA 3QBTA 3M9WA 1Q77A 4N9WA 1UP7A 4YJHB 3M1LA 5AI8A 2CBXA 3DC7A 1W87A 1SHKA 2A14A 3C6MA 2JLVA 4QUIA 5FI3A 5LL6P 1XDGA 1COWD 4CMGA 1ILWA 2XB9A 4BUZA 4OBWA 1OXUA 2WWTA 5TT0A 4ODIA 4LI3X 1C3OA 1KIFA 4FZ3A 1JIVA 5B1DA 3OJLA 2QROA 1G8MA 1WR8A 1VKRA 4Y6PA 1HX8A 3CHMA 4IIJF 4L8GA 3IPAA 2HPZA 5FO1A 4ER5A 2VXYA 4BO4A 3UJ9A 2E49A 3LCVB 3VHLB 5E0OA 3SZGA 1L3CA 1KAMA 3ACDA 4HMQA 3EJNA 4BCBA 1OGJA 3F5SA 4PCLA 4C07A 2ZUFA 2DR3A 3TW8B 4WJKB 5C51B 1Y6JA 2ZWMA 3ROGA 1ULAA 4XEIG 2DKFA 2BZSA 1RDFA 4CFSA 1U2DA 3ZNPA 3O8QA 1LBEA 2VCEA 3ZW7A 3GLGE 3PXGA 2NN3C 3T41A 5DFAA 4IDNA 4GVLA 3CW2A 4BGVA 4ZHQF 3JAMA 3A1UA 2RKKA 4KNWA 1WB6A 3C1UA 3JWPA 4ZFHA 4ECEA 4Q02A 1MCZA 1Z4NA 1NXVA 3A6ZA 4MB0A 1T6ZA 1YBHA 1N3IA 2PL3A 2IYVA 1DINA 3ENVA 2Z2JA 2REBA 2BBTA 1ELWA 3TBKA 1V5GA 2AG6A 4D9KA 2O05A 3KDAA 3QEBZ 3AI2A 2OOEA 4BX9A 4PYOA 5B2EA 4H4CA 3ZYMA 5T3RA 1L4HA 4K88A 3HGMA 3RTDA 4KXQA 4IHKA 1JQKA 1D6MA 1NU8A 2WPNA 3G0HA 4UI9C 3C3PA 1KARA 1TI7A 5B2FA 3GGDA 3X0DA 4ZHQA 4EGQA 1Y9DA 1E94E 3ZE0B 4TKUA 4WZAE 1Z18A 4L5AA 3QE3A 4FYXA 5ICEA 2YC4C 1VL2A 5E9WA 3ZV6A 3Q7EA 4ANVA 2QVZX 2J30A 4LJ8A 2XAUA 2VNAA 3BXHA 4AZ0B 4QVKA 4X3CA 1FU7A 3UATA 4KR9A 4BV9A 4EFNA 1F6WA 2YHUA 2J4DA 3KSZO 4IH1A 3KSDO 2A30A 1EGQA 3WSVA 2ATCA 2O8FA 4TLDA 4O02B 2KPOA 1PWEA 3G7NA 3OY7A 4NC9A 3JQ7A 4PHTA 3GP8A 1G5FA 2CVQA 1GU1A 4C0AC 5G4LA 4Y2XA 4ZDIA 2WXGA 5CCMA 3IA2A 2ODAA 3DXMG 1L4BA 2HE0A 5I4CA 3H65A 2ZM6B 2DULA 5EJ9A 3QNMA 2FSPA 1KH2A 3DPUA 2VATA 2B34A 1U2VG 1ZRMA 2C9OA 3W3AA 1K2WA 3JW8A 3ZWVA 4E13A 4EW2A 2OEVA 3VR5A 3C6XA 2XUFA 5JQGB 2CNDA 2LRHA 3KLNA 5F52A 4ILIA 4BFSA 4HGPA 1E0KA 1SVOA 2YIVX 4DQKA 5DLDA 3HEMA 2R6CA 5EJAA 9ABPA 1ZMOA 3R7AA 2AN4A 3D3WB 1TAUA 4QU5A 3ABRB 5DK6A 3HXBA 4TLMB 3HYMB 4PS8A 1FRNA 3MJVA 3PG5A 2IS6A 5ALGA 2VBFA 3H87A 1QIKA 3B7PA 3JUEA 2VVTA 1GITA 1DBVO 2ZT6A 3HTXA 5DP2A 1DRUA 1H6BA 5LOVA 5JMPA 1ZD1A 2XKJE 6LDHA 1GUBA 3UPDA 4UHEA 2ZJ4A 3SNHA 5DTMA 1SBCA 3V2XA 1H23A 4L0CA 4W5OA 5ENSD 4PX5A 2XDQA 2YYSA 3GK3A 3PUJA 4JLWA 4R7ZA 2JLSA 1FFXA 3I30X 3OM9A 3GLFB 3WBJA 2CHEA 4CBVA 2AQKA 2J0EA 2QRMA 4JL5A 4RYDA 5EGNA 2I80A 2HU8A 1PF7E 2FPIA 4E03A 2J5QA 3QPDA 4NABA 2O3QA 4BNDA 4XSGA 2YJ3A 2PUCA 3I0NA 1H2FA 2DFDA 4L3VA 4JQYA 1QQ7A 1LVUA 3BB4A 3DM5A 3MTAA 4ZTZB 4YP1A 1DXOA 4Q7EA 4JYCA 1XRNA 3RFFA 2ZBFA 4LRQA 1LC3A 1PZFA 2XZDA 3SPXA 5CVTA 1IXKA 2YNMD 3L7BA 2HMUA 4L4RA 1EUDA 2C5LA 2V8BA 4PXSA 5DYIA 1FIUA 3RIGA 4GTMA 1MB2A 1YDEA 4TLLB 4D4HA 4F5WA 2LUOA 3KD7A 4TV8F 2IU6A 3ZR4B 1PR2A 1GLGA 1LPAB 1QIFA 3GCDA 3PQ5A 1IPEA 5BVHB 3I9V6 4A6EA 5FF9A 1W76A 1JEOA 2GB4A 3UEOA 3AEUA 3QKRA 3I3OA 1A9YA 3D8UA 1A5EA 3KJZA 4Q1EA 2H4XA 1BS2A 1Z0SA 5J63A 2UYHA 4X00A 1KAEA 3LY9A 5EUBA 4L3WA 3MWDB 5AHXA 2R6FA 1M33A 3MELA 3I12A 5F3DA 1E3JA 3IKJA 1QIHA 5C52B 5T4FA 3QG5A 1NOJA 2WY2D 3G2HA 5I51A 1V2HE 5LC1A 2XA9A 4TV8A 2WOOA 3MWYW 2IYPA 3FPCA 1H05A 3T9DA 4KN8A 2HYDA 8ATCA 3IE1A 3OE5A 3Q15A 2GVNA 1S1MA 4H1VA 4EW1A 2XCSB 1I0IA 1RR6A 3GBSA 1KKLA 3AI7A 1GNPA 2VF2A 5JECA 1NXPA 1YNSA 2H5LA 4B3RB 4FHGA 4N3GA 5HS4A 1WWKA 4QJ4A 1U8XX 2Y2VA 5CITA 2G0NA 1G66A 3GZNB 3MB8A 3GLHA 2EZUA 1DQYA 4FVTA 2COKA 2ZKLA 1PL6A 4H9GA 4X90A 3Q7SA 1GL3A 4L02A 3FYUB 4BKMA 3Q7FA 5LM3A 3R3UA 1QF9A 4FCWA 3PFNA 1PWHA 4KYIB 2PFKA 4BP9A 3K15A 3VR4D 3UX4A 1FJ2A 3GXBA 3BL5A 4QLBA 2IPAB 4GBJA 4XEHA 3SK0A 3UPTA 2E0IA 5HF9A 2IC5A 1T2FA 4HYYA 3G79A 1M72A 1RABA 5AP9A 5JYBA 3RI3A 4NBKA 8AT1A 2FJPA 3ASDA 2A0FA 3NTVA 4GH5A 4IRXA 3FSRA 4QOIA 4NMXB 1MOQA 5IKXA 4EUKA 2O8NA 5K3FA 2C1EA 4PCAA 2MTBA 3ORFA 1AQJA 2WAMA 2R97A 2JIBA 1IBCA 4B84A 4F86A 2ZB8A 1PR4A 3U61B 4HYEA 4RTNA 1W30A 3NRBA 2EQXA 1G8SA 3IQGX 1RJ9B 1P29A 1IBMB 4HGZA 2PLFA 2QNBA 4DLWA 5D7BA 1HQDA 2I4OA 5JZBA 3C6YA 2R3SA 1NN1A 3FSJX 3FZGA 4XD7D 5JNVA 2QUKA 1PK9A 4YMSA 2PWAA 2ILTA 3QOXA 3ULKA 5G1NA 2RG8A 1N92A 3F3SA 3UY4A 2GNOA 1U9CA 3O9VA 4EARA 3IKLA 3JD0A 2ZXEA 3LQ2A 2OP0A 2W93A 1WDKA 1O58A 4Y1GA 1ZGBA 4E5VA 3UM2A 3OUZA 4Z9FA 1D1QA 2XUZA 5IZCC 3DZGA 4X20B 3QX3A 3EARA 3HS3A 2KCVA 1OGIA 4GU5A 1PJ3A 3BWDD 5ECGC 4Z1MA 4DA0A 5CXSA 1QRTA 4URVR 2PY6A 1GZUA 4B5LA 2XCOA 4X92A 1QYXA 4TV9B 2WVJA 5EMHA 2ONCA 4JCCA 4GRAA 1HWYA 2QL5A 1XGWA 3GJ4A 5AWFC 2YFQA 3TVYA 3FEXA 2OMKA 1QKKA 4LSMA 1SUBA 4FJYA 3TWOA 3H1AA 2YMPA 2PKXA 2QX6A 3LCAA 1EG7A 4FMCB 3D8NA 4QPJC 4UHCA 4HS4A 4CR8A 1TLTA 3GAFA 3UTMA 1TM1E 3ILSA 3B6KA 3R3SA 4U5QA 1Z4IA 4QGAA 2H1VA 2JGFA 2AHRA 4Y1EA 1JQJC 4Q3OA 4KDCA 2QN8A 4DCMA 5EFZA 1NP3A 3U3JA 4HNUA 4G1UC 3WYDA 1G7CA 2ZR9A 5G2NA 4HAYA 3NOCD 3GOQA 5A5FA 4QDJA 3DTVB 4ZCLA 4C04A 2IS1A 4LJAA 3PS6A 3TKAA 3GVHA 2QOEA 1IVSA 3UBTA 2B92A 3I9JA 2O2XA 3PTZA 2OZEA 2X4GA 2P6PA 5CDFA 3TVDA 3N2LA 2TMDA 3DKRA 4J8SA 1U5AA 2HKIA 1SBIA 3QVLA 2Y1GA 1PY1A 4MBGA 4EGAA 3RC1A 1WW8A 1DDIA 1Z2EA 4LSZA 4KNYA 4B3DA 4JENA 5KCMA 1UAYA 3IXMA 3UAOA 2XZDG 1IDN1 4IZHA 5JHAA 4Y2JA 5BWLA 1W4AA 4HLNA 4J7WA 3CYFA 5CHEA 3JY6A 1QLHA 2VQEB 1CVIA 1T6NA 2GRJA 1QP4A 3D9NA 5FWNA 4N3CA 1KDPA 3OD1A 2Y0BA 3V55A 5HBGA 3G0BA 1ZY2A 2VWQA 3L6BA 1HEYA 3LC2O 1RTKA 3K71B 2O8CB 3ROZA 4E5UA 2XWSA 1KZYC 3OJOA 2C00A 4DY4A 3GZTB 3F49S 3W79A 2VO1A 4J1TA 3VC7A 4N5IX 3WYGA 3V46A 4ZAVA 4AF6A 1E8NA 3PC4A 1BN6A 1GA4A 3A27A 1PDOA 2PKQP 3WHKA 4DIOA 4CRWA 1PYDA 3ST7A 1U11A 3S2ZA 3GRVA 4TZTA 5HXAA 4KLCA 1DXYA 1GNSA 1VHJA 2GHIA 1N3LA 3AIKA 2XNJA 1RIFA 2QV7A 1BU8A 1X7HA 3QLVA 1M8KA 4HXGA 2PH3A 4XYGA 4F85A 2A5DA 4HWPA 4O4JF 1N94A 2ZDQA 4GXTA 4JVLA 2J3EA 1R9MA 3N0XA 5CDSA 2D0DA 3PT9A 1XT6A 3BK1A 4ZWNA 5DOVA 4CLOB 1RAGA 3QMVA 1P72A 2HRRA 3TL5A 2O1WA 5CEJA 3AERB 2GO1A 5EZYB 2PV7A 1GU0A 2VXCA 2H48A 2RGWA 2PS9A 3HL4A 1WTAA 5AD1A 4DAEA 4JEMA 1T10A 2JGAA 4ARCA 4PH4B 1ACMA 3RIBA 2VSFA 1MAWA 4I6JA 5G0UA 1ADBA 5BSKA 3ADDA 1SOMA 3OP4A 1E2BA 2DLNA 3EFHA 4AN1A 3GZ1A 4RF5A 1E3MA 4C21A 3QKWA 4EG0A 3PC7A 4L4YA 2P6NA 1T4GA 4DG9A 4C9BA 3RFVA 1FDWA 3COSA 3Q4GA 4W7IA 2OQIA 3FHJA 3ZZ0A 1DG9A 4K2HA 4Y6LA 3RS8A 3INTA 1FS5A 4Y6OA 1U1FA 2X6JA 2WXIA 2VAMA 3FKQA 2FMUA 1WD7A 1XZAA 5CJ2A 3DW1X 1JYFA 1DAMA 4S1NA 1KMHB 3PKIA 4X8MA 5LXTA 3PNVA 1Y3CE 2DM6A 3IT1A 2CLIB 4OYYA 2H1SA 1NDUA 4FYYA 3HSYA 5FOQA 1ZJYA 2W4MA 4GA2A 5KSYA 4XRRA 3EIFA 3SHVA 4JQCA 4H1WA 2Z1MA 1MV5A 2WICA 1FU8A 5KU1A 1J1ZA 2RFLA 3NNSA 2RGYA 2EG9A 2PKYX 4YRCA 2GLTA 1GNVA 3N6VA 2H1OA 2FQ1A 3DMTC 3F3YA 5IS2A 5AXDA 1R4MB 3FB1A 1M6VA 1S8FA 2G3YA 3ONLA 3ENEA 3U81A 3V4PB 2PGAA 1E7RA 3VRHA 1VKNA 3LZ6A 2GZ2A 3PC8A 2QLJA 2V4LA 2Y1LA 2CHGA 3RVSA 1W5AA 3TFWA 4NWIA 3DO6A 3K9WA 3L6DA 2V5UA 3B9RA 2I1QA 2BKGA 2X7XA 1W85B 3AG6A 4XB1A 3GLFE 4A3SA 4D9JA 2BOVA 1D2HA 3S5UA 1S70B 2JHGA 5T8IA 3OEYA 2QMOA 4XOIA 1BWSA 4OX9B 2I8AA 1IHUA 3FKSD 3IBGA 3MT8A 4M0UA 4LC9A 3CVLA 3O4ZA 5IHPA 2B21A 1JUDA 2RSLA 3TXYA 2GZMA 2QK4A 4UUQA 4BWGA 4GE0A 2I99A 1V1MA 3II6X 2I03A 1SUCA 2XB2A 2APJA 3BAFA 3UWMA 5EDSA 1RRKA 4ZANA 4PC7A 5AQ7A 1WPQA 3OTWA 4RG9A 5JAUA 5IBQA 4L6CA 4YFVA 1OIWA 3G23A 4AWAA 4H6WA 5K9ZA 1ADFA 4TXHA 1H69A 1US8B 4CM1A 5CVCA 1QX3A 1PKXA 3GQBA 3GV0A 3CZMA 3WMRA 3FX2A 1DWOA 4ZEOA 4IWXA 1THTA 4E5MA 1TA4A 1RYYA 2P3QA 4BX3A 5E95A 3RJTA 1IXSB 2CLOB 4RF2A 1BVHA 4UD2A 1HFJA 5HUJA 3TPCA 1QHEA 3RRYA 4FFPA 4BKUA 1Z35A 2BTOA 1LJ8A 3HXMA 4KVFA 2Y0BG 5LYYA 4ENTA 1RI5A 4GUDA 3USCS 2NZYA 4Y18A 3DFIA 1G6KA 4X60A 2NTVA 1RW2A 2O23A 3EVCA 1DHRA 3H1BA 1YR8A 4M87A 2DGDA 3KOUA 4XYBA 4AJJA 4AW9A 4WX2B 4S0XA 1YQQA 3PEVA 3TLCA 4DB4A 2GSDA 3E7FA 1H6CA 1HBJA 4BKPA 3EY9A 5KMGB 4RV9A 1JAYA 2GFIA 4TL7A 1AKWA 4MKZA 3KYIB 1J8DA 2QM7A 4EPTA 5LMUB 1GQOA 3QYPA 3I58A 5ILGA 1J99A 5JCOC 8MHTA 2XVYA 4H7DA 2BW0A 3ZQJA 4BS9A 3CUKA 5FEMA 4P33A 2P6MA 5IW8A 1BG6A 2NP7A 2HI0A 1QR2A 1EWYA 1O5OA 3JASB 5K3BA 3ZZUA 5AM4A 4LDPA 3FVTA 5T7BA 5HKBA 1YQ9A 2HOQA 4CN8A 3GJ6A 1RXEA 1IY1A 4AC9A 2IYWA 4UM9B 4D0NA 1DOZA 4O2RA 2ZRNA 2J08A 3WK4A 3E15A 4IN3B 2I6GA 4FGLA 3CVQA 1XZ8A 4K6OA 4HDMB 2ZVJA 5LZ5A 1UP6A 5ALYA 3F4BA 2X9VA 4GHWA 4A6DA 4KVAA 3ZTWA 2NTJA 3BN3A 2QIPA 4WN9A 3CV3A 4M0CA 1PJ8A 3AYXB 1ZUHA 4ZOCA 1YBMA 4JYMA 1JHQA 1GSHA 3U7IA 3S7DA 1LSOA 3CRVA 3BXZA 2QUHA 2QRVB 4B74A 1EUYA 4URFA 3WNQA 1XQWA 1UWKA 2YZKA 3NOVA 3Q2KA 3CR3C 4IW3B 2QTMA 4W7HA 2VJNA 3PDUA 3LXRA 3DMNA 1JFLA 4XSVA 3SEQA 2VDRB 3PYMA 3D4OA 2NYUA 1DLIA 3NBKA 2RGNC 1EK6A 1S01A 3DL2A 2XS1A 2C61A 1R0XA 1K0FA 1NDQA 2E18A 4UAGA 2NUPB 1CQJB 4XTRA 3M6MD 2FW0A 3C3MA 3KPWA 2MYOA 3R4CA 3GPCA 1CF2O 4IH9A 4YY3B 4B47A 1K7CA 3A36A 4Q0MA 1BOOA 4OHPA 3RHFA 3WWOA 4GB9A 3SF8B 3MN1A 2VBIA 1CFZA 2K6GA 3I6BA 1KVSA 4A3VA 1QSGA 4D96A 2R68A 3O8BA 4GPEA 5J5VA 2ZRGA 2FXIA 1UOHA 3CSSA 5ENTD 1ESMA 4GKKB 3MWEA 1AJEA 5EXPA 2I1VB 3JATB 1ORHA 1P9OA 4HX9A 2XSZD 4PZCA 4J4TA 1N95A 2H6FA 3KZCA 5GM2A 4PLGA 1Q3TA 1NJ1A 3EUAA 4Q4HB 2X8BA 1LU9A 3M6VA 2FR0A 1K6MA 1ZI6A 3VBCA 1C1HA 2R6JA 1VLJA 1I6MA 1I3OA 3IB6A 3LP6A 2B8EA 5AARA 5BSRA 3BSSA 3SBEA 1G18A 2ZUDA 2BL4A 3IPXA 4URZR 2P4QA 3KQWA 4H7HA 5FADA 3CKBA 2ZUVA 3OOWA 1REQA 3TWWA 3LPCA 2WD8A 2ECKA 1C9KA 1W0JD 1U3CA 2X9LA 3GN1A 5EJIA 3O4VA 5G1PA 1OZHA 3CCBA 2C4WA 2FEOA 1HETA 3E2IA 3AVWA 2YQZA 3RVLA 1DRKA 3R6TA 4D3DA 5KHOC 1N8SA 3DBLB 1PJ2A 3MJTA 4BX2A 5JZOA 5T8KA 5CB4F 3K6SA 2I4LA 3S55A 1JG3A 4HAUA 4JL8A 2P2DA 2X9GA 1X1BA 2QSYA 4JQOA 3WLOA 1T9BA 1N25A 1ENZA 2E4YA 1U8YA 3HCAA 4G8LA 4I6EA 3HDJA 3M5DA 1TM3E 3FPLA 5KJCA 4M7RA 3DULA 1MX6A 2RKOA 2V8SE 4DX5D 1T1EA 4C7JA 3C3DA 3KFVA 4LERA 2ZE5A 1Q12A 3BGOS 4PXYA 4NZPA 2B8JA 4RZHA 4FJ2A 5JRZA 1T8TA 1SVIA 1OLXA 1UKAA 3PRZA 3DMPA 1R6XA 3RLIA 4NFLA 1T8WA 1M0EA 1A5AB 1CVLA 4BNNA 3I1JA 4YMLA 1WG8A 2AV6A 5JSUA 4QAJA 5JSFA 1KI8A 1IY0A 1ZM3A 5FTJA 5CLFA 1DKPA 4DA4A 3HN2A 3TEJA 4EZLA 1Y5MA 2OQRA 3L4BA 2FUKA 4FQ7A 2PWZA 1A4IA 3AY7A 2EGHA 1EHIA 3URMA 2B2XA 1YZNA 1XMIA 1X7WA 4Y67A 3A9SA 4ED9A 3K35A 3JD3A 4RAOA 3C3YA 4IHQA 2JZCA 1N7HA 4EI2A 1CJTC 3OPMA 1MFPA 5KWSA 4RGVA 2GK7A 2KATA 2V3VA 4F93B 2I3ZA 2Q9BA 1AWCB 3JYPA 1D8DA 3MFQA 1SPBS 1YZUA 4ARUA 5DYWA 1FPPA 3JYLA 3R0ZA 3ASHA 1NWHA 2OK7A 4OQPA 4KKXB 1AN0A 2PX4A 3ZHBA 1DBSA 3QKSA 3FSGD 1XRQA 2FMFA 1GWNA 5A1JA 4LHSA 2W98A 3QIVA