4I6JA

A ubiquitin ligase-substrate complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
507
structure length
503
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 170
structure length 503
sequence length 507
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6jA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6jA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6jA01
1COZA 3P0JA 4JXZA 3ILVA 3ZJVA 1M8KA 2C5SA 2JA2A 3Q10A 4ZT3A 4JZYA 2CV0A 3UC5A 1H3EA 5IJXA 1ZH6A 3SEZA 4Q93A 2GOYA 2QTRA 4ZCQA 3TZLA 3INNA 4AQ7A 5LLTA 4HK4A 2D54A 1QJCA 2PZ8A 1KH3A 3D6VA 3COVA 4PY2A 4CT0A 2J08A 2BTEA 5TEVA 4L2IA 1IQ0A 4MQ6A 3VU8A 1J21A 4HPWA 3ISJA 1O97C 1O96B 3NV7A 1T6XA 1U7DA 1M8GA 1U3DA 4MUGA 2QUIA 1ZUNA 2AZXA 2A4MA 2BYTA 3RJZA 4EG3A 1IH8A 1QRSA 4MLPA 5K0TA 3IUBA 2XRZA 3CA8A 3K32A 4OJMX 2A84A 1QRTA 3HMQA 1IVSA 1NUPA 4DDHA 3VRHA 5KWVA 1MAUA 4KPUA 5HUJA 4MW7A 1JEEA 4MWDA 4NDAA 1QTQA 2QJFA 4ZCTA 4MUKA 2E0IA 4CDMA 1V47A 4F3RA 2VTBB 1DNPA 2XRYA 1VBKA 2DPLA 3QTTA 3FDXA 1ZJWA 1XNHA 1JIIA 1LW7A 1I2DA 2JAXA 3L92A 4EG1A 4JYZA 3GLVA 3UMVA 4MW4A 4E1AA 1JGTA 5FO1A 1TYCA 2A1UB 1MC1A 3PNYA 4R2MA 1S4MA 2X0KA 5HUHA 4I6JA 1XNJA 3N05A 2ZUEA 2DXIA 3N8HA 1EJ2A 1WXEA 4EF6A 1J70A 1P7PA 1J09A 4X0EA 1G8HA 3H99A 3PNVA 4AS1A 3KFLA 3KT6A 3IOEA 4R2LA 4MW9A 4NAUA 4U63A 1MJHA 3NBKA 3AFHA 2R5WA 2GKSA 4EG5A 1GTRA 3DO8A 3TZEA 3ZJUA 3FG9A 3S3TA 4EG4A 1N1DA 2OV4A 2TS1A 3IOCA 3CVUA 3KT0A 2A7XA 1NUTA 2RE8A 2J07A 4DLPA 4YP7A 3CLRD 3SZ3A 5LM3A 1U0BB 3AKZA 1PG2A 1M8FA 1XNGA 3ZGZA 4YP6A 4G5FA 3LE8A 1R6TA 4YMIA 1F7UA 1Q11A 3N9IA 2OQ2A 3BL5A 1OWNA 3I05A 4GRIA 2CSXA 4EFKA 4NZPA 1N78A 3CLUC 1YULA 2CT8A 2QTNA 3FY4A 5KCMA 4ARCA 2CYAA 4J76A 1SURA 5KHAA 3A2KA 4MULA 4OUDB 1CT9A 1Q19A 3ND7A 5H7XA 3X1MA 4G6ZA 3LOQA 2DR2A 4DE5A 3JXEA 3QTBA 1R6UA 2ZUFA 1NUUA 1K4MA 1ILEA 3C8ZA 1M83A 2A1TS 3DV2A 5J58A 1JZSA 3RK1A 1MB2A 2VXOA 1EFPA 3L93A 4WSOA 3AL0C 3ELBA 1WXHA 1WXIA 2PFSA 2J09A 1EFPB 1KP2A 1K4KA 5LFAA 3PXUA 2IP1A 5J59A 1IFXA 2VTBA 1BS2A 1J1UA 1IQUA 1J1ZA 3ND5A 1F4LA 1JZQA 1VBNA 1JIKA 4DDMA 1QNFA 4P2BA 3LCJA 4K03A 4DNXA 3QE4A 1YUNA 4ZT4A 3TS1A 3CLSD 4MWBA 1N2BA 4JXXA 3HL4A 1G8FA 4FZJA 4ND6A 1G8GA 1RQGA 3ZUGA 1TEZA 1PFYA 2CYCA 3X1KA 2Z08A 3COWA 4MUFA 1WKBA 1O96A 4YBRA 3MXTA 4XFJA 1I6LA 2G36A 1QQTA 1F9AA 4MVWA 2HGZA 3P0IA 4QREA 1EFVB 3CLRC 1KR2A 1N2HA 4H3SA 4PBSA 3SYTA 2H29A 5IHXA 3GUZA 1OD6A 1JHDA 1KAQA 1XJQA 3N2YA 2HZ7A 5H16A 1K97A 4ZCSA 4F4HA 1N2GA 4EG8A 1T6ZA 1QU3A 4MW0A 1I6MA 3IDFA 3CVWA 2CYBA 4TS1A 5DK4A 5J5AA 3CVVA 1NURA 3TNJA 1N2OA 3RBAA 1MBZA 1TYAE 1N2EA 2YWCA 2GM3A 2DEUA 1O0CA 1NP7A 3MUEA 1KQPA 3UY4A 5TS2A 1IHOA 1MB9A 2QUJA 4MW2A 4ZT5A 4MWEA 3ZXSA 1H3FA 1WY5A 3A05A 1GPMA 1O94D 1WXFA 3A04A 4MUHA 1T9GS 1R6XA 4MW1A 4ZT2A 1KH2A 4A91A 1KH1A 5BNZA 4KKVA 1O0BA 1KAMA 4UZFA 2AKEA 4PBTA 1H3NA 1Q77A 1J20A 4QBTA 4MUNA 1ZH0A 3FOCA 3HZRA 2PXHA 3MLAA 1NUQA 5DEOA 1KP3A 1U7XA 4BWVA 2A88A 4DJAA 1X6VA 2IJGX 1FYDA 3IMGA 3M5WA 2CUZA 4WNYA 1B6TA 2EJCA 1H1TA 1O6BA 1JIJA 3SDBA 3FIUA 1IQRA 4I6EA 1K92A 3MMXA 4MW6A 1KQOA 2PIDA 5EKDA 5K0SA 1GZUA 3UK2A 1X8XA 3FI0A 1YIAA 1WQ3A 4MVYA 3H9BA 4QRDA 4MWCA 2NSYA 1YIDA 1M8PA 1TYBE 3MLBA 2B7LA 3E27A 4EG6A 3OP1A 4KR9A 4XSVA 1M8JA 4L2IB 4S1OA 4NATA 2QJOA 4EGAA 1KKUA 4DDKA 4CDNA 1M1ZA 3FNRA 4ZT7A 1U3CA 3SZGA 3RK0A 4JFAA 1EXDA 1TQ8A 3AIIA 3G5AA 1MOPA 5FO0A 1O95D 3U1VA 3FWKA 2WB2A 1TFUA 4EG7A 1NSYA 1QRUA 5AHWA 3CLSC 4U8HA 2I1LA 1I6KA 2EL7A 2YXNA 1A8HA 2ZP1A 3X1JA 3ZJTA 2CFOA 3GMIA 2IELA 1VL2A 1FFYA 4ZCRA 4GU5A 4OUDA 3DPIA 4MVCA 2V0CA 1GAXA 2WSIA 1GLNA 3AG5A 4HJRA 4MUEA 2V0GA 3FETA 3H05A 1WQ4A 4K0RA 1TYDE 1QU2A 3CVYA 3IMCA 1T9GR 3PRHA 1GN8A 4G5YA 1N75A 4PBRA 2H2AA 3DLAA 3HFJA 3SP1A 4U7JA 2AG6A 5F23A 4RUKA 2J4DA 1UFVA 3CVXA 1KQNA 3SEQA 1GTSA 2QJTA 1F7VA 4XFDA 1WOYA 4KR7A 3Q4GA 4ZCPA 2YY5A 4KPUB 2D13A 2Z09A 2DERA 4MUJA 3ZIUA 5DB4A 3IH5A 3D6UA 3TQOA 1YI8A 2WQ7A 3ND6A 3P52A 5TGTA 1MRZA 3CLUD 3IVGA 2NZ2A 1Q15A 1N2JA 3G59A 3A4IA 2QUKA 1OWMA 4UZEA 2CV1A 1YUMA 3FHJA 1ULHA 1PFWA 4J75A 5HG0A 2E21A 3IVCA 1VLHA 1T6YA 1OWOA 1WZ2A 1JEDA 2QUHA 3IUEA 2DUMA 3RFFA 4ARIA 1HYBA 2D5BA 1OBCA 1PFUA 2O5RA 2A1UA 4RPIA 1N3LA 3KT3A 4NX2A 1NYLA 4ND7A 3IODA 3VGJA 2CV2A 1LI5A 3P0HA 4NAHA 4CQNA 2PG3A 1EUQA 3AG6A 1LI7A 5JBNA 3K9WA 3NBAA 2DLCX 1KORA 2E18A 1PFVA 1D2RA 2X1LA 1OWLA 1NUSA 2JANA 3OTWA 3IMEA 3FH0A 2DETA 3COZA 1JMVA 3HGMA 3KT8A 5DASA 3RHSA 3IOBA 2PZBA 3Q12A 4MVXA 4MUIA 3COYA 1O5TA 4KR6A 2Z3VA 3PNBA 2HMAA 3UOWA 4MAFA 1V8FA 3IVXA 1EE1A 3H97A 1VBMA 3G6KA 1MAWA 1EFVA 1N77A 1WJGA 1PG0A 1O97D 1OWPA 1WXGA 5TEWA 3CLTD 3ZXIA 1O95C 3H9CA 3F3MA 2QTMA 2PZAA 2A1TR 4ZT6A 5FNZA 1OBHA 1NZJA 1NI5A 2O8VA 4MW5A 1N2IA 1JECA 3TQIA 4YP5A 4I6GA 2X1MA 2RD2A 1IRXA 3CLTC 1Y42X 4Q16A 2YWBA 3CR8A 3HV0A 2WQ6A 1JILA 4R0NA 1G59A 1O94C 2A86A 1EUYA 4HJXA 2J5BA 2E89A 2X3FA
chains in the Genus database with same CATH superfamily
5A7DB 4HX9A 3OEYA 5DBFA 3GLIB 4PS1A 1TGVA 3QPVA 4AVXA 5K99A 1Y6GA 4KI7A 4U0JA 1GIAA 5AOVA 5EJEA 3LCAA 1S7CA 2GCPA 2PQ2A 2YW2A 3GDHA 2IXEA 1G291 2XYPA 4CYMD 2OG2A 1CIVA 3Q88A 4WWHA 4Y9DA 5AHXA 3SS8A 4G0PA 4J0JA 3G5MA 4O6VA 1ZITA 4LYAA 2OFFA 4CMHA 1PWZA 1GZ4A 2WFLB 4QFCA 1T2CA 3FSGA 1N54A 3F3SA 1XZFA 3HXLA 4BETA 1VE5A 1UKBA 2A0YA 1J21A 3I8SA 4JJIA 4AB1A 1LPOA 1T35A 4OB8A 4UTNA 4ZO9A 5ESDA 1DO0A 2ACEA 2DUNA 3AVWA 1CY6A 3NB2A 4CM9A 2MCFA 4EGCB 1KYYA 3CN7A 5D84A 3WP1B 5KJCA 4XWWA 1A1VA 1N0HA 5E0OA 3EE6A 4ZARA 1UC5B 5JZVA 1NBMA 3C5VA 4MLPA 3RUEA 3N8NA 1N5MA 1D0VA 2CHEA 3ZY5A 3EVAA 3HBNA 3R7LA 4A3TA 4ZMSA 1NIPA 3UB3A 4GOOD 4J2TA 4BDSA 2QTCA 3U19A 3EFBA 5KU1A 4TMWA 1O08A 4DDHA 2XR1A 1YR9A 4ZXFA 3ZKJA 4XM2A 4DG5A 2J8ZA 2PM7A 3RG2A 3JV7A 3FRJA 1KS9A 1NAIA 3CXRA 3HA7A 4YT5A 4DA7A 1VCMA 1UM9B 4QYXA 4ESEA 2HYIC 4D8UA 4C0KA 4I55B 3LUJA 4IIGA 2YYYA 3OF5A 2WA2A 3V1MA 3CCFA 1V26A 1C0LA 3ORHA 5FUVA 1I2DA 3COJA 1AHIA 1C8KA 5ECGC 3V1YA 4M46A 3HL0A 3OOSA 5KYGA 3VKHA 1C4WA 1Z4OA 3NONA 4BNZA 1MC1A 3FWYA 1GFSA 3BGIA 2BFDA 3OUTA 4HDRB 3VOTA 4J4BA 1MDBA 2JC3A 2V96A 4XYLA 4OGKA 1Q17A 4LGCA 3IEPA 4MGIR 4KXKB 4R3UC 4B44A 4GR5A 4GTQA 1EK6A 1DEHA 4X0EA 4L15A 5C9ZA 1I4EB 3KFLA 3B38A 4FGUA 4MS4B 2Z5LA 4PVCA 3KU4A 5H5JA 5LBTA 3TXXA 5BNIA 3U1BA 3PFNA 1FXWA 3U7QB 2RJ3A 2B20A 2HT6A 3LQYA 5K20A 1XEAA 5EQTA 3UTMA 4YDSA 3GRYA 4EG5A 2YZMA 3AWIA 2XKAA 3DSTA 4AM9A 1GKKA 5HE9A 3VPCA 1RWWA 1NKSA 3I1FA 2BY4A 3RKUA 2P11A 2R8OA 3KT0A 5JNSA 3BG1B 1CD5A 1UBKS 1MVLA 1SOWA 2J07A 4EX7A 2NSZA 2FMIA 4PQYA 3FWHA 2P4EA 2XVYA 4ZFNA 1G3NB 4PTZA 1YT5A 2CJWB 3U16A 5C2YA 5ANLA 4U2KA 4DN6A 5EZSA 3ENZA 3AEZA 1FP7A 3PPYA 4FHDA 4I2NA 3K9NA 3IEMA 2W6IA 2AG5A 2G9VA 1AV7A 2Z95A 4QQFA 1YI1A 2IO3C 4AURA 3GYBA 1T26A 1ZVVA 1ZCFA 2JAPA 2JGDA 2ZE7A 1CZNA 5JY1A 1ONSA 1DAEA 2BV3A 1J06A 5FUYA 5ALIA 2F1RA 4UCQA 2YN4A 5C1BA 3HGQA 5D8DA 1YULA 3HCDA 2OOEA 5GWXA 4I2WA 4MYHA 3HBJA 3FY4A 3QFCA 4LJAA 2CT8A 1XTZA 1C8LA 4HDKB 1SURA 3FUFA 2F00A 2YCBA 2WF9A 2YQ8A 3M9XA 1NQTA 3OHPA 3Q9UA 3UAVA 4F6CA 5JYEA 4QTZA 4RS4A 3I6YA 1E3LA 2IU6A 2ODBA 2HM8A 4G4JA 4GPEA 2HBRA 1TT5B 1PTJA 2WJZB 3GROA 3NJRA 3O6VA 5EJ6A 5DM70 1KDYA 3THSA 3NOVA 5BSHA 4WWOA 3C3XA 1NJ8A 4ZO4A 5AK6A 4KWEA 1HTTA 5EE3A 5FQ6A 1UANA 1XQ6A 4P32A 4D9GA 1K4MA 1KJZA 2FQWA 2GO7A 1A9RA 1YTLA 3C8ZA 1NMQA 4TKVB 2WSMA 4CM4A 5JMND 1FF9A 1F0PA 4I1AA 3B9RA 1A4UA 1WUYA 2YIDA 3JQFC 4X1YB 1HO8A 4GTOA 3ELDA 1QH1A 3G2TA 3N8IA 1JXQA 3FBWA 2EP8A 2WVIA 1PCXA 1T15A 4KAAA 4OPMA 5BW8C 1SUFA 2BEUA 2YIMA 4QBKA 5IDYA 3SS7X 4EBFA 2D2XA 4MCJA 2QG9A 2P75A 2BPOA 4MKGA 2ETVA 1V6CA 3UIPC 1XVLA 3NYQA 2I91A 2AUTA 5BORA 1IVNA 5A4KA 4NECA 4MDEA 3IEIA 3R5TA 2DZOA 2IUSA 2ZETA 2AMJA 5KYVA 4LZLA 1OREA 3DSVA 1XNFA 2C2XA 2OPBA 4YA6A 2VDJA 1P4JA 2RI1A 3P26A 3L08A 1KFJB 4RYLA 2NZXA 2BR3A 3DPDA 2GHRA 2OEWA 3Q3VA 4FJ0A 4QNMA 3A9UA 4QD3A 4BNLA 2WZCA 4QUKA 4DUGA 1FX0B 1K08A 2JFBA 2UXCB 3FOFC 4LHWA 1VJDA 2ZIXA 4CHGA 3WBKA 3QM1A 3QPWA 4UD2A 1E89A 4CN8A 3RIBA 1KZ7B 2H1CA 3SIWA 1PJLA 4DLQA 5AXBA 4BRZA 5FYDA 2J30A 5JAUA 5KHAA 2ILVA 3E03A 1MA3A 3CMCO 1ZUWA 4O2BF 1RC1A 4NJOA 1FLAA 2I71A 4WI1A 4YDRA 3G8AA 3RF7A 1C3LA 4NNJA 1KEEA 3A9CA 3JVEA 3Q6IA 1HR0B 1E8YA 4HTAA 3DE0X 4DJFC 4EPYA 3BHNA 5JJIA 3A1EA 2EIJE 4YJKA 1P18A 4OMCA 1FVFA 1H8HA 3E18A 3OLCX 4LZWA 4OB7A 5HF8A 2IOQA 1KZYC 1X74A 3HYRA 2CLIB 4I7EA 3RJVA 4YACA 1QCYA 3W79A 2M98A 4ZRMA 1TLFA 3ZZUA 1PHPA 3ANTA 1Z16A 1EFKA 3WX0A 4IDHA 3TL2A 4C4OA 1NNEA 5ENRD 2OHXA 2O2SA 3ZVRA 5ICSA 2IOFA 3BHJA 1TVKB 4EIWA 5KQSA 3IE0A 1JHAA 2XQIA 1ADYA 2QC9A 2Q5HA 4Z3OA 4HD8A 2JJ1D 4YN3A 4G4IA 1ZH2A 1U1IA 4WUYA 2Q1TA 4DSAA 2CLMB 5HKBA 2JHFA 4H3SA 2DYSE 2HHCA 5KNDH 4U9UA 4MQMA 4ZMRA 1LSUA 3BK2A 1DXQA 1KBQA 5ENOD 5THKA 4QJ3A 5ALOA 2W2QA 4TL8A 1I7DA 2EIXA 2O59A 3EWSA 3GT7A 5BPHA 1P80A 1WHSB 2VCHA 3DMFA 4B5KA 1P4GA 4QOSA 3H04A 2L0TB 2R00C 2XTMA 2L42A 4WCFA 4WLUA 1KGSA 2ATEA 5CH3A 4WCFC 3NIDB 3BMOB 1FBNA 1KP9A 4TS4A 4CLDA 2ECFA 2W00A 4DMHA 3KYDA 9LDTA 3TVTA 5JFTA 4TZ6A 2JIQA 2R7NA 3CNBA 1MBZA 4TYPA 4E5UA 1N2EA 1F1BA 1AGPA 1GUYA 5T6MA 4Z6KA 4ITUA 1UJBA 5DGCA 4IDAA 4GMHA 1K7EB 5KDOA 3AFGA 1UC8A 2QVYX 4QAQA 4WEOA 1ORTA 2JKYA 2QUJA 3S7FA 3D9JA 3A28A 4ZAGA 5LQCA 1GA6A 3ET4A 2NX2A 2BJVA 2QRPA 4G01B 2BTQA 3PVCA 4NQRA 1W25A 4AWXA 2WT4A 3K6SA 1R0ZA 1WPGA 4QG7A 2JB9A 3G8CA 4QLBA 2RHLA 2E1PA 4B82A 3S7TA 5FIUA 3SF4A 2Q3JA 4NENA 2LSVA 3VLFA 4MR7A 4TL7A 4E1VA 5BNZA 3KNZA 4GL4A 4XDHA 3Q2IA 3W5AA 2DUJA 3DWGA 2P6NA 2WWHA 2GCNA 5EZYF 3TE7A 4NLLA 3U0VA 1TJFA 1WTAA 2WFZA 1DELA 2I2CA 1QHNA 4F9TA 2JGDB 1X6VA 3WYEA 4C30A 3MGKA 4PRKA 3TOVA 3OLQA 3P5SA 5A3QA 3OESA 2VJAA 4I36A 3JARA 2HWYA 3CPSA 4Q6WA 3MWKA 1FFBA 4R1MA 4U7EB 4HZUB 1KRHA 4J0GA 4UCXA 1IQRA 2P2DA 1JNXX 2OR3A 3B36A 1RZRA 3HU1A 4GG1A 3MMXA 4R1TA 4UAJA 4ROTA 3PUZA 1Q84A 4J3NA 4DCNA 5KYYB 2CJWA 2GI4A 2C5HA 4LBYA 4LYEA 4OVUA 1PZXA 4D4GA 2HR1A 3LUDA 3EZ2A 1UFKA 3I23A 1PR2A 4BQOA 3ZD8A 2GW1A 2YDXA 4FKBA 4RLSA 1LF0A 3BD7A 3NVAA 3OIUA 2QUAA 2QW8A 4HN9A 3R40A 3WWPA 2C8LA 5BWBA 3M3PA 2W42A 5KVSA 3MA5A 5E1DA 3WI7A 1RP7A 4JBXA 4KGXA 4X7PA 3CEJA 1PD0A 3A0UA 4BTVA 1ZEJA 2YRXA 4K26A 5AH0A 4YUWA 2CFZA 3LO8A 1N52A 2VLIA 1D6SA 4K1LA 4U7GA 2FF5A 3IQIX 5DV9A 2GRLA 3ASOE 2X1VA 4BNMA 4B3RB 1YF3A 5T4FA 4K5AB 5JMTA 2WTNA 1NW3A 2RHMA 3BMCB 1Y8QA 4MNTA 4A1FA 1RIFA 5D6OA 2R6JA 1RYMA 1AY0A 3IV6A 5D1HA 1TFUA 4GICA 3VR4H 3TUZC 5J23A 1O8CA 4P3YA 4WGFA 2R0QC 2WIFA 2E37A 2HMTA 3W5VA 3PZBA 1L8XA 4FMDF 5EX0A 1G17A 1VCOA 3I52A 4KYOB 3TMYA 3UPDA 3O8RA 4PGFA 1KEZA 2CFOA 2Q6IA 2HY7A 4X20B 4EF4A 4A6PA 5IT5A 4NDZA 3TBHA 4O29A 4UAVA 5HCUA 3WRWA 4JI2B 4ZOLF 2XW6A 1NE2A 1I8TA 2IOSA 3DPIA 1W4CA 4MVCA 2V0CA 2F3UA 2IU0A 1I5EA 1XGWA 4WJZA 5DISB 4ZEWA 2H4XA 1Q3HA 1X70A 3DEKA 1MO4A 4B09A 2XZDA 4PG5A 4YRBA 1NN1A 1AU9A 3THOA 2DE0X 1RTKA 1Y9JA 4EF5A 4L57A 5JVDF 4G5YA 1DIRA 3LRXA 3KUUA 4QPDA 4MKRA 5LR6A 1PT7A 1U0TA 2I03A 2RG8A 4CN9A 5F23A 3AAAC 1BFUA 3H4TA 3VZSA 3GLSA 3FBGA 1PNOA 2G04A 1LJLA 1QAQA 4BP8A 3W2TA 3ITEA 2IQ5A 4OFBA 3SI5A 4RFVA 3P9CA 3AUTA 4YRDA 2Q27A 4FYHA 2IEAA 5IZ4A 4UDXX 1I51A 1AUXA 3E7FA 3H9QA 1F7VA 4YJHB 1WOYA 2XMGA 3IGFA 2COUA 5A02A 2QMOA 1TJNA 2LWIA 4PZEA 4WNAB 4QUAA 5AW9A 1T2NA 2Z09A 4Q9DA 4HBGA 1BKSB 3S7DA 4ER5A 2NXPA 5LPNA 1DU4A 3HB4X 4H6VA 1A5SB 1Z8HA 1NXTA 3JQAD 1N3BA 1FU4A 3OX1A 5JHAA 1R8SA 2XY4A 2HRCA 4P98A 1U0HC 3CZRA 2LNDA 3HXPA 2W7TA 3DB2A 3CLUD 3LRPA 3IHKA 3MJFA 3N2IA 4MR9B 5SYAA 4IRUA 2NU7B 3ITKA 5C5DA 2GR9A 2OZLA 1D8EA 4JL6A 3PIIA 2NUBA 3ZPJA 5EPEA 3QKYA 5FWNA 3HE3A 3RVPA 2BUCA 1CPYA 2EAUA 3HJGA 4GVXA 4J75A 3OOJA 4L8GA 4O2AF 4ZO8A 5F5LA 2GJ8A 3R7BA 3CR3C 5I8WA 1VLHA 4BFYA 2ZT5A 3B13B 3TRIA 2WIAA 1WZNA 3B51X 3W5SA 4LWOA 2WP8J 3HJAA 4L5CA 3J81k 4BESA 2WPDA 4LNUA 4DX2A 5BQPA 1CQWA 3E4BA 2X3UA 1HYBA 3KZOA 1TM3E 4DLKA 2NP7A 5LQUA 4Q69A 4JA2A 5A9TA 1QGOA 1BD8A 2M1XA 1UIRA 2XTNA 4UHDA 4EZBA 1JEYB 3K94A 1MAAA 3IODA 4W5WA 3WP0A 1OFGA 3WJ1A 2WSBA 4NAHA 3T5AA 4XQ0A 2EX4A 3DB1A 1DWPA 5A2QA 4P7JA 1XLVA 1X77A 1Y3DE 2PCLA 3HKCB 4QNNA 4EKNB 4TKVA 2XCIA 2WU1A 3PS9A 2YWJA 3SC6A 2AWNA 4B45A 3EH2A 1KC1A 3QPDA 3U40A 5K8UA 2R8EA 3IMEA 4RIIA 2QM3A 1M7BA 4Z2YA 4BLSA 1RYHA 3LWNA 3X1YA 3IBGA 3KHUA 2NADA 4CYMA 5LQAA 3DYBA 3FYCA 1NPYA 1H0SA 4H3VA 3RADC 1T3TA 1MR3F 3FJYA 4HDKA 3TVYA 3NHYA 2X5JO 1RHQA 4MUIA 1K3TA 1U7PA 1UXJA 1TK3A 4AG5A 3TG8A 2YHSA 3UAYA 1WSDA 2UDPA 5IFKA 1NY6A 3BJRA 3D3MA 4DMRA 1V8FA 5JNLA 3H97A 1VBMA 3C98A 4F1PA 3A06A 3IX7A 3S29A 3HB0A 5JBIA 2X6IA 1N77A 4NMMA 1EX7A 1J9EA 1WAMA 2FYTA 2B8JA 1O87A 2ZRNA 2RGWA 1MZVA 2K87A 1JDUA 3C3WA 4QHSA 2O50A 5IEBA 3RS2A 1RQNA 2I9CA 4TXRA 1HOXA 1NJ1A 1P4SA 3AKCA 3MNFA 4GR9A 5B6JA 3EA0A 3MWDB 5EMKA 1NDHA 4FZVA 1XX6A 2JKZA 1QFSA 3IL2A 5JNRA 1T9DA 3G2WA 3ZWCA 4EFNA 1PJ4A 4IW3B 2GRNB 3VAZA 3EXIA 4AL4A 5ADVA 2Y27A 3R5JA 5JJBA 5FTNA 5CP8A 4CCAA 1I3OA 2WW8A 1KIMA 3FUTA 4PZ9A 5ED0A 2HUPA 3VGPA 3WK7A 2X1MA 2ZFUA 4TVBA 1GRNA 2UXDB 1P5RA 4FS3A 2JZCA 1VQ1A 1DAHA 3R7QA 4R0NA 2Q5CA 4X1KB 1XWWA 2HRRA 1FX1A 1G59A 3ZYCA 1S9HA 3C3KA 4ZQCB 1DV1A 2IY8A 5CURA 1OAKA 4CR8A 1F2TB 1QIDA 4E1BA 1BE0A 1P60A 2ZRPA 4FFLA 4JXZA 5TXGA 5IY5E 2BJHA 5DFAA 1GNPA 1EK0A 3KL2A 3EOZA 4F4FA 3MYVA 3GOQA 3K2QA 3NHPA 4ZZ1A 1ZIYA 1M10A 2WSLA 2BMJA 4RD1A 3CJTA 3TLMA 2QUZA 2YVQA 3OZDA 1XP5A 2DBAA 4UEKA 4D6PA 2D0DA 3FMIA 1ORDA 3OX4A 4RVSA 9GPBA 2IYQA 3U3XA 1H6DA 4L27A 1T0UA 1GPH1 1MVOA 4XOIA 5ICCA 5A7HA 3KAPA 1BEEA 4F7DA 3H87A 1GNLA 4EZKA 2AG1A 1KH3A 4BO5A 2GO1A 4F92B 3FUHA 3C74A 4CT0A 1AIPA 3NUQA 4Q00A 5CB4B 2BTEA 3BUSA 5AI4A 1P1BA 1E7SA 3VDRA 4A92A 3ZHCA 2JFGA 4HPWA 3QSGA 3G2LA 4XB1A 1C1DA 5BVHA 3R3JA 4NOKA 4A7PA 2XV1A 3JW8A 5U4XA 5I01A 1BRMA 1NJ2A 4P93A 3ZGNA 4IDGA 3EEYA 4FXPA 3ZV4A 4WTOA 1KPIA 4CDRA 1NWCA 3EASA 4DMFA 5JRJA 5JCJA 1P7ZA 3CSSA 121PA 4I46A 2XRZA 4ZZIA 2RHDA 5TQ2B 2WOOA 3HUDA 5L8VA 3D4LA 5J4VA 1QRTA 4Z0PA 2GRRB 5AUQA 4TYMA 1ABFA 3ADKA 2I87A 1BS9A 1RPNA 3BJEA 3EHDA 3LNTA 1CJTC 1CVRA 2Q7OE 1JEEA 2LCIA 3A3KA 1PR3A 1VJ5A 3GEIA 3ZE0B 1QF9A 2WMOA 1KEPA 3BB4A 3EH1A 1Z17A 5HDQA 3QWAA 4EHKA 3KJEA 1XYVA 3AR4A 3Q8XB 4B4WA 1Z0KA 1S8FA 4PAWA 3R9AB 2DM6A 2RHBA 1ZGJA 2M63A 2Q5FA 1ZBQA 1A77A 1IPFA 1J8DA 2G4CA 2QV7A 3B5JA 1V9LA 1VKNA 4KSBA 4XCXA 3ACCA 3VC1A 3B6JA 3DUFA 1OTHA 3I28A 5MGNA 2I4MA 3LC7O 3UMVA 1MXHA 2RAPA 2X42A 3QGMA 3C7DB 5GOZA 4M53A 2A1UB 3QU7A 1SBQA 5DIFA 5IDVA 4QOFA 3UKJA 2Q4TA 3W6NA 5IG2A 3I61A 3AESB 2A6PA 2C5FA 4BFUA 3MM4A 2KM1A 3W8NA 1RI4A 3O2NA 4JIGA 3LM8A 3ZD9A 4L73A 3VR3A 1BU8A 4MQLA 1JHQA 1P9RA 2OXFA 3LBYA 3SJZA 1LVGA 3W7BA 3KXDA 3Q6MA 1G8MA 1QE3A 4NP6A 4UM9D 5H59A 1V2GA 3L1IA 3AESA 4C7JA 1I3MA 3OZXA 3A4TA 5DHPA 3TW0A 2VAMA 1USVA 1VLQA 1YQEA 3FI9A 1T9ZA 3G2UA 4OIFA 4Q4AA 2ZBEA 4NV0A 3EIXA 2BELA 2F43B 1BX1A 2A67A 1AH2A 1QQAA 1IWPB 3AH8A 3GJ0A 1FS6A 3KR0A 4R01A 5ALUA 5HMMA 5CEEA 4RHCA 3ZJUA 2QRLA 1M2OB 2J3LA 2PMKA 3IMFA 5JFOA 2KB0A 1KLXA 3FKJA 3IOCA 1BYIA 4PZUA 2A7XA 1ARZA 1U81A 2CE7A 3WMRA 2CJYA 2ZIEA 4CM6A 3DDCA 5BRAA 3OZEA 2RE8A 2WDZA 3C87A 1OTYA 4OLAA 2GARA 3WK8A 1QVZA 4LE1A 4RMIA 4TKZA 4RETA 5BUCA 1UQUA 3E3OA 4YY3B 4EO7A 1P61B 2PIAA 3AKZA 4MLDA 4BUCA 3FNEA 4NURA 1CULC 3DDUA 2F8TA 4F91B 2JCVA 3QWFA 3A31A 4G5FA 3VC2A 2MIIA 5HKLA 3WLOA 2HEIA 3BL5A 4HUQA 3RTCA 4DSZA 3MWEB 4JASB 3NXSA 2J41A 1PGOA 2K4MA 4RTQA 3KQUA 1IB6A 3I2FA 3ZVLA 2P58C 1KKMA 1OQAA 4GTSA 4QDUA 2IHUA 3GBVA 5FLKA 3MTGA 4XVUA 4FMDB 5M2QA 3DSXA 1JQDA 2RGBA 2C0QA 2BUBA 2HUNA 3Q7EA 4L74A 5ARCA 4ESHA 3WG7E 2QG6A 4KQ1A 4Z54A 2ZR7A 2VDQB 1K66A 1XN1A 4HI8A 1Z0FA 3L8MA 1E32A 2B1QA 3U13A 1PIWA 3D4IA 1R27A 4HORA 2CVOA 1AXGA 4KYVA 2FSGA 2F4VB 1PWHA 1NQXA 3X1MA 1GPUA 3SX4A 3WL5A 4INJA 5CDGA 1YMVA 5ERYA 5F5NA 1K86A 2WM8A 2ZPUA 4DHWA 3GR6A 1TJ5A 2LUOA 1Y98A 3CNNA 1RRMA 1HM5A 1RYEA 5IFLA 4CMCA 1ZMOA 5HIMA 4K9QA 3IB3A 8GPBA 4OXNA 4F4JA 4M99A 1HH8A 2E4XA 3E5HA 3KJHA 2QM7A 5CA0B 2QXUA 1KRXA 4OIMA 3FTSA 3QHPA 1CS4C 4AKTA 3A6PC 2XWJI 4TWZA 1DC8A 2PH3A 3IUYA 3K9FC 1UOHA 1KJ9A 1A1SA 1UBEA 2EBWA 1LDBA 4WSOA 1I1OA 3AO0B 3P0EA 3PWTA 3KYCB 4EPZA 1XL1A 2X6HA 1JXMA 3BD8A 4JD5A 3WGMA 1P9OA 4RY9A 3NWPA 1DQNA 3IVMA 4IHJB 3F4KA 5KSPA 3UH0A 3V8MA 1I2CA 1KK0A 3K9CA 3DE3X 4H16A 2LCQA 3WWZA 1RHJA 3N2ZB 3PXUA 3QVOA 4WACA 3CHYA 1AQNA 1NP3A 2R8ZA 3DOFA 1GOTA 4MQBA 4KXFB 1J1UA 1J8VA 2POQX 3ZW8A 5B2EA 5AXCA 4PS3A 1K5HA 2QLNA 1UT6A 3ADOA 2QDXA 5D0QD 4MVJA 3ZDCA 2ZIZA 3D6NB 2ZBFA 1BU5A 3ZHXA 2ZXEA 1CZKA 3T7EA 1C3VA 3T3MB 4HNAB 2KS6A 5LP6F 1P29A 3A9WA 3UWOA 5C5CA 4OBBA 5B12A 4C1BA 3WICA 1XAJA 4DNXA 5J90A 2DWZA 1W0KA 2BEWB 5DPMA 4E21A 3DLCA 1BHJA 1JDNA 3ENVA 1SKAA 2I3DA 5FL3A 2RI6A 5A0VA 1FFAA 3BMQA 4CMJA 1SZPA 1PGQA 4FGWA 2B5WA 3QKTA 1XXHA 4O33A 3VSDA 1R8YA 2FSVC 4CE6A 3RHZA 5KCZA 1Z4KA 1HDIA 1QORA 3Q2OA 4IV5A 2F4NA 2RHRA 4CL0A 4PO9A 4YBRA 2O7RA 2ZWIA 3BKXA 3MW8A 4UPDA 3ZBUA 2GZ3A 4WL0A 3V30A 1Z12A 5AW0A 3SHVA 2ZM6B 1XIVA 2OHJA 1Y7LA 4V03A 4HEA1 2HO1A 1JVNA 2NVUA 3STTA 5T4YA 1GDHA 1W5EA 1V11B 1GEGA 3RR2A 4B7AA 2GK7A 1ZONA 4COKA 3RJ5A 3HDYA 4J49A 2V7BA 3T9DA 2EW2A 1W9HA 9ATCA 1LD7A 2ZB7A 1PD1A 1EDUA 3EWNA 3OJLA 4AJJA 1DHRA 4UREA 1T0JB 4JC5A 5IHXA 4GTVA 2FSSA 5BXYA 1QV9A 5K3EA 5AVSA 1Q3KA 5JHBA 3EF1A 4I8XA 4ZCSA 3NX4A 4MJ3A 4OA8A 4L9RA 5FUQA 3NB0A 3VNSA 2BHLA 3QUQA 2QDKA 4GOMD 1HG0A 1KS2A 4JYMA 5BSTA 4UOZA 10MHA 2Y99A 2DJ5A 1CUZA 2FJUA 2H17A 3FLBA 4TLDA 5EE9A 3ROMA 3SSOA 4W1QA 1COWD 3WWDA 3WYBA 2YY6A 2QMQA 1U0OC 3OLXA 2GZAA 2IXTA 2ZRJA 1XGKA 1W34A 2EARA 2G4LA 3AUAA 3EXG1 3B13A 2JGFA 3HWWA 1CQIB 4QPZA 3WK9A 1ZVMA 4UHBA 3IPYA 3SXUA 2GM3A 2QM0A 1P5HA 3L7KA 1XZDA 1MENA 1IOWA 2HWWA 4E70A 3RRZA 1S2IA 2AG0A 3IV0A 4PR3A 5I8PA 3TQTA 4H1VA 4JLAA 1SU8A 4QO7A 2EKLA 2YMMA 3BA1A 3GGPA 1GT6A 5CB0A 4UWKA 2IWHA 1JPLA 4U96D 1E1MA 4MUHA 4AYWA 4AO7A 1DFIA 5JO9A 1FE8A 3KOUA 3L5KA 1FVOA 3UZUA 3MEQA 3PPWA 2QVZX 4K3UA 4UQYA 3DO5A 1FDSA 2XHEA 2ZBPA 1S70B 4TTVA 2XPIA 5EYPB 3RSQA 4U8YD 3KXKA 2O2ZA 1XTRA 3KE8A 3FTVA 4G2NA 4MUNA 5K05A 3O1LA 3BGSA 1ZNZA 2GEKA 3H0EA 4J1SA 3HXTA 2NU9B 3T34A 4WVFA 5LQJA 3K9QO 4DW8A 2X0JA 4YJ3F 1MO5A 2REOA 3WLJA 4D8YA 2GDJA 2AMLA 2J0VA 1L4HA 4UU1A 3WAJA 1U7WA 4HBDA 1L5MA 3M5WA 2AXQA 4DSNA 4F85A 1OLSA 3V2XA 1E3QA 1QDLB 2R96A 3HCAA 3NTXA 5G1NA 4IOLA 1NLZA 3AB7A 3T1QA 1PF7E 2AJLI 3PX2A 2BI8A 3RS3A 4F45A 4KXNA 2G1KA 1HEIA 1U0SY 2EKPA 2H63A 3PDWA 2HLDA 1IN7A 3IEXA 3VPAA 1D0SA 3SEFA 4NG5A 4MWCA 2NSYA 5DK6A 5HPYB 1T2AA 5EMJA 3ONEA 1TYBE 3WLSA 5LQRA 3GZ1A 3E27A 4KAJA 1A8QA 3PDCA 4BHTA 3ANLA 5EPUA 1SBCA 4ZVKA 3A6HA 1DOHA 3W6PA 4E09A 2W5UA 4E5PA 3JQQA 3LXUX 4AWBA 3OY2A 1CV2A 1CUUA 4QYTA 4JX8A 4H4EA 5CIWA 2OYRA 5TF0A 2QVBA 3R5FA 1S2MA 3H6KA 4IVNA 4KWHA 4RWZA 3BVPA 2X38A 1FDIA 4NBKA 3WGOA 5LOVF 3IIJA 1NQAO 3WLAA 4LJ4A 2H51A 4R3WA 3WMGA 3DCYA 5IXYA 3CUWA 1NSYA 3ASDA 2JKVA 3I4FA 3RK6A 1FMCA 3QAQA 1D6NA 1HY3A 1RCTE 2MSLA 4H0NA 3VNQA 1USWA 3DOUA 4TTSA 2JLYA 4AY6A 4C2TA 4O4JB 1H2FA 2G6BA 4Z51A 1JZTA 4TUUA 3CT6A 4XRGA 5JMOA 2C2LA 3KAEA 1OB2A 4P22A 3UT4A 4PGMA 3L8HA 2G8LA 3QYPA 3LGXA 4Q9AA 2ZXWE 1K0FA 2Q46A 1AUOA 4NH4A 4YHHB 4X7MA 4B3SB 4ILHB 2DFPA 2ZJBA 4UBIA 1GSAA 4K0RA 1PK8A 1G4AE 5JZ9A 3AKDA 5CT4A 3CQGB 2ZUWA 4URXR 5IABA 2OEPA 3K5HA 1EX1A 2VA8A 4ZN6A 2CHFA 3QHQA 1G3UA 4OA5A 4DIDA 1J4AA 2CLDX 3TEFA 1XR3A 3TLEA 1I94B 3B70A 4PNEA 1EZ1A 1G5IA 4X91A 3ZYLA 4LXTA 1E0KA 1HUQA 4RUKA 1DG1G 2HDNB 3NIBA 3HDVA 2DC1A 5BQFA 4MS3B 3HVEA 1VLLA 5EXPA 3B2EA 4W5OA 4WA7A 4CFSA 2C58A 3NS7A 1TJCA 1RPTA 4KXVA 4Q39A 4EA9A 4DLBA 4OVVA 2FN4A 1KJWA 4UVEA 1T9HA 3J5PA 3KZMA 4REQA 3FNIA 3WV5A 3BH0A 3SLGA 1QO0A 3SIPA 1TOAA 4XXHA 3SZMA 1JFSA 2PJZA 3WKAA 3F8WA 4NK5A 1W44A 4V0ME 2J4CA 1TNYA 4RANA 4RA9A 3ZU7B 2FEWB 4O1OA 1N4PA 1NA3A 4MXDA 3RKRA 3GFGA 1JEQA 2Q1SA 3KM0A 1MOQA 2AR0A 1YI8A 2GHQA 3BK7A 1TW3A 2Y1XA 4N54A 1RMTA 4PR0A 1WXWA 1T9KA 3D43A 1ISFA 1ZPDA 1DFGA 3HWRA 1UJJA 1IZZA 3L49A 5BVGA 2BW0A 3H1AA 4IJMA 4UNQA 1Z8NA 2BI7A 3HU5A 3NHSA 5IPFA 3D9IA 1KA9H 1OLUA 2KBFA 2ZQYA 5KYUA 5TC4A 4P7KA 3U9TA 2RK6A 4AO6A 5HTOA 1S2GA 1X39A 5I7OA 2XNHA 1XZGA 3URMA 2W6QA 3FUJA 2WHQA 2C98A 2IW3A 3IO3A 2AFIB 3OHSX 5EJMA 4EY3A 5AW6A 2BT4A 1JPNA 5EI5A 3BKWA 3L6EA 5J4LA 4ARIA 4J3JA 3N8DA 3QE3A 2XF2A 5CAEA 2AFIA 3E9RA 3S5UA 3WGLA 3HRAA 1XZAA 2C82A 4FOTA 4BOYA 4BNFA 1U99A 1YHYA 2Z6VA 4FNGA 2GEVA 5KNHD 3O2SB 1GLGA 1CUEA 3EIEA 5FL7A 4JC4A 2IYTA 4N9QA 1KEKA 2BEJA 4XR4A 3NBAA 1SH7A 3TIIA 1KY3A 2HLPA 3JCKC 2RHJA 1JPJA 4OXQA 1NUSA 2JANA 3MTQA 4FN4A 1FQOA 5AW8A 3A1DA 5DYNA 4E5NA 3RBZA 2FSUA 4YRJA 2VP5A 1RKUA 1ZL0A 3LT2A 3AUYA 4BLTA 1HEUA 5B7PA 4Z68A 2H5LA 1MFPA 1ZK0A 2PMBA 3L77A 3ZQKA 5CD1A 1QZ3A 3RHSA 1A9OA 2FF4A 5CCDA 1XMQB 3AB3A 4BYGA 5LKAA 3FPFA 4BEJA 3W5UA 5JMWA 3W3AD 1VIVA 3LQKA 4FYWA 3WBJA 5CA0F 1E2BA 1YMPA 2RFMA 1BDIA 3B60A 3GAAA 5A9SB 5J43A 2MSDB 5BV7A 3SKVA 1QGED 1KZ1A 3FVTA 1XMXA 3D6TB 1EFVA 1ZM4A 3QVVA 2CB9A 1G6Q1 1OKKD 1O97D 3L0PA 2J6CA 4BNNA 1VYVA 5KOIA 1VE6A 4BFXA 2R62A 4PONA 4XWGA 4EOGA 1Q12A 1A17A 1TM5E 2H85A 4MP6A 2XGJA 3M1YA 3CH7A 2VP0A 3K9BA 3MT8A 4D97A 1M34E 2D2IA 4TZ0A 3RAUA 1DJLA 1JE1A 3VR5H 2GEDA 1JHUA 4EM6A 4HCJA 4B7ZA 1FW6A 5EY5B 2TMDA 3BIOA 3U3RA 2Z2IA 4APFA 4J07A 2P9QA 4HDAA 1DO2A 1RRFA 2Q9AA 1VHDA 3I92A 2F9MA 2ZWVA 1G21B 3ME5A 5DBKA 2LGJA 3D2BA 3GGOA 3L54A 1A95A 1R4NA 1NF2A 1SUAA 1B6RA 1TTPB 3FOAA 3VH3A 1ZN8A 4ZOBA 3JXIA 4WBNA 3H9EO 3K5PA 3NAMA 3KSUA 5F9MA 5DOVA 1RHKA 5D7NA 4DR2B 1L0BA 4KITB 2ODQA 1M67A 1NV8A 4R81A 4P9NA 1O94C 4OMUA 2B61A 5IS2A 2JLSA 2MHCA 1PQWA 3EGOA 3PR3A 4YP0A 3ZQ6A 1JDPA 2HPVA 4L50A 1NVKA 4GSLA 3I3NA 4G56A 1ZHOA 3F1LA 1L1RA 2NXJA 4I9CA 1E1QD 1LBSA 1O1YA 3AR8A 3DUWA 2NT4A 4KQKA 1PR1A 2VT2A 3NHMA 5IJXA 1I3CA 1NFRA 2SICE 4G1TA 3L04A 5DX0A 5JLJA 2AXVA 4APOA 3PUVA 1GG8A 2RK4A 3KBBA 4MEAA 3ADDA 2I22A 2A9VA 2J0UA 1D1PA 2ZVPX 3PUYA 5GAJA 1L4EA 1QJCA 4LY9A 1Z7GA 1G5TA 3AZQA 2F8LA 3KWLA 3CISA 4BMSA 4J8YA 4WZAB 3ZWDA 1WETA 2WXRA 1U04A 3F6SA 3KQHA 1LBHA 3IT2A 1RT9A 2NU8B 5EIBD 1GPDG 3KPVA 4M6WA 1G8YA 2AFHB 3BREA 3AS4A 3PHLA 3TZCA 1KZGB 5AXAA 1E5DA 4UI9K 1AQUA 3SVTA 3THWA 5KNBD 3THXA 3ML9A 1YR8A 2WYOA 1XVIA 3CA8A 1E5QA 3TXAA 1JIQA 1Z0UA 1J0CA 4LC1A 4CMEC 4DR3B 5ECYA 4A55A 3JQPA 3NP7A 1JBQA 2C9OA 5EG5A 3ZGVA 1PSZA 5KNCD 3VRHA 3PYXA 4YMVA 3DZCA 1DAPA 1DMRA 4BEBA 3PDIA 2AI3A 3KZ1E 2ZB4A 4N49A 4P3XA 1L5KA 5B2FA 4GI7A 1V47A 2FLKA 1IZ7A 4ZVPA 5IVDA 3BGVA 4O1MA 1TNUA 1SXGA 2IVZA 4POAA 3VPXA 3C3RA 4AIRA 2XDQA 2I7XA 1C3XA 4R6XA 1YU9A 4K9SA 4OQZA 5IHPA 3EJNA 1YE8A 3KO8A 5ER9A 5AARA 4BGIA 1KI7A 4UE6A 1J39A 2X2EA 1NT4A 5FO1A 2VYQA 4K6KA 4X95A 4C5BA 1AD2A 2HPZA 3P0FA 3G0IA 2ECOA 1UZUA 4R1LA 4WZBE 4FNMA 2BF4A 2ORWA 3PWZA 1MT0A 4CG2A 4DLAA 1GPYA 1K3ZD 3JQRA 4V3BA 4BNYA 1EJ2A 1RYBA 3DFIA 3GFBA 4N0EA 2R25B 4UQXA 5HEKA 4A0FA 1DKNA 1H4TA 2C31A 5BN1A 2JLWA 2A0KA 3A4VA 2QYOA 3R20A 4HYQA 1XZJA 3TWTA 5LCWJ 4HLCA 3ZQ4A 4C05A 4DBLE 1IM5A 4L4ZA 4DLXA 4JFRA 1KQFA 1AJEA 2Q6KA 2YNMC 4MTLA 3C6ZA 2P6PA 3TR5A 1Z4IA 1SBHA 1U0RA 3T7RA 5CB6A 2FMTA 4EVRA 4LC0A 5FQ8A 3AG4E 4RQIA 1TIPA 1LRLA 1C80A 1HDEA 2GKSA 1IWOA 4FVTA 1B6SA 1FJXA 1EIWA 4O2RA 3PEVB 1SUCA 2Q49A 2VJKA 2H9YA 2Y93A 3TVDA 3C7KA 1LLDA 2B37A 2UUOA 4ZYTA 1NUTA 3GDFA 4BFZA 3P2MA 4EHHA 2CGEA 3GPCA 4YP7A 4CVNA 2FJPA 4RHYA 1KOLA 1NR7A 2XMBA 3L6CA 5JROA 2IHBA 2ZJFA 4CL3A 4TMVA 1S1MA 4FJ2A 4MV0A 2NLOA 2QD3A 4XYBA 4BIIA 3KSBC 1NM5C 2REXB 1KQ3A 2P2NA 3NYIA 2VJDA 4WT7A 1HNXB 4TYNA 2JFYA 4U8GA 1XCOA 5ALKA 2GYVA 1S89A 3WWYA 4F04A 2QLLA 4CF3A 1I7PA 5LDGA 1WG0A 1NU8A 3KUCA 1UK9A 5E1BA 2V03A 4CTJA 4ALJA 5UKDA 1OGJA 2GRAA 1ZC4A 2W98A 3U4AA 4LUNU 3R7WB 4EUHA 2IKSA 3G8BA 4BN0A 3NG1A 4PHGA 2JF0A 2Q5JA 5ITSA 1NI3A 4IN3B 3IESA 4TSFD 5I51A 1IEQA 1VPTA 1NMSA 1NFIE 1VP9A 1WPRA 1D9SA 1K4YA 4CT5A 1M33A 5IWAB 1EYHA 1Q19A 3G1TA 3KL4A 3NH9A 1G7SA 2PL9A 3CEMA 3BQMB 4PIMA 4HWKA 4FN5A 2O0MA 2H2FA 2Q1XA 2QT9A 3LOQA 2OCYC 2F9LA 3OEED 4WY5A 4HGQA 1EF1C 1V5IA 2FWJA 3NCTA 4TRNA 5IMBA 3U81A 5KVCA 3KTAB 4P4GA 3T3DA 3OOWA 3ZWYA 2QORA 5CEJA 2WIGA 4UI9J 3G2VA 4LFCB 2XSZD 4GTPA 1YJ5A 5C0OE 2INGX 4S35A 4D45A 4QVGA 1LB1B 5DWQA 3JYPA 3UGQA 2IT1A 3TW6A 3FTWA 3D9OA 1OT8A 1DRVA 3KQNA 1GU0A 4EZLA 4G1BA 1IY8A 2D1YA 1RZ3A 3MELA 3UAXA 1M0SA 4FLFA 4M8LA 3UHPA 2QP9X 2V45A 4R7TA 4G0NA 2CXOA 1K89A 2FPUA 4UEQA 2ZYSA 4W4TA 3U4CA 1NBIA 1FDOA 1VRVA 2I66A 3QVXA 2IYVA 1HYQA 2P78A 5DHFA 3UMSA 2PYDA 2BGGA 1E1CA 1YRBA 4U9IS 3UC9A 1A4XA 3CK8A 1IFXA 1BS2A 2NNWB 3L84A 3CUSA 3ZE1B 1E1LA 4D7AA 3VR2A 1Y5NA 3BYZA 2CJPA 3DAPA 4RIHA 5A6SA 5A23A 4MGZR 1IN5A 4HRMB 3V6MA 1THTA 2FPXA 2XBLA 5TMPA 4J3FA 3KV1A 4JV5B 1UOOA 1W1IA 4AECA 2A5LA 1ZC3A 5JFGA 1L8QA 4M37A 1BXRA 2V98A 4S1NA 1NRIA 3PNSA 4BV8A 1MHQA 3GGDA 1NZDA 1V9SA 1UJ5A 1XZBA 4DX1A 2QRUA 1G3MA 3OJCA 2C4VA 4Q7JB 4XGNA 4CTKA 1G8FA 3NEPX 4I1IA 4JXXA 2O57A 5DYIA 4DA4A 1GT91 1ICEA 1DAKA 4YNDA 1PT5A 2ERXA 2GLUA 2HZBA 3HNOA 3O91A 2BKLA 2RGGA 3ZW7A 1QV6A 1ILWA 1YCHA 2YYSA 3QKRB 5EKSA 4M49A 3PYLA 4DIUA 3F5MA 4HQ6A 3HVJA 3BB1A 5K8TA 2OBYA 2ILRA 1FFXB 4TMTA 3TPCA 1TZCA 1DZ3A 3ZUVB 1UAYA 2CVFA 3V4VB 3GO4A 3QFHA 3K2IA 2C00A 4IH1A 5B1AE 5K3AA 3RQIA 1IXKA 4CCYA 4IKPA 1YI0A 3ESCA 3DAHA 2NSJA 3B9PA 4I8DA 5C8YA 1A27A 1D2GA 1KK1A 2WJVA 3BN3A 3OJOA 4PQRA 3EK2A 2HGSA 1BVRA 1JIVA 2G3YA 2P2SA 5LIPA 4F96A 2BM9A 4DEVA 3PUJA 4M54A 1Q92A 5HQJA 4AO8A 3HM9A 1Z0AA 2H29A 2BE7A 3CPJB 2WPNA 1BAPA 2RHTA 3EWAA 3PXCX 4LI0A 1TAHA 4RF3A 1QS0B 3C1OA 1OOEA 2C3PA 5AK4A 3GFPA 5C3UA 3TN7A 4D4JA 3L4KA 3EG9B 3K30A 4PYNA 2GEUA 1KOFA 3CNEA 4UUBA 2ZQ5A 1G5RA 3HDGA 1CY0A 4DM7A 4MW0A 4E08A 4EW6A 4ZYZA 3W5CA 2BEVA 4Q4AB 3DVAB 2W6JA 1FMLA 3V4OA 4B4OA 3AETB 1U8ZA 3KUKA 3RC2A 4CHTA 4BBPA 1INLA 1XEXB 5BXOA 1XQWA 1I30A 4AN1A 2I3AA 1E8WA 1A98A 1CE8B 3L9TA 2QYTA 3L07A 1X80B 3FCSB 5GM1A 3EISA 1TZ2A 1OCRE 4FHGA 1PSWA 1U2EA 1HYGA 1KQPA 1N6KA 2GZRA 2I2BA 2IC5A 3QXXA 4MIKA 3W5BA 3R9XB 2OSBA 3VYSB 4B33A 1KERA 4EQZA 2IEDA 5E8JA 1H3FA 1LXCA 3PQ2A 1S02A 5BYBA 1US8B 1GSIA 3RM3A 2ES4A 3UT5A 5EIAA 3WRXC 1C5KA 1GPMA 4ILEA 4D4HA 1TUBA 1JR4A 1K9SA 3AINA 3H3JA 5F1OA 4BQSA 5HOEA 2JD2A 2PUCA 2J0SA 4NCNA 1UZAA 1Z35A 1NXVA 4P4SA 3UTDA 1T5IA 3PGVA 1NBHA 1TL7C 3IVRA 4QQKA 1ENYA 4PCVA 4ANVA 1RIIA 5CJPA 2Q9CA 2I65A 1WKVA 1MB4A 4YAUA 3BE5A 3MLAA 5KIAA 3J5QB 3UT7A 3F0TA 4HDRA 4F2HA 4D4MA 2B5VA 4DJDC 1DWOA 2I1QA 4RVGA 1CJMA 4WZBB 4FYJA 5DNCA 4CNBA 4OD0A 2RCYA 4LDPA 5JBQA 2C7QA 2H6HA 1HLDA 3K73O 1VSVA 4DLNA 3ASFA 1B0PA 1JA9A 3MQFA 4R9VA 2MOWA 1R3UA 3G0DA 4KAFA 3AVTA 4WZBA 4EEXA 4LY0A 2ADMA 5GZ3A 1LC0A 2PO5A 4Z4EA 1MZCA 4V02A 3MHPA 1EB9A 4NEQA 3ZGXA 5HZMA 4AJPA 4C4YA 1X7HA 4ZU3A 1X1AA 2O1SA 1CU1A 3TR0A 2ZYIA 1OW3B 2BR5A 1RYFA 3CHRA 1YKGA 1JHZA 4INOA 1GAEO 1DCKA 2C5AA 2FMUA 1VRWA 2LIPA 3QPUA 4OQPA 2E2WA 2ZK7A 5EXDA 3ZNPA 5CBPA 3ZHVA 1CRQA 3AJ9A 3V00A 4HGRA 3NJ4A 4ZU6X 2QZ4A 4KJXA 1X0XA 4KQ6A 4YRNA 3ZTYA 3M3DA 3NAQA 3HJUA 2ZR0A 5I9LA 2JL1A 4PLWA 4HB2A 1XV5A 1FPPA 2WM2A 1E7YA 2ON6A 4JLPA 5LOVB 5CHEE 2IU4A 2OB2A 4CF5A 2OCAA 4BTBA 1HK7A 1MV8A 1ZOSA 5FP0A 1C0KA 1CE8A 1U7HA 3U1VA 1QOQB 4E33A 3WIDA 4LTNA 3IELA 2V7QD 1T5HX 1WA5A 2EWWA 1ZIXA 3C4VA 1NA5A 3V55A 4ETNA 4FC8A 2ZI9A 1X8JA 4TKLA 3TZQA 2YXNA 2NC9A 2WU0A 1FEZA 1G0NA 4KO4S 2HFJA 1IB0A 2X41A 4LJ8A 2NW6A 1B26A 2R68A 2C04A 4MX8A 2V0NA 3GW4A 2BLNA 4OHXA 1HNWB 3G5LA 1NI4A 4RZHA 5HCNA 4M76B 4Q1VA 3GCGA 2VTDA 1NKVA 3K35A 1SXHA 1XDWA 3JQ7A 2XH8A 1ZM7A 1RHRA 4JZKA 1K8RA 4EH1A 2GWHA 3ABIA 5IKOA 3WV4A 5EJ8A 3H9GA 1GN8A 3L18A 1BTOA 3BJIC 1IY2A 1SUIA 3H16A 3ZTWA 3R7FA 3RTDA 3ZIAD 1MEOA 4JJZA 2IUYA 4NU8X 3ZWPA 3L7CA 1K7SN 4Z4CA 4LFAB 1QH0A 5K51A 3TLXA 1QC5A 4M1SA 5T67A 3SVLA 3V79K 4L1BA 3TLAA 3EX7C 1PJAA 3KD2A 4OYYA 4XCVA 4B6QA 1O57A 4YJ3B 1RJ9A 5FPYA 3V7UA 2J0QA 4CODB 4LF9B 2I6HA 4FFMA 3EJ6A 4QECA 5EHQA 2XMDA 5EZ5A 4Q0MA 1GPAA 1WX1A 3NH6A 3P9PA 4LAFA 3RKSA 4DVGA 2CG3A 3RVKA 1X42A 1DKOA 2KE5A 1UBNA 2XCQA 3PVZA 3BWYA 2XYQA 5K0ZA 2G0NA 4O0MA 5FCDA 4QXQA 3TLCA 1RU3A 3QH4A 4RGQA 3PLRA 3RTAA 3OTIA 1BWPA 3GGSA 4OH7A 1P0MA 1Q91A 3IH5A 3MT0A 5JXHA 2R2AA 3HN6A 1W8IA 1QXSA 1L5YA 2EKZA 3JQ6A 1F0NA 2HK9A 4M9SA 3EHRA 3KX2A 2YQZA 2P79A 3AI2A 4YHBA 5TGDA 5BV1A 3HU3A 4MRSA 4D9CA 1R50A 3HRHA 1WTCA 3W7AA 2JFVA 2ZUSA 3U3OA 4DIKA 5BQXA 1BCSA 3FTUA 1I4DD 4ZQIA 4BDTA 2E1RA 1A8SA 2VJOA 3UAZA 4KUEA 2TRSB 1YS6A 2G63A 2ZIGA 4DEXA 1MX4A 2JABA 2QI9F 4H1UA 3UEOA 4BX3A 4J16C 4D9KA 4NONA 1KT0A 3IURA 3IUEA 1EWKA 2VHXA 4IMRA 3WXBA 1ORIA 1MX9A 2B4YA 4FYKA 3V8VA 2BFOA 3ZWQA 2QVCA 5LJLA 1RMQA 3RUHA 1N3LA 2H5IA 2RAFA 4IXNA 4D4KA 3DHWC 1LI5A 1K06A 1W0KD 2LXNA 3EW9A 3WLTA 4BRUA 4EHLA 1CHDA 4Z9FA 2TMKA 4FFBA 5HRUA 3ZCXA 3AHDA 2J5XA 2EBHX 3IYLW 3RK4A 5ED4A 1K88A 3JR7A 3WBFA 4ENTA 3WKCA 1WHTB 2W6JD 3FPKA 3SQLA 2NZWA 1JCQA 4CKYA 1UK7A 2X0IA 4ABNA 1R4MA 3FGPA 3T06B 3U6KA 2A0WA 5FYQA 3PKIA 1XROA 2XZTG 1BMQA 1R12A 1TZBA 4H59A 2EX0A 4TXMA 4MR9A 1HE8B 2NZVG 5EZYB 5TNXA 2PWAA 3IDOA 3V7FA 4CGVA 4M8SA 3S5JA 3NBMA 2G0AA 3OKCA 2ZKIA 4KQJA 5H3CA 3WLFA 6CHYA 2V4ZA 1T1GA 3NOOA 1J25A 3JVDA 3MBKA 2IDZA 2VNHA 4HH1A 2ZE6A 3ABOB 2Z3VA 4RLQA 2ZU6A 2ZUVA 5EKXA 3PNBA 3Q47B 5GONF 3VAAA 5BN3A 1GL3A 4KRGA 3C24A 3FPEA 2HLHA 1EXWA 1T43A 5TE9A 1Y9AA 2WF8A 3CZ5A 3MMSA 1U4NA 2VRCA 3IAXA 1S2NA 2EQBA 4H18A 4P3PA 4QOHA 3P2OA 1WULS 3FEYA 3D0KA 4LXGA 4KN5A 3UIEA 3H1GA 4BNKA 3IBYA 4NH0A 3SKXA 3H13A 1D4OA 5K0GA 3TW8A 4G0VA 3EXHC 4LIPD 2HO4A 2IYXA 4MYTA 3QOYA 2IP4A 4KQGA 1XZCA 4NG4A 3MEKA 1V1JA 2YNMA 1QWSA 3IJEB 3O9ZA 4HLNA 2E49A 4ICIA 3B9BA 3DPUA 4PTLA 4HH0A 2CXQA 4IGFA 4MW5A 4I4NA 4N3GA 4DABA 1XL0A 3I39X 1FXSA 3M4ZA 4DX7D 2BMVA 3UM9A 4YR7A 4ALIA 3E8XA 4Q16A 3U62A 4AOFA 2QT0A 2GNPA 2Q4BA 1H4SA 2WQ6A 4BFRA 1FNBA 2GB4A 4BPBA 3PE6A 1OFHA 2NV6A 2DT8A 4BWYA 1ZDMA 3R74A 3GLFB 2WIDA 4YI3A 2CG2A 4RY8A 5FBHA 4CIBA 3CTMA 2VHVA 4A27A 3E9YA 1BI8B 6Q21A 3KJNA 1ZA1A 3KOXA 3DNPA 4G81A 3BTOA 4J7CA 1KI4A 2B0OE 2BP7B 16PKA 3I73A 4RVDA 3UOAB 2WFMA 1M8KA 1XHLA 2C5SA 2QZJA 3DQPA 2BFEA 3O1JC 1PJ3A 5EKUA 4W7SA 5IJ0A 3EVCA 1ETUA 1U0LA 2D3TA 1KFKB 2YV5A 1JLMA 2BGRA 1V3UA 5KNBA 3TPZA 2QTRA 4TLEA 3W5JA 5C52B 2PT9A 2IOHA 1W76A 2DU8A 1GZ7A 3VR6D 2FFBA 4A5OA 4IO0A 4AQ7A 4KYIB 3EEQA 5DZSA 2AG8A 1C7RA 4IEEA 2Q5EA 4S2UA 3UMCA 1TC1A 3QWPA 1H5NA 2AE1A 3B9QA 3LLMA 4AY5A 3OWOA 3QA3E 4KVAA 4LV5B 4Y2JA 1H6BA 4M3NA 2G1UA 1NNI1 3RO3A 1U3DA 1V1MB 1MNAA 3BEDA 4NEGA 4P92A 3M4JA 4RZ3A 4L0CA 4M8IA 2D1SA 2PYZA 4E88A 1VL5A 4I5GA 1YZFA 3BC1A 2AJBA 4HNGA 3N3BC 3CIAA 4QYMA 2R4UA 1T0PA 4A2CA 5K4GA 3U3WA 5JUWA 3QKSB 4Y2TA 1E9RA 1V8BA 4PYKA 2A92A 1IVYA 4R54A 2Y0BG 1VG0B 5LQKA 1W8DA 2ODEA 3C6YA 3I0ZA 3O8NA 3STWA 3THWB 4KRFA 2XKKA 1D0IA 3H7AA 2O2YA 5A5EA 2C83A 1YNSA 4V0RA 2B1GA 4EI2A 5A1TA 4UZSA 4PLCA 3LVBA 3NI2A 1Q7GA 2AJTA 2J85A 3O8OB 4O1IA 4RH1A 2RAUA 4XLLA 4D92A 5C7LO 1PVVA 4QUBA 4CETA 3E2MA 1SEPA 4I4IA 2BM1A 5I9SA 2P3QA 3ROZA 4P8RA 4C7XA 5K3BA 3FXAA 1VHLA 3IUSA 3R4CA 2EFDB 1NJFA 4TSFA 1H2YA 3FDXA 3STVA 3OT4A 4TPKA 3TTXA 2JH8A 4AZSA 2FXVA 3GQBA 2JAXA 3BUAA 4GXRA 4XKBA 1H69A 3FFXA 4OQ4A 4WESA 3WKDA 4GMRA 1MX5A 4FINA 1T9AA 2A0UA 1SOVA 4XZ3A 4YK7A 1FPMA 1SKUA 1TYCA 4IUDS 5AOBA 4HYTA 1S4MA 1Y1RA 4BLRA 2M9MA 2XHZA 4LI3X 3G0BA 2QR2A 1ZUHA 3RGGA 1XOIA 2XPYA 1E3WA 2JAQA 3MWFA 1KHTA 3ZR4B 5AYWD 5J4YA 5MN6A 2VBIA 3K72B 1VJTA 5LJIA 4Y0AA 3UQ3A 1YZLA 2WABA 1GKLA 1DIHA 1UPAA 4R51A 3BEOA 2OGUA 4X1OA 1EH5A 5GQSA 1AB6A 5SZIA 1W30A 2FSHA 1A2OA 5F73A 5FBWB 1OX6A 1QQEA 2H0RA 4EY4A 3JWEA 2EHJA 1AX9A 1JB9A 3QMPA 2OM6A 4NYJR 4CT4B 1EHYA 3RVOA 4BNIA 2O2EA 3UM1A 1FFGA 3LV8A 4DV4B 1WHSA 1FCJA 3H11A 1WZIA 2BGJA 2Q6LA 2I3ZA 2PX3A 2ZWPA 2R6AA 1N1DA 1R4NB 4JNCA 4CW7A 4KHZA 4BQPA 2Q2QA 3EGXA 1E7MA 1LUAA 2O1EA 3K5IA 3JZIA 3KG2A 4NFHA 4XB6B 4Z4FA 2OQRA 4E31A 1HE1C 2VSOE 2HMUA 2VUHB 4FGSA 2XYVA 5JDIC 1CIPA 3FCEA 2XZPA 1IONA 1X8LA 1L4KA 4Y1GA 1I9CA 5G4KA 3T5CA 3W9UA 3SQXA 2AVDA 4FFRA 4HUTA 3DEOA 1JKIA 4LMBA 5JSQA 3LD9A 2J5RA 2HK6A 3VTFA 1R0CA 2QX8A 4DT1A 2XE8A 2D59A 2C2GA 3M33A 2FKNA 2FAXA 5TQJA 3I05A 1ZY2A 1LW6E 3MB5A 4DXHA 3NZSA 2NVWA 3MUOA 1P8AA 4F5DA 3ICWA 5JNWA 4RACA 2WAXA 1T1SA 3QEKA 3LUPA 3FPHA 3EPLA 2L2QA 4N40A 3ZHTA 4RK0A 1RI3A 5BWNA 3P1JA 1FW8A 4PO8A 2Q99A 1UBGA 4NOLA 4TX1A 1AA6A 1N25A 4NS4A 3GHHA 5LMZA 1EZ4A 1CYEA 3N0WA 1CT9A 3QXGA 4HRXA 1E4YA 2ANBA 3CX4A 2GRJA 3DT6A 1GO2A 4P4NA 5BWLA 2VK8A 4ZCIA 2FPLA 3TSOA 4HWSA 1W6RA 3N71A 4OG2A 3JXEA 4YVFA 2CXRA 5EC8A 5FWYB 3ROKA 1XZ8A 5JH7F 2ZUFA 4PXAA 5EL0A 4F4DA 3C5WP 3DWFA 1VXOA 1NF9A 3GG9A 3W0LB 1OY3D 1VCIA 3JD4A 4F9FA 4FADA 1EWQA 1ZUIA 1JZSA 3X3HA 3TDNA 3E7WA 3U17A 4M9XA 1ELKA 4QBHA 2HA5A 3K71B 1FQKA 3CV0A 5JTTA 2RB5A 2BF0X 1SZDA 2JBHA 4ZKEA 5KQPA 3TINA 3NF1A 2OORA 1L4BA 3E58A 4U07A 1TF2A 1DEOA 3AVYA 1S96A 1PHRA 3UUFA 4OP2A 5FI1B 3EDRA 1OLUB 5J59A 4WFKA 5EMNA 3SHOA 4XWYA 4BNDA 2HRQA 5CDHA 2NMVA 2GROB 1KOJA 3UA4A 2GLTA 3FH5A 2F48A 4BZPA 1Z7EA 1JHRA 3DAGA 3DLBA 2C7VA 1K0UA 3OX2A 4DDMA 3C1AA 2Z30A 3JQEA 4HP8A 1DIBA 2CL5A 2J87A 2VRWA 1IXZA 4Q4JB 2Z9DA 4R2JA 5KX5F 1DDIA 2O1XA 3AOGA 3RSLA 1NN3A 3VO8A 2A2ZA 2DHRA 1NASA 2NPIA 1JMYA 2DWUA 1OIXA 3EA4A 2JIZA 3MJEA 1M7HA 2JJ2D 3OPVA 2WUFA 5AKIA 3RODA 1N94A 1AF4A 2W48A 4URFA 5EIOA 4UWLA 4AZ3A 4BJ1A 3WLIA 5T4BA 3ULQA 1DQRA 4OJQA 1YQ9A 4TM8A 4MAMA 4B3DA 3QARA 2HF7A 4I1YA 4NXNB 3EQ9A 1K2VN 2Z1MA 4JB0A 4UTXA 2PFGA 3HKDB 4MUFA 5E4JA 3MKQA 2FRXA 1W4ZA 2A9QA 1OZFA 4K3VA 4RMNA 1H6OA 2HI0A 5FORA 5H80A 3FCOA 4KRXA 5J5VA 3U3ZA 1J24A 3UAWA 4EKIA 1FT2A 1UXIA 3MK31 1GUZA 4E2WA 3QI7A 3IKTA 3D3WB 3ROTA 4KWIA 4L0QA 1BG6A 3WDKA 1X7DA 4UNSA 3BERA 2YVKA 1CIJA 2E4WA 4PICA 4W6ZA 4XWOA 1USUA 1IPHA 3LHSA 1KJJA 1OIWA 3IQHX 2K2WA 5K2MA 3VPGA 3O3CA 1QYIA 2ECQA 3AHCA 3OFJA 4FFBB 2GN0A 2CNBA 3LX8A 4PG4A 1XJQA 3MHTA 1EGQA 3H2GA 1NUHA 1K97A 2HJSA 5BMVB 3KSDO 4YVOA 3RJ9A 3IV9A 5KO2A 2G70A 2BFCA 3IQZA 3PQFA 3WGJA 1VSUA 3KYCA 4ECEA 3DV9A 3IDFA 1J00A 5HOQA 2DZNA 4AULA 3CG4A 1ML4A 4RE6A 2P2CA 3A3OA 5F76A 3KKMA 1KYIA 1T6NA 1Z6ZA 1C9DB 1OASA 3AQ4A 3OCYA 4G4GA 2W2LD 3OZIA 5A6CA 1XAHA 4I9UA 3I30X 2I80A 1TLTA 4JC0A 4DIOA 5AUPB 4JHLA 3GT3A 1U9JA 3AY3A 3A1CA 3WL7A 2AXZA 4FI3C 4XM1A 4W5QA 2V6JA 2VF5X 2F90A 2GJ4A 1DARA 1E96A 1SU6A 5AQ9A 2FMFA 3GVCA 1ISMA 4QLAA 3V6LA 3P9YA 1YZGA 3IUMA 2Y68A 3GEGA 4L28A 4HLDA 1DVRA 1H2TC 1O94D 4LQCA 2ZIUB 1KJYA 3RUFA 1Q6YA 3JVIA 4KH0A 1R2QA 1R6XA 4V0KA 1KH2A 1L4LA 4MP3A 5LMCA 4R71A 4A91A 4MYCA 2B1IA 4OQMA 1FFDA 2V4MA 2PA3A 4LX8A 5J4KA 5KEIA 1KO5A 3OD1A 1N34B 1I9GA 2AR9A 1QIFA 2O8NA 3IAM1 1EDOA 1VMEA 1AA9A 2B1JA 4QXMA 3U26A 5LLDA 3S8EA 4GKJB 4D1YA 2PV0A 1E5LA 4NMXB 1G8AA 1QCZA 5DEOA 1IZYA 4X3CA 4D0GA 4BWVA 1YRQA 4KPYA 4U8VD 2RC5A 4QEDA 2IJGX 1YHNA 1LNSA 3FDZB 3DMRA 4WOJA 1AKTA 2QPOA 1GPKA 3IALA 2ZS8A 4HF7A 4PS0A 3O8CA 4JJEA 1CCWA 2OBLA 5KZMB 2BKAA 3QWIA 4D8TA 2C9MA 2XDYA 5CK4A 1PG5A 3QLVA 1C4KA 1O4VA 1EQ2A 2QX6A 4GA2A 3S40A 4C03A 2WV9A 4Q47A 2X23A 4F12A 3PQ5A 5ITZB 4AZ0A 2PMDA 2QMHA 2CNOA 3EGDA 1M54A 3HI4A 3VH1A 1M1YE 2CWWA 5LN1A 4B48A 3RT7A 2C4UA 2WJ4A 4PFJA 1BHSA 3MFQA 4J0KA 1RE1A 3QJ5A 2CVZA 2A57A 1DAFA 2V7GA 4KXXA 2Y4NA 3MT7A 3LJNA 4E11A 4BLOA 3UANA 1PEDA 1MIOB 4FMBB 1PNVA 1F2UB 2OAEA 5EJFA 5C4MA 4V39A 3ONKA 3ZWKA 5IKPA 3V97A 2F37A 2BSXA 3TMKA 4FLHA 4G5OA 3CVPA 3FZYA 4GX0A 5ERGB 3UKDA 3WL8A 2XYGA 3WNCA 3DGEC 1KKUA 1P2TA 1U3VA 4KTVE 4DS3A 1B3BA 3QE0A 3Q5MA 2UYHA 2ID8A 4Y1RA 1A2QA 5HM6A 4MV7A 5E6UA 2F55A 2WUWE 5FLYA 1SRQA 3DP9A 2XXJA 4C14A 4YWHA 4NOJA 3P32A 4JFAA 3AIIA 3SXUB 2FSFA 5FULA 1TB4A 2J5KA 3AEKB 1YR6A 3F5SA 2WJ6A 2H6FA 3OM0A 2KW5A 4GOLD 2QMEA 4JLWA 3UMRA 3OWHA 4BZXA 1Y1KE 3DM5A 4DV5B 1Q2UA 4NFSA 3RU9A 4HXEB 4PEVA 3R9MA 2L19A 4HY3A 2OY0A 3ZH9B 2O8FA 1A8HA 3DE6X 3ASGA 4Q9LA 3NU1A 4WLEA 1SULA 2HLDD 1W85B 4GH5A 5CHYA 2Y1OA 3I6ZA 3O4HA 3Q9UC 3RRXA 3SJCA 4YIHA 2C0LA 4TWIA 2QLTA 1L2TA 2PGLA 4A5SA 1GAXA 2HN9A 2PRYA 3S8YA 4N7JA 4HOSA 1JI3A 1T9GR 1NT2A 5DCLA 3W8DA 4E0BA 2GTPA 3F73A 4R84A 5KTKA 5D01A 2D5IA 2JPDA 2QTBA 2JCXA 2WTEA 4HFJA 3W5IA 3MXOA 1KTVA 2OGZA 3C6MA 1EEXB 4KNWA 2L82A 5DTMA 1ZVKA 4PHCA 3L02A 3LBNA 4G85A 3M1AA 2WJGA 1ODTC 4RMHA 4I5FA 4ZVNA 3VZCA 4YUAA 2AJCA 1II8B 1YJQA 3LYHA 1YZYA 2ETCA 5KJEA 3TI7A 4MPPA 3P2BA 4OXYA 1SHUX 4W1RA 1A71A 4J1QA 4BV9A 1QP7A 1JG7A 3FFLA 1Z68A 2G7MC 4OV6B 1A9XA 1ODSA 4TMZA 3JWJA 4P0QB 3WHLA 2H2DA 3K0HA 4PZCA 2FUG1 2YJ4A 3RC3A 4BKMA 1TYQG 2D1TA 4LK3A 4PHFA 4HN4B 4S0ZA 5P21A 1MO6A 5IXSA 1IBMB 4H60A 4MHOA 2EJUA 2YFYA 4G26A 5B3SE 4XI9A 2OESA 3V8BA 3D1VA 3M6IA 2FW6A 2PANA 2QK4A 4OTZA 2V1UA 3VTAA 2E82A 2M6RA 5KJMA 3DQQA 3KVVA 2AR7A 3ROPA 4DIEA 3B7TA 5DJ5A 4AY4A 2HA7A 2H54A 2WOJA 4CMGA 5BW4A 4EQ6B 1OWMA 1ACJA 1I0LA 5CFMA 2CV1A 5E76A 2VGXA 5GOTA 1VHJA 1Y81A 3GFTA 1XXHE 1T4DA 1QUFA 1S6YA 5KAMA 1QAOA 4DC0A 3K70C 2GBIA 4KQHA 2OQVA 4GPMA 2GXQA 3DOJA 2GCIA 2YHCA 1HDGO 2V97A 1TAQA 4C0MA 1JEDA 2LE0A 2QUHA 4N5DA 4S24A 3SWWA 1FJGB 3UA3A 3HJBA 4JA0A 4KK3A 4LNAA 5IVIA 4L7VA 5L3QB 4JSYA 4O4IA 2FUKA 2HQSA 3P8ZA 3DYVA 1G5QA 1ZB1A 1GPWB 3DHNA 1N3YA 1H6PA 5EILA 1W581 2VDLB 2GM5A 3GPDG 4IAOA 4KACA 3ZG6A 3K0CA 3ZY2A 2I9PA 2R8XA 4GMKA 2D5CA 5JEEA 3E9NA 3OPYB 4OP3A 4YONB 5BT9A 3GLIA 5BURA 5JBNA 3IIKA 1S7GA 2GN4A 2XUKA 4D3FA 5C1IA 1YR7A 1WV0A 1HLGA 5CD9A 1U8UA 2JW5A 3AZPA 4A4DA 1Z5UA 1AN9A 1E5TA 4PCAA 1EWRA 3V7YA 1XA4A 3JR3A 2QAJA 4OXKA 5ALGA 3SC3A 1C0PA 1FLDA 1KGDA 1U2ZA 4ESOA 1MGOA 1OU0A 3CNOA 4GWKA 3G2MA 4Y6GB 5G1PA 4K6GA 4AG6A 5KTRA 2ZWMA 1D8TA 5D85A 4DUZB 1QANA 4JIMA 4MTCA 3UOWA 3TNYA 2WXPA 1TD1A 1ZNYA 3OIDA 4LYHA 7REQB 3C8HA 3JRWA 4HRVA 3LPLA 3PC7A 2PKXA 3LMKA 2PS0A 4OKSA 3N28A 5SYMA 1Z2NX 3SHFA 4MDHA 1C9YA 1ZCAA 2V6MA 2Z04A 1KNXA 2YV4A 3CV3A 3KBOA 4PS7A 3LXMA 4HMPA 1X1DA 4Z53A 3UJNA 3LT0A 4BFLA 3ISTA 1QO0D 3EIUA 3GPLA 4DQUA 1U80A 4W5NA 4ZEOA 3V4FA 4ZYXA 1BQEA 2W2KA 3BULA 2X5NA 1O1SA 5JSFA 1E2IA 3L6AA 5DCYA 4EUNA 5HHTA 1XB2A 5C53B 4TYQA 1BYUA 3NBUA 5CVTA 2Z4SA 1D4FA 1ZW6A 1QYDA 1VYTA 3KHKA 4TQUS 3VBCA 1SBTA 4DOMA 2RD2A 3WMWA 2ZYHA 5FAXA 4MUMA 4RPLA 3AYXB 4GXTA 4TTAA 5ALJA 3JS5A 3FUIA 1LF5A 1WW2A 2NTEA 2JJYA 2WF5A 3FZNA 4K05A 4IIBA 4OM7A 2PEZA 3LUGA 5TIIA 1OH7A 2P9GA 2Z6QA 1Y5MA 1NRWA 3MT9A 3TXNA 1EGAA 2KJQA 5KNGA 3QG1A 4MS1B 3QFRA 3WGUA 5C8DA 1SPBS 2FWBA 3KZCA 1YB2A 3HLTA 2PNFA 2FUEA 4JH0A 2JFQA 1U2SA 3JYHA 1TF5A 3MLBA 4QPPA 1GR1A 3PL1A 1YQXA 3KS9A 2NUTB 4MVJI 3WRVA 1E77A 1K8ZB 1DZIA 3AVPA 3ASNE 2FVYA 3LUBA 2C5GA 2R1TA 3NDIA 3P27A 3BFKA 1ZMTA 2QXTA 2YWHA 5DGTA 3W9BA 3E1KA 4L5IA 1BHQ1 3UJ8A 4AU1A 4D9BA 4B3XA 4EYQA 4KQEA 2NAPA 3E15A 1DOZA 5CVVA 1QMPA 2AZ4A 4Q93A 3W5DA 1PZFA 4KV7A 4ZRDA 4EY5A 2WSYB 5LLTA 5LYJF 3IQGX 2P68A 3EVZA 4FYPA 1EESA 4MUXA 4L78A 4HNUA 4IPTA 5CPFA 3BBLA 1ZI9A 4R83A 3ZY6A 4J0QA 3G82C 2V9PA 5DGIA 1P73A 1O96B 5SY6A 1LTKA 2HHHB 3D9HA 4CJXA 1SCKA 2FPPA 2PM8A 2O23A 2YQ4A 3QNMA 2IZ1A 3ASZA 4FFSA 4GNKA 5IKXA 4HMQA 3LPAA 4EG3A 3HNPA 2FR8A 1DXOA 4ZTBA 4REMA 2HYZA 1Z5WA 2FE1A 4G8LA 2Q41A 2X19A 5IT9A 2QBYA 4XTCS 3LXXA 2QLBA 2X8JB 5F5XA 4N18A 4H3KB 4G84A 2J9XB 4EJSA 5BSFA 5ES4B 3N0RA 4JI8B 1P9LA 4N6OA 1NUPA 3NR2A 4IR7A 1OFVA 1TCUA 1Z4NA 1M34B 2CXXA 4FDTA 3DTVA 4J1TA 2XUIA 1BGWA 4MWDA 1WDLA 3TOCA 3L7AA 1PTKA 5K8LA 3G0CA 4MQFA 5FADA 1BE1A 1AKYA 1Z2CA 4LCTA 3CX3A 3JSAA 4MUKA 3VVCA 4DPMA 2R03A 1F2DA 1O8BA 4V1CB 2YMQA 4MVJE 1LV7A 3OEHD 4FZRA 3I9KA 1DJNA 4UM8B 3MJVA 1XNHA 2EINE 3LGAA 1SBYA 1J56A 4IDNA 5E7IA 3WY9A 4YRAA 1G19A 4M7WA 5ENTD 1TCCA 3AEXA 3DMDA 3QWHA 2EKQA 2Y1DA 2FI7A 3G2JA 3D7MA 3HSKA 3PPIA 3RSHA 1IULA 5EZQA 2IYSA 3C16C 3AM5A 5I9NA 3P4XA 3SFVA 2IY7A 3F96A 4UPEA 4M22A 1WV1A 4FGLA 3LBIA 3UV3A 4F1JA 5DTQA 3SLKA 5LZ7A 4D9IA 4RMGA 4GZ5A 3TSWA 1I7LA 4CLOA 2VDPB 3ZS8A 1B16A 4AS1A 4M1MA 4YAFA 5HKKD 2AQHA 2UYQA 3EDOA 2D0IA 1J49A 3OQ6A 1IJEA 2C5BA 3KZKA 3SFYA 4LRQA 3WR5A 2M6KA 3ZW3A 1TRHA 2FFHA 1MJHA 1DEXA 2EV9A 4WKCA 2BHTA 2GPJA 3GCWA 3ZYKA 4IOJA 4C7OA 4PANA 1BXGB 1ISPA 5GJVC 3PGXA 3S7BA 3B20A 3N0TA 4URKA 4WK4B 4UU8A 1K7CA 2OLEA 4K6FA 1GY8A 4IBOA 2HRDA 3AU8A 3BWXA 3OF2A 5KOHA 3FMFA 5EIXA 5LQSA 3BXFA 2VJNA 4F2DA 2JS7A 4BERA 2QZ9A 4ARUA 2FDXA 4TQGA 4JEIA 2YWXA 4CTOA 5LM3A 3ER9A 1NOKA 5AUNB 1P6XA 2QIOA 4CU5A 1A72A 2W2KB 4RLHA 3ZDYB 1TN7A 1K1AA 2I3GA 4Z9XA 3WNQA 3ZGZA 4G1FA 3PT9A 2EZTA 2JARA 1Y9DA 2Y1WA 1PQYA 1TQHA 2RHOA 3I3SR 3ETJA 4I3GA 4K9DA 4BNVA 4BRSA 4DL9A 3G2OA 1IBCA 4HKTA 3SQNA 1HE5A 2JFUA 5F3DA 4OXRA 1MMFB 2O07A 1SA4A 4RADA 4ZTUB 2ZJAA 3OQJA 3UIOC 3KKPA 1QCDA 4JEUA 1TTQB 4O4IF 2VJLA 3ZGOA 4B85A 2GN1A 4GM1A 1SWWA 1W5BA 1TK9A 2EW8A 1P0FA 1UBLS 3CTPA 3GCXA 1Z4PX 4UDYX 1P6QA 4JJGA 1AK1A 4S0XA 2EIME 4AKGA 3CZCA 2WB4A 3I5XA 1ZRNA 1CUJA 1X9GA 2VOEA 4YJ3A 5ALFA 3BDVA 2D2EA 4OGFA 4EB3A 3ABRB 3A0RB 1KAHA 4A26A 1J0AA 6AT1A 2ZE5A 1NW8A 3A6GA 2GYUA 1CJBA 1GTG1 1XRQA 2PKQO 4YRIA 3G2KA 3QTBA 3X2SA 3HJNA 4LQDA 2AX3A 1NUUA 2Y92A 1ILEA 1E8MA 4N0QA 3U7FB 3G23A 4HAWA 3DV2A 1TT7A 3AIOA 3ADBA 3FUXA 2GXSA 1JEOA 1NW9B 1QPBA 1XG5A 3JALA 4WN9A 4D99A 5GVSA 5K2OA 1DBPA 3P9KA 3UAGA 5AOAA 2C2YA 3OIYA 3C3BA 1FLVA 2JH3A 2PGIA 5BQ5A 4MA0A 4UUAA 1NC3A 1VYUA 2NO5A 5FBRB 5ALDA 4PAGA 1CC1S 1MDFA 3E1GA 4G2TA 2PT7A 4LSMA 4JJKA 4M2LA 5BY2A 4BMOB 2OV2A 5BSWA 4YIKA 5CDSA 2J09A 3DH0A 2VZ0A 2WXGA 3S70A 4AMUA 5JSYA 1W73A 4D4IA 5JNTA 3FUMA 2H7XA 4Q19A 1U1DA 4PHHA 4CQMD 3MV2B 1QK4A 2IP1A 2YMLA 3JASB