4I6JA

A ubiquitin ligase-substrate complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
507
structure length
503
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 170
structure length 503
sequence length 507
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6jA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6jA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6jA01
4A91A 1M8FA 5JBNA 5FO1A 1QU3A 1YULA 4MUHA 5DK4A 3RJZA 2PG3A 3CVUA 1O94C 3IVCA 1Q19A 4HK4A 1KP3A 3N8HA 2QUKA 3H97A 2ZUEA 4DNXA 1KH3A 1TYCA 4MW1A 4RPIA 1T6XA 2CUZA 4NX2A 1Y42X 3AG6A 3IMGA 4CDNA 1QNFA 1EJ2A 1O0BA 2TS1A 3G5AA 5KHAA 4E1AA 3NBKA 1SURA 5K0TA 3K32A 2GKSA 2EL7A 2X0KA 2C5SA 2X1MA 1GPMA 1O6BA 4U63A 3ND6A 3D6VA 1IRXA 3DPIA 4MW4A 2DPLA 1N2BA 2E89A 2CV1A 1R6XA 1LW7A 2D5BA 4P2BA 3CLTD 4ZCTA 4ZT5A 5FNZA 4EG3A 2AKEA 2WB2A 1NUPA 5HUJA 3COWA 1KQOA 2VXOA 3AFHA 1J70A 4JXXA 3HMQA 1ZH0A 3PNVA 4MW5A 3DV2A 1T9GS 1EUYA 3BL5A 4F4HA 4JFAA 4X0EA 3IMEA 1EUQA 1X8XA 1O96B 3KT6A 3A2KA 3H9CA 2A4MA 3INNA 3IODA 1U0BB 3CLUD 1MAWA 3F3MA 2A7XA 2RD2A 1O0CA 3L93A 3SEZA 2R5WA 1YI8A 4MVCA 4XFJA 2AG6A 3Q12A 4EG1A 2J07A 2A86A 1EFPB 2J09A 2A1TS 3SZ3A 4TS1A 2CFOA 1OWMA 2WQ7A 3CLSC 1FFYA 1MBZA 4PY2A 1PG0A 2X3FA 3S3TA 2OQ2A 2OV4A 5LM3A 3PXUA 2QTMA 3KT0A 1ILEA 4JZYA 1U3CA 4MWEA 2O8VA 4L2IA 3QTTA 5TS2A 4DDMA 4F3RA 3GLVA 2AZXA 1I6MA 2QJFA 3ND5A 4R2LA 1WXIA 3G6KA 2WQ6A 3K9WA 1N3LA 3CVXA 1XJQA 1WZ2A 1U3DA 1N2GA 1Q11A 5FO0A 3ZUGA 2XRZA 5DEOA 1QTQA 3IDFA 4OUDA 1ZJWA 1WXEA 4CDMA 2QTRA 2CYAA 1VL2A 3HGMA 1J1UA 1WQ4A 2A1UA 1MRZA 1K4KA 1O94D 3E27A 3KFLA 2J5BA 2QUIA 3VRHA 2I1LA 1M8JA 4EF6A 1MB2A 3QE4A 1MJHA 4MVXA 2A1UB 3CLRD 2IJGX 3UK2A 1J1ZA 1NYLA 3SP1A 1QQTA 1YIDA 1EFVB 1WXHA 1COZA 4MULA 3RK1A 4MUJA 3ILVA 2YWCA 3FHJA 4EG5A 3AKZA 4EG7A 1KH2A 3P0IA 1OBHA 2EJCA 4CT0A 1O95D 5IJXA 1IQ0A 3CLRC 2QUJA 3NV7A 1GN8A 1KQPA 3TNJA 3SZGA 4JXZA 3FOCA 4XFDA 4EFKA 3COYA 1BS2A 1J09A 2IP1A 1JECA 4NDAA 1IH8A 4R2MA 3CVYA 3FETA 3Q4GA 3TQIA 1U7DA 1WKBA 3ZXSA 4YMIA 1JEDA 1M8KA 4UZEA 1JMVA 3IUEA 4J76A 1F7VA 4UZFA 5EKDA 4GU5A 3AG5A 2BTEA 1MAUA 3X1JA 2JANA 2ZUFA 3KT3A 2YY5A 4MWBA 3IMCA 5J58A 4MLPA 1MB9A 3OP1A 3VU8A 3IOBA 1WQ3A 4G5FA 1GZUA 2WSIA 1G8GA 1TYAE 1VLHA 4ZCRA 2DERA 5J5AA 1N75A 5H16A 3M5WA 3X1KA 4ARCA 2J08A 2J4DA 4PBRA 1WJGA 3FH0A 4MUGA 2XRYA 3P0JA 1EFPA 3DO8A 4HPWA 1F9AA 1ZH6A 4QBTA 4R0NA 4MUIA 3FNRA 1KKUA 3IVXA 1O5TA 4MUFA 2DEUA 3CLSD 5H7XA 1VBMA 1EXDA 3RFFA 1NUQA 3X1MA 3IVGA 3JXEA 2CYBA 1JIJA 1PFWA 4MUEA 2IELA 1K92A 3MLBA 5TEWA 3P0HA 2YWBA 1JILA 1I2DA 2DUMA 2Z08A 3MUEA 3TQOA 1X6VA 2Z09A 1JZQA 3RBAA 3FIUA 4AQ7A 1H3FA 2CYCA 4WSOA 4ND7A 3FI0A 2HZ7A 2HMAA 4EG4A 1QRSA 1TYBE 1H1TA 1R6UA 3LE8A 1PG2A 1LI5A 3N9IA 1QU2A 3OTWA 4HJXA 4KR7A 3ELBA 3PRHA 1JEEA 1YUMA 4ND6A 1TYDE 5IHXA 1OD6A 1T6ZA 4I6JA 3AL0C 3TZEA 2VTBB 1WOYA 1TEZA 3IH5A 4ZT7A 4QRDA 1O95C 5HUHA 1T9GR 4MUNA 1IFXA 1PFYA 3KT8A 3L92A 1DNPA 3ISJA 4ZT6A 1FYDA 1NUSA 4OJMX 1JZSA 4MUKA 1WXFA 2GOYA 2QJOA 1JIKA 3FG9A 3IOCA 2VTBA 4ZT2A 1GTRA 1NURA 1M1ZA 2PIDA 3U1VA 2H2AA 3SEQA 4DDHA 1XNJA 3A4IA 2QUHA 3TS1A 1T6YA 1EFVA 1M8GA 1VBNA 5DASA 1K97A 2D13A 3N2YA 3ZJVA 4MWCA 4DJAA 4U8HA 5KWVA 4FZJA 1IQRA 1QRTA 4ZCQA 4MVYA 3PNBA 1KQNA 4ZCPA 1F4LA 5F23A 1N2EA 2PZBA 4MW7A 2X1LA 3H9BA 1KP2A 1YIAA 3CLTC 1KH1A 4YBRA 3FWKA 3VGJA 1WY5A 2CT8A 4QREA 1NZJA 3HFJA 4YP7A 3CVVA 1HYBA 4EG8A 1OWLA 1OBCA 4U7JA 1K4MA 1R6TA 1VBKA 2DR2A 1F7UA 3COVA 2DXIA 1G8HA 3D6UA 4KR9A 1LI7A 2GM3A 2V0GA 1P7PA 5DB4A 5TEVA 3HZRA 4KR6A 1TQ8A 1MC1A 5K0SA 1I6KA 2QTNA 3AIIA 1QRUA 1OWNA 1NP7A 4ZT4A 3COZA 1UFVA 2B7LA 4KPUA 1B6TA 4MW0A 3RHSA 4DDKA 5HG0A 1KAMA 1J20A 1H3NA 1H3EA 1N2IA 2A1TR 4NAHA 3MMXA 3PNYA 1ZUNA 2G36A 2E18A 3LOQA 1M8PA 3GMIA 3CVWA 3FDXA 2RE8A 2NSYA 1V47A 4YP6A 5KCMA 3SDBA 1ULHA 4ZT3A 1Q77A 3HV0A 1GTSA 2PZ8A 5LLTA 4S1OA 4I6EA 3H05A 3NBAA 1KR2A 4GRIA 2PZAA 3CR8A 4NATA 1M83A 3H99A 2PXHA 1Q15A 3SYTA 4DE5A 1J21A 3ZJUA 3IOEA 3UOWA 1U7XA 3HL4A 3ZIUA 3DLAA 5LFAA 3FY4A 3ND7A 1V8FA 4K03A 4DLPA 4PBSA 3Q10A 4NZPA 4MQ6A 1XNGA 3UY4A 2A84A 3CA8A 2CV2A 3LCJA 1JHDA 1NI5A 2A88A 2JA2A 1S4MA 2CSXA 1G59A 4MW2A 4EG6A 1OWPA 1O96A 1NUUA 2H29A 2V0CA 4MW9A 2QJTA 4ZCSA 3ZJTA 2CV0A 1GAXA 1XNHA 1JGTA 3A05A 4JYZA 4K0RA 4CQNA 1N2JA 3C8ZA 1N78A 1PFVA 4BWVA 3QTBA 4MW6A 4MAFA 1KAQA 2O5RA 4MVWA 1A8HA 2HGZA 1NSYA 4Q16A 1EE1A 1QJCA 1IVSA 3IUBA 4G6ZA 2DLCX 2PFSA 3UC5A 3UMVA 1OWOA 3I05A 4I6GA 1NUTA 4MWDA 3RK0A 4PBTA 3ZXIA 1PFUA 4J75A 3CLUC 2E21A 2DETA 1G8FA 3TZLA 1N2HA 4NAUA 1KORA 4H3SA 2Z3VA 1CT9A 2NZ2A 5AHWA 4RUKA 1IHOA 5J59A 4YP5A 2E0IA 1O97C 2ZP1A 4XSVA 2BYTA 2JAXA 2D54A 1N2OA 3MLAA 4G5YA 1WXGA 3GUZA 1YUNA 1D2RA 4HJRA 4L2IB 4Q93A 3ZGZA 3G59A 1GLNA 1TFUA 4AS1A 4EGAA 3P52A 1O97D 1IQUA 2YXNA 3MXTA 1N77A 4ARIA 1JIIA 1N1DA 3N05A 1RQGA 1MOPA 3A04A 4WNYA 4KPUB 5BNZA 4OUDB 5TGTA 4KKVA 1I6LA
chains in the Genus database with same CATH superfamily
4HB0A 3B5IA 4FHZA 5IT9A 2ZVQX 1TM3E 1CUGA 1DT5A 4GPKA 1EFLA 2V4ZA 3Q85A 2Q62A 4TXQA 1Q83A 1U0GA 3KV1A 4CKZA 1CR2A 4U4AA 1KQFA 1QGYA 4EATA 3G8CA 1IHBA 1TN6A 2I2DA 3GEMA 4GEKA 3EOBI 1F60A 1C2TA 2WAAA 3BFKA 3CRZA 1TGYA 5D1HA 3C7AA 4IRUA 4EHHA 4P29A 1E2EA 3TR5A 2X76A 4FHGA 4HRNA 1C3OA 1F8UA 1FU7A 4I4LA 5D84A 3NOOA 5EP4A 3RDPA 3WLKX 5KINB 1KYYA 4EQZA 4K9DA 4JMPA 2QM0A 4OL0A 1LF5A 1SULA 4E1AA 3AQ4A 1PNOA 1ZGBA 3AZPA 3MMPA 4OX9B 4OY3A 4GYOA 1PKXA 1ZGHA 4JB8A 3OMXA 2DBRA 1U5BB 4UHBA 1Q91A 1BSVA 2BFBB 4YAWA 4YRLA 5IN4A 2FWJA 1IBLB 3FHTA 1E94E 3KDSE 4PYOA 1JG4A 2CLMB 2RHDA 5EEHA 3WLSA 3PDWA 4RMGA 3NNNA 2C5HA 4XVUA 1MVOA 2XNHA 3GC6A 3L8GA 5JH7B 3CX8A 1FX1A 1G3UA 1QFXA 2C9BA 5AHOA 1V55E 1L4YA 1ZJ6A 5AVSA 2CV1A 2JZNA 5AUNB 1HE1C 2NZVG 3PQCA 1NUPA 3MELA 3F7TA 5HUJA 3GRPA 5TXGA 1NVDA 2X8LA 4JYMA 5JLJA 5HTOA 4FJ0A 3DLTA 4PNHA 3S55A 1V11B 5K45A 1E1RA 4PYRA 4AJLA 5JIBA 2V98A 2DVMA 1AKUA 4WOBA 2F1HA 4A0FA 2AWOA 1QANA 2QQGA 2EP7A 3ENEA 1PT6A 4HN4B 1Z6AA 3ISVA 1SK8A 3HXOA 1GFSA 1NP6A 5ISMA 5I8PA 4KFUA 4BFWA 2ZWMA 3Q7TA 4DUGD 2VHCA 5FBWB 2FV8A 1QE3A 3HU5A 5I7EA 1IN7A 2ZJYA 3O8RA 1QB8A 1IBRA 1U0SY 4MYTA 4LF5B 4WECA 1JFLA 4XRRA 2Q5CA 3L22A 3CWCA 1UDBA 2B0JA 1TAQA 3L93A 3IQZA 1EQUA 4PRKA 2BR5A 2QYOA 4OFZA 2Q27A 3AUFA 1YI8A 4XUDA 2IHNA 2PT5A 4ZAVA 1FDWA 3JVVA 1RCFA 3G2IA 3LDGA 1M33A 4ND4A 2A86A 5CM8B 1MABB 1NTRA 1QFMA 1G5FA 3OXLA 1J0BA 5T57A 3U13A 1GW6A 1AZWA 3RVSA 2F8TA 1PL7A 5ENDA 3SFVA 4Q47A 2OOKA 4F9GA 4CEHA 4U2DA 4DLOA 3V8QA 1IUPA 2A35A 4QDTA 1W48A 2CJWA 3ZC3A 2H7XA 4KBYA 4DY6A 4EWLA 4O0MA 4BQNA 1KS9A 1E3IA 1H93A 1D4OA 2IYAA 3A1FA 4XH9B 4RIFA 4XIYA 3EZXA 4NBNA 2YXBA 5EJ6A 3O94A 4DR4B 4Z0HO 1RYFA 3PXUA 1L7OA 1KQ3A 4LQDA 4P4LA 2A5EA 2J9RA 3WL5A 2I2BA 4CCSA 3TIXB 3OKFA 2EDAA 1XD9A 3AIMA 4OHMA 1WXQA 3KZOA 2QX4A 3AI2A 1JLLA 3BL6A 3GN2A 4IJWA 3WRVA 3MRXA 4DM7A 3U44A 1X80B 1DO8A 2ZQZA 4WZBE 4MP8A 3NEYA 3HYTA 4JIMA 1DVRA 3RTEA 3C70A 1FNSA 2P5YA 3MQFA 4C20A 4K2AA 2P79A 1OCRE 1B0UA 3OZEA 4J1SA 4MYHA 1N3LA 3AEZA 2XTZA 4TRJA 4AKGA 3LS8A 2XMGA 1ND6A 1PJ3A 1UZLA 3BXEA 3IBCA 4LVUA 4RXMA 1N2GA 3P2IA 4IV0A 3D9PA 3IP3A 3N75A 2V3CC 3INRA 3CLHA 4WNFA 1L7XA 2VDOB 4OREX 1U7HA 1EHIA 3VHXA 2OO5C 2UZ3A 3UAGA 1Y1LA 3GU3A 2PJDA 4US2R 5CNKA 2H48A 2J3EA 1U9JA 1EDZA 1VRWA 1XTSA 2WRZA 4M83A 1EQAA 3KV3O 1WBJB 7REQB 3DLHA 1FIUA 3CHSA 3WLRA 2C7BA 3NOXA 4L50A 4LKRA 4BP8A 1MB2A 5BVHB 3ET5A 3RYFA 3E9ZA 3ONKA 1R5JA 4X91A 5G0WA 3Q6IA 2SCUB 1CE8B 2R6AA 3C7DB 4K6FA 4DIUA 3QBDA 4PLFA 3KJHA 5EVCA 2AC7A 1NMQA 5C5IA 4I5FA 3HDGA 1OXMA 3SQDA 4EK9A 4XLZA 5TB5A 3FRIA 3HB4X 1WHTA 4PZDA 2BCEA 2VNAA 1D8EA 1H1DA 1YZTA 5CJPA 5GP1A 3D8UA 5FBRB 3KAQA 1TU0A 3ILVA 1IIRA 1S5PA 3PRZA 4NACA 3F5MA 5H9WA 3BPSA 1DBIA 3QKUA 4GUDA 2RB5A 1EA7A 1QGDA 3JZMA 4AZWA 1NJ6A 3FAKA 3H5OA 4XIGS 5IJXA 2SKEA 2QD2A 3BE8A 4FQ5A 5J3JA 2C1XA 2J0UA 4B09A 1PCXA 5IDQA 4QTZA 2F3UA 3DZJA 3G2MA 4LECA 1B1AA 2GETA 1KQPA 3R0JA 4DREA 4OK5A 4JXZA 3K3PA 3KEMA 1JU4A 4GUAA 4EFKA 1I1OA 2QJWA 4S1TA 1XAJA 2MWMA 1XYYA 2Q9CA 3PRYA 4W7HA 1MH9A 3E8MA 4JD2G 4P86A 1C8KA 4LJ4A 4YRBA 5ARBA 1Y8ZA 5BYJA 4MB6A 2ICAA 1FNMA 4NJEA 2D2EA 2BT4A 4Y7CA 2UAGA 3OA2A 1TM1E 1XL0A 4N5NA 4YJKA 4I9FA 3AF5A 3WP1B 4C07A 4F7DA 4IM7A 3T4UA 4XX0B 3T7AA 4FDTA 3VZDA 2CLOB 2PL9A 1TJNA 3OF2A 3F2VA 1Z7EA 1R9GA 1LPOA 4WA7A 4ZICA 3O4IA 1R0KA 4QBKA 5GONA 1CS0A 4C21A 2BWJA 2FR8A 4Q66C 3ZYLA 4QEZA 3ASVA 3GX1A 3JS5A 3ZWOA 4EI2A 5C8YF 5CD1A 1V8BA 3OP1A 1U6KA 5LXTB 5BPHA 1B6SA 5THXA 2XPYA 2BJVA 3M5WA 1H23A 4CKWA 1P9RA 2J4DA 2ECKA 3OKAA 4B43A 1GNQA 4O8CA 1V8OA 3EGCA 4FGZA 5LPNA 5DBOA 1S70B 2FOIA 4FCTA 3PE6A 5CBNA 1D9SA 1V7ZA 1V41E 4QBTA 5KYKA 1JHZA 1X0VA 4R0NA 1UOOA 1LPMA 3F2IA 3P5BA 4PQYA 2IFTA 4MCAA 1SM4A 2XZLA 1SHKA 1IOVA 3RQSA 3KYBA 3W5UA 3M8KA 3G0CA 3FOEC 2GCIA 2P4HX 3BJIC 3JALB 4HZUB 2WUGA 4IHAA 4RKYA 2FQWA 2GHQA 4B17A 1M5UA 4CM4B 3THOA 4G23A 2OBXA 3X1MA 3RVPA 4GVPA 3V8PA 3QKRA 2WA1A 4ARZB 2INGX 1V43A 3L8YA 3N07A 4LGVA 5DM2A 2O19A 2QLTA 3LLUA 3CB4A 1YJQA 5IF9A 2UZ1B 3CKBA 1EEHA 3F6YA 4M53A 3STVA 3WJAA 4KLNA 2HL6A 4PS7A 3UB4A 3GVCA 2OK7A 3TXXA 3VR6D 4UOZA 3C3MA 4TMTA 2QRVA 1NBIA 1P1RA 3P4UA 1ULTA 1Y3HA 3LJ3A 2G6BA 4G25A 1SKUA 3CZ9A 3CHRA 3DMRA 4KAAA 5I9TA 2F67A 2BIFA 3N9IA 4BU1A 4NE9A 4KG7A 1XQ9A 1VE6A 4LY3A 4G5XA 4RVFA 2RGCA 5DMHA 1Z2OX 3UQ3A 4WFQA 2A4KA 3AVVA 1IN4A 4ZV7A 2PLNA 2IEYA 4B83A 1ULZA 4RKFA 1SZJG 5EZ5A 3NTQA 4RVDA 2XE4A 1LDMA 1T6ZA 2NG1A 4RH1A 4UOQA 3FYCA 5M7EA 3D8SA 2JLZA 3P9KA 1HTWA 2QR5A 1N57A 3MCWA 4UXHA 4KGDA 3S2UA 2OHHA 4UW9A 2I80A 4NOMA 2VZLA 1IN8A 1CUCA 5HUHA 3R9XB 4TZKA 4D4HA 2BPOA 4MRMA 1MO2A 3D7LA 2OOEA 4KLZA 4UAVA 2XZTA 1A88A 1PEDA 1U8TA 3AHGA 4HRMB 3FDFA 4V3CA 2WSMA 3U3MA 4DL9A 3OJOA 1KJWA 2YXLA 2IEDA 2TECE 3GOQA 3O83A 4PHGA 4M3OA 1CCWA 1JV2B 3HO1A 3CONA 1UBLS 1NN1A 2PA3A 3ICVA 1WR8A 4QFCA 1CYDA 4KGVA 3L8FA 3URKA 4Z0PA 4KQIA 2F1IA 3R3ZA 1XGKA 1ZP6A 3IP9A 1MU0A 5EQTA 4K9MA 4EYEA 2VPIA 2V7XA 3NHZA 4UXIA 4KRFA 4E6EA 2AOWA 4UWKA 3IE0A 2YNQA 2BP7B 1SH7A 5GIPE 1ZISA 3FTNA 4JU8A 1JWLA 4BQSA 1Z56C 1IQRA 5FTNA 1TKRA 1EXVA 5BN5B 1PDOA 3EPHA 4YS6A 3QPAA 3LRTA 1QGOA 3AF4A 2ZJ1A 4ICIA 4AG5A 4TZ0A 4IMIB 4RAOA 5F52A 4ES6A 1G2IA 3O8QA 3NC4A 2RBKA 1F4LA 1XQ6A 3R3XA 2RC6A 3QWHA 3BFXA 4HDAA 5IG2A 1NBOA 5D2MC 1PTJC 2WNHA 4PGHA 5EHNA 3IILA 3GP8A 1UEJA 1HDZA 2YWRA 1DVPA 1QKKA 4XZ4A 2OMKA 1PN3A 3R3VA 2B4RO 2I4TA 1BEZA 3R41A 2AFHA 1E2DA 1R6BX 2BR3A 1CVRA 1SPXA 3M70A 4RK7A 5JCJA 3O9MA 2XB8A 3D1JA 4KYVA 4KVFA 1Z4JA 3C2QA 2F55A 2UVPB 1GQOA 1N3YA 3NYRA 3ICOA 4UFNA 5T3YA 3ZNQA 4QA9A 5ECGC 4HUTA 1JBQA 3Q98A 3R9IA 1VJTA 5KYXB 3TN7A 3F7MA 1XCJA 2JG3A 3NI2A 3C14C 4E7PA 3L7IA 3E2MA 3RIMA 4YJ2A 2QRQA 4NCIA 3R9WA 2RGDA 1Y8QA 4LYYA 3N0WA 4H2DA 2OECA 4UM8B 5KTOA 2XUHA 4JYBA 2CF6A 4M98A 3RHSA 4QSHA 4JR2A 4RTLA 4C0LA 4HXGA 3A6FA 3BDIA 3QFTA 1H3NA 3QI2A 4NCXA 4O63O 4UM7A 5IDXA 5JCPA 5AVJA 2VATA 4EA6A 3IEPA 1K75A 1QVWA 1Z16A 2O57A 3QMVA 2FETA 5F98A 2R00A 5CRVA 3EVNA 3Q1LA 4LNBA 1JF8A 1MIOA 4L7VA 3L7OA 2WEKA 4R8VA 2WABA 4APOA 2GXAA 3R6GA 5EIFA 2LW7A 3FWVA 5T3RA 3ZHEA 3R3UA 4ND8B 4Q3DA 3BU8A 2CXXA 1XXHE 4BV9A 3ICEA 2AG0A 1H4SA 4J1TC 1SVSA 4LK3A 2WK1A 1ZC3A 3VI3B 3UMJA 4C9BA 1TO6A 5IF3A 3EXHA 3W3AA 1HS6A 4XGQA 4S1OA 5KTPA 5CB8A 3COPA 5EKTA 1LVHA 3NBAA 1DS6A 4DDUA 1KR2A 2WWYA 2I62A 4GSLA 4ZRNA 1ODSA 1NNSA 3NEJA 2FRDA 3VLEA 3CO5A 3ONWA 3UENA 4RGQA 2EG5A 5IM4F 1GRVA 3E15A 3FOWA 3OTNA 1QCDA 5A5DA 3MJHA 5IVDA 5JYEA 1E8XA 4M8SA 5KNBA 1GNRA 2DUNA 1HFEL 3N8IA 4KLCA 4V03A 4HTFB 1T9CA 4V02A 3VLFA 1DFIA 3TGPA 1PZHA 1L8LA 3KQLA 2WWIA 2HK7A 3PXDA 4YACA 3TTVA 4N6NA 2X0DA 5JNSA 4JVNA 3Q6NA 3L7BA 5EIOA 4NCAA 4GMGA 2Q7XA 1X94A 1P60A 5MN5A 4IQ0A 4PCUA 2F9FA 4N0MA 5HOQA 3B2EA 4QQRA 5JXHA 2IY9A 2ZU6B 3VR6A 1YHZA 4BFRA 1GT6A 3NHPA 3T5GA 3CVQA 5F2OA 3BRSA 2NN3C 3MWDA 1BNCA 4GI7A 1ZOIA 2OFXA 3O2QB 3VVCA 3E0QA 4X1KA 5FQNA 3TLXA 1N2JA 3W9SA 2XDWA 3KOZA 4JJEA 4PZYA 4Q19A 1G8JA 3CRNA 3ZLTA 3GFSA 2O7NA 3U7EB 4CMIA 3RAUA 5G3ZA 3T9CA 4IGEA 4L4UA 4FHKA 2P9FA 4KYTA 5CEAA 3DZDA 3UMVA 2A0UA 3AINA 3IIEA 4YRJA 4I6GA 5SZJA 4PIMA 4WCDA 4LJRA 2EC5A 1EEXB 4TT3A 4RXTA 4OPMA 1U9IA 2DKFA 3PX2A 1BE6A 2FEWB 2W4QA 4NF2A 3OOEA 4BKRA 4KWTA 3RG2A 2FPGA 4NR0A 3BGVA 4OI1A 2PKWA 4IX1A 3QEMB 1KORA 2WWWA 1I8TA 2VT2A 1BDIA 4GLBA 4CXMA 2QE7D 4GQIA 1IHGA 3OJFA 3GRUA 3TX6A 2R7AA 5B3JC 2AG1A 4U7GA 4FDUA 1YE8A 2HMVA 2RAVA 4FHDA 4HQLA 2IH2A 1L4MA 1RRPA 2VSOA 3H04A 3NHRA 3O4FA 2C98A 3T7KA 3W3ZB 3WDLA 4CG2A 3RSOA 4UNRA 2GBIA 2VJQA 3GGSA 1Y33E 4NK5A 3LVFO 5KWSA 4HY3A 2OO3A 2R84A 4QE3A 2Y6UA 4X7MA 4PEVA 5FWXA 3ZGZA 5DIFA 1JFRA 5K03A 3PLAE 1OU4A 1M10A 1PUXA 4ZOLF 5EXPA 1TFUA 2D1TA 1K88A 3ZFWA 2LUOA 1NQAO 1QHSA 4W1SA 3DBHB 5AQ1A 5MF6A 1Z2AA 2ZSFA 4LTNA 3OT5A 5E3IA 4V2IA 3DT6A 1V5EA 2IDJA 1NYQA 3MXTA 2VXCA 1RRMA 3OCVA 4XEHA 4HCJA 4N76A 4FHJA 5BNZA 3EW7A 1NVXQ 2XRFA 4MHSA 3TK1A 4M7RA 2IXEA 1W88A 5CFPA 3TGWA 2IXTA 3AU8A 1FFDA 1BROA 2WNSA 4JUIA 1YT5A 1MGPA 1CHNA 1NF3A 5HX7A 3N3BC 2JK0A 1ZUNB 4NS1A 3THXB 3OZSA 3OY7A 2ID9A 4TKUA 5IAKA 3UV3A 4N39A 4CLRA 4IDBA 1RXWA 5IASA 4XGRA 5EYPB 3URZA 1PWZA 2CXHA 3FNQA 4HH3C 5BSUA 4GL2A 2CUZA 1VSQA 1P6XA 1QIHA 2C4NA 3PUZA 1DADA 2XY4A 4J7UA 3DXFA 3RRMB 2O8EA 3D5EA 4CIYA 4D80A 3VDRA 4JYPA 2ZPUA 1LXCA 1WF6A 1E4EA 2V4UA 2JLWA 3V4FA 5BY2A 4HL6A 2WOOA 4V0NA 2UWJG 3G2KA 3PD1A 4OAQA 3K32A 5CGQB 4AIIA 2EL7A 1RYDA 2QORA 3FU6A 5DU2A 5CFZA 1REQB 1WW8A 3R5JA 4WWPA 4DMHA 1XDSA 2EWVA 4JB2A 3BA6A 4PWYA 2WUEA 1BHQ1 3ZRHA 1WVMA 1U8ZA 4TTRA 4UI9J 1HFAA 3DULA 3UJ3X 2QVZX 1IRXA 5DULA 4DJDC 3UGQA 3DPIA 5CNMA 5DNWA 3BFPA 2JGDA 1UP4A 1QM5A 2IOQA 1OYVA 1Q3HA 1FL9A 1QQEA 1I4WA 1X87A 5T6MA 1NLFA 5KC9A 2R25B 1R0WA 3ZHSA 3LWBA 3E7XA 1Z83A 2VQ2A 1WZIA 2PEZA 1XZEA 3DQZA 2E6UX 4YP0A 2CBZA 3EQ7A 2X0EA 3M6IA 2QMEA 1ZHOA 3KB6A 4URFA 4URYR 3UAYA 3B1ZA 3N2GB 3DV2A 4BQOA 1E9BA 2VTEA 3HXLA 5GTDA 4F7AA 2D74A 4AZTA 1V9LA 1RJEA 4BVAA 4GE0A 1VHDA 1JT9A 1N0QA 1Z17A 2XQKA 2ZEJA 3HE3A 3MT8A 2VP5A 1MHTA 4KZ0A 2JJQA 3DE0X 2Q5EA 1JQ3A 2VJYA 3MT9A 4RVGA 4XQCA 3SDSA 5KPDA 2OCKA 3LPNA 3X1ZA 2DPYA 2QE6A 1HA3A 3H4IA 1G8PA 3W3AH 3B3AA 3FFAA 5JJ5A 3QPDA 3TKLA 1UINA 1TU4A 3LUPA 1FVOA 3Q3GE 4PGGA 1KVQA 3WDMA 2XCOA 2DCPA 3K09A 2RCNA 3HPRA 2L6BA 3H5TA 4L5YA 3RS9A 2V1UA 1B74A 3RU2A 1RJ9B 3VMFA 3K0FB 5C3UA 2AI3A 4C7VA 2XQFA 3TWRA 1YQ9A 1QE5A 2NXCA 2KHZA 4TS1A 3QVLA 5B7QA 2MYNA 4IP0A 4K28A 3BQNB 2GI4A 4BRWA 2ZYHA 4DCNA 3HVEA 4U8VD 1EYZA 3V5NA 5K8UA 5K4HA 2WQ7A 2D2IA 4F92B 1VHQA 2XKKA 4L9SA 1ZW6A 1MIHA 1KJIA 3QC1A 1D7OA 3MC1A 4IDCA 2FLWA 2HO5A 4JA0A 4NBLA 5E6RA 4E30A 5HMMA 2GCNA 1BI8B 3OTHA 2OV4A 4BNJA 5CEFA 4JP1A 4IXDA 3GT0A 1P1HA 1J25A 4DZTA 1E1DA 1RWPA 5BXUA 2G9ZA 3BIFA 1YK0A 3HJAA 4C3VA 4C2UA 4EFDA 4GDFA 1C9JA 1A76A 5HM8A 4X64B 1H2ZA 4M9SA 4B4WA 1ZL2A 2XEDA 1C14A 4P2GA 4UFPA 5IABA 1U02A 4BKQA 2R3SA 1GSIA 3EEBA 3UK7A 1E1RD 2PX4A 3ZV5A 4MB0A 1WF3A 1FBTA 4JBNA 4HYYA 4M38A 3FZQA 1BVRA 3CWQA 3PTLA 4DM3A 5CVTA 4B3MB 4PLYA 4EAQA 4OAUC 2CDBA 4W8OA 5K3FB 5JAOA 1TM2A 4BQFA 3E5HA 3Q87B 5DI3A 4BMXA 1BS1A 2I4LA 1VL2A 3JATA 1JEQB 2A1UA 2YHSA 3V1UA 1MRZA 3F5DA 3E27A 3NNSA 2LGJA 2HLNA 2J5BA 3DDUA 4IY1A 4JA7A 5M3BA 1MEOA 5EUCA 2JS7A 3COSA 3CUEF 4ZOQI 3GLGA 1E9CA 2HWUA 5KQPA 2EARA 4CL0A 1V1JA 4R9RA 4KQ9A 4HDMB 6REQB 4URWR 2GA8A 5A6CA 1ISJA 4W6ZA 3KAEA 1AHIA 5DT2A 1O9BA 1MO4A 2IVZA 3W1VA 2NPFA 3PGMA 4GR9A 1T1IA 4IMPA 3DDSA 2IJGX 4FS3A 5ALVA 4N01A 4QUEA 4F85A 5EE3A 4NPAA 3ZU5A 3LNCA 4Q5IA 4XR4A 4EY5A 3PHGA 3TMYA 3NC1C 4NONA 2ZI3A 3NVDA 1SC6A 5TMDA 3JAKA 3EF3A 3ZPXA 1VI5A 3ZDDA 1ZN7A 1KH2A 2EFDB 3BEOA 5JJTA 1ST2A 3OE7D 4I08A 5EFZA 1F12A 3SOPA 4B4DA 4QJIA 1IBMB 4B3CA 2IXBA 2R6HA 3DZIA 2QUJA 1RJFA 4TUYB 5D2CA 4HVCA 2VEOA 3JD2A 4O4JA 1LC3A 4EFLA 2WG0A 4JEHA 1DB3A 1IDOA 3SZGA 3RUHA 2C5FA 3Q5MA 3GPBA 5MFPA 2OCIA 4GGMX 3WYBA 3JQGA 3CVYA 3CKLA 2JI8A 5JQGB 3ASGA 3JXJA 3Q4GA 1NQUA 3OM1A 2J85A 3R4CA 2Q6LA 2UUAB 4N3AA 2QSZA 4NQ0A 1EX1A 4IXTA 4ZVRA 3VR4A 3GCGA 1YVPA 1O1RA 3CB2A 1EFHA 4ARAA 2ZRDA 2DPGA 3LDZA 4UZEA 3W2FA 4DA7A 2QVGA 3RYHA 3LZCA 4GICA 5JAZA 2YHBA 3HZHA 2I7CA 1W29A 2XI4A 3JXIA 1K3UB 1XCOA 3M3DA 1FUIA 4JUAA 4LHSA 4JQCA 4B3FX 2OM6A 3ELDA 2AI1A 2IE8A 1RAFA 5H3CA 3H18A 4DLYA 4EGFA 3GAMA 2ZWIA 3CUVA 4UZSA 5FHRA 4FLHA 4LXGA 3BIWA 1PC2A 2Y3AA 1QK4A 3MD0A 5DYTA 5J58A 4LNGA 2P7IA 3H5IA 2GARA 1KO1A 3DSTA 2QRZA 3VU8A 4OLAA 2WIBA 3DP7A 4OQMA 2WFLB 3EF1A 3DV9A 2GYUA 1ELRA 2R1TA 5D8DA 4G07A 3SR4A 1N75A 5KTTA 2J5KA 4G4SO 1C9KA 3N0TA 4OHXA 3Q9SA 5BSFA 3QB2A 1K3TA 1O6CA 1U1DA 4QJ5A 2YWFA 3H9QA 3M49A 3RUAA 1SBYA 4H31A 1IAQA 4WOPA 3WSTA 4EEKA 3ZQ6A 3A0RB 4B73A 1AM4D 4J2TA 4O2AF 2X3MA 4MUIA 3QLVA 1W4LA 3EYAA 2W0MA 4RJIA 3G79A 2DAPA 3PDIA 1BPOA 4GPIB 4KBFA 3E22A 3UKOA 4RF4A 2GW1A 4CM7A 4N4AA 2ODEA 2YIMA 2A92A 3LHIA 5LCWC 1R8XA 3WLNA 1Y4DE 1QZ2A 4LWQA 1P6QA 1XDUA 3A2MA 3V8RA 4EA8A 4MQEA 1DEOA 1A69A 1V48A 2PQNA 2DUMA 2NZXA 1BU5A 3TQOA 3UJDA 1YBVA 3HXQA 3PQ2A 2PTHA 2Z0MA 3WO0A 3L8EA 1LW6E 1M2EA 1G55A 2UYQA 4PZUA 4WSOA 1MB0A 1X1EA 2ADMA 4IXMA 1NAIA 4LYGA 3E58A 1HDEA 4NS4A 2HMAA 2FFJA 3ZV6A 2UYHA 3FMVA 1VJDA 3EU5A 3FUVA 4NSNA 2JLYA 4LBWA 2BDUA 4EGSA 2RI1A 3D1VA 1JUDA 2V7TA 1C9EA 2W6JA 1YB6A 4EHIA 5ARGA 4AM9A 3HKDB 4UWHA 1ZJZA 1H2HA 1J1IA 1TYDE 3OFKA 3PFWO 3ESZA 3BIOA 2XUKA 5A7DB 4PICA 3ZZ1A 3AOGA 5AK0A 1N0UA 1NQXA 1VL1A 3LYHA 4JR0A 4KRXA 3QNUA 4L4SA 5AXAA 4B35A 3PXCX 5IJWA 1PD0A 3VHLB 1RWOA 2ZIXB 1ZRMA 1UPBA 1IFXA 1NW6A 1SU4A 2H17A 3OPQA 3ZEFA 2R8ZA 4MUNA 3W2HA 4ZT6A 3IMFA 4P7BA 1X1TA 3SFYA 3KUUA 2H1CA 3GFGA 3B3QA 4PZ9A 3VR5D 3HXDA 3ZY6A 2VK8A 2XXAB 4KXKB 1QR6A 3PVZA 4JJKA 2Z5GA 3LVBA 4I2WA 2LXMA 2J31A 2CE7A 2PJUA 4P3KA 4WKBA 2H2AA 3UYKA 1ZD5A 2UYCA 1RKUA 3A4MA 3QRWA 1K66A 1D6MA 5ICGA 1DJNA 3EWNA 1XKTA 4FZ3A 4WOKA 4YJ3A 4OF4A 1FFYA 4GI2A 4O1PA 4MS3A 4Y2TA 1Y0BA 2EX1A 3B1YA 4RLQA 2Q49A 2F9MA 2CCJA 2NXPA 2X7XA 4ZU6X 1NI4B 1SW6A 1CR1A 1L5FA 1P4HA 3HP4A 5LQUA 1O95A 2IE0A 1QTRA 4PLWA 2PMFA 1K5PA 3M3PA 4XEUA 1AKWA 4L74A 1H2AS 3BXPA 3A1SA 1VHJA 4E4RA 5BN4A 1NT2A 1FF9A 2L2QA 3FOAA 2RAPA 3NDRA 2NVBA 2L0IA 3DW1X 3R7AA 1RLJA 3CUWA 2NO1A 3V1NA 3FDZB 4J29A 4JX9A 1FRFS 1BN6A 3TX2A 5KX5B 3RIEA 1UBTS 3RE1A 1A9XA 1DC3A 2IU1A 3S8MA 1AZTA 2O3UA 5BV2P 3KEZA 1QHYA 1VI6A 2IYWA 1D04A 3AV3A 4CVNA 3LU1A 2C77A 2Q5OA 3ZK9A 1KH1A 3SR3A 3EG9B 1DAFA 1SEPA 1CC1S 2ZSJA 3I2KA 1A0OA 2X5JO 4YP7A 4B82A 4N5MA 2WQZA 1ZMRA 1R3DA 1Y4AE 2I2FA 1OBCA 1T8WA 1DBPA 2QLLA 2X8AA 3AW9A 3EXIA 3JQ9C 3WNQA 2AF3C 3ESAA 4GBMA 3JV7A 1V5FA 5BQOA 5A2QA 3AR3A 2JW5A 3QLUA 4BO7A 5FI5A 3KYJB 3P96A 1Z5OA 1U31A 2OILA 4E2WA 1MORA 2XDQA 1VZ2A 1FYVA 3R20A 3TNLA 4P80A 5FOVA 2NUBA 4G41A 1Z12A 2Q3HA 3D02A 3JUIA 4B80A 4ECAA 4N41A 4YXFA 5BR8B 4WERA 2Y1DA 3AIIA 4FONA 4LW8A 3LG2A 4OQYA 1G6Q1 3LC7O 4D96A 1K1AA 1F2VA 3TRJA 2NAPA 2C82A 2EFEB 2RKWA 5FUWA 3C85A 2HZBA 4MR9A 3ZK8A 5C31A 1X7XB 1LDYA 2VRCD 4RVSA 1QV9A 4C0AC 4KH0A 2XNDD 4NAHA 1M74A 3L01A 4CL2A 2ZXWE 2RJOA 1YB1A 1CNFA 1PGPA 1XVTA 2ONYA 3VNUA 1KL7A 2Q7OE 3B6IA 1GUAA 2GBCA 3LJKA 521PA 2LXLA 5JHBA 1GZ3A 3PJEA 8MHTA 4K5QA 3F3YA 1KVRA 5EINA 4ENQA 2JJ2D 3P32A 3E34A 1LB1B 4G24A 1SXHA 1KI1A 1KOGA 3BD8A 5FBZA 1UXOA 3FUHA 4JA2A 3T06B 4IO1A 4ZYYA 2GERA 3WGKA 2B35A 2AZMA 3FLBA 5MGNA 3MJDA 5CMWA 4LJYA 4AVYA 4RJKA 4JENA 3UAOA 4FT2A 3LM8A 4PG6A 1T4CB 5LC1A 3ZJUA 2JGFA 2P2SA 221PA 1YRAA 5G53C 1GQQA 3B78A 5CTAA 2QZAA 1QOQB 4QJ4A 2ONKA 4YXWA 1FY2A 5A4IS 2IHKA 1JFFB 1M34E 1QLWA 2VXBA 1MP0A 1YS6A 2X3UA 1VHWA 4QO7A 4C01A 4Q3NA 4C7MA 4BECA 1P1BA 4R9UC 2ZREA 3CM0A 3G13A 1PD1A 1SY7A 4U2CA 2O05A 1TXGA 2MJLA 3AF3A 3K1JA 1QG0A 3OZFA 3MT0A 2O3SA 3QKSB 2GBFA 2ZJFA 5KBYA 3E7WA 5LQKA 4TMFA 3KQHA 5CP8A 3FOFC 1KSJA 3HYMB 3OICA 2XF8A 3LCJA 2A9KA 1DLIA 2RHGB 1AQJA 5BR7A 1YI1A 3B52X 3IEUA 3V55A 3NAQA 1N4SA 4BS9A 1C30B 3PEVA 4X24A 3DZ8A 4EG6A 3RAGA 3BSYA 4D57A 3D6NB 5ALKA 1O96A 3GAAA 4NMLA 3B38A 3I6ZA 5CYOA 1XEWX 3EFOA 2ZZMA 3AF6A 1D2EA 3U17A 2GH1A 3RSFA 4MMYB 2OO7A 3LPZA 2C5GA 5K0BA 1XDGA 1GITA 3HNRA 1SQ6A 1Y6GA 2EKBA 3LBHA 4RPCA 1EDOA 3H16A 3QOFA 4JVOA 2K6GA 4OFBA 3VZQA 1RQNA 2HU7A 1XLTA 1FUUA 1E5QA 2YIDA 3ZHRA 3ZY4A 4C7OB 2PFGA 8OHMA 3H84A 1PNQA 4Q16A 4TVSA 1NU6A 1ZRNA 3NIWA 5CVVA 4R5MA 4U96D 5KEIA 1Q6ZA 1XMOB 3USZA 4XX5A 3KPUA 4TQ9A 2Y1OA 1KC3A 1M2HA 2LBPA 5K3BA 3V4LA 4I9EA 3E4DA 1OAOC 4LDRA 1PFUA 3DE1X 1FQKA 3WRWA 1IZZA 3QW2A 1TNBA 3W78A 3DPDA 4RF2A 2F43B 2WIJA 4RJ2A 3FFBA 1L9KA 3DUFB 2EJTA 3RUCA 3SSNA 3PYXA 1XU9A 4A9AA 4BVLA 4LEIA 4Y2GA 5KYWB 1USKA 1J9ZA 2G09A 2AOXA 3OQ6A 2VPYA 3PF8A 4BVBA 5JEEA 5JJIA 1U90A 2GESA 1IZ9A 1R15A 2ZSAA 4FW8A 4J90A 5M34A 3GLGE 4A36A 2E0IA 1UK6A 3F4BA 4H60A 4KFSA 2WR8A 1X70A 4Q9JA 3LPMA 3QFCA 4I55A 1E6CA 2B3TA 5DMXA 1KXJA 4PSCA 1AUPA 1G0NA 2HXYA 2TYSB 3LQ1A 1JPNA 1L8AA 2A9JA 2QRHA 3PUVA 3I04M 4HJRA 2IKSA 5EL0A 4AO6A 5LQNA 3PNTB 1IEWA 3U44B 5CFNA 3D6MA 2AH5A 2I87A 2IHZA 4H16A 4JLMA 1UQUA 2LD4A 4LYAA 3SBXA 2A5GA 3RR2A 4FDMA 5E0KB 1JWGA 1HE5A 3AEUB 3N6RA 3KB2A 1DC4A 1LJ8A 2FXVA 1TIKA 2P3LA 4W9RA 3C3JA 4R01A 1CEEA 1LBEA 2VQDA 4E1VA 3A6GA 1KPIA 1FFGA 1EGAA 4GP7A 3MF4A 1WXDA 4OI2A 2OZPA 4BXOA 1ZCAA 2J32A 2CG2A 1AWCB 2VT3A 4OHPA 4D9GA 3MCXA 4YLEA 3BMOA 1UJCA 3DAOA 3VKFA 2J46A 1NJSA 3KQNA 1LLUA 1CQXA 1QTIA 4JBGA 4X3CA 2FA9A 3A58B 4JLBA 3T4PA 2X0IA 3TTTA 4WXPA 3WYFA 4RPIA 4RTOA 5HGXA 2P9PG 3D64A 4HLQB 4NX2A 1M0SA 3T52A 3WKDA 2A0XA 2D0OB 2JIBA 1M75A 4KI7A 4K9PA 4C29A 3ST7A 3OM9A 4RMJA 2JJYA 4G37A 3THYA 2O9JA 1FZQA 2PSFA 4UHEA 5BW8A 3EQ8A 1EXWA 1XV5A 2JIRA 3BK1A 3ABZA 5ESDA 4B7XA 2GKSA 3TTUA 3MLEA 1Y63A 4OA5A 1M5RA 5JJ6A 3HUTA 1YDEA 4OI0A 1OHHD 3ZUPA 5U9CA 1UDAA 3CZMA 4AUNA 1VI2A 1KAGA 3F71A 3U40A 3VDMA 1M6EX 4C43A 2BEKA 3ZKJA 4Q3KA 4INAA 3QTBA 2VJPA 3IDSA 3QY9A 1RLUA 3TUJC 5K8VA 3K0SA 3FCYA 4NE2A 4LJ7A 1WSDA 2QNRA 1GV1A 4QU9A 4DYVA 4F1KA 3FPEA 4WNEA 5EXXA 2CHQA 3F7NA 4IVRA 3K9NA 4ANXA 1O9GA 3AQIA 1JQDA 3NHBA 4HT3B 5CITA 4AFNA 1N2ZA 2C2MA 3P2JA 1P80A 4A92A 3U3WA 1KQOA 3SFXA 2LR0A 1XDWA 3FZNA 2I99A 3BD6A 5EZQA 5KKNB 4DI3A 3BD7A 1E2PA 1U9CA 3RO3A 3GN1A 2GYWA 1WABA 5EZ6B 3I76A 3QUQA 3IAHA 4U7DA 1IC6A 3DGEC 2PQMA 4XQ0A 3TR6A 2JGKA 5AVUA 5EXTA 3M6WA 4KVZA 1ADGA 4L6CA 5FFFA 3B53X 2QZPA 3OETA 4RKEA 3WMWA 1O94A 2WTEA 4HLNA 3V3TA 3D4PA 3VDNB 4ZK2A 2MYTA 3CT4A 3TBHA 1NW4A 1MO5A 4N3BA 2XD9A 4Y0NA 3AESA 3U0VA 1T0UA 4RSGA 4YRTA 2FG5A 2CFCA 4YDHB 3RROA 4A15A 4AJKA 4BZXA 4TKZA 3RVOA 4ZN6A 2BUGA 1H4VB 1ZA1A 3UA3A 4FU3A 4MVJP 3S2AA 4DVGA 4JEMA 5LCXA 1E9DA 3ASOE 4W9NA 1E61A 3MTQA 3VYWA 3SZ3A 4LE1A 3H2BA 2PH7A 4V0QA 5CJ2A 3WS7A 5AYWD 1N5JA 1HNZB 3BMCA 2O5VA 1ZC4A 2V5VA 3ANSA 3D2CA 5EZYA 3PI7A 3VO8A 4HZUA 4DQUA 3AVWA 3F1LA 1VJRA 5FQ4A 1PF7E 4CM4A 5LYJB 3GJSA 1G18A 4JR1A 3IAS6 4JP5A 1I30A 1PG0A 3GGGA 2PMBA 2YXDA 2IEGA 2GVNA 3EVGA 2C58A 4A10A 5CLJA 1JG6A 1G3MA 3KT0A 4CIAA 1TUBB 2QTWB 1GU1A 5FEMA 2ACWA 3JQFA 1TJFA 2LDBA 3N58A 1PR6A 2AK3A 5TS2A 3SIXA 5IFLA 2WU4A 2YIJA 4DUGA 1J2EA 1FSFA 2JI6A 5JAIA 3BWBA 3UC9A 5KNBH 1UJ2A 1CY8A 2EFYA 4YHBA 4L9PA 2J3LA 4LYEA 4BO1A 4ML3A 2B6CA 3NYQA 2AXQA 4NE7A 4NU8X 2C3PA 4E46A 3GPLA 2VHUA 3O74A 4WOCA 3CVXA 2GCPA 4M1TA 2GEFA 3O9ZA 3SZ7A 1UT6A 2BEUA 1YKFA 2UVDA 1QIIA 3LT1A 1ZO8A 3OJLA 5E7IA 1KARA 2SECE 2FSHA 1NFRA 1JDNA 1FCHA 3PVCA 1B89A 2XPIA 2G6TA 4OUDA 4QEKA 5J63A 3SHQA 5IANA 4FD2A 4FFDA 4JELA 1XLUA 2VJAA 2PZKA 1PL6A 4U5QA 1WQ4A 1J1UA 2XS8A 1YB2A 3TM4A 1L1QA 1RLOA 2NYVA 4L3VA 4BE4A 3EAFA 2ASEA 4X61A 4PZEA 4MRMB 3R7DA 3UWPA 1DLJA 4PLVA 1MX5A 4HD8A 2JEZA 1FDSA 3ICQB 3IXMA 2R05A 2DCMA 5FIUA 3RT9A 3ZLVA 3DOOA 3F6RA 3I0ZA 1XU4A 3BX1A 3HEMA 4H18A 4ERXA 4Z4HA 3CV0A 1OCOE 4D6XA 1TUEA 3GBPA 4E07A 1AUQA 5B7PA 1YIDA 4MS4A 1KZ4A 5JJ7A 5GOTA 1A96A 3NQ41 4P3XA 1WXHA 3WMFA 2XCLA 4A6EA 3ZV3A 4BO6A 2YWCA 1YS1X 3FHJA 3JVIA 3KQPA 2BZSA 3TLKA 2X9VA 1H6AA 1ELOA 2W2LD 3RNLA 3IRUA 1H0KA 1DCFA 3B9BA 4CT0A 1N0VC 1XRLA 2H85A 5HFNA 1QONA 1W9MA 4ZAGA 3X1XA 3HA3A 3G6WA 3WGLA 2HLHA 4GTSA 5LOZA 2PSSA 2QMOA 1VE1A 4MQBA 4F4CA 5EIXA 1D6SA 4DK5A 1Q74A 3D9OA 1ZGZA 1KJ9A 3DXYA 3FFWA 3D9LA 4MA0A 4ZO7A 3TCNA 4ALNA 4DJJA 3ZYCA 2EIXA 4XYMA 1EDBA 1V4NA 2BRUC 1BU8A 1M2WA 2Q7DA 1JEYB 1YDFA 3IUMA 3NTVA 3ZWBA 1L9XA 2Q3CA 4L27A 4NZNA 1M6VB 1U0OC 3FKJA 1HE8A 1U7TA 4J76A 5FTMA 4YVOA 2F59A 1O1SA 2KBEA 2QE7A 2R44A 2YMLA 1YBAA 4O2LA 5CH8A 1EBBA 2W2QA 1WX1A 2YZGA 1NDQA 3DAFA 4HRLA 4LZZA 1QVAA 3LP8A 2VKTA 5KYXA 1GZDA 1L0BA 4BFSA 1FCJA 2BH2A 3D3KA 2HCJB 4HRYA 3MKQB 1LDNA 1T5OA 1RPAA 2I29A 3L8HA 3D6HA 4ZHQF 1MB9A 3CR3C 3NIFB 4C3ZA 4FM9A 1C41A 2VP0A 4UCFA 1FFWA 2PH5A 5TMBA 4IUBS 2LDXA 1ZSNA 4WRRA 3CEPB 3KSAC 4W5NA 1X92A 4A23A 1YCFA 1F0YA 3LUGA 3HR7A 1HE3A 3OU2A 1ZNZA 3U62A 1VPLA 3IL2A 3L05A 1RVDA 4IDFA 1FNNA 1KJJA 1FX0B 1R50A 2VHTA 4GF5A 4Y7DA 2IZ7A 1IXVA 1MIOB 2RC5A 1UBJS 2YNMA 5K6AA 1HNWB 5EIBC 4LDJA 4I4TA 3C87A 4ZQGA 5EHIA 5H3LA 1VBFA 3GD5A 4KP7A 4Q37A 5IVHA 4RD3A 5F5LA 2ZYGA 3SJ7A 2KW5A 3JCZA 1EVKA 2NT3A 2HUNA 4CMAA 3RFFA 1YC2A 5FPSA 3ODGA 1EINA 4XSHA 2WJHA 1YMVA 4X94A 4I3HA 2CYBA 3AR4A 4LXIA 3K1YA 2AJLI 2L6JA 2DFLA 3BCUA 3ZGQA 4BB5A 4R71A 3B85A 1EP1B 1JS1X 3E3LA 4F3NA 2FMTA 4G1TA 3M81A 4CTNA 1VSBA 5BWNA 4FGWA 2KS6A 4WY2A 4BMYA 3TQTA 2P6RA 2R4UA 3BOSA 4N47A 4MUMA 1QHXA 5ITZA 2Q2QA 4NARA 4OJYA 1PG2A 5DFAA 3EGIA 3NDIA 1JLRA 3ORRA 1MENA 1C3VA 1JVBA 1Z25A 3PDCA 2QIPA 5FTJA 3RC2A 1B6RA 2XIJA 3ZNNA 4HATA 2WTBA 2J9FB 3IKJA 1TL7C 4EM6A 5JNTA 3BWYA 4LBYA 2QBYB 2ZZNA 5HM6A 4UUNA 1E5XA 3CVNA 2FFBA 4C08A 3MS7A 1GYPA 3UXMA 5A9SB 1C1DA 3DF9A 1X15A 2VF5X 1GL7A 3NBYC 4IWNA 2QP9X 1CJTC 2VTBB 4Q9NA 1R4NA 1XMIA 1ULUA 3LHDA 4MEBA 1A9XB 4X44A 2OFPA 4K6HA 5HQJA 4Z53A 3MV3B 3GH1A 4FEAA 4G8JA 5F35A 1OLUB 1FYDA 1XZQA 5F7XA 2XQVA 3RUIA 3DPUA 2QJOA 4QTTB 5DLYA 2X6JA 1OX4A 3BMQA 5KJLA 1AQIA 1TYQG 1AMOA 3FJYA 1Q7TA 4I50B 1NURA 1C9MA 2ZBQA 3RUFA 3FWHA 3TFQA 1QR2A 1TECE 2F64A 3BXFA 3QHQA 4JT4A 3STUA 2Y4NA 3IPYA 4DIFA 1FFCA 4RZ2A 4YUZA 4F2GA 3ZE8A 3FULA 2Q3EA 3E9YA 3OD5A 1FTSA 4G1VA 1DX9A 1ZLYA 3D9KA 3PPXA 5EYLA 1WWKA 2X6IA 2M2IA 1MG0A 4U39A 1K9VF 5LOVB 5ALOA 2ZRCA 5LZ7A 2VAXA 4CETA 3HYCA 4FDAA 2HJHA 4NABA 1AK2A 1I5OA 2GSWA 2Z8ZA 2LUHA 3C45A 3S27A 1DIGA 2OV2A 2ZS8A 3P2EA 1XTUA 3DFFA 3EXHC 5FCDA 4F5ZA 4UTNA 4GSYA 1V39A 1PK9A 3LKBA 5JDCC 3ZXYA 4K0KB 3CGWA 4AMBA 1GAQA 5CFRA 1PKEA 5CVDA 3J7TA 1S6YA 2W2TA 1CUXA 4UE3S 3SD5A 5FPTA 5H3HA 1UPAA 1V7CA 4AEZC 5LQMA 2DHCA 1X7GA 4IHKA 1W1IA 4DCTA 3NUQA 2OAP1 5IULC 1M2GA 1OJ7A 3GGDA 3BSWA 4QBIA 3NOQA 1JH9A 1HYGA 4PXYA 5C1OA 2I66A 1YRBA 1KO4A 3K2QA 3N0VA 5CG1A 1Z6YA 3LUJA 1HYBA 3ULYA 4WH0A 1BDHA 1DUVG 1E5TA 4RMIA 5BRNA 5BW6B 2BUBA 4NBUA 1PEYA 1XZPA 3VOTA 8ATCA 1CY0A 1XEXB 2ZIUB 1GL9B 3T5VA 4Y6OA 2QMYA 1KI8A 4RCZA 2OYRA 3EA4A 3DBHA 3BG0B 1ST3A 5IZCC 3LVRE 4GBED 2FUG6 5DEIA 4YRAA 5AIJA 1MX3A 3QE2A 4BMSA 4BBPA 5B30A 2GYVA 1OWNA 2EL9A 3C8UA 3DVAA 2VPXA 3AHEA 4ZCMA 1NQTA 1JYSA 4KPUA 3R7NA 5KNGA 3U5TA 1UBFA 1R88A 3VLDA 1SFRA 1MQ8B 3K73O 1R27A 5NULA 4EHJA 4F21A 2AWNA 4TWZA 1P4SA 1P7CA 5JHAA 2BKXA 2DCUA 2GBLC 1ZUNA 1SUEA 1WB9A 5DGDA 3QH4A 2VH5R 3EHMA 1UK8A 2KZTB 4QGAA 4MVJI 4RL4A 3J81A 3FP3A 2NSYA 4ME6A 4C4ZA 2ZE8A 5ADWA 3P0FA 4KAJA 4MKIA 2EKQA 2LTAA 2XT9A 1M1NB 3KO8A 1QFZA 1K2WA 1ZD2P 2L69A 3ASUA 4HVTA 1P31A 3LP5A 5JSZA 2WVAA 3O3NB 5F77A 3ZHUA 5KREA 4AWXA 2IODA 1IZ7A 5K8JB 3D54D 4WKGA 1EVYA 3KL4A 1YNSA 2G25A 4N5DA 3KUCA 2PJRA 5CR9A 3BUSA 2EQAA 3QY0A 2PGDA 1J2YA 2GN9A 4KNYA 3WA7A 4OQQA 4Y2PA 3H99A 1JAHA 1DIOB 4FILA 4RKRA 4DE5A 3EUVA 1SC3A 4OHBA 1Z4LA 1PI3A 1E2JA 3ZZ0A 3V34A 4Z4GA 2BGTA 4LWPA 2OV1A 4ZQHA 2KLHA 2CNWA 3MAGA 5ALJA 4BVKA 5JZOA 3TM5A 3VU0A 2OG2A 2YQ8A 2W2OA 3DEZA 4AJ4A 2FEXA 3ROXA 2VGXB 1LS6A 4DPMA 3VR4H 4EARA 3AU4A 1SBIA 4YDYA 3CA8A 4RDCA 1N54A 3GYZA 3UMSA 4KXFB 1C0EA 5HF6A 5J4KA 4P7JA 3UJCA 2GF9A 2HBRA 2L17A 2MU1A 4LI3X 3TZKA 4M1WA 1XHLA 2C9OA 1JALA 3QPCA 4EF5A 5JQGF 5ALHA 5EIEA 3WL3A 4D9NA 2HHJA 4KZKA 3PC3A 1KJZA 1RQ7A 4QJBA 4YAFA 4QD3A 3UCEA 4PNEA 2OLJA 1TMOA 3ZJYA 4F4DA 1Z7YA 3GA7A 1Q1EA 1T0BA 3QVUA 4ENSA 5IVPA 2NOAA 2A0YA 2XUZA 2IO3C 1G5TA 1C3XA 1L1EA 2ZJ7A 3A6LA 2P9UG 3L7YA 3PNSA 4CGYA 1B23P 4AULA 4ANFA 3DXMG 1YBFA 1R18A 4RLHA 2AV6A 2HMSA 3GFQA 1VGRA 4Z3KA 4LXHA 1E4YA 1GVNB 3TKAA 4U7TB 1JEAA 2X38A 3HJHA 4OMCA 2VYVD 4HNTA 3GT3A 3EA5A 3S4YA 1MV5A 1NKVA 1E6MA 3FSGD 3RHZA 4HXIA 1JE1A 1QXSA 3LWZA 3MRVA 1R3UA 4XWWA 1B6GA 3PF9A 4S0XA 5CXQA 3TW8A 2WD7B 3EVEA 4DZRA 3LCRA 5GONF 4ZD6A 1QGAA 2Q4TA 4FWTA 4CM9D 2A9FA 2OGUA 1GCGA 4YRCA 4FFMA 4TQGA 3PE3A 3KPWA 4NPHA 4BJ6A 5C3MA 2N3ZA 2YX1A 2YOFA 5C7IO 4NV1A 5J59A 1KFJB 1XZMA 4GW3A 2P9LG 5MHTA 1J97A 2ZITA 4B7ZA 4UHCA 2ZPTX 3V8EA 4IDAA 3DO5A 1JWAB 5FL7D 3O82A 4MKZA 5CDGA 3CRRA 2JAOA 5JMWA 1GA6A 1I36A 3NJRA 5DOZA 4AICA 1TCBA 2GPBA 3H6KA 1EBFA 1EF1C 1TQ2A 4L2IB 2BDEA 1A1SA 3HCBA 1MNAA 2FFAA 2ID4A 2WE7A 4C3UA 1GPAA 5I51A 1SOMA 2YJ4A 2WT4A 3B7WA 3AKCA 1KIAA 2IT1A 3GXOA 1NASA 5IAEA 4CQLB 3IEKA 4C5BA 4GTOA 2J33A 1S3SA 3U7FB 3DLCA 1D8TA 1JPVA 1UJBA 2IF0A 3LQFA 4AO7A 1SR8A 3DW3X 3R3WA 4JAVC 4ZV4A 1NR7A 3B2NA 2EJBA 2ZKLA 4Q48A 1XTTA 2GRNB 3MINA 2Y3IA 3W79A 3S2ZA 1UJ5A 2BTQB 1E1KA 1GJRA 5DBGA 5AW3A 4ZEWA 4D9MA 3DAHA 3C3WA 4BQRA 1UPUA 1WZEA 4WX2B 5L95A 2NSHA 4IHJF 3R7WB 1H2BA 3GLGB 1XZNA 4JN6B 4HQ6A 1H9CA 1S2OA 3AF0A 3LXRA 4GOXA 4O5OA 2M9MA 5A6SB 1DI0A 3FVWA 5B58T 3ROPA 4DNPA 1Y3DE 4LGYA 3E9EA 4LJAA 2AW3A 4I1OB 1VYUA 5H9VA 5I5GA 3RWMB 1IK4A 3FTZA 4PO3X 1GGHA 1Y9AA 1KPGA 3FPLA 4E13A 3D4IA 4YI5A 4YJFB 4BV2A 2C4MA 5JJBA 4RPLA 2ZIVB 3DT9A 4PGFA 2IVFA 2AWIA 3OSUA 1YCHA 2FUKA 3A4TA 3KOUA 4FC7A 1AOXA 1I2AA 2P4SA 3B5EA 3DMPA 4IWXA 4ZP1A 5T67A 3HGQA 3CVLA 2VQEB 4UHFA 4WLOA 4CNQA 3WB0A 1JRLA 1CQJA 1SURA 4C2TA 4QSMA 2ODNA 1W46A 1IM5A 5JMTA 1YOVA 1V8DA 3SYKA 3I5PA 4GWKA 2VA9A 1I80A 3DUWA 1ESDA 5EUQB 4R05A 2OA0A 3WL8A 5IDYA 4BLTA 2DLNA 2ZYIA 1K86A 3ITKA 4B3BA 4DR5B 3C6YA 3CH6A 4KN8A 1AO0A 1UR5A 2FPWA 1YR2A 1X2EA 2ZTUA 3HKBB 4Q1CA 3EK2A 1P4JA 4HPJB 3TVTA 4D9KA 3D81A 2Q41A 1OLOA 3JQGB 1GGVA 3GLUA 3MZLB 4P2BA 4G8CA 1Y1QA 1FUKA 2C2LA 1Q5PA 2CLEB 2PS3A 2WU3A 3KEFA 1SVXA 4LV6A 3RTBA 5JQGA 1XP8A 2P1ZA 2QX7A 4EBAG 3EISA 3KTAA 2RGNC 3GBSA 5ETJA 4CQMA 3VPHA 2VN8A 4ZOEA 3ZDFA 1V37A 2H7YA 2OQRA 1KI6B 3LO8A 1L7PA 5I7OA 1DQYA 3H8VA 1XPRA 4URZR 1F2DA 2Q8PA 1M1YA 3K9QO 4PG7A 4B6EA 2FO7A 1LFAA 1J7KA 2F1JA 1QFYA 2GHTA 2L19A 3RWOA 1A9RA 3FUJA 2OOSA 1ISSA 2VDRB 1DFHA 3MJFA 2HV9A 4GX0A 4PFJA 5HA5A 5D0QD 4QOEA 5JD3A 3RRYA 1UW4B 2IQCA 3BRWD 4BSXA 4P22A 3SX2A 4P31A 1BW9B 3IODA 2O4CA 2RBEA 4PH4B 4RGBA 5AJXA 4CMEA 4YLYA 3K6KA 2E2WA 4EUHA 2AZDA 2NO6A 2DKNA 4J0JA 2VAPA 1LDBA 1XWWA 2ISSD 1IJFA 1N6RA 2BI4A 4TM8A 2DOKA 2H16A 2X19A 1F1JA 3CFYA 1JPJA 2WFLA 2WLTA 3K31A 4GOKA 1JHAA 2UV8A 4MGEA 5EJAA 3TD9A 1ZOPA 1JWBB 1CUEA 1KA9H 1JDVA 1VIDA 3LFUA 4N82A 5J9FA 3IV9A 2IU4A 3G1TA 4GRDA 3U7IA 4UULA 5K0NA 2EW8A 3L6CA 4WKOA 3FWNA 5F64A 4GZ3A 4RVBA 4DLAA 2I2AA 3WDKA 4RK6A 3V6LA 5I7VA 5CNIA 5DBHX 4TMYA 1ABFA 4PX3A 1U9YA 3UM0A 2H57A 3ZCSA 4PZ0A 5DYIA 1W93A 4IILA 4AYXA 4BMZA 4EEXA 4K9KA 1I7LA 2Q4RA 1P5QA 2IXDA 3CZPA 3OPMA 1GLGA 4ZRDA 4XTRA 3CUYA 2A57A 3FUDA 3CUSA 4B3XA 3W04A 4AJIA 5LDDC 4F3VA 4RACA 3S3TA 3ASDA 3G0BA 4QATA 1ZX1A 2IXFA 3KR2A 3EGXB 4MQEB 3TOZA 4GYYA 4HI9A 3AB7A 1T10A 1SBHA 3HBLA 4P4SA 2I76A 4OB6A 4R2JA 2ONZA 3TSCA 4DEXA 1Q50A 3ENKA 2C4VA 3QI7A 4CU5A 2CHEA 2RJ3A 4JHLA 1YMQA 4GI1A 3K8OE 1C0KA 4IGAA 4IKEA 2YL2A 1JYFA 4L0CA 4ZVQA 2WQ6A 3OFND 3UB3A 1DELA 1LCIA 1XJQA 2V6IA 4GG1A 2OCGA 5AJWA 3KYIB 4RIEA 3K30A 2GLXA 4JBLA 2WI8A 4YJDA 5DNAA 3KZ1E 5BWOA 1ZH2A 3IDFA 6ABPA 4S3MA 1ZJWA 1BD4A 1TW3A 2G1KA 1HKUA 1NMEA 1FUYB 2AFIB 4FR5A 3VGPA 4EL0A 5G4KA 2BFWA 2JD1A 5THQA 3KSMA 4D25A 1A2QA 2X5KO 2XQJA 3H9EO 4XRGA 1HDCA 3I0MA 4MVJD 4H4DA 3D7KA 3C3BA 1V3VA 3MCTA 5FIOA 1IWBB 3N39C 1K4YA 2ZW9A 1EGQA 4MVXA 3FFXA 4R6XA 4TSKA 4CM3A 3TQCA 2YY6A 2XNKA 1T8PA 3IPLA 4RJTA 1XQ1A 3OU7A 3UK2A 3VVBA 5C8VA 5JVDF 2HF2A 1R00A 5JSHA 1JIVA 1HZJA 2AC2A 2PKQO 4DVJA 3JYLA 2ODTX 4LXYA 3PG5A 4TL8A 1C0PA 4W8GA 3TSYA 3RFCA 2WJIA 5FWNA 2HUPA 3ZI0A 2O8FB 1OI7A 4FEEA 1TN8A 2QRNA 4O1OA 4O4IB 1YCGA 1USGA 4OL9A 4BT9A 1JMKC 2XRMA 1FPMA 2H6HA 3CLRC 5AUOB 3N3AC 2ODBA 2IHUA 1WDTA 1GN8A 3L0ZA 4Y9TA 2R1ZA 5C53B 1UODA 4OQEA 2OM2A 2AQIA 1JECA 2X9NA 4RA6B 4YRQA 5E3HA 1S7GA 2XGSA 1JDTA 3ZGNA 4RA9B 4CHGA 1BZYA 3FH8A 1WSBA 3JVEA 3KELA 4RKQA 1RKVA 4UCQA 5FZSA 5BSRA 5EN4A 4DSZA 3TBKA 4XWKA 1DXYA 2LCQA 4MGZR 2IEZA 1UWLA 3Q6MA 1KI9A 1IDN1 4B6QA 2Q5HA 2ZIRA 1ILWA 1L2TA 1SAYA 1RRFA 5DLQC 5ALXA 4D3ZA 4EUKA 5G1PA 5JJCA 5BWCA 4CEIB 2EINE 4HGYA 1PQYA 4OXXA 3ZE9A 1RABA 4G4SP 2M32A 3UEOA 4DILA 4HEQA 2WMDA 1Z7GA 5TF4A 4GM1A 1QS0A 2Q5LA 5C1BA 3B13B 3KT3A 4MLPA 1LF0A 1RC1A 5KSPA 3QWVA 4KWHA 2ANBA 4Q3EA 3PS9A 4CTMA 2XZDA 1H65A 3MG9A 4RJJA 2PMDA 2C4KA 1SN7A 3N2KB 3IOBA 4V24A 4ZO6A 4EUSA 2WSIA 4LE2A 4OSPA 2HXSA 4AG6A 1HG2A 1LI4A 2PWZA 3Q11A 2JFPA 1F0KA 4OK6A 1E3EA 4P53A 4ZQCB 1E1CA 2VHZA 3UUGA 2FY8A 4X66B 4LJ6A 3Q7QA 4QDOA 4YCDA 2J5XA 1L7QA 3OJ0A 3OIFA 4MUXA 3AUXA 1N9KA 3DQPA 1MC8A 1TK9A 4JNKA 2NLOA 5CB4A 1MH1A 2XBUA 4PE5B 4ENVA 4ENUA 2BUAA 4ZJYA 1KJYA 2QM3A 1KO8A 2EKPA 5IJ0B 3UT5A 1VBMA 1KQGA 1IRIA 2ZJOA 4XYGA 3CSTA 2ZJ3A 2GAIA 4DT1B 1AB5A 3JXEA 2QQFA 1PK7A 3A1UA 3MVEA 3P26A 1JIJA 1Z73A 2IELA 3UTDA 4A2QA 2OR3A 4BIMA 2GWHA 3AY7A 4IIBA 1T0PA 3MUEA 1MGOA 3AFIA 4BO3A 4J8DA 1IHXA 3L79A 3WWPA 1FT1A 5HMLA 4DI4A 4XDGA 2Q5JA 2P2ZA 1L3IA 3FPBA 5DXFA 1OBOA 1E63A 2P9IG 1F2TA 4HNSA 4IFIA 4A0QA 3PIDA 1GZSA 3OZAA 1SOAA 3LQKA 1OY1A 1PAQA 4JLPA 1IN6A 5D85A 3VC7A 1JMYA 3EEOA 1CIVA 1UBKS 4RH3A 5E1BA 5DTJA 3LC2O 3B7SA 3MJWA 1IPFA 1V1RB 1YR6A 3UANA 1ML4A 3I2IA 5ENPD 3U31A 2QY7A 1PT7A 4RPGA 5CD9A 1JI0A 4M9ZA 3CW8X 3JYQA 4MV7A 3ZW9A 2IUTA 3TXMA 3SWWA 2XZDG 5ICEA 2Q9BA 3O6VA 3VU3A 3ZEAA 1H0SA 1E2BA 1YKSA 2BCGY 2BMAA 3B70A 5I7UA 3RIBA 3SC3A 2GZMA 2PRYA 4MWZA 2AMFA 2B1QA 2ZB4A 5AKEA 5GWXA 5ENRD 3FTEA 3AVYA 3OQIB 1JIKA 4RDXA 3ER9A 3EG5A 1PV2A 2ZJ4A 1LK5A 1P2TA 3TEJA 3TLMA 2G5PA 3ABIA 3G0IA 3H65A 4CM6A 4TPKA 3CISA 2X22A 1Z0KA 3N7AA 4QPNA 4DG5A 4EZIA 1TO2E 4ZYVA 2Z5VA 1RDFA 4ZZ1A 1A8IA 3WI7A 3S1SA 5EE0A 1QF6A 3ZEIA 1O1TA 1BEEA 1YQGA 2O14A 4I9NA 1S8AA 3A25A 3WLLA 4FC8A 1SMKA 3AFMA 4DPLA 1JDSA 2CBXA 4U04A 4K1LA 4OOEA 3VJKA 1MX6A 5HQTA 1AKYA 3TB6A 4ZI5A 4UWFA 5CBPB 2X8JB 3RK4A 2FOXA 3AEYA 2HC9A 2PS0A 1Y80A 2WT8A 2FSIA 4AZSA 4IVNA 4KFCA 2FSFA 1LTHR 3H2IA 1NRJB 1NBHA 3P9IA 2LNIA 5HZGA 5AI0A 4GECA 4HEJA 1R0BA 3CG4A 3HBFA 2BHTA 3TRKA 4MRAA 1N2EA 1ICEA 2IPLA 1CD5A 1XG5A 4M0FA 4U7HA 4CMHA 2AJAA 1CLEA 2WJAA 4KYIB 5KJNA 2G06A 5T6BA 1GYQA 1VSUA 4UPDA 5DN6D 3DQQA 5ADHA 2VI5A 3VGJA 3BEEA 4NIMA 3SFTA 4QREA 3JYNA 2PLWA 3NTOA 4WUYA 1T9DA 1KT0A 4OXNA 3LLVA 3SXJA 3OIUA 3QEJA 3PC6A 4XCXA 2WJWA 4HYQA 1QC5A 1GDDA 2BOVA 5AD1A 1DOZA 4DXDA 4JCOA 1X5BA 5JYDA 2BR4A 2OD2A 4AX4A 1Q1QA 2R4QA 2PSEA 2JKZA 2NUAA 4OGKA 1VB5A 2P3SA 4UQPA 4Y2XA 2BGJA 2P40A 5E2AA 4F12A 2ZK7A 4E32A 5JAMA 2NQTA 1EDUA 4PM4A 4BBZA 1E1QD 1Y1RA 1XF9A 3ANXA 1I6KA 3BERA 3BICA 4M49A 1QRUA 4BAGA 2PZGA 2P9NG 1OGIA 1NW3A 3ZU6A 4OSOA 3RS4A 5T7BA 1XN4A 2W2KB 3KE9A 3NYIA 3PBKA 5CDFA 4HAYA 3BWEA 3ERCA 5IZ4A 1BVHA 4QFMA 1SHTX 3UW1A 1IBKB 1GQ2A 2G36A 2SICE 5CHYA 5LMCA 3KOMA 4AJ1A 1NR1A 4PC7A 3EDTB 4ZIRB 1TK3A 3H2JA 4URUR 2YJ5A 4L4ZA 5C8ZA 2WHRA 2HJRA 1N6IA 1JVNA 1WV1A 1TQ6A 4CU2A 4D97A 4DJFC 1U04A 4HHEA 2PUGA 1LSJA 3K0AB 2GX6A 4NOLA 4LZAA 1YD7A 3LNTA 4YAUA 5L4SA 1C1HA 2ZRBA 3BIXA 4IG9A 4MVJM 4EJ0A 2WWHA 4HWSA 2RDMA 3RODA 1QYRA 2AVNA 2AX3A 4I6EA 2IXAA 3DBSA 3TAXA 4GP9A 4U3JA 3WG9A 3ZOZA 1HT3A 4HN2A 4XFKA 1NVEA 2A33A 5EXEA 2P68A 4H6VA 1ESZA 2ZG6A 3QZUA 3C3PA 4ZDWA 4DCSA 1MV8A 2ZSHA 2ZYVX 3D6FA 5DHAA 3PZ1A 2CVPA 4K86A 2Q2OA 3CHMA 1U7XA 3CW2A 3QU2A 5CLHA 3V6MA 1HX8A 2LP4Y 4KAXA 2GYYA 1PJ8A 5CMLA 2XR1A 3T35A 2FF5A 1WMEA 2R60A 3JCKC 4YLGA 5JXIA 3WQRA 2EW1A 3GARA 3H5AA 4W63A 4Z9AA 1SBTA 3SSAA 5DHPA 3ZWAA 3LC0A 4GZLA 4F6CA 1YMPA 1E2HA 1QH1A 1W76A 4YT5A 3L3BA 3ZDRA 2IU6A 2O2DA 3K9GA 2CLLB 1U0FA 1P17A 4BL5A 3BGDA 2VBIA 1JHYA 3NBXX 4HWPA 4IDQA 3VSAA 1IY2A 1G7RA 2GS9A 5JDIC 4XARA 4CIWA 1P29A 2A88A 2HGSA 1GOTA 1S4MA 1ORDA 1V8ZA 3HPQA 3KX2A 4MW2A 4URVR 1F8FA 4ACLA 3CSFA 1RMQA 3EZNA 4X8QA 2V0CA 2QEQA 2QVLA 2IF4A 1JZTA 2DYRE 2CLHB 1C7FA 2HQRA 2IL1A 1YAHA 3GJ4A 3QF7A 4K3UA 4Q1AA 3ZD8A 4AKTA 4LK2A 4TTQA 4XJVA 3OQNA 1L3BA 3W8EA 2FGJA 5AJVB 2Q6IA 2EDCA 3IDQA 3TCXB 4C0KA 1I5RA 2LSVA 3C8ZA 3RF7A 5L7TA 1U1CA 5L6LB 1BEUB 1Q0QA 1K8XB 4BASA 3OCZA 3ZJ4A 1E64A 1G8YA 4Q6BA 4BNKA 2I9KA 2J9YB 1NSYA 2FN7A 3ME5A 1UZMA 3PL1A 4G6ZA 2JCSA 2WA2A 4EZKA 4UDOA 16PKA 4KO1S 4MCIA 4ZYTA 3UKJA 2EF0A 5H68A 3WJ1A 2YVLA 1T3TA 2Z1DA 3QUCA 1R4MB 4ISCA 2QYSA 1I3NA 4Z4FA 2QX8A 1PR3A 5CFLA 2ONDA 3BQMB 1N7JA 4H17A 4I2NA 2C0MA 1JE0A 3KPYA 4HFGA 4GS5A 1L4UA 3BTUA 2HFJA 3CG0A 3F73A 1BMQA 5EKXA 3DFKA 1B0PA 1E5LA 3VPBA 4HAUA 4UQOA 5JCXA 1BFKA 1ZK3A 2PN1A 2G9UA 5IN5A 5B1YA 4CLOA 3D9MA 2BN4A 2Q0SA 3JARA 3JQ6A 2O52A 3LF2A 2HA0A 4XSVA 3RYTC 3ZY3A 5I01A 1E20A 1TCUA 3K92A 1N2OA 1XZHA 3HC7A 3MTIA 5B2ZA 1TUBA 2JJ1D 3M4YA 4RGVA 1NOJA 1NLMA 4OP1A 2Y1LE 3CSDA 4UHDA 3ONLA 4M9CA 4A16A 1EUDB 4PYLA 1ZYUA 4KACA 4L5JA 4BNVA 1W19A 5ANRB 4PS0A 4NFLA 4TV8A 6ADHA 1U6JA 2PDAA 1US8A 1X74A 2WMOB 4EPVA 1JNYA 2I34A 1K7SN 1O97D 3P52A 4GL4A 2HU8A 4QO8A 5B37A 3RSLA 4DNQA 1XMPA 3QYFA 2V5QC 5JE8A 4JBYA 2P67A 2REBA 1JPLA 3M5DA 4QYWA 5E2IA 3SXUB 1ATZA 1RSZA 3TWUA 2PLFA 4DG9A 3IULA 3AJIA 2BDTA 2Z1NA 2ZQ5A 4I3FA 4F3YA 3HN2A 3GROA 4ABNA 5CPFA 4UVGA 2AT1A 3FA2A 1I7PA 4W9NC 1NP3A 2B78A 4DCGA 5IPFA 1W36D 1Z6TA 3VYRB 4EUFA 2W90A 1C4KA 5L3SA 2QUKA 2R6DA 3FUTA 1J5XA 3N2EA 3PC7A 3R5FA 2VOEA 1Z34A 4NL4H 1SIOA 2PGNA 4UMFA 4G11A 4XLLA 4MW1A 3KPVA 3RC1A 3SZUA 1QZ3A 3JQ8A 2QG9A 4GCNA 4D1YA 1RQXA 2W6IA 2DZNA 4BP3A 4YUVA 4DQVA 1SBZA 3QARA 1IG3A 1KFEB 3BAFA 1WEKA 3FCEA 3I45A 4J0CA 5ITVA 4ER3A 2W42A 3CX7A 5TGZA 1WETA 1HH8A 3IQFA 4F5EA 3A06A 4DUIA 2A0WA 1DQNA 2BKLA 1M6NA 1SXJA 3EWAA 4PQGA 4XA8A 3W4KA 4EG0A 5C80A 3OQBA 2NO9A 2B2CA 4DLWA 1Z0AA 2GPAA 4BLRA 9ABPA 2UU9B 1NMZA 2ESRA 3ACDA 4C5AA 4FINA 3WLPA 4DV0B 2O7RA 2HM8A 1O4VA 3REOA 3PWTA 3DL0A 1PS0A 3EIUA 4A8JB 3IC5A 2IDKA 3RVRA 2Q3DA 3CEJA 4HNAB 1R6XA 4IBOA 4XLTA 3GLIE 4O3FA 3AXSA 3RAPR 3U4MA 1RWMA 3ZH9B 3FRJA 5JCOC 4RZQA 2XADA 4UATA 1MJGA 2XMPA 4GE3A 4O1HA 2HCTA 3EZYA 2NSZA 2WDZA 2ZBRA 5B7NA 3CJTA 2PGXA 1DCEA 3SKYA 3Q3HA 1UXJA 3PNVA 3FDJA 3WIOA 3O8OB 3BN3A 3MJTA 4J7WA 5K1ZA 2QI9C 5HDQA 3W9UA 2CWWA 5FA6A 4B8YA 4DLLA 2K4MA 4FOSA 5CT9A 2YV1A 1KO7A 2PNNA 3EJNA 1V1MB 1EP9A 1QE0A 1VMEA 1ZXBA 3KVOA 4WXMA 3WLFA 4YPOA 4OKSA 4L2YA 1T5IA 3ZHZA 1E1NA 1PJRA 1R5BA 4UOEA 1ISMA 1VM6A 2QA5A 4E4YA 4LAFA 4MLDA 2A3NA 5F7OA 2A7XA 1AP7A 3N59A 3DDCA 4I4CA 4M9RA 2IYVA 5EQFA 4KR2A 1U3UA 1EZ4A 1Q0UA 1WNTA 4GYJA 4WHMA 5IHPA 1KNQA 1YBHA 4AVXA 2PK3A 1JG7A 1YA4A 4TXJA 4ZVKA 5DX1A 3PPYA 3EVTA 2YMQA 4YV7A 1SVKA 2J07A 4GM0A 4HI0E 2J09A 4U2BA 2VJNA 3H7IA 3IX7A 4Z5XA 1SA4A 3C0KA 3GK3A 2OFWA 3WVNA 1WL8A 2VKQA 3TWOA 1R0ZA 2QIOA 2XMRA 4OHRA 3ZGXA 4X45A 3QOXA 4PYKA 3SXPA 2C2BA 3WO1A 1CUAA 3HXEA 1YU6A 3OZTA 1NLUA 4RZIA 4N48A 3HS3A 1WUJS 2CC2A 4P93A 3KLPX 3GJ3A 4QDUA 4XQ9A 4AXXA 1MABA 2BI8A 2ALJA 4OOFA 2X2EA 1O5MA 4H0NA 3SBEA 2FN4A 1Z63A 4HBDA 4J3NA 3D3EA 4JJIA 3CTPA 5A4MS 4X62B 3T5MA 3GZNA 5EKUA 3MJSA 4HQOA 3O1IC 2BISA 5BUCA 1JHPA 3ELYA 3M6AA 1PTKA 2C29D 3SJUA 3DR3A 4G0VA 3WLOA 1TKCA 4X6XA 4CMBA 3CX6A 3HCEA 4YCJA 1E96B 3RABA 1E9SA 5CEJA 1RI3A 1GEGA 3ZWWA 4DV3B 1AXEA 4MRVA 2EGHA 4HDRB 1J00A 3KKQA 3U19A 3HUUA 1HG1A 1JKJB 3LXXA 2HLDA 1AKQA 2P5SA 2J0VA 5H80A 5J2UA 4JB8P 4TRNA 1QPGA 3ZNGA 1G41A 3DEOA 3A9CA 4GNRA 4LZPA 5B3JA 3SG0A 2V8BA 2FZWA 3QBTA 3PHCA 2VDMB 2ZSKA 1U3DA 3QEOA 3SBOA 3TIVA 5HZMA 2RGUA 4JJGA 2XKBA 4R83A 1RHRA 5GV7A 2H2WA 1GCIA 1CJCA 5KNLA 4MJLA 2ZWPA 3AKDA 2OFOA 4L4XA 2VDVE 5DBEX 4EMBA 4LOKA 5E75A 1KVTA 4WL0A 3DEPA 3EGEA 3I1YA 5HWSA 5LU8A 1T5DX 4WXHA 4RS4A 4E3WA 3F46A 2EKDA 2A0KA 2JCGA 1Z5GA 1ZWLA 3P8ZA 3Q3VA 4PANA 5CURA 3SKXA 5KKCA 4ALIA 3PQ3A 1ZCJA 3LK6A 1LTKA 4Z1OA 2GXQA 4EZJA 1CUDA 4OMUA 3SN6A 4EI9A 4YV2A 2GEDA 1F8YA 4JC0A 1T4GA 4FNAA 4C04A 1FBNA 1E7MA 3OEEA 3ASYA 4E03A 1E60A 3UJ9A 5I7FA 1A3CA 1G6KA 5ALSA 2VHXA 2C1EA 1QQTA 5BYAA 1UC8A 5J1TB 5AJHA 4KQ2A 4TLLB 2FWNA 4ZKEA 3LQYA 5TNXA 3WRYA 5BVHA 2IONA 5L8VA 1G6HA 3EXAA 1E8YA 4TTSA 4WJZA 4P0PB 1NRIA 5G2OA 2B7CA 5CRIA 1ZW1A 2VQSA 3RIXA 1C0IA 5JZ9A 5F51A 2ZSEA 3REGA 1P3Y1 2HTEA 3IQXA 4WNDA 1TIPA 1NBEA 2FMUA 4B47A 2DE0X 1AVTA 2MSKA 4BSZB 2COEA 2CUTA 4IL5A 2G70A 2XEEA 1B00A 3OBIA 1TLFA 1E69A 5U4QA 1J99A 2CD7A 1M6HA 3FKSA 2YHEA 1A82A 2XXBA 3OA0A 4UDXX 1KOFA 5GV8A 5IP5A 3FB4A 4PN3A 2FUNB 5DT9A 2B20A 4L0QA 1XDBA 1GPLA 1A2BA 2H5EA 1WAO1 2PO5A 1NWHA 2CZQA 3CNOA 2P0AA 1RACA 5EIDA 3MIIA 4HFRA 4XE5A 3KJEA 1VG8A 1A4RA 1ELWA 1BXKA 4G2NA 2FLVA 2C3OA 2N46A 2J6HA 1ZNYA 4R1QA 2P2DA 3IIJA 5AHXA 2BTEA 3PE4A 1N6LA 1IEQA 4P3NA 1QIMA 3IPRA 3WGGA 2BELA 4GZCA 1JIQA 1KDPA 4BNYA 4RLFA 2GBGA 1U98A 3MYYA 3NZSA 1JNXX 1SVNA 1Y89A 2UXBB 2RHLA 5DLDA 3K70D 5BNIA 5EIBE 3SIPA 4BFXA 2YWXA 3G0OA 3HKCB 3JD1A 3BSFA 2W83A 4KRGA 3VNRA 4BQIA 1TYAE 1RLTA 3X43A 3CR3A 2G08A 5KOIA 4K9RA 1S8FA 2AFIE 3O2SB 4MQUA 5GONB 2XQ0A 5C4MA