4I6JA

A ubiquitin ligase-substrate complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
507
structure length
503
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 170
structure length 503
sequence length 507
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6jA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6jA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6jA01
4QBTA 1OBHA 5FO0A 1O0BA 3H99A 4ARIA 1GLNA 2Z3VA 4ZCSA 2XRZA 1VBMA 3SEQA 1QRTA 4AS1A 4MUHA 3COZA 1WOYA 3OTWA 1LW7A 3IDFA 2J07A 3KFLA 3SZGA 2ZP1A 3OP1A 1XNGA 3IOEA 3GUZA 1EFPA 4R0NA 1H3FA 1N1DA 2EJCA 3CLSC 3ZGZA 1UFVA 1J1UA 1WQ3A 2DUMA 3MMXA 1M1ZA 1WXIA 5FO1A 2CV2A 3IVXA 1EUQA 2QJTA 1JIKA 1N2JA 4EG5A 2B7LA 3MLBA 4DJAA 2CYBA 1T6XA 1T6ZA 3E27A 1BS2A 4MVCA 2CSXA 4MVWA 3CA8A 1X8XA 3N2YA 4ZT6A 1IRXA 1N2EA 3ND7A 3IODA 1Q77A 1NP7A 2E18A 4NATA 5DASA 4EF6A 3N9IA 4ZT2A 5KCMA 3UOWA 3TNJA 4EG7A 1NSYA 1IFXA 2X3FA 1V47A 3L92A 4MQ6A 3ZXSA 4EFKA 4XFJA 4DDMA 3AG5A 1I6KA 1G8HA 3MXTA 4KR6A 3FETA 1QQTA 3ISJA 3CLSD 3K32A 1MOPA 4ZT3A 4XFDA 1N2BA 2VXOA 4G5YA 1K92A 1QRSA 1JHDA 1PG2A 1O97D 2D5BA 4ZT5A 4J76A 1QRUA 3TQOA 4MUNA 4DLPA 3AKZA 1IHOA 2HZ7A 1GZUA 1XNJA 2V0CA 3IUBA 4HK4A 1M8PA 1GTRA 3H97A 1ZUNA 3HL4A 1A8HA 2VTBB 4L2IA 5DB4A 3CLRD 4GU5A 3M5WA 3A04A 4EG4A 1LI5A 3HFJA 2EL7A 2QJFA 4GRIA 1J1ZA 2E21A 2QUIA 4PY2A 3X1MA 2V0GA 4YP7A 1WZ2A 1NUSA 2VTBA 1TEZA 2PXHA 4S1OA 1JEEA 5IJXA 2PZAA 1EXDA 2CYAA 3DLAA 2A1TR 2A1TS 4EG3A 2NSYA 3NBKA 4UZEA 1OWLA 1J21A 2A86A 2QTNA 3FIUA 1ULHA 1SURA 1GN8A 4ND6A 2J09A 1EFVB 2I1LA 2CT8A 3IVCA 3INNA 3MUEA 1O96A 1YI8A 2WSIA 3ND6A 2ZUEA 1GPMA 4MAFA 1WQ4A 3RJZA 1F9AA 1JEDA 1MAUA 2A1UB 2WB2A 3AFHA 3DV2A 1J20A 4NAHA 3CLTC 2BTEA 4QRDA 4H3SA 1MJHA 1KAQA 3KT6A 3COYA 4OUDB 2D13A 4ZCRA 1V8FA 1O96B 1XJQA 3ZXIA 1NYLA 5KWVA 2YXNA 1O97C 1VBNA 4MW1A 3TZEA 1OWOA 1G8GA 4CT0A 1X6VA 1MRZA 3KT0A 2IJGX 3DPIA 3KT8A 2JAXA 1JILA 1NUPA 3CLRC 2H29A 3QE4A 4DDHA 5LM3A 5IHXA 1OBCA 4I6JA 5TEWA 5EKDA 2A4MA 1D2RA 4KKVA 4WSOA 2BYTA 2TS1A 4JYZA 3H9CA 3CLTD 2WQ7A 3FH0A 3IMEA 5KHAA 1NURA 2WQ6A 1T9GR 4MWDA 4MW4A 4BWVA 3AL0C 5BNZA 4MUFA 1ZJWA 4MW2A 3FWKA 3CVVA 2CV0A 5K0SA 3A05A 4K0RA 3MLAA 1MB9A 3ND5A 5J5AA 3AG6A 1M8GA 3SEZA 1EE1A 1XNHA 4J75A 3FY4A 4YBRA 1PG0A 1S4MA 4NX2A 4RUKA 3FI0A 1J09A 1NI5A 5HUJA 2YY5A 3PNVA 4WNYA 4MWEA 3TS1A 4F4HA 1TYDE 3PXUA 4MWCA 3P52A 2DPLA 3ZUGA 3CVXA 1P7PA 3P0IA 3RK0A 1EJ2A 3QTBA 4FZJA 4MW0A 4KR7A 1N3LA 1PFWA 3IUEA 3D6VA 1NUQA 3QTTA 2H2AA 3FOCA 1M8JA 4MWBA 3UC5A 2C5SA 2DR2A 3A4IA 2CFOA 2PFSA 4U8HA 1TQ8A 3Q10A 2A7XA 4U7JA 3ZJVA 4JXZA 4I6GA 3NBAA 4MUGA 4MVYA 3G6KA 3UK2A 4YP6A 1O0CA 4Q93A 1EFPB 4X0EA 4QREA 2QTMA 1RQGA 2X1MA 4G5FA 1YIDA 1Q11A 3GMIA 1TYBE 1YUMA 1J70A 2A88A 3ELBA 1N2IA 4YP5A 4KPUA 1KQNA 1Q19A 4ZCTA 1OWPA 1FYDA 5H16A 1T9GS 4CDNA 5JBNA 1IVSA 2DLCX 3Q4GA 1PFVA 3UMVA 1TFUA 4NDAA 1PFYA 1IH8A 1Y42X 3CLUC 1GAXA 3PNBA 3CVYA 2XRYA 1KH3A 1N2GA 2CUZA 4KPUB 5K0TA 2YWBA 4NZPA 3IMGA 4DNXA 1HYBA 1MAWA 1JZSA 3ZJTA 2Z09A 2GOYA 3BL5A 4ZCQA 3IOCA 3NV7A 3HZRA 1VLHA 1KH2A 1O94C 3Q12A 2QUHA 1WXEA 3IOBA 4CDMA 3FDXA 1H3EA 1G8FA 1KR2A 1MB2A 1TYCA 2J5BA 4MW7A 2IELA 3I05A 2DXIA 1JGTA 3CLUD 4AQ7A 3IVGA 2OQ2A 3UY4A 3SZ3A 1K4MA 3ILVA 4ZT7A 3SDBA 1N75A 5HG0A 4RPIA 5TEVA 2AKEA 2DERA 4YMIA 3X1KA 1LI7A 2E0IA 1IQRA 1M83A 4ZCPA 2Z08A 3LCJA 3L93A 4HJXA 4PBTA 1O94D 5F23A 4ARCA 3LOQA 1COZA 1NZJA 4TS1A 1KORA 3KT3A 5AHWA 4DDKA 1KQPA 3RK1A 1KKUA 4JZYA 2DETA 1F4LA 1KQOA 1U3CA 3P0HA 1U0BB 3N8HA 1QU3A 1MC1A 1U3DA 1Q15A 2AG6A 2X1LA 3SP1A 2OV4A 3SYTA 1U7DA 2E89A 1H1TA 4Q16A 1FFYA 1NUUA 1K4KA 4OJMX 1H3NA 3G59A 3IH5A 3H9BA 2QUJA 1R6UA 4HPWA 4JFAA 4U63A 4DE5A 4CQNA 1MBZA 3HMQA 2J08A 4KR9A 1PFUA 3A2KA 1M8FA 4MUJA 1G59A 1N2HA 4G6ZA 3FNRA 4NAUA 2AZXA 1NUTA 1WKBA 1F7VA 2JA2A 1IQUA 2CV1A 4EG8A 1YUNA 5FNZA 4R2LA 3RFFA 4MUKA 2G36A 1QNFA 1EFVA 1N2OA 3FG9A 1K97A 4F3RA 1JMVA 2JANA 1T6YA 2PG3A 3GLVA 1VL2A 4MVXA 2J4DA 1N77A 1U7XA 4JXXA 4P2BA 3P0JA 3JXEA 1O5TA 2ZUFA 2RD2A 1WXGA 1VBKA 1F7UA 1WY5A 1QTQA 2A1UA 4UZFA 2RE8A 5J59A 2O5RA 1B6TA 4MW6A 1ZH0A 1OD6A 2HMAA 3COVA 1JIIA 1WJGA 5H7XA 4MUIA 4OUDA 4ND7A 3K9WA 3N05A 3PRHA 4ZT4A 2QJOA 3LE8A 3H05A 2PIDA 4E1AA 5J58A 1EUYA 2HGZA 1TYAE 2D54A 1O95C 3VGJA 2R5WA 4A91A 3G5AA 1OWMA 2GKSA 5DEOA 3S3TA 1ILEA 3DO8A 4L2IB 1ZH6A 3U1VA 1N78A 4HJRA 2NZ2A 1I2DA 4EG1A 2A84A 1DNPA 1QJCA 1WXHA 1YIAA 5LFAA 2CYCA 2PZ8A 1KAMA 2QUKA 1KP2A 3F3MA 3CR8A 3AIIA 4MW9A 1GTSA 1JECA 1M8KA 1JIJA 1IQ0A 1CT9A 1KH1A 4I6EA 3COWA 1OWNA 1R6TA 2PZBA 2QTRA 2YWCA 1WXFA 3D6UA 5TGTA 1I6LA 1KP3A 1YULA 3X1JA 5HUHA 4MW5A 3FHJA 4MULA 3IMCA 3TQIA 2O8VA 4R2MA 1R6XA 2IP1A 1QU2A 4K03A 3VU8A 3TZLA 1JZQA 2X0KA 5TS2A 4MUEA 3ZJUA 3VRHA 3HV0A 3CVUA 1O6BA 5DK4A 4MLPA 4XSVA 1I6MA 4PBRA 4EGAA 3ZIUA 5LLTA 3CVWA 4EG6A 3HGMA 3RHSA 2GM3A 3RBAA 2DEUA 4PBSA 1O95D 3C8ZA 3PNYA
chains in the Genus database with same CATH superfamily
3ONEA 4XWWA 3AS4A 2ZRKA 4Q3DA 4YA6A 2PV0A 1OZHA 3KEOA 4DPMA 2KM4A 2H54A 3NPMA 1NLMA 2AZ4A 1G3QA 2RC5A 3QWHA 3IAEA 1MTOA 2QX4A 2MR6A 4O4IF 3C3YA 3K31A 4G8KA 3WZ2A 1XT6A 4G67A 4CPDA 5LQNA 4H7FA 3FFBA 1YR7A 3OPYA 1JPUA 4POAA 4G1CA 2J5RA 3RV4A 1XQ6A 3LCRA 5B30A 3DWLG 1BX1A 1DXYA 1UANA 2I6SA 2OZLB 3OTWA 4KVAA 4EL5A 2QVCA 2Y4UA 4KR0A 1ZR4A 3U0VA 4CL3A 1QAQA 3G9QA 4TQ9A 1XHEA 4K5QA 3DKRA 3M1YA 2CJFA 3O3OB 4EZIA 1O2DA 3ETJA 3K92A 2IUUA 1QF6A 4TTAA 3EAFA 3EVNA 1MC8A 1DC8A 1Z5UA 2PLAA 2FCRA 4O25A 3VV2A 3QE9Y 1WQ3A 1B41A 1MEEA 2DG2A 4OVVA 3CNEA 2QVGA 4WMLA 3K9FC 2ZYWX 1E64A 3MLBA 4DJAA 2AI2A 4QHYA 1OZ0A 2ZYDA 2CSXA 2C7BA 1L7EA 1X1BA 4EZEA 3E30A 3MZLB 1VTKA 2RJOA 3GCWA 3N2YA 2X6KA 4XCXA 3ZBQA 1Q3TA 4TL6A 3ND7A 3Q8XB 5FI5A 2PZIA 3AUKA 4Y6CA 4UPEA 1ULZA 1W4AA 2HQRA 3S0JA 4CCYA 2O57A 5IAAA 1HLPA 2E18A 1YI0A 2Q6TA 2QY9A 3JAWA 2FSUA 2OORC 1KZ4A 5FYDA 1M2OA 3H4IA 4MYCA 3TSWA 1IY1A 2VT6A 3HJHA 4NBLA 5EHZA 1GAEO 5FUXA 4U0JA 4BZPA 1VDMA 3MCWA 1TM7E 2JF0A 3O2JA 5E6UA 2TMYA 1JYFA 1XRRA 4UPVA 1KTIA 3RIGA 5JO0A 1X8JA 3DDWA 3C2QA 3B7UX 4Q6BA 3R3JA 1Z4LA 2F1KA 2QSZA 3S28A 3TR0A 3CQGB 1DX9A 4ME2A 1FSGA 4DDVA 1H19A 1N4DA 1JFLA 1VJGA 5K3FB 3UFXA 5J47A 2FMTA 5B1SA 4DLQA 1VQ1A 1OW3B 3NTUA 4ZT5A 1ZVMA 2P1ZA 4MUNA 3AKZA 3DVLA 2HU2A 2WYHA 5IFKA 1FVHA 2W37A 1FQKA 4RXTA 3RARA 3TW8B 4TKUA 4DWJA 5U9CA 2OQRA 2YMLA 4WN9A 3GMDA 4B48A 4JYZA 2PUDA 1WTCA 2JFGA 5CM8B 1U8ZA 1KPHA 4IILA 3WGMA 4E33A 1A8UA 2VWGA 1HFAA 2BISA 4FINA 1UQUA 3HCDA 4FONA 3OU7A 2IYUA 3TH5A 5B1BE 4M8NE 4R7LA 1TT5B 2QRMA 1SXGA 2QLTA 1Z8DA 5KOHB 3K0SA 2KW5A 2GLTA 3H9GA 3UGTA 2QUIA 2X2FA 4KQ6A 4R3UC 4ZOCA 1KYYA 4YP7A 5JI3E 3BD6A 3OSZA 1RYMA 3GHHA 4ENRA 5DP1A 2VTBA 1II8B 3PRYA 4JI1B 4DEXA 4E7PA 2NPOA 2XXJA 1P75A 1L4KA 5A5FA 2A1TR 1QTIA 4A8JA 3VPHA 1NG1A 3LVBA 1TMOA 3GBPA 4F97A 5KAPA 2M32A 1O1SA 4UQOA 3NBKA 5KYXA 4QD3A 1X5BA 3SBOA 1F8UA 2BZ1A 3WG9A 2YZNA 5H02A 2A5UA 1SVWA 3I3SR 2R9VA 3QWAA 4U9HS 5LZ2A 3SMQA 3SJZA 4S35A 3VTAA 1P2FA 1HU3A 1JLKA 1YI8A 2TECE 2Q3DA 1VRWA 4KXVA 3SPXA 2CL0X 1SBYA 2FSHA 1U2DC 2Y76A 4XM0A 4JI2B 4RVGA 3V5NA 1F0YA 1U6IA 1WQ4A 1FLVA 4ARSA 3EEFA 1CUEA 1RKVA 4MR7A 3P45A 1DO0A 4OXKA 3WYDA 1FJGB 1JR3D 3D8RA 2VAPA 3KSQA 1F8GA 4EF5A 3BX1A 1DS6A 1IXVA 2WXQA 3FTWA 3AFHA 4C22A 1OJLA 4NAHA 3ASVA 4KB5A 4GKVA 3WL8A 3T5MA 2IF2A 4K6HA 1O6FA 2QP9X 5LL6P 1NBIA 3KKKA 4LJ7A 2E4XA 3AJAA 3ZQKA 4CU5A 1P4JA 1KAQA 1W9MA 1OXSC 1A82A 1FT1A 1XZQA 2J87A 4J29A 2BHSA 4WXEA 3PNOA 5LCWC 1VA5A 2IPXA 1H6BA 1XJQA 2OZEA 4PSVA 4GGMX 2FZLA 3FGOA 5C5IA 1TZ2A 1G8AA 1YQTA 4WZBA 1GYQA 3B7SA 1F3OA 1S8OA 5AARA 1M34B 4NDNE 1XWIA 2ZDQA 2C0QA 4FT4A 1B0PA 1E0SA 4HN9A 3LJ3A 3KZCA 1E69A 4ZQHA 2HK7A 3Q73A 1Q7CA 3FHTA 3EW7A 3P2EA 1RI3A 2QVXX 4C7KA 5B7PA 2BKVA 1YZ3A 2P4UA 2P67A 1DCEA 3LG2A 1M1YB 1JILA 1ZMRA 4KEAA 4L6CA 1O4WA 1SZAA 3QE4A 3LDFA 3Q5EA 3QSGA 4I14A 3GVPA 1L5HA 3SKYA 5JANA 2FWNA 2C82A 1OBCA 1Z5SC 2FVYA 5AKLA 5GP1A 2VZLA 1ZB1A 4EFDA 3VKWA 4E22A 2OV3A 3WGYA 2ACVA 3M3PA 2WM9A 3H9CA 5DTRA 3U4GA 1JLLB 3MJEA 2PZJA 1G21E 2I80A 2HA5A 4U2CA 1RLOA 5DLQC 4BWRA 1K86A 2J9XB 2GZ3A 5AYVA 5BN5A 4K7JA 1TUIA 2HSEA 2C3OA 2P3OA 3PL5A 2YFHA 4M8LA 5GWXA 1ZJWA 3IDAA 4X00A 2CXNA 2IL1A 3KEGA 2V8OA 5I48A 4TTSA 1OSNA 1UF9A 2ACEA 3JRNA 1Q17A 3LFHA 3W2EA 1ZUNB 4RMNA 1O9GA 1QM5A 1GCIA 4QKQA 5AVYA 1OB5A 2VUIB 2NZUG 3ENWA 3ZU5A 3ZQ6A 4DCMA 5IWAB 1M3SA 2ATIA 1C2YA 1HDRA 2ZVQX 3AJDA 4AUEA 4DW8A 4EBAA 3C3AA 1Y7LA 1MB9A 3O38A 4FVTA 2XVYA 2IYXA 4DLYA 3PDIA 2YV5A 1JDPA 3H1TA 5EXSA 2Q3LA 1PZFA 1FFXB 4CN9A 4QFVA 3UPUA 4WV3A 4JBGA 3TZ6A 4KYUA 5B4TA 2H4ZA 1IAVA 2NYAA 1II8A 3NHKA 2VHCA 1XZCA 1DV1A 2H65A 4NCHA 2OFFA 3PNVA 4WNYA 2O8BA 3BICA 4RTNA 2JVJA 3N7TA 5K99A 1H0HA 1N36B 2VG8A 2B8TA 4JWKA 4HHEA 3RHTA 3STTA 3RK4A 2VQFB 2I29A 2IYTA 4XQCA 1FDUA 3GC6A 4YV2A 1K7YA 3KV3O 2CXRA 3B9RA 2HRBA 4FHCA 4N40A 2HLPA 5HS4A 4U3JB 4ZJUA 3GDWA 1BFUA 1XJ0A 5LA6A 2R97A 3VC1A 1CY7A 1BEEA 2UV8A 3ZWVA 4BMYA 1P6QA 4MW0A 3TZHA 5KNCH 4R9SA 3TTUA 1K1AA 3R9KA 2CMGA 2ERYA 2J45A 3TUIC 4Q4LA 3C98A 1O6ZA 4G1UC 4MWBA 2FRDA 3EBPA 2IU1A 2ZAIA 3QLVA 1A2QA 4JYBA 2CJPA 4I3GA 4E13A 1JUDA 2XCRB 2XYHA 2ODTX 2HJRA 3IQZA 4FB5A 1UFQA 3RQIA 1G3MA 4C48B 4OA5A 1G8KA 5ILOA 1N57A 3D8TA 2FW6A 4D4HA 4A10A 3HC7A 3MKRA 3IP5A 3UXEA 1DADA 1WLYA 2Q9BA 4YP6A 1RWMA 1O0CA 1KBQA 2Q5JA 3EZLA 2QW1A 3IUNA 1V71A 2D0DA 3FBTA 3L05A 2O2CA 3KJZA 5ELLA 1O8CA 2OP1A 1FOEB 4OGLA 2Y69E 2ZRNA 3QV2A 1HMYA 1KJWA 2ZWPA 4AMZA 4DRXB 2UYOA 1TIBA 1VMIA 4GYJA 2X5OA 2P9EA 2QL7A 4GTMA 1FNNA 4L5YA 4ZQCB 5AVOA 3ZDCA 1L8XA 4ZEOA 4A9AA 3K94A 4CLOA 2NTJA 5ALWA 5FL7D 5H16A 2J3QA 4HCJA 4P4SA 3U6KA 1UP4A 2D5LA 2QPTA 1WW3A 1JHYA 1Z82A 1ZUIA 3N2LA 4MQEA 3KYBA 1IXZA 3JATB 5EYPA 1Y42X 2FBNA 3BD8A 5TQ2A 3PVZA 3CZ5A 4QBIA 4FADA 3C6XA 4V0MA 3ZTTA 4DR7B 2IY9A 1H0AA 3OTNA 4GA0A 1PYDA 3KAPA 3RBVA 4NZPA 3L2OB 3IMGA 1G20B 4N49A 3L9WA 1D8DA 4DNXA 3U9WA 4EAQA 5ICMA 2P2GA 3KZNA 2Z09A 2WI8A 3QXJA 1YVDA 4RO0A 1DO2A 3JALB 4YCSA 2AWNA 1LW6E 3RYCB 4QDOA 5DW0A 3DAGA 1VLHA 2BFBA 1DJMA 1ZLYA 5KTKA 3WLLA 1L4LA 4I0WB 1DIBA 1UBUS 2PX4A 5IBPA 1JHRA 4JI6B 3WGHA 3WIDA 2NZVG 2PUJA 3RH0A 1I01A 1SQ5A 2J5BA 1T25A 2HHCA 2WLTA 2Z8YA 3MINA 3FH5A 3UX4A 4RC9A 4B4OA 5K0FA 1EG2A 3PVLA 1L8QA 4JXKA 3AR5A 3H11A 1H2HA 1OPXA 4FFOA 4R01A 5A05A 1L5GB 3UY4A 3FNIA 3CRZA 1GGNA 1TAQA 1UPBA 5H3CA 5I7WA 5DGHA 3ZHSA 1WNTA 2PGIA 4AZVA 5A3VA 2HHHB 1S4QA 3WJ1A 3W9FA 1U8CB 2C3YA 2QM0A 3HUUA 3VO2A 4URKA 4R51A 2NADA 5E0KB 1IQRA 1V39A 1E90A 3GJ6A 1KFKB 1Y4SA 3OQ1A 4M9UA 2HHLA 4ZARA 5EGSA 1UPCA 2AZDA 3D3JA 3EHRA 2IYOA 3GGCA 3HYCA 4FHDA 3TNFA 3IV0A 3ZZTA 2AXZA 4UNRA 3L0CA 4XAQA 3C5RA 4TXRA 5JYCA 1KYZA 5EMMA 1POXA 3G82C 4CBVA 4CZ2D 4D3ZA 2LPMA 3F74A 5BSGA 1ZM7A 3DNPA 3U4IA 2R8PA 4M2LA 4NOLA 1ZIOA 4Q4CA 4M1EA 4MV0A 4B6QA 4MHSA 4EABA 1U3CA 2AXPA 1DZIA 3S2IA 3T5PA 3ZNGA 1OXVA 2PDAA 4WL0A 1RAGA 2ANBA 4JUBA 3SP1A 2JIPA 2WHYA 3GV0A 3SYTA 1H0KA 5TXGA 1RZVA 3NIGB 3IIIA 3C6KA 1N0RA 2HIHA 3P32A 3H75A 3DBSA 5AJDA 1XDUA 2O3RA 2X9NA 4GVXA 4EHKA 3U44B 3JVIA 4DMUB 3BREA 1RWXA 2B1JA 2IHKA 3ESQA 2X6HA 1MW9X 3AOGA 4QYXA 4ARZA 3FNGA 2CLHB 2P5TB 5F52A 2VNHA 2C03A 4MMYB 5CFLA 4CLEA 2NUPB 1BOFA 1YB2A 5C7YA 3LEWA 4HQFA 3S2SA 3LYUA 4I50F 4KR9A 5A71A 3A2KA 3FAZA 4FLBA 1N92A 1IBCA 2R1UA 4GPD1 2QYOA 1VM6A 4RH0A 3L82B 5J43A 5ADUS 2CB0A 4EPWA 4BVEA 2JA2A 4DR4B 5IBRA 4JLJA 2EFJA 4F3YA 1J2YA 1YMQA 2GKGA 5AK6A 1C0KA 4P33A 2AIRA 1U7TA 2WXJA 5IKEA 4UTVA 1DJNA 5JZOA 4QFCA 1UAGA 5D3ZA 4AJHA 2NU9A 3FHLA 4B76A 2YOHA 3A1DA 5CCXA 3RSEG 2J7KA 5CHEA 1BXZA 2AJTA 2WVHA 5BXOA 2DBYA 1VI6A 2IFTA 3HCNA 5DGDA 5F4BA 3BIJA 3KEAA 4XX5A 3W5CA 4DPKA 2MDTA 3LX8A 4GRAA 4ZVNA 1WXGA 1UK8A 4GC9A 1Q1ZA 1TOAA 1C5KA 1E8ZA 1OZAA 2AMYA 1X15A 2V6MA 3GK3A 3I1IA 3QX9A 2GVDC 4IV8A 4MQUA 1ZD3A 3C6MA 5G04J 2LTAA 3RVRA 3R8FA 4AU1A 2CKMA 2F3SA 4MIKA 1WL8A 4NG4A 4JXJA 2G1AA 2XZOA 3NB2A 4XGKA 2JLCA 5TS3A 1MW8X 4POOA 2Q6VA 1RXCA 1QQBA 3M49A 3RF6A 4LNAA 1S7GA 2QPLA 4RY2A 2F8YA 3CSUA 4MUIA 4BKQA 2IUYA 1BW9A 1NNUA 4ND7A 4K3UA 3AJEA 3VLFA 5A4DA 2XMRA 4YO8A 4YRRA 4C0BA 4D96A 3RLIA 4RS3A 2B25A 1Y5NA 3KSAC 5E4JA 3AJIA 1T9BA 1D6JA 2JNWA 2KC7A 1X0VA 1FDVA 1QO0A 1UBCA 4TKVA 2JARA 2OPHA 3GAAA 3H2HA 2FOIA 3RHZA 3WGTA 2X4GA 4UVEA 5MGNA 4X1KB 4AF7A 2F8SA 1C7QA 3ZHUA 3AXTA 3ZDRA 4NMHA 1R4NB 1SBIA 2WICA 3OT1B 5FPKA 1W49A 4UDYX 1OFIA 1AZWA 1KAMA 1KEEB 2AXUA 1TT5A 1NHGA 5KBYA 2OWEA 3BFJA 3E9QA 5JAMA 3GFRA 5BN4A 3ZHBA 4MZDA 3AF4A 3LLCA 3U80A 4BJ1A 1M8KA 3VTFA 1EU1A 3HKDB 1UQTA 3VDNB 1EESA 2Y1LA 1PEDA 2QN9A 3KXKA 2P6RA 1IJEA 5BW5A 1CT9A 3ZEFA 2BDTA 1WULS 2VUUA 4NCXA 4D99A 3TSYA 4PAOA 4EKYA 1VGRA 2GRPB 3WKDA 2EP8A 2ZJZA 4B85A 3AGQA 3KD7A 4TMYA 1PUXA 4L15A 2Q3JA 3WBJA 2VPPA 4K6FA 1QKKA 4YXWA 4KDFA 1AXEA 3UUFA 1HQKA 2V03A 4HYEA 2OBBA 1JU4A 5EKUA 3NORA 4ZTBA 3VKVA 3W4JA 5I7OA 4DEVA 1NZFA 5KBAA 5KEIA 3L7JA 5GJCA 1M34E 2OHIA 2F64A 2PYDA 4GG1A 3W9UA 2MJLA 4K9SA 2IVFA 3O1HB 1QC5A 2PMDA 4HMQA 3OTOB 2KJQA 1FLDA 2R2GA 1D5WA 1NN5A 4N5DA 5EMNA 4FW9A 5DTQA 3GMTA 4XYEA 3ZX5A 1R6XA 3V4LA 1QRRA 1ZEJA 5ALKA 3TZBA 3VHLB 3L79A 3ZYLA 2PKQP 5TS2A 2HF7A 3A9TA 4IJ6A 1TGYA 2AZMA 4RD3A 4E21A 2HW8A 4EPRA 2BR5A 4DLZA 4AAYA 2PUCA 4H6XA 2IHNA 2QM3A 4H2DA 4HVAA 4K9NA 4FD2A 2X22A 5THQA 4YRQA 2CXQA 1C0LA 1L5OA 3LWDA 1ORHA 2RGNC 3OE5A 4MKZA 1GPBA 3HXEA 2FWMX 2BMFA 3P9ZA 2F3RA 3ZIUA 4EY4A 3UJNA 2ZIWB 3LP6A 2YWGA 4J16A 4Y2GA 2F55A 3SHOA 4N5LA 1NIPA 1O4VA 5FPTA 1XRSB 3P97A 1C1XA 5E76A 4ZZ1A 3GN2A 1GFWA 2VBIA 5FFNA 4GQBA 1EA5A 1RKUA 1KC3A 5KNCD 4QBTA 1FFGA 2FKNA 4MI3A 4AXXA 1MGOA 4DGSA 2HFJA 1PTKA 4Q66C 3N0TA 5JNTA 3PFHA 4GGOA 2OC9A 2FPOA 4NF2A 5C32A 3FUKA 1HO3A 1E1LA 4GB9A 1IBRA 3OBIA 5FOWA 2QTWB 4L8LA 4F71A 3OLVA 4PZUA 2ZSJA 4UU7A 2P4EA 4OREX 5IW8A 1LJ8A 1YR6A 2IV3A 1U7WA 4EO7A 3RC8A 2F1RA 3FU0A 3K6KA 3MUNA 4XEIG 1T2VA 2O8FB 4A8HA 1WOYA 3CHPA 1X7XB 3EAQA 3IPAA 4RPGA 5JE8A 5BUCA 4OB6A 1FT2A 5EP2A 5GGXA 4KE8A 3GH3A 4IYRA 2B5OA 1KI6A 2ZP1A 1Y3FE 2OE2A 2Q5HA 3IA7A 2VPZA 4CM5A 4DHEA 3R0ZA 6REQB 3FIJA 4JBWA 4F60A 3L7DA 1WPRA 2ICAA 3ETHA 2XB8A 3ZGNA 1I3OA 4HX2A 3FSGA 1KYWA 1UFVA 3CX8A 3ANSA 2ZJ4A 4LHZA 1WUKS 2FZVA 3TPCA 4AJ2A 4C7JA 1XJWA 1N2JA 3STVA 2PX8A 5AJWA 4LYDA 5BQOA 5E1OA 2BZGA 2C00A 3K53A 3JVDA 5DHRA 4BKRA 3IESA 3VZSA 1H5QA 5B1DA 4CMHA 4ERNA 3JWIA 3EU5A 2W2KB 1LGYA 2W2OA 3KB6A 1X8KA 4YT4A 1WSDA 2H07A 1D04A 1YRAA 3WMEA 5ARFA 4PG5A 4RGBA 5BRAA 2VDPB 2EFCB 1MEOA 2ZIEA 2LZ0A 3BUSA 3K6RA 5KNCA 3RSLA 3FPKA 5MFPA 4J1SA 1OT5A 1J0EA 1DQYA 3KUKA 1TYEB 3PEVB 5AN8A 2WT8A 3CO0S 3DG9A 1JG3A 1PU2A 3OHPA 4N0EA 2PCLA 1E98A 4ZKEA 5AQ9A 5HQ3A 1G9TA 1QHFA 2OCXA 4M9XA 1G8YA 4PGGA 2GJ8A 4CM3A 3E9YA 3MJHA 3ISJA 4MVJD 4I9UA 3AEQA 1ELOA 2C2YA 3ADPA 3N0VA 5JYBA 3HUDA 1W5TA 1PLKA 2JIBA 3TE6A 2KLBA 4FEEA 4OGGA 1BO6A 3BL8A 3ISVA 3JYNA 3GFSA 4G5YA 5F5XA 1E8WA 2JJ1A 3VNSA 3RJMA 1D6SA 4BV8A 4Q3NA 4WZAE 2ZU6A 4NBNA 4I4TA 1HY3A 3THXA 4HQLA 1Z4IA 5KJCA 4N1AA 3G89A 5EKSA 3HVUA 1T29A 5T4FA 2ZI3A 1XZJA 1A8HA 3DEHA 4LHWA 2H8KA 13PKA 2CLIB 4OSOA 5DI3B 4DMMA 3S1AB 3B7WA 2VYVA 3CLRD 4WD3A 3JY6A 4N3GA 4O63O 4MROA 1Z2DA 1PEKE 2M6LA 4L5BA 2IDMA 3LQRA 2J3LA 1KSFX 2WWIA 3ZY6A 1QVRA 4PNPA 4EEZA 4GZLA 3UICA 3RVLA 2WIAA 4DI4A 4I19A 3NVKI 3D1VA 3X3HA 4HTFA 1RC1A 2GSDA 1KU6A 3UT5B 3OA0A 2KCVA 1G2PA 4GOLD 4IL5A 2XUJA 1SM4A 3QI7A 1DX6A 3DLAA 5HBRA 1KY2A 2NSYA 2QLLA 2GN4A 3QG5A 1SBCA 3GJYA 5ICGA 3D0OA 1QH8B 2A86A 1GJRA 4IVQA 4OF4A 1T8YA 1C3JA 2A5JA 3FIUA 2HMSA 3PWSA 3VVMA 1EFVB 2CT8A 3GJZA 4QDXA 4J2TA 1TJPB 4WY2A 1C8KA 2N0SA 2AFVA 1P61B 3C6YA 5LCWJ 2WSIA 1PL0A 5EYPB 1GPMA 1B2LA 4WA7A 1MC4A 2XQKA 3L7OA 2Q28A 1IHYA 1SVOA 5AJUA 5ALSA 3VSDA 4F3TA 5IMSA 3L1HA 3RJZA 3JZFA 2QJWA 2J3KA 4RD2A 4I5EA 1G2OA 3V7FA 1YR3A 4GX0A 4Y6QA 1K3TA 1P2UA 4L4SA 4L74A 1NJFA 4JT2A 4ZI7B 4BZWA 2XD4A 3SJ7A 3CIAA 2B94A 3OTQA 2WM8A 2AG8A 4OGFA 2DFTA 3LPCA 3IQIX 2WC1A 3JQ7B 2JHGA 3FHOA 4D6YA 1YB4A 5CCLA 4XJXA 2QRZA 3LHKA 2B9VA 1V8FA 2PSHA 1FSZA 4P5DA 2QBYB 4FYIA 1I4OA 1NVUQ 3MINB 4WNAA 1IHUA 1MV5A 3HYTA 4HQKA 1L3IA 1FP7A 3OCCA 4M98A 4QQRA 4C4ZA 5FWNA 2HT1A 5E9WA 1U3TA 5G3YA 5B3JA 5BYKA 2JGKA 1YZNA 2ZUUA 2LXNA 3PGA1 2ZTLA 3OFSA 2XEHA 4O5OA 3GLFE 5K8LA 4CKCB 2XSZD 3S4YA 2I1QA 1AM4D 2ZRMA 1GW6A 3QPAA 1YCFA 4RVNA 2EGGA 1KMNA 3G1TA 4K9OA 5AP9A 4G5QA 3KQLA 1HYQA 1H2XA 2HPHA 3M4NA 2QYSA 1NFQA 3HNPA 3N8IA 4JJKA 3U26A 4AJPA 3FMGA 4S24A 3LXXA 2D8AA 2CSUA 3MGKA 2NUTA 4DREA 2Y99A 4MW4A 5CX4A 4NACA 3GGPA 2PD3A 4ALIA 4TQAA 4YAOA 5I5GA 3FFAA 4Q9DA 1DELA 1QOZA 2WIDA 5KSOA 3IKMB 4XH9B 4MTCA 3JU3A 3RKUA 1Z2NX 1Z5VA 3MK31 4IDCA 1IK6A 2R0QC 2ZOSA 3Q9UA 3A05A 2NXWA 2FO1E 3A10A 1EQAA 2IE8A 3NC1C 2AF3C 3QITA 5TQJA 4C20A 2ZPTX 2XZPA 3KZXA 3QLTA 4XPZA 2Q4TA 3GLGA 3U44A 3ENEA 1GZ3A 2ASEA 3HVKA 2W6ZA 1HQYE 3AVVA 1C7EA 1VFNA 4DDTA 1H1LA 3T3MB 5K0ZA 3TZCA 1RBQA 2GNAA 5CJ2A 5H82A 1C7ZA 2OAEA 3WKAA 3HXLA 1ABEA 2J48A 4QJIA 1BRTA 5TJHA 3HY4A 3CYFA 3PJEA 4U7TB 3DZKA 2ZS7A 4MWEA 2L6JA 3TB6A 1LUAA 2OCGA 3I34X 4M0LA 4F9TA 3T94A 3HSYA 1JS1X 4RU1A 1E62A 1RLUA 1UXOA 3VNUA 2GEBA 1VMEA 2WINI 3FJ1A 4NBTA 1ESDA 4QJ5A 1V8PA 5KYGA 5HS6A 1RRCA 4OXQA 1XTIA 3C5HA 4DA8A 1GL9B 2AXQA 2QTHA 1HE4A 1RW2A 2WG1A 1UZNA 3K9HA 5CCEA 2XECA 4F21A 2R8XA 3RYHA 3LSYA 2J41A 4RVDA 2IPLA 1XFAA 1H2TC 2YVAA 4BX2A 1PK9A 5BQ3A 6LDHA 1B76A 3E82A 3A6GA 4DV3B 1LNSA 1PG5A 3KKZA 4I3HA 3E0XA 1Y81A 2CLDX 4M1OA 4RPKA 2CFOA 2BKEA 2DBRA 4F93B 3TQSA 2O8CB 4FFPA 3TRKA 4TM8A 3W5IA 4HDRB 2K7FA 4WH0A 1G7TA 4B6OA 3LXUX 1VPTA 4FFRA 3AR6A 4JV5B 2VBFA 1T0JB 3D3NA 4BE7B 3OA2A 2ADFA 1IVYA 1CB7A 3R0XA 4BWGA 4UE6A 3WWDA 5J4KA 1SB8A 5HIKA 3VPGA 5LU9A 1M6WA 4OYLA 5CVEA 1DRUA 3SBSA 3NGLA 4UHHA 4GKJB 1R0LA 3WAJA 4QIHA 4R1LA 3EULA 4H31A 2HM8A 4F2WA 1GA4A 1TZJA 3B52X 4IEIA 4X7BA 1HG2A 3H2KA 3H2YA 5G05J 3KD2A 3KB8A 4JQZA 4RKEA 4LTNA 1IHPA 2I3BA 4QXRA 4RVCA 4YK7A 1NFFA 3TKYA 3WSTA 2W2MA 2VRCA 3ZCSA 1Q19A 2AR9A 4KU4A 721PA 4BL5A 1R00A 4IVPA 3LZCA 2PUTA 2ZGGA 3ERCA 1ELRA 2JAQA 5ENRD 1Z6GA 3W3AA 1BEUB 1DLJA 3UIEA 3M34A 1JJIA 4CFSA 1FB5A 3P9YA 5INTA 5CMLA 3BK7A 4A92A 1L6IA 4AXBA 4GR9A 2UZ1B 4MB0A 2HDHA 1X74A 2PH7A 4G4IA 4JB2A 5GVRA 1N7IA 1EYZA 1MAWA 4L8GA 1T5TA 4W1RA 3W04A 4C0WA 4EBFA 2ZVPX 4QRIA 3UIOC 3P9XA 2PKYX 2YV1A 3DLIA 4TXHA 4B4UA 1SIUA 2GOYA 4KFUA 1VLJA 2HUPA 4APFA 4C78A 2NC9A 2R60A 2B83A 3EEYA 3IILA 2EKBA 3IPLA 5CW2A 2L2QA 4RK7A 2IV7A 3RAUA 1PF7E 1XP8A 2ZJ0A 1ULBA 3EXFB 3IB3A 3HR4A 4FMCF 4L07A 3RTAA 3CLKA 4XSGA 2ZGDA 2HX1A 3KKQA 1BCSB 1BHSA 5EMKA 5IF9A 1KRHA 3EQ8A 2NO5A 1MX4A 5KNGA 1JGTA 3A4MA 2WD7B 3OQIB 1U2ZA 4G4GA 4JYPA 4MWTA 4NIMA 2XY4A 3F2IA 3BGSA 3QPDA 5JAQA 3G0OA 2WG2A 3AVOA 2X3UA 3MHTA 3VKHA 2WP8J 1C1HA 3ROPA 2BUGA 4R8MA 3OJEA 3N8DA 1HSZA 4PZ0A 4E1VA 3X1KA 3BSSA 4FDVA 2XQ0A 1R9MA 4FD3A 4FHZA 5HFAA 5EKTA 4ZHQA 4YQEA 1BS1A 3HXOA 2VN8A 1CHDA 2BTOA 2ZGVA 5EJ2A 2ZANA 3C1OA 4P31A 5G0WA 1YFJA 3MYVA 1SU8A 1U9CA 4D0RA 4WBNF 5AUNB 5F23A 3EPJA 3DGEC 1AHHA 3EEOA 3GLTA 4UQYA 4OLFA 4IIHA 1J8MF 4ZEXA 4W1QA 2PWYA 3ASDA 1EJ0A 4MUBA 3B7TA 3BMCA 4D9CA 3QVGB 5BMVB 3C8HA 3QARA 1I4LD 4LPSA 3KX2A 3K4PA 2BUAA 3GFTA 1JKJA 3EB9A 3TEFA 5AM4A 2X1LA 4B80A 5C8DA 1E79A 2FW8A 2GHTA 3IURA 1FX0B 3LRXA 3MB5A 4Y0VA 2CWWA 1Q2UA 2XMZA 1VI5A 1ZU4A 1FFXA 3FTPA 1H1TA 3PUIA 4J8PA 4L72A 4Q16A 3SDZA 3H1AA 2WTEA 4QUEA 2PKWA 1G8SA 8ADHA 4ANWA 2CL7X 2WIFA 3HDYA 5HKPA 2LUHA 3C6ZA 1HYGA 2OGTA 4RIEA 4YP9A 4A1GA 1T2AA 3G1UA 3HU3A 3SOZA 3Q87B 4EPVA 1FMFA 1FDSA 1UMCA 2W58A 5AVSA 2BKAA 3RC7A 3CPJB 1M2KA 2J6CA 1GFZA 3L4BA 4JQOA 5FF9A 3NBMA 1F1JA 2VYQA 4LMRA 3WXBA 4U3JA 5CFPA 3ZVKA 1PSDA 3K0BA 4MGEA 4F3NA 2B8NA 1N2HA 3S2ZA 3KL2A 4U7EB 4EAAA 3SYRA 1T26A 3DV0A 3H2ZA 2AG1A 3H4TA 4JVOA 4ZO9A 3DGFC 4RETA 1Y1LA 3FTUA 4Z0PA 3OXFA 4R2LA 3PZ2A 1E6MA 2CD9A 3JPWA 2B0OE 2BDEA 1TUGA 1HM5A 1ETHA 1S02A 1U28A 2AUTA 2FN7A 2P9JA 3OKFA 1K97A 1OI3A 3QWPA 4LQDA 5LVAA 4F1WA 4ZGGA 3F73A 1IUOA 2XB6A 3ZWOA 2ABWA 3KE8A 3Q8LA 3BULA 3PDCA 4O2AB 4D0GA 5I8WA 4LF8B 3BB1A 3ODGA 3C5EA 4YQFA 3OHSX 5AVKA 1MO3A 2YJNA 4UEJA 4RZ2A 4Z3DA 4M9QA 4PC6A 4AECA 5HQTA 2O2HA 4AO7A 4CMEC 1EVLA 2VRWA 3AC0A 4EB8A 1CR6A 3B6MA 3T4EA 4J9VA 4V0QA 2M6KA 4RANA 1I5RA 1QH9A 1SC9A 3H83A 5ALMA 3PRJA 5EIXA 2FUG6 1Z17A 5ALIA 5CR9A 4JLPA 2D4HA 3W2GA 2G4VA 1ZH0A 3M9LA 2XKKA 5E7JA 3EHNA 3WWOA 4RJKA 2Y1KA 1JIIA 5HIAA 1TZBA 1VXRA 1Y5MA 1DHRA 2FRVA 1U28C 3I92A 1KF0A 4LMAA 4R2KA 3K9WA 4Q3BA 2GRMA 1ONBA 2AJ8A 2Q3BA 5J2TF 3HACA 3SZLA 1I13A 5A62A 4XM1A 3JXIA 1EDUA 3I8OA 4B8YA 2XKJE 5EIBE 2XEEA 4G9GA 3DPYA 1L4BA 4ZEMA 3IXLA 5L95A 1J9EA 2EDAA 5M34A 4DRXE 3RU2A 3COSA 3G2SA 4I5FA 4P5EA 1SCAA 2XNDA 3NX4A 1UFRA 2L19A 3TD6A 4A0FA 2HJGA 5JVDB 1A7UA 2HPVA 4LDZA 4O1IA 4ZTUB 1YTLA 1RXWA 5CLHA 1GL3A 2BW0A 3F3SA 2A3NA 3HDTA 2PM6A 1QYWA 3GRCA 3QX7A 4EZKA 2ZCVA 2IYLD 4FMDB 2WU3A 4NVRA 5JQWA 1WXHA 4W8HA 5LP1A 1PVOA 4TTTS 1EP9A 3JQDA 3CSDA 2OLKA 1T5OA 2P2CA 2Q3FA 4KBYA 1P1KA 4YASA 5DGTA 3VBEA 4AYTA 4DIMA 4AQYB 1PNRA 3R3SA 3CVPA 2XMBA 4LSZA 1V35A 4MV5A 4A6PA 1HFEL 3TXAA 4N5NA 4O4HA 2DCUA 3VH4A 3N2NA 3OLWA 4LF9B 2IO2C 1F06A 3AF2A 5CU7A 3JWJA 1QH1A 1RAEA 3A70A 4DG5A 2O8DB 4BB6A 1OWNA 2O54A 2WHPA 1T8SA 3C3CA 3FPAA 3VH2A 5F9HA 2CMKA 5J90A 1Z2OX 2DVMA 3ZTWA 4M0FA 2YIJA 3D6UA 1LWOA 4H7HA 3CK8A 2O7VA 1LNQA 1KYXA 3NTXA 3D9MA 3B3GA 2C0PA 1DHTA 1YGYA 3C3XA 1BXRA 3PGLA 3RS2A 3FM9A 3FFXA 3CW9A 4AJWA 1YCSB 3GCZA 3I73A 5E0OA 3UJAA 3IAAA 3BWVA 4X3PA 4U00A 3PTAA 2P9SG 1B6RA 2R86A 3TQIA 1Y8AA 3ER9A 1WCWA 1GZDA 2JS7A 4HYTA 1T4BA 3FWZA 4XWTA 1JZQA 1Q0ZA 1NFRA 1RWBA 5BQ5A 3RUCA 1AVTA 4P0QB 1UK7A 3DFMA 2W93A 1G17A 4TTRA 3L8DA 1EUCB 5HF5A 1SOVA 4KH0A 5JSHA 3FPHA 1NXWA 1QXSA 4UJ5A 1X14A 1I6MA 2IYFA 1E2LA 4EQ6B 1J0BA 4QWWA 1Q0PA 2YJ3A 3IS3A 3QJZA 3U7GA 1BKDR 3Q7AA 4XX0B 5TMPA 1V16A 2GK4A 1CQJB 2H51A 3LUFA 5D1HA 1Y34E 5HE8A 4B81A 2UY1A 1XYVA 3FF1A 1YV9A 3P0EA 3T3EA 1HA3A 4OMDA 3M6WA 3OM8A 3JV7A 3AHCA 3KJIA 3T9FA 1FBNA 5M29A 2VC2B 1LF5A 4DLOA 1OX4B 4QUIA 4ARIA 1AT1A 4GLFA 2GM5A 2ID7A 3SEQA 4BAZA 4PPGA 3HG7A 4QJ3A 1O95A 3LQFA 4ABTA 1NW9B 3QA3E 3FUXA 1TVKB 2VXYA 4JGIA 10MHA 1C4OA 3REQA 1XIVA 2DYRE 3THSA 1UH5A 3RIEA 5A4FS 2P1DA 3KFLA 2Q3MA 3F7NA 1HORA 3DUWA 4EO9A 2JKZA 4M8SA 1YL7A 2I6GA 3OLCX 4G41A 1ZHOA 1BGVA 3FOWA 5HCUA 5EXPA 3VR2A 3ZHXA 2Y66A 1ZUHA 3KLPX 3WS7A 3D4PA 5HSGA 4ITUA 4FOSA 4IH9A 4LRYA 4UHJA 2DUMA 121PA 1NV9A 3R9WA 1CZHA 1GRVA 3AHHA 1XX6A 5KB3A 1ACJA 1CEQA 4FEYA 3AB7A 1P33A 1T6XA 2YJGA 1N6OA 2OPBA 1CR2A 3CF0A 3NTLA 2OCCE 3JD1A 2XJ4A 4P0TA 1R10A 4CWAA 5C1BA 4K8OA 2V3CC 2V9CA 4ZMSA 4PXSA 4B6SA 2O5EA 3BYZA 4R0VA 1ZI9A 3QC1A 1PT8A 1U0TA 4I2ZA 1QIMA 3AUUA 4A3VA 4AIFA 4RA9B 5EUCA 4I1OA 4JI8B 1F4VA 4LQCA 3ZY5A 3O3CA 4KGVA 1LCIA 3ULYA 3C5VA 5L3SA 1UP7A 3ASZA 4KN9S 3O1LA 3UVEA 5A7FA 1OTXA 4HGNA 4NJEB 4EGJA 1MA0A 1ZN9A 2FF7A 1XK6A 421PA 4Q19A 3ZWBA 1ZXLA 4UFPA 1WIWA 2CVOA 3CHQA 2V9ZA 5JDCC 3MXTA 4M49A 3HDHA 2OHHA 5EKXA 3V4OA 4Q3KA 3VU9A 2D8MA 1HE3A 2ARKA 2IF0A 3GJ4A 3CLSD 2J5QA 3WYNA 2JLXA 2RGUA 2GZSA 1QVWA 2Q6KA 1LBQA 4JYMA 4Q4HA 4ZT3A 5JJCA 5ENOD 2CHUA 2M63A 4AK9A 1PFQA 5BR4A 5LP6F 4F06A 3MIIA 1USUA 5E7IA 2VDUE 1OFUX 1M5UA 2BUCA 1E2JA 1HTBA 2GCOA 1ISJA 3HVJA 2MIIA 3PPYA 4G1TA 3CV3A 4F6LA 1Z34A 4MR9B 1RXEA 4LZJA 1RWPA 2FX5A 3GF4A 4YT2A 5JDIC 4HZIA 4N7BA 1U90A 5T3YA 3ZE0B 5BWLA 5CFRA 1IZYA 2ZSDA 5B3SE 2QAGA 3D81A 4XIIA 1E7SA 4X66B 2AOVA 1LFDB 2C9OA 4D79A 2C7GA 1WBDA 4WN3A 1OOEA 3RYIB 2AZTA 3UW3A 2BT4A 3FZGA 3E03A 2B1RA 1C0EA 2DSNA 1GDDA 2GGFA 1CQIA 2B4YA 2R3SA 3ZCPA 1OASA 4YIHA 4G2TA 1NUSA 1XF1A 5DTMA 3Q7RA 4G24A 1SCDA 4AJKA 4DAEA 1P0IA 5AM1A 4CMAA 5ANRB 4PLTA 3OWOA 3G8YA 5ARGA 1WUIS 4QPZA 2FGJA 4E08A 3HKCA 4Q48A 4YR7A 3O91A 4N18A 4KIJA 4D8TA 2RH4A 1V7QA 1NC1A 2IHZA 3BTUA 4GAAA 4N9QA 1E3EA 2WXKA 2ZJ7A 4PO8A 4N0MA 1Q74A 1C3OB 1SURA 2GZ1A 3I0MA 4ND6A 3DHVA 4ZPXA 3TIGA 5A1JA 3P19A 4XB2A 2FX3A 3IX7A 4XUCA 4I1IA 4PQFA 5P8WA 4N39A 4BFYA 2D0OB 3PPWA 5D0QD 1T4CB 2XOKA 4PONA 3KOUA 1T3GA 3MCTA 3ROQA 1SKMA 4KOAA 2G63A 2PK3A 2CDRA 3DEFA 4MWGA 3DWEX 1TJYA 3APDA 1C9EA 2HTEA 4L50A 2SKEA 3DSXA 2BBOA 5BSMA 3MMSA 4JB8A 1C1XB 1R9JA 1GAQA 4II7A 3A3PA 1D2GA 1F5SA 1R3UA 2AMVA 4JQYA 5BMVF 5CEJA 4BEVA 1RXVA 1Y4ZA 2NQ8A 2MU1A 1TB4A 3AL3A 4IDHA 4OUDB 4KVFA 1NJ8A 3CKLA 3VHXA 3GLRA 4BMCA 5BPHA 4C0AC 3EOBI 5JD4A 4WBNB 3F6YA 3L41A 5L6MB 3LF2A 5BORA 1F2DA 1ZK2A 3SC6A 2XTAA 1ML3A 1UWLA 4DLRA 2IITA 4WKGA 4P4LA 4B2PA 4TUUA 4L9AA 5AVTA 4PS7A 4P84A 4P8RA 5FWAA 3SR3A 3WL7A 3GJRA 4DJTA 1KK2A 5C81A 2AI1A 1KDYA 4D0NA 3CSTA 3E35A 4INAA 3NZSA 3OT5A 3T41A 3AYXB 3EH1A 3EOAI 3H16A 3CUYA 5T4BA 3TLBA 1KI6B 4Q9LA 2WNHA 1HNNA 4LKRA 4DCUA 5BWBA 2AUNA 2D1RA 2VDMB 2ZI4A 3BH0A 4OJQA 4RZSA 4TRNA 4C4SA 4WTOA 5JS7A 1KJNA 4M0PA 4P3PA 1WU8A 1AA6A 4AN1A 3EIFA 2P9IG 3NHFA 3N2KA 2J0SA 1NMQA 4YI3A 3HEAA 2VPYA 5DOZA 5DYIA 1S64A 4EP1A 3NJ4A 4DL9A 3BXGA 5BSTA 1UC5B 3A9VA 3O82A 4MUFA 4ESEA 4K5AB 3W9YA 1Q0SA 3JQ1A 5K8UA 3KD3A 4JVSB 3U81A 2YHSA 2HADA 3IT1A 4S12A 3EQ7A 2W11A 4RKRA 4YJGA 3SJCA 2G5TA 4A2PA 5AVUA 3NONA 4CEIA 1FX0A 2D6FA 4Y1RB 4XDYA 1SG0A 3MILA 1DBIA 3UGQA 5K0SA 2XVMA 3S68A 4EPYA 1A7AA 5CT8A 3L5OA 3SVLA 1T24A 3ABLE 4ZANA 1I5EA 2FV8A 1GSHA 3LLSA 4KQHA 3V46A 4B47A 2H5LA 4DKJA 1YJ5A 1IEWA 2AFIB 2OV8A 3V4FA 4OHWA 1CIPA 1OAAA 3GCGA 5DRYA 1PZMA 3ITDA 4NX2A 2EX4A 3D6JA 3NVDA 5DN6A 3HO1A 5HUJA 2HU5A 2GPNA 4MRVA 4D25A 1AKQA 4OHXA 3HKCB 1GY8A 2WPDD 2CFUA 4FEAA 3R9IA 4IG4A 2QL5A 1G8PA 2F1OA 3A58B 5JSKA 4CU2A 4MSUA 4MWCA 3ZIAD 1TEXA 3IA2A 4LY6A 1NOKA 1PNQA 1G66A 1FDWA 3HUTA 3CZ4A 3L4BC 5IARA 3IQXA 4NQ0A 2OQVA 3T12A 3AHIA 2GZRA 1VLQA 3O9VA 2O0LA 4CM1A 2FHSA 1KYQA 1Z45A 3HN6A 4K6CA 5IUKC 1XQYA 4NV1A 1L5ZA 4F6RD 5CK4A 4TYWA 4JUDX 2EYQA 2W43A 1PUJA 4DARA 3BXHA 4DOMA 2QMZA 4QYIA 1LVUA 1UWKA 5EN4A 4AP2A 2ZETA 5H0IA 3DBHB 3K3PA 1LFAA 1EP2B 3ZDXB 5LB2A 2Y0CA 2Q45A 2ZR8A 3CXRA 4Q7MB 3RTGA 5LQJA 3I61A 1FP4A 4CF3A 3PDUA 1JAXA 1ESMA 4NZYA 1M6VA 4TZKA 1RR6A 4KYOB 1XTVA 1PDOA 1JG7A 1ZXXA 1F20A 2XS8A 5H5JA 4E88A 5JATA 1V0JA 4G3XA 2R65A 2X4DA 1N2CE 3KG2A 4C1BA 1TPYA 4JI7B 4YV7A 1WMBA 4TLAA 4QREA 2QTMA 1NU6A 1TZCA 2IYEA 1NY6A 4G5FA 1J2JA 1NQUA 5AJYA 3C16C 5FBQB 4JLWA 2RHDA 2J6BA 2A88A 3ELBA 1LWNA 4KXUA 5ECDA 4I1MA 2R1ZA 4RY8A 1UBTS 4XFKA 3T5AA 2DLDA 2VAMA 2Y68A 1EQUA 4Z3OA 4HSGA 5I45A 5KYUA 3BRWA 1X42A 3WLPA 4CHGA 2FPMA 3I76A 3LI2A 2Z2KA 4L7TA 1K6MA 2X42A 4QOIA 3FJOA 4HDAA 4YMTA 1UP6A 2JGRA 1PBNA 1HXHA 4O2BB 1RC0A 1GGHA 3MJFA 4TLBA 3EVDA 4WOBA 1N6NA 1NR5A 3VH3A 3NAWA 1R64A 2ZCUA 5TPWB 2V58A 1B0UA 2HHJA 5ITZF 1ZIPA 1LPMA 3DONA 2B2CA 1JFFA 3NV7A 4OXRA 3TKLA 1U2GA 3LUJA 5AVJA 3RC1A 3UMCA 2ORED 1NW6A 3PUZA 3KRTA 2RGWA 3AETA 2HAEA 4JX8A 1EKXA 1VCMA 2YYZA 3H18A 3QXGA 5JCPA 4Y2UA 3FKJA 2I9KA 1CRPA 1MVLA 4QHSA 1DVRA 3DZGA 1UEJA 5AKJA 5BVHA 1RRKA 1T2FA 2A9OA 3M6VA 4OVKA 1LBHA 3D54D 3K2IA 3QUBA 1E4EB 5EERA 4DIEA 4QBFA 3RREA 1HE1C 3F5DA 3ABZA 3PGKA 2VNSA 4CXMA 2O2SA 1CJMA 3F1LA 1YD7A 4C0LA 2H7VA 5JOQA 3PC7A 4WK6A 3WDMA 3EIQA 3EDMA 5TEVA 4YXWD 3ML8A 3QTBA 2CJWA 5ALZA 2OV2A 3R3HA 3VPSA 1OLUB 2R00C 2QF7A 3HB0A 1MHTA 4WW0A 3LUGA 1CFZA 4DUYB 3L93A 2RGEA 1V1RA 3AFMA 3PWTA 2Q62A 4QNRA 1RQNA 3ZEAA 2FPGA 1CDZA 1SVMA 2VNAA 2H6HA 1HKUA 3L3BA 3PR3A 5CK5A 3AFIA 1L1FA 3SZ7A 4EQ6A 2EBWA 2PQNA 4QUHA 4EIWA 5B6IA 2C9YA 2OBMA 3KQKA 1Q22A 2HMUA 2C9ZA 1KRWA 3AM3A 2EQ5A 3AM5A 3NLLA 2XX3A 1A88A 2X6FA 4ZI7F 1UJ2A 1Q15A 3A4NA 3EXAA 1U7OA 1KZHA 5K3EA 4ZWNA 1B3RA 5FPHA 3HN2A 2Q7FA 1PS9A 4L9RA 2O06A 3VR4A 3DB2A 1GXSB 2EW2A 3FKQA 3TRFA 1DJOA 1HI9A 2HLHA 3E7XA 5DYYA 4J0QA 2O6LA 4O3FA 3V80A 1NUUA 1G0NA 1OX4A 1V5WA 2F2TA 4DMGA 4CM4A 4F4DA 4QYTA 1RYNA 4YALA 1P5FA 1YOVA 4MRRA 2AOXA 1D6NA 4RQUA 5J2UF 1OKKA 1K7FB 3L1VA 3HNRA 2YN0A 4TVKA 1C41A 1UJKA 2I2CA 3K9BA 5FR1A 3IBCA 1XDSA 4QXPA 3JYLA 2G0AA 2JJQA 5KDLA 4BNJA 3GLIE 1FUEA 4NJMB 4OQZA 1GG8A 3CB2A 3UCFA 4MUJA 4M7OA 3G2QA 3NHAA 4FYJA 2IYYA 2YNMA 2ZIAA 4KQIA 1FRNA 4ERXA 4NAUA 5LWQA 3TWWA 3C3WA 5IAJA 3LWNA 4BMNA 4G1VA 1M5TA 2PZKA 2FZWA 3R5SA 4BVLA 3PVCA 4ODIA 4XI0A 1JMYA 2P9ZA 3ZCVA 1OYYA 1ZINA 3UM9A 4IEEA 3I2JA 5GAJA 4QUKA 1N2OA 1T8PA 4XXHA 2K4MA 1VCOA 3G8DA 4YMLA 2JIZA 4R0MA 4WINA 4TS9A 1N5RA 4UWFA 1XLWA 4HDQB 3BXOA 2M6SA 3AY0A 1MORA 2PKCA 5UKDA 1T6NA 4DIOA 3RSOA 1W47A 4MRSA 3TGOA 3P26A 5BP7A 1FPPA 3GOHA 5CHEE 2J5KA 4X20A 3C4JA 3TSCA 4O2RA 1U0EA 3EDYA 3UPDA 4CUJA 1JFFB 1NP3A 4Z86A 3ADBA 2O8EA 4REOA 3AUTA 3GLHE 3H5OA 3QZUA 3NIDB 1GL7A 3WRVA 3GUCA 4B6JA 3AETB 2XZTA 3G0BA 3ZDYB 2ZZMA 3TQTA 3DMGA 1J06A 3FKSA 4N48A 2HMAA 4HB2A 4FI3C 1MIOB 3QU4A 4G07A 1HS6A 1J24A 4QYSA 4JLBA 5BVHB 1ZNYA 5L53A 4IJKA 1H2RS 3HU2A 4HXEB 4W1PA 4R31A 1ZQ1A 3OD1A 3PRHA 2VWQA 1NQVA 1WPQA 1X92A 4A23A 2HGZA 3HCEA 3CBQA 3GEIA 5TQ0B 4DFDA 2V8SE 2GRRB 2C88A 8ATCA 1OWMA 5KSWB 1TF7A 4MKIA 1TX4B 3NUZA 2HY7A 4I1PA 1ZN8A 4P4NA 3SVTA 1VRVA 1KP9A 5IY5E 1WLSA 2OECA 1C7IA 3BDIA 3U1VA 4DBLE 2I3DA 2DHQA 4CM6A 2ID4A 5JPDA 2GCPA 2QMYA 2KB0A 4HH1A 4EUHA 5F2NA 1YQ9A 1MA3A 1A50B 3HP7A 3N39C 3SN6A 2GXUA 1F2TA 2CUNA 3A6HA 3KSDO 4L28A 1K5HA 4BBPA 3BA1A 1A27A 3S7JA 3KHUA 3RBZA 1K63A 3EIXA 5ESDA 1AGNA 4AWXA 4ZIRB 3HFRA 5HBGA 4R54A 2AFHB 4C7VA 5K03A 1X86B 2QZ4A 5FADA 1RCFA 4BERA 1BLXB 1G5FA 3JX9A 3TD2A 2DTEA 2QIOA 3LDAA 5TRTA 3T15A 5L4SA 4BCDA 2H4YA 2OMKA 2V7BA 3KDSE 4QQKA 3HXQA 1AV6A 2Q21A 2XT9A 1D09A 5GIPE 1CC1S 4A55A 1EUDA 2V7UA 3I5UA 5BWOA 2ZYUX 2NUPA 5DYNA 4AXHA 1AKYA 3T1YB 3WOVA 4RTQA 2YQZA 3DLPX 1FVXA 2EG9A 2O2DA 4N5HX 3S44A 2A0KA 1L5QA 2XCOA 2ONZA 3NHRA 5CDFE 5CYOA 5FTWA 3KQQA 2ZT5A 4QWMA 5DRTA 1EFLA 4GM0A 1N0VC 3DL0A 1PO7A 2VQDA 4J91A 4JLMA 4CETA 1UMDA 1MO2A 5L8VA 3IBTA 3L7IA 4V0KA 1RRGA 3E15A 4FZ3A 1QWOA 2QU7A 4DQVA 3L0PA 3Q7SA 4ND5A 1R0SA 1M0WA 4TWZA 4RYDA 3RSZA 4D74A 4HV4A 1QTNA 2NNWB 5A03A 5FWXB 2B61A 3IL2A 3ZPJA 4HQOA 2Y3AA 4YAUA 2BWJA 4GZ5A 4WXMA 5IDVA 1DZ3A 3LJKA 1T9DA 3EYWA 4FFBA 4O4LA 1CUSA 4P9NA 3WLEA 2GO7A 1TTHA 2QTFA 3LO8A 4NECA 1Q14A 2FKAA 4KHZA 3TCKA 2JFFA 1LPAB 3CR3C 4L5IA 1CY1A 3F71A 4TT3A 1QP4A 2I4TA 4KIWA 2DZOA 1ACMA 2H00A 4XRGA 4C6TA 5JW6A 1Q0RA 3WYFA 1JIUA 1IDOA 5A04A 3QBJA 3OKPA 2FN9A 5B58T 1YBAA 2R7MA 3DEZA 5BV2P 4UAGA 5LQMA 4PYJA 3H99A 5JCXA 2VIIA 4QLOA 2GD2A 1U1FA 4RSRA 3WGGA 1FZTA 3AR2A 3X2SA 3ZZMA 4HNVA 2IDJA 4BFUA 4PYQA 3HB5X 2AWIA 2GA9A 1OJ7A 2H1HA 2HH9A 1X7WB 3F9IA 4JJIA 4LVCA 5FNVB 3ZGYA 5B5SA 2JAHA 4DADA 3K0EA 3FI9A 2Y27A 2RJNA 1Z35A 1E2UA 3BFXA 2J07A 3DDSA 2IH4A 3BWCA 3T95A 5GINE 1HZZC 3BG5A 1W0JD 1VSBA 3BE5A 1ULTA 4G01B 4HNAD 2AMLA 4JMLA 5FBZA 3ZDBA 1NA3A 2O6HA 4IM7A 4FNMA 5EZ5A 2J8ZA 1G64A 2Z6AA 3G88A 4A0QA 1C0IA 1M1ZA 1CCWA 2BH9A 3HU1A 1USKA 1RHJA 4P81A 5SY6A 2D0IA 4HUQA 1HT3A 4DN6A 4RZHA 3F8SA 4HAZA 4O2BF 5HTKA 3SE7A 3OCVA 5L3QB 4HR7A 2VS1A 3HCRA 2DTDA 4KUEA 4D98A 1EBBA 4RENA 1TMGE 1Z6XA 1FTQA 2DFDA 3I9FA 4RHTA 5CDTA 1Q77A 4MJXA 1JAIA 1IQPA 4OHKA 4C4PA 3GRZA 2DWQA 3KUXA 4X6YA 1SUFA 3WWEA 3IE2A 3KYCB 3FVVA 3HIZA 2V96A 1H2VC 1Z12A 4BNKA 3O26A 4FYPA 3R3UA 4PLPA 5CLIA 4ZFNA 1I2MA 1NXXA 4FS3A 2IU0A 4MQ6A 4EFKA 3EF3A 3RRMA 2WKWA 1M7GA 3EAGA 4I08A 3RRXA 4DZTA 4X1YA 5A7DB 5EE0A 1VYUA 3FB4A 5AT1A 4HO1X 2XUAA 2MSNA 4NHEA 2X6RA 1Y6FA 5G41A 1Y9DA 4PPYA 3LT0A 2H1VA 4FMPA 1MOPA 1UOHA 4MMZB 4U7GA 1QKIA 4ZDJA 2F4NA 2IZZA 1LDNA 2RHMA 2V6JA 4FGLA 4UATA 4N03A 4YROA 5K0EA 1JHDA 1IBSA 5DXJA 1OC4A 4H7KA 4NULA 3ZXXA 5AUPB 4I50A 2BGGA 5FT9A 4UXIA 5IJ9A 2HDOA 5B7GA 1XMVA 3SSMA 4WLNA 4X7MA 3STWA 2DJ5A 4L4UA 4DA4A 1NTRA 3GU3A 3JQFC 1QQ7A 2NTVA 4TWRA 3TLAA 5I9MA 1IC6A 2J1LA 1MH9A 1ENOA 1H94A 2VHEA 3IEMA 3I2YX 4PNZA 4QPDA 1M2NA 1E7YA 4QFMA 1DSSG 3JQAB 3PZRA 1U6JA 4RA6A 1C9YA 1ZI8A 2QV7A 1VMKA 2H8GA 3LQKA 3Q7PA 4ROSA 2X0FA 3WDLA 3AILA 3UCXA 3ZCQA 1EPUA 1XNQB 3FTEA 3WV5A 1TEZA 4TX1A 4QEDA 4IRXA 1LDEA 2CNKA 1GQYA 4XB1A 1I4DD 3CG4A 3S8MA 4BYGA 4Y2QA 4FYKA 5A2GA 2B30A 2QIPA 4R6WA 2ODAA 4UHFA 2WXMA 1FLAA 1GGEA 1L5SA 4EB6B 2HC9A 4LHXA 4UU8A 4ZVRA 1OMOA 4U7PB 1T2UA 4AMYA 4CR8A 4YONB 4AMVA 2XUQA 3AR9A 4ZQFA 1XC7A 4EYEA 1YDHA 2RG8A 2I1LA 3MT0A 3OFKA 1E1DA 4ZVKA 1C8LA 2G1UA 1EFTA 2PEYA 2Q2OA 4M7PA 3QVVA 5U4QA 3T3HA 3U3XA 4V1CI 5KYUB 2M2IA 4P7KA 1XEAA 4REQA 4QG3A 2RAUA 4KMOA 1QIFA 3PF8A 3VO8A 4C0KA 4HDNB 4RKQA 4Q7LA 3K0CA 3L8GA 4W9MC 4CRWB 2XE7A 2R6DA 1FK8A 4P4SB 4AV7A 3KKEA 2A1UB 2A92A 4DJFC 3WV4A 2QZSA 3WKCA 5JSUA 5KC8A 5ECGC 2HO1A 4ZZ2A 2NWQA 2ERCA 1TRHA 3KVRA 5I9SA 5M5BA 2VJOA 4KLAA 3N2GB 3ZVMA 1LU9A 3NAMA 4MBGA 4PCLA 4IF4A 3QELB 2AQKA 3TZKA 5AYWD 2R2LA 2WJZB 2CDCA 3N5KA 3IXMA 3PDHA 5COAA 5FI3A 3SX4A 4ZCRA 1ZD4A 1DX4A 1HG0A 5E4TA 3JALA 2YXNA 3PEVA 3I2GA 5E9JA 2ZUBA 1JN0A 2DZNA 2BMEA 3ZDQA 3VR2D 2PH3A 4CGYA 2D2EA 5G4LA 1FFHA 5LQUA 4KZPA 4DIBA 2VJQA 4J90A 5JMWA 1QV9A 4FSXA 5AWFC 3VR4H 1P2SA 5L40A 3BTOA 5ED0A 1O5IA 2W6JD 1W8DA 4I6JA 4RSYA 1PK8A 5ESXA 4R3NA 4LBWA 5JARA 1TA0A 2YIDA 3A3YA 1E1CB 4DNOA 4DLSA 3CISA 3FSRA 4OIMA 1W19A 3HPRA 4D80A 3KJXA 3GFFA 3W6NA 2R02A 1UXHA 3ELDA 3O2SB 2ECKA 1L5LA 4ENWA 2Z3WA 1F0KA 1XR3A 2FK8A 3HBLA 4HNAB 1FMTA 2QUZA 5JEDA 4XKBA 2P79A 4HSEA 4RZ3A 4AMUA 1OH5A 3E9EA 3IHYA 5KWSA 2QY7A 1SUDA 3DBRA 1PQPA 2BM9A 4JYCA 1FXSA 3LXMA 3V4VB 1SC4A 4GW3A 4K6OA 3GZNA 2R05A 1WCV1 5CH5A 1QPGA 1FXUA 5CT4A 4JSTA 5BN5B 1AQ6A 1FEZA 1JYSA 1RT9A 1VYHA 3DCIA 3ZI7A 3KELA 5E38A 2JKVA 3LVRE 2NYUA 2YX1A 3OIYA 2DC1A 1KZ9A 2W2TA 3QPCA 4LMBA 4Q34A 2YHIA 3ZCRA 1QDUA 3S29A 2JFYA 4D92A 1DL5A 3C3JA 3VAAA 2R5NA 4MLDA 3FY4A 1FXWA 3F7OA 5FIUA 1VKHA 3UT8A 2CK3D 3B2NA 3KSUA 4S1PA 1LTHR 5KQGA 3W79A 2W2XA 4URWR 4F1PA 2NIPA 2YHUA 2YZMA 1RBMA 3DKKA 3OY2A 4KDCA 5DPMA 1RHRA 4AZWA 4F8JA 4PX2A 5IAOA 2W6MA 4A5SA 1KOGA 1TAHA 1ADYA 2VNIA 3GUHA 3IEPA 3SX0A 3ROTA 4B73A 3DC7A 5D3KA 3NTRA 5I9LA 1JQAA 5K3AA 3ZUGA 1S3IA 3X0DA 1RDFA 5KYKA 4KO1S 4CJXA 1CIVA 2XE8A 3P0IA 4TXNA 4DTIA 2J85A 3L4EA 4J3JA 3LTNC 3DQPA 3CBGA 5FI0B 3FFWA 4E5SA 1X80A 4PFJA 1EVQA 4E85A 1YRWA 3HA7A 2RONA 4J4HA 3RYIA 1M66A 3CK9A 4QBKA 3OQVA 4EI8A 4N41A 1FMJA 2C61A 4LDQA 3PGXA 4BVKA 4CM8B 5IT9A 3D9HA 2GPAA 1KU0A 4QUGA 4WOCA 3UNXA 2WFMA 1DOAA 3NHBA 1P7CA 1DAEA 3VR5A 4FC8A 3WICA 1HX8A 1YB1A 4FC7A 3KLOA 4U8HA 1ZBPA 2X5JO 4MA4A 3RRYA 1SU4A 3NO4A 4PFSA 3HXMA 3NTVA 3PNLB 2VT7A 1IJBA 3NGXA 3D3MA 4C2UA 4JDPA 5HQ3B 1IZ9A 1WHTB 1CZRA 2H5EA 1DINA 2BTQA 3DXMG 3B89A 3JQAD 3PA8A 3QELA 3IJEB 3I6BA 3UAWA 2PX3A 4EWLA 2XNSA 4BTEA 2V1XA 4R1NA 2EP7A 2HYIC 1HX7A 1XZMA 2QROA 1YK0A 2YKGA 1DARA 1VG8A 4C0EA 5T6MA 4IFBA 3ZR4B 5CRVA 2WWWA 4OQXA 4LGMA 5AVRA 1R37A 1KI4A 4U2KA 4L23A 1M0TA 5EX3A 1ZZEA 2VDVE 2JJ2D 4HL6A 1TTTA 3T4UA 3IT3A 1N6RA 2DT5A 3IEXA 4JBHA 3X1YA 2IS2A 1CULC 2I7TA 1DIGA 3N7UA 1NXPA 4NTZA 4PHTA 1PNVA 2VZEA 2EATA 1MO5A 1EBUA 3PXBA 3CH4B 3R23A 1D2HA 1Z08A 1MPTA 2RGGA 2E55A 2CHWA 2A5FA 3DBLA 1CJKC 2TSYB 3C7CB 1VSUA 3R09A 1IU9A 1GAXA 3WC4A 2RK6A 3EHDA 3DL4A 3L6RA 4D45A 3D9LA 1U5CA 3OZDA 3CCFA 4K9QA 4EUNA 3AG1E 4Q4JB 3STHA 5AICA 5A4AA 2UYHA 5D66A 1FFEA 3E1KA 1Q7TA 1T5BA 3ESZA 2GFHA 4X8HA 3VH1A 2QU8A 2R8ZA 1EUZA 2DOKA 4FI3F 5LQAA 3FYUA 5D5HA 3D1LA 1U99A 1AQNA 1N0HA 3SBDA 2BGRA 3UG7A 4F2DA 4F3CA 4DV5B 1XMXA 4GMLA 1ZESA 2WILA 2AEJA 4CDMA 2ZAMA 3LECA 4JVLA 5CXXA 1XEFA 4MW7A 2D59A 1W4BA 3DMRA 4KAJA 3C1UA 4RHUA 4N5QA 1YMUA 3BMNA 1RACA 1KY4A 2RGBA 3IP7A 3TBFA 4OHPA 5DWDA 1VMDA 2O2GA 3MGCA 2BFBB 1EFRD 1NI4B 1IBMB 3ILVA 2OSVA 2H6GA 2OG2A 2GAJA 4Q3CA 2PUWA 3H8VA 4GH5A 3JAMA 4YMIA 3ZYMA 1GA1A 1SWWA 1Z37A 2I2WA 1D5CA 3F5FA 2GEDA 1DAKA 3H2IA 2Q5CA 4ND4A 4LEIA 4P83A 4HRLA 4UBIA 1I1QB 3EA5A 4PBTA 3INYA 1DQNA 4RZUA 1DDIA 1OXKB 3K1JA 3KQPA 3RO7A 1V55E 5CERB 5BYBA 5JS8A 4Z68A 1K66A 1M1UA 1NZJA 4MKFA 3C41J 3NAZA 2FPIB 2NPIA 3UN1A 3GDGA 3TAHA 4R2JA 3V8QA 3T5GA 1CLEA 1L4FA 3WE7A 3NH9A 3VUFA 1KKUA 3ZWMA 3GLKA 4NK4A 1OC2A 4QELA 4XD2A 3H8JA 1QU3A 3N8HA 5LCXA 1JAYA 1NBMD 3OIGA 4KIFA 3Q3EA 1BGXT 1AC5A 4MYUA 3ZBTA 4ESVA 3WK9A 3U56A 5DM2A 5DEIA 4UTPA 4HRXA 4ZAXA 1QFSA 5K09A 1K4KA 1QK5A 1H3NA 2FFRA 2HPZA 3DF9A 3DMHA 4PLYA 3N0WA 4RIIA 3U5ZB 1NSFA 1F2UA 1S3FA 3EG9B 4C07A 2YBDA 4NCBA 4L9SA 5LOZA 4DE5A 1VDYA 1WB6A 2ECFA 4AIRA 1J39A 2H52A 4HQDA 3GJSA 3Q2OA 3TW6A 2E37A 2W0SA 1OXBB 5HF6A 5ITVA 1DTWA 1GPJA 1PJAA 2W4QA 1Z3IX 1QUFA 4PCAA 5DGXA 5EE5B 1AUXA 1VKOA 4CHTA 1N9ZA 1EFAA 1U7ZA 2QAJA 3K6JA 1JDBB 1R16A 3FNRA 4GYKA 3IB6A 1YQWA 2DBZA 2Y1DA 2XNCA 1NTOA 2AKAB 3OC0A 3FR7A 3UXHA 5CA0B 1YUNA 1IHBA 5DYTA 5FNZA 1SXQA 2R59A 3RFFA 1DKRA 4S0ZA 5IWCA 2II6A 2VCHA 3E33A 1XQ9A 5DK6A 1MYOA 1QNFA 1Q5PA 1QR2A 1TUEA 4YT8A 4OB8A 3RSFA 3WGVA 1D0VA 2PG3A 5K9ZA 2PT5A 3KUCA 4X54A 1TM1E 3QEBZ 3VJMA 3DNFA 3R5TA 3VVCA 1L5VA 1LLUA 1QAOA 2VBGA 3K8ZA 1HE8B 1VA4A 1NZNA 2AGVA 1H2FA 2W83A 2VQ6A 2WU4A 3RVKA 2C2BA 5IYZF 1QZ3A 2AL7A 3GB9A 3Q8MA 1ZR2A 3KS9A 3QPWA 2QP4A 3PZ3A 4TVOA 5LB4A 5BVGB 2HT6A 1WG0A 1JX6A 3F78A 1RQPA 2AVPA 1DBVO 3D4IA 1B6TA 1U7UA 2R6FA 4P08A 4DSNA 1FRQA 4DCNA 1AGRA 5IXSA 5KVAA 4FFWA 2X38A 1FFCA 1HLGA 3OCXA 3LX5A 2QXTA 2ZRFA 1EEHA 4Q02A 2VDKB 4JX9A 3U0BA 2CZQA 4DLBA 3FTFA 3FPSA 1WXWA 4RBNA 2FZEA 2Y6VA 4HB0A 3CZ9A 3MB8A 3N05A 1UDWA 4NH0A 4HBZA 1OXXK 3LE8A 5DYWA 1TL7C 2EFDB 1EXMA 2GBCA 4MDHA 4OV6B 3HYSA 2MYOA 4UVHA 3U4TA 1G3RA 3HJCA 4BLRA 4UE2A 2FFHA 2W9XA 3D3EA 3GFQA 4R1OA 1AS2A 4HZGA 5E95A 1X1CA 3ENNA 5CEEA 1SOWA 5CB8A 1IOVA 1JSXA 5M72A 4JQCA 1EJBA 1R6VA 3RIHA 2QT9A 4MJ3A 2XXAA 4PQEA 4MUXA 5I5EA 2H63A 2LSVA 3RF7A 1SKYB 3A7DA 3PVSA 1ZJ5A 3Q0TA 3V3TA 5M04A 3C43A 2J0UB 2G04A 1Z0AA 4TUYA 4EY5A 2QYTA 2AR7A 3CR8A 3TQFA 1SAYA 1YOBA 3L0YA 3UWOA 1ZNZA 5A4IS 1GTSA 2BCEA 2D00A 5MN4A 4BLSA 1P0MA 4OJTA 2FWBA 1GRCA 2DQKA 3HBFA 4I6EA 1BGWA 1CIJA 1QIIA 4MUYA 4LZLA 4CQMB 3NW9A 3EUVA 1UXGA 3R20A 3WRXC 3WO0A 3PENA 1OGYA 4C76A 2B6NA 5C7IO 3U9LA 1JHUA 2ZWAA 2PXCA 3IR7A 4I1SA 1AUVA 3RJTA 4BU0A 2I1VB 3FCUB 4W5HA 3MYRA 1V26A 4CQMD 3GFVA 3UPVA 1E3LA 3Q7FA 1HDYA 1P4SA 4NBVA 4R83A 1ZCZA 2WF8A 3R76A 3ZYZA 4F12A 3LUDA 1ZCJA 1BIFA 1SOUA 3T99A 2GI4A 3EUEA 3DDCA 4OAUC 4BNLA 1YZQA 2UDPA 2X0KA 5GOZA 5EZ6B 1UPTA 2Q0SA 3RAFC 4ATGA 2JFBA 1R4ZA 3AM4A 2WYOA 4QULA 1H42A 4ZVTA 3Q79A 1ZQ9A 3W78A 2EIHA 4COKA 3SZMA 1H2ZA 1PS8A 4JW1A 1UKYA 4ZO6A 4B83A 4EARA 3WJ7A 3NEYA 5KTOA 1ORIA 4OKIA 2JD1A 3AS5A 3BIFA 5TT1A 3ZBPA 2QORA 1KDOA 3B5EA 3WLRA 2KLHA 4WEOA 3HSSA 2REXB 1EINA 4DR3B 3H3JA 3O7MA 3SXUA 1WEHA 4OFXA 4QAJA 3D9QX 1KNQA 2COKA 4ZAVA 5FQOA 5KQSA 3GLIA 2JG3A 4GOXA 4E12A 2LW7A 3BHIA 1PTJC 5EUQB 5KQPA 5DHQA 4HGPA 1DEAA 2C84A 3OX4A 4C2TA 2COUA 4CM9D 2E5FA 4NK5A 4WE3A 3NC4A 3O8NA 3MYYA 4PO3X 4BN4A 4E03A 3FU6A 5HWSA 4PYRA 3DBOB 2EJWA 2A7QA 4I5IA 4LQ4A 3OOYA 3EMBA 5JQGB 2CXOA 2XWPA 1LW7A 3IDFA 4BNIA 1YQXA 4BTBA 4YXFA 5DFAA 3G2KA 1R7RA 1CY6A 2JD2A 2ZTHA 3B3JA 1ZH2A 4J0IA 4OI4A 1JT9A 4UWHA 4NQRA 3D4LA 4NCIA 5CA1B 3TBKA 4LVUA 2PNNA 3EH2A 1HDGO 1V2HE 2X8BA 4FLMA 4A03A 1J1UA 1XLUA 1RHMA 2YMPA 2O0KA 3QKRA 2BBWA 1AN9A 3JQRA 4N54A 3EIQC 3D9KA 4YUVA 1ECCA 2OENG 4N2QA 4C0SA 3PBKA 4L9PA 2ZIGA 3CA8A 4YREA 5EIWA 3SHFA 1Z6PA 1ISPA 2ZIFA 3HL0A 5FBWB 1I5OA 1GCGA 1I1HA 1LK0A 2BHTA 2LXLA 4BTVA 2PEZA 4MV3A 3I8SA 3MV3B 2FP4B 1L4GA 4BCCA 1P3JA 4KPGA 1VPWA 1WB5A 4XX1A 4YTEA 2FU5C 3VKGA 1W7AA 1QE3A 3KBOA 3BFPA 2OXTA 1YR2A 1LDGA 5LWHA 2MT9A 4G5SA 4DDMA 3AG5A 3G49A 1YA8A 4JI0B 3G9ZA 3JR3A 2QXUA 3H19A 1QQTA 1NXQA 2J9YB 1MD9A 2HJ9A 1QFYA 5EYPF 2ON6A 3WVNA 5L4NA 1N2BA 1HNXB 3IP1A 4ZTZB 3EUWA 5F9FA 2D5BA 2ZJ8A 1EUCA 4H1WA 2X6IA 1VPEA 4Q00A 2BGNA 4G8BA 1EHCA 1SIOA 5JIBA 4OLAA 5IYZB 4FOTA 1MOZA 3L8ZA 3WI7A 3EEQA 3HLYA 5G0SA 2W2NA 5DB4A 5A4KA 2QTVB 2YXDA 2V6BA 4U7HA 3RYHB 2BMWA 3VSCA 3A04A 1L7MA 5B57C 4XTCS 1IG0A 1LI5A 1R0RE 3RFUA 3TQHA 4IFEA 1OREA 3TINA 5JH7B 2X1HA 1MJ5A 3TTTA 1KSHA 4Q47A 4ZJYA 4F56A 1Y5RA 1EVYA 5IEJA 1TE2A 3UJBA 1B73A 1WW2A 1NRWA 1OA1A 2VYIA 4FFMA 4DLVA 2PSEA 1RE0A 3L7NA 3R5JA 4JU8A 3ZUVB 2I34A 4XUDA 4DG9A 1C14A 1XEWX 5LXTA 4MHTA 1U2DA 2ZSUA 5IM4F 2XHEA 3TW8A 3W1WA 5JISA 3CGHA 1RIFA 3BFKA 1LSSA 2ZVDA 2XPZA 5BNFA 3D5QA 1LBIA 4BNZA 2HDWA 3DJYA 3N28A 4HLQB 4JT8A 1CETA 4JD2G 3PS9A 4L08A 4PM4A 3RG2A 4DLWA 4BQSA 4B5LA 3DM5A 3OQPA 2C5EA 3GRPA 5DE3A 5EHGA 5KKNB 1A8QA 3BWBA 1QLHA 2Y93A 1LZLA 4YDHB 2NUBA 4LGCA 3G13A 4BNNA 3GDHA 4BO1A 1V6AA 4RGVA 4FUTA 4Z6KA 2ZYHA 3FZQA 4A63B 4JEIA 3EDQA 1PV4A 1TNDA 4IIUA 4AEZC 3I9JA 4H7PA 1XCOA 5H3HA 3EZFA 3UT6A 1JQLB 1BCRA 5HJ2A 3BQ9A 4AJ4A 3FWVA 3CZRA 3RQSA 1RQLA 4ONEA 2H92A 4JR1A 1EXVA 3B7GA 4ACKA 3AUAA 3G2NA 3CGGA 4MKGA 4H3SA 3LT5A 4NPAA 1U5AA 3CB4A 2HEIA 4RZXA 4UTNA 3S2UA 1CPYA 5F7JA 4WFKA 4KGXA 3NOXA 5DLYA 1N4RA 1PHPA 1SELA 2GEVA 4GOND 1QYMA 2WU1A 3NT2A 4PAQA 2PWPA 1B89A 4H7DA 3NBYC 5D5QA 2EFYA 4QJBA 2HSWA 4B45A 5BYJA 5HW0A 3FRIA 3C3QA 1MRZA 4PN7A 4IH1A 4JKOA 3JQ7A 3IAS6 3GUVA 1F2VA 1I7PA 3BZWA 5DVZA 1NSTA 3L02A 4HB4A 3TAXA 4OLJA 4S1NA 3HUEA 1ODSA 4OP2A 2BKLA 2H0AA 1VL0A 3SMVA 5D6NA 4LHVA 3C3OA 5IVIA 1RP7A 1X70A 2QE7A 4BO0A 5AKKA 1XAIA 1HOTA 2BFCB 3D6TB 1EFRA 4KKVA 2H16A 4V0LA 4V2UA 3U3ZA 4CKXA 4J4BA 4AICA 5MDHA 3WL6A 4EECA 3BERA 3AVWA 3L1KA 4NV0A 3ZZ1A 4F04A 4QTXA 2AOUB 3DEPA 3M89A 3RS0A 2O3SA 3JWGA 4BKUA 4YJ2F 3PREA 4FR0A 1JI0A 2HF9A 2JGIA 1OI2A 1ZO8A 3L7LA 4BSXA 4ND3A 2VDOB 2JGDA 4KCGA 3WGQA 5IYZA 1YC2A 2DETA 3SF0A 5KAMA 3ESYA 1JQ3A 4GUDA 2PKEA 3CVVA 1IBKB 1BROA 1DEKA 4OXNA 3Q4AB 4FBGA 4URHA 4X64B 2I4RA 5FOTA 3QE2A 1H9BA