2F8YA

Crystal structure of human notch1 ankyrin repeats to 1.55a resolution.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
215
Chain Sequence
AVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Notch homolog 1, translocation-associated (Drosophila)
publication title Structural basis for cooperativity in recruitment of MAML coactivators to Notch transcription complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2f8yA00
5ENPD 4U8VD 4ATZD 5AQBA 3EHQA 2F8XK 1N0RA 1BI8B 3NOCD 1AWCB 5EYLA 3LJNA 3ZU7B 2ETBA 2XZTG 1TR4A 4ZFHA 3B7BA 1IHBA 1MX4A 5FINA 1IKND 2DZOA 4U8YD 4F6RD 5CBOA 4J8YA 2L6BA 4BEPA 3AJIA 4YDYA 3ZUVB 1BU9A 4K5CA 3NOGD 1MJ0A 4BETA 3JUEA 3HRAA 5EILA 4RLYA 1N11A 3NBNB 2KBXA 4F1PA 4NIKA 1MX6A 2F37A 4HI8A 5ENRD 4LSZE 4OAUC 2ZGGA 4DUIA 3JXJA 4A63B 4DX2A 1BD8A 3TWTA 5EYPF 4GPMA 5JMND 5CEAA 1MX2A 2RFAA 1N0QA 3DEPA 3D9HA 4HRMB 2ETAA 3B95A 4U95D 5AARA 3TWVA 1AP7A 2DZNA 4HNAD 1UOHA 2XEHA 3TWXA 1NFIE 4C48B 3JXIA 4HI9A 4HRNA 5ENOD 4HRLA 3ZNGA 4B93B 1WDYA 3V31A 4BERA 2J8SD 3TWRA 4UUCA 3KEAA 2JABA 3C5RA 2AJAA 5AN8A 1OY3D 4CYMD 5D66A 1DC2A 2KXPC 4K5AB 3TWWA 4YDWA 5BXOA 3EHRA 1K3ZD 5ITZF 2XEEA 5ENTD 4HQDA 3F6QA 1K1AA 2V5QC 3T9KA 4G8KA 4U96D 2QC9A 3UXGA 5CBNA 1K1BA 2F8YA 1YCSB 2MYOA 3TWQA 5BXUA 3TWUA 2P2CP 5EIBE 1G3NB 5HS0A 2V4HC 3SO8A 3Q9UC 2HE0A 1OT8A 4LG6A 3W9GA 4J7WA 4DX1A 4K5BA 3V79K 5KNGA 1SVXA 4HBDA 5KBAA 4BESA 4O1PA 2Y0BG 5ENQD 1QYMA 3J5PA 3AAAC 1YYHA 5AAOA 1BI7B 3V30A 5EIDA 4DX6D 2NYJA 5JA4D 4ZHBA 3DEOA 4LNUD 3V2OA 5HKPA 3IXEA 2FO1E 2XZDG 5CEDB 3TWSA 2A5EA 2BKKB 1DCQA 2ETCA 3HG0D 3J5QB 5AQ9A 3T8KA 2VGEA 1D9SA 5AQ7A 2B0OE 4CZ2D 1SW6A 1BLXB 5KWDA 4BSZB 2DVWA 4O60A 1WG0A 4DRXE 4OAVB 3W9FA 5FIOA 2ZGDA 5EN5D 4TUMA 5CERB 4HLLA 2PNNA 4HB5A 4G8LA 5ENSD 5KNHD 4DX5D 5CECB 2DWZA 5HRYA 1A5EA 3Q9NC 2RFMA 5AQAA 4QQIA 1MYOA 4O1OA 1S70B 1IXVA 4DX7D 4GMRA 2XENA 4JB8P 3UI2A 3UTMA 4N5QA 2Y1LE 1YMPA 3V2XA 4QFVA 4Z68A 3EU9A 2BKGA 3ZKJA 2QYJA
chains in the Genus database with same CATH superfamily
2LAIA 3SGHA 4WNEA 3LJNA 3FDHA 1MX4A 3ZXSA 2DZOA 1KLXA 3UIPC 3FU5A 1ELKA 1RZ4A 4DX2A 1TNYA 3U3WA 5CEAA 2WXKA 2ETAA 4G2VA 2HM8A 3FEYA 1NP7A 5CCMA 5FQ6A 5ENOD 4HRLA 2J49A 3RO3A 3ZNGA 3E30A 2XQ0A 3V31A 4BERA 3SNXA 4I6GA 3PEUB 2PQNA 2WXFA 3UINC 3Q78A 2YHCA 2WMOA 3LDZA 4WNGA 1K1BA 1N94A 3LY7A 2P58C 3Q9UC 1TNOA 3BG0B 4I6JA 3BU8A 2EINE 3HXBA 5B1AE 5BNWA 2LSVA 4MLPA 3CHRA 3AU5A 5EX0A 1Z3YA 4APOA 2ETCA 4MS6A 3OXGA 4GTVA 1D9SA 5AQ7A 3EDTB 3UX4A 3S7FA 1N4RA 4YVQC 3CGHA 3GZSA 1MZCA 5CECB 4IYPA 4ILGA 4LRZA 1MYOA 1NA0A 3U9WA 4DLOA 1OCCE 4K0RA 3PE3A 2VGYA 4LEUA 5G55A 4WNFA 2WMNA 1SZ9A 4L2YA 4CT0A 4ACLA 3MA5A 3QK0A 4U0ZA 2FO7A 1N9AA 2LSUA 3ZN3A 4OVVA 4UWKA 2PM6A 4BY6A 3FH5A 3UKUG 3CIAA 3NBNB 4F1PA 5ENRD 1HG2A 4PUCA 3OTNA 4N3BA 2XPYA 4AVXA 5HQ8A 4GYOA 2C0LA 4TXRA 4AV7A 4F1SA 3DXKG 2J8SD 3EUVA 3FUKA 4HQDA 3UQ3A 2EILE 3CVLA 3HVEA 3QWPA 3LVRE 5HS0A 4FJZA 1OT8A 1TN8A 4B89A 3ENEA 1TEZA 2GRRB 3PNLB 4I17A 3GZ1A 3JUIA 3IXEA 4B0ZA 2BKKB 4LUNU 3CVXA 1BLXB 3K9IA 2V4LA 3PREA 3D9KA 2OVBA 3LXUX 2WM9A 3G2TA 5HRYA 2IOLA 2CHXA 4QQIA 3ZRHA 1OXJA 1EF1C 1H2UA 4HLEA 3APCA 2I9CA 2Y1LE 2A4ZA 5LCWC 3AU4A 3CSTA 4EECA 3BQOA 3EHQA 3UIOC 3SBSA 5T4YA 2DBAA 4I2WA 4J8YA 2AW6A 2L6BA 3AS4A 1BU9A 3FP3A 2NSZA 4AJWA 3MJWA 4ABNA 3LS8A 2GRNB 3JXJA 3CVVA 4AOFA 2J9QA 4JHJA 3MGBA 4PS7A 4YVOA 1N0QA 3D9IA 3JCKC 4GTQA 2L0IA 1FT2A 3KEAA 3WG7E 3ZHEA 5ITZF 1YA0A 1HZ4A 4I9EA 5KJNA 1DCEA 3RIBA 3ZYQA 5LCWJ 2PQRA 3FTYA 2H6IA 4FU3A 5ARGA 2NYJA 3ASFA 4GZ6A 1DCQA 1N4QA 3RK6A 3E4BA 2P9KG 4LNGA 3MKQA 4TUMA 4HB5A 5KNHD 3MZLB 2OEVA 3MX3A 4EZJA 2EIJE 3LCAA 4GMRA 2ILRA 4AP2A 4LCTA 5AQBA 4CGVA 4UQYA 5CHEE 4JA7A 1UN9A 4PS3A 5CBOA 2KCVA 2J08A 3ISMC 1V55E 3I4GA 4E6HA 4O6FA 4A1SA 3T5VA 4XZ4A 1OCRE 2OV8A 4NQ0A 1JCRA 1AP7A 1UJJA 4PDXA 1O1TA 3LY9A 4JPSA 1WDYA 2HO1A 4JEHA 1FT1A 2KXPC 5AYWD 1H2VC 2V5QC 4F7AA 1OWNA 2KATA 2QC9A 4JW1A 3Q4AB 4ANUA 2P2CP 5JJTA 2OOEA 3P1UA 4AY6A 3ULEG 4F3VA 4PH4B 2EQXA 4JC8A 1OUVA 4KXKB 4P29A 3TXMA 2X38A 1HE8A 5T3RA 5C1DA 3FH7A 3W9FA 5EN5D 3HHMA 5ENSD 5LX8A 1XGWA 3OXFA 4JVSA 3Q9NC 2GROB 1HF8A 3D9MA 4RQIA 4HORA 4HOTA 2XENA 1V54E 2VGXA 2WXPA 2R05A 3FU3A 5JJ7A 4AEZC 4XI0A 2XZTG 3VLDA 4B8AA 4ZFHA 4URKA 2QZAA 3TG4A 2ZISA 4A1GA 4YDYA 4I2ZA 3TL5A 3Q49B 1WM5A 3MCXA 3D9LA 1ELRA 4GTMA 2XS1A 2LO6A 1N95A 1TNBA 3D9HA 1E8YA 5BT1A 2R17C 4MRUA 3CK7A 4G26A 1LD8A 5FZQA 3B13A 3VTYA 5EDSA 4RG9A 4EHMA 3C5RA 3UM3A 5D66A 3DWLG 2LUHA 4AY5A 5JHBA 2P9IG 3L16A 3D3MA 4B94A 2P9UG 2FEZA 3MV3B 5CRVA 3JYSA 4U0SA 3Q79A 4BFRA 5BW8C 3J5PA 3BUAA 4EQFA 4J0UA 4J8FA 3S7JA 4GTPA 1DNPA 3N71A 4CZ2D 1SW6A 2UWJG 3S7BA 1SZAA 2H6HA 3KSLA 5FQ8A 3C98A 4O1OA 4DX7D 3FTXA 1O5MA 2P9SG 4FLHA 2F0YA 5J08A 1SA5A 4G24A 4U07A 2WXJA 1AWCB 2EIME 2WXOA 3CKCA 5KJMA 2MRIA 4RG6A 1UJKA 4BEPA 2XS8A 1E7VA 2R5SA 4RLYA 4D10C 1QQEA 4N39A 4LSZE 1U3DA 2Y4TA 2VSNA 3DXMG 2R59A 2ONDA 3UT7A 4GCNA 5H7PA 1A17A 4L9PA 4I1OB 3B7RL 5DIZA 4U7EB 1TYQG 2QY7A 2XGMA 3S7DA 2ZIRA 5E76A 3P2BA 4G25A 3FTVA 3UXGA 3ASGA 2MYOA 3FUNA 4Q96A 3ABLE 4K5BA 2LNIA 4GMLA 5HI7A 3AAAC 2YHEA 4GTRA 4I6EA 4LNUD 3PNTB 5CEDB 3PZDA 1O1RA 1Y8MA 4XKBA 4DLQA 2X6FA 4A3VA 3IEGA 4O60A 5FIOA 2BF0X 4DX5D 5A7DB 3CSFA 2ZU6B 3SI5A 3ONKA 1Q2ZA 4JB8P 4GZ3A 4Z68A 3EU9A 4I1AA 3JQ0A 3QJZA 1S63A 2Y4UA 3KS2A 3L82A 3FU0A 4YDOA 1IQUA 4NACA 2GW1A 2ETBA 1QNFA 4RSYA 4EZKA 2HR2A 1MJ0A 1WY6A 3JUEA 3JQ1A 4FC8A 3PUKA 2X6KA 2P9NG 3B95A 3EU5A 4TRQA 4C0MA 3LJ3A 4ACKA 3PS6A 3AS8A 2CFUA 4WWNA 1UW4B 3WXXA 5ARFA 3EHRA 2XEEA 1K1AA 3FU6A 4H7YA 2YNQA 3DPYA 2XRZA 1G3NB 4EZLA 1KZPA 2ZXWE 4EPZA 4Q69A 3D9PA 1SA4A 2KM4A 3V30A 2IJGX 4ZHBA 4N3AA 2XZDG 2H6GA 2VJ8A 5AQ9A 3HG0D 2HYZA 1P5QA 3L13A 3RJVA 5KWDA 4R7LA 5JHAA 2L0TB 4L1BA 2C0MA 2FBNA 3FY4A 1H19A 1D8EA 2RFMA 1LD7A 1E8WA 4FJYA 3MEKA 4GTSA 3UPVA 5CRUA 3TGOA 3L22A 2QYJA 1MQSA 1TJFA 2F8XK 3DSTA 4I9CA 3SFXA 1TR4A 2X6IA 3ZHEB 3AJIA 4J8SA 3UM2A 2IFUA 3R7QA 3HRAA 3SFZA 4K03A 3RSEG 1IHGA 2IF4A 1BD8A 4L2LA 2GRPB 5IY5E 5AARA 4HRMB 2WXMA 4CT4A 3Q73A 4WUYA 3FHEA 4HI9A 3UMVA 3CHOA 3TWWA 5E75A 3RU0A 1K3ZD 3Q75A 5ENTD 3MKQB 4W9RA 3RRUA 1S64A 3KAEA 1NA3A 3ULYA 3UM0A 3W9GA 2RG8A 3KSQA 4HXIA 1WAO1 1YYHA 1KZOA 5AIJA 2IO3C 2QYUA 3TWSA 2J09A 5FT9A 2JLBA 3D9JA 3RAUA 3G2WA 2CG2A 5B3SE 3D9NA 3EJNA 3O48A 3PVLA 1WG0A 4GTTA 5EKQD 1HG5A 2ZGDA 3CHMA 4G8LA 1DVPA 1TNUA 2UY1B 1S70B 4C0EA 3UI2A 3VTXA 3UTMA 1HX8A 4BSXA 2Q7FA 1N4PA 2VTBB 1NL4A 1UN8A 3NOCD 4GZCA 3ASNE 1X81A 1B89A 2EIKE 4E85A 5LP0A 4CCAA 4JHRA 4APFA 5J90A 2XGSA 5D0OD 1RW2A 2CG3A 4A63B 3LY8A 3TG5A 3URZA 3SY2A 3FTZA 1Y6IA 1X5BA 1MHQA 3CQGB 3B7SA 2XEHA 5C2YA 5KJKA 3FUIA 3TWRA 2IO2C 4BX8A 4YDWA 2C2LA 4KVMA 5BPPA 1HS6A 4ATGA 3T8MA 4DX1A 3V79K 1NI1A 1H6PA 3KD7A 2Y0BG 3FWVA 4ANVA 5AAOA 1FPPA 2L9BA 3ML9A 4H7XA 4BT9A 3FUMA 3ZGQA 4G1TA 1EDUA 4GYYA 2XCBA 2B6CA 3CVPA 2I6HA 2DWZA 1OWPA 2Y69E 4DI4A 5AENA 1JCSA 1UG3A 4UI9K 4G11A 5AJDA 3QC1A 3FTWA 3HYMB 3UUXA 4Q94A 1U3CA 3PZ2A 4OYSA 1K8KG 2WXIA 2IU1A 3T5XA 3CVYA 4EBAA 1PC2A 4G23A 3ULQA 5FQ7A 4CYMD 3PUJA 3SHFA 5KJLA 1PY1A 3EIQC 1ZB1A 3OAWA 4U04A 2KZTB 3GW4A 2V4HC 4KT6B 3E32A 3ASOE 1QYMA 2AXUA 4TUUA 3E37A 3DEOA 4UWFA 3FUJA 2A5EA 3QOUA 3GYZA 3NQPA 2FI7A 3UKRG 3MV2B 5CMWA 4OVUA 5FQ4A 2R02A 3APDA 3ZYKA 2IOSA 3RO2A 3CEQA 4GB9A 1H6OA 3DRAA 1IXVA 4GYWA 4FHJA 4N3CA 3OXLA 3ZKJA 2V8SE 2AVPA 5ENPD 2RKKA 3QWVA 1NZNA 5LOZA 2NXPA 2R2LA 3PZ4A 3DPDA 4HOSA 4CEMA 4KVOA 1E96B 4F6RD 4U8YD 3ABME 3DSVA 3NOGD 4UI9C 3ASDA 3C3QA 1E7UA 3IHYA 3Q15A 1XNFA 3QB2A 2J07A 3G2VA 5BV1A 1H0AA 3QWWA 2NC9A 4LNBA 3I3NA 3B7TA 2OCCE 4EBAG 3ABKE 3CHSA 4KBQA 3I4RB 5AN8A 5BXOA 2BTDA 3SF4A 1YCSB 4U8HA 3TWUA 4CDNA 2J4DA 3Q7AA 4U0UA 3B7UX 1SVXA 3G2SA 4J8DA 4A3TA 4GA0A 3ESLA 3T8KA 3IV0A 2RD0A 2AWIA 2WXGA 4UI9J 2PM7A 1IQRA 3L54A 1JWGA 3S2AA 4OAVB 2P9PG 2CHWA 4GPKA 3CKBA 4FP7A 4FHKA 4BX9A 4TXPA 3CVUA 4NRHB 4KZCA 3FH8A 3PZ3A 3V2XA 4QFVA 3HXEA 4CRWA 2IONA 2X6HA 3I5PA 2BEDA 3QNKA 4ATZD 1VDYA 2VSOE 3CVWA 3ESKA 3B7BA 1JWFA 5FINA 1IKND 4GCOA 4K5CA 3ASHA 4JA9A 1ELWA 2LXMA 2XPIA 3C3RA 4N2QA 3PZ1A 3FUHA 3L6AA 3R9MA 4GPMA 2RFAA 1OWMA 3AG1E 4AXHA 5A6CA 3FTSA 3FUEA 4FULA 5BUZA 3JXIA 4HRNA 3TXNA 4MKTA 4B8CB 1TNZA 2WPVA 3ZEFA 3QAQA 5G2NA 4UUCA 2JABA 2WXRA 3FUFA 4NURA 3NAWA 2WXQA 2WXLA 3FUDA 3HVEB 2IQCA 4U96D 4PS8A 5A23A 4UWLA 2J4BA 2F8YA 3SO8A 2OVFA 2HE0A 4BESA 4O1PA 3AG2E 3FULA 4XIFA 5EIDA 4GZDA 2XPZA 3UT4A 4I1MA 2I1JA 4UQZA 4BTBA 5CMYA 5T8IA 3Q7FA 4Y6WA 3EIJA 2FULA 3CLJA 4HVBA 3E34A 4DRXE 3AS5A 3D9OA 2Y3AA 1D8DA 1O1SA 4A55A 4GA1A 3DSXA 2YQ8A 1N0RA 3CK9A 2I2OA 3LKUA 1OWLA 1H2TC 1FCHA 1LF8A 3CV0A 3ZXPA 4DK5A 4OAUC 4NIKA 3O4ZA 1TN7A 2I1KA 3DSUA 1MX2A 1Z5SC 4GA2A 3TWVA 4IRUA 2H6FA 4UQXA 3RRNB 4HNAD 1E90A 3IKOB 4WAFA 3TWXA 1OCZE 1E8XA 3C3OA 2XRYA 5FTPA 4XEIG 1FVHA 3Q47B 5AJLA 4KZ0A 3CHQA 3F6QA 1S0PA 4FLBA 4YNDA 3SQVA 4ILHB 2VYIA 3ZPJA 3GZ2A 2WVIA 4WWPA 1TN6A 2XCCA 5KNGA 3ZVVA 3HIZA 4HBDA 3ZFWA 2XHEA 4DX6D 2DYRE 5JA4D 3V2OA 2KCLA 4N2SA 5HKPA 1INZA 1TJCA 4M3OA 2WB2A 5LFAA 1PAQA 3IBEA 3EHNA 4JXTA 3L08A 1SQMA 2DVWA 4HLLA 1HH8A 5JJ6A 4JD2G 3EHMA 5ENNA 4M7CA 3LEWA 3DSWA 4BWRA 5M72A 5EX3A 3BG1B 1LTXA 1HO8A 3VLFA 4KMOA 3MKRA 4BETA 2CFZA 4TXQA 3X2QE 4AIFA 2X3MA 2KBXA 4DUIA 2MOWA 2YINA 3TWTA 5EYPF 5ANRA 4FA6A 4U95D 2FF4A 4HS2A 2PL2A 1NFIE 3Q5MA 2V5FA 1KT1A 1OY3D 2BUGA 3FEXA 2KCKA 4WWOA 3RKVA 2IY0C 3PDNA 3TWQA 2GRMA 4UWGA 2WQHA 1JUQA 3ML8A 3ZIMA 4LG6A 4J7WA 3LPZA 2WQ6A 1QBQA 3QKYA 5FZSA 4JL0A 4IULA 5ENQD 3SZ7A 1QZ2A 2FO1E 1Z3XA 2CHZA 4ILIA 2OEWA 4BTAA 4XE0A 1JCQA 2XEVA 3C72A 1EYHA 2V0PA 3R7RA 1ZU2A 3U64A 3IHVA 1BPOA 2PNNA 3PRZA 4F53A 2VSYA 5KCMA 5AQAA 2AXVA 1N52A 2VGXB 3TAXA 2UY1A 2BKGA 1OWOA 2DIWA 4U8VD 2IEJA 1BI8B 2QFCA 4WNDA 2VTBA 4TV3A 3CVNA 3HXDA 2KC7A 1IHBA 4HOUA 3L9TA 2WXHA 3ZUVB 2M63A 4C9BB 2F37A 3DBSA 3HDXA 3ZYMA 4L23A 5G04C 3SD5A 5JMND 4AM9A 5CCLA 3CK8A 1JPLA 4B93B 5FJYA 2DCPA 4J8EA 4GAAA 2AJAA 1N54A 3SBTB 4GMJA 2DYSE 4YDEA 3UM1A 4G8KA 1IYGA 2L6JA 2LXLA 5B1BE 5EIBE 3UT8A 2PZIA 4J6IA 3AG3E 4UWHA 4HFGA 3ONLA 4DI3A 4JHKA 2AXZA 1Z6TA 1FVFA 4RVBA 3KEZA 3NZSA 3MYVA 4GU5A 5D2MC 2E2EA 4GTOA 3CHPA 2VGEA 3VLEA 1N4SA 4BSZB 1OCOE 2R03A 1E8ZA 3PEVB 4L7TA 5G04J 5DBKA 3FTUA 3E33A 2XGOA 5BV0A 1EPUA 4JEUA 2JEKA 1A5EA 5FWQA 4XI9A 3NF1A 2GRLA 5EYLA 3ZU7B 3QDNA 3ZW3A 4DJAA 3NZUA 4ME2A 3SFYA 3AG4E 2LAHA 3R9AB 2VQ2A 4KYOB 5G05C 5EILA 3PH0C 1N11A 1MX6A 4HI8A 2ZGGA 3LVQE 4CGWA 1KT0A 5FZRA 4XX5A 3DSSA 3DEPA 1DC2A 3CQCB 2A5UA 2DZNA 4HOQA 1UOHA 4MBGA 4GZ5A 4C48B 2GRQB 3L17A 4XKCA 1HFAA 3LYAA 4FADA 1HXIA 1HU3A 2WQ7A 3BEEA 5D0QD 3APFA 4CDRA 3HXFA 3ZYLA 4K5AB 4U63A 4BT8A 1U2VG 3T9KA 3NB2A 4X8QA 3HXCA 5CBNA 5BXUA 4IN3B 3CR3A 4LERA 4CDMA 2KZTA 3G2UA 2GGFA 4N5CA 5KBAA 1BI7B 3CVQA 4ANWA 2P9LG 3RRMB 1ZBPA 4Y6CA 3J5QB 2MHKA 5ANLA 4JZYA 1KPSB 2B0OE 5G05J 3TJPA 3U4TA 3FFLA 3U66A 2X6JA 5CERB 2WXNA 1W3BA 2VSXE 1L5JA 4V3IA 3PE4A 3QARA 4ANXA 4I43A 4N5QA 2E0IA 1YMPA 4DPRA 1GW6A 1H6KA
chains in the Genus database with same CATH topology
5ENPD 4U8VD 4ATZD 5AQBA 3EHQA 2F8XK 1N0RA 1BI8B 3NOCD 1AWCB 5EYLA 3LJNA 3ZU7B 2ETBA 2XZTG 1TR4A 4ZFHA 3B7BA 1IHBA 1MX4A 5FINA 1IKND 2DZOA 4U8YD 4F6RD 5CBOA 4J8YA 2L6BA 4BEPA 3AJIA 4YDYA 3ZUVB 1BU9A 4K5CA 3NOGD 1MJ0A 4BETA 3JUEA 3HRAA 5EILA 4RLYA 1N11A 3NBNB 2KBXA 4F1PA 4NIKA 1MX6A 2F37A 4HI8A 5ENRD 4LSZE 4OAUC 2ZGGA 4DUIA 3JXJA 4A63B 4DX2A 1BD8A 3TWTA 5EYPF 4GPMA 5JMND 5CEAA 1MX2A 2RFAA 1N0QA 3DEPA 3D9HA 4HRMB 2ETAA 3B95A 4U95D 5AARA 3TWVA 1AP7A 2DZNA 4HNAD 1UOHA 2XEHA 3TWXA 1NFIE 4C48B 3JXIA 4HI9A 4HRNA 5ENOD 4HRLA 3ZNGA 4B93B 1WDYA 3V31A 4BERA 2J8SD 3TWRA 4UUCA 3KEAA 2JABA 3C5RA 2AJAA 5AN8A 1OY3D 4CYMD 5D66A 1DC2A 2KXPC 4K5AB 3TWWA 4YDWA 5BXOA 3EHRA 1K3ZD 5ITZF 2XEEA 5ENTD 4HQDA 3F6QA 1K1AA 2V5QC 3T9KA 4G8KA 4U96D 2QC9A 3UXGA 5CBNA 1K1BA 2F8YA 1YCSB 2MYOA 3TWQA 5BXUA 3TWUA 2P2CP 5EIBE 1G3NB 5HS0A 2V4HC 3SO8A 3Q9UC 2HE0A 1OT8A 4LG6A 3W9GA 4J7WA 4DX1A 4K5BA 3V79K 5KNGA 1SVXA 4HBDA 5KBAA 4BESA 4O1PA 2Y0BG 5ENQD 1QYMA 3J5PA 3AAAC 1YYHA 5AAOA 1BI7B 3V30A 5EIDA 4DX6D 2NYJA 5JA4D 4ZHBA 3DEOA 4LNUD 3V2OA 5HKPA 3IXEA 2FO1E 2XZDG 5CEDB 3TWSA 2A5EA 2BKKB 1DCQA 2ETCA 3HG0D 3J5QB 5AQ9A 3T8KA 2VGEA 1D9SA 5AQ7A 2B0OE 4CZ2D 1SW6A 1BLXB 5KWDA 4BSZB 2DVWA 4O60A 1WG0A 4DRXE 4OAVB 3W9FA 5FIOA 2ZGDA 5EN5D 4TUMA 5CERB 4HLLA 2PNNA 4HB5A 4G8LA 5ENSD 5KNHD 4DX5D 5CECB 2DWZA 5HRYA 1A5EA 3Q9NC 2RFMA 5AQAA 4QQIA 1MYOA 4O1OA 1S70B 1IXVA 4DX7D 4GMRA 2XENA 4JB8P 3UI2A 3UTMA 4N5QA 2Y1LE 1YMPA 3V2XA 4QFVA 4Z68A 3EU9A 2BKGA 3ZKJA 2QYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENP D;  4U8V D;  4ATZ D;  5AQB A;  3EHQ A;  2F8X K;  1N0R A;  1BI8 B;  3NOC D;  1AWC B;  5EYL A;  3LJN A;  3ZU7 B;  2ETB A;  2XZT G;  1TR4 A;  4ZFH A;  3B7B A;  1IHB A;  1MX4 A;  5FIN A;  1IKN D;  2DZO A;  4U8Y D;  4F6R D;  5CBO A;  4J8Y A;  2L6B A;  4BEP A;  3AJI A;  4YDY A;  3ZUV B;  1BU9 A;  4K5C A;  3NOG D;  1MJ0 A;  4BET A;  3JUE A;  3HRA A;  5EIL A;  4RLY A;  1N11 A;  3NBN B;  2KBX A;  4F1P A;  4NIK A;  1MX6 A;  2F37 A;  4HI8 A;  5ENR D;  4LSZ E;  4OAU C;  2ZGG A;  4DUI A;  3JXJ A;  4A63 B;  4DX2 A;  1BD8 A;  3TWT A;  5EYP F;  4GPM A;  5JMN D;  5CEA A;  1MX2 A;  2RFA A;  1N0Q A;  3DEP A;  3D9H A;  4HRM B;  2ETA A;  3B95 A;  4U95 D;  5AAR A;  3TWV A;  1AP7 A;  2DZN A;  4HNA D;  1UOH A;  2XEH A;  3TWX A;  1NFI E;  4C48 B;  3JXI A;  4HI9 A;  4HRN A;  5ENO D;  4HRL A;  3ZNG A;  4B93 B;  1WDY A;  3V31 A;  4BER A;  2J8S D;  3TWR A;  4UUC A;  3KEA A;  2JAB A;  3C5R A;  2AJA A;  5AN8 A;  1OY3 D;  4CYM D;  5D66 A;  1DC2 A;  2KXP C;  4K5A B;  3TWW A;  4YDW A;  5BXO A;  3EHR A;  1K3Z D;  5ITZ F;  2XEE A;  5ENT D;  4HQD A;  3F6Q A;  1K1A A;  2V5Q C;  3T9K A;  4G8K A;  4U96 D;  2QC9 A;  3UXG A;  5CBN A;  1K1B A;  2F8Y A;  1YCS B;  2MYO A;  3TWQ A;  5BXU A;  3TWU A;  2P2C P;  5EIB E;  1G3N B;  5HS0 A;  2V4H C;  3SO8 A;  3Q9U C;  2HE0 A;  1OT8 A;  4LG6 A;  3W9G A;  4J7W A;  4DX1 A;  4K5B A;  3V79 K;  5KNG A;  1SVX A;  4HBD A;  5KBA A;  4BES A;  4O1P A;  2Y0B G;  5ENQ D;  1QYM A;  3J5P A;  3AAA C;  1YYH A;  5AAO A;  1BI7 B;  3V30 A;  5EID A;  4DX6 D;  2NYJ A;  5JA4 D;  4ZHB A;  3DEO A;  4LNU D;  3V2O A;  5HKP A;  3IXE A;  2FO1 E;  2XZD G;  5CED B;  3TWS A;  2A5E A;  2BKK B;  1DCQ A;  2ETC A;  3HG0 D;  3J5Q B;  5AQ9 A;  3T8K A;  2VGE A;  1D9S A;  5AQ7 A;  2B0O E;  4CZ2 D;  1SW6 A;  1BLX B;  5KWD A;  4BSZ B;  2DVW A;  4O60 A;  1WG0 A;  4DRX E;  4OAV B;  3W9F A;  5FIO A;  2ZGD A;  5EN5 D;  4TUM A;  5CER B;  4HLL A;  2PNN A;  4HB5 A;  4G8L A;  5ENS D;  5KNH D;  4DX5 D;  5CEC B;  2DWZ A;  5HRY A;  1A5E A;  3Q9N C;  2RFM A;  5AQA A;  4QQI A;  1MYO A;  4O1O A;  1S70 B;  1IXV A;  4DX7 D;  4GMR A;  2XEN A;  4JB8 P;  3UI2 A;  3UTM A;  4N5Q A;  2Y1L E;  1YMP A;  3V2X A;  4QFV A;  4Z68 A;  3EU9 A;  2BKG A;  3ZKJ A;  2QYJ A; 
#chains in the Genus database with same CATH topology
 2LAI A;  3SGH A;  4WNE A;  3LJN A;  3FDH A;  1MX4 A;  3ZXS A;  2DZO A;  1KLX A;  3UIP C;  3FU5 A;  1ELK A;  1RZ4 A;  4DX2 A;  1TNY A;  3U3W A;  5CEA A;  2WXK A;  2ETA A;  4G2V A;  2HM8 A;  3FEY A;  1NP7 A;  5CCM A;  5FQ6 A;  5ENO D;  4HRL A;  2J49 A;  3RO3 A;  3ZNG A;  3E30 A;  2XQ0 A;  3V31 A;  4BER A;  3SNX A;  4I6G A;  3PEU B;  2PQN A;  2WXF A;  3UIN C;  3Q78 A;  2YHC A;  2WMO A;  3LDZ A;  4WNG A;  1K1B A;  1N94 A;  3LY7 A;  2P58 C;  3Q9U C;  1TNO A;  3BG0 B;  4I6J A;  3BU8 A;  2EIN E;  3HXB A;  5B1A E;  5BNW A;  2LSV A;  4MLP A;  3CHR A;  3AU5 A;  5EX0 A;  1Z3Y A;  4APO A;  2ETC A;  4MS6 A;  3OXG A;  4GTV A;  1D9S A;  5AQ7 A;  3EDT B;  3UX4 A;  3S7F A;  1N4R A;  4YVQ C;  3CGH A;  3GZS A;  1MZC A;  5CEC B;  4IYP A;  4ILG A;  4LRZ A;  1MYO A;  1NA0 A;  3U9W A;  4DLO A;  1OCC E;  4K0R A;  3PE3 A;  2VGY A;  4LEU A;  5G55 A;  4WNF A;  2WMN A;  1SZ9 A;  4L2Y A;  4CT0 A;  4ACL A;  3MA5 A;  3QK0 A;  4U0Z A;  2FO7 A;  1N9A A;  2LSU A;  3ZN3 A;  4OVV A;  4UWK A;  2PM6 A;  4BY6 A;  3FH5 A;  3UKU G;  3CIA A;  3NBN B;  4F1P A;  5ENR D;  1HG2 A;  4PUC A;  3OTN A;  4N3B A;  2XPY A;  4AVX A;  5HQ8 A;  4GYO A;  2C0L A;  4TXR A;  4AV7 A;  4F1S A;  3DXK G;  2J8S D;  3EUV A;  3FUK A;  4HQD A;  3UQ3 A;  2EIL E;  3CVL A;  3HVE A;  3QWP A;  3LVR E;  5HS0 A;  4FJZ A;  1OT8 A;  1TN8 A;  4B89 A;  3ENE A;  1TEZ A;  2GRR B;  3PNL B;  4I17 A;  3GZ1 A;  3JUI A;  3IXE A;  4B0Z A;  2BKK B;  4LUN U;  3CVX A;  1BLX B;  3K9I A;  2V4L A;  3PRE A;  3D9K A;  2OVB A;  3LXU X;  2WM9 A;  3G2T A;  5HRY A;  2IOL A;  2CHX A;  4QQI A;  3ZRH A;  1OXJ A;  1EF1 C;  1H2U A;  4HLE A;  3APC A;  2I9C A;  2Y1L E;  2A4Z A;  5LCW C;  3AU4 A;  3CST A;  4EEC A;  3BQO A;  3EHQ A;  3UIO C;  3SBS A;  5T4Y A;  2DBA A;  4I2W A;  4J8Y A;  2AW6 A;  2L6B A;  3AS4 A;  1BU9 A;  3FP3 A;  2NSZ A;  4AJW A;  3MJW A;  4ABN A;  3LS8 A;  2GRN B;  3JXJ A;  3CVV A;  4AOF A;  2J9Q A;  4JHJ A;  3MGB A;  4PS7 A;  4YVO A;  1N0Q A;  3D9I A;  3JCK C;  4GTQ A;  2L0I A;  1FT2 A;  3KEA A;  3WG7 E;  3ZHE A;  5ITZ F;  1YA0 A;  1HZ4 A;  4I9E A;  5KJN A;  1DCE A;  3RIB A;  3ZYQ A;  5LCW J;  2PQR A;  3FTY A;  2H6I A;  4FU3 A;  5ARG A;  2NYJ A;  3ASF A;  4GZ6 A;  1DCQ A;  1N4Q A;  3RK6 A;  3E4B A;  2P9K G;  4LNG A;  3MKQ A;  4TUM A;  4HB5 A;  5KNH D;  3MZL B;  2OEV A;  3MX3 A;  4EZJ A;  2EIJ E;  3LCA A;  4GMR A;  2ILR A;  4AP2 A;  4LCT A;  5AQB A;  4CGV A;  4UQY A;  5CHE E;  4JA7 A;  1UN9 A;  4PS3 A;  5CBO A;  2KCV A;  2J08 A;  3ISM C;  1V55 E;  3I4G A;  4E6H A;  4O6F A;  4A1S A;  3T5V A;  4XZ4 A;  1OCR E;  2OV8 A;  4NQ0 A;  1JCR A;  1AP7 A;  1UJJ A;  4PDX A;  1O1T A;  3LY9 A;  4JPS A;  1WDY A;  2HO1 A;  4JEH A;  1FT1 A;  2KXP C;  5AYW D;  1H2V C;  2V5Q C;  4F7A A;  1OWN A;  2KAT A;  2QC9 A;  4JW1 A;  3Q4A B;  4ANU A;  2P2C P;  5JJT A;  2OOE A;  3P1U A;  4AY6 A;  3ULE G;  4F3V A;  4PH4 B;  2EQX A;  4JC8 A;  1OUV A;  4KXK B;  4P29 A;  3TXM A;  2X38 A;  1HE8 A;  5T3R A;  5C1D A;  3FH7 A;  3W9F A;  5EN5 D;  3HHM A;  5ENS D;  5LX8 A;  1XGW A;  3OXF A;  4JVS A;  3Q9N C;  2GRO B;  1HF8 A;  3D9M A;  4RQI A;  4HOR A;  4HOT A;  2XEN A;  1V54 E;  2VGX A;  2WXP A;  2R05 A;  3FU3 A;  5JJ7 A;  4AEZ C;  4XI0 A;  2XZT G;  3VLD A;  4B8A A;  4ZFH A;  4URK A;  2QZA A;  3TG4 A;  2ZIS A;  4A1G A;  4YDY A;  4I2Z A;  3TL5 A;  3Q49 B;  1WM5 A;  3MCX A;  3D9L A;  1ELR A;  4GTM A;  2XS1 A;  2LO6 A;  1N95 A;  1TNB A;  3D9H A;  1E8Y A;  5BT1 A;  2R17 C;  4MRU A;  3CK7 A;  4G26 A;  1LD8 A;  5FZQ A;  3B13 A;  3VTY A;  5EDS A;  4RG9 A;  4EHM A;  3C5R A;  3UM3 A;  5D66 A;  3DWL G;  2LUH A;  4AY5 A;  5JHB A;  2P9I G;  3L16 A;  3D3M A;  4B94 A;  2P9U G;  2FEZ A;  3MV3 B;  5CRV A;  3JYS A;  4U0S A;  3Q79 A;  4BFR A;  5BW8 C;  3J5P A;  3BUA A;  4EQF A;  4J0U A;  4J8F A;  3S7J A;  4GTP A;  1DNP A;  3N71 A;  4CZ2 D;  1SW6 A;  2UWJ G;  3S7B A;  1SZA A;  2H6H A;  3KSL A;  5FQ8 A;  3C98 A;  4O1O A;  4DX7 D;  3FTX A;  1O5M A;  2P9S G;  4FLH A;  2F0Y A;  5J08 A;  1SA5 A;  4G24 A;  4U07 A;  2WXJ A;  1AWC B;  2EIM E;  2WXO A;  3CKC A;  5KJM A;  2MRI A;  4RG6 A;  1UJK A;  4BEP A;  2XS8 A;  1E7V A;  2R5S A;  4RLY A;  4D10 C;  1QQE A;  4N39 A;  4LSZ E;  1U3D A;  2Y4T A;  2VSN A;  3DXM G;  2R59 A;  2OND A;  3UT7 A;  4GCN A;  5H7P A;  1A17 A;  4L9P A;  4I1O B;  3B7R L;  5DIZ A;  4U7E B;  1TYQ G;  2QY7 A;  2XGM A;  3S7D A;  2ZIR A;  5E76 A;  3P2B A;  4G25 A;  3FTV A;  3UXG A;  3ASG A;  2MYO A;  3FUN A;  4Q96 A;  3ABL E;  4K5B A;  2LNI A;  4GML A;  5HI7 A;  3AAA C;  2YHE A;  4GTR A;  4I6E A;  4LNU D;  3PNT B;  5CED B;  3PZD A;  1O1R A;  1Y8M A;  4XKB A;  4DLQ A;  2X6F A;  4A3V A;  3IEG A;  4O60 A;  5FIO A;  2BF0 X;  4DX5 D;  5A7D B;  3CSF A;  2ZU6 B;  3SI5 A;  3ONK A;  1Q2Z A;  4JB8 P;  4GZ3 A;  4Z68 A;  3EU9 A;  4I1A A;  3JQ0 A;  3QJZ A;  1S63 A;  2Y4U A;  3KS2 A;  3L82 A;  3FU0 A;  4YDO A;  1IQU A;  4NAC A;  2GW1 A;  2ETB A;  1QNF A;  4RSY A;  4EZK A;  2HR2 A;  1MJ0 A;  1WY6 A;  3JUE A;  3JQ1 A;  4FC8 A;  3PUK A;  2X6K A;  2P9N G;  3B95 A;  3EU5 A;  4TRQ A;  4C0M A;  3LJ3 A;  4ACK A;  3PS6 A;  3AS8 A;  2CFU A;  4WWN A;  1UW4 B;  3WXX A;  5ARF A;  3EHR A;  2XEE A;  1K1A A;  3FU6 A;  4H7Y A;  2YNQ A;  3DPY A;  2XRZ A;  1G3N B;  4EZL A;  1KZP A;  2ZXW E;  4EPZ A;  4Q69 A;  3D9P A;  1SA4 A;  2KM4 A;  3V30 A;  2IJG X;  4ZHB A;  4N3A A;  2XZD G;  2H6G A;  2VJ8 A;  5AQ9 A;  3HG0 D;  2HYZ A;  1P5Q A;  3L13 A;  3RJV A;  5KWD A;  4R7L A;  5JHA A;  2L0T B;  4L1B A;  2C0M A;  2FBN A;  3FY4 A;  1H19 A;  1D8E A;  2RFM A;  1LD7 A;  1E8W A;  4FJY A;  3MEK A;  4GTS A;  3UPV A;  5CRU A;  3TGO A;  3L22 A;  2QYJ A;  1MQS A;  1TJF A;  2F8X K;  3DST A;  4I9C A;  3SFX A;  1TR4 A;  2X6I A;  3ZHE B;  3AJI A;  4J8S A;  3UM2 A;  2IFU A;  3R7Q A;  3HRA A;  3SFZ A;  4K03 A;  3RSE G;  1IHG A;  2IF4 A;  1BD8 A;  4L2L A;  2GRP B;  5IY5 E;  5AAR A;  4HRM B;  2WXM A;  4CT4 A;  3Q73 A;  4WUY A;  3FHE A;  4HI9 A;  3UMV A;  3CHO A;  3TWW A;  5E75 A;  3RU0 A;  1K3Z D;  3Q75 A;  5ENT D;  3MKQ B;  4W9R A;  3RRU A;  1S64 A;  3KAE A;  1NA3 A;  3ULY A;  3UM0 A;  3W9G A;  2RG8 A;  3KSQ A;  4HXI A;  1WAO 1;  1YYH A;  1KZO A;  5AIJ A;  2IO3 C;  2QYU A;  3TWS A;  2J09 A;  5FT9 A;  2JLB A;  3D9J A;  3RAU A;  3G2W A;  2CG2 A;  5B3S E;  3D9N A;  3EJN A;  3O48 A;  3PVL A;  1WG0 A;  4GTT A;  5EKQ D;  1HG5 A;  2ZGD A;  3CHM A;  4G8L A;  1DVP A;  1TNU A;  2UY1 B;  1S70 B;  4C0E A;  3UI2 A;  3VTX A;  3UTM A;  1HX8 A;  4BSX A;  2Q7F A;  1N4P A;  2VTB B;  1NL4 A;  1UN8 A;  3NOC D;  4GZC A;  3ASN E;  1X81 A;  1B89 A;  2EIK E;  4E85 A;  5LP0 A;  4CCA A;  4JHR A;  4APF A;  5J90 A;  2XGS A;  5D0O D;  1RW2 A;  2CG3 A;  4A63 B;  3LY8 A;  3TG5 A;  3URZ A;  3SY2 A;  3FTZ A;  1Y6I A;  1X5B A;  1MHQ A;  3CQG B;  3B7S A;  2XEH A;  5C2Y A;  5KJK A;  3FUI A;  3TWR A;  2IO2 C;  4BX8 A;  4YDW A;  2C2L A;  4KVM A;  5BPP A;  1HS6 A;  4ATG A;  3T8M A;  4DX1 A;  3V79 K;  1NI1 A;  1H6P A;  3KD7 A;  2Y0B G;  3FWV A;  4ANV A;  5AAO A;  1FPP A;  2L9B A;  3ML9 A;  4H7X A;  4BT9 A;  3FUM A;  3ZGQ A;  4G1T A;  1EDU A;  4GYY A;  2XCB A;  2B6C A;  3CVP A;  2I6H A;  2DWZ A;  1OWP A;  2Y69 E;  4DI4 A;  5AEN A;  1JCS A;  1UG3 A;  4UI9 K;  4G11 A;  5AJD A;  3QC1 A;  3FTW A;  3HYM B;  3UUX A;  4Q94 A;  1U3C A;  3PZ2 A;  4OYS A;  1K8K G;  2WXI A;  2IU1 A;  3T5X A;  3CVY A;  4EBA A;  1PC2 A;  4G23 A;  3ULQ A;  5FQ7 A;  4CYM D;  3PUJ A;  3SHF A;  5KJL A;  1PY1 A;  3EIQ C;  1ZB1 A;  3OAW A;  4U04 A;  2KZT B;  3GW4 A;  2V4H C;  4KT6 B;  3E32 A;  3ASO E;  1QYM A;  2AXU A;  4TUU A;  3E37 A;  3DEO A;  4UWF A;  3FUJ A;  2A5E A;  3QOU A;  3GYZ A;  3NQP A;  2FI7 A;  3UKR G;  3MV2 B;  5CMW A;  4OVU A;  5FQ4 A;  2R02 A;  3APD A;  3ZYK A;  2IOS A;  3RO2 A;  3CEQ A;  4GB9 A;  1H6O A;  3DRA A;  1IXV A;  4GYW A;  4FHJ A;  4N3C A;  3OXL A;  3ZKJ A;  2V8S E;  2AVP A;  5ENP D;  2RKK A;  3QWV A;  1NZN A;  5LOZ A;  2NXP A;  2R2L A;  3PZ4 A;  3DPD A;  4HOS A;  4CEM A;  4KVO A;  1E96 B;  4F6R D;  4U8Y D;  3ABM E;  3DSV A;  3NOG D;  4UI9 C;  3ASD A;  3C3Q A;  1E7U A;  3IHY A;  3Q15 A;  1XNF A;  3QB2 A;  2J07 A;  3G2V A;  5BV1 A;  1H0A A;  3QWW A;  2NC9 A;  4LNB A;  3I3N A;  3B7T A;  2OCC E;  4EBA G;  3ABK E;  3CHS A;  4KBQ A;  3I4R B;  5AN8 A;  5BXO A;  2BTD A;  3SF4 A;  1YCS B;  4U8H A;  3TWU A;  4CDN A;  2J4D A;  3Q7A A;  4U0U A;  3B7U X;  1SVX A;  3G2S A;  4J8D A;  4A3T A;  4GA0 A;  3ESL A;  3T8K A;  3IV0 A;  2RD0 A;  2AWI A;  2WXG A;  4UI9 J;  2PM7 A;  1IQR A;  3L54 A;  1JWG A;  3S2A A;  4OAV B;  2P9P G;  2CHW A;  4GPK A;  3CKB A;  4FP7 A;  4FHK A;  4BX9 A;  4TXP A;  3CVU A;  4NRH B;  4KZC A;  3FH8 A;  3PZ3 A;  3V2X A;  4QFV A;  3HXE A;  4CRW A;  2ION A;  2X6H A;  3I5P A;  2BED A;  3QNK A;  4ATZ D;  1VDY A;  2VSO E;  3CVW A;  3ESK A;  3B7B A;  1JWF A;  5FIN A;  1IKN D;  4GCO A;  4K5C A;  3ASH A;  4JA9 A;  1ELW A;  2LXM A;  2XPI A;  3C3R A;  4N2Q A;  3PZ1 A;  3FUH A;  3L6A A;  3R9M A;  4GPM A;  2RFA A;  1OWM A;  3AG1 E;  4AXH A;  5A6C A;  3FTS A;  3FUE A;  4FUL A;  5BUZ A;  3JXI A;  4HRN A;  3TXN A;  4MKT A;  4B8C B;  1TNZ A;  2WPV A;  3ZEF A;  3QAQ A;  5G2N A;  4UUC A;  2JAB A;  2WXR A;  3FUF A;  4NUR A;  3NAW A;  2WXQ A;  2WXL A;  3FUD A;  3HVE B;  2IQC A;  4U96 D;  4PS8 A;  5A23 A;  4UWL A;  2J4B A;  2F8Y A;  3SO8 A;  2OVF A;  2HE0 A;  4BES A;  4O1P A;  3AG2 E;  3FUL A;  4XIF A;  5EID A;  4GZD A;  2XPZ A;  3UT4 A;  4I1M A;  2I1J A;  4UQZ A;  4BTB A;  5CMY A;  5T8I A;  3Q7F A;  4Y6W A;  3EIJ A;  2FUL A;  3CLJ A;  4HVB A;  3E34 A;  4DRX E;  3AS5 A;  3D9O A;  2Y3A A;  1D8D A;  1O1S A;  4A55 A;  4GA1 A;  3DSX A;  2YQ8 A;  1N0R A;  3CK9 A;  2I2O A;  3LKU A;  1OWL A;  1H2T C;  1FCH A;  1LF8 A;  3CV0 A;  3ZXP A;  4DK5 A;  4OAU C;  4NIK A;  3O4Z A;  1TN7 A;  2I1K A;  3DSU A;  1MX2 A;  1Z5S C;  4GA2 A;  3TWV A;  4IRU A;  2H6F A;  4UQX A;  3RRN B;  4HNA D;  1E90 A;  3IKO B;  4WAF A;  3TWX A;  1OCZ E;  1E8X A;  3C3O A;  2XRY A;  5FTP A;  4XEI G;  1FVH A;  3Q47 B;  5AJL A;  4KZ0 A;  3CHQ A;  3F6Q A;  1S0P A;  4FLB A;  4YND A;  3SQV A;  4ILH B;  2VYI A;  3ZPJ A;  3GZ2 A;  2WVI A;  4WWP A;  1TN6 A;  2XCC A;  5KNG A;  3ZVV A;  3HIZ A;  4HBD A;  3ZFW A;  2XHE A;  4DX6 D;  2DYR E;  5JA4 D;  3V2O A;  2KCL A;  4N2S A;  5HKP A;  1INZ A;  1TJC A;  4M3O A;  2WB2 A;  5LFA A;  1PAQ A;  3IBE A;  3EHN A;  4JXT A;  3L08 A;  1SQM A;  2DVW A;  4HLL A;  1HH8 A;  5JJ6 A;  4JD2 G;  3EHM A;  5ENN A;  4M7C A;  3LEW A;  3DSW A;  4BWR A;  5M72 A;  5EX3 A;  3BG1 B;  1LTX A;  1HO8 A;  3VLF A;  4KMO A;  3MKR A;  4BET A;  2CFZ A;  4TXQ A;  3X2Q E;  4AIF A;  2X3M A;  2KBX A;  4DUI A;  2MOW A;  2YIN A;  3TWT A;  5EYP F;  5ANR A;  4FA6 A;  4U95 D;  2FF4 A;  4HS2 A;  2PL2 A;  1NFI E;  3Q5M A;  2V5F A;  1KT1 A;  1OY3 D;  2BUG A;  3FEX A;  2KCK A;  4WWO A;  3RKV A;  2IY0 C;  3PDN A;  3TWQ A;  2GRM A;  4UWG A;  2WQH A;  1JUQ A;  3ML8 A;  3ZIM A;  4LG6 A;  4J7W A;  3LPZ A;  2WQ6 A;  1QBQ A;  3QKY A;  5FZS A;  4JL0 A;  4IUL A;  5ENQ D;  3SZ7 A;  1QZ2 A;  2FO1 E;  1Z3X A;  2CHZ A;  4ILI A;  2OEW A;  4BTA A;  4XE0 A;  1JCQ A;  2XEV A;  3C72 A;  1EYH A;  2V0P A;  3R7R A;  1ZU2 A;  3U64 A;  3IHV A;  1BPO A;  2PNN A;  3PRZ A;  4F53 A;  2VSY A;  5KCM A;  5AQA A;  2AXV A;  1N52 A;  2VGX B;  3TAX A;  2UY1 A;  2BKG A;  1OWO A;  2DIW A;  4U8V D;  2IEJ A;  1BI8 B;  2QFC A;  4WND A;  2VTB A;  4TV3 A;  3CVN A;  3HXD A;  2KC7 A;  1IHB A;  4HOU A;  3L9T A;  2WXH A;  3ZUV B;  2M63 A;  4C9B B;  2F37 A;  3DBS A;  3HDX A;  3ZYM A;  4L23 A;  5G04 C;  3SD5 A;  5JMN D;  4AM9 A;  5CCL A;  3CK8 A;  1JPL A;  4B93 B;  5FJY A;  2DCP A;  4J8E A;  4GAA A;  2AJA A;  1N54 A;  3SBT B;  4GMJ A;  2DYS E;  4YDE A;  3UM1 A;  4G8K A;  1IYG A;  2L6J A;  2LXL A;  5B1B E;  5EIB E;  3UT8 A;  2PZI A;  4J6I A;  3AG3 E;  4UWH A;  4HFG A;  3ONL A;  4DI3 A;  4JHK A;  2AXZ A;  1Z6T A;  1FVF A;  4RVB A;  3KEZ A;  3NZS A;  3MYV A;  4GU5 A;  5D2M C;  2E2E A;  4GTO A;  3CHP A;  2VGE A;  3VLE A;  1N4S A;  4BSZ B;  1OCO E;  2R03 A;  1E8Z A;  3PEV B;  4L7T A;  5G04 J;  5DBK A;  3FTU A;  3E33 A;  2XGO A;  5BV0 A;  1EPU A;  4JEU A;  2JEK A;  1A5E A;  5FWQ A;  4XI9 A;  3NF1 A;  2GRL A;  5EYL A;  3ZU7 B;  3QDN A;  3ZW3 A;  4DJA A;  3NZU A;  4ME2 A;  3SFY A;  3AG4 E;  2LAH A;  3R9A B;  2VQ2 A;  4KYO B;  5G05 C;  5EIL A;  3PH0 C;  1N11 A;  1MX6 A;  4HI8 A;  2ZGG A;  3LVQ E;  4CGW A;  1KT0 A;  5FZR A;  4XX5 A;  3DSS A;  3DEP A;  1DC2 A;  3CQC B;  2A5U A;  2DZN A;  4HOQ A;  1UOH A;  4MBG A;  4GZ5 A;  4C48 B;  2GRQ B;  3L17 A;  4XKC A;  1HFA A;  3LYA A;  4FAD A;  1HXI A;  1HU3 A;  2WQ7 A;  3BEE A;  5D0Q D;  3APF A;  4CDR A;  3HXF A;  3ZYL A;  4K5A B;  4U63 A;  4BT8 A;  1U2V G;  3T9K A;  3NB2 A;  4X8Q A;  3HXC A;  5CBN A;  5BXU A;  4IN3 B;  3CR3 A;  4LER A;  4CDM A;  2KZT A;  3G2U A;  2GGF A;  4N5C A;  5KBA A;  1BI7 B;  3CVQ A;  4ANW A;  2P9L G;  3RRM B;  1ZBP A;  4Y6C A;  3J5Q B;  2MHK A;  5ANL A;  4JZY A;  1KPS B;  2B0O E;  5G05 J;  3TJP A;  3U4T A;  3FFL A;  3U66 A;  2X6J A;  5CER B;  2WXN A;  1W3B A;  2VSX E;  1L5J A;  4V3I A;  3PE4 A;  3QAR A;  4ANX A;  4I43 A;  4N5Q A;  2E0I A;  1YMP A;  4DPR A;  1GW6 A;  1H6K A; 
#chains in the Genus database with same CATH homology
 5ENP D;  4U8V D;  4ATZ D;  5AQB A;  3EHQ A;  2F8X K;  1N0R A;  1BI8 B;  3NOC D;  1AWC B;  5EYL A;  3LJN A;  3ZU7 B;  2ETB A;  2XZT G;  1TR4 A;  4ZFH A;  3B7B A;  1IHB A;  1MX4 A;  5FIN A;  1IKN D;  2DZO A;  4U8Y D;  4F6R D;  5CBO A;  4J8Y A;  2L6B A;  4BEP A;  3AJI A;  4YDY A;  3ZUV B;  1BU9 A;  4K5C A;  3NOG D;  1MJ0 A;  4BET A;  3JUE A;  3HRA A;  5EIL A;  4RLY A;  1N11 A;  3NBN B;  2KBX A;  4F1P A;  4NIK A;  1MX6 A;  2F37 A;  4HI8 A;  5ENR D;  4LSZ E;  4OAU C;  2ZGG A;  4DUI A;  3JXJ A;  4A63 B;  4DX2 A;  1BD8 A;  3TWT A;  5EYP F;  4GPM A;  5JMN D;  5CEA A;  1MX2 A;  2RFA A;  1N0Q A;  3DEP A;  3D9H A;  4HRM B;  2ETA A;  3B95 A;  4U95 D;  5AAR A;  3TWV A;  1AP7 A;  2DZN A;  4HNA D;  1UOH A;  2XEH A;  3TWX A;  1NFI E;  4C48 B;  3JXI A;  4HI9 A;  4HRN A;  5ENO D;  4HRL A;  3ZNG A;  4B93 B;  1WDY A;  3V31 A;  4BER A;  2J8S D;  3TWR A;  4UUC A;  3KEA A;  2JAB A;  3C5R A;  2AJA A;  5AN8 A;  1OY3 D;  4CYM D;  5D66 A;  1DC2 A;  2KXP C;  4K5A B;  3TWW A;  4YDW A;  5BXO A;  3EHR A;  1K3Z D;  5ITZ F;  2XEE A;  5ENT D;  4HQD A;  3F6Q A;  1K1A A;  2V5Q C;  3T9K A;  4G8K A;  4U96 D;  2QC9 A;  3UXG A;  5CBN A;  1K1B A;  2F8Y A;  1YCS B;  2MYO A;  3TWQ A;  5BXU A;  3TWU A;  2P2C P;  5EIB E;  1G3N B;  5HS0 A;  2V4H C;  3SO8 A;  3Q9U C;  2HE0 A;  1OT8 A;  4LG6 A;  3W9G A;  4J7W A;  4DX1 A;  4K5B A;  3V79 K;  5KNG A;  1SVX A;  4HBD A;  5KBA A;  4BES A;  4O1P A;  2Y0B G;  5ENQ D;  1QYM A;  3J5P A;  3AAA C;  1YYH A;  5AAO A;  1BI7 B;  3V30 A;  5EID A;  4DX6 D;  2NYJ A;  5JA4 D;  4ZHB A;  3DEO A;  4LNU D;  3V2O A;  5HKP A;  3IXE A;  2FO1 E;  2XZD G;  5CED B;  3TWS A;  2A5E A;  2BKK B;  1DCQ A;  2ETC A;  3HG0 D;  3J5Q B;  5AQ9 A;  3T8K A;  2VGE A;  1D9S A;  5AQ7 A;  2B0O E;  4CZ2 D;  1SW6 A;  1BLX B;  5KWD A;  4BSZ B;  2DVW A;  4O60 A;  1WG0 A;  4DRX E;  4OAV B;  3W9F A;  5FIO A;  2ZGD A;  5EN5 D;  4TUM A;  5CER B;  4HLL A;  2PNN A;  4HB5 A;  4G8L A;  5ENS D;  5KNH D;  4DX5 D;  5CEC B;  2DWZ A;  5HRY A;  1A5E A;  3Q9N C;  2RFM A;  5AQA A;  4QQI A;  1MYO A;  4O1O A;  1S70 B;  1IXV A;  4DX7 D;  4GMR A;  2XEN A;  4JB8 P;  3UI2 A;  3UTM A;  4N5Q A;  2Y1L E;  1YMP A;  3V2X A;  4QFV A;  4Z68 A;  3EU9 A;  2BKG A;  3ZKJ A;  2QYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...