2F8YA

Crystal structure of human notch1 ankyrin repeats to 1.55a resolution.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
215
Chain Sequence
AVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for cooperativity in recruitment of MAML coactivators to Notch transcription complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Notch homolog 1, translocation-associated (Drosophila)
total genus 79
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2f8yA00
5AN8A 1N11A 2Y0BG 5CECB 1OT8A 3V31A 1WDYA 4J7WA 1G3NB 1N0QA 3JUEA 4K5AB 2FO1E 3TWRA 3TWUA 4G8LA 2RFAA 1MX2A 4U8YD 4N5QA 3AJIA 1S70B 5ENSD 1MX4A 2PNNA 2RFMA 3JXJA 1MYOA 1BD8A 4HNAD 3TWSA 1AWCB 1BU9A 4LSZE 3ZNGA 4ATZD 5CEDB 5FINA 4JB8P 5BXOA 2F37A 1IKND 2KXPC 4A63B 3B95A 4OAVB 4U96D 1MJ0A 5HS0A 4CYMD 2ZGDA 3V2OA 2ETAA 5HKPA 5KWDA 1D9SA 2DZOA 1BI8B 4TUMA 4UUCA 4YDYA 5KNHD 4BETA 1YCSB 4LNUD 3B7BA 3W9GA 1BLXB 1UOHA 1DC2A 5EYLA 3IXEA 1SW6A 5EN5D 4C48B 2JABA 3AAAC 4DX6D 4HLLA 3W9FA 3UXGA 3Q9UC 5FIOA 3V30A 1A5EA 2P2CP 3DEPA 2QC9A 5AQAA 5ENPD 2Y1LE 1K3ZD 2L6BA 1YMPA 2NYJA 4GMRA 3NOGD 4ZFHA 2A5EA 4QQIA 4BSZB 3DEOA 2ETCA 4U8VD 3NOCD 4DX7D 4DX2A 4HI8A 5AQ9A 3EU9A 5CBOA 5D66A 5ENTD 3UI2A 4U95D 5CERB 5ENQD 1BI7B 4YDWA 1AP7A 5EIDA 1IHBA 2DWZA 4O60A 4F1PA 1K1AA 2DVWA 5JMND 4HBDA 5CEAA 3HRAA 5CBNA 4RLYA 5HRYA 2F8YA 3D9HA 2BKKB 4OAUC 2HE0A 1IXVA 2J8SD 4ZHBA 4NIKA 3F6QA 1QYMA 1N0RA 2ETBA 4O1OA 3UTMA 1YYHA 3Q9NC 4BERA 4QFVA 5KNGA 2XZDG 3V2XA 3TWQA 2QYJA 4G8KA 4CZ2D 3V79K 2MYOA 4HRLA 3TWVA 5BXUA 5EYPF 1DCQA 2DZNA 5KBAA 2V5QC 3HG0D 3TWWA 4BESA 2B0OE 2XEHA 2KBXA 3LJNA 1TR4A 4LG6A 2XENA 5AAOA 3SO8A 4HB5A 2XEEA 1MX6A 3T8KA 4DX1A 5ITZF 4J8YA 3KEAA 4DX5D 1SVXA 3EHQA 3NBNB 3ZU7B 3T9KA 3ZKJA 2VGEA 3TWTA 3J5QB 1K1BA 5ENOD 4HQDA 4HRMB 5EILA 2AJAA 5AARA 4K5BA 2XZTG 5AQBA 2BKGA 4O1PA 2V4HC 4BEPA 4F6RD 5AQ7A 3TWXA 2ZGGA 4HI9A 4Z68A 2F8XK 3EHRA 3J5PA 1OY3D 4K5CA 1WG0A 5ENRD 4HRNA 3ZUVB 4DUIA 5JA4D 4GPMA 3JXIA 1NFIE 5EIBE 4DRXE 3C5RA 4B93B
chains in the Genus database with same CATH superfamily
5AN8A 2AXZA 5LOZA 4Y6CA 3ZW3A 3BU8A 3ULYA 2FO1E 5CMYA 4JHJA 1SA4A 4I6EA 2I9CA 2NC9A 2XHEA 3ZNGA 3NB2A 1U3CA 1E8WA 3ML8A 4HORA 2Y4UA 3CK9A 4DLOA 3UM3A 3AU4A 3PZDA 2CHXA 5A7DB 4GTVA 3PNLB 5FZRA 3CHMA 4BSZB 3ZIMA 3IEGA 4EZKA 1V55E 1E90A 2Y69E 4WNDA 4AY6A 4PH4B 3SBSA 3FU0A 5AYWD 2A4ZA 4CT0A 1KPSB 4ZHBA 4F3VA 1U2VG 3DSTA 3GZSA 2XCBA 2LNIA 3OXGA 1N4RA 5ITZF 3Q7FA 3U66A 4J8SA 4M3OA 5EKQD 4K5BA 4OVUA 4GCOA 1KZOA 5AENA 1H2VC 5KJLA 2EIKE 1FPPA 2Y0BG 4OYSA 5BUZA 1MQSA 3L08A 3MV2B 3PEVB 4ANUA 2J08A 3D9PA 4LSZE 4HS2A 4UWGA 5D0OD 5HS0A 1TEZA 2DBAA 4TUMA 2FO7A 4B8AA 1YCSB 4ME2A 1OXJA 1NL4A 4A1SA 2VYIA 4LRZA 4EBAA 5EX0A 1HZ4A 2H6GA 3FUFA 4GMRA 5BV0A 3ASDA 4DX7D 3IBEA 3LS8A 1OCOE 4HI8A 3EU9A 2BF0X 4Q69A 4AY5A 1N9AA 5M72A 3OAWA 4JXTA 3D9JA 4UWHA 3Q5MA 3TL5A 2LAHA 1IHGA 3NAWA 3UINC 1TJFA 1TR4A 3FTSA 1LTXA 3AG1E 1Z5SC 3U3WA 2ZXWE 3PZ4A 1Q2ZA 4A3TA 4J8FA 2J4BA 2WM9A 4U8HA 4XX5A 3J5PA 5J90A 1RW2A 4XKBA 2UY1A 3SQVA 4JVSA 4N3CA 4XE0A 3KAEA 2R05A 2WXOA 3CVUA 3CSFA 4Q96A 1OWNA 2HR2A 4U8YD 1S63A 2VTBB 2RFMA 5CRUA 4E6HA 4F1SA 4B0ZA 2ZIRA 4GTPA 2HYZA 1EYHA 4U07A 5ANLA 1BLXB 2L0TB 3E4BA 4L2LA 4GCNA 5KJNA 3CIAA 1HG2A 4FADA 3LVRE 1H6OA 3B7TA 2WMNA 3UM1A 3FP3A 3SY2A 2IFUA 3UI2A 2KCKA 5EIDA 3ZXSA 2DVWA 5CEAA 2J4DA 3PEUB 3MJWA 2J9QA 1Y8MA 4N2SA 4NIKA 2A5UA 4GZCA 3C3QA 2V8SE 3DXMG 3ASOE 1TNBA 5AJDA 1FCHA 3ULQA 3HVEB 4AOFA 1DCQA 3SF4A 3CHSA 3S7JA 3LJNA 1SQMA 5BNWA 4GB9A 3MKQB 1B89A 2DIWA 3HXEA 4RG9A 4UWKA 3B7UX 3L54A 4I17A 1OY3D 5ENRD 1JUQA 2B6CA 2WXRA 4FJZA 5C1DA 2GROB 5FQ6A 2Y3AA 2QY7A 2VSOE 2PM6A 4G26A 1HX8A 3JXJA 4XEIG 1AWCB 3ASNE 2BUGA 3PH0C 2RD0A 4M7CA 4U96D 1DC2A 3CK7A 3B7SA 5EYLA 4JEHA 3RSEG 3LDZA 4EECA 2AXUA 3ZN3A 4AVXA 3PREA 3DEPA 2IO3C 3BQOA 1ZBPA 2FULA 3NOCD 4JA9A 5D0QD 1AP7A 1PC2A 4F1PA 3D9LA 3HXCA 2CFZA 1OWLA 1IQRA 4JD2G 1UN9A 4LNGA 4MBGA 2Y4TA 4G24A 3R7RA 3CVYA 2KCLA 4BESA 4I43A 5AAOA 2PL2A 3FH7A 3Q49B 5BPPA 5G04J 1EDUA 2X6KA 3WXXA 3ZGQA 3KS2A 1WM5A 1N52A 3I3NA 1HO8A 2EQXA 5AQBA 1LD8A 4N5CA 2WXKA 3K9IA 5IY5E 4HI9A 4ILGA 3MKQA 2WB2A 1PAQA 1XGWA 3PE3A 1H2UA 4U63A 1OT8A 2YNQA 3UIPC 1N0QA 3JUEA 4JA7A 3KSQA 1EPUA 4I9CA 5ENSD 5HI7A 1KZPA 4TV3A 3ESKA 1QZ2A 2VGYA 2NSZA 3LJ3A 3S7FA 2KXPC 4Y6WA 3AS8A 5KWDA 2IEJA 3QWWA 1TN6A 4I9EA 3PNTB 2JABA 4UQXA 5B1AE 3W9FA 2P2CP 2GRNB 4XIFA 1YMPA 4GZDA 3L9TA 3U64A 1WY6A 3EHNA 5ENTD 3SFZA 5EDSA 5ENQD 4GTSA 3ZHEB 3KD7A 4U7EB 4U0UA 2WXJA 2P9NG 3RRNB 2R5SA 3SZ7A 4FA6A 2GRPB 4XI0A 3L22A 4UWLA 3V79K 2I1JA 2J07A 5BXUA 2DZNA 4RSYA 2XEHA 2R02A 2WXHA 4GZ5A 5HQ8A 4GA0A 4AM9A 2I1KA 3HYMB 3FY4A 1HS6A 3NQPA 3T8MA 3DSXA 3TWTA 4BFRA 3PZ1A 3S7DA 5ENNA 4JHKA 4EQFA 2WMOA 2V4HC 4H7XA 4K5CA 4AXHA 2L0IA 4HRNA 3ABKE 1Y6IA 5E76A 4RQIA 4WWOA 1WDYA 3U4TA 2EILE 1OCCE 1KLXA 4H7YA 3ABLE 4N39A 1MX2A 1N95A 1JCSA 1S70B 1OUVA 3DWLG 4URKA 2X6IA 3PRZA 4I2ZA 4BWRA 3CHPA 4KVOA 2F37A 4UI9K 5G05J 3P2BA 1W3BA 3TJPA 4GTRA 5T3RA 4BY6A 3EHMA 3DSSA 3HIZA 1A5EA 3DSUA 1DCEA 2Y1LE 1TYQG 2L6BA 2JLBA 2XCCA 2VSNA 3TG5A 1FT2A 1O1TA 4ANWA 4ANXA 4OVVA 4UQZA 5AQ9A 3DBSA 1SZAA 4TUUA 2R17C 2H6IA 3VLFA 4O60A 4HOTA 3TGOA 1N4SA 4GYYA 4RLYA 3URZA 3O4ZA 5J08A 3CHRA 4E85A 4L23A 4BERA 4WAFA 2L9BA 2XPYA 3SFXA 2V5FA 1MZCA 4J8EA 1S0PA 3Q73A 3SO8A 4I2WA 1MX6A 5ANRA 4KZ0A 1S64A 2OVFA 3J5QB 5LCWC 1H19A 2GGFA 3WG7E 3EIJA 5AIJA 2KM4A 2WQ6A 4WWPA 2XRYA 1H2TC 2XZTG 3QC1A 4FHKA 3DSVA 4GAAA 3AG2E 1JPLA 3CR3A 3E30A 1NFIE 2AVPA 5CCLA 3EU5A 4C0EA 4L7TA 3ASHA 3D9KA 3QAQA 3V31A 2AWIA 3FULA 4XI9A 5G2NA 3TWUA 3ZXPA 3QK0A 2IOLA 2H6HA 2PNNA 4UI9J 4AEZC 3O48A 3CHQA 4JB8P 3SBTB 4JC8A 3B13A 3CKBA 2XGMA 3IXEA 3NZSA 1QQEA 3AG3E 4APOA 3IHVA 4DX6D 1UJJA 3FU6A 2WXGA 4N3BA 5KCMA 5DIZA 2FF4A 1K3ZD 3KEZA 3DXKG 2XS8A 4I6JA 4CRWA 2BEDA 1HG5A 4WUYA 3CVWA 3RKVA 3RAUA 2ETBA 5DBKA 4PS7A 3SFYA 1E8ZA 2X38A 5EX3A 3SGHA 5EYPF 1DVPA 4JPSA 4WNEA 3CVPA 2XEEA 4ABNA 4UI9C 2XRZA 3ASFA 3ZKJA 3DPYA 3FHEA 4BEPA 4MLPA 1WG0A 5EIBE 1TN8A 1X81A 3Q15A 2KCVA 1QNFA 1QBQA 1NZNA 5FTPA 4GMLA 2CG3A 3AJIA 4YNDA 3ZRHA 3B7RL 3ULEG 5FQ4A 2X6JA 2J09A 4GTTA 3T5VA 3PZ2A 2I2OA 2P9KG 1RZ4A 1GW6A 1KT1A 2ETAA 2KZTA 4LNUD 4F53A 3FUHA 4F7AA 4KBQA 3UXGA 5FIOA 1H6PA 5ENPD 5LFAA 2WVIA 3CLJA 2OOEA 3MX3A 3UPVA 3E34A 4D10C 2LO6A 1HXIA 3FUKA 4EPZA 2F8YA 2C2LA 3ASGA 2QFCA 1IXVA 2J8SD 3ZVVA 3F6QA 3APCA 1E96B 3JQ1A 1IYGA 4G8KA 4MKTA 1TNZA 4G2VA 3ISMC 5G55A 2V5QC 3C3OA 2RG8A 2XENA 4DX1A 4CDRA 4LEUA 4MS6A 4HRMB 2AJAA 5AARA 4CDNA 2LXMA 2IO2C 4XKCA 4F6RD 2X3MA 5BW8C 4N3AA 1NA3A 2GRRB 3OTNA 4TXPA 1IQUA 2QYUA 1ZB1A 3Q7AA 1MYOA 1NA0A 3TWSA 1TNUA 5CCMA 3ZYMA 3JCKC 4LUNU 4UQYA 1IKND 2HM8A 4KZCA 2BTDA 3PUKA 2ZGDA 2ZU6B 1TJCA 1INZA 4C48B 4G25A 3MKRA 4B89A 2NXPA 5LX8A 4WWNA 2X6FA 2A5EA 4U0ZA 3QWVA 5CBOA 5CMWA 1OCZE 1X5BA 4KT6B 4C0MA 3D9MA 5BV1A 3TAXA 3PS6A 3D3MA 3PUJA 3VLDA 2DYRE 4MRUA 4B94A 4P29A 3FTXA 2VJ8A 3Q9NC 3ML9A 2XZDG 4IRUA 2QYJA 4CZ2D 2WQ7A 3UMVA 3DSWA 5C2YA 2ZISA 3L17A 3ZU7B 4CCAA 2WXPA 4JW1A 4I1MA 3NF1A 3RU0A 1ZU2A 4O1PA 2UWJG 3CSTA 3AG4E 4U04A 1E8YA 1D8DA 3APDA 3FUMA 4EBAG 1PY1A 5KJKA 3UIOC 1G3NB 4JHRA 2DYSE 1JCQA 2RFAA 4G23A 3NZUA 1MX4A 3HHMA 2H6FA 4BT8A 5JHAA 4KMOA 5CEDB 3B95A 2OEVA 3MGBA 4FJYA 4NQ0A 3MCXA 4YDYA 2MOWA 1UOHA 5EN5D 2LUHA 4HLLA 5FT9A 1ELKA 2C0MA 2XPIA 3Q4AB 2PQRA 4K0RA 2NYJA 2P9PG 1O5MA 3JYSA 3R7QA 3FH5A 1EF1C 2QZAA 2KC7A 3MV3B 3UT7A 3UKUG 4OAUC 5A6CA 1Z3YA 3UUXA 4APFA 4IN3B 3GZ1A 4FC8A 1N0RA 2WPVA 3ENEA 4V3IA 3LCAA 3FTZA 2R03A 3CV0A 3D9NA 4LG6A 3FTWA 3I4GA 1P5QA 3EUVA 4TXQA 4LERA 5B1BE 4FP7A 2BKGA 2E2EA 3AS4A 4EHMA 3TWXA 3FUNA 1OWOA 3CVXA 4HOQA 3ZUVB 1UG3A 4BT9A 3JUIA 4B93B 2GRQB 2J49A 5FQ8A 4J6IA 1TN7A 3Q75A 3HDXA 3TG4A 2WXMA 3UT8A 4GTOA 5FINA 5CHEE 2EIJE 3VTYA 1LD7A 5JJ6A 4RVBA 2DZOA 4CDMA 3QKYA 3G2VA 3AAAC 2I6HA 2WXNA 3V30A 2OCCE 3D9IA 4ACLA 4GYWA 5T8IA 4GZ6A 5FZSA 2OEWA 3CKCA 2WXIA 3L82A 5D66A 3TXNA 3G2TA 3LY8A 4AP2A 2GW1A 4U0SA 4NRHB 5HRYA 3JQ0A 2KZTB 2XEVA 1QYMA 1O1SA 3UQ3A 3SNXA 3ZYLA 3TWQA 3MYVA 4PDXA 2VGXA 5KBAA 2R2LA 3G2WA 1E8XA 2P58C 4ILHB 5D2MC 3T8KA 3ZYKA 4XZ4A 3ZPJA 3T9KA 1N4QA 4UWFA 4Q94A 4HQDA 4IULA 2P9LG 3FEYA 3CVVA 5FQ7A 5AQ7A 4DK5A 3Q47B 1MHQA 3EHRA 1OWMA 5JA4D 4CGWA 3GYZA 3C5RA 2XS1A 4HVBA 1JWFA 3CHOA 4K03A 4K5AB 4G8LA 3CQCB 2LSUA 1BU9A 1BD8A 1SA5A 1TNYA 2VGXB 1ELRA 4G11A 2ONDA 4A63B 2YINA 4G1TA 4UUCA 4BETA 4KVMA 1DNPA 2RKKA 5ARGA 3ZEFA 4AIFA 3QJZA 4ZFHA 4GZ3A 4JZYA 3R9MA 5CERB 2LXLA 3L13A 4YVOA 2ILRA 1K1AA 4IYPA 4JL0A 5CBNA 3RRMB 3MA5A 4EZLA 2V0PA 4O1OA 4I1OB 1YYHA 3E32A 3PZ3A 2Q7FA 3FUJA 2MYOA 5G04C 3CEQA 3HG0D 4CGVA 3LVQE 1NP7A 1SVXA 1N4PA 3NBNB 1XNFA 4ANVA 4J8DA 2MRIA 3BUAA 3HXBA 2MHKA 2OVBA 4CEMA 3PE4A 4DPRA 2L6JA 5T4YA 1E7UA 1K8KG 3TWRA 5ARFA 2YQ8A 4N5QA 4HNAD 2AW6A 4AV7A 3FWVA 5BXOA 4OAVB 1MJ0A 3LYAA 3FDHA 1BI8B 2GRMA 4YDOA 1HF8A 1UJKA 4DJAA 1OCRE 3RK6A 2GRLA 4A55A 2QC9A 1Z6TA 4WNGA 2CHWA 2PQNA 4DX2A 1N94A 1L5JA 3MZLB 4U95D 3UT4A 4FLBA 4YDWA 4FU3A 3X2QE 1FT1A 2VSYA 3VTXA 3BEEA 4GA1A 2BKKB 3P1UA 2VSXE 4YVQC 3QDNA 1KT0A 1WAO1 3TXMA 3U9WA 3QARA 5KNGA 2UY1B 1E7VA 3V2XA 3CVLA 3FUDA 4EZJA 1NI1A 2P9IG 3TWWA 4LCTA 2E0IA 1VDYA 3QOUA 4J8YA 1HE8A 3C3RA 2IQCA 5JHBA 1U3DA 1HU3A 4DI4A 2C0LA 3C72A 3LKUA 4FLHA 2PZIA 2ZGGA 2F8XK 4PUCA 1H6KA 2IONA 3FTYA 3AU5A 4DUIA 5A23A 3JXIA 3D9OA 3C98A 2YHEA 4LNBA 2DCPA 3LPZA 2F0YA 1JCRA 4BTAA 2IJGX 5FWQA 3G2SA 2WXFA 4AJWA 3VLEA 3ONLA 3LY9A 4JEUA 1OWPA 3FUEA 5HKPA 5KNHD 3RRUA 3W9GA 3SHFA 4L1BA 2KATA 3APFA 2EINE 4CT4A 2XGSA 3Q9UC 1A17A 3FUIA 4KYOB 4WNFA 3EJNA 4A1GA 3DEOA 3LXUX 4W9RA 4HXIA 4PS3A 2JEKA 5LCWJ 2IU1A 3RJVA 3PDNA 1IHBA 3R9AB 5JMND 3HRAA 3ESLA 4GTQA 4ILIA 4I6GA 3D9HA 3BG0B 2IF4A 3N71A 3ONKA 4PS8A 3Q78A 3I5PA 4HRLA 3G2UA 3RO2A 2EIME 4GTMA 4KXKB 2CG2A 3L6AA 4HB5A 4YDEA 5JJ7A 3EHQA 3AS5A 3QB2A 3UM0A 1K1BA 2XPZA 4L2YA 5AJLA 1UN8A 5LP0A 1ELWA 3MEKA 4HOSA 4GPMA 4ACKA 2P9UG 4NURA 5CECB 3FTVA 4J7WA 3DPDA 3EDTB 3IHYA 5E75A 4DI3A 2FI7A 4FULA 3IKOB 3KSLA 3EIQC 2X6HA 2FBNA 4GMJA 1H0AA 2V4LA 4CYMD 4I1AA 5KJMA 3B7BA 3S2AA 4TRQA 1SW6A 2WQHA 1TNOA 4BX8A 2IOSA 3FU3A 3S7BA 2WXLA 3HVEA 3I4RB 3CGHA 3SI5A 1LF8A 1Z3XA 1BI7B 2DWZA 1N54A 5FJYA 3ZYQA 3FEXA 5JJTA 3LY7A 4GYOA 4NACA 4N2QA 2AXVA 2VTBA 3IV0A 3TWVA 2LSVA 4GPKA 2B0OE 4HFGA 2CFUA 4DX5D 2FEZA 5CRVA 3RIBA 4RG6A 5ENOD 2CHZA 2M63A 1HFAA 3T5XA 1O1RA 3CQGB 1D8EA 3PVLA 3FH8A 4BSXA 1N11A 3E37A 5G05C 2OV8A 3CVNA 3UX4A 4ATZD 1HH8A 4J0UA 1D9SA 3V2OA 2IY0C 4R7LA 3DRAA 2XGOA 5BT1A 3OXLA 3GW4A 4GA2A 3FU5A 2PM7A 1BPOA 5FZQA 5AQAA 3GZ2A 3NOGD 4HOUA 4QQIA 1SZ9A 3ZFWA 3LEWA 2ETCA 4U8VD 4TXRA 4DLQA 1JWGA 3HXDA 3SD5A 3CVQA 3UKRG 4BX9A 4A3VA 4HBDA 4B8CB 3L16A 3ABME 4O6FA 2HE0A 3BG1B 3UTMA 3QNKA 3RO3A 4QFVA 2WXQA 2HO1A 4GU5A 4ATGA 2R59A 3HXFA 3Q79A 5B3SE 2KBXA 1V54E 2YHCA 2LAIA 1UW4B 4L9PA 3KEAA 3OXFA 3UM2A 3E33A 3ZHEA 2VGEA 4HLEA 2XQ0A 2VQ2A 5EILA 3FTUA 1YA0A 1FVHA 1FVFA 4FHJA 3FFLA 4Z68A 4X8QA 2P9SG 5H7PA 4BTBA 4DRXE 3CK8A 3QWPA 4C9BB
chains in the Genus database with same CATH topology
5AN8A 1N11A 2Y0BG 5CECB 1OT8A 3V31A 1WDYA 4J7WA 1G3NB 1N0QA 3JUEA 4K5AB 2FO1E 3TWRA 3TWUA 4G8LA 2RFAA 1MX2A 4U8YD 4N5QA 3AJIA 1S70B 5ENSD 1MX4A 2PNNA 2RFMA 3JXJA 1MYOA 1BD8A 4HNAD 3TWSA 1AWCB 1BU9A 4LSZE 3ZNGA 4ATZD 5CEDB 5FINA 4JB8P 5BXOA 2F37A 1IKND 2KXPC 4A63B 3B95A 4OAVB 4U96D 1MJ0A 5HS0A 4CYMD 2ZGDA 3V2OA 2ETAA 5HKPA 5KWDA 1D9SA 2DZOA 1BI8B 4TUMA 4UUCA 4YDYA 5KNHD 4BETA 1YCSB 4LNUD 3B7BA 3W9GA 1BLXB 1UOHA 1DC2A 5EYLA 3IXEA 1SW6A 5EN5D 4C48B 2JABA 3AAAC 4DX6D 4HLLA 3W9FA 3UXGA 3Q9UC 5FIOA 3V30A 1A5EA 2P2CP 3DEPA 2QC9A 5AQAA 5ENPD 2Y1LE 1K3ZD 2L6BA 1YMPA 2NYJA 4GMRA 3NOGD 4ZFHA 2A5EA 4QQIA 4BSZB 3DEOA 2ETCA 4U8VD 3NOCD 4DX7D 4DX2A 4HI8A 5AQ9A 3EU9A 5CBOA 5D66A 5ENTD 3UI2A 4U95D 5CERB 5ENQD 1BI7B 4YDWA 1AP7A 5EIDA 1IHBA 2DWZA 4O60A 4F1PA 1K1AA 2DVWA 5JMND 4HBDA 5CEAA 3HRAA 5CBNA 4RLYA 5HRYA 2F8YA 3D9HA 2BKKB 4OAUC 2HE0A 1IXVA 2J8SD 4ZHBA 4NIKA 3F6QA 1QYMA 1N0RA 2ETBA 4O1OA 3UTMA 1YYHA 3Q9NC 4BERA 4QFVA 5KNGA 2XZDG 3V2XA 3TWQA 2QYJA 4G8KA 4CZ2D 3V79K 2MYOA 4HRLA 3TWVA 5BXUA 5EYPF 1DCQA 2DZNA 5KBAA 2V5QC 3HG0D 3TWWA 4BESA 2B0OE 2XEHA 2KBXA 3LJNA 1TR4A 4LG6A 2XENA 5AAOA 3SO8A 4HB5A 2XEEA 1MX6A 3T8KA 4DX1A 5ITZF 4J8YA 3KEAA 4DX5D 1SVXA 3EHQA 3NBNB 3ZU7B 3T9KA 3ZKJA 2VGEA 3TWTA 3J5QB 1K1BA 5ENOD 4HQDA 4HRMB 5EILA 2AJAA 5AARA 4K5BA 2XZTG 5AQBA 2BKGA 4O1PA 2V4HC 4BEPA 4F6RD 5AQ7A 3TWXA 2ZGGA 4HI9A 4Z68A 2F8XK 3EHRA 3J5PA 1OY3D 4K5CA 1WG0A 5ENRD 4HRNA 3ZUVB 4DUIA 5JA4D 4GPMA 3JXIA 1NFIE 5EIBE 4DRXE 3C5RA 4B93B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN8 A;  1N11 A;  2Y0B G;  5CEC B;  1OT8 A;  3V31 A;  1WDY A;  4J7W A;  1G3N B;  1N0Q A;  3JUE A;  4K5A B;  2FO1 E;  3TWR A;  3TWU A;  4G8L A;  2RFA A;  1MX2 A;  4U8Y D;  4N5Q A;  3AJI A;  1S70 B;  5ENS D;  1MX4 A;  2PNN A;  2RFM A;  3JXJ A;  1MYO A;  1BD8 A;  4HNA D;  3TWS A;  1AWC B;  1BU9 A;  4LSZ E;  3ZNG A;  4ATZ D;  5CED B;  5FIN A;  4JB8 P;  5BXO A;  2F37 A;  1IKN D;  2KXP C;  4A63 B;  3B95 A;  4OAV B;  4U96 D;  1MJ0 A;  5HS0 A;  4CYM D;  2ZGD A;  3V2O A;  2ETA A;  5HKP A;  5KWD A;  1D9S A;  2DZO A;  1BI8 B;  4TUM A;  4UUC A;  4YDY A;  5KNH D;  4BET A;  1YCS B;  4LNU D;  3B7B A;  3W9G A;  1BLX B;  1UOH A;  1DC2 A;  5EYL A;  3IXE A;  1SW6 A;  5EN5 D;  4C48 B;  2JAB A;  3AAA C;  4DX6 D;  4HLL A;  3W9F A;  3UXG A;  3Q9U C;  5FIO A;  3V30 A;  1A5E A;  2P2C P;  3DEP A;  2QC9 A;  5AQA A;  5ENP D;  2Y1L E;  1K3Z D;  2L6B A;  1YMP A;  2NYJ A;  4GMR A;  3NOG D;  4ZFH A;  2A5E A;  4QQI A;  4BSZ B;  3DEO A;  2ETC A;  4U8V D;  3NOC D;  4DX7 D;  4DX2 A;  4HI8 A;  5AQ9 A;  3EU9 A;  5CBO A;  5D66 A;  5ENT D;  3UI2 A;  4U95 D;  5CER B;  5ENQ D;  1BI7 B;  4YDW A;  1AP7 A;  5EID A;  1IHB A;  2DWZ A;  4O60 A;  4F1P A;  1K1A A;  2DVW A;  5JMN D;  4HBD A;  5CEA A;  3HRA A;  5CBN A;  4RLY A;  5HRY A;  2F8Y A;  3D9H A;  2BKK B;  4OAU C;  2HE0 A;  1IXV A;  2J8S D;  4ZHB A;  4NIK A;  3F6Q A;  1QYM A;  1N0R A;  2ETB A;  4O1O A;  3UTM A;  1YYH A;  3Q9N C;  4BER A;  4QFV A;  5KNG A;  2XZD G;  3V2X A;  3TWQ A;  2QYJ A;  4G8K A;  4CZ2 D;  3V79 K;  2MYO A;  4HRL A;  3TWV A;  5BXU A;  5EYP F;  1DCQ A;  2DZN A;  5KBA A;  2V5Q C;  3HG0 D;  3TWW A;  4BES A;  2B0O E;  2XEH A;  2KBX A;  3LJN A;  1TR4 A;  4LG6 A;  2XEN A;  5AAO A;  3SO8 A;  4HB5 A;  2XEE A;  1MX6 A;  3T8K A;  4DX1 A;  5ITZ F;  4J8Y A;  3KEA A;  4DX5 D;  1SVX A;  3EHQ A;  3NBN B;  3ZU7 B;  3T9K A;  3ZKJ A;  2VGE A;  3TWT A;  3J5Q B;  1K1B A;  5ENO D;  4HQD A;  4HRM B;  5EIL A;  2AJA A;  5AAR A;  4K5B A;  2XZT G;  5AQB A;  2BKG A;  4O1P A;  2V4H C;  4BEP A;  4F6R D;  5AQ7 A;  3TWX A;  2ZGG A;  4HI9 A;  4Z68 A;  2F8X K;  3EHR A;  3J5P A;  1OY3 D;  4K5C A;  1WG0 A;  5ENR D;  4HRN A;  3ZUV B;  4DUI A;  5JA4 D;  4GPM A;  3JXI A;  1NFI E;  5EIB E;  4DRX E;  3C5R A;  4B93 B; 
#chains in the Genus database with same CATH topology
 5AN8 A;  2AXZ A;  5LOZ A;  4Y6C A;  3ZW3 A;  3BU8 A;  3ULY A;  2FO1 E;  5CMY A;  4JHJ A;  1SA4 A;  4I6E A;  2I9C A;  2NC9 A;  2XHE A;  3ZNG A;  3NB2 A;  1U3C A;  1E8W A;  3ML8 A;  4HOR A;  2Y4U A;  3CK9 A;  4DLO A;  3UM3 A;  3AU4 A;  3PZD A;  2CHX A;  5A7D B;  4GTV A;  3PNL B;  5FZR A;  3CHM A;  4BSZ B;  3ZIM A;  3IEG A;  4EZK A;  1V55 E;  1E90 A;  2Y69 E;  4WND A;  4AY6 A;  4PH4 B;  3SBS A;  3FU0 A;  5AYW D;  2A4Z A;  4CT0 A;  1KPS B;  4ZHB A;  4F3V A;  1U2V G;  3DST A;  3GZS A;  2XCB A;  2LNI A;  3OXG A;  1N4R A;  5ITZ F;  3Q7F A;  3U66 A;  4J8S A;  4M3O A;  5EKQ D;  4K5B A;  4OVU A;  4GCO A;  1KZO A;  5AEN A;  1H2V C;  5KJL A;  2EIK E;  1FPP A;  2Y0B G;  4OYS A;  5BUZ A;  1MQS A;  3L08 A;  3MV2 B;  3PEV B;  4ANU A;  2J08 A;  3D9P A;  4LSZ E;  4HS2 A;  4UWG A;  5D0O D;  5HS0 A;  1TEZ A;  2DBA A;  4TUM A;  2FO7 A;  4B8A A;  1YCS B;  4ME2 A;  1OXJ A;  1NL4 A;  4A1S A;  2VYI A;  4LRZ A;  4EBA A;  5EX0 A;  1HZ4 A;  2H6G A;  3FUF A;  4GMR A;  5BV0 A;  3ASD A;  4DX7 D;  3IBE A;  3LS8 A;  1OCO E;  4HI8 A;  3EU9 A;  2BF0 X;  4Q69 A;  4AY5 A;  1N9A A;  5M72 A;  3OAW A;  4JXT A;  3D9J A;  4UWH A;  3Q5M A;  3TL5 A;  2LAH A;  1IHG A;  3NAW A;  3UIN C;  1TJF A;  1TR4 A;  3FTS A;  1LTX A;  3AG1 E;  1Z5S C;  3U3W A;  2ZXW E;  3PZ4 A;  1Q2Z A;  4A3T A;  4J8F A;  2J4B A;  2WM9 A;  4U8H A;  4XX5 A;  3J5P A;  5J90 A;  1RW2 A;  4XKB A;  2UY1 A;  3SQV A;  4JVS A;  4N3C A;  4XE0 A;  3KAE A;  2R05 A;  2WXO A;  3CVU A;  3CSF A;  4Q96 A;  1OWN A;  2HR2 A;  4U8Y D;  1S63 A;  2VTB B;  2RFM A;  5CRU A;  4E6H A;  4F1S A;  4B0Z A;  2ZIR A;  4GTP A;  2HYZ A;  1EYH A;  4U07 A;  5ANL A;  1BLX B;  2L0T B;  3E4B A;  4L2L A;  4GCN A;  5KJN A;  3CIA A;  1HG2 A;  4FAD A;  3LVR E;  1H6O A;  3B7T A;  2WMN A;  3UM1 A;  3FP3 A;  3SY2 A;  2IFU A;  3UI2 A;  2KCK A;  5EID A;  3ZXS A;  2DVW A;  5CEA A;  2J4D A;  3PEU B;  3MJW A;  2J9Q A;  1Y8M A;  4N2S A;  4NIK A;  2A5U A;  4GZC A;  3C3Q A;  2V8S E;  3DXM G;  3ASO E;  1TNB A;  5AJD A;  1FCH A;  3ULQ A;  3HVE B;  4AOF A;  1DCQ A;  3SF4 A;  3CHS A;  3S7J A;  3LJN A;  1SQM A;  5BNW A;  4GB9 A;  3MKQ B;  1B89 A;  2DIW A;  3HXE A;  4RG9 A;  4UWK A;  3B7U X;  3L54 A;  4I17 A;  1OY3 D;  5ENR D;  1JUQ A;  2B6C A;  2WXR A;  4FJZ A;  5C1D A;  2GRO B;  5FQ6 A;  2Y3A A;  2QY7 A;  2VSO E;  2PM6 A;  4G26 A;  1HX8 A;  3JXJ A;  4XEI G;  1AWC B;  3ASN E;  2BUG A;  3PH0 C;  2RD0 A;  4M7C A;  4U96 D;  1DC2 A;  3CK7 A;  3B7S A;  5EYL A;  4JEH A;  3RSE G;  3LDZ A;  4EEC A;  2AXU A;  3ZN3 A;  4AVX A;  3PRE A;  3DEP A;  2IO3 C;  3BQO A;  1ZBP A;  2FUL A;  3NOC D;  4JA9 A;  5D0Q D;  1AP7 A;  1PC2 A;  4F1P A;  3D9L A;  3HXC A;  2CFZ A;  1OWL A;  1IQR A;  4JD2 G;  1UN9 A;  4LNG A;  4MBG A;  2Y4T A;  4G24 A;  3R7R A;  3CVY A;  2KCL A;  4BES A;  4I43 A;  5AAO A;  2PL2 A;  3FH7 A;  3Q49 B;  5BPP A;  5G04 J;  1EDU A;  2X6K A;  3WXX A;  3ZGQ A;  3KS2 A;  1WM5 A;  1N52 A;  3I3N A;  1HO8 A;  2EQX A;  5AQB A;  1LD8 A;  4N5C A;  2WXK A;  3K9I A;  5IY5 E;  4HI9 A;  4ILG A;  3MKQ A;  2WB2 A;  1PAQ A;  1XGW A;  3PE3 A;  1H2U A;  4U63 A;  1OT8 A;  2YNQ A;  3UIP C;  1N0Q A;  3JUE A;  4JA7 A;  3KSQ A;  1EPU A;  4I9C A;  5ENS D;  5HI7 A;  1KZP A;  4TV3 A;  3ESK A;  1QZ2 A;  2VGY A;  2NSZ A;  3LJ3 A;  3S7F A;  2KXP C;  4Y6W A;  3AS8 A;  5KWD A;  2IEJ A;  3QWW A;  1TN6 A;  4I9E A;  3PNT B;  2JAB A;  4UQX A;  5B1A E;  3W9F A;  2P2C P;  2GRN B;  4XIF A;  1YMP A;  4GZD A;  3L9T A;  3U64 A;  1WY6 A;  3EHN A;  5ENT D;  3SFZ A;  5EDS A;  5ENQ D;  4GTS A;  3ZHE B;  3KD7 A;  4U7E B;  4U0U A;  2WXJ A;  2P9N G;  3RRN B;  2R5S A;  3SZ7 A;  4FA6 A;  2GRP B;  4XI0 A;  3L22 A;  4UWL A;  3V79 K;  2I1J A;  2J07 A;  5BXU A;  2DZN A;  4RSY A;  2XEH A;  2R02 A;  2WXH A;  4GZ5 A;  5HQ8 A;  4GA0 A;  4AM9 A;  2I1K A;  3HYM B;  3FY4 A;  1HS6 A;  3NQP A;  3T8M A;  3DSX A;  3TWT A;  4BFR A;  3PZ1 A;  3S7D A;  5ENN A;  4JHK A;  4EQF A;  2WMO A;  2V4H C;  4H7X A;  4K5C A;  4AXH A;  2L0I A;  4HRN A;  3ABK E;  1Y6I A;  5E76 A;  4RQI A;  4WWO A;  1WDY A;  3U4T A;  2EIL E;  1OCC E;  1KLX A;  4H7Y A;  3ABL E;  4N39 A;  1MX2 A;  1N95 A;  1JCS A;  1S70 B;  1OUV A;  3DWL G;  4URK A;  2X6I A;  3PRZ A;  4I2Z A;  4BWR A;  3CHP A;  4KVO A;  2F37 A;  4UI9 K;  5G05 J;  3P2B A;  1W3B A;  3TJP A;  4GTR A;  5T3R A;  4BY6 A;  3EHM A;  3DSS A;  3HIZ A;  1A5E A;  3DSU A;  1DCE A;  2Y1L E;  1TYQ G;  2L6B A;  2JLB A;  2XCC A;  2VSN A;  3TG5 A;  1FT2 A;  1O1T A;  4ANW A;  4ANX A;  4OVV A;  4UQZ A;  5AQ9 A;  3DBS A;  1SZA A;  4TUU A;  2R17 C;  2H6I A;  3VLF A;  4O60 A;  4HOT A;  3TGO A;  1N4S A;  4GYY A;  4RLY A;  3URZ A;  3O4Z A;  5J08 A;  3CHR A;  4E85 A;  4L23 A;  4BER A;  4WAF A;  2L9B A;  2XPY A;  3SFX A;  2V5F A;  1MZC A;  4J8E A;  1S0P A;  3Q73 A;  3SO8 A;  4I2W A;  1MX6 A;  5ANR A;  4KZ0 A;  1S64 A;  2OVF A;  3J5Q B;  5LCW C;  1H19 A;  2GGF A;  3WG7 E;  3EIJ A;  5AIJ A;  2KM4 A;  2WQ6 A;  4WWP A;  2XRY A;  1H2T C;  2XZT G;  3QC1 A;  4FHK A;  3DSV A;  4GAA A;  3AG2 E;  1JPL A;  3CR3 A;  3E30 A;  1NFI E;  2AVP A;  5CCL A;  3EU5 A;  4C0E A;  4L7T A;  3ASH A;  3D9K A;  3QAQ A;  3V31 A;  2AWI A;  3FUL A;  4XI9 A;  5G2N A;  3TWU A;  3ZXP A;  3QK0 A;  2IOL A;  2H6H A;  2PNN A;  4UI9 J;  4AEZ C;  3O48 A;  3CHQ A;  4JB8 P;  3SBT B;  4JC8 A;  3B13 A;  3CKB A;  2XGM A;  3IXE A;  3NZS A;  1QQE A;  3AG3 E;  4APO A;  3IHV A;  4DX6 D;  1UJJ A;  3FU6 A;  2WXG A;  4N3B A;  5KCM A;  5DIZ A;  2FF4 A;  1K3Z D;  3KEZ A;  3DXK G;  2XS8 A;  4I6J A;  4CRW A;  2BED A;  1HG5 A;  4WUY A;  3CVW A;  3RKV A;  3RAU A;  2ETB A;  5DBK A;  4PS7 A;  3SFY A;  1E8Z A;  2X38 A;  5EX3 A;  3SGH A;  5EYP F;  1DVP A;  4JPS A;  4WNE A;  3CVP A;  2XEE A;  4ABN A;  4UI9 C;  2XRZ A;  3ASF A;  3ZKJ A;  3DPY A;  3FHE A;  4BEP A;  4MLP A;  1WG0 A;  5EIB E;  1TN8 A;  1X81 A;  3Q15 A;  2KCV A;  1QNF A;  1QBQ A;  1NZN A;  5FTP A;  4GML A;  2CG3 A;  3AJI A;  4YND A;  3ZRH A;  3B7R L;  3ULE G;  5FQ4 A;  2X6J A;  2J09 A;  4GTT A;  3T5V A;  3PZ2 A;  2I2O A;  2P9K G;  1RZ4 A;  1GW6 A;  1KT1 A;  2ETA A;  2KZT A;  4LNU D;  4F53 A;  3FUH A;  4F7A A;  4KBQ A;  3UXG A;  5FIO A;  1H6P A;  5ENP D;  5LFA A;  2WVI A;  3CLJ A;  2OOE A;  3MX3 A;  3UPV A;  3E34 A;  4D10 C;  2LO6 A;  1HXI A;  3FUK A;  4EPZ A;  2F8Y A;  2C2L A;  3ASG A;  2QFC A;  1IXV A;  2J8S D;  3ZVV A;  3F6Q A;  3APC A;  1E96 B;  3JQ1 A;  1IYG A;  4G8K A;  4MKT A;  1TNZ A;  4G2V A;  3ISM C;  5G55 A;  2V5Q C;  3C3O A;  2RG8 A;  2XEN A;  4DX1 A;  4CDR A;  4LEU A;  4MS6 A;  4HRM B;  2AJA A;  5AAR A;  4CDN A;  2LXM A;  2IO2 C;  4XKC A;  4F6R D;  2X3M A;  5BW8 C;  4N3A A;  1NA3 A;  2GRR B;  3OTN A;  4TXP A;  1IQU A;  2QYU A;  1ZB1 A;  3Q7A A;  1MYO A;  1NA0 A;  3TWS A;  1TNU A;  5CCM A;  3ZYM A;  3JCK C;  4LUN U;  4UQY A;  1IKN D;  2HM8 A;  4KZC A;  2BTD A;  3PUK A;  2ZGD A;  2ZU6 B;  1TJC A;  1INZ A;  4C48 B;  4G25 A;  3MKR A;  4B89 A;  2NXP A;  5LX8 A;  4WWN A;  2X6F A;  2A5E A;  4U0Z A;  3QWV A;  5CBO A;  5CMW A;  1OCZ E;  1X5B A;  4KT6 B;  4C0M A;  3D9M A;  5BV1 A;  3TAX A;  3PS6 A;  3D3M A;  3PUJ A;  3VLD A;  2DYR E;  4MRU A;  4B94 A;  4P29 A;  3FTX A;  2VJ8 A;  3Q9N C;  3ML9 A;  2XZD G;  4IRU A;  2QYJ A;  4CZ2 D;  2WQ7 A;  3UMV A;  3DSW A;  5C2Y A;  2ZIS A;  3L17 A;  3ZU7 B;  4CCA A;  2WXP A;  4JW1 A;  4I1M A;  3NF1 A;  3RU0 A;  1ZU2 A;  4O1P A;  2UWJ G;  3CST A;  3AG4 E;  4U04 A;  1E8Y A;  1D8D A;  3APD A;  3FUM A;  4EBA G;  1PY1 A;  5KJK A;  3UIO C;  1G3N B;  4JHR A;  2DYS E;  1JCQ A;  2RFA A;  4G23 A;  3NZU A;  1MX4 A;  3HHM A;  2H6F A;  4BT8 A;  5JHA A;  4KMO A;  5CED B;  3B95 A;  2OEV A;  3MGB A;  4FJY A;  4NQ0 A;  3MCX A;  4YDY A;  2MOW A;  1UOH A;  5EN5 D;  2LUH A;  4HLL A;  5FT9 A;  1ELK A;  2C0M A;  2XPI A;  3Q4A B;  2PQR A;  4K0R A;  2NYJ A;  2P9P G;  1O5M A;  3JYS A;  3R7Q A;  3FH5 A;  1EF1 C;  2QZA A;  2KC7 A;  3MV3 B;  3UT7 A;  3UKU G;  4OAU C;  5A6C A;  1Z3Y A;  3UUX A;  4APF A;  4IN3 B;  3GZ1 A;  4FC8 A;  1N0R A;  2WPV A;  3ENE A;  4V3I A;  3LCA A;  3FTZ A;  2R03 A;  3CV0 A;  3D9N A;  4LG6 A;  3FTW A;  3I4G A;  1P5Q A;  3EUV A;  4TXQ A;  4LER A;  5B1B E;  4FP7 A;  2BKG A;  2E2E A;  3AS4 A;  4EHM A;  3TWX A;  3FUN A;  1OWO A;  3CVX A;  4HOQ A;  3ZUV B;  1UG3 A;  4BT9 A;  3JUI A;  4B93 B;  2GRQ B;  2J49 A;  5FQ8 A;  4J6I A;  1TN7 A;  3Q75 A;  3HDX A;  3TG4 A;  2WXM A;  3UT8 A;  4GTO A;  5FIN A;  5CHE E;  2EIJ E;  3VTY A;  1LD7 A;  5JJ6 A;  4RVB A;  2DZO A;  4CDM A;  3QKY A;  3G2V A;  3AAA C;  2I6H A;  2WXN A;  3V30 A;  2OCC E;  3D9I A;  4ACL A;  4GYW A;  5T8I A;  4GZ6 A;  5FZS A;  2OEW A;  3CKC A;  2WXI A;  3L82 A;  5D66 A;  3TXN A;  3G2T A;  3LY8 A;  4AP2 A;  2GW1 A;  4U0S A;  4NRH B;  5HRY A;  3JQ0 A;  2KZT B;  2XEV A;  1QYM A;  1O1S A;  3UQ3 A;  3SNX A;  3ZYL A;  3TWQ A;  3MYV A;  4PDX A;  2VGX A;  5KBA A;  2R2L A;  3G2W A;  1E8X A;  2P58 C;  4ILH B;  5D2M C;  3T8K A;  3ZYK A;  4XZ4 A;  3ZPJ A;  3T9K A;  1N4Q A;  4UWF A;  4Q94 A;  4HQD A;  4IUL A;  2P9L G;  3FEY A;  3CVV A;  5FQ7 A;  5AQ7 A;  4DK5 A;  3Q47 B;  1MHQ A;  3EHR A;  1OWM A;  5JA4 D;  4CGW A;  3GYZ A;  3C5R A;  2XS1 A;  4HVB A;  1JWF A;  3CHO A;  4K03 A;  4K5A B;  4G8L A;  3CQC B;  2LSU A;  1BU9 A;  1BD8 A;  1SA5 A;  1TNY A;  2VGX B;  1ELR A;  4G11 A;  2OND A;  4A63 B;  2YIN A;  4G1T A;  4UUC A;  4BET A;  4KVM A;  1DNP A;  2RKK A;  5ARG A;  3ZEF A;  4AIF A;  3QJZ A;  4ZFH A;  4GZ3 A;  4JZY A;  3R9M A;  5CER B;  2LXL A;  3L13 A;  4YVO A;  2ILR A;  1K1A A;  4IYP A;  4JL0 A;  5CBN A;  3RRM B;  3MA5 A;  4EZL A;  2V0P A;  4O1O A;  4I1O B;  1YYH A;  3E32 A;  3PZ3 A;  2Q7F A;  3FUJ A;  2MYO A;  5G04 C;  3CEQ A;  3HG0 D;  4CGV A;  3LVQ E;  1NP7 A;  1SVX A;  1N4P A;  3NBN B;  1XNF A;  4ANV A;  4J8D A;  2MRI A;  3BUA A;  3HXB A;  2MHK A;  2OVB A;  4CEM A;  3PE4 A;  4DPR A;  2L6J A;  5T4Y A;  1E7U A;  1K8K G;  3TWR A;  5ARF A;  2YQ8 A;  4N5Q A;  4HNA D;  2AW6 A;  4AV7 A;  3FWV A;  5BXO A;  4OAV B;  1MJ0 A;  3LYA A;  3FDH A;  1BI8 B;  2GRM A;  4YDO A;  1HF8 A;  1UJK A;  4DJA A;  1OCR E;  3RK6 A;  2GRL A;  4A55 A;  2QC9 A;  1Z6T A;  4WNG A;  2CHW A;  2PQN A;  4DX2 A;  1N94 A;  1L5J A;  3MZL B;  4U95 D;  3UT4 A;  4FLB A;  4YDW A;  4FU3 A;  3X2Q E;  1FT1 A;  2VSY A;  3VTX A;  3BEE A;  4GA1 A;  2BKK B;  3P1U A;  2VSX E;  4YVQ C;  3QDN A;  1KT0 A;  1WAO 1;  3TXM A;  3U9W A;  3QAR A;  5KNG A;  2UY1 B;  1E7V A;  3V2X A;  3CVL A;  3FUD A;  4EZJ A;  1NI1 A;  2P9I G;  3TWW A;  4LCT A;  2E0I A;  1VDY A;  3QOU A;  4J8Y A;  1HE8 A;  3C3R A;  2IQC A;  5JHB A;  1U3D A;  1HU3 A;  4DI4 A;  2C0L A;  3C72 A;  3LKU A;  4FLH A;  2PZI A;  2ZGG A;  2F8X K;  4PUC A;  1H6K A;  2ION A;  3FTY A;  3AU5 A;  4DUI A;  5A23 A;  3JXI A;  3D9O A;  3C98 A;  2YHE A;  4LNB A;  2DCP A;  3LPZ A;  2F0Y A;  1JCR A;  4BTA A;  2IJG X;  5FWQ A;  3G2S A;  2WXF A;  4AJW A;  3VLE A;  3ONL A;  3LY9 A;  4JEU A;  1OWP A;  3FUE A;  5HKP A;  5KNH D;  3RRU A;  3W9G A;  3SHF A;  4L1B A;  2KAT A;  3APF A;  2EIN E;  4CT4 A;  2XGS A;  3Q9U C;  1A17 A;  3FUI A;  4KYO B;  4WNF A;  3EJN A;  4A1G A;  3DEO A;  3LXU X;  4W9R A;  4HXI A;  4PS3 A;  2JEK A;  5LCW J;  2IU1 A;  3RJV A;  3PDN A;  1IHB A;  3R9A B;  5JMN D;  3HRA A;  3ESL A;  4GTQ A;  4ILI A;  4I6G A;  3D9H A;  3BG0 B;  2IF4 A;  3N71 A;  3ONK A;  4PS8 A;  3Q78 A;  3I5P A;  4HRL A;  3G2U A;  3RO2 A;  2EIM E;  4GTM A;  4KXK B;  2CG2 A;  3L6A A;  4HB5 A;  4YDE A;  5JJ7 A;  3EHQ A;  3AS5 A;  3QB2 A;  3UM0 A;  1K1B A;  2XPZ A;  4L2Y A;  5AJL A;  1UN8 A;  5LP0 A;  1ELW A;  3MEK A;  4HOS A;  4GPM A;  4ACK A;  2P9U G;  4NUR A;  5CEC B;  3FTV A;  4J7W A;  3DPD A;  3EDT B;  3IHY A;  5E75 A;  4DI3 A;  2FI7 A;  4FUL A;  3IKO B;  3KSL A;  3EIQ C;  2X6H A;  2FBN A;  4GMJ A;  1H0A A;  2V4L A;  4CYM D;  4I1A A;  5KJM A;  3B7B A;  3S2A A;  4TRQ A;  1SW6 A;  2WQH A;  1TNO A;  4BX8 A;  2IOS A;  3FU3 A;  3S7B A;  2WXL A;  3HVE A;  3I4R B;  3CGH A;  3SI5 A;  1LF8 A;  1Z3X A;  1BI7 B;  2DWZ A;  1N54 A;  5FJY A;  3ZYQ A;  3FEX A;  5JJT A;  3LY7 A;  4GYO A;  4NAC A;  4N2Q A;  2AXV A;  2VTB A;  3IV0 A;  3TWV A;  2LSV A;  4GPK A;  2B0O E;  4HFG A;  2CFU A;  4DX5 D;  2FEZ A;  5CRV A;  3RIB A;  4RG6 A;  5ENO D;  2CHZ A;  2M63 A;  1HFA A;  3T5X A;  1O1R A;  3CQG B;  1D8E A;  3PVL A;  3FH8 A;  4BSX A;  1N11 A;  3E37 A;  5G05 C;  2OV8 A;  3CVN A;  3UX4 A;  4ATZ D;  1HH8 A;  4J0U A;  1D9S A;  3V2O A;  2IY0 C;  4R7L A;  3DRA A;  2XGO A;  5BT1 A;  3OXL A;  3GW4 A;  4GA2 A;  3FU5 A;  2PM7 A;  1BPO A;  5FZQ A;  5AQA A;  3GZ2 A;  3NOG D;  4HOU A;  4QQI A;  1SZ9 A;  3ZFW A;  3LEW A;  2ETC A;  4U8V D;  4TXR A;  4DLQ A;  1JWG A;  3HXD A;  3SD5 A;  3CVQ A;  3UKR G;  4BX9 A;  4A3V A;  4HBD A;  4B8C B;  3L16 A;  3ABM E;  4O6F A;  2HE0 A;  3BG1 B;  3UTM A;  3QNK A;  3RO3 A;  4QFV A;  2WXQ A;  2HO1 A;  4GU5 A;  4ATG A;  2R59 A;  3HXF A;  3Q79 A;  5B3S E;  2KBX A;  1V54 E;  2YHC A;  2LAI A;  1UW4 B;  4L9P A;  3KEA A;  3OXF A;  3UM2 A;  3E33 A;  3ZHE A;  2VGE A;  4HLE A;  2XQ0 A;  2VQ2 A;  5EIL A;  3FTU A;  1YA0 A;  1FVH A;  1FVF A;  4FHJ A;  3FFL A;  4Z68 A;  4X8Q A;  2P9S G;  5H7P A;  4BTB A;  4DRX E;  3CK8 A;  3QWP A;  4C9B B; 
#chains in the Genus database with same CATH homology
 5AN8 A;  1N11 A;  2Y0B G;  5CEC B;  1OT8 A;  3V31 A;  1WDY A;  4J7W A;  1G3N B;  1N0Q A;  3JUE A;  4K5A B;  2FO1 E;  3TWR A;  3TWU A;  4G8L A;  2RFA A;  1MX2 A;  4U8Y D;  4N5Q A;  3AJI A;  1S70 B;  5ENS D;  1MX4 A;  2PNN A;  2RFM A;  3JXJ A;  1MYO A;  1BD8 A;  4HNA D;  3TWS A;  1AWC B;  1BU9 A;  4LSZ E;  3ZNG A;  4ATZ D;  5CED B;  5FIN A;  4JB8 P;  5BXO A;  2F37 A;  1IKN D;  2KXP C;  4A63 B;  3B95 A;  4OAV B;  4U96 D;  1MJ0 A;  5HS0 A;  4CYM D;  2ZGD A;  3V2O A;  2ETA A;  5HKP A;  5KWD A;  1D9S A;  2DZO A;  1BI8 B;  4TUM A;  4UUC A;  4YDY A;  5KNH D;  4BET A;  1YCS B;  4LNU D;  3B7B A;  3W9G A;  1BLX B;  1UOH A;  1DC2 A;  5EYL A;  3IXE A;  1SW6 A;  5EN5 D;  4C48 B;  2JAB A;  3AAA C;  4DX6 D;  4HLL A;  3W9F A;  3UXG A;  3Q9U C;  5FIO A;  3V30 A;  1A5E A;  2P2C P;  3DEP A;  2QC9 A;  5AQA A;  5ENP D;  2Y1L E;  1K3Z D;  2L6B A;  1YMP A;  2NYJ A;  4GMR A;  3NOG D;  4ZFH A;  2A5E A;  4QQI A;  4BSZ B;  3DEO A;  2ETC A;  4U8V D;  3NOC D;  4DX7 D;  4DX2 A;  4HI8 A;  5AQ9 A;  3EU9 A;  5CBO A;  5D66 A;  5ENT D;  3UI2 A;  4U95 D;  5CER B;  5ENQ D;  1BI7 B;  4YDW A;  1AP7 A;  5EID A;  1IHB A;  2DWZ A;  4O60 A;  4F1P A;  1K1A A;  2DVW A;  5JMN D;  4HBD A;  5CEA A;  3HRA A;  5CBN A;  4RLY A;  5HRY A;  2F8Y A;  3D9H A;  2BKK B;  4OAU C;  2HE0 A;  1IXV A;  2J8S D;  4ZHB A;  4NIK A;  3F6Q A;  1QYM A;  1N0R A;  2ETB A;  4O1O A;  3UTM A;  1YYH A;  3Q9N C;  4BER A;  4QFV A;  5KNG A;  2XZD G;  3V2X A;  3TWQ A;  2QYJ A;  4G8K A;  4CZ2 D;  3V79 K;  2MYO A;  4HRL A;  3TWV A;  5BXU A;  5EYP F;  1DCQ A;  2DZN A;  5KBA A;  2V5Q C;  3HG0 D;  3TWW A;  4BES A;  2B0O E;  2XEH A;  2KBX A;  3LJN A;  1TR4 A;  4LG6 A;  2XEN A;  5AAO A;  3SO8 A;  4HB5 A;  2XEE A;  1MX6 A;  3T8K A;  4DX1 A;  5ITZ F;  4J8Y A;  3KEA A;  4DX5 D;  1SVX A;  3EHQ A;  3NBN B;  3ZU7 B;  3T9K A;  3ZKJ A;  2VGE A;  3TWT A;  3J5Q B;  1K1B A;  5ENO D;  4HQD A;  4HRM B;  5EIL A;  2AJA A;  5AAR A;  4K5B A;  2XZT G;  5AQB A;  2BKG A;  4O1P A;  2V4H C;  4BEP A;  4F6R D;  5AQ7 A;  3TWX A;  2ZGG A;  4HI9 A;  4Z68 A;  2F8X K;  3EHR A;  3J5P A;  1OY3 D;  4K5C A;  1WG0 A;  5ENR D;  4HRN A;  3ZUV B;  4DUI A;  5JA4 D;  4GPM A;  3JXI A;  1NFI E;  5EIB E;  4DRX E;  3C5R A;  4B93 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...