2F8YA

Crystal structure of human notch1 ankyrin repeats to 1.55a resolution.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
215
Chain Sequence
AVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Notch homolog 1, translocation-associated (Drosophila)
publication title Structural basis for cooperativity in recruitment of MAML coactivators to Notch transcription complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 79
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2f8yA00
5KWDA 5JMND 4GPMA 3TWUA 3V79K 3JXJA 3ZKJA 1MX2A 2ETCA 3ZUVB 4LSZE 2BKGA 4DUIA 5CECB 2Y0BG 5ENTD 4F6RD 3JXIA 1IKND 2J8SD 2JABA 3V31A 5HRYA 2XENA 3EHQA 3NOCD 4TUMA 4BERA 2V4HC 4OAVB 5FINA 1NFIE 1N0QA 1MX6A 2KXPC 3SO8A 4BETA 2Y1LE 3KEAA 3TWTA 3UXGA 1BI7B 2L6BA 4ZFHA 4J8YA 4U8YD 4CYMD 1MJ0A 3Q9UC 4U95D 4BESA 4LNUD 5CBNA 3IXEA 1IXVA 4NIKA 5EYPF 4RLYA 2F8XK 2XZTG 4O1OA 3AJIA 1SW6A 4C48B 4CZ2D 1BD8A 3V2OA 3TWSA 2V5QC 3DEPA 1DC2A 4LG6A 4U96D 4ZHBA 1K3ZD 2XEHA 3F6QA 1G3NB 5JA4D 2DZOA 5AAOA 1N11A 3EU9A 3TWVA 5EYLA 4HNAD 3NOGD 3HRAA 2DZNA 3B7BA 1OY3D 4J7WA 5EILA 3TWRA 5CERB 2P2CP 2MYOA 2QYJA 4HI9A 4B93B 4GMRA 4YDYA 5ENOD 3NBNB 3Q9NC 5EN5D 4DX7D 1IHBA 1YMPA 1S70B 2KBXA 4K5BA 4HBDA 4O60A 4QFVA 5AN8A 3T9KA 2ETBA 3V30A 1WDYA 1BU9A 4A63B 3HG0D 2BKKB 1MYOA 3W9GA 3UTMA 1SVXA 3J5QB 4G8KA 4HRNA 3ZNGA 2A5EA 3C5RA 4BEPA 5AQAA 4O1PA 5CEAA 4OAUC 3LJNA 1AP7A 2DWZA 1BI8B 5AQ7A 5HKPA 5KNHD 3JUEA 3AAAC 2ZGGA 5KNGA 1MX4A 5CEDB 2DVWA 4ATZD 4U8VD 4F1PA 3J5PA 5ENRD 4DRXE 4HRLA 2AJAA 1YCSB 4K5AB 5AQBA 3DEOA 2RFAA 2ETAA 5AARA 2F8YA 3W9FA 3V2XA 4DX2A 1K1AA 3EHRA 4UUCA 5ENPD 3TWQA 5EIBE 1YYHA 2B0OE 5EIDA 4Z68A 5KBAA 5ENQD 5D66A 4QQIA 3D9HA 4K5CA 3ZU7B 4DX5D 4DX6D 2FO1E 2XZDG 3UI2A 4YDWA 3TWWA 3B95A 2F37A 1WG0A 4HRMB 3T8KA 1K1BA 2XEEA 2HE0A 5FIOA 4DX1A 5HS0A 5BXUA 5CBOA 2PNNA 1OT8A 1D9SA 5BXOA 2VGEA 1N0RA 5ITZF 4G8LA 4BSZB 1A5EA 5ENSD 4HB5A 4N5QA 3TWXA 2RFMA 2QC9A 1UOHA 4JB8P 1QYMA 2NYJA 1AWCB 1BLXB 4HI8A 2ZGDA 1TR4A 4HQDA 5AQ9A 4HLLA 1DCQA
chains in the Genus database with same CATH superfamily
2X6HA 3SZ7A 1MX2A 2IU1A 5A23A 3U64A 2VSYA 1FPPA 2Y1LE 3CVVA 2ZXWE 4J8YA 2YINA 2HM8A 2RKKA 3ASFA 3L9TA 4X8QA 1UG3A 1DNPA 4L2LA 4JZYA 3ZN3A 4YVQC 4GU5A 1HU3A 3ZEFA 3LS8A 3MX3A 3UKUG 1N4QA 3Q73A 4J7WA 4WWOA 5EILA 2LO6A 2DYRE 1H6PA 3ESLA 1OCRE 2KCVA 3JCKC 3Q78A 4Q94A 3W9GA 4HOTA 3SD5A 4HS2A 5JHBA 1MX4A 4BX8A 4HFGA 4F1PA 3GYZA 2HR2A 4DJAA 3RIBA 3ZHEB 1U2VG 3ASHA 2F0YA 2F8YA 4UWFA 3ZHEA 1EDUA 1EPUA 3CVNA 1V54E 5JJ7A 4F3VA 2F37A 2R5SA 2PM6A 3FP3A 4BSZB 2E2EA 3SFYA 3UM3A 1RW2A 4FHJA 4B0ZA 4WWNA 4NURA 1HG2A 4GPMA 2WM9A 3IEGA 2IO3C 4PS3A 4N39A 2CFUA 4HORA 4BTAA 4F53A 5KJMA 4Y6WA 4U8YD 1E8YA 4NACA 1PAQA 2IEJA 5A6CA 3SQVA 1K3ZD 2GROB 3FTVA 5J08A 1W3BA 4WNFA 4HNAD 3NOGD 2CHXA 4EZLA 2QYJA 4YDYA 4K03A 2WXFA 3UM0A 4JEUA 3MCXA 3PEUB 4I2WA 2R05A 3HDXA 2XS1A 3L6AA 3FTYA 5AQBA 5CRVA 3C98A 3CHQA 2J9QA 3TJPA 1OWLA 2WXJA 3S7BA 3VLEA 3SFXA 4I6EA 3I3NA 4I17A 3RSEG 4Z68A 3NF1A 4GZ6A 1LD7A 3UMVA 5FQ4A 4I1AA 4DLOA 3SBTB 3ZU7B 2YHEA 5FQ7A 3LCAA 3UT4A 5FIOA 1XGWA 4JHJA 1A17A 3ZPJA 3CK7A 3UM1A 3UIOC 4ABNA 1E8XA 1QZ2A 2XCBA 4HI8A 4WNDA 1TR4A 3B7RL 3SGHA 3TWUA 2GRLA 3PUKA 3JXJA 4L9PA 3DSTA 3ZYMA 4I6GA 3EHMA 3FU5A 2J8SD 3V31A 3R9AB 3ABLE 4OAVB 5FT9A 2KM4A 3O4ZA 3CEQA 2ZISA 3CK9A 3IXEA 2JLBA 1SZAA 5EKQD 3I5PA 2NC9A 3DEPA 5AJDA 2XEHA 1V55E 2WB2A 4LNGA 4GTQA 1E7VA 5ENOD 3MA5A 5C2YA 3T9KA 1WDYA 3EU5A 1LD8A 4XIFA 4GYYA 2X38A 4B94A 3FULA 2WQ6A 3FTWA 4J8DA 4XKBA 4JD2G 5ENRD 1E96B 2Q7FA 4HRLA 2YNQA 4JW1A 2AJAA 1YCSB 3CVYA 1ELKA 5HI7A 1YYHA 2H6GA 5EIDA 1N9AA 3AS4A 5ENQD 4K5CA 5CHEE 3AG1E 3UT7A 4U0SA 2MHKA 4GYOA 2IFUA 5KJNA 2XPZA 3EHNA 3NZSA 4O6FA 3ASGA 2IOLA 4G2VA 4FP7A 3NB2A 1LF8A 4DUIA 5ARFA 1NFIE 3RRUA 2L6BA 4MRUA 4UQYA 4FLHA 3DSVA 1KZPA 5G04C 2V5QC 2GRQB 1HZ4A 3L08A 4UWLA 2P9LG 2XGOA 2WQ7A 4AY6A 4KZCA 4J8EA 4PS7A 3ISMC 4U0UA 4BFRA 3HRAA 3G2UA 3S7JA 3NBNB 4P29A 4R7LA 4TRQA 4K5BA 3FUNA 5AN8A 3ASOE 3HG0D 3MEKA 4EZKA 4AEZC 3CIAA 3LDZA 2RG8A 1BI8B 5IY5E 2GW1A 3AAAC 1WM5A 4N2SA 3L16A 4K5AB 4APOA 2GRMA 3UUXA 1DCEA 4TXPA 5D0QD 3Q75A 4B89A 1KT1A 3ZYQA 1TNUA 3D9IA 3SY2A 3TGOA 2OCCE 3TXMA 1NP7A 2XQ0A 1S64A 4GTVA 4AY5A 5FZQA 3LVQE 4HB5A 4URKA 1QNFA 2HYZA 3FH7A 4GTPA 3FDHA 2J09A 3HXBA 2WXIA 2H6HA 5JMND 4OVUA 1LTXA 3MKQB 5D0OD 1OWMA 4JA9A 4EECA 3PE4A 2J49A 2PZIA 4LNUD 2V8SE 3E4BA 2F8XK 2CHWA 3NAWA 5C1DA 4Q96A 2XGMA 1WAO1 5AAOA 3TWVA 4GZ5A 4HI9A 4TUUA 4JL0A 1IHBA 2RD0A 1U3CA 3UTMA 1SVXA 4FULA 5EX0A 4ATZD 4U8VD 1H19A 1MHQA 5BV1A 3PREA 2ETAA 5AYWD 3BG0B 3D9MA 4XI0A 5EIBE 3AS5A 2GRPB 3O48A 5D66A 4ANUA 3DSWA 3EUVA 4L1BA 4EPZA 4ANXA 2PM7A 4I1MA 3CSTA 2ETCA 3BUAA 2I9CA 4N2QA 5FJYA 4BERA 3ML8A 2WXLA 2EILE 1OXJA 2LNIA 1BI7B 3MV3B 1HG5A 4ME2A 1U3DA 4KYOB 3C3RA 2OV8A 3AS8A 2DCPA 1PC2A 4MLPA 3L22A 3CVUA 2MRIA 4NQ0A 4UI9J 2DZNA 5E75A 3Q9NC 4I6JA 2KBXA 5EX3A 2ETBA 4CDNA 1IQRA 4GTSA 3ONLA 3UIPC 2LSUA 3APFA 2XCCA 5T8IA 5AQAA 4O1PA 1AP7A 4JA7A 1Z5SC 1HXIA 2OVFA 3FTZA 3ULYA 4H7XA 4DI4A 3CHOA 4CDMA 4ATGA 1HE8A 2UWJG 4Y6CA 4UUCA 3CSFA 3FH5A 4JXTA 4RG6A 4GTRA 3CHRA 2H6FA 4UQZA 1N52A 2AXUA 1A5EA 2LAHA 1OCCE 2RFMA 1QYMA 2L0IA 1BLXB 2PQNA 4U7EB 2LSVA 3L17A 3UXGA 3QDNA 4GCNA 3T8MA 4GYWA 4Q69A 2L0TB 4YDEA 2XENA 2EIKE 3Q49B 4ZFHA 1L5JA 4CYMD 4LCTA 4NIKA 4RLYA 5E76A 3FUHA 4I43A 3ULEG 4CT0A 4A3VA 5FZSA 3HVEB 5CMWA 4WNEA 2VTBB 1YA0A 1OUVA 3KSQA 4GCOA 3BQOA 3HVEA 4TXRA 2C0MA 2VTBA 2R59A 2PL2A 3OXFA 4PDXA 4RSYA 2Y4TA 1MZCA 2AWIA 2BKKB 4I1OB 3WXXA 2A5EA 3KD7A 3FHEA 3KSLA 3BEEA 5CEDB 5FWQA 3FUIA 1RZ4A 3J5PA 1JCQA 3IV0A 2XHEA 2JEKA 3PZ2A 4CCAA 1N4SA 2CFZA 5J90A 2I2OA 2DIWA 5ENNA 1TN7A 2BUGA 1OCZE 5JJ6A 2P9KG 3APCA 4ANVA 2R2LA 2FEZA 3Q47B 3FUEA 1D9SA 5BXOA 5LCWJ 1N0RA 5ITZF 2P9IG 5ENSD 1P5QA 3Q15A 3ML9A 1TNBA 5D2MC 3ZKJA 3T5XA 2Y4UA 4CT4A 4A1GA 1IYGA 2FI7A 3NOCD 4KVOA 5FINA 1MX6A 3S7FA 2LUHA 1TEZA 4MBGA 3EIJA 3U3WA 1N94A 4G26A 4OYSA 5CBNA 4N5CA 3AU5A 5HQ8A 4RG9A 2XRYA 4AIFA 3HXCA 2C2LA 1UN8A 3G2WA 4KXKB 4DX7D 4KBQA 2DBAA 4BX9A 2GRRB 3DSXA 4O60A 4GB9A 5FZRA 4G1TA 3UX4A 1INZA 4AVXA 4BEPA 3C3QA 2DWZA 4U0ZA 5KNHD 3K9IA 1UW4B 1UJJA 1ZB1A 4B8AA 2VQ2A 4XX5A 5KJLA 3EDTB 2RFAA 1D8EA 2X6IA 3BG1B 3CQCB 3RO2A 2CG3A 3V2XA 4GA2A 5LP0A 3EJNA 4YDOA 1KPSB 4K0RA 2L9BA 4BTBA 4QQIA 4DX5D 3CVWA 4YDWA 1K1BA 5B1BE 2XGSA 4FADA 3DPYA 4UWKA 1Y8MA 1O1TA 5LX8A 5AQ9A 4I9EA 3LKUA 5ANRA 1JCRA 1VDYA 2X6FA 3Q7AA 1H6KA 3QWVA 2BKGA 2OEVA 4FLBA 4F6RD 1IKND 2FO7A 5FQ8A 2V4LA 2BEDA 3D9JA 3HYMB 3FEXA 3SO8A 4ANWA 4C9BB 3ASNE 3Q4AB 5KJKA 3MZLB 3JQ1A 1BD8A 5G05J 3TWSA 4FJZA 3HIZA 1OCOE 4ILGA 4N3BA 2J08A 5JA4D 1MQSA 4GTOA 1NI1A 1BPOA 3T5VA 3EIQC 4DPRA 3G2SA 1YMPA 4APFA 1BU9A 3FU0A 1NL4A 3PNTB 3PRZA 2ILRA 2VGYA 3CK8A 1PY1A 4FC8A 5AENA 3WG7E 3MV2B 1FCHA 2XPYA 4OVVA 3CVLA 2A5UA 3ZYKA 3RK6A 3DSUA 4ACLA 4H7YA 3VTYA 3CV0A 2P58C 3QB2A 5AARA 4BSXA 4FJYA 4B8CB 1KLXA 4KMOA 3TXNA 4KZ0A 2FO1E 1E8ZA 4ILIA 4G8LA 2WXRA 5T3RA 1TNZA 1SA4A 3ZGQA 3LVRE 2Y69E 3SNXA 2ZGDA 4GA1A 1H2UA 3PZ1A 3V79K 3LJ3A 1TNOA 3TAXA 4U63A 2Y0BG 3RKVA 2JABA 1Q2ZA 3URZA 3NZUA 3FTSA 4HVBA 2QZAA 1EYHA 2V4HC 4BETA 2KXPC 4FHKA 4U95D 3ABME 4LEUA 4TXQA 3P1UA 2XZTG 4C48B 4L2YA 1DC2A 1N95A 4ZHBA 3KAEA 4HOUA 2V5FA 2L6JA 3QOUA 2I1KA 3F6QA 3KS2A 2DZOA 4G23A 4LRZA 3Q5MA 4LERA 1N54A 3B7BA 1S63A 3G2TA 4CEMA 4FA6A 4GMRA 4G11A 3Q79A 1O1SA 4YNDA 4A63B 3D9OA 1E90A 4JVSA 4OAUC 4CRWA 1TN6A 3QAQA 2UY1B 4XKCA 1ZU2A 3JUIA 3RJVA 3ZVVA 4AJWA 3SFZA 1H6OA 5CRUA 3W9FA 2UY1A 1K1AA 3EHRA 3FU3A 1HH8A 2R17C 3APDA 2WXOA 5B3SE 1HFAA 3TWWA 1FT2A 2LXMA 3B95A 4UQXA 3T8KA 4L23A 1N4PA 3D9PA 4KT6B 2QYUA 4J0UA 3QC1A 4J8SA 2QC9A 4JB8P 2VGXB 3X2QE 5BUZA 1AWCB 3TG4A 4F7AA 4GZ3A 2VGXA 4ACKA 2R03A 5ENTD 4JEHA 3LPZA 4TUMA 4WNGA 3TWTA 2XRZA 3ZXPA 5BT1A 3UPVA 4J8FA 3S7DA 3AJIA 5ANLA 3G2VA 2WVIA 3CKCA 4GZDA 1G3NB 3U66A 2VSXE 5EDSA 5EYLA 5AJLA 5CMYA 1WY6A 3R7QA 4AV7A 2P2CP 4EZJA 1S70B 3DSSA 2DYSE 5ARGA 1SQMA 3FUKA 2NSZA 3LY7A 4G8KA 2VJ8A 3FUJA 3Q7FA 5T4YA 4I2ZA 3PZDA 4EBAG 3R9MA 3GZSA 2E0IA 4EHMA 4U07A 4CGWA 2OEWA 3D3MA 2P9PG 1S0PA 5H7PA 3PE3A 3D9HA 3OAWA 4DX6D 3FUMA 3ONKA 4WUYA 4CDRA 2M63A 4DX1A 1ELRA 4LNBA 2IF4A 3FH8A 2C0LA 5JHAA 2KCKA 3CR3A 2IONA 4AXHA 3CVPA 2OOEA 1FVHA 3DXMG 1JCSA 3PH0C 5HRYA 3EHQA 1E7UA 2J4DA 4XEIG 4PS8A 1EF1C 2ONDA 3UQ3A 3SI5A 3LYAA 3PDNA 3Q9UC 4IRUA 2WXGA 3GW4A 3VLFA 1QBQA 1IXVA 3RRMB 1SW6A 3FU6A 4E85A 4LG6A 4U96D 1OWOA 1KZOA 5AIJA 3L54A 4GAAA 3IBEA 3OTNA 1JWFA 4IYPA 5DBKA 3CVQA 3ZFWA 4HOSA 4BT8A 1MYOA 3UINC 3J5QB 1FVFA 3HXEA 2FULA 3GZ2A 4BWRA 3PZ3A 3QARA 1X81A 5HKPA 3JUEA 3ESKA 2DVWA 5BNWA 3CQGB 3QWPA 4XZ4A 1IHGA 3PS6A 4PUCA 2WXPA 1B89A 4GMLA 4DX2A 4U8HA 2B0OE 1UN9A 1JWGA 4W9RA 1K8KG 1JUQA 4HOQA 1NZNA 4M7CA 3RAUA 4WWPA 2IJGX 4HRMB 3PEVB 2XEEA 2P9SG 2PNNA 3E33A 5LFAA 3ENEA 4EBAA 2QFCA 5A7DB 3PZ4A 3L13A 1NA0A 3IKOB 5KWDA 4ILHB 3VLDA 4BY6A 3U9WA 3R7RA 4UI9C 3JQ0A 5CECB 3ZXSA 4MKTA 3FWVA 2OVBA 3GZ1A 1N0QA 3KEAA 4HXIA 3OXGA 4BESA 3MKRA 4JC8A 3DRAA 3V2OA 2CHZA 1Z6TA 3AG2E 4IULA 1Z3YA 2YHCA 2WXQA 4A3TA 5BV0A 4AM9A 3DWLG 3N71A 3AG3E 4TV3A 5DIZA 3FY4A 4M3OA 5EN5D 2WXKA 2KZTB 5FQ6A 2A4ZA 3PNLB 2KCLA 2WXNA 2IOSA 4HRNA 3ZNGA 1HS6A 2X3MA 1SA5A 1H0AA 5CEAA 2LXLA 2KZTA 3D9NA 5KNGA 3LY8A 3CGHA 4RVBA 5G04J 2I1JA 2MOWA 3CKBA 3HXFA 1HF8A 4FU3A 2XZDG 3CHMA 1WG0A 3CVXA 2HE0A 4GA0A 3FFLA 3P2BA 1OT8A 2VGEA 4JHKA 4DI3A 2HO1A 3TL5A 1H2TC 2EQXA 3QNKA 3E32A 5FTPA 4V3IA 3FTXA 2EIME 3IHYA 3MGBA 4GTMA 1OWNA 3SF4A 4A1SA 1QQEA 1SZ9A 4MS6A 3B7SA 4PH4B 1N4RA 1MJ0A 3NQPA 2X6JA 1HX8A 5BPPA 4O1OA 3BU8A 3JYSA 5BW8C 3AG4E 3QK0A 4C0EA 2EIJE 2XPIA 5B1AE 4B93B 4HLEA 1GW6A 1FT1A 4HBDA 2AVPA 3FUFA 4YVOA 3RRNB 2J4BA 3D9LA 3MJWA 2WXMA 3C5RA 3QKYA 2WMNA 2B6CA 5LCWC 5AQ7A 3VTXA 4A55A 3U4TA 3CHSA 2ZGGA 4NRHB 2WPVA 1TJCA 3TG5A 4EQFA 2V0PA 2QY7A 1ZBPA 4UWGA 2AW6A 2IY0C 4N3CA 5KBAA 2XEVA 3MYVA 4WAFA 3QWWA 4UWHA 2I6HA 3HHMA 3ULQA 3DBSA 1IQUA 4DK5A 2KC7A 3PUJA 4J6IA 3C3OA 1UOHA 2IO2C 4UI9K 3E37A 4HQDA 4I9CA 5LOZA 1TJFA 3ABKE 4G24A 3D9KA 2YQ8A 3LXUX 3L82A 1TN8A 3DXKG 5KCMA 3RO3A 1KT0A 3ZW3A 3RU0A 3AU4A 2FF4A 5EYPF 3UKRG 3UT8A 4G25A 2EINE 3ZRHA 3I4GA 2Y3AA 3UM2A 3CLJA 1N11A 4AOFA 3IHVA 4GMJA 3TWRA 1OY3D 5CERB 1Z3XA 3V30A 5M72A 3C72A 3S2AA 3B7UX 4CGVA 2GGFA 3QJZA 4JPSA 2AXZA 5JJTA 2WMOA 1D8DA 4U04A 4DRXE 3DEOA 1JPLA 4AP2A 3CHPA 2R02A 4GPKA 2P9NG 2WQHA 2GRNB 3UI2A 3ZIMA 4RQIA 2KATA 2BTDA 1OWPA 4C0MA 3MKQA 4XE0A 5G05C 4IN3B 2NYJA 2CG2A 3TWXA 4HLLA 1DCQA 4GTTA 1Y6IA 3ZUVB 4LSZE 2LAIA 1DVPA 2VSNA 1O1RA 3JXIA 3HXDA 2VYIA 4BT9A 4KVMA 2ZU6B 2AXVA 3DPDA 4D10C 1E8WA 3I4RB 3PVLA 4CZ2D 3B13A 2X6KA 4F1SA 2VSOE 1NA3A 3EU9A 3E30A 2MYOA 3SHFA 4E6HA 3E34A 3LY9A 3ZYLA 2BF0X 2FBNA 4LUNU 4QFVA 5G2NA 1H2VC 5G55A 3FTUA 3KEZA 1HO8A 4N3AA 3LJNA 1UJKA 2P9UG 1TYQG 2NXPA 4L7TA 1X5BA 3B7TA 2XS8A 5ENPD 3TWQA 4XI9A 2ZIRA 4JHRA 1TNYA 3FUDA 4DLQA 5CCLA 2WXHA 3SBSA 4GZCA 1ELWA 3FEYA 2J07A 5BXUA 5HS0A 5CBOA 1XNFA 3ASDA 4N5QA 2H6IA 2PQRA 3LEWA 2IQCA 5CCMA 3OXLA 1O5MA
chains in the Genus database with same CATH topology
5KWDA 5JMND 4GPMA 3TWUA 3V79K 3JXJA 3ZKJA 1MX2A 2ETCA 3ZUVB 4LSZE 2BKGA 4DUIA 5CECB 2Y0BG 5ENTD 4F6RD 3JXIA 1IKND 2J8SD 2JABA 3V31A 5HRYA 2XENA 3EHQA 3NOCD 4TUMA 4BERA 2V4HC 4OAVB 5FINA 1NFIE 1N0QA 1MX6A 2KXPC 3SO8A 4BETA 2Y1LE 3KEAA 3TWTA 3UXGA 1BI7B 2L6BA 4ZFHA 4J8YA 4U8YD 4CYMD 1MJ0A 3Q9UC 4U95D 4BESA 4LNUD 5CBNA 3IXEA 1IXVA 4NIKA 5EYPF 4RLYA 2F8XK 2XZTG 4O1OA 3AJIA 1SW6A 4C48B 4CZ2D 1BD8A 3V2OA 3TWSA 2V5QC 3DEPA 1DC2A 4LG6A 4U96D 4ZHBA 1K3ZD 2XEHA 3F6QA 1G3NB 5JA4D 2DZOA 5AAOA 1N11A 3EU9A 3TWVA 5EYLA 4HNAD 3NOGD 3HRAA 2DZNA 3B7BA 1OY3D 4J7WA 5EILA 3TWRA 5CERB 2P2CP 2MYOA 2QYJA 4HI9A 4B93B 4GMRA 4YDYA 5ENOD 3NBNB 3Q9NC 5EN5D 4DX7D 1IHBA 1YMPA 1S70B 2KBXA 4K5BA 4HBDA 4O60A 4QFVA 5AN8A 3T9KA 2ETBA 3V30A 1WDYA 1BU9A 4A63B 3HG0D 2BKKB 1MYOA 3W9GA 3UTMA 1SVXA 3J5QB 4G8KA 4HRNA 3ZNGA 2A5EA 3C5RA 4BEPA 5AQAA 4O1PA 5CEAA 4OAUC 3LJNA 1AP7A 2DWZA 1BI8B 5AQ7A 5HKPA 5KNHD 3JUEA 3AAAC 2ZGGA 5KNGA 1MX4A 5CEDB 2DVWA 4ATZD 4U8VD 4F1PA 3J5PA 5ENRD 4DRXE 4HRLA 2AJAA 1YCSB 4K5AB 5AQBA 3DEOA 2RFAA 2ETAA 5AARA 2F8YA 3W9FA 3V2XA 4DX2A 1K1AA 3EHRA 4UUCA 5ENPD 3TWQA 5EIBE 1YYHA 2B0OE 5EIDA 4Z68A 5KBAA 5ENQD 5D66A 4QQIA 3D9HA 4K5CA 3ZU7B 4DX5D 4DX6D 2FO1E 2XZDG 3UI2A 4YDWA 3TWWA 3B95A 2F37A 1WG0A 4HRMB 3T8KA 1K1BA 2XEEA 2HE0A 5FIOA 4DX1A 5HS0A 5BXUA 5CBOA 2PNNA 1OT8A 1D9SA 5BXOA 2VGEA 1N0RA 5ITZF 4G8LA 4BSZB 1A5EA 5ENSD 4HB5A 4N5QA 3TWXA 2RFMA 2QC9A 1UOHA 4JB8P 1QYMA 2NYJA 1AWCB 1BLXB 4HI8A 2ZGDA 1TR4A 4HQDA 5AQ9A 4HLLA 1DCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KWD A;  5JMN D;  4GPM A;  3TWU A;  3V79 K;  3JXJ A;  3ZKJ A;  1MX2 A;  2ETC A;  3ZUV B;  4LSZ E;  2BKG A;  4DUI A;  5CEC B;  2Y0B G;  5ENT D;  4F6R D;  3JXI A;  1IKN D;  2J8S D;  2JAB A;  3V31 A;  5HRY A;  2XEN A;  3EHQ A;  3NOC D;  4TUM A;  4BER A;  2V4H C;  4OAV B;  5FIN A;  1NFI E;  1N0Q A;  1MX6 A;  2KXP C;  3SO8 A;  4BET A;  2Y1L E;  3KEA A;  3TWT A;  3UXG A;  1BI7 B;  2L6B A;  4ZFH A;  4J8Y A;  4U8Y D;  4CYM D;  1MJ0 A;  3Q9U C;  4U95 D;  4BES A;  4LNU D;  5CBN A;  3IXE A;  1IXV A;  4NIK A;  5EYP F;  4RLY A;  2F8X K;  2XZT G;  4O1O A;  3AJI A;  1SW6 A;  4C48 B;  4CZ2 D;  1BD8 A;  3V2O A;  3TWS A;  2V5Q C;  3DEP A;  1DC2 A;  4LG6 A;  4U96 D;  4ZHB A;  1K3Z D;  2XEH A;  3F6Q A;  1G3N B;  5JA4 D;  2DZO A;  5AAO A;  1N11 A;  3EU9 A;  3TWV A;  5EYL A;  4HNA D;  3NOG D;  3HRA A;  2DZN A;  3B7B A;  1OY3 D;  4J7W A;  5EIL A;  3TWR A;  5CER B;  2P2C P;  2MYO A;  2QYJ A;  4HI9 A;  4B93 B;  4GMR A;  4YDY A;  5ENO D;  3NBN B;  3Q9N C;  5EN5 D;  4DX7 D;  1IHB A;  1YMP A;  1S70 B;  2KBX A;  4K5B A;  4HBD A;  4O60 A;  4QFV A;  5AN8 A;  3T9K A;  2ETB A;  3V30 A;  1WDY A;  1BU9 A;  4A63 B;  3HG0 D;  2BKK B;  1MYO A;  3W9G A;  3UTM A;  1SVX A;  3J5Q B;  4G8K A;  4HRN A;  3ZNG A;  2A5E A;  3C5R A;  4BEP A;  5AQA A;  4O1P A;  5CEA A;  4OAU C;  3LJN A;  1AP7 A;  2DWZ A;  1BI8 B;  5AQ7 A;  5HKP A;  5KNH D;  3JUE A;  3AAA C;  2ZGG A;  5KNG A;  1MX4 A;  5CED B;  2DVW A;  4ATZ D;  4U8V D;  4F1P A;  3J5P A;  5ENR D;  4DRX E;  4HRL A;  2AJA A;  1YCS B;  4K5A B;  5AQB A;  3DEO A;  2RFA A;  2ETA A;  5AAR A;  2F8Y A;  3W9F A;  3V2X A;  4DX2 A;  1K1A A;  3EHR A;  4UUC A;  5ENP D;  3TWQ A;  5EIB E;  1YYH A;  2B0O E;  5EID A;  4Z68 A;  5KBA A;  5ENQ D;  5D66 A;  4QQI A;  3D9H A;  4K5C A;  3ZU7 B;  4DX5 D;  4DX6 D;  2FO1 E;  2XZD G;  3UI2 A;  4YDW A;  3TWW A;  3B95 A;  2F37 A;  1WG0 A;  4HRM B;  3T8K A;  1K1B A;  2XEE A;  2HE0 A;  5FIO A;  4DX1 A;  5HS0 A;  5BXU A;  5CBO A;  2PNN A;  1OT8 A;  1D9S A;  5BXO A;  2VGE A;  1N0R A;  5ITZ F;  4G8L A;  4BSZ B;  1A5E A;  5ENS D;  4HB5 A;  4N5Q A;  3TWX A;  2RFM A;  2QC9 A;  1UOH A;  4JB8 P;  1QYM A;  2NYJ A;  1AWC B;  1BLX B;  4HI8 A;  2ZGD A;  1TR4 A;  4HQD A;  5AQ9 A;  4HLL A;  1DCQ A; 
#chains in the Genus database with same CATH topology
 2X6H A;  3SZ7 A;  1MX2 A;  2IU1 A;  5A23 A;  3U64 A;  2VSY A;  1FPP A;  2Y1L E;  3CVV A;  2ZXW E;  4J8Y A;  2YIN A;  2HM8 A;  2RKK A;  3ASF A;  3L9T A;  4X8Q A;  1UG3 A;  1DNP A;  4L2L A;  4JZY A;  3ZN3 A;  4YVQ C;  4GU5 A;  1HU3 A;  3ZEF A;  3LS8 A;  3MX3 A;  3UKU G;  1N4Q A;  3Q73 A;  4J7W A;  4WWO A;  5EIL A;  2LO6 A;  2DYR E;  1H6P A;  3ESL A;  1OCR E;  2KCV A;  3JCK C;  3Q78 A;  4Q94 A;  3W9G A;  4HOT A;  3SD5 A;  4HS2 A;  5JHB A;  1MX4 A;  4BX8 A;  4HFG A;  4F1P A;  3GYZ A;  2HR2 A;  4DJA A;  3RIB A;  3ZHE B;  1U2V G;  3ASH A;  2F0Y A;  2F8Y A;  4UWF A;  3ZHE A;  1EDU A;  1EPU A;  3CVN A;  1V54 E;  5JJ7 A;  4F3V A;  2F37 A;  2R5S A;  2PM6 A;  3FP3 A;  4BSZ B;  2E2E A;  3SFY A;  3UM3 A;  1RW2 A;  4FHJ A;  4B0Z A;  4WWN A;  4NUR A;  1HG2 A;  4GPM A;  2WM9 A;  3IEG A;  2IO3 C;  4PS3 A;  4N39 A;  2CFU A;  4HOR A;  4BTA A;  4F53 A;  5KJM A;  4Y6W A;  4U8Y D;  1E8Y A;  4NAC A;  1PAQ A;  2IEJ A;  5A6C A;  3SQV A;  1K3Z D;  2GRO B;  3FTV A;  5J08 A;  1W3B A;  4WNF A;  4HNA D;  3NOG D;  2CHX A;  4EZL A;  2QYJ A;  4YDY A;  4K03 A;  2WXF A;  3UM0 A;  4JEU A;  3MCX A;  3PEU B;  4I2W A;  2R05 A;  3HDX A;  2XS1 A;  3L6A A;  3FTY A;  5AQB A;  5CRV A;  3C98 A;  3CHQ A;  2J9Q A;  3TJP A;  1OWL A;  2WXJ A;  3S7B A;  3VLE A;  3SFX A;  4I6E A;  3I3N A;  4I17 A;  3RSE G;  4Z68 A;  3NF1 A;  4GZ6 A;  1LD7 A;  3UMV A;  5FQ4 A;  4I1A A;  4DLO A;  3SBT B;  3ZU7 B;  2YHE A;  5FQ7 A;  3LCA A;  3UT4 A;  5FIO A;  1XGW A;  4JHJ A;  1A17 A;  3ZPJ A;  3CK7 A;  3UM1 A;  3UIO C;  4ABN A;  1E8X A;  1QZ2 A;  2XCB A;  4HI8 A;  4WND A;  1TR4 A;  3B7R L;  3SGH A;  3TWU A;  2GRL A;  3PUK A;  3JXJ A;  4L9P A;  3DST A;  3ZYM A;  4I6G A;  3EHM A;  3FU5 A;  2J8S D;  3V31 A;  3R9A B;  3ABL E;  4OAV B;  5FT9 A;  2KM4 A;  3O4Z A;  3CEQ A;  2ZIS A;  3CK9 A;  3IXE A;  2JLB A;  1SZA A;  5EKQ D;  3I5P A;  2NC9 A;  3DEP A;  5AJD A;  2XEH A;  1V55 E;  2WB2 A;  4LNG A;  4GTQ A;  1E7V A;  5ENO D;  3MA5 A;  5C2Y A;  3T9K A;  1WDY A;  3EU5 A;  1LD8 A;  4XIF A;  4GYY A;  2X38 A;  4B94 A;  3FUL A;  2WQ6 A;  3FTW A;  4J8D A;  4XKB A;  4JD2 G;  5ENR D;  1E96 B;  2Q7F A;  4HRL A;  2YNQ A;  4JW1 A;  2AJA A;  1YCS B;  3CVY A;  1ELK A;  5HI7 A;  1YYH A;  2H6G A;  5EID A;  1N9A A;  3AS4 A;  5ENQ D;  4K5C A;  5CHE E;  3AG1 E;  3UT7 A;  4U0S A;  2MHK A;  4GYO A;  2IFU A;  5KJN A;  2XPZ A;  3EHN A;  3NZS A;  4O6F A;  3ASG A;  2IOL A;  4G2V A;  4FP7 A;  3NB2 A;  1LF8 A;  4DUI A;  5ARF A;  1NFI E;  3RRU A;  2L6B A;  4MRU A;  4UQY A;  4FLH A;  3DSV A;  1KZP A;  5G04 C;  2V5Q C;  2GRQ B;  1HZ4 A;  3L08 A;  4UWL A;  2P9L G;  2XGO A;  2WQ7 A;  4AY6 A;  4KZC A;  4J8E A;  4PS7 A;  3ISM C;  4U0U A;  4BFR A;  3HRA A;  3G2U A;  3S7J A;  3NBN B;  4P29 A;  4R7L A;  4TRQ A;  4K5B A;  3FUN A;  5AN8 A;  3ASO E;  3HG0 D;  3MEK A;  4EZK A;  4AEZ C;  3CIA A;  3LDZ A;  2RG8 A;  1BI8 B;  5IY5 E;  2GW1 A;  3AAA C;  1WM5 A;  4N2S A;  3L16 A;  4K5A B;  4APO A;  2GRM A;  3UUX A;  1DCE A;  4TXP A;  5D0Q D;  3Q75 A;  4B89 A;  1KT1 A;  3ZYQ A;  1TNU A;  3D9I A;  3SY2 A;  3TGO A;  2OCC E;  3TXM A;  1NP7 A;  2XQ0 A;  1S64 A;  4GTV A;  4AY5 A;  5FZQ A;  3LVQ E;  4HB5 A;  4URK A;  1QNF A;  2HYZ A;  3FH7 A;  4GTP A;  3FDH A;  2J09 A;  3HXB A;  2WXI A;  2H6H A;  5JMN D;  4OVU A;  1LTX A;  3MKQ B;  5D0O D;  1OWM A;  4JA9 A;  4EEC A;  3PE4 A;  2J49 A;  2PZI A;  4LNU D;  2V8S E;  3E4B A;  2F8X K;  2CHW A;  3NAW A;  5C1D A;  4Q96 A;  2XGM A;  1WAO 1;  5AAO A;  3TWV A;  4GZ5 A;  4HI9 A;  4TUU A;  4JL0 A;  1IHB A;  2RD0 A;  1U3C A;  3UTM A;  1SVX A;  4FUL A;  5EX0 A;  4ATZ D;  4U8V D;  1H19 A;  1MHQ A;  5BV1 A;  3PRE A;  2ETA A;  5AYW D;  3BG0 B;  3D9M A;  4XI0 A;  5EIB E;  3AS5 A;  2GRP B;  3O48 A;  5D66 A;  4ANU A;  3DSW A;  3EUV A;  4L1B A;  4EPZ A;  4ANX A;  2PM7 A;  4I1M A;  3CST A;  2ETC A;  3BUA A;  2I9C A;  4N2Q A;  5FJY A;  4BER A;  3ML8 A;  2WXL A;  2EIL E;  1OXJ A;  2LNI A;  1BI7 B;  3MV3 B;  1HG5 A;  4ME2 A;  1U3D A;  4KYO B;  3C3R A;  2OV8 A;  3AS8 A;  2DCP A;  1PC2 A;  4MLP A;  3L22 A;  3CVU A;  2MRI A;  4NQ0 A;  4UI9 J;  2DZN A;  5E75 A;  3Q9N C;  4I6J A;  2KBX A;  5EX3 A;  2ETB A;  4CDN A;  1IQR A;  4GTS A;  3ONL A;  3UIP C;  2LSU A;  3APF A;  2XCC A;  5T8I A;  5AQA A;  4O1P A;  1AP7 A;  4JA7 A;  1Z5S C;  1HXI A;  2OVF A;  3FTZ A;  3ULY A;  4H7X A;  4DI4 A;  3CHO A;  4CDM A;  4ATG A;  1HE8 A;  2UWJ G;  4Y6C A;  4UUC A;  3CSF A;  3FH5 A;  4JXT A;  4RG6 A;  4GTR A;  3CHR A;  2H6F A;  4UQZ A;  1N52 A;  2AXU A;  1A5E A;  2LAH A;  1OCC E;  2RFM A;  1QYM A;  2L0I A;  1BLX B;  2PQN A;  4U7E B;  2LSV A;  3L17 A;  3UXG A;  3QDN A;  4GCN A;  3T8M A;  4GYW A;  4Q69 A;  2L0T B;  4YDE A;  2XEN A;  2EIK E;  3Q49 B;  4ZFH A;  1L5J A;  4CYM D;  4LCT A;  4NIK A;  4RLY A;  5E76 A;  3FUH A;  4I43 A;  3ULE G;  4CT0 A;  4A3V A;  5FZS A;  3HVE B;  5CMW A;  4WNE A;  2VTB B;  1YA0 A;  1OUV A;  3KSQ A;  4GCO A;  3BQO A;  3HVE A;  4TXR A;  2C0M A;  2VTB A;  2R59 A;  2PL2 A;  3OXF A;  4PDX A;  4RSY A;  2Y4T A;  1MZC A;  2AWI A;  2BKK B;  4I1O B;  3WXX A;  2A5E A;  3KD7 A;  3FHE A;  3KSL A;  3BEE A;  5CED B;  5FWQ A;  3FUI A;  1RZ4 A;  3J5P A;  1JCQ A;  3IV0 A;  2XHE A;  2JEK A;  3PZ2 A;  4CCA A;  1N4S A;  2CFZ A;  5J90 A;  2I2O A;  2DIW A;  5ENN A;  1TN7 A;  2BUG A;  1OCZ E;  5JJ6 A;  2P9K G;  3APC A;  4ANV A;  2R2L A;  2FEZ A;  3Q47 B;  3FUE A;  1D9S A;  5BXO A;  5LCW J;  1N0R A;  5ITZ F;  2P9I G;  5ENS D;  1P5Q A;  3Q15 A;  3ML9 A;  1TNB A;  5D2M C;  3ZKJ A;  3T5X A;  2Y4U A;  4CT4 A;  4A1G A;  1IYG A;  2FI7 A;  3NOC D;  4KVO A;  5FIN A;  1MX6 A;  3S7F A;  2LUH A;  1TEZ A;  4MBG A;  3EIJ A;  3U3W A;  1N94 A;  4G26 A;  4OYS A;  5CBN A;  4N5C A;  3AU5 A;  5HQ8 A;  4RG9 A;  2XRY A;  4AIF A;  3HXC A;  2C2L A;  1UN8 A;  3G2W A;  4KXK B;  4DX7 D;  4KBQ A;  2DBA A;  4BX9 A;  2GRR B;  3DSX A;  4O60 A;  4GB9 A;  5FZR A;  4G1T A;  3UX4 A;  1INZ A;  4AVX A;  4BEP A;  3C3Q A;  2DWZ A;  4U0Z A;  5KNH D;  3K9I A;  1UW4 B;  1UJJ A;  1ZB1 A;  4B8A A;  2VQ2 A;  4XX5 A;  5KJL A;  3EDT B;  2RFA A;  1D8E A;  2X6I A;  3BG1 B;  3CQC B;  3RO2 A;  2CG3 A;  3V2X A;  4GA2 A;  5LP0 A;  3EJN A;  4YDO A;  1KPS B;  4K0R A;  2L9B A;  4BTB A;  4QQI A;  4DX5 D;  3CVW A;  4YDW A;  1K1B A;  5B1B E;  2XGS A;  4FAD A;  3DPY A;  4UWK A;  1Y8M A;  1O1T A;  5LX8 A;  5AQ9 A;  4I9E A;  3LKU A;  5ANR A;  1JCR A;  1VDY A;  2X6F A;  3Q7A A;  1H6K A;  3QWV A;  2BKG A;  2OEV A;  4FLB A;  4F6R D;  1IKN D;  2FO7 A;  5FQ8 A;  2V4L A;  2BED A;  3D9J A;  3HYM B;  3FEX A;  3SO8 A;  4ANW A;  4C9B B;  3ASN E;  3Q4A B;  5KJK A;  3MZL B;  3JQ1 A;  1BD8 A;  5G05 J;  3TWS A;  4FJZ A;  3HIZ A;  1OCO E;  4ILG A;  4N3B A;  2J08 A;  5JA4 D;  1MQS A;  4GTO A;  1NI1 A;  1BPO A;  3T5V A;  3EIQ C;  4DPR A;  3G2S A;  1YMP A;  4APF A;  1BU9 A;  3FU0 A;  1NL4 A;  3PNT B;  3PRZ A;  2ILR A;  2VGY A;  3CK8 A;  1PY1 A;  4FC8 A;  5AEN A;  3WG7 E;  3MV2 B;  1FCH A;  2XPY A;  4OVV A;  3CVL A;  2A5U A;  3ZYK A;  3RK6 A;  3DSU A;  4ACL A;  4H7Y A;  3VTY A;  3CV0 A;  2P58 C;  3QB2 A;  5AAR A;  4BSX A;  4FJY A;  4B8C B;  1KLX A;  4KMO A;  3TXN A;  4KZ0 A;  2FO1 E;  1E8Z A;  4ILI A;  4G8L A;  2WXR A;  5T3R A;  1TNZ A;  1SA4 A;  3ZGQ A;  3LVR E;  2Y69 E;  3SNX A;  2ZGD A;  4GA1 A;  1H2U A;  3PZ1 A;  3V79 K;  3LJ3 A;  1TNO A;  3TAX A;  4U63 A;  2Y0B G;  3RKV A;  2JAB A;  1Q2Z A;  3URZ A;  3NZU A;  3FTS A;  4HVB A;  2QZA A;  1EYH A;  2V4H C;  4BET A;  2KXP C;  4FHK A;  4U95 D;  3ABM E;  4LEU A;  4TXQ A;  3P1U A;  2XZT G;  4C48 B;  4L2Y A;  1DC2 A;  1N95 A;  4ZHB A;  3KAE A;  4HOU A;  2V5F A;  2L6J A;  3QOU A;  2I1K A;  3F6Q A;  3KS2 A;  2DZO A;  4G23 A;  4LRZ A;  3Q5M A;  4LER A;  1N54 A;  3B7B A;  1S63 A;  3G2T A;  4CEM A;  4FA6 A;  4GMR A;  4G11 A;  3Q79 A;  1O1S A;  4YND A;  4A63 B;  3D9O A;  1E90 A;  4JVS A;  4OAU C;  4CRW A;  1TN6 A;  3QAQ A;  2UY1 B;  4XKC A;  1ZU2 A;  3JUI A;  3RJV A;  3ZVV A;  4AJW A;  3SFZ A;  1H6O A;  5CRU A;  3W9F A;  2UY1 A;  1K1A A;  3EHR A;  3FU3 A;  1HH8 A;  2R17 C;  3APD A;  2WXO A;  5B3S E;  1HFA A;  3TWW A;  1FT2 A;  2LXM A;  3B95 A;  4UQX A;  3T8K A;  4L23 A;  1N4P A;  3D9P A;  4KT6 B;  2QYU A;  4J0U A;  3QC1 A;  4J8S A;  2QC9 A;  4JB8 P;  2VGX B;  3X2Q E;  5BUZ A;  1AWC B;  3TG4 A;  4F7A A;  4GZ3 A;  2VGX A;  4ACK A;  2R03 A;  5ENT D;  4JEH A;  3LPZ A;  4TUM A;  4WNG A;  3TWT A;  2XRZ A;  3ZXP A;  5BT1 A;  3UPV A;  4J8F A;  3S7D A;  3AJI A;  5ANL A;  3G2V A;  2WVI A;  3CKC A;  4GZD A;  1G3N B;  3U66 A;  2VSX E;  5EDS A;  5EYL A;  5AJL A;  5CMY A;  1WY6 A;  3R7Q A;  4AV7 A;  2P2C P;  4EZJ A;  1S70 B;  3DSS A;  2DYS E;  5ARG A;  1SQM A;  3FUK A;  2NSZ A;  3LY7 A;  4G8K A;  2VJ8 A;  3FUJ A;  3Q7F A;  5T4Y A;  4I2Z A;  3PZD A;  4EBA G;  3R9M A;  3GZS A;  2E0I A;  4EHM A;  4U07 A;  4CGW A;  2OEW A;  3D3M A;  2P9P G;  1S0P A;  5H7P A;  3PE3 A;  3D9H A;  3OAW A;  4DX6 D;  3FUM A;  3ONK A;  4WUY A;  4CDR A;  2M63 A;  4DX1 A;  1ELR A;  4LNB A;  2IF4 A;  3FH8 A;  2C0L A;  5JHA A;  2KCK A;  3CR3 A;  2ION A;  4AXH A;  3CVP A;  2OOE A;  1FVH A;  3DXM G;  1JCS A;  3PH0 C;  5HRY A;  3EHQ A;  1E7U A;  2J4D A;  4XEI G;  4PS8 A;  1EF1 C;  2OND A;  3UQ3 A;  3SI5 A;  3LYA A;  3PDN A;  3Q9U C;  4IRU A;  2WXG A;  3GW4 A;  3VLF A;  1QBQ A;  1IXV A;  3RRM B;  1SW6 A;  3FU6 A;  4E85 A;  4LG6 A;  4U96 D;  1OWO A;  1KZO A;  5AIJ A;  3L54 A;  4GAA A;  3IBE A;  3OTN A;  1JWF A;  4IYP A;  5DBK A;  3CVQ A;  3ZFW A;  4HOS A;  4BT8 A;  1MYO A;  3UIN C;  3J5Q B;  1FVF A;  3HXE A;  2FUL A;  3GZ2 A;  4BWR A;  3PZ3 A;  3QAR A;  1X81 A;  5HKP A;  3JUE A;  3ESK A;  2DVW A;  5BNW A;  3CQG B;  3QWP A;  4XZ4 A;  1IHG A;  3PS6 A;  4PUC A;  2WXP A;  1B89 A;  4GML A;  4DX2 A;  4U8H A;  2B0O E;  1UN9 A;  1JWG A;  4W9R A;  1K8K G;  1JUQ A;  4HOQ A;  1NZN A;  4M7C A;  3RAU A;  4WWP A;  2IJG X;  4HRM B;  3PEV B;  2XEE A;  2P9S G;  2PNN A;  3E33 A;  5LFA A;  3ENE A;  4EBA A;  2QFC A;  5A7D B;  3PZ4 A;  3L13 A;  1NA0 A;  3IKO B;  5KWD A;  4ILH B;  3VLD A;  4BY6 A;  3U9W A;  3R7R A;  4UI9 C;  3JQ0 A;  5CEC B;  3ZXS A;  4MKT A;  3FWV A;  2OVB A;  3GZ1 A;  1N0Q A;  3KEA A;  4HXI A;  3OXG A;  4BES A;  3MKR A;  4JC8 A;  3DRA A;  3V2O A;  2CHZ A;  1Z6T A;  3AG2 E;  4IUL A;  1Z3Y A;  2YHC A;  2WXQ A;  4A3T A;  5BV0 A;  4AM9 A;  3DWL G;  3N71 A;  3AG3 E;  4TV3 A;  5DIZ A;  3FY4 A;  4M3O A;  5EN5 D;  2WXK A;  2KZT B;  5FQ6 A;  2A4Z A;  3PNL B;  2KCL A;  2WXN A;  2IOS A;  4HRN A;  3ZNG A;  1HS6 A;  2X3M A;  1SA5 A;  1H0A A;  5CEA A;  2LXL A;  2KZT A;  3D9N A;  5KNG A;  3LY8 A;  3CGH A;  4RVB A;  5G04 J;  2I1J A;  2MOW A;  3CKB A;  3HXF A;  1HF8 A;  4FU3 A;  2XZD G;  3CHM A;  1WG0 A;  3CVX A;  2HE0 A;  4GA0 A;  3FFL A;  3P2B A;  1OT8 A;  2VGE A;  4JHK A;  4DI3 A;  2HO1 A;  3TL5 A;  1H2T C;  2EQX A;  3QNK A;  3E32 A;  5FTP A;  4V3I A;  3FTX A;  2EIM E;  3IHY A;  3MGB A;  4GTM A;  1OWN A;  3SF4 A;  4A1S A;  1QQE A;  1SZ9 A;  4MS6 A;  3B7S A;  4PH4 B;  1N4R A;  1MJ0 A;  3NQP A;  2X6J A;  1HX8 A;  5BPP A;  4O1O A;  3BU8 A;  3JYS A;  5BW8 C;  3AG4 E;  3QK0 A;  4C0E A;  2EIJ E;  2XPI A;  5B1A E;  4B93 B;  4HLE A;  1GW6 A;  1FT1 A;  4HBD A;  2AVP A;  3FUF A;  4YVO A;  3RRN B;  2J4B A;  3D9L A;  3MJW A;  2WXM A;  3C5R A;  3QKY A;  2WMN A;  2B6C A;  5LCW C;  5AQ7 A;  3VTX A;  4A55 A;  3U4T A;  3CHS A;  2ZGG A;  4NRH B;  2WPV A;  1TJC A;  3TG5 A;  4EQF A;  2V0P A;  2QY7 A;  1ZBP A;  4UWG A;  2AW6 A;  2IY0 C;  4N3C A;  5KBA A;  2XEV A;  3MYV A;  4WAF A;  3QWW A;  4UWH A;  2I6H A;  3HHM A;  3ULQ A;  3DBS A;  1IQU A;  4DK5 A;  2KC7 A;  3PUJ A;  4J6I A;  3C3O A;  1UOH A;  2IO2 C;  4UI9 K;  3E37 A;  4HQD A;  4I9C A;  5LOZ A;  1TJF A;  3ABK E;  4G24 A;  3D9K A;  2YQ8 A;  3LXU X;  3L82 A;  1TN8 A;  3DXK G;  5KCM A;  3RO3 A;  1KT0 A;  3ZW3 A;  3RU0 A;  3AU4 A;  2FF4 A;  5EYP F;  3UKR G;  3UT8 A;  4G25 A;  2EIN E;  3ZRH A;  3I4G A;  2Y3A A;  3UM2 A;  3CLJ A;  1N11 A;  4AOF A;  3IHV A;  4GMJ A;  3TWR A;  1OY3 D;  5CER B;  1Z3X A;  3V30 A;  5M72 A;  3C72 A;  3S2A A;  3B7U X;  4CGV A;  2GGF A;  3QJZ A;  4JPS A;  2AXZ A;  5JJT A;  2WMO A;  1D8D A;  4U04 A;  4DRX E;  3DEO A;  1JPL A;  4AP2 A;  3CHP A;  2R02 A;  4GPK A;  2P9N G;  2WQH A;  2GRN B;  3UI2 A;  3ZIM A;  4RQI A;  2KAT A;  2BTD A;  1OWP A;  4C0M A;  3MKQ A;  4XE0 A;  5G05 C;  4IN3 B;  2NYJ A;  2CG2 A;  3TWX A;  4HLL A;  1DCQ A;  4GTT A;  1Y6I A;  3ZUV B;  4LSZ E;  2LAI A;  1DVP A;  2VSN A;  1O1R A;  3JXI A;  3HXD A;  2VYI A;  4BT9 A;  4KVM A;  2ZU6 B;  2AXV A;  3DPD A;  4D10 C;  1E8W A;  3I4R B;  3PVL A;  4CZ2 D;  3B13 A;  2X6K A;  4F1S A;  2VSO E;  1NA3 A;  3EU9 A;  3E30 A;  2MYO A;  3SHF A;  4E6H A;  3E34 A;  3LY9 A;  3ZYL A;  2BF0 X;  2FBN A;  4LUN U;  4QFV A;  5G2N A;  1H2V C;  5G55 A;  3FTU A;  3KEZ A;  1HO8 A;  4N3A A;  3LJN A;  1UJK A;  2P9U G;  1TYQ G;  2NXP A;  4L7T A;  1X5B A;  3B7T A;  2XS8 A;  5ENP D;  3TWQ A;  4XI9 A;  2ZIR A;  4JHR A;  1TNY A;  3FUD A;  4DLQ A;  5CCL A;  2WXH A;  3SBS A;  4GZC A;  1ELW A;  3FEY A;  2J07 A;  5BXU A;  5HS0 A;  5CBO A;  1XNF A;  3ASD A;  4N5Q A;  2H6I A;  2PQR A;  3LEW A;  2IQC A;  5CCM A;  3OXL A;  1O5M A; 
#chains in the Genus database with same CATH homology
 5KWD A;  5JMN D;  4GPM A;  3TWU A;  3V79 K;  3JXJ A;  3ZKJ A;  1MX2 A;  2ETC A;  3ZUV B;  4LSZ E;  2BKG A;  4DUI A;  5CEC B;  2Y0B G;  5ENT D;  4F6R D;  3JXI A;  1IKN D;  2J8S D;  2JAB A;  3V31 A;  5HRY A;  2XEN A;  3EHQ A;  3NOC D;  4TUM A;  4BER A;  2V4H C;  4OAV B;  5FIN A;  1NFI E;  1N0Q A;  1MX6 A;  2KXP C;  3SO8 A;  4BET A;  2Y1L E;  3KEA A;  3TWT A;  3UXG A;  1BI7 B;  2L6B A;  4ZFH A;  4J8Y A;  4U8Y D;  4CYM D;  1MJ0 A;  3Q9U C;  4U95 D;  4BES A;  4LNU D;  5CBN A;  3IXE A;  1IXV A;  4NIK A;  5EYP F;  4RLY A;  2F8X K;  2XZT G;  4O1O A;  3AJI A;  1SW6 A;  4C48 B;  4CZ2 D;  1BD8 A;  3V2O A;  3TWS A;  2V5Q C;  3DEP A;  1DC2 A;  4LG6 A;  4U96 D;  4ZHB A;  1K3Z D;  2XEH A;  3F6Q A;  1G3N B;  5JA4 D;  2DZO A;  5AAO A;  1N11 A;  3EU9 A;  3TWV A;  5EYL A;  4HNA D;  3NOG D;  3HRA A;  2DZN A;  3B7B A;  1OY3 D;  4J7W A;  5EIL A;  3TWR A;  5CER B;  2P2C P;  2MYO A;  2QYJ A;  4HI9 A;  4B93 B;  4GMR A;  4YDY A;  5ENO D;  3NBN B;  3Q9N C;  5EN5 D;  4DX7 D;  1IHB A;  1YMP A;  1S70 B;  2KBX A;  4K5B A;  4HBD A;  4O60 A;  4QFV A;  5AN8 A;  3T9K A;  2ETB A;  3V30 A;  1WDY A;  1BU9 A;  4A63 B;  3HG0 D;  2BKK B;  1MYO A;  3W9G A;  3UTM A;  1SVX A;  3J5Q B;  4G8K A;  4HRN A;  3ZNG A;  2A5E A;  3C5R A;  4BEP A;  5AQA A;  4O1P A;  5CEA A;  4OAU C;  3LJN A;  1AP7 A;  2DWZ A;  1BI8 B;  5AQ7 A;  5HKP A;  5KNH D;  3JUE A;  3AAA C;  2ZGG A;  5KNG A;  1MX4 A;  5CED B;  2DVW A;  4ATZ D;  4U8V D;  4F1P A;  3J5P A;  5ENR D;  4DRX E;  4HRL A;  2AJA A;  1YCS B;  4K5A B;  5AQB A;  3DEO A;  2RFA A;  2ETA A;  5AAR A;  2F8Y A;  3W9F A;  3V2X A;  4DX2 A;  1K1A A;  3EHR A;  4UUC A;  5ENP D;  3TWQ A;  5EIB E;  1YYH A;  2B0O E;  5EID A;  4Z68 A;  5KBA A;  5ENQ D;  5D66 A;  4QQI A;  3D9H A;  4K5C A;  3ZU7 B;  4DX5 D;  4DX6 D;  2FO1 E;  2XZD G;  3UI2 A;  4YDW A;  3TWW A;  3B95 A;  2F37 A;  1WG0 A;  4HRM B;  3T8K A;  1K1B A;  2XEE A;  2HE0 A;  5FIO A;  4DX1 A;  5HS0 A;  5BXU A;  5CBO A;  2PNN A;  1OT8 A;  1D9S A;  5BXO A;  2VGE A;  1N0R A;  5ITZ F;  4G8L A;  4BSZ B;  1A5E A;  5ENS D;  4HB5 A;  4N5Q A;  3TWX A;  2RFM A;  2QC9 A;  1UOH A;  4JB8 P;  1QYM A;  2NYJ A;  1AWC B;  1BLX B;  4HI8 A;  2ZGD A;  1TR4 A;  4HQD A;  5AQ9 A;  4HLL A;  1DCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...