3RRMB

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
295
structure length
295
Chain Sequence
TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 118
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rrmB00
3PEVB 3RRMB 3RRNB 3PEUB
chains in the Genus database with same CATH superfamily
2QC9A 2WB2A 1HO8A 4B0ZA 4F7AA 2V8SE 5T3RA 2NYJA 4IULA 4N2QA 3AAAC 3GZ1A 2I1JA 5KBAA 3UPVA 4FC8A 2AW6A 4UWFA 4CZ2D 1NI1A 1MYOA 4MBGA 1FVHA 4HNAD 2WM9A 4EPZA 4DI4A 3W9FA 4XI9A 4TXPA 5AQ7A 5FQ4A 5G05C 3AS4A 3ZIMA 3CVVA 3FH8A 4TV3A 4L2YA 4WNFA 2AWIA 4J0UA 3U66A 4BTBA 3LY8A 1NFIE 5FZQA 1UN9A 2EIJE 4N3AA 3GZ2A 3FY4A 3KSLA 2L0TB 3AG2E 3IV0A 5AJDA 4GYOA 2EINE 4F53A 1HS6A 2BTDA 1VDYA 1JUQA 3AS8A 5CBOA 2AJAA 5ENPD 1BI7B 1FCHA 4K5BA 1K3ZD 4EZJA 1MX4A 2F8YA 1TNBA 2EIKE 1HG2A 5C2YA 5CMWA 1N4PA 3CVQA 1N9AA 4YVQC 3FTYA 1NP7A 2WXHA 5FTPA 4HI8A 2WMNA 3E33A 2VYIA 2R2LA 5HQ8A 3OXFA 4KXKB 4ANVA 4TRQA 5LCWJ 1B89A 5BNWA 3JCKC 5BPPA 3ZUVB 2XRZA 3PE4A 3MGBA 1HFAA 4ILHB 3RIBA 2ETAA 2OCCE 3UKUG 2F0YA 1BLXB 4CDNA 2I2OA 1IQUA 4O1OA 3LEWA 1SZAA 3ABLE 4FHKA 4F1PA 4ACKA 5LX8A 1WDYA 3DXKG 3FUNA 4U0ZA 3LPZA 2IFUA 3CV0A 4LCTA 4IN3B 2L0IA 2WMOA 3X2QE 4U95D 1YMPA 1KZOA 1INZA 5CCMA 2NSZA 3V2XA 3T8KA 3CKBA 3KAEA 3FFLA 2JABA 3L08A 2XEEA 4U7EB 5CMYA 1DC2A 3HXFA 5H7PA 2Q7FA 2WQ7A 4AY6A 3TG5A 1EF1C 1DCEA 3LY7A 4YDEA 4BETA 3TJPA 1U2VG 3NZSA 2BUGA 4GTPA 4XZ4A 4B94A 1E8YA 3UXGA 3C72A 3Q9UC 4HRMB 2LSVA 4N5QA 3CKCA 3CIAA 1JCSA 3FU0A 3T5VA 1U3CA 3ZHEA 5ENQD 3FEXA 4ABNA 2XEHA 3TWXA 2FEZA 3RKVA 4U04A 1EYHA 3DRAA 1QQEA 3VLEA 4G24A 3QWWA 3D9LA 3ABME 1QZ2A 4CGWA 3L82A 4JHJA 4UWLA 2GRMA 1N54A 1IYGA 1OCOE 3HYMB 4KT6B 4Q69A 2BKKB 2X6IA 1IQRA 4I9EA 3GZSA 4K03A 3D9OA 3Q47B 3B13A 3SFZA 4WAFA 5FWQA 3UT4A 5BW8C 3EIJA 2YHCA 2ZIRA 3CK8A 4AVXA 2XZDG 4YDOA 4HLLA 3EJNA 1DNPA 4YDYA 3ULQA 4G11A 3I4RB 4PH4B 1SVXA 4FA6A 4B93B 3LKUA 5FIOA 1FT2A 2HM8A 3AU5A 4ANUA 1H2UA 4C48B 2C0LA 4QFVA 4UUCA 5EKQD 2IONA 2OVBA 4FLBA 2XHEA 5J08A 4F1SA 4HQDA 3S7DA 4I1AA 3QKYA 3RSEG 2E0IA 2CHZA 1QBQA 2VQ2A 3TL5A 4ATGA 2WPVA 4L1BA 4GCNA 5FJYA 3SZ7A 3APCA 1N11A 5LFAA 2X6FA 4P29A 5G04C 2J09A 3HXBA 3VTXA 2X38A 5AQBA 1IHGA 3C5RA 4A1SA 3DBSA 4CGVA 4J8YA 4GAAA 1NA3A 2J08A 3CQCB 3AS5A 3B7TA 3ISMC 5ENRD 3O48A 4DX2A 1GW6A 2NXPA 1KT0A 4U0SA 3MV3B 1E90A 4I17A 3QWPA 2LNIA 2P9LG 2IQCA 3JYSA 4XKCA 3FUFA 1Z5SC 3MKQA 2FO1E 3RU0A 4JHRA 5JHAA 1TN6A 1P5QA 2V4HC 2CFZA 3FWVA 4LUNU 1E8WA 3CHRA 5BV1A 3TWVA 4HI9A 4KMOA 1NL4A 4ANWA 2XCBA 4CDRA 3EHQA 2ZXWE 1O1RA 5FQ7A 1OWLA 5FQ8A 4HS2A 1ZBPA 3PDNA 1TJFA 3LDZA 3PRZA 3UM3A 2P9UG 4DK5A 2OEVA 2AXVA 5CEDB 4MS6A 3HXCA 2XGMA 4E85A 5KJNA 4UWHA 4FHJA 2R02A 2FI7A 3D9IA 3TXNA 2LUHA 1G3NB 1MX2A 3I5PA 2VTBA 4GA1A 1L5JA 1OUVA 2DWZA 3MV2B 2GRLA 3P2BA 3QK0A 1Z3XA 3ABKE 1E7VA 3C3RA 4NURA 1KT1A 4DX5D 3LVRE 3L17A 2KBXA 4U63A 1LTXA 4FJZA 3FH7A 2B0OE 3K9IA 1MQSA 1W3BA 1JCRA 5T8IA 3B7RL 1K1AA 1Y8MA 2CG3A 3FTZA 4TXRA 3D9KA 3SNXA 2F8XK 4UI9C 4APOA 3CHQA 2DCPA 4WNGA 3E32A 2P9IG 2ONDA 1ELWA 4JL0A 3CVNA 4C9BB 3CR3A 2ZGDA 3PUKA 3B7SA 1N4SA 2I9CA 1BU9A 2L6JA 3U9WA 2I6HA 4LEUA 3QAQA 2R5SA 2EQXA 1TJCA 4GZ3A 2J9QA 4FLHA 1PC2A 5EYLA 1TN7A 3Q73A 3UINC 1N95A 2XPZA 4BTAA 2Y4UA 4BFRA 4AM9A 2VGEA 5FZSA 2AVPA 2Y69E 2KXPC 3PS6A 4L2LA 2IOLA 2QYJA 2R03A 2RKKA 2YINA 1FPPA 2DYRE 4AXHA 3QARA 4LNUD 1WAO1 3DSUA 2R05A 3EIQC 2XS8A 5AYWD 4LNBA 3T9KA 3B7BA 2IF4A 2X6KA 5B1AE 5CEAA 1WM5A 3UT7A 2R59A 3HVEB 4I2ZA 5AQAA 2GROB 5EYPF 4L7TA 3J5QB 1E8ZA 1EDUA 2GW1A 1K1BA 5A6CA 2BEDA 3DXMG 3URZA 2ZISA 4UQZA 4I6JA 3G2UA 3SHFA 1ZB1A 2MHKA 3L16A 3NZUA 3SFYA 2ZU6B 2AXZA 2XGOA 1N0QA 2XEVA 1H19A 3HG0D 3TGOA 2FO7A 4FP7A 3Q49B 4B8AA 3QDNA 3DEOA 3CVYA 3B95A 5EX3A 4UQXA 4NRHB 3ZHEB 4BSXA 1Y6IA 4RLYA 3CHMA 4HOUA 3ZYQA 1HX8A 2R17C 2XS1A 2WXOA 1TEZA 4J8SA 1YCSB 2HE0A 4WWPA 1MZCA 1A17A 5CRVA 4K0RA 2ETBA 2IOSA 4BT8A 4J6IA 2XENA 3CHSA 3CSFA 4KZ0A 4B8CB 2GRRB 2NC9A 1HF8A 4JC8A 4MLPA 3WG7E 1S0PA 4XIFA 1IHBA 2L9BA 3UQ3A 3BEEA 1TNZA 2J49A 4HLEA 1KPSB 3KD7A 3HVEA 3DSWA 3ZYLA 4I43A 2IY0C 1H6PA 2JLBA 5BXOA 3Q79A 5CCLA 4ZHBA 2OOEA 3FTXA 3UTMA 1IKND 2LSUA 2XPIA 4CYMD 2QZAA 2EILE 5A7DB 3BG0B 4G26A 4E6HA 3PZ3A 3IHVA 1FT1A 3DSSA 1OY3D 3E37A 3D9PA 4CRWA 3CGHA 1BPOA 4JD2G 4BX9A 4JA7A 4I1MA 5G05J 1N4QA 4AIFA 3I4GA 3ESKA 3KSQA 3UKRG 1Z6TA 5HS0A 2C2LA 3NAWA 2X3MA 3AU4A 2CG2A 3Q7AA 1UJKA 3ZRHA 1UOHA 5KNHD 5LP0A 4LERA 4M3OA 3TWSA 2PL2A 1RW2A 2P9NG 4A3TA 1U3DA 4GMJA 2XCCA 3RAUA 4N3BA 4HRLA 1H0AA 4Q96A 2PNNA 5ARFA 5HKPA 2IU1A 3JUIA 3RRNB 4HBDA 1NA0A 3ASOE 4JXTA 2V4LA 1OCZE 4RVBA 3OAWA 4CDMA 4I9CA 3MZLB 3T5XA 3PZ2A 4G2VA 3DPYA 3TWRA 3MKQB 3FUJA 2RD0A 2DYSE 4KYOB 5KJKA 4K5AB 2PZIA 1OWOA 4H7XA 5M72A 4GZ6A 3IHYA 4JW1A 2PQNA 3EHMA 5ARGA 3G2WA 2P9PG 3ZFWA 3S7BA 2L6BA 4HXIA 4RQIA 1X81A 4QQIA 1QNFA 3QNKA 3FUKA 1O5MA 3PVLA 2AXUA 3FP3A 3ASFA 1HE8A 2OVFA 2A5EA 1OWPA 2KZTA 4H7YA 4HORA 4JZYA 3UM1A 4GYYA 2VTBB 3ASHA 3FH5A 3ZW3A 2VGYA 3V2OA 5KNGA 4V3IA 2VSNA 3TWQA 4BY6A 4UI9K 4ATZD 3IBEA 4N2SA 2VJ8A 4OVUA 4LRZA 4Y6CA 4GTQA 5E76A 3CLJA 1D8DA 2MOWA 4HOSA 2UWJG 2V5QC 4X8QA 2KC7A 5JJ6A 3LS8A 5D0OD 3BU8A 3D9MA 4KVMA 3UMVA 2KCVA 5BXUA 4G25A 1OWNA 3NB2A 4WWNA 2VSXE 1O1TA 1AP7A 4M7CA 4IRUA 5G2NA 1K8KG 4PS3A 5AARA 3V79K 5AENA 2Y1LE 5D0QD 3NBNB 3L9TA 3G2TA 2WXPA 1TNUA 3Q7FA 2CHWA 1SA5A 4GTSA 3RO2A 4DX1A 4ACLA 4O1PA 3U64A 3G2VA 3QWVA 4KZCA 5ENTD 2UY1B 4AOFA 3IKOB 2FULA 4ILGA 3FHEA 4AV7A 1IXVA 2HO1A 3HXEA 4APFA 3PNTB 1Z3YA 4U0UA 3IEGA 4Y6WA 4ZFHA 5HI7A 2XPYA 4PUCA 2P58C 3JXJA 2WQ6A 2LXLA 4GU5A 4GZCA 2ILRA 3HIZA 4J8FA 4D10C 1D8EA 3FDHA 1MX6A 3TG4A 4J8DA 5HRYA 3ULEG 4JA9A 3TWUA 5C1DA 2HYZA 3EU9A 3APDA 4GB9A 3C98A 4FADA 3JXIA 4DJAA 4HVBA 5CECB 4LNGA 4L23A 3Q15A 3NQPA 4JPSA 5FZRA 3L13A 3LVQE 3R7QA 1A5EA 3J5PA 3QC1A 2J4BA 4YVOA 1UW4B 3W9GA 1OXJA 4DUIA 3DWLG 3ML8A 4FU3A 5KJLA 2J8SD 1V55E 5EX0A 3BUAA 4DPRA 2WXIA 5G04J 2KATA 4XE0A 1HZ4A 3R9AB 3CHOA 3CQGB 3S2AA 2XRYA 3ESLA 2H6IA 3WXXA 4PS8A 5LCWC 4DX6D 1ELKA 3TAXA 3EDTB 3PZ1A 3ZXSA 3SO8A 3FUIA 4W9RA 1SA4A 2PM7A 3PNLB 1RZ4A 1WY6A 2UY1A 3ASNE 1LD8A 5JJTA 2A5UA 5ANRA 4DLOA 3ZYKA 5AN8A 2B6CA 3DSTA 2ETCA 5FT9A 3U3WA 2X6JA 1H2TC 3OXLA 3CVXA 2RG8A 1UN8A 3ZVVA 2BKGA 4RSYA 4GYWA 1HXIA 3FTUA 3FULA 5BUZA 4A1GA 5J90A 4I6GA 4BEPA 1SW6A 3ZKJA 1N52A 2WXNA 2H6HA 2WXMA 4A55A 3S7JA 4U8YD 4N39A 5ENSD 2VSYA 4WNEA 4C0MA 4CCAA 1E7UA 5EIBE 3LY9A 4IYPA 3AJIA 4EECA 3V31A 1DCQA 1NZNA 2CHXA 3FTSA 5BV0A 3JQ1A 2XGSA 3SI5A 5ENNA 4F6RD 1TNYA 2WXLA 3NOCD 5KWDA 3PUJA 3QB2A 4EQFA 3ASGA 3AG3E 1UJJA 3MYVA 4G1TA 4O60A 4KVOA 5CHEE 3UI2A 3UM2A 5IY5E 4A63B 3C3OA 4Z68A 1JCQA 3APFA 3NF1A 2P9SG 5LOZA 4HRNA 1TNOA 3MA5A 3MEKA 3FEYA 3D9HA 2WXRA 4RG9A 4NQ0A 4G8KA 2DBAA 4BERA 1HU3A 5JMND 2LAHA 4AJWA 1E8XA 4FULA 3LXUX 1S63A 2P2CP 4G23A 4HOTA 2PQRA 5D66A 2KCLA 2KM4A 2F37A 4Q94A 4GTVA 2GRNB 3Q9NC 2BF0X 4UI9J 4JHKA 2H6GA 2A4ZA 1BI8B 2IO3C 4RG6A 3EUVA 3AG4E 4GA0A 4GZDA 2OEWA 3PZ4A 1FVFA 3KEZA 3SBSA 5CRUA 1X5BA 3TWTA 4GTRA 4NIKA 3ONLA 2RFAA 1TYQG 3ZXPA 4BWRA 1TN8A 4YDWA 4LSZE 1SZ9A 3FTVA 1LD7A 3CVLA 3OXGA 4PDXA 3T8MA 5FQ6A 1WG0A 2C0MA 4J8EA 3UUXA 3GW4A 4JB8P 3UIPC 2Y0BG 3RJVA 3JQ0A 5KJMA 2GRPB 3LJ3A 4URKA 1S64A 3DPDA 4DI3A 3DSVA 3HHMA 4OVVA 3QOUA 3S7FA 3MCXA 2H6FA 4GTTA 3SGHA 1MHQA 3HDXA 4BESA 5ITZF 4JEHA 3CVUA 5EN5D 4DLQA 5EIDA 3E4BA 1OT8A 1UG3A 1O1SA 3RK6A 4C0EA 1PY1A 3U4TA 4ANXA 2Y4TA 2KZTB 4UWGA 3SQVA 3PREA 5E75A 3AG1E 1OCCE 2GRQB 4EZLA 3N71A 4HOQA 2RFMA 3TWWA 5CERB 2DZOA 1HG5A 5B1BE 1N0RA 3D9JA 1H6OA 3SF4A 3BQOA 4OYSA 4BT9A 4CEMA 2QYUA 3Q75A 3R7RA 3MKRA 2YQ8A 2LXMA 3L22A 2I1KA 1KLXA 2OV8A 3FU6A 3PE3A 1E96B 5T4YA 1SQMA 4OAUC 1ELRA 3QJZA 3L6AA 1LF8A 4N3CA 2XQ0A 2EIME 2P9KG 2QY7A 2DVWA 4F3VA 5EDSA 4I6EA 3G2SA 4UWKA 5FINA 3BG1B 2E2EA 1JWGA 1YA0A 2V0PA 3FTWA 3R9MA 1N94A 3PZDA 5ANLA 1XNFA 3CVWA 3EHNA 5D2MC 3FUDA 2IJGX 3FUEA 3SD5A 4DX7D 2IEJA 2DIWA 2GGFA 2MYOA 4GCOA 4K5CA 4OAVB 3UT8A 3Q5MA 4CT4A 4DRXE 4WNDA 4BSZB 4GTOA 3KS2A 3ZYMA 2IO2C 1EPUA 3VLFA 3ZNGA 4NACA 3FUHA 1Q2ZA 4XX5A 5AQ9A 4A3VA 3Q4AB 4GA2A 3PH0C 4KBQA 5JHBA 2DZNA 1N4RA 3E34A 3LJNA 2WXQA 4UQYA 4BX8A 4R7LA 5DIZA 5CBNA 3EHRA 4AEZC 2VGXB 4JEUA 4GTMA 3OTNA 4AP2A 5BT1A 3UIOC 3MJWA 3ULYA 1KZPA 3ZU7B 2X6HA 4ILIA 4TXQA 5JA4D 4L9PA 4I2WA 4U8HA 2WQHA 5DBKA 3D9NA 1D9SA 3CK7A 2FF4A 3CVPA 3D3MA 2VSOE 3ZGQA 3E30A 1OCRE 2WXJA 3ASDA 4GPMA 2V5FA 3L54A 2WXFA 1PAQA 3LCAA 3MX3A 2M63A 4GPKA 2MRIA 2WXKA 4YNDA 4U8VD 5EILA 3IXEA 2FBNA 4HB5A 1MJ0A 3RRMB 2YHEA 4WUYA 4EZKA 3ZN3A 3ONKA 3JUEA 3HXDA 5A23A 2CFUA 2XZTG 3CSTA 3SFXA 1JPLA 3P1UA 4PS7A 4JVSA 2PM6A 1H2VC 3CEQA 4FJYA 2WVIA 4ME2A 4XKBA 4U96D 3PEVB 4GMLA 3ML9A 3CK9A 3V30A 3GYZA 4N5CA 3CHPA 3TXMA 4MKTA 2J4DA 1BD8A 2YNQA 5ENOD 2VGXA 4EHMA 5G55A 4I1OB 1HH8A 3ZPJA 3B7UX 5B3SE 3VLDA 2HR2A 2ZGGA 5AIJA 1S70B 3ENEA 3EU5A 1YYHA 3FU5A 1H6KA 4B89A 3ZEFA 2JEKA 1QYMA 1JWFA 4GZ5A 3LYAA 3FU3A 4U07A 2LAIA 3UM0A 3KEAA 4MRUA 4TUUA 5JJ7A 3DEPA 4LG6A 3FUMA 4O6FA 3F6QA 5KCMA 4WWOA 3SY2A 4XI0A 4EBAA 2J07A 3UX4A 3HRAA 4GMRA 3SBTB 2QFCA 4J7WA 2KCKA 1DVPA 1OWMA 3DSXA 3Q78A 2LO6A 1TR4A 4G8LA 4CT0A 3O4ZA 3PEUB 4EBAG 1XGWA 1V54E 2WXGA 5AJLA 3NOGD 1AWCB 4XEIG 1ZU2A 5AAOA 3VTYA 3C3QA 4AY5A 3I3NA 4TUMA 3RO3A 2Y3AA 3RRUA 4HFGA
chains in the Genus database with same CATH topology
2XGMA 2PZIA 4E85A 1OWOA 2WB2A 1HO8A 4H7XA 4B0ZA 4BWRA 4F7AA 5M72A 4GZ6A 5KJNA 2V8SE 4UWHA 1SZ9A 4FHJA 3IHYA 2FI7A 3D9IA 5T3RA 3FTVA 2PQNA 3EHMA 4IULA 3G2WA 4JW1A 5ARGA 3TXNA 3CVLA 4N2QA 3OXGA 4PDXA 3T8MA 5FQ6A 3GZ1A 3I5PA 2VTBA 4GA1A 1L5JA 2I1JA 2C0MA 3ZFWA 1OUVA 4J8EA 3S7BA 3UPVA 3MV2B 4HXIA 4FC8A 3UUXA 2AW6A 3GW4A 4UWFA 2GRLA 3P2BA 1FVHA 3QK0A 3RJVA 2WM9A 1Z3XA 4EPZA 1QNFA 3JQ0A 3QNKA 5KJMA 4DI4A 3LJ3A 4XI9A 5FQ4A 1E7VA 3FUKA 5G05C 4URKA 3AS4A 4NURA 3DPDA 3ZIMA 4DI3A 1KT1A 3CVVA 3FH8A 4TV3A 3PVLA 4L2YA 4WNFA 2AWIA 2AXUA 3FP3A 3ASFA 4J0UA 3LVRE 4BTBA 3L17A 3U66A 1HE8A 3LY8A 4OVVA 3HHMA 2OVFA 3QOUA 4U63A 5FZQA 1OWPA 1UN9A 3S7FA 4N3AA 2KZTA 3MCXA 4H7YA 3SGHA 3GZ2A 4HORA 3FY4A 4JZYA 4GYYA 1MHQA 3HDXA 2VTBB 2L0TB 3ASHA 3FH5A 3ZW3A 3IV0A 2VGYA 5AJDA 4GYOA 4FJZA 3FH7A 4JEHA 4F53A 1HS6A 3CVUA 2BTDA 4DLQA 3K9IA 1VDYA 1MQSA 4V3IA 1JUQA 3AS8A 1W3BA 2VSNA 3E4BA 4BY6A 4UI9K 1UG3A 5T8IA 3RK6A 3B7RL 3IBEA 4N2SA 1FCHA 2VJ8A 4OVUA 4C0EA 4LRZA 1PY1A 1Y8MA 2CG3A 4Y6CA 3U4TA 5E76A 3CLJA 3FTZA 4ANXA 2MOWA 2Y4TA 4EZJA 2KZTB 4UWGA 4HOSA 2UWJG 3D9KA 3SNXA 3PREA 1HG2A 2KC7A 4UI9C 5JJ6A 4APOA 5E75A 3CHQA 5C2YA 2DCPA 5CMWA 3LS8A 5D0OD 3CVQA 3D9MA 4YVQC 4KVMA 3FTYA 4WNGA 3UMVA 4EZLA 1NP7A 2KCVA 3N71A 2WXHA 5FTPA 4G25A 4HOQA 1OWNA 2WMNA 2ONDA 1ELWA 4WWNA 2VSXE 4JL0A 2VYIA 1HG5A 5HQ8A 4IRUA 5G2NA 3CVNA 3OXFA 4KXKB 4C9BB 3D9JA 3CR3A 4PS3A 3SF4A 5AENA 4ANVA 4TRQA 4OYSA 4BT9A 4CEMA 5D0QD 1B89A 5LCWJ 5BNWA 3JCKC 3PUKA 3B7SA 3G2TA 2WXPA 3R7RA 5BPPA 3MKRA 2YQ8A 2XRZA 2I9CA 3L22A 3PE4A 2L6JA 3U9WA 3MGBA 1HFAA 4ILHB 2I6HA 3RIBA 2CHWA 4LEUA 3QAQA 2I1KA 2R5SA 1KLXA 2EQXA 2OV8A 1TJCA 1E96B 3FU6A 3PE3A 5T4YA 3RO2A 1SQMA 4CDNA 4ACLA 2I2OA 4GZ3A 1IQUA 2J9QA 4FLHA 1PC2A 3LEWA 1ELRA 1SZAA 4FHKA 3U64A 3G2VA 3QWVA 4ACKA 5LX8A 2XPZA 4BTAA 2Y4UA 4KZCA 3FUNA 2UY1B 4AOFA 3QJZA 4BFRA 4AM9A 4U0ZA 3IKOB 3LPZA 2FULA 2IFUA 3CV0A 3FHEA 2L0IA 4ILGA 2WMOA 3L6AA 4IN3B 4LCTA 4AV7A 1LF8A 2HO1A 2AVPA 2XQ0A 4N3CA 5FZSA 4APFA 3PNTB 3PS6A 4L2LA 1Z3YA 2IOLA 3IEGA 2QY7A 4U0UA 4Y6WA 1INZA 5CCMA 4F3VA 5EDSA 5HI7A 2YINA 2NSZA 4I6EA 3G2SA 4UWKA 2XPYA 4PUCA 3CKBA 2P58C 3KAEA 3FFLA 2WQ6A 4GU5A 3L08A 4GZCA 2ILRA 3BG1B 3QARA 5CMYA 2E2EA 4AXHA 1JWGA 1YA0A 2V0PA 1WAO1 3FTWA 3HIZA 4J8FA 4D10C 3PZDA 3FDHA 3EIQC 3TG4A 5ANLA 4J8DA 5AYWD 1XNFA 2Q7FA 4JA9A 2WQ7A 3CVWA 3EHNA 4AY6A 3TG5A 2IF4A 3FUDA 2X6KA 1EF1C 2HYZA 2IJGX 5C1DA 4GB9A 3APDA 3C98A 3LY7A 1WM5A 3UT7A 3FUEA 4FADA 4DJAA 2R59A 3SD5A 4HVBA 4L23A 3Q15A 3NQPA 2DIWA 2GGFA 3TJPA 4GCOA 3UT8A 3Q5MA 4JPSA 5FZRA 4CT4A 3L13A 3HVEB 3LVQE 3NZSA 2BUGA 4I2ZA 3R7QA 4XZ4A 4B94A 1E8YA 4L7TA 4WNDA 1E8ZA 1EDUA 2GW1A 3KS2A 5A6CA 3QC1A 3URZA 3ZYMA 1EPUA 2J4BA 2LSVA 3VLFA 3CKCA 3CIAA 4UQZA 4I6JA 3G2UA 3FU0A 3SHFA 4YVOA 4NACA 3FUHA 1UW4B 2MHKA 3L16A 3T5VA 1U3CA 4XX5A 3NZUA 3ZHEA 3FEXA 2ZU6B 4ABNA 3ML8A 4FU3A 5KJLA 2FEZA 2AXZA 2XGOA 4A3VA 3Q4AB 5EX0A 2XEVA 3RKVA 4DPRA 4GA2A 4U04A 2WXIA 1H19A 5G04J 3PH0C 4KBQA 5JHBA 3TGOA 2KATA 1EYHA 4XE0A 1HZ4A 2FO7A 3R9AB 3CHOA 3CQGB 1QQEA 2WXQA 3S2AA 2XRYA 4G24A 3VLEA 4UQYA 4FP7A 4BX8A 3ESLA 3Q49B 3QWWA 4R7LA 3WXXA 4B8AA 5DIZA 4PS8A 3D9LA 5LCWC 1ELKA 3TAXA 4AEZC 2VGXB 1QZ2A 3EDTB 3QDNA 3ZXSA 4CGWA 4JHJA 4JEUA 3CVYA 4UWLA 3OTNA 4AP2A 5BT1A 3FUIA 4W9RA 2GRMA 2PM7A 5EX3A 1N54A 3PNLB 4NRHB 4UQXA 3MJWA 1IYGA 3ZHEB 3HYMB 1WY6A 2UY1A 4KT6B 2X6HA 4Q69A 4BSXA 4ILIA 1Y6IA 5JJTA 3CHMA 2A5UA 4HOUA 5ANRA 3ZYQA 1HX8A 2R17C 4I2WA 2X6IA 1IQRA 2WXOA 4DLOA 1TEZA 4I9EA 4U8HA 3ZYKA 2WQHA 3GZSA 4K03A 4J8SA 3D9NA 5DBKA 3D9OA 3Q47B 3B13A 3CK7A 2FF4A 3CVPA 4WWPA 1A17A 3D3MA 2VSOE 3SFZA 4K0RA 4WAFA 5FWQA 3ZGQA 2IOSA 2WXJA 3ASDA 5FT9A 3UT4A 4BT8A 2X6JA 3U3WA 2V5FA 3EIJA 5BW8C 4J6IA 1H2TC 3L54A 2WXFA 3CHSA 1PAQA 2YHCA 3OXLA 3CSFA 3CVXA 3LCAA 2RG8A 3MX3A 3CK8A 2M63A 4KZ0A 4AVXA 4B8CB 2MRIA 4GPKA 2NC9A 2WXKA 1UN8A 1HF8A 3EJNA 4YNDA 3ZVVA 4RSYA 1DNPA 4JC8A 4MLPA 1S0PA 4GYWA 4XIFA 2FBNA 1HXIA 3ULQA 4G11A 2L9BA 3I4RB 3FTUA 4PH4B 3FULA 2YHEA 4WUYA 3RRMB 4FA6A 4EZKA 3UQ3A 5BUZA 3LKUA 3BEEA 4A1GA 5J90A 2HM8A 4I6GA 3ZN3A 3ONKA 3AU5A 4ANUA 2J49A 1H2UA 2C0LA 4HLEA 3KD7A 4QFVA 5A23A 2CFUA 5EKQD 2IONA 3HVEA 2OVBA 4FLBA 2XHEA 3ZYLA 5J08A 3CSTA 4F1SA 1N52A 4I43A 1JPLA 2WXNA 2WXMA 3S7DA 4A55A 3S7JA 3P1UA 4N39A 2JLBA 4I1AA 4PS7A 3QKYA 4JVSA 2E0IA 2PM6A 2CHZA 5CCLA 1H2VC 2VSYA 3CEQA 4WNEA 4C0MA 4CCAA 1E7UA 4FJYA 2WVIA 4ME2A 3LY9A 2VQ2A 4IYPA 4XKBA 3TL5A 2OOEA 3FTXA 4ATGA 4EECA 3PEVB 4GMLA 3ML9A 2LSUA 2XPIA 2WPVA 3CK9A 1NZNA 4L1BA 2CHXA 3BG0B 3GYZA 4GCNA 4G26A 5FJYA 5A7DB 3FTSA 4N5CA 4E6HA 3CHPA 3SZ7A 5BV0A 3IHVA 2XGSA 3APCA 3JQ1A 3SI5A 4MKTA 5ENNA 3TXMA 2WXLA 5LFAA 2X6FA 2J4DA 2YNQA 3PUJA 3QB2A 2VGXA 4P29A 5G55A 5G04C 4EQFA 3ASGA 4I1OB 1HH8A 3D9PA 3ZPJA 4CRWA 3B7UX 2J09A 3CGHA 1BPOA 3VLDA 2HR2A 4BX9A 3VTXA 5AIJA 1UJJA 2X38A 3MYVA 4I1MA 4JA7A 4G1TA 5G05J 4KVOA 5CHEE 4AIFA 3I4GA 3ESKA 3ENEA 1IHGA 1Z6TA 4A1SA 2C2LA 3DBSA 4CGVA 3FU5A 2X3MA 3AU4A 1H6KA 2CG2A 3APFA 4GAAA 3ZEFA 4B89A 3NF1A 5LOZA 1UJKA 2JEKA 3ZRHA 1JWFA 1NA3A 2J08A 3CQCB 3MA5A 3LYAA 3AS5A 3MEKA 4GZ5A 3FU3A 3FEYA 4U07A 2WXRA 5LP0A 4RG9A 4LERA 3B7TA 4M3OA 2LAIA 4NQ0A 3O48A 2DBAA 1GW6A 2PL2A 2NXPA 1HU3A 1KT0A 4U0SA 4A3TA 4MRUA 3MV3B 4TUUA 5JJ7A 1U3DA 2LAHA 4GMJA 4AJWA 1E90A 4I17A 1E8XA 3FUMA 3LXUX 3QWPA 4FULA 4O6FA 2XCCA 4N3BA 5KCMA 4WWOA 2LNIA 2IQCA 3JYSA 4G23A 4XI0A 4EBAA 4HOTA 2PQRA 4XKCA 3FUFA 2J07A 1H0AA 2KCLA 2KM4A 3MKQA 3UX4A 4Q96A 3RU0A 4Q94A 4JHRA 5JHAA 3SBTB 1P5QA 5ARFA 2CFZA 3FWVA 4LUNU 1E8WA 2QFCA 3CHRA 2KCKA 1DVPA 2IU1A 3JUIA 5BV1A 1OWMA 2BF0X 4KMOA 4JHKA 4UI9J 3RRNB 4ANWA 2XCBA 2A4ZA 1NA0A 2LO6A 4JXTA 4CT0A 4CDRA 3O4ZA 3PEUB 2V4LA 4EBAG 1XGWA 4RG6A 4RVBA 3OAWA 2WXGA 4CDMA 4GA0A 5AJLA 5FQ7A 1OWLA 4I9CA 4GZDA 5FQ8A 1ZU2A 3MZLB 4G2VA 1ZBPA 4HS2A 3T5XA 3VTYA 1FVFA 3MKQB 3FUJA 3KEZA 3PDNA 3SBSA 1TJFA 4AY5A 3LDZA 3I3NA 3PRZA 1X5BA 2RD0A 3RO3A 4DK5A 2AXVA 2Y3AA 4MS6A 4KYOB 4HFGA 3RRUA 5KJKA 3ONLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEV B;  3RRM B;  3RRN B;  3PEU B; 
#chains in the Genus database with same CATH topology
 2QC9 A;  2WB2 A;  1HO8 A;  4B0Z A;  4F7A A;  2V8S E;  5T3R A;  2NYJ A;  4IUL A;  4N2Q A;  3AAA C;  3GZ1 A;  2I1J A;  5KBA A;  3UPV A;  4FC8 A;  2AW6 A;  4UWF A;  4CZ2 D;  1NI1 A;  1MYO A;  4MBG A;  1FVH A;  4HNA D;  2WM9 A;  4EPZ A;  4DI4 A;  3W9F A;  4XI9 A;  4TXP A;  5AQ7 A;  5FQ4 A;  5G05 C;  3AS4 A;  3ZIM A;  3CVV A;  3FH8 A;  4TV3 A;  4L2Y A;  4WNF A;  2AWI A;  4J0U A;  3U66 A;  4BTB A;  3LY8 A;  1NFI E;  5FZQ A;  1UN9 A;  2EIJ E;  4N3A A;  3GZ2 A;  3FY4 A;  3KSL A;  2L0T B;  3AG2 E;  3IV0 A;  5AJD A;  4GYO A;  2EIN E;  4F53 A;  1HS6 A;  2BTD A;  1VDY A;  1JUQ A;  3AS8 A;  5CBO A;  2AJA A;  5ENP D;  1BI7 B;  1FCH A;  4K5B A;  1K3Z D;  4EZJ A;  1MX4 A;  2F8Y A;  1TNB A;  2EIK E;  1HG2 A;  5C2Y A;  5CMW A;  1N4P A;  3CVQ A;  1N9A A;  4YVQ C;  3FTY A;  1NP7 A;  2WXH A;  5FTP A;  4HI8 A;  2WMN A;  3E33 A;  2VYI A;  2R2L A;  5HQ8 A;  3OXF A;  4KXK B;  4ANV A;  4TRQ A;  5LCW J;  1B89 A;  5BNW A;  3JCK C;  5BPP A;  3ZUV B;  2XRZ A;  3PE4 A;  3MGB A;  1HFA A;  4ILH B;  3RIB A;  2ETA A;  2OCC E;  3UKU G;  2F0Y A;  1BLX B;  4CDN A;  2I2O A;  1IQU A;  4O1O A;  3LEW A;  1SZA A;  3ABL E;  4FHK A;  4F1P A;  4ACK A;  5LX8 A;  1WDY A;  3DXK G;  3FUN A;  4U0Z A;  3LPZ A;  2IFU A;  3CV0 A;  4LCT A;  4IN3 B;  2L0I A;  2WMO A;  3X2Q E;  4U95 D;  1YMP A;  1KZO A;  1INZ A;  5CCM A;  2NSZ A;  3V2X A;  3T8K A;  3CKB A;  3KAE A;  3FFL A;  2JAB A;  3L08 A;  2XEE A;  4U7E B;  5CMY A;  1DC2 A;  3HXF A;  5H7P A;  2Q7F A;  2WQ7 A;  4AY6 A;  3TG5 A;  1EF1 C;  1DCE A;  3LY7 A;  4YDE A;  4BET A;  3TJP A;  1U2V G;  3NZS A;  2BUG A;  4GTP A;  4XZ4 A;  4B94 A;  1E8Y A;  3UXG A;  3C72 A;  3Q9U C;  4HRM B;  2LSV A;  4N5Q A;  3CKC A;  3CIA A;  1JCS A;  3FU0 A;  3T5V A;  1U3C A;  3ZHE A;  5ENQ D;  3FEX A;  4ABN A;  2XEH A;  3TWX A;  2FEZ A;  3RKV A;  4U04 A;  1EYH A;  3DRA A;  1QQE A;  3VLE A;  4G24 A;  3QWW A;  3D9L A;  3ABM E;  1QZ2 A;  4CGW A;  3L82 A;  4JHJ A;  4UWL A;  2GRM A;  1N54 A;  1IYG A;  1OCO E;  3HYM B;  4KT6 B;  4Q69 A;  2BKK B;  2X6I A;  1IQR A;  4I9E A;  3GZS A;  4K03 A;  3D9O A;  3Q47 B;  3B13 A;  3SFZ A;  4WAF A;  5FWQ A;  3UT4 A;  5BW8 C;  3EIJ A;  2YHC A;  2ZIR A;  3CK8 A;  4AVX A;  2XZD G;  4YDO A;  4HLL A;  3EJN A;  1DNP A;  4YDY A;  3ULQ A;  4G11 A;  3I4R B;  4PH4 B;  1SVX A;  4FA6 A;  4B93 B;  3LKU A;  5FIO A;  1FT2 A;  2HM8 A;  3AU5 A;  4ANU A;  1H2U A;  4C48 B;  2C0L A;  4QFV A;  4UUC A;  5EKQ D;  2ION A;  2OVB A;  4FLB A;  2XHE A;  5J08 A;  4F1S A;  4HQD A;  3S7D A;  4I1A A;  3QKY A;  3RSE G;  2E0I A;  2CHZ A;  1QBQ A;  2VQ2 A;  3TL5 A;  4ATG A;  2WPV A;  4L1B A;  4GCN A;  5FJY A;  3SZ7 A;  3APC A;  1N11 A;  5LFA A;  2X6F A;  4P29 A;  5G04 C;  2J09 A;  3HXB A;  3VTX A;  2X38 A;  5AQB A;  1IHG A;  3C5R A;  4A1S A;  3DBS A;  4CGV A;  4J8Y A;  4GAA A;  1NA3 A;  2J08 A;  3CQC B;  3AS5 A;  3B7T A;  3ISM C;  5ENR D;  3O48 A;  4DX2 A;  1GW6 A;  2NXP A;  1KT0 A;  4U0S A;  3MV3 B;  1E90 A;  4I17 A;  3QWP A;  2LNI A;  2P9L G;  2IQC A;  3JYS A;  4XKC A;  3FUF A;  1Z5S C;  3MKQ A;  2FO1 E;  3RU0 A;  4JHR A;  5JHA A;  1TN6 A;  1P5Q A;  2V4H C;  2CFZ A;  3FWV A;  4LUN U;  1E8W A;  3CHR A;  5BV1 A;  3TWV A;  4HI9 A;  4KMO A;  1NL4 A;  4ANW A;  2XCB A;  4CDR A;  3EHQ A;  2ZXW E;  1O1R A;  5FQ7 A;  1OWL A;  5FQ8 A;  4HS2 A;  1ZBP A;  3PDN A;  1TJF A;  3LDZ A;  3PRZ A;  3UM3 A;  2P9U G;  4DK5 A;  2OEV A;  2AXV A;  5CED B;  4MS6 A;  3HXC A;  2XGM A;  4E85 A;  5KJN A;  4UWH A;  4FHJ A;  2R02 A;  2FI7 A;  3D9I A;  3TXN A;  2LUH A;  1G3N B;  1MX2 A;  3I5P A;  2VTB A;  4GA1 A;  1L5J A;  1OUV A;  2DWZ A;  3MV2 B;  2GRL A;  3P2B A;  3QK0 A;  1Z3X A;  3ABK E;  1E7V A;  3C3R A;  4NUR A;  1KT1 A;  4DX5 D;  3LVR E;  3L17 A;  2KBX A;  4U63 A;  1LTX A;  4FJZ A;  3FH7 A;  2B0O E;  3K9I A;  1MQS A;  1W3B A;  1JCR A;  5T8I A;  3B7R L;  1K1A A;  1Y8M A;  2CG3 A;  3FTZ A;  4TXR A;  3D9K A;  3SNX A;  2F8X K;  4UI9 C;  4APO A;  3CHQ A;  2DCP A;  4WNG A;  3E32 A;  2P9I G;  2OND A;  1ELW A;  4JL0 A;  3CVN A;  4C9B B;  3CR3 A;  2ZGD A;  3PUK A;  3B7S A;  1N4S A;  2I9C A;  1BU9 A;  2L6J A;  3U9W A;  2I6H A;  4LEU A;  3QAQ A;  2R5S A;  2EQX A;  1TJC A;  4GZ3 A;  2J9Q A;  4FLH A;  1PC2 A;  5EYL A;  1TN7 A;  3Q73 A;  3UIN C;  1N95 A;  2XPZ A;  4BTA A;  2Y4U A;  4BFR A;  4AM9 A;  2VGE A;  5FZS A;  2AVP A;  2Y69 E;  2KXP C;  3PS6 A;  4L2L A;  2IOL A;  2QYJ A;  2R03 A;  2RKK A;  2YIN A;  1FPP A;  2DYR E;  4AXH A;  3QAR A;  4LNU D;  1WAO 1;  3DSU A;  2R05 A;  3EIQ C;  2XS8 A;  5AYW D;  4LNB A;  3T9K A;  3B7B A;  2IF4 A;  2X6K A;  5B1A E;  5CEA A;  1WM5 A;  3UT7 A;  2R59 A;  3HVE B;  4I2Z A;  5AQA A;  2GRO B;  5EYP F;  4L7T A;  3J5Q B;  1E8Z A;  1EDU A;  2GW1 A;  1K1B A;  5A6C A;  2BED A;  3DXM G;  3URZ A;  2ZIS A;  4UQZ A;  4I6J A;  3G2U A;  3SHF A;  1ZB1 A;  2MHK A;  3L16 A;  3NZU A;  3SFY A;  2ZU6 B;  2AXZ A;  2XGO A;  1N0Q A;  2XEV A;  1H19 A;  3HG0 D;  3TGO A;  2FO7 A;  4FP7 A;  3Q49 B;  4B8A A;  3QDN A;  3DEO A;  3CVY A;  3B95 A;  5EX3 A;  4UQX A;  4NRH B;  3ZHE B;  4BSX A;  1Y6I A;  4RLY A;  3CHM A;  4HOU A;  3ZYQ A;  1HX8 A;  2R17 C;  2XS1 A;  2WXO A;  1TEZ A;  4J8S A;  1YCS B;  2HE0 A;  4WWP A;  1MZC A;  1A17 A;  5CRV A;  4K0R A;  2ETB A;  2IOS A;  4BT8 A;  4J6I A;  2XEN A;  3CHS A;  3CSF A;  4KZ0 A;  4B8C B;  2GRR B;  2NC9 A;  1HF8 A;  4JC8 A;  4MLP A;  3WG7 E;  1S0P A;  4XIF A;  1IHB A;  2L9B A;  3UQ3 A;  3BEE A;  1TNZ A;  2J49 A;  4HLE A;  1KPS B;  3KD7 A;  3HVE A;  3DSW A;  3ZYL A;  4I43 A;  2IY0 C;  1H6P A;  2JLB A;  5BXO A;  3Q79 A;  5CCL A;  4ZHB A;  2OOE A;  3FTX A;  3UTM A;  1IKN D;  2LSU A;  2XPI A;  4CYM D;  2QZA A;  2EIL E;  5A7D B;  3BG0 B;  4G26 A;  4E6H A;  3PZ3 A;  3IHV A;  1FT1 A;  3DSS A;  1OY3 D;  3E37 A;  3D9P A;  4CRW A;  3CGH A;  1BPO A;  4JD2 G;  4BX9 A;  4JA7 A;  4I1M A;  5G05 J;  1N4Q A;  4AIF A;  3I4G A;  3ESK A;  3KSQ A;  3UKR G;  1Z6T A;  5HS0 A;  2C2L A;  3NAW A;  2X3M A;  3AU4 A;  2CG2 A;  3Q7A A;  1UJK A;  3ZRH A;  1UOH A;  5KNH D;  5LP0 A;  4LER A;  4M3O A;  3TWS A;  2PL2 A;  1RW2 A;  2P9N G;  4A3T A;  1U3D A;  4GMJ A;  2XCC A;  3RAU A;  4N3B A;  4HRL A;  1H0A A;  4Q96 A;  2PNN A;  5ARF A;  5HKP A;  2IU1 A;  3JUI A;  3RRN B;  4HBD A;  1NA0 A;  3ASO E;  4JXT A;  2V4L A;  1OCZ E;  4RVB A;  3OAW A;  4CDM A;  4I9C A;  3MZL B;  3T5X A;  3PZ2 A;  4G2V A;  3DPY A;  3TWR A;  3MKQ B;  3FUJ A;  2RD0 A;  2DYS E;  4KYO B;  5KJK A;  4K5A B;  2PZI A;  1OWO A;  4H7X A;  5M72 A;  4GZ6 A;  3IHY A;  4JW1 A;  2PQN A;  3EHM A;  5ARG A;  3G2W A;  2P9P G;  3ZFW A;  3S7B A;  2L6B A;  4HXI A;  4RQI A;  1X81 A;  4QQI A;  1QNF A;  3QNK A;  3FUK A;  1O5M A;  3PVL A;  2AXU A;  3FP3 A;  3ASF A;  1HE8 A;  2OVF A;  2A5E A;  1OWP A;  2KZT A;  4H7Y A;  4HOR A;  4JZY A;  3UM1 A;  4GYY A;  2VTB B;  3ASH A;  3FH5 A;  3ZW3 A;  2VGY A;  3V2O A;  5KNG A;  4V3I A;  2VSN A;  3TWQ A;  4BY6 A;  4UI9 K;  4ATZ D;  3IBE A;  4N2S A;  2VJ8 A;  4OVU A;  4LRZ A;  4Y6C A;  4GTQ A;  5E76 A;  3CLJ A;  1D8D A;  2MOW A;  4HOS A;  2UWJ G;  2V5Q C;  4X8Q A;  2KC7 A;  5JJ6 A;  3LS8 A;  5D0O D;  3BU8 A;  3D9M A;  4KVM A;  3UMV A;  2KCV A;  5BXU A;  4G25 A;  1OWN A;  3NB2 A;  4WWN A;  2VSX E;  1O1T A;  1AP7 A;  4M7C A;  4IRU A;  5G2N A;  1K8K G;  4PS3 A;  5AAR A;  3V79 K;  5AEN A;  2Y1L E;  5D0Q D;  3NBN B;  3L9T A;  3G2T A;  2WXP A;  1TNU A;  3Q7F A;  2CHW A;  1SA5 A;  4GTS A;  3RO2 A;  4DX1 A;  4ACL A;  4O1P A;  3U64 A;  3G2V A;  3QWV A;  4KZC A;  5ENT D;  2UY1 B;  4AOF A;  3IKO B;  2FUL A;  4ILG A;  3FHE A;  4AV7 A;  1IXV A;  2HO1 A;  3HXE A;  4APF A;  3PNT B;  1Z3Y A;  4U0U A;  3IEG A;  4Y6W A;  4ZFH A;  5HI7 A;  2XPY A;  4PUC A;  2P58 C;  3JXJ A;  2WQ6 A;  2LXL A;  4GU5 A;  4GZC A;  2ILR A;  3HIZ A;  4J8F A;  4D10 C;  1D8E A;  3FDH A;  1MX6 A;  3TG4 A;  4J8D A;  5HRY A;  3ULE G;  4JA9 A;  3TWU A;  5C1D A;  2HYZ A;  3EU9 A;  3APD A;  4GB9 A;  3C98 A;  4FAD A;  3JXI A;  4DJA A;  4HVB A;  5CEC B;  4LNG A;  4L23 A;  3Q15 A;  3NQP A;  4JPS A;  5FZR A;  3L13 A;  3LVQ E;  3R7Q A;  1A5E A;  3J5P A;  3QC1 A;  2J4B A;  4YVO A;  1UW4 B;  3W9G A;  1OXJ A;  4DUI A;  3DWL G;  3ML8 A;  4FU3 A;  5KJL A;  2J8S D;  1V55 E;  5EX0 A;  3BUA A;  4DPR A;  2WXI A;  5G04 J;  2KAT A;  4XE0 A;  1HZ4 A;  3R9A B;  3CHO A;  3CQG B;  3S2A A;  2XRY A;  3ESL A;  2H6I A;  3WXX A;  4PS8 A;  5LCW C;  4DX6 D;  1ELK A;  3TAX A;  3EDT B;  3PZ1 A;  3ZXS A;  3SO8 A;  3FUI A;  4W9R A;  1SA4 A;  2PM7 A;  3PNL B;  1RZ4 A;  1WY6 A;  2UY1 A;  3ASN E;  1LD8 A;  5JJT A;  2A5U A;  5ANR A;  4DLO A;  3ZYK A;  5AN8 A;  2B6C A;  3DST A;  2ETC A;  5FT9 A;  3U3W A;  2X6J A;  1H2T C;  3OXL A;  3CVX A;  2RG8 A;  1UN8 A;  3ZVV A;  2BKG A;  4RSY A;  4GYW A;  1HXI A;  3FTU A;  3FUL A;  5BUZ A;  4A1G A;  5J90 A;  4I6G A;  4BEP A;  1SW6 A;  3ZKJ A;  1N52 A;  2WXN A;  2H6H A;  2WXM A;  4A55 A;  3S7J A;  4U8Y D;  4N39 A;  5ENS D;  2VSY A;  4WNE A;  4C0M A;  4CCA A;  1E7U A;  5EIB E;  3LY9 A;  4IYP A;  3AJI A;  4EEC A;  3V31 A;  1DCQ A;  1NZN A;  2CHX A;  3FTS A;  5BV0 A;  3JQ1 A;  2XGS A;  3SI5 A;  5ENN A;  4F6R D;  1TNY A;  2WXL A;  3NOC D;  5KWD A;  3PUJ A;  3QB2 A;  4EQF A;  3ASG A;  3AG3 E;  1UJJ A;  3MYV A;  4G1T A;  4O60 A;  4KVO A;  5CHE E;  3UI2 A;  3UM2 A;  5IY5 E;  4A63 B;  3C3O A;  4Z68 A;  1JCQ A;  3APF A;  3NF1 A;  2P9S G;  5LOZ A;  4HRN A;  1TNO A;  3MA5 A;  3MEK A;  3FEY A;  3D9H A;  2WXR A;  4RG9 A;  4NQ0 A;  4G8K A;  2DBA A;  4BER A;  1HU3 A;  5JMN D;  2LAH A;  4AJW A;  1E8X A;  4FUL A;  3LXU X;  1S63 A;  2P2C P;  4G23 A;  4HOT A;  2PQR A;  5D66 A;  2KCL A;  2KM4 A;  2F37 A;  4Q94 A;  4GTV A;  2GRN B;  3Q9N C;  2BF0 X;  4UI9 J;  4JHK A;  2H6G A;  2A4Z A;  1BI8 B;  2IO3 C;  4RG6 A;  3EUV A;  3AG4 E;  4GA0 A;  4GZD A;  2OEW A;  3PZ4 A;  1FVF A;  3KEZ A;  3SBS A;  5CRU A;  1X5B A;  3TWT A;  4GTR A;  4NIK A;  3ONL A;  2RFA A;  1TYQ G;  3ZXP A;  4BWR A;  1TN8 A;  4YDW A;  4LSZ E;  1SZ9 A;  3FTV A;  1LD7 A;  3CVL A;  3OXG A;  4PDX A;  3T8M A;  5FQ6 A;  1WG0 A;  2C0M A;  4J8E A;  3UUX A;  3GW4 A;  4JB8 P;  3UIP C;  2Y0B G;  3RJV A;  3JQ0 A;  5KJM A;  2GRP B;  3LJ3 A;  4URK A;  1S64 A;  3DPD A;  4DI3 A;  3DSV A;  3HHM A;  4OVV A;  3QOU A;  3S7F A;  3MCX A;  2H6F A;  4GTT A;  3SGH A;  1MHQ A;  3HDX A;  4BES A;  5ITZ F;  4JEH A;  3CVU A;  5EN5 D;  4DLQ A;  5EID A;  3E4B A;  1OT8 A;  1UG3 A;  1O1S A;  3RK6 A;  4C0E A;  1PY1 A;  3U4T A;  4ANX A;  2Y4T A;  2KZT B;  4UWG A;  3SQV A;  3PRE A;  5E75 A;  3AG1 E;  1OCC E;  2GRQ B;  4EZL A;  3N71 A;  4HOQ A;  2RFM A;  3TWW A;  5CER B;  2DZO A;  1HG5 A;  5B1B E;  1N0R A;  3D9J A;  1H6O A;  3SF4 A;  3BQO A;  4OYS A;  4BT9 A;  4CEM A;  2QYU A;  3Q75 A;  3R7R A;  3MKR A;  2YQ8 A;  2LXM A;  3L22 A;  2I1K A;  1KLX A;  2OV8 A;  3FU6 A;  3PE3 A;  1E96 B;  5T4Y A;  1SQM A;  4OAU C;  1ELR A;  3QJZ A;  3L6A A;  1LF8 A;  4N3C A;  2XQ0 A;  2EIM E;  2P9K G;  2QY7 A;  2DVW A;  4F3V A;  5EDS A;  4I6E A;  3G2S A;  4UWK A;  5FIN A;  3BG1 B;  2E2E A;  1JWG A;  1YA0 A;  2V0P A;  3FTW A;  3R9M A;  1N94 A;  3PZD A;  5ANL A;  1XNF A;  3CVW A;  3EHN A;  5D2M C;  3FUD A;  2IJG X;  3FUE A;  3SD5 A;  4DX7 D;  2IEJ A;  2DIW A;  2GGF A;  2MYO A;  4GCO A;  4K5C A;  4OAV B;  3UT8 A;  3Q5M A;  4CT4 A;  4DRX E;  4WND A;  4BSZ B;  4GTO A;  3KS2 A;  3ZYM A;  2IO2 C;  1EPU A;  3VLF A;  3ZNG A;  4NAC A;  3FUH A;  1Q2Z A;  4XX5 A;  5AQ9 A;  4A3V A;  3Q4A B;  4GA2 A;  3PH0 C;  4KBQ A;  5JHB A;  2DZN A;  1N4R A;  3E34 A;  3LJN A;  2WXQ A;  4UQY A;  4BX8 A;  4R7L A;  5DIZ A;  5CBN A;  3EHR A;  4AEZ C;  2VGX B;  4JEU A;  4GTM A;  3OTN A;  4AP2 A;  5BT1 A;  3UIO C;  3MJW A;  3ULY A;  1KZP A;  3ZU7 B;  2X6H A;  4ILI A;  4TXQ A;  5JA4 D;  4L9P A;  4I2W A;  4U8H A;  2WQH A;  5DBK A;  3D9N A;  1D9S A;  3CK7 A;  2FF4 A;  3CVP A;  3D3M A;  2VSO E;  3ZGQ A;  3E30 A;  1OCR E;  2WXJ A;  3ASD A;  4GPM A;  2V5F A;  3L54 A;  2WXF A;  1PAQ A;  3LCA A;  3MX3 A;  2M63 A;  4GPK A;  2MRI A;  2WXK A;  4YND A;  4U8V D;  5EIL A;  3IXE A;  2FBN A;  4HB5 A;  1MJ0 A;  3RRM B;  2YHE A;  4WUY A;  4EZK A;  3ZN3 A;  3ONK A;  3JUE A;  3HXD A;  5A23 A;  2CFU A;  2XZT G;  3CST A;  3SFX A;  1JPL A;  3P1U A;  4PS7 A;  4JVS A;  2PM6 A;  1H2V C;  3CEQ A;  4FJY A;  2WVI A;  4ME2 A;  4XKB A;  4U96 D;  3PEV B;  4GML A;  3ML9 A;  3CK9 A;  3V30 A;  3GYZ A;  4N5C A;  3CHP A;  3TXM A;  4MKT A;  2J4D A;  1BD8 A;  2YNQ A;  5ENO D;  2VGX A;  4EHM A;  5G55 A;  4I1O B;  1HH8 A;  3ZPJ A;  3B7U X;  5B3S E;  3VLD A;  2HR2 A;  2ZGG A;  5AIJ A;  1S70 B;  3ENE A;  3EU5 A;  1YYH A;  3FU5 A;  1H6K A;  4B89 A;  3ZEF A;  2JEK A;  1QYM A;  1JWF A;  4GZ5 A;  3LYA A;  3FU3 A;  4U07 A;  2LAI A;  3UM0 A;  3KEA A;  4MRU A;  4TUU A;  5JJ7 A;  3DEP A;  4LG6 A;  3FUM A;  4O6F A;  3F6Q A;  5KCM A;  4WWO A;  3SY2 A;  4XI0 A;  4EBA A;  2J07 A;  3UX4 A;  3HRA A;  4GMR A;  3SBT B;  2QFC A;  4J7W A;  2KCK A;  1DVP A;  1OWM A;  3DSX A;  3Q78 A;  2LO6 A;  1TR4 A;  4G8L A;  4CT0 A;  3O4Z A;  3PEU B;  4EBA G;  1XGW A;  1V54 E;  2WXG A;  5AJL A;  3NOG D;  1AWC B;  4XEI G;  1ZU2 A;  5AAO A;  3VTY A;  3C3Q A;  4AY5 A;  3I3N A;  4TUM A;  3RO3 A;  2Y3A A;  3RRU A;  4HFG A; 
#chains in the Genus database with same CATH homology
 2XGM A;  2PZI A;  4E85 A;  1OWO A;  2WB2 A;  1HO8 A;  4H7X A;  4B0Z A;  4BWR A;  4F7A A;  5M72 A;  4GZ6 A;  5KJN A;  2V8S E;  4UWH A;  1SZ9 A;  4FHJ A;  3IHY A;  2FI7 A;  3D9I A;  5T3R A;  3FTV A;  2PQN A;  3EHM A;  4IUL A;  3G2W A;  4JW1 A;  5ARG A;  3TXN A;  3CVL A;  4N2Q A;  3OXG A;  4PDX A;  3T8M A;  5FQ6 A;  3GZ1 A;  3I5P A;  2VTB A;  4GA1 A;  1L5J A;  2I1J A;  2C0M A;  3ZFW A;  1OUV A;  4J8E A;  3S7B A;  3UPV A;  3MV2 B;  4HXI A;  4FC8 A;  3UUX A;  2AW6 A;  3GW4 A;  4UWF A;  2GRL A;  3P2B A;  1FVH A;  3QK0 A;  3RJV A;  2WM9 A;  1Z3X A;  4EPZ A;  1QNF A;  3JQ0 A;  3QNK A;  5KJM A;  4DI4 A;  3LJ3 A;  4XI9 A;  5FQ4 A;  1E7V A;  3FUK A;  5G05 C;  4URK A;  3AS4 A;  4NUR A;  3DPD A;  3ZIM A;  4DI3 A;  1KT1 A;  3CVV A;  3FH8 A;  4TV3 A;  3PVL A;  4L2Y A;  4WNF A;  2AWI A;  2AXU A;  3FP3 A;  3ASF A;  4J0U A;  3LVR E;  4BTB A;  3L17 A;  3U66 A;  1HE8 A;  3LY8 A;  4OVV A;  3HHM A;  2OVF A;  3QOU A;  4U63 A;  5FZQ A;  1OWP A;  1UN9 A;  3S7F A;  4N3A A;  2KZT A;  3MCX A;  4H7Y A;  3SGH A;  3GZ2 A;  4HOR A;  3FY4 A;  4JZY A;  4GYY A;  1MHQ A;  3HDX A;  2VTB B;  2L0T B;  3ASH A;  3FH5 A;  3ZW3 A;  3IV0 A;  2VGY A;  5AJD A;  4GYO A;  4FJZ A;  3FH7 A;  4JEH A;  4F53 A;  1HS6 A;  3CVU A;  2BTD A;  4DLQ A;  3K9I A;  1VDY A;  1MQS A;  4V3I A;  1JUQ A;  3AS8 A;  1W3B A;  2VSN A;  3E4B A;  4BY6 A;  4UI9 K;  1UG3 A;  5T8I A;  3RK6 A;  3B7R L;  3IBE A;  4N2S A;  1FCH A;  2VJ8 A;  4OVU A;  4C0E A;  4LRZ A;  1PY1 A;  1Y8M A;  2CG3 A;  4Y6C A;  3U4T A;  5E76 A;  3CLJ A;  3FTZ A;  4ANX A;  2MOW A;  2Y4T A;  4EZJ A;  2KZT B;  4UWG A;  4HOS A;  2UWJ G;  3D9K A;  3SNX A;  3PRE A;  1HG2 A;  2KC7 A;  4UI9 C;  5JJ6 A;  4APO A;  5E75 A;  3CHQ A;  5C2Y A;  2DCP A;  5CMW A;  3LS8 A;  5D0O D;  3CVQ A;  3D9M A;  4YVQ C;  4KVM A;  3FTY A;  4WNG A;  3UMV A;  4EZL A;  1NP7 A;  2KCV A;  3N71 A;  2WXH A;  5FTP A;  4G25 A;  4HOQ A;  1OWN A;  2WMN A;  2OND A;  1ELW A;  4WWN A;  2VSX E;  4JL0 A;  2VYI A;  1HG5 A;  5HQ8 A;  4IRU A;  5G2N A;  3CVN A;  3OXF A;  4KXK B;  4C9B B;  3D9J A;  3CR3 A;  4PS3 A;  3SF4 A;  5AEN A;  4ANV A;  4TRQ A;  4OYS A;  4BT9 A;  4CEM A;  5D0Q D;  1B89 A;  5LCW J;  5BNW A;  3JCK C;  3PUK A;  3B7S A;  3G2T A;  2WXP A;  3R7R A;  5BPP A;  3MKR A;  2YQ8 A;  2XRZ A;  2I9C A;  3L22 A;  3PE4 A;  2L6J A;  3U9W A;  3MGB A;  1HFA A;  4ILH B;  2I6H A;  3RIB A;  2CHW A;  4LEU A;  3QAQ A;  2I1K A;  2R5S A;  1KLX A;  2EQX A;  2OV8 A;  1TJC A;  1E96 B;  3FU6 A;  3PE3 A;  5T4Y A;  3RO2 A;  1SQM A;  4CDN A;  4ACL A;  2I2O A;  4GZ3 A;  1IQU A;  2J9Q A;  4FLH A;  1PC2 A;  3LEW A;  1ELR A;  1SZA A;  4FHK A;  3U64 A;  3G2V A;  3QWV A;  4ACK A;  5LX8 A;  2XPZ A;  4BTA A;  2Y4U A;  4KZC A;  3FUN A;  2UY1 B;  4AOF A;  3QJZ A;  4BFR A;  4AM9 A;  4U0Z A;  3IKO B;  3LPZ A;  2FUL A;  2IFU A;  3CV0 A;  3FHE A;  2L0I A;  4ILG A;  2WMO A;  3L6A A;  4IN3 B;  4LCT A;  4AV7 A;  1LF8 A;  2HO1 A;  2AVP A;  2XQ0 A;  4N3C A;  5FZS A;  4APF A;  3PNT B;  3PS6 A;  4L2L A;  1Z3Y A;  2IOL A;  3IEG A;  2QY7 A;  4U0U A;  4Y6W A;  1INZ A;  5CCM A;  4F3V A;  5EDS A;  5HI7 A;  2YIN A;  2NSZ A;  4I6E A;  3G2S A;  4UWK A;  2XPY A;  4PUC A;  3CKB A;  2P58 C;  3KAE A;  3FFL A;  2WQ6 A;  4GU5 A;  3L08 A;  4GZC A;  2ILR A;  3BG1 B;  3QAR A;  5CMY A;  2E2E A;  4AXH A;  1JWG A;  1YA0 A;  2V0P A;  1WAO 1;  3FTW A;  3HIZ A;  4J8F A;  4D10 C;  3PZD A;  3FDH A;  3EIQ C;  3TG4 A;  5ANL A;  4J8D A;  5AYW D;  1XNF A;  2Q7F A;  4JA9 A;  2WQ7 A;  3CVW A;  3EHN A;  4AY6 A;  3TG5 A;  2IF4 A;  3FUD A;  2X6K A;  1EF1 C;  2HYZ A;  2IJG X;  5C1D A;  4GB9 A;  3APD A;  3C98 A;  3LY7 A;  1WM5 A;  3UT7 A;  3FUE A;  4FAD A;  4DJA A;  2R59 A;  3SD5 A;  4HVB A;  4L23 A;  3Q15 A;  3NQP A;  2DIW A;  2GGF A;  3TJP A;  4GCO A;  3UT8 A;  3Q5M A;  4JPS A;  5FZR A;  4CT4 A;  3L13 A;  3HVE B;  3LVQ E;  3NZS A;  2BUG A;  4I2Z A;  3R7Q A;  4XZ4 A;  4B94 A;  1E8Y A;  4L7T A;  4WND A;  1E8Z A;  1EDU A;  2GW1 A;  3KS2 A;  5A6C A;  3QC1 A;  3URZ A;  3ZYM A;  1EPU A;  2J4B A;  2LSV A;  3VLF A;  3CKC A;  3CIA A;  4UQZ A;  4I6J A;  3G2U A;  3FU0 A;  3SHF A;  4YVO A;  4NAC A;  3FUH A;  1UW4 B;  2MHK A;  3L16 A;  3T5V A;  1U3C A;  4XX5 A;  3NZU A;  3ZHE A;  3FEX A;  2ZU6 B;  4ABN A;  3ML8 A;  4FU3 A;  5KJL A;  2FEZ A;  2AXZ A;  2XGO A;  4A3V A;  3Q4A B;  5EX0 A;  2XEV A;  3RKV A;  4DPR A;  4GA2 A;  4U04 A;  2WXI A;  1H19 A;  5G04 J;  3PH0 C;  4KBQ A;  5JHB A;  3TGO A;  2KAT A;  1EYH A;  4XE0 A;  1HZ4 A;  2FO7 A;  3R9A B;  3CHO A;  3CQG B;  1QQE A;  2WXQ A;  3S2A A;  2XRY A;  4G24 A;  3VLE A;  4UQY A;  4FP7 A;  4BX8 A;  3ESL A;  3Q49 B;  3QWW A;  4R7L A;  3WXX A;  4B8A A;  5DIZ A;  4PS8 A;  3D9L A;  5LCW C;  1ELK A;  3TAX A;  4AEZ C;  2VGX B;  1QZ2 A;  3EDT B;  3QDN A;  3ZXS A;  4CGW A;  4JHJ A;  4JEU A;  3CVY A;  4UWL A;  3OTN A;  4AP2 A;  5BT1 A;  3FUI A;  4W9R A;  2GRM A;  2PM7 A;  5EX3 A;  1N54 A;  3PNL B;  4NRH B;  4UQX A;  3MJW A;  1IYG A;  3ZHE B;  3HYM B;  1WY6 A;  2UY1 A;  4KT6 B;  2X6H A;  4Q69 A;  4BSX A;  4ILI A;  1Y6I A;  5JJT A;  3CHM A;  2A5U A;  4HOU A;  5ANR A;  3ZYQ A;  1HX8 A;  2R17 C;  4I2W A;  2X6I A;  1IQR A;  2WXO A;  4DLO A;  1TEZ A;  4I9E A;  4U8H A;  3ZYK A;  2WQH A;  3GZS A;  4K03 A;  4J8S A;  3D9N A;  5DBK A;  3D9O A;  3Q47 B;  3B13 A;  3CK7 A;  2FF4 A;  3CVP A;  4WWP A;  1A17 A;  3D3M A;  2VSO E;  3SFZ A;  4K0R A;  4WAF A;  5FWQ A;  3ZGQ A;  2IOS A;  2WXJ A;  3ASD A;  5FT9 A;  3UT4 A;  4BT8 A;  2X6J A;  3U3W A;  2V5F A;  3EIJ A;  5BW8 C;  4J6I A;  1H2T C;  3L54 A;  2WXF A;  3CHS A;  1PAQ A;  2YHC A;  3OXL A;  3CSF A;  3CVX A;  3LCA A;  2RG8 A;  3MX3 A;  3CK8 A;  2M63 A;  4KZ0 A;  4AVX A;  4B8C B;  2MRI A;  4GPK A;  2NC9 A;  2WXK A;  1UN8 A;  1HF8 A;  3EJN A;  4YND A;  3ZVV A;  4RSY A;  1DNP A;  4JC8 A;  4MLP A;  1S0P A;  4GYW A;  4XIF A;  2FBN A;  1HXI A;  3ULQ A;  4G11 A;  2L9B A;  3I4R B;  3FTU A;  4PH4 B;  3FUL A;  2YHE A;  4WUY A;  3RRM B;  4FA6 A;  4EZK A;  3UQ3 A;  5BUZ A;  3LKU A;  3BEE A;  4A1G A;  5J90 A;  2HM8 A;  4I6G A;  3ZN3 A;  3ONK A;  3AU5 A;  4ANU A;  2J49 A;  1H2U A;  2C0L A;  4HLE A;  3KD7 A;  4QFV A;  5A23 A;  2CFU A;  5EKQ D;  2ION A;  3HVE A;  2OVB A;  4FLB A;  2XHE A;  3ZYL A;  5J08 A;  3CST A;  4F1S A;  1N52 A;  4I43 A;  1JPL A;  2WXN A;  2WXM A;  3S7D A;  4A55 A;  3S7J A;  3P1U A;  4N39 A;  2JLB A;  4I1A A;  4PS7 A;  3QKY A;  4JVS A;  2E0I A;  2PM6 A;  2CHZ A;  5CCL A;  1H2V C;  2VSY A;  3CEQ A;  4WNE A;  4C0M A;  4CCA A;  1E7U A;  4FJY A;  2WVI A;  4ME2 A;  3LY9 A;  2VQ2 A;  4IYP A;  4XKB A;  3TL5 A;  2OOE A;  3FTX A;  4ATG A;  4EEC A;  3PEV B;  4GML A;  3ML9 A;  2LSU A;  2XPI A;  2WPV A;  3CK9 A;  1NZN A;  4L1B A;  2CHX A;  3BG0 B;  3GYZ A;  4GCN A;  4G26 A;  5FJY A;  5A7D B;  3FTS A;  4N5C A;  4E6H A;  3CHP A;  3SZ7 A;  5BV0 A;  3IHV A;  2XGS A;  3APC A;  3JQ1 A;  3SI5 A;  4MKT A;  5ENN A;  3TXM A;  2WXL A;  5LFA A;  2X6F A;  2J4D A;  2YNQ A;  3PUJ A;  3QB2 A;  2VGX A;  4P29 A;  5G55 A;  5G04 C;  4EQF A;  3ASG A;  4I1O B;  1HH8 A;  3D9P A;  3ZPJ A;  4CRW A;  3B7U X;  2J09 A;  3CGH A;  1BPO A;  3VLD A;  2HR2 A;  4BX9 A;  3VTX A;  5AIJ A;  1UJJ A;  2X38 A;  3MYV A;  4I1M A;  4JA7 A;  4G1T A;  5G05 J;  4KVO A;  5CHE E;  4AIF A;  3I4G A;  3ESK A;  3ENE A;  1IHG A;  1Z6T A;  4A1S A;  2C2L A;  3DBS A;  4CGV A;  3FU5 A;  2X3M A;  3AU4 A;  1H6K A;  2CG2 A;  3APF A;  4GAA A;  3ZEF A;  4B89 A;  3NF1 A;  5LOZ A;  1UJK A;  2JEK A;  3ZRH A;  1JWF A;  1NA3 A;  2J08 A;  3CQC B;  3MA5 A;  3LYA A;  3AS5 A;  3MEK A;  4GZ5 A;  3FU3 A;  3FEY A;  4U07 A;  2WXR A;  5LP0 A;  4RG9 A;  4LER A;  3B7T A;  4M3O A;  2LAI A;  4NQ0 A;  3O48 A;  2DBA A;  1GW6 A;  2PL2 A;  2NXP A;  1HU3 A;  1KT0 A;  4U0S A;  4A3T A;  4MRU A;  3MV3 B;  4TUU A;  5JJ7 A;  1U3D A;  2LAH A;  4GMJ A;  4AJW A;  1E90 A;  4I17 A;  1E8X A;  3FUM A;  3LXU X;  3QWP A;  4FUL A;  4O6F A;  2XCC A;  4N3B A;  5KCM A;  4WWO A;  2LNI A;  2IQC A;  3JYS A;  4G23 A;  4XI0 A;  4EBA A;  4HOT A;  2PQR A;  4XKC A;  3FUF A;  2J07 A;  1H0A A;  2KCL A;  2KM4 A;  3MKQ A;  3UX4 A;  4Q96 A;  3RU0 A;  4Q94 A;  4JHR A;  5JHA A;  3SBT B;  1P5Q A;  5ARF A;  2CFZ A;  3FWV A;  4LUN U;  1E8W A;  2QFC A;  3CHR A;  2KCK A;  1DVP A;  2IU1 A;  3JUI A;  5BV1 A;  1OWM A;  2BF0 X;  4KMO A;  4JHK A;  4UI9 J;  3RRN B;  4ANW A;  2XCB A;  2A4Z A;  1NA0 A;  2LO6 A;  4JXT A;  4CT0 A;  4CDR A;  3O4Z A;  3PEU B;  2V4L A;  4EBA G;  1XGW A;  4RG6 A;  4RVB A;  3OAW A;  2WXG A;  4CDM A;  4GA0 A;  5AJL A;  5FQ7 A;  1OWL A;  4I9C A;  4GZD A;  5FQ8 A;  1ZU2 A;  3MZL B;  4G2V A;  1ZBP A;  4HS2 A;  3T5X A;  3VTY A;  1FVF A;  3MKQ B;  3FUJ A;  3KEZ A;  3PDN A;  3SBS A;  1TJF A;  4AY5 A;  3LDZ A;  3I3N A;  3PRZ A;  1X5B A;  2RD0 A;  3RO3 A;  4DK5 A;  2AXV A;  2Y3A A;  4MS6 A;  4KYO B;  4HFG A;  3RRU A;  5KJK A;  3ONL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...