3RRMB

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
295
structure length
295
Chain Sequence
TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 118
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rrmB00
3PEVB 3RRNB 3RRMB 3PEUB
chains in the Genus database with same CATH superfamily
4FJZA 3ULEG 5B3SE 4J7WA 3JQ0A 3ZHEB 3ZYMA 3CK7A 4YNDA 1N11A 2AXZA 1DCEA 4PS3A 2WXQA 3DXKG 3APDA 3HYMB 3L13A 2YNQA 4MBGA 3E30A 4U8YD 3PNTB 4WWOA 3FTUA 5BXUA 3TWQA 3AU4A 2R2LA 2CFUA 4GTSA 2I1KA 1NFIE 1FVFA 2AVPA 3LXUX 4TRQA 3PS6A 3CQCB 1TEZA 3I5PA 3HVEB 3MEKA 2L6JA 2LSVA 5JJ6A 2KC7A 2EIKE 3CHSA 3DSWA 4U0UA 2VSNA 3PVLA 3LY9A 1H6KA 3GZSA 1MX4A 2IOLA 3FTSA 2Q7FA 3HXCA 2HM8A 5JA4D 5G2NA 3HG0D 2BKGA 3SFYA 2R05A 2WPVA 2C2LA 1UG3A 3MV3B 1IHGA 1TNOA 3QB2A 2XPIA 2VTBA 3JXJA 3FUKA 2R59A 3TAXA 3E32A 4GA0A 2EILE 2Y4UA 1HF8A 1QQEA 3Q49B 2ETCA 4UWFA 1O5MA 4FLHA 4XKBA 3ZXSA 3O4ZA 2I2OA 4L2YA 1SZAA 3LY8A 3FUEA 5IY5E 3D9HA 3FH8A 1SVXA 5HQ8A 4WUYA 4UQXA 4IULA 3Q5MA 5EIDA 2IO2C 3DBSA 4HLEA 4ZHBA 5ITZF 3C98A 1TYQG 2QYUA 2NC9A 4I1AA 4I6JA 5EX3A 3FTYA 3ZPJA 4LG6A 2VGXB 1LD8A 4U07A 2DVWA 4L7TA 1JCSA 2XPZA 2L6BA 1HS6A 2GRMA 3R7QA 4KVMA 4K03A 3EIJA 3LKUA 3LVQE 4KBQA 1JCRA 1KLXA 4OVVA 1P5QA 3SD5A 4F7AA 2Y4TA 3L6AA 1QZ2A 4F6RD 5AAOA 2WXMA 4RQIA 2UWJG 1S0PA 2FI7A 3C72A 1ZB1A 3FULA 2UY1A 3PNLB 2EQXA 4J8YA 4L2LA 3FTXA 3FUJA 1TNBA 3TWVA 3CQGB 4CGVA 3TXNA 1DC2A 3ZYLA 4Q94A 4UQZA 4KYOB 3TWSA 2R02A 3HXFA 4PUCA 4JPSA 4U7EB 2H6HA 3FEXA 5M72A 4WNFA 1Y6IA 4C0MA 5DBKA 2DIWA 2PM6A 5AQBA 3D9MA 3DSSA 3AG1E 3JXIA 3NZUA 4QFVA 2X6JA 4IN3B 4DI3A 5BXOA 3ABLE 4A1SA 2VQ2A 4RG6A 1K1AA 4CDRA 3T8KA 5CCMA 3AS5A 3PUJA 4U0SA 2X6KA 4FULA 3R7RA 3CLJA 3MZLB 5C2YA 3UT4A 4R7LA 3DEPA 4BESA 4GTRA 5AARA 3TL5A 4HOTA 3CHQA 4QQIA 2F8XK 3UM2A 4O1PA 5EYPF 3CGHA 4FLBA 3RK6A 4BFRA 3V31A 4D10C 3CVXA 4WWNA 4WWPA 4HS2A 4JEHA 4CCAA 4JW1A 3IV0A 3GYZA 3RRUA 3TJPA 5BNWA 2V5FA 3TXMA 3NQPA 4C48B 1O1SA 3DXMG 2NXPA 3ZIMA 2GRQB 3UI2A 2KATA 3CVNA 4TXRA 2I1JA 1L5JA 3EIQC 5G04C 4K5CA 3ZNGA 3LEWA 2X6IA 1SQMA 4XEIG 3Q73A 1WY6A 2J9QA 1AWCB 5LOZA 4HFGA 3UMVA 4GU5A 3WG7E 4JZYA 1EPUA 4FU3A 1SW6A 1UW4B 4UWLA 1FT1A 2FEZA 4DUIA 3EJNA 1IQUA 1U2VG 1YA0A 2WVIA 1A17A 4G26A 5LFAA 3L54A 3C3QA 1HO8A 1IKND 1N54A 5ARGA 4TV3A 4KVOA 1E8YA 1FCHA 4EHMA 4FADA 4J8DA 3DPYA 4DX2A 4F1SA 3OXFA 2AWIA 2FBNA 2X38A 3U9WA 2XENA 4U8HA 3UQ3A 4PS8A 2VSXE 2Y69E 4I9EA 4J8FA 3W9GA 4BT8A 4HOSA 4KZCA 4BEPA 1V54E 3UTMA 3ISMC 2DCPA 1N0RA 3FP3A 4CRWA 4G11A 3SFXA 4U63A 3B7TA 2RFAA 5JMND 4XE0A 4UI9K 1GW6A 1FPPA 3MKRA 3KSQA 4BX8A 5ENQD 2DZNA 3Q78A 4JVSA 4PS7A 3VTXA 4GZDA 5E76A 2AXVA 1NP7A 1UN9A 1X81A 2Y3AA 1D8EA 2F8YA 3EHRA 5T8IA 2BF0X 2YINA 2CHXA 1NA3A 3B7BA 3G2UA 5CBOA 3L16A 4GTOA 2CHZA 4I43A 5BUZA 3ULYA 3KAEA 5KWDA 1OXJA 2EIME 1ELKA 3FDHA 2MYOA 2XRZA 3IEGA 3L22A 1OUVA 4F53A 2QYJA 3TWRA 4B89A 2V0PA 4HQDA 3SHFA 5EN5D 3C3OA 3HHMA 4GTPA 3Q7AA 4DX7D 1OWLA 3P1UA 4IRUA 5BPPA 3LVRE 2GRRB 2BEDA 5A7DB 3ONLA 3CV0A 2WQHA 2XGMA 1S64A 2GW1A 1LD7A 2WMNA 4GCOA 1NI1A 2WQ6A 3SFZA 4FHJA 2F37A 3FU3A 4GMRA 2RG8A 1MHQA 5CRUA 1G3NB 3OXLA 3QWWA 4A55A 3B7SA 5LCWC 3CVPA 1TR4A 2CG2A 2YHCA 4AOFA 1N4QA 3ZRHA 5A6CA 1SZ9A 2J49A 4I17A 2B6CA 1AP7A 3E33A 3MX3A 5EILA 2KXPC 3UKRG 4LUNU 1N9AA 3BG1B 1HFAA 3DSVA 4ILIA 4I6GA 3DEOA 1KZOA 2E0IA 4ILHB 3QK0A 4JB8P 2VGYA 3IXEA 1KPSB 2HE0A 4JD2G 5B1AE 3EU9A 4AY5A 4E85A 1XNFA 3EU5A 2ILRA 2WXHA 2KZTB 4GYWA 1FT2A 4I1MA 5ENTD 3TWXA 4G8LA 1LTXA 4N5CA 1O1RA 3QDNA 3SO8A 2J4DA 4K0RA 2PQNA 3PH0C 4UI9J 1FVHA 3EHNA 3PZDA 3Q47B 1N52A 4NURA 4FJYA 2VSYA 3PUKA 3ASDA 4G1TA 4ATGA 3PREA 3CVLA 4EZJA 4ILGA 1KT1A 4HB5A 5FINA 1MJ0A 1K3ZD 1BD8A 3FUIA 2WXRA 1Z5SC 4KMOA 1WAO1 4J8EA 3MGBA 4O1OA 5G05J 5LP0A 2WMOA 4B8AA 2RKKA 4APOA 2IONA 3I3NA 4N5QA 2OOEA 3D9LA 5A23A 2PL2A 3L17A 2KZTA 3UUXA 3MCXA 3LCAA 3UX4A 2NSZA 3ABKE 4BSXA 2M63A 3V2OA 5T3RA 3NOCD 3PZ4A 3LYAA 5FJYA 3B95A 4YDOA 3TG5A 3HRAA 4N39A 1RZ4A 2OEVA 4GZCA 5ANRA 4P29A 1A5EA 3HXDA 5AQ7A 4DX6D 3IBEA 3UKUG 4MKTA 5KNHD 2ETAA 3LJ3A 1N4RA 4DPRA 3I4GA 3CIAA 5HRYA 4AVXA 1TN8A 4K5AB 3CHPA 3ZUVB 3UM1A 2X6FA 3FU0A 3S2AA 2P9LG 3T8MA 4JHJA 3ZN3A 2XHEA 4I2WA 4YVOA 3KSLA 2RFMA 3MV2B 4EBAG 3ONKA 2HYZA 5CBNA 2VGEA 4WNEA 3OAWA 4UQYA 4GTMA 1O1TA 1Z3XA 2P58C 5KJLA 2V4LA 3CKCA 4CDMA 4U8VD 2WXOA 3WXXA 3EHMA 5CEDB 2DBAA 1OWMA 4BTAA 2OV8A 2WM9A 4HRLA 2LAIA 1E8WA 1BLXB 4F1PA 4HVBA 4U95D 1H2VC 1ELWA 1H2UA 5FQ7A 3BU8A 4HORA 4HI9A 5EX0A 2IF4A 2LUHA 5JJTA 3N71A 3U3WA 3C5RA 3BG0B 3PZ3A 1BI7B 3S7DA 4JA7A 2Y0BG 1MZCA 2H6FA 4G23A 2WXGA 3UINC 4L23A 3KD7A 3AJIA 2VGXA 3CR3A 2MOWA 2EINE 4FA6A 4W9RA 4DRXE 5D66A 5AQ9A 4HLLA 4A3VA 1H0AA 1PY1A 1TNZA 4B94A 5EDSA 3RIBA 5BV1A 3FU5A 2P2CP 4TUUA 4G25A 3TWWA 1PC2A 4ANVA 3OXGA 1OCCE 5J90A 2FO1E 1KZPA 2P9IG 3SI5A 2GRPB 4OAUC 1JUQA 3ASHA 2J8SD 2WXNA 1IHBA 1UOHA 1JWFA 2WXLA 4I6EA 2VTBB 4LNGA 1IXVA 4NRHB 3ZEFA 2LNIA 2R03A 2V4HC 3ZYQA 3ENEA 3CEQA 4ANUA 2PZIA 4AV7A 5G05C 4DX1A 2DYRE 4KXKB 3GZ2A 3L9TA 4GCNA 2ZGGA 2J07A 3F6QA 1TJCA 2YQ8A 4AIFA 3VLFA 4MRUA 2VJ8A 3UT7A 2RD0A 2KCVA 4ABNA 5CMWA 4LNBA 5KJNA 5CCLA 1N95A 2XZDG 1K1BA 4HOUA 3RSEG 1U3CA 4XI9A 4YDEA 4CT4A 4IYPA 2IOSA 3LS8A 3EDTB 2L0IA 4EECA 3DWLG 2ZU6B 3TGOA 3FTWA 3HDXA 4AP2A 3FEYA 3PRZA 1INZA 4XKCA 2CG3A 2XCCA 3AG3E 2IU1A 1HG5A 3ZHEA 3CSFA 4BT9A 5EIBE 2DWZA 4FP7A 5ENRD 4CDNA 4J8SA 5G04J 4GAAA 2HR2A 3L82A 5AYWD 3VLEA 3IHVA 3CVYA 2OVBA 1OT8A 4GPMA 3Q7FA 2A5EA 3P2BA 3AG4E 4WNGA 5FTPA 4MS6A 3D9PA 3EHQA 2P9UG 2A4ZA 5ENPD 5AENA 3G2VA 2GROB 3GZ1A 2ETBA 1ZU2A 1N4PA 5G55A 4GZ5A 5KCMA 3ULQA 1K8KG 1JWGA 3FWVA 5BT1A 3DRAA 3FUNA 5CEAA 5AQAA 1HX8A 1E7UA 4JL0A 2ZIRA 2KBXA 1TN7A 4M7CA 3G2TA 2R17C 3E37A 5D2MC 2PNNA 4OAVB 4HRMB 1HE8A 4B8CB 3UXGA 2H6IA 4EBAA 3T5VA 5EKQD 4FHKA 5D0OD 2FO7A 3LJNA 4F3VA 3K9IA 5CRVA 4APFA 5CERB 3CVQA 4B93B 2E2EA 3B7RL 2YHEA 3ESLA 3ZXPA 4I1OB 2A5UA 4U96D 3W9FA 3ABME 4AEZC 2WXPA 2XS1A 1HU3A 2QC9A 3E4BA 4Q69A 3JYSA 4EPZA 4BX9A 2KCKA 3CHRA 2X3MA 4LNUD 1IYGA 3V30A 2WXKA 5ANLA 3PDNA 4AM9A 3VTYA 3FUFA 2VYIA 3RJVA 5CHEE 1KT0A 2UY1B 1ZBPA 4NIKA 1NZNA 4BY6A 3RRNB 5D0QD 1TNUA 2BTDA 2IFUA 2H6GA 3NAWA 4YDYA 2PM7A 2CHWA 5FQ8A 3QC1A 3IKOB 3UT8A 3R9AB 3CKBA 3QKYA 1HXIA 1MX6A 5CECB 5FZQA 2AW6A 3KS2A 2ZISA 3FH5A 5AIJA 3S7BA 4DK5A 2FF4A 5KJKA 3QJZA 2QZAA 1OWPA 1E96B 4N3CA 3UPVA 2MRIA 3D9NA 4U0ZA 3ASFA 1TNYA 1Z3YA 2IQCA 3SZ7A 1H19A 2B0OE 3SGHA 5BV0A 2J4BA 4TUMA 4TXPA 1SA5A 5FZSA 4ME2A 1OWOA 1OCZE 3HXBA 1DNPA 1UJJA 3FU6A 5LCWJ 3RKVA 1JCQA 3MKQB 2AJAA 4Q96A 4WNDA 4N2QA 3ZKJA 1X5BA 3J5PA 4GPKA 1Q2ZA 3LY7A 5BW8C 1HZ4A 3ASGA 5AJDA 5AJLA 2XGOA 3NF1A 4M3OA 3ASNE 1LF8A 3HXEA 3SBSA 4LERA 1NA0A 1HH8A 3PEVB 3QWVA 2GRNB 2WXFA 1S70B 4YDWA 4EZLA 2XS8A 2ZXWE 5FIOA 3HVEA 2KM4A 3L08A 4CGWA 3JCKC 1Z6TA 1S63A 2V5QC 1HG2A 5C1DA 3PEUB 3MJWA 1EDUA 1QBQA 4O60A 5DIZA 4LSZE 4HI8A 3TG4A 2F0YA 2LXLA 4JXTA 2WB2A 3QOUA 1OCRE 2LXMA 3B13A 5FT9A 3RO3A 4WAFA 3AS8A 3FUMA 1D9SA 1PAQA 4TXQA 5T4YA 5ENSD 4J0UA 2V8SE 5HI7A 4U04A 3BUAA 5KNGA 3LPZA 5H7PA 4CZ2D 1YYHA 4RLYA 3UM0A 4JEUA 3APCA 4HBDA 4GZ3A 3NZSA 2XPYA 4DLOA 2OEWA 4DX5D 3T9KA 3S7JA 3DSUA 3G2SA 3D9IA 3D9JA 2JLBA 4I2ZA 3Q9UC 3QARA 1OCOE 3Q9NC 3T5XA 4ANXA 4CT0A 3ML9A 4JHKA 2ONDA 1MQSA 5JHBA 4L1BA 1BU9A 3GW4A 3CHOA 1E8XA 1OY3D 3DPDA 2P9SG 3D9KA 4HNAD 2XQ0A 2OCCE 1MYOA 4BETA 2OVFA 2DZOA 2P9KG 3E34A 4ANWA 1NL4A 3ZVVA 4GTQA 3I4RB 1E8ZA 3FFLA 3URZA 1UN8A 4UUCA 2P9NG 4G2VA 4E6HA 3SY2A 3Q75A 1DVPA 5HS0A 2XEHA 3UIPC 4EZKA 4LCTA 3CVWA 2WQ7A 1WG0A 4B0ZA 3RRMB 4CYMD 1WM5A 5LX8A 2C0MA 2XZTG 4GYYA 5B1BE 3LDZA 5AN8A 3PZ1A 4ZFHA 2J08A 3MA5A 3FUHA 4BWRA 1YCSB 2PQRA 4AY6A 3AAAC 2LSUA 3U4TA 4HOQA 3O48A 2GGFA 4XZ4A 4OVUA 3JUEA 1WDYA 4GB9A 4YVQC 2Y1LE 3B7UX 3AS4A 2WXJA 3FY4A 1H6PA 4KZ0A 3NB2A 4X8QA 3U64A 2DYSE 1V55E 1YMPA 5ENNA 4N3BA 4DLQA 3BEEA 3SF4A 3RAUA 4GTTA 1B89A 3EUVA 3Q15A 3APFA 3DSXA 3TWUA 2X6HA 3FUDA 2ZGDA 1H6OA 4L9PA 3UIOC 1N0QA 2GRLA 3FHEA 4GA1A 3J5QB 3S7FA 1RW2A 4JA9A 2L9BA 2LO6A 1QNFA 3CHMA 4XI0A 3R9MA 1OWNA 4Y6WA 2I9CA 3FH7A 4PDXA 4NQ0A 2I6HA 3MKQA 3V2XA 1W3BA 1SA4A 3PE3A 4GMLA 5HKPA 1Y8MA 3OTNA 3CK8A 3CVUA 4URKA 5FQ4A 4HRNA 2KCLA 2QFCA 2NYJA 2AXUA 3TWTA 3VLDA 4J6IA 5ENOD 2CFZA 1EF1C 1DCQA 5KBAA 3JUIA 3U66A 2QY7A 3PE4A 4I9CA 4N2SA 1BI8B 4RG9A 1N4SA 2XRYA 4ACKA 2JEKA 4PH4B 5JHAA 4BERA 3DSTA 1TN6A 5FWQA 3IHYA 1N94A 2VSOE 4UI9C 3MYVA 4EQFA 3ZGQA 5CMYA 1H2TC 4RVBA 5KJMA 2C0LA 3D9OA 4XX5A 3X2QE 2IEJA 3Q79A 3ZYKA 4DJAA 3KEZA 4O6FA 4H7YA 1TJFA 5FZRA 1D8DA 4OYSA 3V79K 3SQVA 2XEVA 2XCBA 1BPOA 4GA2A 5JJ7A 3JQ1A 2JABA 4RSYA 5ARFA 2IJGX 4H7XA 4Z68A 3SBTB 3QWPA 3ZFWA 3RU0A 3CK9A 2BUGA 1U3DA 4GTVA 2J09A 4A63B 5EYLA 3AG2E 4LEUA 3HIZA 4LRZA 3AU5A 3ZW3A 2MHKA 4K5BA 1IQRA 3ZU7B 3PZ2A 1ELRA 5E75A 4KT6B 1MX2A 2R5SA 4ATZD 4UWKA 3SNXA 1JPLA 3CSTA 2HO1A 4UWHA 4A3TA 5J08A 2LAHA 2L0TB 4JC8A 2BKKB 3C3RA 3ML8A 4G8KA 3KEAA 3FTVA 3D3MA 4FC8A 1UJKA 1E90A 2XEEA 4DI4A 4BSZB 3FTZA 3UM3A 3NBNB 3Q4AB 2XGSA 3G2WA 3NOGD 3RO2A 4NACA 2IO3C 4C0EA 4AJWA 4BTBA 3ASOE 2WXIA 4A1GA 4ACLA 4UWGA 2IY0C 1EYHA 2EIJE 5FQ6A 4C9BB 3QAQA 4AXHA 4MLPA 3BQOA 2FULA 4N3AA 4V3IA 3QNKA 4CEMA 1QYMA 4G24A 3ESKA 1E7VA 1XGWA 4GMJA 4XIFA 2P9PG 3CVVA 4HXIA 1VDYA 4JHRA 4Y6CA 4GZ6A 4GYOA
chains in the Genus database with same CATH topology
4A3VA 1H0AA 4FJZA 1PY1A 4XE0A 4B94A 4UI9K 3B13A 1GW6A 5FT9A 4WAFA 3RO3A 5EDSA 3RIBA 3JQ0A 3MKRA 3AS8A 5BV1A 3FUMA 3ZHEB 1PAQA 3FU5A 3ZYMA 4BX8A 4TUUA 4G25A 3CK7A 4YNDA 1PC2A 4ANVA 5T4YA 3OXGA 4JVSA 4PS7A 3VTXA 5J90A 2AXZA 4GZDA 4J0UA 2V8SE 4PS3A 2WXQA 5E76A 5HI7A 2AXVA 4U04A 3APDA 3HYMB 1NP7A 1UN9A 3SI5A 2Y3AA 2YNQA 3L13A 1JUQA 3LPZA 5T8IA 3PNTB 4WWOA 2BF0X 3ASHA 2YINA 2CHXA 3FTUA 2WXNA 1JWFA 3AU4A 1NA3A 2WXLA 4I6EA 4JEUA 3APCA 2CFUA 4GZ3A 2VTBB 3G2UA 4NRHB 3L16A 2I1KA 3ZEFA 2CHZA 3NZSA 2LNIA 1FVFA 2XPYA 2AVPA 3LXUX 3ZYQA 4I43A 4TRQA 4DLOA 3ENEA 5BUZA 3S7JA 3KAEA 3CEQA 3G2SA 4ANUA 2PZIA 4AV7A 3PS6A 5G05C 3CQCB 3D9IA 1ELKA 3FDHA 1TEZA 3D9JA 4KXKB 2JLBA 3GZ2A 4I2ZA 3I5PA 3QARA 4GCNA 2J07A 2XRZA 3IEGA 3T5XA 3HVEB 4ANXA 4CT0A 3MEKA 1TJCA 2L6JA 3ML9A 2LSVA 3L22A 4JHKA 2YQ8A 1OUVA 4AIFA 4F53A 2ONDA 3VLFA 5JJ6A 2KC7A 1MQSA 4MRUA 2V0PA 2VJ8A 4B89A 3CHSA 4U0UA 3UT7A 3SHFA 2RD0A 2KCVA 2VSNA 4ABNA 5JHBA 5CMWA 3PVLA 5KJNA 3LY9A 4L1BA 5CCLA 3HHMA 1H6KA 3GZSA 3GW4A 1OWLA 4HOUA 2IOLA 3CHOA 2Q7FA 3FTSA 2HM8A 1E8XA 1U3CA 3DPDA 4XI9A 3P1UA 3D9KA 2XQ0A 4IRUA 5G2NA 5BPPA 3LVRE 2OVFA 4CT4A 2WPVA 4IYPA 2IOSA 2C2LA 5A7DB 3ONLA 3ZVVA 1UG3A 3LS8A 1IHGA 3MV3B 4ANWA 3CV0A 3I4RB 1E8ZA 3QB2A 3FFLA 3URZA 2XPIA 2WQHA 2XGMA 1UN8A 2VTBA 4G2VA 2GW1A 3FUKA 4E6HA 2WMNA 4GCOA 3EDTB 2R59A 3TAXA 2L0IA 2WQ6A 3SFZA 4GA0A 4FHJA 4EECA 3FU3A 2ZU6B 2Y4UA 1HF8A 3FTWA 3TGOA 3HDXA 1DVPA 1QQEA 3Q49B 4UWFA 4AP2A 3FEYA 2RG8A 3PRZA 4FLHA 4XKBA 1INZA 4EZKA 3ZXSA 3O4ZA 2I2OA 4XKCA 2CG3A 4LCTA 2XCCA 1MHQA 4L2YA 3CVWA 1SZAA 2WQ7A 4B0ZA 3RRMB 2IU1A 1WM5A 1HG5A 3ZHEA 5LX8A 3LY8A 3CSFA 4BT9A 3OXLA 3FUEA 4FP7A 2C0MA 3QWWA 3B7SA 3FH8A 4GYYA 4A55A 4CDNA 5LCWC 3CVPA 3LDZA 4J8SA 4WUYA 4UQXA 4IULA 2CG2A 5G04J 2YHCA 5HQ8A 3Q5MA 4AOFA 3DBSA 4GAAA 3ZRHA 2HR2A 2J08A 3MA5A 5AYWD 3FUHA 3VLEA 4HLEA 5A6CA 3IHVA 4BWRA 1SZ9A 2J49A 3CVYA 2OVBA 3C98A 2PQRA 4I17A 4AY6A 3P2BA 2LSUA 3U4TA 2NC9A 4I1AA 4HOQA 3O48A 4WNGA 2GGFA 5FTPA 4I6JA 4XZ4A 5EX3A 4OVUA 4MS6A 3D9PA 3FTYA 3ZPJA 4GB9A 2VGXB 4YVQC 2A4ZA 3MX3A 3B7UX 3AS4A 4LUNU 5AENA 2WXJA 3FY4A 4U07A 3BG1B 1HFAA 3G2VA 4L7TA 2XPZA 4ILIA 4I6GA 3GZ1A 4KZ0A 1HS6A 3U64A 2GRMA 3R7QA 4KVMA 1ZU2A 2E0IA 4K03A 5ENNA 3EIJA 3LKUA 3LVQE 4GZ5A 5G55A 5KCMA 4KBQA 4ILHB 3ULQA 3QK0A 1KLXA 4N3BA 1P5QA 3BEEA 4OVVA 3SF4A 4DLQA 2VGYA 1JWGA 3SD5A 3FWVA 4F7AA 5BT1A 2Y4TA 3L6AA 1B89A 1QZ2A 2WXMA 4AY5A 3FUNA 1HX8A 1E7UA 2UWJG 4E85A 1XNFA 4JL0A 3Q15A 3APFA 3G2TA 2R17C 2ILRA 2WXHA 1S0PA 2KZTB 2X6HA 3FUDA 4GYWA 2FI7A 3FULA 2UY1A 3U66A 2GRLA 4I1MA 3FHEA 3PNLB 4GA1A 3S7FA 2EQXA 4N5CA 4L2LA 1HE8A 4JA9A 3FTXA 3FUJA 4B8CB 2L9BA 3QDNA 3CQGB 2LO6A 2J4DA 4CGVA 1QNFA 3TXNA 4K0RA 3CHMA 4XI0A 4EBAA 3ZYLA 5EKQD 3T5VA 2PQNA 1OWNA 3PH0C 4FHKA 4Q94A 4UI9J 5D0OD 4Y6WA 4UQZA 1FVHA 2FO7A 2I9CA 3EHNA 3FH7A 3PZDA 3Q47B 4F3VA 1N52A 4NURA 3K9IA 4KYOB 4NQ0A 4FJYA 4PDXA 2I6HA 4APFA 3MKQA 3CVQA 2VSYA 3PUKA 4PUCA 1W3BA 2E2EA 3ASDA 4G1TA 4JPSA 3B7RL 4ATGA 3PE3A 4GMLA 2YHEA 3FEXA 3CVLA 3ESLA 3PREA 5M72A 4WNFA 1Y6IA 4I1OB 4EZJA 4C0MA 1Y8MA 2A5UA 5DBKA 4ILGA 1KT1A 3OTNA 3CK8A 3CVUA 2DIWA 4AEZC 4URKA 2WXPA 1HU3A 2PM6A 5FQ4A 3E4BA 3D9MA 3FUIA 2WXRA 3NZUA 4QFVA 4Q69A 3JYSA 4KMOA 1WAO1 2X6JA 4IN3B 3MGBA 4J8EA 4EPZA 5G05J 2KCLA 4DI3A 5LP0A 2QFCA 2WMOA 4A1SA 4BX9A 4B8AA 2KCKA 2AXUA 2VQ2A 3CHRA 3VLDA 2X3MA 4RG6A 4J6IA 4CDRA 2CFZA 1IYGA 1EF1C 5CCMA 3AS5A 2WXKA 3PUJA 3JUIA 4U0SA 2QY7A 2X6KA 3PDNA 3PE4A 4I9CA 4FULA 5ANLA 3R7RA 3CLJA 3MZLB 5C2YA 3UT4A 3VTYA 4R7LA 4RG9A 4AM9A 4N2SA 3FUFA 2VYIA 3RJVA 2XRYA 5CHEE 4APOA 2IONA 3I3NA 1KT0A 2OOEA 3D9LA 3TL5A 4HOTA 3CHQA 2UY1B 4ACKA 2JEKA 4PH4B 1ZBPA 5A23A 5JHAA 2PL2A 3L17A 2KZTA 3UUXA 3MCXA 3LCAA 3UX4A 3CGHA 1NZNA 4FLBA 2NSZA 5FWQA 3RK6A 4BY6A 3RRNB 3IHYA 4BFRA 4UI9C 2VSOE 4BSXA 2M63A 5D0QD 5T3RA 3MYVA 4D10C 3LYAA 5FJYA 3CVXA 4EQFA 3ZGQA 4WWNA 2BTDA 5CMYA 2IFUA 1H2TC 4RVBA 3TG5A 5KJMA 4WWPA 2PM7A 4N39A 4HS2A 4JEHA 2C0LA 4CCAA 2CHWA 4JW1A 3IV0A 3D9OA 4XX5A 3QC1A 3GYZA 5FQ8A 3RRUA 4GZCA 3IKOB 4P29A 5ANRA 3TJPA 3ZYKA 3UT8A 5BNWA 2V5FA 4DJAA 3R9AB 3TXMA 3CKBA 3KEZA 4O6FA 3NQPA 4H7YA 1TJFA 3QKYA 5FZRA 3IBEA 1HXIA 4OYSA 2NXPA 2XEVA 4MKTA 3ZIMA 2XCBA 5FZQA 2AW6A 1BPOA 3KS2A 4GA2A 5JJ7A 2KATA 3FH5A 3LJ3A 4DPRA 3JQ1A 3I4GA 3CVNA 3CIAA 3S7BA 5AIJA 4DK5A 2I1JA 1L5JA 3EIQC 4RSYA 5G04C 4AVXA 3LEWA 2FF4A 5ARFA 5KJKA 2X6IA 2IJGX 1SQMA 3QJZA 1OWPA 3CHPA 1E96B 4N3CA 3UPVA 2MRIA 3D9NA 4U0ZA 3ASFA 2X6FA 1Z3YA 2IQCA 3FU0A 4H7XA 1WY6A 1H19A 3SZ7A 3SBTB 3QWPA 3SGHA 2J9QA 3ZFWA 3RU0A 3S2AA 5BV0A 2J4BA 3CK9A 2BUGA 1U3DA 2J09A 5LOZA 5FZSA 4ME2A 1OWOA 4HFGA 4LEUA 3T8MA 4JHJA 3HIZA 3UMVA 4LRZA 3ZN3A 4GU5A 4JZYA 1DNPA 1UJJA 2XHEA 3FU6A 1EPUA 3AU5A 4FU3A 5LCWJ 3RKVA 3ZW3A 4I2WA 2MHKA 1IQRA 3MKQB 4Q96A 4YVOA 4WNDA 4N2QA 3MV2B 1X5BA 4EBAG 1UW4B 3ONKA 2HYZA 4UWLA 1ELRA 2FEZA 4WNEA 3OAWA 5E75A 4KT6B 2R5SA 4UWKA 4UQYA 4GPKA 1Z3XA 2P58C 3EJNA 5KJLA 2V4LA 3CKCA 3SNXA 4CDMA 1JPLA 3CSTA 3LY7A 5BW8C 1HZ4A 3ASGA 5AJDA 5AJLA 2WXOA 2XGOA 2HO1A 4UWHA 3NF1A 4M3OA 1IQUA 3WXXA 3EHMA 4A3TA 1LF8A 5J08A 3SBSA 2LAHA 2DBAA 1YA0A 2L0TB 1A17A 2WVIA 4G26A 4JC8A 5LFAA 1OWMA 3L54A 1NA0A 1HO8A 4LERA 2OV8A 4BTAA 2WM9A 2LAIA 1E8WA 1N54A 5ARGA 3ML8A 4TV3A 4KVOA 1HH8A 3PEVB 3QWVA 3FTVA 3D3MA 4FC8A 1UJKA 2WXFA 1E90A 4DI4A 4HVBA 1H2VC 3FTZA 1E8YA 1FCHA 4EZLA 4FADA 3Q4AB 2XGSA 3G2WA 4J8DA 3RO2A 4F1SA 1ELWA 1H2UA 3OXFA 5FQ7A 3HVEA 2AWIA 2FBNA 4NACA 2KM4A 4HORA 3L08A 2X38A 5EX0A 3U9WA 4C0EA 4AJWA 2IF4A 4BTBA 5JJTA 3N71A 3U3WA 4CGWA 3JCKC 1Z6TA 3BG0B 1HG2A 3S7DA 4U8HA 2WXIA 3UQ3A 5C1DA 4JA7A 4PS8A 4A1GA 2VSXE 3PEUB 4ACLA 4UWGA 4G23A 4I9EA 3MJWA 4J8FA 2WXGA 4BT8A 4L23A 1EYHA 4HOSA 4KZCA 3KD7A 5FQ6A 4C9BB 3QAQA 1EDUA 2VGXA 4AXHA 4MLPA 4V3IA 2FULA 4N3AA 5DIZA 3QNKA 3CR3A 4CEMA 2DCPA 4G24A 3ESKA 2MOWA 3TG4A 1E7VA 1XGWA 3FP3A 4GMJA 4CRWA 4XIFA 4JXTA 2WB2A 4G11A 4FA6A 4U63A 3QOUA 3CVVA 4W9RA 4HXIA 1VDYA 3B7TA 4JHRA 4Y6CA 4GZ6A 4GYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEV B;  3RRN B;  3RRM B;  3PEU B; 
#chains in the Genus database with same CATH topology
 4FJZ A;  3ULE G;  5B3S E;  4J7W A;  3JQ0 A;  3ZHE B;  3ZYM A;  3CK7 A;  4YND A;  1N11 A;  2AXZ A;  1DCE A;  4PS3 A;  2WXQ A;  3DXK G;  3APD A;  3HYM B;  3L13 A;  2YNQ A;  4MBG A;  3E30 A;  4U8Y D;  3PNT B;  4WWO A;  3FTU A;  5BXU A;  3TWQ A;  3AU4 A;  2R2L A;  2CFU A;  4GTS A;  2I1K A;  1NFI E;  1FVF A;  2AVP A;  3LXU X;  4TRQ A;  3PS6 A;  3CQC B;  1TEZ A;  3I5P A;  3HVE B;  3MEK A;  2L6J A;  2LSV A;  5JJ6 A;  2KC7 A;  2EIK E;  3CHS A;  3DSW A;  4U0U A;  2VSN A;  3PVL A;  3LY9 A;  1H6K A;  3GZS A;  1MX4 A;  2IOL A;  3FTS A;  2Q7F A;  3HXC A;  2HM8 A;  5JA4 D;  5G2N A;  3HG0 D;  2BKG A;  3SFY A;  2R05 A;  2WPV A;  2C2L A;  1UG3 A;  3MV3 B;  1IHG A;  1TNO A;  3QB2 A;  2XPI A;  2VTB A;  3JXJ A;  3FUK A;  2R59 A;  3TAX A;  3E32 A;  4GA0 A;  2EIL E;  2Y4U A;  1HF8 A;  1QQE A;  3Q49 B;  2ETC A;  4UWF A;  1O5M A;  4FLH A;  4XKB A;  3ZXS A;  3O4Z A;  2I2O A;  4L2Y A;  1SZA A;  3LY8 A;  3FUE A;  5IY5 E;  3D9H A;  3FH8 A;  1SVX A;  5HQ8 A;  4WUY A;  4UQX A;  4IUL A;  3Q5M A;  5EID A;  2IO2 C;  3DBS A;  4HLE A;  4ZHB A;  5ITZ F;  3C98 A;  1TYQ G;  2QYU A;  2NC9 A;  4I1A A;  4I6J A;  5EX3 A;  3FTY A;  3ZPJ A;  4LG6 A;  2VGX B;  1LD8 A;  4U07 A;  2DVW A;  4L7T A;  1JCS A;  2XPZ A;  2L6B A;  1HS6 A;  2GRM A;  3R7Q A;  4KVM A;  4K03 A;  3EIJ A;  3LKU A;  3LVQ E;  4KBQ A;  1JCR A;  1KLX A;  4OVV A;  1P5Q A;  3SD5 A;  4F7A A;  2Y4T A;  3L6A A;  1QZ2 A;  4F6R D;  5AAO A;  2WXM A;  4RQI A;  2UWJ G;  1S0P A;  2FI7 A;  3C72 A;  1ZB1 A;  3FUL A;  2UY1 A;  3PNL B;  2EQX A;  4J8Y A;  4L2L A;  3FTX A;  3FUJ A;  1TNB A;  3TWV A;  3CQG B;  4CGV A;  3TXN A;  1DC2 A;  3ZYL A;  4Q94 A;  4UQZ A;  4KYO B;  3TWS A;  2R02 A;  3HXF A;  4PUC A;  4JPS A;  4U7E B;  2H6H A;  3FEX A;  5M72 A;  4WNF A;  1Y6I A;  4C0M A;  5DBK A;  2DIW A;  2PM6 A;  5AQB A;  3D9M A;  3DSS A;  3AG1 E;  3JXI A;  3NZU A;  4QFV A;  2X6J A;  4IN3 B;  4DI3 A;  5BXO A;  3ABL E;  4A1S A;  2VQ2 A;  4RG6 A;  1K1A A;  4CDR A;  3T8K A;  5CCM A;  3AS5 A;  3PUJ A;  4U0S A;  2X6K A;  4FUL A;  3R7R A;  3CLJ A;  3MZL B;  5C2Y A;  3UT4 A;  4R7L A;  3DEP A;  4BES A;  4GTR A;  5AAR A;  3TL5 A;  4HOT A;  3CHQ A;  4QQI A;  2F8X K;  3UM2 A;  4O1P A;  5EYP F;  3CGH A;  4FLB A;  3RK6 A;  4BFR A;  3V31 A;  4D10 C;  3CVX A;  4WWN A;  4WWP A;  4HS2 A;  4JEH A;  4CCA A;  4JW1 A;  3IV0 A;  3GYZ A;  3RRU A;  3TJP A;  5BNW A;  2V5F A;  3TXM A;  3NQP A;  4C48 B;  1O1S A;  3DXM G;  2NXP A;  3ZIM A;  2GRQ B;  3UI2 A;  2KAT A;  3CVN A;  4TXR A;  2I1J A;  1L5J A;  3EIQ C;  5G04 C;  4K5C A;  3ZNG A;  3LEW A;  2X6I A;  1SQM A;  4XEI G;  3Q73 A;  1WY6 A;  2J9Q A;  1AWC B;  5LOZ A;  4HFG A;  3UMV A;  4GU5 A;  3WG7 E;  4JZY A;  1EPU A;  4FU3 A;  1SW6 A;  1UW4 B;  4UWL A;  1FT1 A;  2FEZ A;  4DUI A;  3EJN A;  1IQU A;  1U2V G;  1YA0 A;  2WVI A;  1A17 A;  4G26 A;  5LFA A;  3L54 A;  3C3Q A;  1HO8 A;  1IKN D;  1N54 A;  5ARG A;  4TV3 A;  4KVO A;  1E8Y A;  1FCH A;  4EHM A;  4FAD A;  4J8D A;  3DPY A;  4DX2 A;  4F1S A;  3OXF A;  2AWI A;  2FBN A;  2X38 A;  3U9W A;  2XEN A;  4U8H A;  3UQ3 A;  4PS8 A;  2VSX E;  2Y69 E;  4I9E A;  4J8F A;  3W9G A;  4BT8 A;  4HOS A;  4KZC A;  4BEP A;  1V54 E;  3UTM A;  3ISM C;  2DCP A;  1N0R A;  3FP3 A;  4CRW A;  4G11 A;  3SFX A;  4U63 A;  3B7T A;  2RFA A;  5JMN D;  4XE0 A;  4UI9 K;  1GW6 A;  1FPP A;  3MKR A;  3KSQ A;  4BX8 A;  5ENQ D;  2DZN A;  3Q78 A;  4JVS A;  4PS7 A;  3VTX A;  4GZD A;  5E76 A;  2AXV A;  1NP7 A;  1UN9 A;  1X81 A;  2Y3A A;  1D8E A;  2F8Y A;  3EHR A;  5T8I A;  2BF0 X;  2YIN A;  2CHX A;  1NA3 A;  3B7B A;  3G2U A;  5CBO A;  3L16 A;  4GTO A;  2CHZ A;  4I43 A;  5BUZ A;  3ULY A;  3KAE A;  5KWD A;  1OXJ A;  2EIM E;  1ELK A;  3FDH A;  2MYO A;  2XRZ A;  3IEG A;  3L22 A;  1OUV A;  4F53 A;  2QYJ A;  3TWR A;  4B89 A;  2V0P A;  4HQD A;  3SHF A;  5EN5 D;  3C3O A;  3HHM A;  4GTP A;  3Q7A A;  4DX7 D;  1OWL A;  3P1U A;  4IRU A;  5BPP A;  3LVR E;  2GRR B;  2BED A;  5A7D B;  3ONL A;  3CV0 A;  2WQH A;  2XGM A;  1S64 A;  2GW1 A;  1LD7 A;  2WMN A;  4GCO A;  1NI1 A;  2WQ6 A;  3SFZ A;  4FHJ A;  2F37 A;  3FU3 A;  4GMR A;  2RG8 A;  1MHQ A;  5CRU A;  1G3N B;  3OXL A;  3QWW A;  4A55 A;  3B7S A;  5LCW C;  3CVP A;  1TR4 A;  2CG2 A;  2YHC A;  4AOF A;  1N4Q A;  3ZRH A;  5A6C A;  1SZ9 A;  2J49 A;  4I17 A;  2B6C A;  1AP7 A;  3E33 A;  3MX3 A;  5EIL A;  2KXP C;  3UKR G;  4LUN U;  1N9A A;  3BG1 B;  1HFA A;  3DSV A;  4ILI A;  4I6G A;  3DEO A;  1KZO A;  2E0I A;  4ILH B;  3QK0 A;  4JB8 P;  2VGY A;  3IXE A;  1KPS B;  2HE0 A;  4JD2 G;  5B1A E;  3EU9 A;  4AY5 A;  4E85 A;  1XNF A;  3EU5 A;  2ILR A;  2WXH A;  2KZT B;  4GYW A;  1FT2 A;  4I1M A;  5ENT D;  3TWX A;  4G8L A;  1LTX A;  4N5C A;  1O1R A;  3QDN A;  3SO8 A;  2J4D A;  4K0R A;  2PQN A;  3PH0 C;  4UI9 J;  1FVH A;  3EHN A;  3PZD A;  3Q47 B;  1N52 A;  4NUR A;  4FJY A;  2VSY A;  3PUK A;  3ASD A;  4G1T A;  4ATG A;  3PRE A;  3CVL A;  4EZJ A;  4ILG A;  1KT1 A;  4HB5 A;  5FIN A;  1MJ0 A;  1K3Z D;  1BD8 A;  3FUI A;  2WXR A;  1Z5S C;  4KMO A;  1WAO 1;  4J8E A;  3MGB A;  4O1O A;  5G05 J;  5LP0 A;  2WMO A;  4B8A A;  2RKK A;  4APO A;  2ION A;  3I3N A;  4N5Q A;  2OOE A;  3D9L A;  5A23 A;  2PL2 A;  3L17 A;  2KZT A;  3UUX A;  3MCX A;  3LCA A;  3UX4 A;  2NSZ A;  3ABK E;  4BSX A;  2M63 A;  3V2O A;  5T3R A;  3NOC D;  3PZ4 A;  3LYA A;  5FJY A;  3B95 A;  4YDO A;  3TG5 A;  3HRA A;  4N39 A;  1RZ4 A;  2OEV A;  4GZC A;  5ANR A;  4P29 A;  1A5E A;  3HXD A;  5AQ7 A;  4DX6 D;  3IBE A;  3UKU G;  4MKT A;  5KNH D;  2ETA A;  3LJ3 A;  1N4R A;  4DPR A;  3I4G A;  3CIA A;  5HRY A;  4AVX A;  1TN8 A;  4K5A B;  3CHP A;  3ZUV B;  3UM1 A;  2X6F A;  3FU0 A;  3S2A A;  2P9L G;  3T8M A;  4JHJ A;  3ZN3 A;  2XHE A;  4I2W A;  4YVO A;  3KSL A;  2RFM A;  3MV2 B;  4EBA G;  3ONK A;  2HYZ A;  5CBN A;  2VGE A;  4WNE A;  3OAW A;  4UQY A;  4GTM A;  1O1T A;  1Z3X A;  2P58 C;  5KJL A;  2V4L A;  3CKC A;  4CDM A;  4U8V D;  2WXO A;  3WXX A;  3EHM A;  5CED B;  2DBA A;  1OWM A;  4BTA A;  2OV8 A;  2WM9 A;  4HRL A;  2LAI A;  1E8W A;  1BLX B;  4F1P A;  4HVB A;  4U95 D;  1H2V C;  1ELW A;  1H2U A;  5FQ7 A;  3BU8 A;  4HOR A;  4HI9 A;  5EX0 A;  2IF4 A;  2LUH A;  5JJT A;  3N71 A;  3U3W A;  3C5R A;  3BG0 B;  3PZ3 A;  1BI7 B;  3S7D A;  4JA7 A;  2Y0B G;  1MZC A;  2H6F A;  4G23 A;  2WXG A;  3UIN C;  4L23 A;  3KD7 A;  3AJI A;  2VGX A;  3CR3 A;  2MOW A;  2EIN E;  4FA6 A;  4W9R A;  4DRX E;  5D66 A;  5AQ9 A;  4HLL A;  4A3V A;  1H0A A;  1PY1 A;  1TNZ A;  4B94 A;  5EDS A;  3RIB A;  5BV1 A;  3FU5 A;  2P2C P;  4TUU A;  4G25 A;  3TWW A;  1PC2 A;  4ANV A;  3OXG A;  1OCC E;  5J90 A;  2FO1 E;  1KZP A;  2P9I G;  3SI5 A;  2GRP B;  4OAU C;  1JUQ A;  3ASH A;  2J8S D;  2WXN A;  1IHB A;  1UOH A;  1JWF A;  2WXL A;  4I6E A;  2VTB B;  4LNG A;  1IXV A;  4NRH B;  3ZEF A;  2LNI A;  2R03 A;  2V4H C;  3ZYQ A;  3ENE A;  3CEQ A;  4ANU A;  2PZI A;  4AV7 A;  5G05 C;  4DX1 A;  2DYR E;  4KXK B;  3GZ2 A;  3L9T A;  4GCN A;  2ZGG A;  2J07 A;  3F6Q A;  1TJC A;  2YQ8 A;  4AIF A;  3VLF A;  4MRU A;  2VJ8 A;  3UT7 A;  2RD0 A;  2KCV A;  4ABN A;  5CMW A;  4LNB A;  5KJN A;  5CCL A;  1N95 A;  2XZD G;  1K1B A;  4HOU A;  3RSE G;  1U3C A;  4XI9 A;  4YDE A;  4CT4 A;  4IYP A;  2IOS A;  3LS8 A;  3EDT B;  2L0I A;  4EEC A;  3DWL G;  2ZU6 B;  3TGO A;  3FTW A;  3HDX A;  4AP2 A;  3FEY A;  3PRZ A;  1INZ A;  4XKC A;  2CG3 A;  2XCC A;  3AG3 E;  2IU1 A;  1HG5 A;  3ZHE A;  3CSF A;  4BT9 A;  5EIB E;  2DWZ A;  4FP7 A;  5ENR D;  4CDN A;  4J8S A;  5G04 J;  4GAA A;  2HR2 A;  3L82 A;  5AYW D;  3VLE A;  3IHV A;  3CVY A;  2OVB A;  1OT8 A;  4GPM A;  3Q7F A;  2A5E A;  3P2B A;  3AG4 E;  4WNG A;  5FTP A;  4MS6 A;  3D9P A;  3EHQ A;  2P9U G;  2A4Z A;  5ENP D;  5AEN A;  3G2V A;  2GRO B;  3GZ1 A;  2ETB A;  1ZU2 A;  1N4P A;  5G55 A;  4GZ5 A;  5KCM A;  3ULQ A;  1K8K G;  1JWG A;  3FWV A;  5BT1 A;  3DRA A;  3FUN A;  5CEA A;  5AQA A;  1HX8 A;  1E7U A;  4JL0 A;  2ZIR A;  2KBX A;  1TN7 A;  4M7C A;  3G2T A;  2R17 C;  3E37 A;  5D2M C;  2PNN A;  4OAV B;  4HRM B;  1HE8 A;  4B8C B;  3UXG A;  2H6I A;  4EBA A;  3T5V A;  5EKQ D;  4FHK A;  5D0O D;  2FO7 A;  3LJN A;  4F3V A;  3K9I A;  5CRV A;  4APF A;  5CER B;  3CVQ A;  4B93 B;  2E2E A;  3B7R L;  2YHE A;  3ESL A;  3ZXP A;  4I1O B;  2A5U A;  4U96 D;  3W9F A;  3ABM E;  4AEZ C;  2WXP A;  2XS1 A;  1HU3 A;  2QC9 A;  3E4B A;  4Q69 A;  3JYS A;  4EPZ A;  4BX9 A;  2KCK A;  3CHR A;  2X3M A;  4LNU D;  1IYG A;  3V30 A;  2WXK A;  5ANL A;  3PDN A;  4AM9 A;  3VTY A;  3FUF A;  2VYI A;  3RJV A;  5CHE E;  1KT0 A;  2UY1 B;  1ZBP A;  4NIK A;  1NZN A;  4BY6 A;  3RRN B;  5D0Q D;  1TNU A;  2BTD A;  2IFU A;  2H6G A;  3NAW A;  4YDY A;  2PM7 A;  2CHW A;  5FQ8 A;  3QC1 A;  3IKO B;  3UT8 A;  3R9A B;  3CKB A;  3QKY A;  1HXI A;  1MX6 A;  5CEC B;  5FZQ A;  2AW6 A;  3KS2 A;  2ZIS A;  3FH5 A;  5AIJ A;  3S7B A;  4DK5 A;  2FF4 A;  5KJK A;  3QJZ A;  2QZA A;  1OWP A;  1E96 B;  4N3C A;  3UPV A;  2MRI A;  3D9N A;  4U0Z A;  3ASF A;  1TNY A;  1Z3Y A;  2IQC A;  3SZ7 A;  1H19 A;  2B0O E;  3SGH A;  5BV0 A;  2J4B A;  4TUM A;  4TXP A;  1SA5 A;  5FZS A;  4ME2 A;  1OWO A;  1OCZ E;  3HXB A;  1DNP A;  1UJJ A;  3FU6 A;  5LCW J;  3RKV A;  1JCQ A;  3MKQ B;  2AJA A;  4Q96 A;  4WND A;  4N2Q A;  3ZKJ A;  1X5B A;  3J5P A;  4GPK A;  1Q2Z A;  3LY7 A;  5BW8 C;  1HZ4 A;  3ASG A;  5AJD A;  5AJL A;  2XGO A;  3NF1 A;  4M3O A;  3ASN E;  1LF8 A;  3HXE A;  3SBS A;  4LER A;  1NA0 A;  1HH8 A;  3PEV B;  3QWV A;  2GRN B;  2WXF A;  1S70 B;  4YDW A;  4EZL A;  2XS8 A;  2ZXW E;  5FIO A;  3HVE A;  2KM4 A;  3L08 A;  4CGW A;  3JCK C;  1Z6T A;  1S63 A;  2V5Q C;  1HG2 A;  5C1D A;  3PEU B;  3MJW A;  1EDU A;  1QBQ A;  4O60 A;  5DIZ A;  4LSZ E;  4HI8 A;  3TG4 A;  2F0Y A;  2LXL A;  4JXT A;  2WB2 A;  3QOU A;  1OCR E;  2LXM A;  3B13 A;  5FT9 A;  3RO3 A;  4WAF A;  3AS8 A;  3FUM A;  1D9S A;  1PAQ A;  4TXQ A;  5T4Y A;  5ENS D;  4J0U A;  2V8S E;  5HI7 A;  4U04 A;  3BUA A;  5KNG A;  3LPZ A;  5H7P A;  4CZ2 D;  1YYH A;  4RLY A;  3UM0 A;  4JEU A;  3APC A;  4HBD A;  4GZ3 A;  3NZS A;  2XPY A;  4DLO A;  2OEW A;  4DX5 D;  3T9K A;  3S7J A;  3DSU A;  3G2S A;  3D9I A;  3D9J A;  2JLB A;  4I2Z A;  3Q9U C;  3QAR A;  1OCO E;  3Q9N C;  3T5X A;  4ANX A;  4CT0 A;  3ML9 A;  4JHK A;  2OND A;  1MQS A;  5JHB A;  4L1B A;  1BU9 A;  3GW4 A;  3CHO A;  1E8X A;  1OY3 D;  3DPD A;  2P9S G;  3D9K A;  4HNA D;  2XQ0 A;  2OCC E;  1MYO A;  4BET A;  2OVF A;  2DZO A;  2P9K G;  3E34 A;  4ANW A;  1NL4 A;  3ZVV A;  4GTQ A;  3I4R B;  1E8Z A;  3FFL A;  3URZ A;  1UN8 A;  4UUC A;  2P9N G;  4G2V A;  4E6H A;  3SY2 A;  3Q75 A;  1DVP A;  5HS0 A;  2XEH A;  3UIP C;  4EZK A;  4LCT A;  3CVW A;  2WQ7 A;  1WG0 A;  4B0Z A;  3RRM B;  4CYM D;  1WM5 A;  5LX8 A;  2C0M A;  2XZT G;  4GYY A;  5B1B E;  3LDZ A;  5AN8 A;  3PZ1 A;  4ZFH A;  2J08 A;  3MA5 A;  3FUH A;  4BWR A;  1YCS B;  2PQR A;  4AY6 A;  3AAA C;  2LSU A;  3U4T A;  4HOQ A;  3O48 A;  2GGF A;  4XZ4 A;  4OVU A;  3JUE A;  1WDY A;  4GB9 A;  4YVQ C;  2Y1L E;  3B7U X;  3AS4 A;  2WXJ A;  3FY4 A;  1H6P A;  4KZ0 A;  3NB2 A;  4X8Q A;  3U64 A;  2DYS E;  1V55 E;  1YMP A;  5ENN A;  4N3B A;  4DLQ A;  3BEE A;  3SF4 A;  3RAU A;  4GTT A;  1B89 A;  3EUV A;  3Q15 A;  3APF A;  3DSX A;  3TWU A;  2X6H A;  3FUD A;  2ZGD A;  1H6O A;  4L9P A;  3UIO C;  1N0Q A;  2GRL A;  3FHE A;  4GA1 A;  3J5Q B;  3S7F A;  1RW2 A;  4JA9 A;  2L9B A;  2LO6 A;  1QNF A;  3CHM A;  4XI0 A;  3R9M A;  1OWN A;  4Y6W A;  2I9C A;  3FH7 A;  4PDX A;  4NQ0 A;  2I6H A;  3MKQ A;  3V2X A;  1W3B A;  1SA4 A;  3PE3 A;  4GML A;  5HKP A;  1Y8M A;  3OTN A;  3CK8 A;  3CVU A;  4URK A;  5FQ4 A;  4HRN A;  2KCL A;  2QFC A;  2NYJ A;  2AXU A;  3TWT A;  3VLD A;  4J6I A;  5ENO D;  2CFZ A;  1EF1 C;  1DCQ A;  5KBA A;  3JUI A;  3U66 A;  2QY7 A;  3PE4 A;  4I9C A;  4N2S A;  1BI8 B;  4RG9 A;  1N4S A;  2XRY A;  4ACK A;  2JEK A;  4PH4 B;  5JHA A;  4BER A;  3DST A;  1TN6 A;  5FWQ A;  3IHY A;  1N94 A;  2VSO E;  4UI9 C;  3MYV A;  4EQF A;  3ZGQ A;  5CMY A;  1H2T C;  4RVB A;  5KJM A;  2C0L A;  3D9O A;  4XX5 A;  3X2Q E;  2IEJ A;  3Q79 A;  3ZYK A;  4DJA A;  3KEZ A;  4O6F A;  4H7Y A;  1TJF A;  5FZR A;  1D8D A;  4OYS A;  3V79 K;  3SQV A;  2XEV A;  2XCB A;  1BPO A;  4GA2 A;  5JJ7 A;  3JQ1 A;  2JAB A;  4RSY A;  5ARF A;  2IJG X;  4H7X A;  4Z68 A;  3SBT B;  3QWP A;  3ZFW A;  3RU0 A;  3CK9 A;  2BUG A;  1U3D A;  4GTV A;  2J09 A;  4A63 B;  5EYL A;  3AG2 E;  4LEU A;  3HIZ A;  4LRZ A;  3AU5 A;  3ZW3 A;  2MHK A;  4K5B A;  1IQR A;  3ZU7 B;  3PZ2 A;  1ELR A;  5E75 A;  4KT6 B;  1MX2 A;  2R5S A;  4ATZ D;  4UWK A;  3SNX A;  1JPL A;  3CST A;  2HO1 A;  4UWH A;  4A3T A;  5J08 A;  2LAH A;  2L0T B;  4JC8 A;  2BKK B;  3C3R A;  3ML8 A;  4G8K A;  3KEA A;  3FTV A;  3D3M A;  4FC8 A;  1UJK A;  1E90 A;  2XEE A;  4DI4 A;  4BSZ B;  3FTZ A;  3UM3 A;  3NBN B;  3Q4A B;  2XGS A;  3G2W A;  3NOG D;  3RO2 A;  4NAC A;  2IO3 C;  4C0E A;  4AJW A;  4BTB A;  3ASO E;  2WXI A;  4A1G A;  4ACL A;  4UWG A;  2IY0 C;  1EYH A;  2EIJ E;  5FQ6 A;  4C9B B;  3QAQ A;  4AXH A;  4MLP A;  3BQO A;  2FUL A;  4N3A A;  4V3I A;  3QNK A;  4CEM A;  1QYM A;  4G24 A;  3ESK A;  1E7V A;  1XGW A;  4GMJ A;  4XIF A;  2P9P G;  3CVV A;  4HXI A;  1VDY A;  4JHR A;  4Y6C A;  4GZ6 A;  4GYO A; 
#chains in the Genus database with same CATH homology
 4A3V A;  1H0A A;  4FJZ A;  1PY1 A;  4XE0 A;  4B94 A;  4UI9 K;  3B13 A;  1GW6 A;  5FT9 A;  4WAF A;  3RO3 A;  5EDS A;  3RIB A;  3JQ0 A;  3MKR A;  3AS8 A;  5BV1 A;  3FUM A;  3ZHE B;  1PAQ A;  3FU5 A;  3ZYM A;  4BX8 A;  4TUU A;  4G25 A;  3CK7 A;  4YND A;  1PC2 A;  4ANV A;  5T4Y A;  3OXG A;  4JVS A;  4PS7 A;  3VTX A;  5J90 A;  2AXZ A;  4GZD A;  4J0U A;  2V8S E;  4PS3 A;  2WXQ A;  5E76 A;  5HI7 A;  2AXV A;  4U04 A;  3APD A;  3HYM B;  1NP7 A;  1UN9 A;  3SI5 A;  2Y3A A;  2YNQ A;  3L13 A;  1JUQ A;  3LPZ A;  5T8I A;  3PNT B;  4WWO A;  2BF0 X;  3ASH A;  2YIN A;  2CHX A;  3FTU A;  2WXN A;  1JWF A;  3AU4 A;  1NA3 A;  2WXL A;  4I6E A;  4JEU A;  3APC A;  2CFU A;  4GZ3 A;  2VTB B;  3G2U A;  4NRH B;  3L16 A;  2I1K A;  3ZEF A;  2CHZ A;  3NZS A;  2LNI A;  1FVF A;  2XPY A;  2AVP A;  3LXU X;  3ZYQ A;  4I43 A;  4TRQ A;  4DLO A;  3ENE A;  5BUZ A;  3S7J A;  3KAE A;  3CEQ A;  3G2S A;  4ANU A;  2PZI A;  4AV7 A;  3PS6 A;  5G05 C;  3CQC B;  3D9I A;  1ELK A;  3FDH A;  1TEZ A;  3D9J A;  4KXK B;  2JLB A;  3GZ2 A;  4I2Z A;  3I5P A;  3QAR A;  4GCN A;  2J07 A;  2XRZ A;  3IEG A;  3T5X A;  3HVE B;  4ANX A;  4CT0 A;  3MEK A;  1TJC A;  2L6J A;  3ML9 A;  2LSV A;  3L22 A;  4JHK A;  2YQ8 A;  1OUV A;  4AIF A;  4F53 A;  2OND A;  3VLF A;  5JJ6 A;  2KC7 A;  1MQS A;  4MRU A;  2V0P A;  2VJ8 A;  4B89 A;  3CHS A;  4U0U A;  3UT7 A;  3SHF A;  2RD0 A;  2KCV A;  2VSN A;  4ABN A;  5JHB A;  5CMW A;  3PVL A;  5KJN A;  3LY9 A;  4L1B A;  5CCL A;  3HHM A;  1H6K A;  3GZS A;  3GW4 A;  1OWL A;  4HOU A;  2IOL A;  3CHO A;  2Q7F A;  3FTS A;  2HM8 A;  1E8X A;  1U3C A;  3DPD A;  4XI9 A;  3P1U A;  3D9K A;  2XQ0 A;  4IRU A;  5G2N A;  5BPP A;  3LVR E;  2OVF A;  4CT4 A;  2WPV A;  4IYP A;  2IOS A;  2C2L A;  5A7D B;  3ONL A;  3ZVV A;  1UG3 A;  3LS8 A;  1IHG A;  3MV3 B;  4ANW A;  3CV0 A;  3I4R B;  1E8Z A;  3QB2 A;  3FFL A;  3URZ A;  2XPI A;  2WQH A;  2XGM A;  1UN8 A;  2VTB A;  4G2V A;  2GW1 A;  3FUK A;  4E6H A;  2WMN A;  4GCO A;  3EDT B;  2R59 A;  3TAX A;  2L0I A;  2WQ6 A;  3SFZ A;  4GA0 A;  4FHJ A;  4EEC A;  3FU3 A;  2ZU6 B;  2Y4U A;  1HF8 A;  3FTW A;  3TGO A;  3HDX A;  1DVP A;  1QQE A;  3Q49 B;  4UWF A;  4AP2 A;  3FEY A;  2RG8 A;  3PRZ A;  4FLH A;  4XKB A;  1INZ A;  4EZK A;  3ZXS A;  3O4Z A;  2I2O A;  4XKC A;  2CG3 A;  4LCT A;  2XCC A;  1MHQ A;  4L2Y A;  3CVW A;  1SZA A;  2WQ7 A;  4B0Z A;  3RRM B;  2IU1 A;  1WM5 A;  1HG5 A;  3ZHE A;  5LX8 A;  3LY8 A;  3CSF A;  4BT9 A;  3OXL A;  3FUE A;  4FP7 A;  2C0M A;  3QWW A;  3B7S A;  3FH8 A;  4GYY A;  4A55 A;  4CDN A;  5LCW C;  3CVP A;  3LDZ A;  4J8S A;  4WUY A;  4UQX A;  4IUL A;  2CG2 A;  5G04 J;  2YHC A;  5HQ8 A;  3Q5M A;  4AOF A;  3DBS A;  4GAA A;  3ZRH A;  2HR2 A;  2J08 A;  3MA5 A;  5AYW D;  3FUH A;  3VLE A;  4HLE A;  5A6C A;  3IHV A;  4BWR A;  1SZ9 A;  2J49 A;  3CVY A;  2OVB A;  3C98 A;  2PQR A;  4I17 A;  4AY6 A;  3P2B A;  2LSU A;  3U4T A;  2NC9 A;  4I1A A;  4HOQ A;  3O48 A;  4WNG A;  2GGF A;  5FTP A;  4I6J A;  4XZ4 A;  5EX3 A;  4OVU A;  4MS6 A;  3D9P A;  3FTY A;  3ZPJ A;  4GB9 A;  2VGX B;  4YVQ C;  2A4Z A;  3MX3 A;  3B7U X;  3AS4 A;  4LUN U;  5AEN A;  2WXJ A;  3FY4 A;  4U07 A;  3BG1 B;  1HFA A;  3G2V A;  4L7T A;  2XPZ A;  4ILI A;  4I6G A;  3GZ1 A;  4KZ0 A;  1HS6 A;  3U64 A;  2GRM A;  3R7Q A;  4KVM A;  1ZU2 A;  2E0I A;  4K03 A;  5ENN A;  3EIJ A;  3LKU A;  3LVQ E;  4GZ5 A;  5G55 A;  5KCM A;  4KBQ A;  4ILH B;  3ULQ A;  3QK0 A;  1KLX A;  4N3B A;  1P5Q A;  3BEE A;  4OVV A;  3SF4 A;  4DLQ A;  2VGY A;  1JWG A;  3SD5 A;  3FWV A;  4F7A A;  5BT1 A;  2Y4T A;  3L6A A;  1B89 A;  1QZ2 A;  2WXM A;  4AY5 A;  3FUN A;  1HX8 A;  1E7U A;  2UWJ G;  4E85 A;  1XNF A;  4JL0 A;  3Q15 A;  3APF A;  3G2T A;  2R17 C;  2ILR A;  2WXH A;  1S0P A;  2KZT B;  2X6H A;  3FUD A;  4GYW A;  2FI7 A;  3FUL A;  2UY1 A;  3U66 A;  2GRL A;  4I1M A;  3FHE A;  3PNL B;  4GA1 A;  3S7F A;  2EQX A;  4N5C A;  4L2L A;  1HE8 A;  4JA9 A;  3FTX A;  3FUJ A;  4B8C B;  2L9B A;  3QDN A;  3CQG B;  2LO6 A;  2J4D A;  4CGV A;  1QNF A;  3TXN A;  4K0R A;  3CHM A;  4XI0 A;  4EBA A;  3ZYL A;  5EKQ D;  3T5V A;  2PQN A;  1OWN A;  3PH0 C;  4FHK A;  4Q94 A;  4UI9 J;  5D0O D;  4Y6W A;  4UQZ A;  1FVH A;  2FO7 A;  2I9C A;  3EHN A;  3FH7 A;  3PZD A;  3Q47 B;  4F3V A;  1N52 A;  4NUR A;  3K9I A;  4KYO B;  4NQ0 A;  4FJY A;  4PDX A;  2I6H A;  4APF A;  3MKQ A;  3CVQ A;  2VSY A;  3PUK A;  4PUC A;  1W3B A;  2E2E A;  3ASD A;  4G1T A;  4JPS A;  3B7R L;  4ATG A;  3PE3 A;  4GML A;  2YHE A;  3FEX A;  3CVL A;  3ESL A;  3PRE A;  5M72 A;  4WNF A;  1Y6I A;  4I1O B;  4EZJ A;  4C0M A;  1Y8M A;  2A5U A;  5DBK A;  4ILG A;  1KT1 A;  3OTN A;  3CK8 A;  3CVU A;  2DIW A;  4AEZ C;  4URK A;  2WXP A;  1HU3 A;  2PM6 A;  5FQ4 A;  3E4B A;  3D9M A;  3FUI A;  2WXR A;  3NZU A;  4QFV A;  4Q69 A;  3JYS A;  4KMO A;  1WAO 1;  2X6J A;  4IN3 B;  3MGB A;  4J8E A;  4EPZ A;  5G05 J;  2KCL A;  4DI3 A;  5LP0 A;  2QFC A;  2WMO A;  4A1S A;  4BX9 A;  4B8A A;  2KCK A;  2AXU A;  2VQ2 A;  3CHR A;  3VLD A;  2X3M A;  4RG6 A;  4J6I A;  4CDR A;  2CFZ A;  1IYG A;  1EF1 C;  5CCM A;  3AS5 A;  2WXK A;  3PUJ A;  3JUI A;  4U0S A;  2QY7 A;  2X6K A;  3PDN A;  3PE4 A;  4I9C A;  4FUL A;  5ANL A;  3R7R A;  3CLJ A;  3MZL B;  5C2Y A;  3UT4 A;  3VTY A;  4R7L A;  4RG9 A;  4AM9 A;  4N2S A;  3FUF A;  2VYI A;  3RJV A;  2XRY A;  5CHE E;  4APO A;  2ION A;  3I3N A;  1KT0 A;  2OOE A;  3D9L A;  3TL5 A;  4HOT A;  3CHQ A;  2UY1 B;  4ACK A;  2JEK A;  4PH4 B;  1ZBP A;  5A23 A;  5JHA A;  2PL2 A;  3L17 A;  2KZT A;  3UUX A;  3MCX A;  3LCA A;  3UX4 A;  3CGH A;  1NZN A;  4FLB A;  2NSZ A;  5FWQ A;  3RK6 A;  4BY6 A;  3RRN B;  3IHY A;  4BFR A;  4UI9 C;  2VSO E;  4BSX A;  2M63 A;  5D0Q D;  5T3R A;  3MYV A;  4D10 C;  3LYA A;  5FJY A;  3CVX A;  4EQF A;  3ZGQ A;  4WWN A;  2BTD A;  5CMY A;  2IFU A;  1H2T C;  4RVB A;  3TG5 A;  5KJM A;  4WWP A;  2PM7 A;  4N39 A;  4HS2 A;  4JEH A;  2C0L A;  4CCA A;  2CHW A;  4JW1 A;  3IV0 A;  3D9O A;  4XX5 A;  3QC1 A;  3GYZ A;  5FQ8 A;  3RRU A;  4GZC A;  3IKO B;  4P29 A;  5ANR A;  3TJP A;  3ZYK A;  3UT8 A;  5BNW A;  2V5F A;  4DJA A;  3R9A B;  3TXM A;  3CKB A;  3KEZ A;  4O6F A;  3NQP A;  4H7Y A;  1TJF A;  3QKY A;  5FZR A;  3IBE A;  1HXI A;  4OYS A;  2NXP A;  2XEV A;  4MKT A;  3ZIM A;  2XCB A;  5FZQ A;  2AW6 A;  1BPO A;  3KS2 A;  4GA2 A;  5JJ7 A;  2KAT A;  3FH5 A;  3LJ3 A;  4DPR A;  3JQ1 A;  3I4G A;  3CVN A;  3CIA A;  3S7B A;  5AIJ A;  4DK5 A;  2I1J A;  1L5J A;  3EIQ C;  4RSY A;  5G04 C;  4AVX A;  3LEW A;  2FF4 A;  5ARF A;  5KJK A;  2X6I A;  2IJG X;  1SQM A;  3QJZ A;  1OWP A;  3CHP A;  1E96 B;  4N3C A;  3UPV A;  2MRI A;  3D9N A;  4U0Z A;  3ASF A;  2X6F A;  1Z3Y A;  2IQC A;  3FU0 A;  4H7X A;  1WY6 A;  1H19 A;  3SZ7 A;  3SBT B;  3QWP A;  3SGH A;  2J9Q A;  3ZFW A;  3RU0 A;  3S2A A;  5BV0 A;  2J4B A;  3CK9 A;  2BUG A;  1U3D A;  2J09 A;  5LOZ A;  5FZS A;  4ME2 A;  1OWO A;  4HFG A;  4LEU A;  3T8M A;  4JHJ A;  3HIZ A;  3UMV A;  4LRZ A;  3ZN3 A;  4GU5 A;  4JZY A;  1DNP A;  1UJJ A;  2XHE A;  3FU6 A;  1EPU A;  3AU5 A;  4FU3 A;  5LCW J;  3RKV A;  3ZW3 A;  4I2W A;  2MHK A;  1IQR A;  3MKQ B;  4Q96 A;  4YVO A;  4WND A;  4N2Q A;  3MV2 B;  1X5B A;  4EBA G;  1UW4 B;  3ONK A;  2HYZ A;  4UWL A;  1ELR A;  2FEZ A;  4WNE A;  3OAW A;  5E75 A;  4KT6 B;  2R5S A;  4UWK A;  4UQY A;  4GPK A;  1Z3X A;  2P58 C;  3EJN A;  5KJL A;  2V4L A;  3CKC A;  3SNX A;  4CDM A;  1JPL A;  3CST A;  3LY7 A;  5BW8 C;  1HZ4 A;  3ASG A;  5AJD A;  5AJL A;  2WXO A;  2XGO A;  2HO1 A;  4UWH A;  3NF1 A;  4M3O A;  1IQU A;  3WXX A;  3EHM A;  4A3T A;  1LF8 A;  5J08 A;  3SBS A;  2LAH A;  2DBA A;  1YA0 A;  2L0T B;  1A17 A;  2WVI A;  4G26 A;  4JC8 A;  5LFA A;  1OWM A;  3L54 A;  1NA0 A;  1HO8 A;  4LER A;  2OV8 A;  4BTA A;  2WM9 A;  2LAI A;  1E8W A;  1N54 A;  5ARG A;  3ML8 A;  4TV3 A;  4KVO A;  1HH8 A;  3PEV B;  3QWV A;  3FTV A;  3D3M A;  4FC8 A;  1UJK A;  2WXF A;  1E90 A;  4DI4 A;  4HVB A;  1H2V C;  3FTZ A;  1E8Y A;  1FCH A;  4EZL A;  4FAD A;  3Q4A B;  2XGS A;  3G2W A;  4J8D A;  3RO2 A;  4F1S A;  1ELW A;  1H2U A;  3OXF A;  5FQ7 A;  3HVE A;  2AWI A;  2FBN A;  4NAC A;  2KM4 A;  4HOR A;  3L08 A;  2X38 A;  5EX0 A;  3U9W A;  4C0E A;  4AJW A;  2IF4 A;  4BTB A;  5JJT A;  3N71 A;  3U3W A;  4CGW A;  3JCK C;  1Z6T A;  3BG0 B;  1HG2 A;  3S7D A;  4U8H A;  2WXI A;  3UQ3 A;  5C1D A;  4JA7 A;  4PS8 A;  4A1G A;  2VSX E;  3PEU B;  4ACL A;  4UWG A;  4G23 A;  4I9E A;  3MJW A;  4J8F A;  2WXG A;  4BT8 A;  4L23 A;  1EYH A;  4HOS A;  4KZC A;  3KD7 A;  5FQ6 A;  4C9B B;  3QAQ A;  1EDU A;  2VGX A;  4AXH A;  4MLP A;  4V3I A;  2FUL A;  4N3A A;  5DIZ A;  3QNK A;  3CR3 A;  4CEM A;  2DCP A;  4G24 A;  3ESK A;  2MOW A;  3TG4 A;  1E7V A;  1XGW A;  3FP3 A;  4GMJ A;  4CRW A;  4XIF A;  4JXT A;  2WB2 A;  4G11 A;  4FA6 A;  4U63 A;  3QOU A;  3CVV A;  4W9R A;  4HXI A;  1VDY A;  3B7T A;  4JHR A;  4Y6C A;  4GZ6 A;  4GYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...