3RRMB

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
295
structure length
295
Chain Sequence
TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 118
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rrmB00
3RRNB 3PEVB 3RRMB 3PEUB
chains in the Genus database with same CATH superfamily
2IQCA 4DX7D 1N54A 5IY5E 4YVQC 4G24A 2E2EA 4ATZD 3IHVA 5AAOA 4B0ZA 4XKBA 1DCEA 4FADA 2RD0A 2MHKA 4XE0A 3VTXA 5LCWJ 4IRUA 4L2LA 2R5SA 3IKOB 2J9QA 2Q7FA 3FU3A 3NZUA 5ENNA 2OOEA 2YINA 2IY0C 5EILA 2M63A 1TJFA 3HXEA 3Q78A 1H2UA 3E33A 2V4LA 3B95A 2WXMA 4G8LA 4E6HA 2XGOA 4EPZA 3ZUVB 3IBEA 3W9GA 3L17A 1UN8A 2J8SD 3QK0A 1E8YA 2JLBA 2VSNA 2X6KA 1PY1A 1MX6A 2P9SG 3AG1E 3B7SA 3FTZA 4GMRA 2DCPA 1SA5A 3G2SA 4KVMA 3OTNA 3DSTA 3Q75A 3CSFA 3J5PA 4WWNA 4JEUA 3JQ0A 5JJTA 1PC2A 4C0MA 3CHRA 2ETAA 4LERA 4I2WA 4Q96A 3T5VA 4HFGA 3V2XA 2VTBB 1K1BA 3S7DA 3T8KA 4YNDA 2WXOA 5C2YA 1BPOA 4YDWA 3T8MA 5M72A 5FWQA 4F1SA 5ENQD 3PH0C 3FTSA 1EPUA 4I1MA 2ZIRA 2IEJA 2P9LG 4UQZA 4ACLA 3D9OA 3V30A 3ZHEA 2V4HC 3L13A 1SQMA 1ELWA 1U3CA 5EX0A 2QYUA 4HLLA 1FCHA 3BG1B 3LCAA 5FQ4A 3JCKC 2V5QC 4JXTA 5AN8A 2AXVA 5KJKA 3TJPA 1N4SA 4I1OB 2F37A 3E34A 3T9KA 3U9WA 1OY3D 5AJDA 4JB8P 2VGEA 3UM0A 4I1AA 3MYVA 3D9KA 2AW6A 3G2WA 1K3ZD 5BXOA 3GW4A 3U4TA 2ONDA 4U95D 4GTOA 4NURA 4J8EA 1QYMA 4BSXA 2AWIA 3ZRHA 2A4ZA 2F8YA 1QNFA 2KM4A 2BKGA 4C48B 4GAAA 3UM3A 4GB9A 5BPPA 5BUZA 4U04A 4GMLA 4ANUA 4BX9A 4HNAD 4L1BA 3CIAA 3CVNA 4FHJA 4ABNA 3HXFA 2I9CA 3WG7E 3TWSA 3ZPJA 4BX8A 4H7XA 3BQOA 3UINC 1DVPA 2XRYA 5G55A 4J8YA 2H6GA 4A1SA 2ZISA 3OXFA 2CG3A 5JJ6A 2GRRB 2OVFA 2Y69E 2QC9A 2ZXWE 3QWPA 3UQ3A 2FO7A 1OUVA 1TNOA 4XEIG 3ZNGA 2KCLA 1OWMA 3CHOA 2J49A 5D2MC 3AG2E 5G04J 1S0PA 3FU5A 1TNUA 3FUJA 3UIPC 4LCTA 1E90A 3SFZA 4B89A 3ZYLA 3T5XA 1KT0A 4I43A 3ULYA 3OXLA 3PNLB 5BV0A 1RZ4A 2L9BA 2VGYA 3L6AA 4A1GA 5LX8A 3L16A 4L7TA 3RK6A 5JHBA 3KSLA 1WY6A 3FH7A 2VGXB 4HI9A 4HRNA 2YNQA 4URKA 3TWUA 4RLYA 1ZBPA 1B89A 3PUJA 2KXPC 4U8YD 3DXKG 1HH8A 4A3TA 2VTBA 2WQ7A 4JHJA 4AEZC 3MEKA 1TEZA 3NZSA 2I1JA 1AP7A 2PNNA 4U0UA 1P5QA 5HI7A 3R7RA 4ACKA 1E7UA 1N9AA 2BTDA 4RVBA 4APOA 1UW4B 4ANVA 3PNTB 3SBSA 2GROB 4G23A 4J8FA 3ML9A 4B93B 3TAXA 3FTVA 4CDRA 3PEVB 2KATA 3RRMB 1EDUA 1KLXA 3MZLB 3CVXA 3CK8A 4LNBA 1OWPA 2DVWA 2RFAA 3KAEA 3S7JA 2XCBA 5BW8C 5EX3A 3NB2A 4P29A 3SZ7A 1JWGA 1S64A 2EILE 4WNDA 3FFLA 3C3RA 1NZNA 3ISMC 5B1AE 5CMWA 4G1TA 3NOGD 4FA6A 4HRMB 3MCXA 2Y4TA 3C98A 3MA5A 1EF1C 2P9NG 3CVUA 1SZ9A 3ZFWA 1INZA 2YQ8A 2IFUA 3JYSA 3CVPA 4JC8A 3I5PA 2IONA 1JCSA 2CHWA 1N11A 1MQSA 4R7LA 2FBNA 3DSXA 1GW6A 2WVIA 1QBQA 4DI4A 4IN3B 5LCWC 3G2UA 5KJMA 4NACA 1IXVA 4GZ3A 1HXIA 4FJYA 5AQAA 5ANLA 3JXJA 2NC9A 5KNGA 5AQ9A 2X6JA 3MX3A 3S7FA 2NYJA 1N0RA 2HO1A 3RO2A 3DWLG 3SGHA 3E4BA 3O4ZA 4GZ5A 4ME2A 2H6FA 4AY6A 3PEUB 3FDHA 4N39A 2QY7A 1VDYA 3UM1A 4UWHA 2GRPB 3IXEA 2R2LA 4TUUA 5G05J 3FUKA 3CVLA 5AARA 4LG6A 4MRUA 4UUCA 2FO1E 3EIQC 3NOCD 4YDYA 2EQXA 3JXIA 3ZW3A 2VGXA 3HIZA 4GA0A 4UI9J 3TWQA 2C0MA 5J08A 1MZCA 3C5RA 4GTMA 1PAQA 5ITZF 4DX1A 1ZB1A 4JEHA 3CQCB 1HE8A 3IEGA 4AY5A 2QFCA 5AYWD 3K9IA 5FQ8A 4YDEA 2MRIA 3ASOE 5BXUA 3TWVA 4N3BA 3ZKJA 4F6RD 1WG0A 4ANXA 4KYOB 1NA0A 4M7CA 1OWLA 3JUIA 3TGOA 3TWTA 4U7EB 5D0QD 3FWVA 3SY2A 1KT1A 3SFXA 4LNGA 1IQRA 1V55E 2WXGA 5ENTD 4EQFA 4G26A 4L2YA 5DIZA 4OVUA 3PZ4A 4O1PA 1NP7A 1E8WA 4L9PA 4J8SA 3Q15A 1A5EA 2ZGDA 4BERA 4AM9A 2FF4A 1Z3XA 4GPKA 4PS3A 2BUGA 1MX2A 3AAAC 2AXUA 5HKPA 2PM7A 4KBQA 3I4RB 3TWRA 2EIJE 5BT1A 3UPVA 3UKUG 5A6CA 4E85A 2KCKA 4M3OA 2AJAA 4CGVA 3CK9A 5FIOA 1FPPA 3LVRE 4WWPA 4I9EA 5KNHD 3UT8A 3KSQA 5G2NA 4BETA 3APFA 5CEAA 2WB2A 3ZU7B 3FTXA 3EDTB 3LY8A 5JHAA 4MS6A 4WWOA 3OXGA 4HRLA 3CQGB 2R17C 1DNPA 4QFVA 3TWXA 4JD2G 4UQXA 4GZCA 4FJZA 2MOWA 3HG0D 1ELKA 2LXMA 1HU3A 4N5QA 2DYRE 1A17A 3FHEA 4AV7A 5KJLA 3FTWA 3PRZA 5JMND 4HB5A 2V0PA 1QZ2A 1Y8MA 2LUHA 2OVBA 1OCRE 1JCRA 2P58C 4I6GA 4NQ0A 4DI3A 1H6PA 2B6CA 4EZKA 2E0IA 3FUIA 5G04C 2WMOA 4DK5A 3CHPA 2MYOA 3X2QE 4ZHBA 3SHFA 3DSUA 3ASNE 3CV0A 3LJNA 4GMJA 3RSEG 2IO2C 4AVXA 4KMOA 2XRZA 4JW1A 2PM6A 1FVHA 1HS6A 1KZPA 3PS6A 4PS8A 4DUIA 3GZ1A 1UN9A 4XX5A 4JHRA 1OCZE 3ASHA 3J5QB 2V8SE 2EIME 4OVVA 4GYOA 4CEMA 4GYYA 2VJ8A 3KD7A 2XPZA 3FH8A 4KZCA 4IYPA 3AS4A 3VLFA 2XEEA 2OEWA 2L6JA 3DEOA 4RQIA 1OXJA 3L82A 3PVLA 4GTTA 2CFZA 3UTMA 3LEWA 4DX6D 4K03A 2QZAA 4L23A 2R03A 2X6FA 1O5MA 3EUVA 3D9MA 1XGWA 2XPYA 3V2OA 3CKCA 3FEXA 5KJNA 1WDYA 5HS0A 3CR3A 5FINA 4O6FA 2GRMA 1IHGA 5CRUA 3MKRA 2WQHA 2R05A 2CG2A 2LNIA 3ONKA 2C0LA 2WXPA 3SQVA 3DEPA 5BV1A 3MV3B 2J09A 3ZEFA 4I9CA 3R7QA 2DZOA 1E8ZA 3URZA 5FZQA 2NXPA 3V79K 1JCQA 3HXCA 5EYPF 4LNUD 1H6OA 3DSVA 4CRWA 2GW1A 3ZVVA 5ENPD 4KVOA 2PZIA 4CT4A 3CK7A 5AQ7A 4GA1A 1TYQG 3VLDA 3QJZA 4EHMA 3ESKA 5BNWA 2PQNA 3E32A 4O1OA 4GYWA 1QQEA 4KT6B 4MLPA 5DBKA 2OCCE 5H7PA 4I17A 2JABA 3NQPA 3LJ3A 1W3BA 3TG4A 3LXUX 3TG5A 1H2TC 1UJJA 2GRQB 2P9UG 2YHEA 4A3VA 4GTPA 4F3VA 3DSWA 4EZLA 4C0EA 3AG4E 3LDZA 4CDNA 4RG9A 5FTPA 5EDSA 1ZU2A 1D8EA 1N4PA 2WMNA 1O1RA 2IU1A 5ENSD 3SI5A 1Y6IA 4OAUC 2AXZA 1Q2ZA 4GCNA 4OAVB 3EU5A 3DRAA 2XS1A 3C3QA 4G8KA 1SVXA 4Q69A 5ARFA 3Q7FA 1UJKA 2ILRA 3SO8A 4DJAA 1HZ4A 4FULA 4HORA 3Q7AA 1L5JA 2DIWA 3AS5A 3TWWA 4GTSA 3RO3A 3D9NA 3DXMG 2J4DA 3W9FA 1KZOA 2B0OE 3CVWA 2VYIA 5G05C 5EIDA 4N3AA 2H6IA 1HFAA 4GA2A 1AWCB 4Y6CA 4HOTA 1TNYA 2IOLA 3Q9UC 4CDMA 1O1TA 3AJIA 4K0RA 1JUQA 5KBAA 5EIBE 3CVVA 3V31A 1LD8A 1XNFA 4UI9C 4DLQA 2VSOE 3ENEA 3Q47B 3PZ2A 4HOUA 2XS8A 1BLXB 1DCQA 1OCCE 3MJWA 4MKTA 4BTBA 3GZSA 4EBAG 1KPSB 2FULA 5C1DA 4N3CA 2XEVA 3DPYA 3FY4A 4CT0A 3B7RL 1IYGA 4ILIA 3ULQA 4ATGA 1YCSB 2A5EA 2J4BA 3JUEA 2DWZA 3FEYA 4UWLA 5CMYA 1WAO1 2XCCA 3MV2B 3RU0A 3RKVA 3PZ3A 1E8XA 4CYMD 3APCA 3UXGA 5B3SE 2X6IA 3B13A 5CCLA 2IF4A 3MKQB 4APFA 4EECA 3HVEB 3QC1A 3Q9NC 2ZGGA 5JA4D 5EKQD 3CSTA 2KZTB 5B1BE 4BFRA 2EIKE 3Q4AB 1TN7A 4F7AA 3EHQA 1D8DA 2WXFA 4HQDA 4XI0A 4BT9A 1OCOE 3D9JA 5A7DB 4FLBA 3BU8A 1BI8B 3CHSA 1JPLA 2GGFA 2WXQA 4J0UA 2XPIA 2IOSA 3KEAA 3LPZA 3EIJA 4UQYA 3CHQA 1U3DA 5EYLA 4AP2A 3G2VA 4BTAA 1EYHA 4AIFA 2WXHA 4GPMA 3ABLE 3D9LA 1SA4A 1X81A 3HXDA 1FVFA 3U64A 1RW2A 4DPRA 3UMVA 3ABKE 2KBXA 3ESLA 2LAHA 3EHRA 4TXPA 5CEDB 3FUDA 3LS8A 4G25A 4K5BA 1HG2A 1IKND 3ZGQA 4GTQA 3DPDA 4J8DA 3U3WA 2YHCA 4I6JA 4K5CA 3WXXA 2Y4UA 4B8AA 3R9MA 1OWNA 5T8IA 4GTVA 4MBGA 4CGWA 4X8QA 2J08A 1N0QA 4GU5A 4I6EA 3HXBA 2DBAA 4AJWA 3TL5A 2VSYA 3CGHA 3ONLA 4ILHB 5AENA 1E7VA 5J90A 4W9RA 5CERB 5HRYA 3O48A 4XI9A 1K8KG 4WNEA 2BKKB 4U96D 3ZIMA 4H7YA 2VQ2A 4JL0A 5D0OD 3UUXA 4F1PA 4FP7A 3LYAA 5CCMA 1HF8A 4HI8A 4HS2A 2H6HA 3QB2A 3SF4A 3SD5A 4UWGA 1NFIE 3ULEG 2KCVA 2LAIA 3P2BA 2FEZA 3AG3E 4PS7A 4JHKA 5FJYA 4BESA 2WXLA 4CZ2D 4BY6A 2LXLA 4U07A 1K1AA 2XZDG 4UI9K 2CHXA 4B8CB 3P1UA 4JA9A 5AIJA 4AXHA 4TV3A 2WQ6A 3VTYA 3SFYA 2R59A 3EJNA 2UWJG 4U0SA 5T3RA 3AU5A 1HX8A 4HVBA 4D10C 3QAQA 1NA3A 1SW6A 3F6QA 2JEKA 1TN8A 4ZFHA 4RSYA 4WNGA 5CECB 4XKCA 3L9TA 5LP0A 4G2VA 1WM5A 1DC2A 3MKQA 4JVSA 3HVEA 3CVYA 2CFUA 2LSUA 1YMPA 2QYJA 3QWWA 3BEEA 1N52A 2AVPA 2KZTA 4G11A 5E76A 3FP3A 3ASFA 1U2VG 1YYHA 2L0IA 4IULA 4TXQA 3UI2A 4HLEA 1FT2A 4PUCA 2WM9A 3LKUA 1G3NB 4YVOA 4BT8A 2P9KG 1N94A 4WUYA 1SZAA 3ML8A 1HO8A 3Q5MA 4HBDA 2L6BA 1OWOA 2X6HA 2F0YA 2XEHA 3E30A 1BU9A 1MJ0A 1N95A 4JPSA 4ANWA 4BSZB 2ETBA 1Z5SC 3QARA 5ANRA 2J07A 2WXRA 4N5CA 4ILGA 3S7BA 2A5UA 3BG0B 3QDNA 3L54A 3UM2A 2F8XK 3PE4A 2C2LA 2BF0X 3CEQA 4LUNU 4DX5D 2P9PG 2P2CP 2DZNA 2HM8A 3MGBA 4FU3A 3D3MA 4HOSA 4U0ZA 5CHEE 3D9HA 4CCAA 2PL2A 2NSZA 1OT8A 1H6KA 5T4YA 4UWFA 3S2AA 5JJ7A 2HE0A 3ASGA 2R02A 3ZXPA 2I1KA 3ZYKA 3UX4A 4JA7A 2WPVA 1TNZA 3TXMA 4B94A 2RFMA 1IHBA 2XHEA 3G2TA 4GCOA 3FUHA 4WNFA 2OV8A 3FU6A 5LOZA 3RJVA 2DYSE 4GZ6A 3QOUA 2LSVA 4U63A 1BD8A 4DX2A 1TJCA 2WXNA 3R9AB 2XZTG 3SNXA 4FLHA 3FTUA 3GYZA 1UOHA 3Q49B 4NRHB 5CBNA 3HYMB 3PDNA 2IJGX 1H19A 2IO3C 3Q73A 4LEUA 3DBSA 5FT9A 3RAUA 3EHMA 3C72A 3B7UX 2Y0BG 4F53A 3EU9A 2L0TB 3RRUA 4A55A 2Y1LE 5CBOA 2ZU6B 4PH4B 4UWKA 4JZYA 2XGSA 4FC8A 3ASDA 1LF8A 1HG5A 4QQIA 3FUEA 3FUMA 1Z3YA 4K5AB 4I2ZA 2UY1B 1S70B 4Y6WA 4BEPA 5ARGA 5E75A 1LTXA 4DLOA 2XGMA 1Z6TA 3ZXSA 4TUMA 3CHMA 1E96B 3IHYA 2RKKA 3NAWA 5FZRA 3PZDA 5FQ7A 3PUKA 3FUFA 5ENOD 1BI7B 2WXKA 2VSXE 3D9IA 3KEZA 2WXIA 3I4GA 4Q94A 4DRXE 3QWVA 2BEDA 1IQUA 3FH5A 2X3MA 3ZYQA 3OAWA 4WAFA 2ETCA 4GTRA 1N4QA 4LRZA 3FTYA 3RIBA 4J6IA 1MYOA 2WXJA 3L22A 2EINE 4FHKA 2LO6A 4U8HA 3L08A 4U8VD 4AOFA 3I3NA 3B7BA 3AS8A 2HR2A 2PQRA 3LY9A 2X38A 4GZDA 1UG3A 3UKRG 3EHNA 3UT7A 4YDOA 4HOQA 2GRNB 2OEVA 5KCMA 3FU0A 4C9BB 2V5FA 3ABME 1ELRA 3DSSA 4NIKA 3HDXA 3CLJA 3GZ2A 4J7WA 1X5BA 1YA0A 5D66A 3ZYMA 3B7TA 4N2QA 3PZ1A 2GRLA 5CRVA 3QNKA 1H0AA 3CVQA 3NF1A 3HHMA 4RG6A 3UT4A 2XQ0A 4BWRA 4OYSA 3ZHEB 2CHZA 5FQ6A 3NBNB 4KXKB 5EN5D 3Q79A 2FI7A 2RG8A 2KC7A 1NI1A 3APDA 4XIFA 1LD7A 3FUNA 3AU4A 3SBTB 1MX4A 3KS2A 1V54E 4TRQA 5HQ8A 3CKBA 1TNBA 2I6HA 4KZ0A 3C3OA 3D9PA 3N71A 3PREA 1D9SA 4XZ4A 1TN6A 3FULA 5LFAA 3U66A 4EBAA 5KWDA 5ENRD 4A63B 3VLEA 4LSZE 5AJLA 4O60A 3LVQE 3TXNA 2P9IG 3RRNB 3PE3A 3JQ1A 5AQBA 2I2OA 1MHQA 1JWFA 4N2SA 3E37A 2Y3AA 1TR4A 1H2VC 1S63A 1N4RA 4TXRA 4PDXA 2UY1A 3LY7A 3IV0A 4EZJA 4V3IA 1O1SA 4Z68A 3QKYA 5FZSA 2XENA 3ZN3A 1FT1A 2HYZA 1NL4A 4HXIA 5A23A 3BUAA 3HRAA 3UIOC
chains in the Genus database with same CATH topology
4CDNA 4RG9A 2IQCA 5FTPA 2CHWA 5EDSA 1N54A 4BT8A 1ZU2A 4YVQC 4G24A 2E2EA 1MQSA 2WMNA 3IHVA 4R7LA 4B0ZA 2FBNA 1SZAA 2IU1A 3ML8A 4WUYA 4XKBA 1HO8A 3Q5MA 1GW6A 4FADA 2RD0A 1OWOA 2X6HA 2WVIA 2MHKA 4XE0A 3VTXA 5LCWJ 4IRUA 3SI5A 4IN3B 1Y6IA 4DI4A 5LCWC 4L2LA 2AXZA 3G2UA 2R5SA 3IKOB 5KJMA 4JPSA 4ANWA 4GCNA 4NACA 2J9QA 3QARA 4GZ3A 1HXIA 2Q7FA 4FJYA 3FU3A 3NZUA 5ANRA 5ENNA 2J07A 2OOEA 2YINA 5ANLA 2NC9A 2WXRA 2M63A 4Q69A 4N5CA 5ARFA 4ILGA 3S7BA 2A5UA 1TJFA 1UJKA 3BG0B 2ILRA 2X6JA 1H2UA 3QDNA 3MX3A 2V4LA 3L54A 4DJAA 3S7FA 2WXMA 1HZ4A 2HO1A 4FULA 3RO2A 4E6HA 3SGHA 2XGOA 4HORA 4EPZA 3E4BA 3O4ZA 4GZ5A 4ME2A 1L5JA 3PE4A 3IBEA 2C2LA 4AY6A 2BF0X 3CEQA 2DIWA 3AS5A 3L17A 1UN8A 3RO3A 3D9NA 4LUNU 3PEUB 3FDHA 4N39A 2HM8A 2J4DA 2QY7A 3QK0A 1E8YA 1VDYA 2JLBA 2VSNA 3MGBA 4FU3A 3D3MA 2X6KA 4HOSA 4UWHA 4U0ZA 1PY1A 3CVWA 5CHEE 3B7SA 4TUUA 5G05J 3FTZA 2VYIA 2DCPA 5G05C 3FUKA 4CCAA 2PL2A 3CVLA 3G2SA 2NSZA 4N3AA 4KVMA 1HFAA 3OTNA 4GA2A 4MRUA 4Y6CA 4HOTA 1H6KA 3CSFA 4WWNA 4JEUA 5T4YA 4UWFA 2IOLA 3EIQC 3JQ0A 5JJTA 3S2AA 4CDMA 5JJ7A 4K0RA 1JUQA 1PC2A 4C0MA 3ASGA 3CHRA 2EQXA 2I1KA 4LERA 3ZW3A 3CVVA 2VGXA 3HIZA 3ZYKA 3UX4A 4JA7A 4I2WA 2WPVA 4GA0A 4Q96A 4UI9J 1XNFA 2C0MA 3T5VA 5J08A 4HFGA 2VTBB 4UI9C 3TXMA 4B94A 4DLQA 2VSOE 3S7DA 3ENEA 3Q47B 2XHEA 3G2TA 4YNDA 2WXOA 5C2YA 4GCOA 1BPOA 3FUHA 1PAQA 4WNFA 3T8MA 4HOUA 5M72A 5FWQA 4JEHA 3MJWA 4F1SA 2OV8A 3CQCB 1EPUA 3FTSA 3PH0C 1HE8A 3IEGA 4I1MA 3FU6A 4AY5A 5LOZA 4MKTA 4BTBA 3GZSA 3RJVA 2QFCA 5AYWD 4UQZA 3K9IA 4GZ6A 4ACLA 4EBAG 5FQ8A 2MRIA 2FULA 5C1DA 3QOUA 4N3CA 3D9OA 2LSVA 2XEVA 4N3BA 4U63A 3FY4A 3ZHEA 4ANXA 3L13A 1SQMA 4CT0A 4KYOB 1TJCA 2WXNA 1NA0A 1ELWA 3B7RL 3R9AB 1IYGA 1U3CA 5EX0A 1OWLA 3SNXA 4ILIA 3JUIA 1FCHA 3BG1B 4FLHA 3TGOA 3FTUA 3ULQA 5D0QD 3LCAA 4ATGA 3GYZA 3JCKC 5FQ4A 3FWVA 3Q49B 1KT1A 4JXTA 4NRHB 3HYMB 2J4BA 3PDNA 1IQRA 2AXVA 1H19A 2IJGX 5KJKA 3TJPA 4I1OB 4LEUA 2WXGA 3FEYA 4UWLA 3DBSA 4EQFA 4G26A 4L2YA 5FT9A 5CMYA 5DIZA 1WAO1 3U9WA 5AJDA 3EHMA 2XCCA 4OVUA 4I1AA 3MYVA 3D9KA 3MV2B 2AW6A 3RU0A 3RKVA 3B7UX 1NP7A 1E8WA 3G2WA 1E8XA 4F53A 3APCA 4J8SA 2X6IA 3Q15A 3B13A 2L0TB 2FF4A 3RRUA 4AM9A 1Z3XA 4A55A 5CCLA 4GPKA 4PS3A 2IF4A 2BUGA 2ZU6B 3MKQB 4APFA 3GW4A 4PH4B 4EECA 3HVEB 2AXUA 3U4TA 2ONDA 4UWKA 3QC1A 2PM7A 4JZYA 2XGSA 4NURA 4FC8A 4KBQA 3ASDA 1LF8A 3I4RB 5EKQD 1HG5A 4J8EA 5BT1A 3UPVA 4BSXA 5A6CA 2AWIA 3CSTA 3ZRHA 4E85A 2KZTB 2KCKA 4M3OA 4BFRA 2A4ZA 3CK9A 4CGVA 3Q4AB 1QNFA 3FUEA 2KM4A 4F7AA 3FUMA 4GAAA 1Z3YA 4I2ZA 3LVRE 4WWPA 4I9EA 2UY1B 3UT8A 4GB9A 2WXFA 4Y6WA 4XI0A 5BPPA 5BUZA 5G2NA 4BT9A 3APFA 3D9JA 4U04A 4GMLA 2WB2A 4ANUA 5A7DB 5ARGA 5E75A 4BX9A 3FTXA 4FLBA 4L1BA 3EDTB 3CHSA 3CIAA 1JPLA 3LY8A 2GGFA 4DLOA 5JHAA 2XGMA 3CVNA 4FHJA 4ABNA 1Z6TA 2WXQA 4J0UA 4MS6A 2XPIA 2IOSA 4WWOA 3ZXSA 2I9CA 3OXGA 3CHMA 3LPZA 1E96B 3IHYA 3CQGB 3ZPJA 2R17C 1DNPA 3EIJA 4QFVA 4BX8A 4UQXA 4H7XA 3CHQA 1U3DA 4UQYA 4GZCA 4FJZA 2MOWA 4AP2A 3G2VA 1DVPA 1ELKA 4BTAA 2XRYA 1EYHA 1HU3A 5G55A 4AIFA 2WXHA 1A17A 3FHEA 4AV7A 3D9LA 5KJLA 3FTWA 5FZRA 4A1SA 3PRZA 3OXFA 2CG3A 5JJ6A 2V0PA 1FVFA 1QZ2A 1Y8MA 2OVFA 3U64A 3PZDA 5FQ7A 2OVBA 4DPRA 3QWPA 3PUKA 3FUFA 3UQ3A 3UMVA 2P58C 2WXKA 2FO7A 4I6GA 2VSXE 4NQ0A 3D9IA 3ESLA 2LAHA 1OUVA 3KEZA 2WXIA 3I4GA 4Q94A 3QWVA 4DI3A 2KCLA 1OWMA 1IQUA 4EZKA 3CHOA 3FH5A 2X3MA 3FUDA 3LS8A 4G25A 3ZYQA 3OAWA 1HG2A 2J49A 4WAFA 3ZGQA 3DPDA 2E0IA 4J8DA 2YHCA 4I6JA 5G04J 1S0PA 3FUIA 3U3WA 3WXXA 5G04C 2WMOA 3FU5A 2Y4UA 3FTYA 4LRZA 3RIBA 4DK5A 4J6IA 2WXJA 3CHPA 4B8AA 1OWNA 3FUJA 5T8IA 3SHFA 3L22A 4LCTA 1E90A 3CV0A 3SFZA 4GMJA 4FHKA 4AVXA 4B89A 4KMOA 2LO6A 3ZYLA 2XRZA 4JW1A 3L08A 4U8HA 3T5XA 4CGWA 4AOFA 3I3NA 2PM6A 3AS8A 1FVHA 1HS6A 1KT0A 2HR2A 2J08A 2PQRA 4I43A 3PS6A 4GU5A 4PS8A 4I6EA 3LY9A 2DBAA 2X38A 3OXLA 4GZDA 4AJWA 3PNLB 1UG3A 3GZ1A 3TL5A 1UN9A 4XX5A 5BV0A 2VSYA 3EHNA 4JHRA 3CGHA 2L9BA 3UT7A 3ONLA 4HOQA 3ASHA 4ILHB 2VGYA 5AENA 3L6AA 1E7VA 2V8SE 5J90A 4W9RA 4A1GA 5LX8A 3L16A 5KCMA 4L7TA 3FU0A 3RK6A 4OVVA 4C9BB 4GYOA 5JHBA 4CEMA 3O48A 1WY6A 2V5FA 3FH7A 4XI9A 2VGXB 1ELRA 4GYYA 2VJ8A 3KD7A 2XPZA 3FH8A 4KZCA 4WNEA 2YNQA 3AS4A 4IYPA 3VLFA 4URKA 3HDXA 3CLJA 3ZIMA 2L6JA 4H7YA 2VQ2A 1ZBPA 1B89A 3GZ2A 3PVLA 1X5BA 1YA0A 3PUJA 3ZYMA 2CFZA 4JL0A 3B7TA 4N2QA 3LEWA 5D0OD 3UUXA 4FP7A 3LYAA 4K03A 1HH8A 2GRLA 4L23A 4A3TA 2WQ7A 2X6FA 2VTBA 3D9MA 1H0AA 3QNKA 4JHJA 3CVQA 1XGWA 3NF1A 2XPYA 5CCMA 4AEZC 3HHMA 4RG6A 3UT4A 3MEKA 1TEZA 3CKCA 3NZSA 3FEXA 1HF8A 2I1JA 5KJNA 2XQ0A 4BWRA 4HS2A 4OYSA 3CR3A 3ZHEB 2CHZA 3QB2A 3SF4A 3SD5A 4U0UA 1P5QA 5HI7A 3R7RA 4ACKA 4UWGA 5FQ6A 4O6FA 2GRMA 1IHGA 1E7UA 4KXKB 3MKRA 2KCVA 2LAIA 2WQHA 3P2BA 2BTDA 2FEZA 4RVBA 4APOA 1UW4B 2FI7A 2RG8A 4PS7A 4ANVA 2KC7A 3PNTB 4JHKA 3APDA 3SBSA 4XIFA 3FUNA 4G23A 4J8FA 5FJYA 3ML9A 2CG2A 2WXLA 4BY6A 3AU4A 3SBTB 4U07A 3KS2A 3TAXA 4UI9K 2CHXA 4B8CB 3FTVA 3P1UA 4JA9A 5AIJA 2LNIA 4CDRA 3ONKA 4TRQA 4AXHA 2C0LA 4TV3A 3PEVB 2KATA 3RRMB 3CKBA 1EDUA 1KLXA 2WXPA 3MZLB 5HQ8A 2WQ6A 3CK8A 5BV1A 3MV3B 3CVXA 3VTYA 2J09A 2R59A 2I6HA 1OWPA 3ZEFA 4I9CA 3R7QA 1E8ZA 4KZ0A 3KAEA 3D9PA 3S7JA 3URZA 3N71A 5FZQA 2NXPA 3EJNA 2XCBA 5BW8C 5EX3A 3PREA 2UWJG 4U0SA 4XZ4A 5T3RA 3FULA 3AU5A 4CRWA 2GW1A 3ZVVA 1HX8A 4HVBA 5LFAA 4D10C 3QAQA 4KVOA 3U66A 1NA3A 2PZIA 4P29A 2JEKA 4CT4A 3CK7A 3SZ7A 4EBAA 4GA1A 1JWGA 4RSYA 4WNGA 4XKCA 3QJZA 3VLDA 3ESKA 4WNDA 5BNWA 2PQNA 4G2VA 3FFLA 3VLEA 5AJLA 5LP0A 1NZNA 1WM5A 3MKQA 4GYWA 3LVQE 4JVSA 5CMWA 3HVEA 3TXNA 1QQEA 4KT6B 3CVYA 2CFUA 4MLPA 3RRNB 4G1TA 2LSUA 3PE3A 3JQ1A 5DBKA 3QWWA 3BEEA 2I2OA 1N52A 1MHQA 4FA6A 1JWFA 4N2SA 2AVPA 2KZTA 2Y3AA 4G11A 4I17A 1H2VC 3MCXA 3NQPA 3LJ3A 2Y4TA 3C98A 1W3BA 4PDXA 5E76A 3MA5A 1EF1C 3LXUX 3TG5A 3TG4A 3FP3A 1H2TC 2UY1A 3CVUA 3ASFA 3LY7A 1SZ9A 3IV0A 4EZJA 4V3IA 2L0IA 4IULA 3ZFWA 3QKYA 1UJJA 1INZA 2YHEA 2YQ8A 4A3VA 2IFUA 3JYSA 3CVPA 5FZSA 4HLEA 4PUCA 4F3VA 3ZN3A 2HYZA 4EZLA 4HXIA 5A23A 2WM9A 4C0EA 4JC8A 3LKUA 3I5PA 2IONA 4YVOA 3LDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRN B;  3PEV B;  3RRM B;  3PEU B; 
#chains in the Genus database with same CATH topology
 2IQC A;  4DX7 D;  1N54 A;  5IY5 E;  4YVQ C;  4G24 A;  2E2E A;  4ATZ D;  3IHV A;  5AAO A;  4B0Z A;  4XKB A;  1DCE A;  4FAD A;  2RD0 A;  2MHK A;  4XE0 A;  3VTX A;  5LCW J;  4IRU A;  4L2L A;  2R5S A;  3IKO B;  2J9Q A;  2Q7F A;  3FU3 A;  3NZU A;  5ENN A;  2OOE A;  2YIN A;  2IY0 C;  5EIL A;  2M63 A;  1TJF A;  3HXE A;  3Q78 A;  1H2U A;  3E33 A;  2V4L A;  3B95 A;  2WXM A;  4G8L A;  4E6H A;  2XGO A;  4EPZ A;  3ZUV B;  3IBE A;  3W9G A;  3L17 A;  1UN8 A;  2J8S D;  3QK0 A;  1E8Y A;  2JLB A;  2VSN A;  2X6K A;  1PY1 A;  1MX6 A;  2P9S G;  3AG1 E;  3B7S A;  3FTZ A;  4GMR A;  2DCP A;  1SA5 A;  3G2S A;  4KVM A;  3OTN A;  3DST A;  3Q75 A;  3CSF A;  3J5P A;  4WWN A;  4JEU A;  3JQ0 A;  5JJT A;  1PC2 A;  4C0M A;  3CHR A;  2ETA A;  4LER A;  4I2W A;  4Q96 A;  3T5V A;  4HFG A;  3V2X A;  2VTB B;  1K1B A;  3S7D A;  3T8K A;  4YND A;  2WXO A;  5C2Y A;  1BPO A;  4YDW A;  3T8M A;  5M72 A;  5FWQ A;  4F1S A;  5ENQ D;  3PH0 C;  3FTS A;  1EPU A;  4I1M A;  2ZIR A;  2IEJ A;  2P9L G;  4UQZ A;  4ACL A;  3D9O A;  3V30 A;  3ZHE A;  2V4H C;  3L13 A;  1SQM A;  1ELW A;  1U3C A;  5EX0 A;  2QYU A;  4HLL A;  1FCH A;  3BG1 B;  3LCA A;  5FQ4 A;  3JCK C;  2V5Q C;  4JXT A;  5AN8 A;  2AXV A;  5KJK A;  3TJP A;  1N4S A;  4I1O B;  2F37 A;  3E34 A;  3T9K A;  3U9W A;  1OY3 D;  5AJD A;  4JB8 P;  2VGE A;  3UM0 A;  4I1A A;  3MYV A;  3D9K A;  2AW6 A;  3G2W A;  1K3Z D;  5BXO A;  3GW4 A;  3U4T A;  2OND A;  4U95 D;  4GTO A;  4NUR A;  4J8E A;  1QYM A;  4BSX A;  2AWI A;  3ZRH A;  2A4Z A;  2F8Y A;  1QNF A;  2KM4 A;  2BKG A;  4C48 B;  4GAA A;  3UM3 A;  4GB9 A;  5BPP A;  5BUZ A;  4U04 A;  4GML A;  4ANU A;  4BX9 A;  4HNA D;  4L1B A;  3CIA A;  3CVN A;  4FHJ A;  4ABN A;  3HXF A;  2I9C A;  3WG7 E;  3TWS A;  3ZPJ A;  4BX8 A;  4H7X A;  3BQO A;  3UIN C;  1DVP A;  2XRY A;  5G55 A;  4J8Y A;  2H6G A;  4A1S A;  2ZIS A;  3OXF A;  2CG3 A;  5JJ6 A;  2GRR B;  2OVF A;  2Y69 E;  2QC9 A;  2ZXW E;  3QWP A;  3UQ3 A;  2FO7 A;  1OUV A;  1TNO A;  4XEI G;  3ZNG A;  2KCL A;  1OWM A;  3CHO A;  2J49 A;  5D2M C;  3AG2 E;  5G04 J;  1S0P A;  3FU5 A;  1TNU A;  3FUJ A;  3UIP C;  4LCT A;  1E90 A;  3SFZ A;  4B89 A;  3ZYL A;  3T5X A;  1KT0 A;  4I43 A;  3ULY A;  3OXL A;  3PNL B;  5BV0 A;  1RZ4 A;  2L9B A;  2VGY A;  3L6A A;  4A1G A;  5LX8 A;  3L16 A;  4L7T A;  3RK6 A;  5JHB A;  3KSL A;  1WY6 A;  3FH7 A;  2VGX B;  4HI9 A;  4HRN A;  2YNQ A;  4URK A;  3TWU A;  4RLY A;  1ZBP A;  1B89 A;  3PUJ A;  2KXP C;  4U8Y D;  3DXK G;  1HH8 A;  4A3T A;  2VTB A;  2WQ7 A;  4JHJ A;  4AEZ C;  3MEK A;  1TEZ A;  3NZS A;  2I1J A;  1AP7 A;  2PNN A;  4U0U A;  1P5Q A;  5HI7 A;  3R7R A;  4ACK A;  1E7U A;  1N9A A;  2BTD A;  4RVB A;  4APO A;  1UW4 B;  4ANV A;  3PNT B;  3SBS A;  2GRO B;  4G23 A;  4J8F A;  3ML9 A;  4B93 B;  3TAX A;  3FTV A;  4CDR A;  3PEV B;  2KAT A;  3RRM B;  1EDU A;  1KLX A;  3MZL B;  3CVX A;  3CK8 A;  4LNB A;  1OWP A;  2DVW A;  2RFA A;  3KAE A;  3S7J A;  2XCB A;  5BW8 C;  5EX3 A;  3NB2 A;  4P29 A;  3SZ7 A;  1JWG A;  1S64 A;  2EIL E;  4WND A;  3FFL A;  3C3R A;  1NZN A;  3ISM C;  5B1A E;  5CMW A;  4G1T A;  3NOG D;  4FA6 A;  4HRM B;  3MCX A;  2Y4T A;  3C98 A;  3MA5 A;  1EF1 C;  2P9N G;  3CVU A;  1SZ9 A;  3ZFW A;  1INZ A;  2YQ8 A;  2IFU A;  3JYS A;  3CVP A;  4JC8 A;  3I5P A;  2ION A;  1JCS A;  2CHW A;  1N11 A;  1MQS A;  4R7L A;  2FBN A;  3DSX A;  1GW6 A;  2WVI A;  1QBQ A;  4DI4 A;  4IN3 B;  5LCW C;  3G2U A;  5KJM A;  4NAC A;  1IXV A;  4GZ3 A;  1HXI A;  4FJY A;  5AQA A;  5ANL A;  3JXJ A;  2NC9 A;  5KNG A;  5AQ9 A;  2X6J A;  3MX3 A;  3S7F A;  2NYJ A;  1N0R A;  2HO1 A;  3RO2 A;  3DWL G;  3SGH A;  3E4B A;  3O4Z A;  4GZ5 A;  4ME2 A;  2H6F A;  4AY6 A;  3PEU B;  3FDH A;  4N39 A;  2QY7 A;  1VDY A;  3UM1 A;  4UWH A;  2GRP B;  3IXE A;  2R2L A;  4TUU A;  5G05 J;  3FUK A;  3CVL A;  5AAR A;  4LG6 A;  4MRU A;  4UUC A;  2FO1 E;  3EIQ C;  3NOC D;  4YDY A;  2EQX A;  3JXI A;  3ZW3 A;  2VGX A;  3HIZ A;  4GA0 A;  4UI9 J;  3TWQ A;  2C0M A;  5J08 A;  1MZC A;  3C5R A;  4GTM A;  1PAQ A;  5ITZ F;  4DX1 A;  1ZB1 A;  4JEH A;  3CQC B;  1HE8 A;  3IEG A;  4AY5 A;  2QFC A;  5AYW D;  3K9I A;  5FQ8 A;  4YDE A;  2MRI A;  3ASO E;  5BXU A;  3TWV A;  4N3B A;  3ZKJ A;  4F6R D;  1WG0 A;  4ANX A;  4KYO B;  1NA0 A;  4M7C A;  1OWL A;  3JUI A;  3TGO A;  3TWT A;  4U7E B;  5D0Q D;  3FWV A;  3SY2 A;  1KT1 A;  3SFX A;  4LNG A;  1IQR A;  1V55 E;  2WXG A;  5ENT D;  4EQF A;  4G26 A;  4L2Y A;  5DIZ A;  4OVU A;  3PZ4 A;  4O1P A;  1NP7 A;  1E8W A;  4L9P A;  4J8S A;  3Q15 A;  1A5E A;  2ZGD A;  4BER A;  4AM9 A;  2FF4 A;  1Z3X A;  4GPK A;  4PS3 A;  2BUG A;  1MX2 A;  3AAA C;  2AXU A;  5HKP A;  2PM7 A;  4KBQ A;  3I4R B;  3TWR A;  2EIJ E;  5BT1 A;  3UPV A;  3UKU G;  5A6C A;  4E85 A;  2KCK A;  4M3O A;  2AJA A;  4CGV A;  3CK9 A;  5FIO A;  1FPP A;  3LVR E;  4WWP A;  4I9E A;  5KNH D;  3UT8 A;  3KSQ A;  5G2N A;  4BET A;  3APF A;  5CEA A;  2WB2 A;  3ZU7 B;  3FTX A;  3EDT B;  3LY8 A;  5JHA A;  4MS6 A;  4WWO A;  3OXG A;  4HRL A;  3CQG B;  2R17 C;  1DNP A;  4QFV A;  3TWX A;  4JD2 G;  4UQX A;  4GZC A;  4FJZ A;  2MOW A;  3HG0 D;  1ELK A;  2LXM A;  1HU3 A;  4N5Q A;  2DYR E;  1A17 A;  3FHE A;  4AV7 A;  5KJL A;  3FTW A;  3PRZ A;  5JMN D;  4HB5 A;  2V0P A;  1QZ2 A;  1Y8M A;  2LUH A;  2OVB A;  1OCR E;  1JCR A;  2P58 C;  4I6G A;  4NQ0 A;  4DI3 A;  1H6P A;  2B6C A;  4EZK A;  2E0I A;  3FUI A;  5G04 C;  2WMO A;  4DK5 A;  3CHP A;  2MYO A;  3X2Q E;  4ZHB A;  3SHF A;  3DSU A;  3ASN E;  3CV0 A;  3LJN A;  4GMJ A;  3RSE G;  2IO2 C;  4AVX A;  4KMO A;  2XRZ A;  4JW1 A;  2PM6 A;  1FVH A;  1HS6 A;  1KZP A;  3PS6 A;  4PS8 A;  4DUI A;  3GZ1 A;  1UN9 A;  4XX5 A;  4JHR A;  1OCZ E;  3ASH A;  3J5Q B;  2V8S E;  2EIM E;  4OVV A;  4GYO A;  4CEM A;  4GYY A;  2VJ8 A;  3KD7 A;  2XPZ A;  3FH8 A;  4KZC A;  4IYP A;  3AS4 A;  3VLF A;  2XEE A;  2OEW A;  2L6J A;  3DEO A;  4RQI A;  1OXJ A;  3L82 A;  3PVL A;  4GTT A;  2CFZ A;  3UTM A;  3LEW A;  4DX6 D;  4K03 A;  2QZA A;  4L23 A;  2R03 A;  2X6F A;  1O5M A;  3EUV A;  3D9M A;  1XGW A;  2XPY A;  3V2O A;  3CKC A;  3FEX A;  5KJN A;  1WDY A;  5HS0 A;  3CR3 A;  5FIN A;  4O6F A;  2GRM A;  1IHG A;  5CRU A;  3MKR A;  2WQH A;  2R05 A;  2CG2 A;  2LNI A;  3ONK A;  2C0L A;  2WXP A;  3SQV A;  3DEP A;  5BV1 A;  3MV3 B;  2J09 A;  3ZEF A;  4I9C A;  3R7Q A;  2DZO A;  1E8Z A;  3URZ A;  5FZQ A;  2NXP A;  3V79 K;  1JCQ A;  3HXC A;  5EYP F;  4LNU D;  1H6O A;  3DSV A;  4CRW A;  2GW1 A;  3ZVV A;  5ENP D;  4KVO A;  2PZI A;  4CT4 A;  3CK7 A;  5AQ7 A;  4GA1 A;  1TYQ G;  3VLD A;  3QJZ A;  4EHM A;  3ESK A;  5BNW A;  2PQN A;  3E32 A;  4O1O A;  4GYW A;  1QQE A;  4KT6 B;  4MLP A;  5DBK A;  2OCC E;  5H7P A;  4I17 A;  2JAB A;  3NQP A;  3LJ3 A;  1W3B A;  3TG4 A;  3LXU X;  3TG5 A;  1H2T C;  1UJJ A;  2GRQ B;  2P9U G;  2YHE A;  4A3V A;  4GTP A;  4F3V A;  3DSW A;  4EZL A;  4C0E A;  3AG4 E;  3LDZ A;  4CDN A;  4RG9 A;  5FTP A;  5EDS A;  1ZU2 A;  1D8E A;  1N4P A;  2WMN A;  1O1R A;  2IU1 A;  5ENS D;  3SI5 A;  1Y6I A;  4OAU C;  2AXZ A;  1Q2Z A;  4GCN A;  4OAV B;  3EU5 A;  3DRA A;  2XS1 A;  3C3Q A;  4G8K A;  1SVX A;  4Q69 A;  5ARF A;  3Q7F A;  1UJK A;  2ILR A;  3SO8 A;  4DJA A;  1HZ4 A;  4FUL A;  4HOR A;  3Q7A A;  1L5J A;  2DIW A;  3AS5 A;  3TWW A;  4GTS A;  3RO3 A;  3D9N A;  3DXM G;  2J4D A;  3W9F A;  1KZO A;  2B0O E;  3CVW A;  2VYI A;  5G05 C;  5EID A;  4N3A A;  2H6I A;  1HFA A;  4GA2 A;  1AWC B;  4Y6C A;  4HOT A;  1TNY A;  2IOL A;  3Q9U C;  4CDM A;  1O1T A;  3AJI A;  4K0R A;  1JUQ A;  5KBA A;  5EIB E;  3CVV A;  3V31 A;  1LD8 A;  1XNF A;  4UI9 C;  4DLQ A;  2VSO E;  3ENE A;  3Q47 B;  3PZ2 A;  4HOU A;  2XS8 A;  1BLX B;  1DCQ A;  1OCC E;  3MJW A;  4MKT A;  4BTB A;  3GZS A;  4EBA G;  1KPS B;  2FUL A;  5C1D A;  4N3C A;  2XEV A;  3DPY A;  3FY4 A;  4CT0 A;  3B7R L;  1IYG A;  4ILI A;  3ULQ A;  4ATG A;  1YCS B;  2A5E A;  2J4B A;  3JUE A;  2DWZ A;  3FEY A;  4UWL A;  5CMY A;  1WAO 1;  2XCC A;  3MV2 B;  3RU0 A;  3RKV A;  3PZ3 A;  1E8X A;  4CYM D;  3APC A;  3UXG A;  5B3S E;  2X6I A;  3B13 A;  5CCL A;  2IF4 A;  3MKQ B;  4APF A;  4EEC A;  3HVE B;  3QC1 A;  3Q9N C;  2ZGG A;  5JA4 D;  5EKQ D;  3CST A;  2KZT B;  5B1B E;  4BFR A;  2EIK E;  3Q4A B;  1TN7 A;  4F7A A;  3EHQ A;  1D8D A;  2WXF A;  4HQD A;  4XI0 A;  4BT9 A;  1OCO E;  3D9J A;  5A7D B;  4FLB A;  3BU8 A;  1BI8 B;  3CHS A;  1JPL A;  2GGF A;  2WXQ A;  4J0U A;  2XPI A;  2IOS A;  3KEA A;  3LPZ A;  3EIJ A;  4UQY A;  3CHQ A;  1U3D A;  5EYL A;  4AP2 A;  3G2V A;  4BTA A;  1EYH A;  4AIF A;  2WXH A;  4GPM A;  3ABL E;  3D9L A;  1SA4 A;  1X81 A;  3HXD A;  1FVF A;  3U64 A;  1RW2 A;  4DPR A;  3UMV A;  3ABK E;  2KBX A;  3ESL A;  2LAH A;  3EHR A;  4TXP A;  5CED B;  3FUD A;  3LS8 A;  4G25 A;  4K5B A;  1HG2 A;  1IKN D;  3ZGQ A;  4GTQ A;  3DPD A;  4J8D A;  3U3W A;  2YHC A;  4I6J A;  4K5C A;  3WXX A;  2Y4U A;  4B8A A;  3R9M A;  1OWN A;  5T8I A;  4GTV A;  4MBG A;  4CGW A;  4X8Q A;  2J08 A;  1N0Q A;  4GU5 A;  4I6E A;  3HXB A;  2DBA A;  4AJW A;  3TL5 A;  2VSY A;  3CGH A;  3ONL A;  4ILH B;  5AEN A;  1E7V A;  5J90 A;  4W9R A;  5CER B;  5HRY A;  3O48 A;  4XI9 A;  1K8K G;  4WNE A;  2BKK B;  4U96 D;  3ZIM A;  4H7Y A;  2VQ2 A;  4JL0 A;  5D0O D;  3UUX A;  4F1P A;  4FP7 A;  3LYA A;  5CCM A;  1HF8 A;  4HI8 A;  4HS2 A;  2H6H A;  3QB2 A;  3SF4 A;  3SD5 A;  4UWG A;  1NFI E;  3ULE G;  2KCV A;  2LAI A;  3P2B A;  2FEZ A;  3AG3 E;  4PS7 A;  4JHK A;  5FJY A;  4BES A;  2WXL A;  4CZ2 D;  4BY6 A;  2LXL A;  4U07 A;  1K1A A;  2XZD G;  4UI9 K;  2CHX A;  4B8C B;  3P1U A;  4JA9 A;  5AIJ A;  4AXH A;  4TV3 A;  2WQ6 A;  3VTY A;  3SFY A;  2R59 A;  3EJN A;  2UWJ G;  4U0S A;  5T3R A;  3AU5 A;  1HX8 A;  4HVB A;  4D10 C;  3QAQ A;  1NA3 A;  1SW6 A;  3F6Q A;  2JEK A;  1TN8 A;  4ZFH A;  4RSY A;  4WNG A;  5CEC B;  4XKC A;  3L9T A;  5LP0 A;  4G2V A;  1WM5 A;  1DC2 A;  3MKQ A;  4JVS A;  3HVE A;  3CVY A;  2CFU A;  2LSU A;  1YMP A;  2QYJ A;  3QWW A;  3BEE A;  1N52 A;  2AVP A;  2KZT A;  4G11 A;  5E76 A;  3FP3 A;  3ASF A;  1U2V G;  1YYH A;  2L0I A;  4IUL A;  4TXQ A;  3UI2 A;  4HLE A;  1FT2 A;  4PUC A;  2WM9 A;  3LKU A;  1G3N B;  4YVO A;  4BT8 A;  2P9K G;  1N94 A;  4WUY A;  1SZA A;  3ML8 A;  1HO8 A;  3Q5M A;  4HBD A;  2L6B A;  1OWO A;  2X6H A;  2F0Y A;  2XEH A;  3E30 A;  1BU9 A;  1MJ0 A;  1N95 A;  4JPS A;  4ANW A;  4BSZ B;  2ETB A;  1Z5S C;  3QAR A;  5ANR A;  2J07 A;  2WXR A;  4N5C A;  4ILG A;  3S7B A;  2A5U A;  3BG0 B;  3QDN A;  3L54 A;  3UM2 A;  2F8X K;  3PE4 A;  2C2L A;  2BF0 X;  3CEQ A;  4LUN U;  4DX5 D;  2P9P G;  2P2C P;  2DZN A;  2HM8 A;  3MGB A;  4FU3 A;  3D3M A;  4HOS A;  4U0Z A;  5CHE E;  3D9H A;  4CCA A;  2PL2 A;  2NSZ A;  1OT8 A;  1H6K A;  5T4Y A;  4UWF A;  3S2A A;  5JJ7 A;  2HE0 A;  3ASG A;  2R02 A;  3ZXP A;  2I1K A;  3ZYK A;  3UX4 A;  4JA7 A;  2WPV A;  1TNZ A;  3TXM A;  4B94 A;  2RFM A;  1IHB A;  2XHE A;  3G2T A;  4GCO A;  3FUH A;  4WNF A;  2OV8 A;  3FU6 A;  5LOZ A;  3RJV A;  2DYS E;  4GZ6 A;  3QOU A;  2LSV A;  4U63 A;  1BD8 A;  4DX2 A;  1TJC A;  2WXN A;  3R9A B;  2XZT G;  3SNX A;  4FLH A;  3FTU A;  3GYZ A;  1UOH A;  3Q49 B;  4NRH B;  5CBN A;  3HYM B;  3PDN A;  2IJG X;  1H19 A;  2IO3 C;  3Q73 A;  4LEU A;  3DBS A;  5FT9 A;  3RAU A;  3EHM A;  3C72 A;  3B7U X;  2Y0B G;  4F53 A;  3EU9 A;  2L0T B;  3RRU A;  4A55 A;  2Y1L E;  5CBO A;  2ZU6 B;  4PH4 B;  4UWK A;  4JZY A;  2XGS A;  4FC8 A;  3ASD A;  1LF8 A;  1HG5 A;  4QQI A;  3FUE A;  3FUM A;  1Z3Y A;  4K5A B;  4I2Z A;  2UY1 B;  1S70 B;  4Y6W A;  4BEP A;  5ARG A;  5E75 A;  1LTX A;  4DLO A;  2XGM A;  1Z6T A;  3ZXS A;  4TUM A;  3CHM A;  1E96 B;  3IHY A;  2RKK A;  3NAW A;  5FZR A;  3PZD A;  5FQ7 A;  3PUK A;  3FUF A;  5ENO D;  1BI7 B;  2WXK A;  2VSX E;  3D9I A;  3KEZ A;  2WXI A;  3I4G A;  4Q94 A;  4DRX E;  3QWV A;  2BED A;  1IQU A;  3FH5 A;  2X3M A;  3ZYQ A;  3OAW A;  4WAF A;  2ETC A;  4GTR A;  1N4Q A;  4LRZ A;  3FTY A;  3RIB A;  4J6I A;  1MYO A;  2WXJ A;  3L22 A;  2EIN E;  4FHK A;  2LO6 A;  4U8H A;  3L08 A;  4U8V D;  4AOF A;  3I3N A;  3B7B A;  3AS8 A;  2HR2 A;  2PQR A;  3LY9 A;  2X38 A;  4GZD A;  1UG3 A;  3UKR G;  3EHN A;  3UT7 A;  4YDO A;  4HOQ A;  2GRN B;  2OEV A;  5KCM A;  3FU0 A;  4C9B B;  2V5F A;  3ABM E;  1ELR A;  3DSS A;  4NIK A;  3HDX A;  3CLJ A;  3GZ2 A;  4J7W A;  1X5B A;  1YA0 A;  5D66 A;  3ZYM A;  3B7T A;  4N2Q A;  3PZ1 A;  2GRL A;  5CRV A;  3QNK A;  1H0A A;  3CVQ A;  3NF1 A;  3HHM A;  4RG6 A;  3UT4 A;  2XQ0 A;  4BWR A;  4OYS A;  3ZHE B;  2CHZ A;  5FQ6 A;  3NBN B;  4KXK B;  5EN5 D;  3Q79 A;  2FI7 A;  2RG8 A;  2KC7 A;  1NI1 A;  3APD A;  4XIF A;  1LD7 A;  3FUN A;  3AU4 A;  3SBT B;  1MX4 A;  3KS2 A;  1V54 E;  4TRQ A;  5HQ8 A;  3CKB A;  1TNB A;  2I6H A;  4KZ0 A;  3C3O A;  3D9P A;  3N71 A;  3PRE A;  1D9S A;  4XZ4 A;  1TN6 A;  3FUL A;  5LFA A;  3U66 A;  4EBA A;  5KWD A;  5ENR D;  4A63 B;  3VLE A;  4LSZ E;  5AJL A;  4O60 A;  3LVQ E;  3TXN A;  2P9I G;  3RRN B;  3PE3 A;  3JQ1 A;  5AQB A;  2I2O A;  1MHQ A;  1JWF A;  4N2S A;  3E37 A;  2Y3A A;  1TR4 A;  1H2V C;  1S63 A;  1N4R A;  4TXR A;  4PDX A;  2UY1 A;  3LY7 A;  3IV0 A;  4EZJ A;  4V3I A;  1O1S A;  4Z68 A;  3QKY A;  5FZS A;  2XEN A;  3ZN3 A;  1FT1 A;  2HYZ A;  1NL4 A;  4HXI A;  5A23 A;  3BUA A;  3HRA A;  3UIO C; 
#chains in the Genus database with same CATH homology
 4CDN A;  4RG9 A;  2IQC A;  5FTP A;  2CHW A;  5EDS A;  1N54 A;  4BT8 A;  1ZU2 A;  4YVQ C;  4G24 A;  2E2E A;  1MQS A;  2WMN A;  3IHV A;  4R7L A;  4B0Z A;  2FBN A;  1SZA A;  2IU1 A;  3ML8 A;  4WUY A;  4XKB A;  1HO8 A;  3Q5M A;  1GW6 A;  4FAD A;  2RD0 A;  1OWO A;  2X6H A;  2WVI A;  2MHK A;  4XE0 A;  3VTX A;  5LCW J;  4IRU A;  3SI5 A;  4IN3 B;  1Y6I A;  4DI4 A;  5LCW C;  4L2L A;  2AXZ A;  3G2U A;  2R5S A;  3IKO B;  5KJM A;  4JPS A;  4ANW A;  4GCN A;  4NAC A;  2J9Q A;  3QAR A;  4GZ3 A;  1HXI A;  2Q7F A;  4FJY A;  3FU3 A;  3NZU A;  5ANR A;  5ENN A;  2J07 A;  2OOE A;  2YIN A;  5ANL A;  2NC9 A;  2WXR A;  2M63 A;  4Q69 A;  4N5C A;  5ARF A;  4ILG A;  3S7B A;  2A5U A;  1TJF A;  1UJK A;  3BG0 B;  2ILR A;  2X6J A;  1H2U A;  3QDN A;  3MX3 A;  2V4L A;  3L54 A;  4DJA A;  3S7F A;  2WXM A;  1HZ4 A;  2HO1 A;  4FUL A;  3RO2 A;  4E6H A;  3SGH A;  2XGO A;  4HOR A;  4EPZ A;  3E4B A;  3O4Z A;  4GZ5 A;  4ME2 A;  1L5J A;  3PE4 A;  3IBE A;  2C2L A;  4AY6 A;  2BF0 X;  3CEQ A;  2DIW A;  3AS5 A;  3L17 A;  1UN8 A;  3RO3 A;  3D9N A;  4LUN U;  3PEU B;  3FDH A;  4N39 A;  2HM8 A;  2J4D A;  2QY7 A;  3QK0 A;  1E8Y A;  1VDY A;  2JLB A;  2VSN A;  3MGB A;  4FU3 A;  3D3M A;  2X6K A;  4HOS A;  4UWH A;  4U0Z A;  1PY1 A;  3CVW A;  5CHE E;  3B7S A;  4TUU A;  5G05 J;  3FTZ A;  2VYI A;  2DCP A;  5G05 C;  3FUK A;  4CCA A;  2PL2 A;  3CVL A;  3G2S A;  2NSZ A;  4N3A A;  4KVM A;  1HFA A;  3OTN A;  4GA2 A;  4MRU A;  4Y6C A;  4HOT A;  1H6K A;  3CSF A;  4WWN A;  4JEU A;  5T4Y A;  4UWF A;  2IOL A;  3EIQ C;  3JQ0 A;  5JJT A;  3S2A A;  4CDM A;  5JJ7 A;  4K0R A;  1JUQ A;  1PC2 A;  4C0M A;  3ASG A;  3CHR A;  2EQX A;  2I1K A;  4LER A;  3ZW3 A;  3CVV A;  2VGX A;  3HIZ A;  3ZYK A;  3UX4 A;  4JA7 A;  4I2W A;  2WPV A;  4GA0 A;  4Q96 A;  4UI9 J;  1XNF A;  2C0M A;  3T5V A;  5J08 A;  4HFG A;  2VTB B;  4UI9 C;  3TXM A;  4B94 A;  4DLQ A;  2VSO E;  3S7D A;  3ENE A;  3Q47 B;  2XHE A;  3G2T A;  4YND A;  2WXO A;  5C2Y A;  4GCO A;  1BPO A;  3FUH A;  1PAQ A;  4WNF A;  3T8M A;  4HOU A;  5M72 A;  5FWQ A;  4JEH A;  3MJW A;  4F1S A;  2OV8 A;  3CQC B;  1EPU A;  3FTS A;  3PH0 C;  1HE8 A;  3IEG A;  4I1M A;  3FU6 A;  4AY5 A;  5LOZ A;  4MKT A;  4BTB A;  3GZS A;  3RJV A;  2QFC A;  5AYW D;  4UQZ A;  3K9I A;  4GZ6 A;  4ACL A;  4EBA G;  5FQ8 A;  2MRI A;  2FUL A;  5C1D A;  3QOU A;  4N3C A;  3D9O A;  2LSV A;  2XEV A;  4N3B A;  4U63 A;  3FY4 A;  3ZHE A;  4ANX A;  3L13 A;  1SQM A;  4CT0 A;  4KYO B;  1TJC A;  2WXN A;  1NA0 A;  1ELW A;  3B7R L;  3R9A B;  1IYG A;  1U3C A;  5EX0 A;  1OWL A;  3SNX A;  4ILI A;  3JUI A;  1FCH A;  3BG1 B;  4FLH A;  3TGO A;  3FTU A;  3ULQ A;  5D0Q D;  3LCA A;  4ATG A;  3GYZ A;  3JCK C;  5FQ4 A;  3FWV A;  3Q49 B;  1KT1 A;  4JXT A;  4NRH B;  3HYM B;  2J4B A;  3PDN A;  1IQR A;  2AXV A;  1H19 A;  2IJG X;  5KJK A;  3TJP A;  4I1O B;  4LEU A;  2WXG A;  3FEY A;  4UWL A;  3DBS A;  4EQF A;  4G26 A;  4L2Y A;  5FT9 A;  5CMY A;  5DIZ A;  1WAO 1;  3U9W A;  5AJD A;  3EHM A;  2XCC A;  4OVU A;  4I1A A;  3MYV A;  3D9K A;  3MV2 B;  2AW6 A;  3RU0 A;  3RKV A;  3B7U X;  1NP7 A;  1E8W A;  3G2W A;  1E8X A;  4F53 A;  3APC A;  4J8S A;  2X6I A;  3Q15 A;  3B13 A;  2L0T B;  2FF4 A;  3RRU A;  4AM9 A;  1Z3X A;  4A55 A;  5CCL A;  4GPK A;  4PS3 A;  2IF4 A;  2BUG A;  2ZU6 B;  3MKQ B;  4APF A;  3GW4 A;  4PH4 B;  4EEC A;  3HVE B;  2AXU A;  3U4T A;  2OND A;  4UWK A;  3QC1 A;  2PM7 A;  4JZY A;  2XGS A;  4NUR A;  4FC8 A;  4KBQ A;  3ASD A;  1LF8 A;  3I4R B;  5EKQ D;  1HG5 A;  4J8E A;  5BT1 A;  3UPV A;  4BSX A;  5A6C A;  2AWI A;  3CST A;  3ZRH A;  4E85 A;  2KZT B;  2KCK A;  4M3O A;  4BFR A;  2A4Z A;  3CK9 A;  4CGV A;  3Q4A B;  1QNF A;  3FUE A;  2KM4 A;  4F7A A;  3FUM A;  4GAA A;  1Z3Y A;  4I2Z A;  3LVR E;  4WWP A;  4I9E A;  2UY1 B;  3UT8 A;  4GB9 A;  2WXF A;  4Y6W A;  4XI0 A;  5BPP A;  5BUZ A;  5G2N A;  4BT9 A;  3APF A;  3D9J A;  4U04 A;  4GML A;  2WB2 A;  4ANU A;  5A7D B;  5ARG A;  5E75 A;  4BX9 A;  3FTX A;  4FLB A;  4L1B A;  3EDT B;  3CHS A;  3CIA A;  1JPL A;  3LY8 A;  2GGF A;  4DLO A;  5JHA A;  2XGM A;  3CVN A;  4FHJ A;  4ABN A;  1Z6T A;  2WXQ A;  4J0U A;  4MS6 A;  2XPI A;  2IOS A;  4WWO A;  3ZXS A;  2I9C A;  3OXG A;  3CHM A;  3LPZ A;  1E96 B;  3IHY A;  3CQG B;  3ZPJ A;  2R17 C;  1DNP A;  3EIJ A;  4QFV A;  4BX8 A;  4UQX A;  4H7X A;  3CHQ A;  1U3D A;  4UQY A;  4GZC A;  4FJZ A;  2MOW A;  4AP2 A;  3G2V A;  1DVP A;  1ELK A;  4BTA A;  2XRY A;  1EYH A;  1HU3 A;  5G55 A;  4AIF A;  2WXH A;  1A17 A;  3FHE A;  4AV7 A;  3D9L A;  5KJL A;  3FTW A;  5FZR A;  4A1S A;  3PRZ A;  3OXF A;  2CG3 A;  5JJ6 A;  2V0P A;  1FVF A;  1QZ2 A;  1Y8M A;  2OVF A;  3U64 A;  3PZD A;  5FQ7 A;  2OVB A;  4DPR A;  3QWP A;  3PUK A;  3FUF A;  3UQ3 A;  3UMV A;  2P58 C;  2WXK A;  2FO7 A;  4I6G A;  2VSX E;  4NQ0 A;  3D9I A;  3ESL A;  2LAH A;  1OUV A;  3KEZ A;  2WXI A;  3I4G A;  4Q94 A;  3QWV A;  4DI3 A;  2KCL A;  1OWM A;  1IQU A;  4EZK A;  3CHO A;  3FH5 A;  2X3M A;  3FUD A;  3LS8 A;  4G25 A;  3ZYQ A;  3OAW A;  1HG2 A;  2J49 A;  4WAF A;  3ZGQ A;  3DPD A;  2E0I A;  4J8D A;  2YHC A;  4I6J A;  5G04 J;  1S0P A;  3FUI A;  3U3W A;  3WXX A;  5G04 C;  2WMO A;  3FU5 A;  2Y4U A;  3FTY A;  4LRZ A;  3RIB A;  4DK5 A;  4J6I A;  2WXJ A;  3CHP A;  4B8A A;  1OWN A;  3FUJ A;  5T8I A;  3SHF A;  3L22 A;  4LCT A;  1E90 A;  3CV0 A;  3SFZ A;  4GMJ A;  4FHK A;  4AVX A;  4B89 A;  4KMO A;  2LO6 A;  3ZYL A;  2XRZ A;  4JW1 A;  3L08 A;  4U8H A;  3T5X A;  4CGW A;  4AOF A;  3I3N A;  2PM6 A;  3AS8 A;  1FVH A;  1HS6 A;  1KT0 A;  2HR2 A;  2J08 A;  2PQR A;  4I43 A;  3PS6 A;  4GU5 A;  4PS8 A;  4I6E A;  3LY9 A;  2DBA A;  2X38 A;  3OXL A;  4GZD A;  4AJW A;  3PNL B;  1UG3 A;  3GZ1 A;  3TL5 A;  1UN9 A;  4XX5 A;  5BV0 A;  2VSY A;  3EHN A;  4JHR A;  3CGH A;  2L9B A;  3UT7 A;  3ONL A;  4HOQ A;  3ASH A;  4ILH B;  2VGY A;  5AEN A;  3L6A A;  1E7V A;  2V8S E;  5J90 A;  4W9R A;  4A1G A;  5LX8 A;  3L16 A;  5KCM A;  4L7T A;  3FU0 A;  3RK6 A;  4OVV A;  4C9B B;  4GYO A;  5JHB A;  4CEM A;  3O48 A;  1WY6 A;  2V5F A;  3FH7 A;  4XI9 A;  2VGX B;  1ELR A;  4GYY A;  2VJ8 A;  3KD7 A;  2XPZ A;  3FH8 A;  4KZC A;  4WNE A;  2YNQ A;  3AS4 A;  4IYP A;  3VLF A;  4URK A;  3HDX A;  3CLJ A;  3ZIM A;  2L6J A;  4H7Y A;  2VQ2 A;  1ZBP A;  1B89 A;  3GZ2 A;  3PVL A;  1X5B A;  1YA0 A;  3PUJ A;  3ZYM A;  2CFZ A;  4JL0 A;  3B7T A;  4N2Q A;  3LEW A;  5D0O D;  3UUX A;  4FP7 A;  3LYA A;  4K03 A;  1HH8 A;  2GRL A;  4L23 A;  4A3T A;  2WQ7 A;  2X6F A;  2VTB A;  3D9M A;  1H0A A;  3QNK A;  4JHJ A;  3CVQ A;  1XGW A;  3NF1 A;  2XPY A;  5CCM A;  4AEZ C;  3HHM A;  4RG6 A;  3UT4 A;  3MEK A;  1TEZ A;  3CKC A;  3NZS A;  3FEX A;  1HF8 A;  2I1J A;  5KJN A;  2XQ0 A;  4BWR A;  4HS2 A;  4OYS A;  3CR3 A;  3ZHE B;  2CHZ A;  3QB2 A;  3SF4 A;  3SD5 A;  4U0U A;  1P5Q A;  5HI7 A;  3R7R A;  4ACK A;  4UWG A;  5FQ6 A;  4O6F A;  2GRM A;  1IHG A;  1E7U A;  4KXK B;  3MKR A;  2KCV A;  2LAI A;  2WQH A;  3P2B A;  2BTD A;  2FEZ A;  4RVB A;  4APO A;  1UW4 B;  2FI7 A;  2RG8 A;  4PS7 A;  4ANV A;  2KC7 A;  3PNT B;  4JHK A;  3APD A;  3SBS A;  4XIF A;  3FUN A;  4G23 A;  4J8F A;  5FJY A;  3ML9 A;  2CG2 A;  2WXL A;  4BY6 A;  3AU4 A;  3SBT B;  4U07 A;  3KS2 A;  3TAX A;  4UI9 K;  2CHX A;  4B8C B;  3FTV A;  3P1U A;  4JA9 A;  5AIJ A;  2LNI A;  4CDR A;  3ONK A;  4TRQ A;  4AXH A;  2C0L A;  4TV3 A;  3PEV B;  2KAT A;  3RRM B;  3CKB A;  1EDU A;  1KLX A;  2WXP A;  3MZL B;  5HQ8 A;  2WQ6 A;  3CK8 A;  5BV1 A;  3MV3 B;  3CVX A;  3VTY A;  2J09 A;  2R59 A;  2I6H A;  1OWP A;  3ZEF A;  4I9C A;  3R7Q A;  1E8Z A;  4KZ0 A;  3KAE A;  3D9P A;  3S7J A;  3URZ A;  3N71 A;  5FZQ A;  2NXP A;  3EJN A;  2XCB A;  5BW8 C;  5EX3 A;  3PRE A;  2UWJ G;  4U0S A;  4XZ4 A;  5T3R A;  3FUL A;  3AU5 A;  4CRW A;  2GW1 A;  3ZVV A;  1HX8 A;  4HVB A;  5LFA A;  4D10 C;  3QAQ A;  4KVO A;  3U66 A;  1NA3 A;  2PZI A;  4P29 A;  2JEK A;  4CT4 A;  3CK7 A;  3SZ7 A;  4EBA A;  4GA1 A;  1JWG A;  4RSY A;  4WNG A;  4XKC A;  3QJZ A;  3VLD A;  3ESK A;  4WND A;  5BNW A;  2PQN A;  4G2V A;  3FFL A;  3VLE A;  5AJL A;  5LP0 A;  1NZN A;  1WM5 A;  3MKQ A;  4GYW A;  3LVQ E;  4JVS A;  5CMW A;  3HVE A;  3TXN A;  1QQE A;  4KT6 B;  3CVY A;  2CFU A;  4MLP A;  3RRN B;  4G1T A;  2LSU A;  3PE3 A;  3JQ1 A;  5DBK A;  3QWW A;  3BEE A;  2I2O A;  1N52 A;  1MHQ A;  4FA6 A;  1JWF A;  4N2S A;  2AVP A;  2KZT A;  2Y3A A;  4G11 A;  4I17 A;  1H2V C;  3MCX A;  3NQP A;  3LJ3 A;  2Y4T A;  3C98 A;  1W3B A;  4PDX A;  5E76 A;  3MA5 A;  1EF1 C;  3LXU X;  3TG5 A;  3TG4 A;  3FP3 A;  1H2T C;  2UY1 A;  3CVU A;  3ASF A;  3LY7 A;  1SZ9 A;  3IV0 A;  4EZJ A;  4V3I A;  2L0I A;  4IUL A;  3ZFW A;  3QKY A;  1UJJ A;  1INZ A;  2YHE A;  2YQ8 A;  4A3V A;  2IFU A;  3JYS A;  3CVP A;  5FZS A;  4HLE A;  4PUC A;  4F3V A;  3ZN3 A;  2HYZ A;  4EZL A;  4HXI A;  5A23 A;  2WM9 A;  4C0E A;  4JC8 A;  3LKU A;  3I5P A;  2ION A;  4YVO A;  3LDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...