2R2LA

Structure of farnesyl protein transferase bound to pb-93
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
315
structure length
315
Chain Sequence
b'GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase subunit alpha
publication title Efficacy, pharmacokinetics, and metabolism of tetrahydroquinoline inhibitors of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2r2lA00
4GTSA 1DCEA 1S63A 3PZ3A 1JCRA 3Q7AA 2ZIRA 4GTRA 3Q75A 2H6HA 1D8EA 1O1TA 1TNZA 3Q73A 1FT1A 1N4QA 1O1RA 4LNBA 1N4SA 3KSQA 3HXEA 3EUVA 1FT2A 2ZISA 3C72A 3PZ2A 3Q79A 1N4RA 3HXDA 3DSVA 4GTPA 1N95A 3DSWA 3PZ1A 2R2LA 1TNYA 1MZCA 1TN6A 3DRAA 4GTMA 3HXCA 4YDOA 3E33A 1D8DA 3PZ4A 1LD8A 1TN7A 3E32A 4EHMA 4MBGA 3Q7FA 3HXBA 1NL4A 3DSXA 1TNUA 3EU5A 1NI1A 2H6FA 1TNBA 1FPPA 2IEJA 2H6IA 3DSSA 1JCSA 4GTQA 4L9PA 4LNGA 1QBQA 1SA5A 4GTTA 3Q78A 2H6GA 3E37A 1JCQA 3SFXA 1TNOA 1X81A 3E34A 1N9AA 1N94A 1SA4A 4GTVA 1LTXA 3DSUA 2BEDA 4YDEA 3HXFA 1O5MA 4GTOA 1O1SA 1LD7A 1N4PA 1KZOA 3E30A 3SFYA 1KZPA 1S64A 3KSLA 3DSTA 2F0YA 3DPYA 1TN8A
chains in the Genus database with same CATH superfamily
2R59A 3OAWA 4KBQA 3PE4A 1W3BA 3PZ3A 4G23A 2AXUA 1D8EA 2BKKB 4LNUD 4TXQA 4Z68A 2FI7A 4JEUA 4LNBA 5LFAA 3O4ZA 2VTBA 4BERA 3T5VA 2I2OA 1PAQA 3FUDA 3PZ2A 5HQ8A 4AM9A 2J4DA 3SNXA 3LPZA 3AG3E 1JUQA 4WNGA 2DZNA 4ANVA 3E33A 2V4LA 4BSXA 4HLLA 3FWVA 2LO6A 1Z3YA 3ZGQA 1TNUA 3ZIMA 5AJDA 1NI1A 3S2AA 3NB2A 2DIWA 1OXJA 4JHKA 4XI0A 3MV2B 3CHPA 4U04A 3UM3A 4FLBA 4I1OB 4NRHB 3SO8A 5KJMA 5CHEE 2BEDA 2VJ8A 4G2VA 1QZ2A 3E30A 3FY4A 3N71A 3OXFA 2CHZA 4J8DA 3KSLA 3QDNA 2J49A 2P9KG 4BFRA 3B7UX 2IONA 4AY5A 3G2SA 1IXVA 2C0LA 1FCHA 4C48B 1H2TC 1MQSA 3EU9A 2WQHA 5AQ9A 3T8MA 4BT8A 3V79K 4ACLA 1QQEA 3APFA 3LS8A 1OWMA 3FFLA 3UIOC 5G05C 3HXDA 2J9QA 4FJZA 3DSVA 4O60A 3KEZA 3ZN3A 2DZOA 4J0UA 4LUNU 4DI4A 3C3RA 4UQYA 2PL2A 4N3BA 3D9JA 1NA0A 3PEVB 2CG3A 4Q69A 2WXRA 4B94A 4UWFA 5FZSA 2ZXWE 5H7PA 3VLFA 5AN8A 1TNBA 2BUGA 4I43A 5AJLA 5JHBA 1K1BA 3MYVA 2WPVA 2IFUA 1SA5A 4JPSA 1IQUA 1E8XA 3FULA 5JJ7A 1SW6A 2PQNA 3UI2A 3GZ2A 5M72A 2LUHA 3DEOA 4F6RD 4HQDA 3ZFWA 4C9BB 2IY0C 2R02A 4MLPA 2CHXA 1ZB1A 2BTDA 4ACKA 1BU9A 1OCRE 5FTPA 1OWNA 3ASOE 2WXNA 3Q7AA 4TUMA 4TXPA 1RZ4A 4HOUA 3AG4E 3ASHA 5ENRD 5ENPD 3LXUX 1ZU2A 5EYPF 1QNFA 4XZ4A 3G2TA 2LAIA 5KNGA 4URKA 4APFA 2YQ8A 3PNLB 4GB9A 4J8FA 5ENOD 4ABNA 3DXKG 4CT4A 3AU5A 4N2QA 2AW6A 1E90A 1TN6A 3DRAA 3ZRHA 4U8YD 3PRZA 3HVEB 1D8DA 3UMVA 1BI8B 1TN7A 4F1PA 2FULA 3S7JA 2XPZA 1OWLA 1UN8A 4FA6A 3B13A 4AV7A 5JJTA 5AAOA 4G26A 4LNGA 1MHQA 4M7CA 2MRIA 2QYJA 2L9BA 5CCMA 3RRNB 5B1BE 2X6JA 2J8SD 3MCXA 4GTOA 3VTYA 3FU0A 2F37A 2QY7A 3OXLA 3ASFA 2WXOA 3FTZA 1IQRA 3S7BA 2KATA 5AENA 4U0ZA 4FADA 3O48A 3ZW3A 4NURA 2P58C 4OVVA 1S0PA 3V30A 5B3SE 1HX8A 4LCTA 4Y6CA 4XX5A 3KD7A 3NBNB 3UM2A 4N5CA 2AXZA 4I9EA 4FJYA 5ARGA 3CQGB 4HI8A 3B7RL 1N0RA 2FBNA 3KSQA 3LY9A 3FEXA 4GTPA 3T9KA 3CHQA 1KPSB 5T4YA 4BY6A 4I9CA 5D66A 3QAQA 3MGBA 3QWWA 4CYMD 4I2ZA 4MBGA 3ZXPA 3JXIA 3RO3A 3SD5A 3AS5A 4E6HA 1NFIE 3DXMG 4ILGA 4AIFA 3U64A 3L22A 3TWSA 3GZ1A 3RRUA 1JCQA 3UM1A 5CECB 3HHMA 2MYOA 1TJFA 2WXQA 1WDYA 2XEEA 1HO8A 2QZAA 5D0QD 1D9SA 2LXMA 1DNPA 2XPIA 4M3OA 5A7DB 3SFYA 4BX8A 4RQIA 3V2XA 4B93B 4FULA 5CEAA 4ILIA 2CHWA 3FUIA 5AYWD 4WNFA 3P2BA 2XEHA 2R17C 3PDNA 3IKOB 3EHMA 4GTRA 2I1KA 3CHRA 4WWNA 1E7VA 4GZ5A 4IYPA 4HRMB 1OWPA 2VYIA 3JCKC 1YYHA 4O1PA 4PS8A 1H2UA 2GRRB 3B95A 4UI9K 4K0RA 3CGHA 1FT2A 2DWZA 2KBXA 3Q9UC 4JA9A 2C0MA 3CVLA 2XGSA 3J5PA 4WWPA 4V3IA 2GRQB 3FH5A 1ELWA 5ARFA 1KT0A 3HRAA 4DJAA 4GMRA 5BV1A 2V8SE 5BV0A 2WM9A 4GYWA 2P9LG 3ULQA 1WAO1 2OVBA 1FPPA 5T3RA 2AXVA 2XGOA 4G8KA 5D0OD 2PZIA 3TWRA 2L6JA 2XEVA 1Z5SC 3UXGA 3NF1A 5FQ8A 2ETCA 4GMLA 4KYOB 3HVEA 2KM4A 4UI9C 4GZ3A 5FIOA 3TG4A 4BSZB 3I5PA 3LKUA 2FO1E 3LVQE 1S64A 5G04C 3LJ3A 3G2WA 3FDHA 2P9NG 1V54E 1H6OA 3R7RA 1MJ0A 2EIJE 3ZNGA 2WMNA 3SQVA 1S70B 3ML9A 1ELKA 5FINA 2LAHA 5JJ6A 4CZ2D 5J90A 1O1RA 4K03A 4C0EA 4OAUC 3PUJA 5KCMA 5AQ7A 5LCWJ 4BTAA 5HI7A 4LEUA 3TWXA 4APOA 5KNHD 2WQ7A 3UIPC 4A63B 2HM8A 3C3QA 1TNYA 2DYSE 3EHRA 4EZKA 1ELRA 5J08A 2RFAA 4JB8P 3UINC 3KAEA 1IHGA 4WNDA 3AAAC 4UQXA 4J7WA 1K1AA 5BNWA 3D9LA 5ITZF 3JQ1A 4ANUA 3DWLG 3IHYA 4WAFA 5CRUA 2I1JA 4JEHA 5G05J 1OCCE 4RVBA 3TXNA 4GTVA 1LTXA 4N3AA 3DSUA 4UWKA 4CT0A 3APDA 5BXOA 3CKCA 1N54A 2Y3AA 1AP7A 5IY5E 3AG1E 3ISMC 2E0IA 3SGHA 4DX5D 2IU1A 2P9IG 4N5QA 2VSOE 1S63A 4L1BA 3FUKA 3D9KA 2ZIRA 3BG1B 3I3NA 3MKQA 2GROB 3RJVA 2X6IA 2MHKA 3C98A 2NXPA 4CGVA 4J6IA 4FHKA 3E4BA 3EUVA 2Y4UA 4HB5A 4GA1A 3R7QA 3LY8A 1N95A 2Q7FA 3LCAA 1MZCA 5FT9A 4Y6WA 4GTMA 3D3MA 2IOSA 3IEGA 3QWPA 4DLQA 3CSTA 4OAVB 3SZ7A 3NZUA 2I6HA 2LXLA 3LDZA 4YVOA 3TAXA 2JABA 5AIJA 3FU6A 5HRYA 5EN5D 3ZPJA 1MX4A 2GRNB 4N39A 4XE0A 4L9PA 2WXMA 1A17A 4YDWA 4EECA 3SFXA 1WY6A 4HFGA 3L16A 4FU3A 1N94A 4AY6A 3S7DA 3PVLA 4W9RA 5FZQA 2WB2A 4HOSA 1O5MA 2WXJA 4D10C 2J07A 5CBOA 2WXPA 3KEAA 3L54A 4PH4B 3K9IA 3L9TA 2Y69E 4KZ0A 3CEQA 3DEPA 3TJPA 3TWVA 3MA5A 4H7YA 4LG6A 3AS8A 4K5CA 3TGOA 3CVUA 3EHNA 3Q5MA 1HE8A 4ME2A 3FTXA 4Q94A 4UWLA 5E76A 1E8YA 4EZLA 1O1TA 2XRZA 1QYMA 5KJLA 4K5BA 1N4QA 5EYLA 4PUCA 4U0SA 1OUVA 3PUKA 4BX9A 2B6CA 3W9GA 2Y0BG 3C72A 4L2LA 3S7FA 4RLYA 1FVHA 4RG6A 4PS3A 1TJCA 2ZGDA 4HVBA 4G24A 4HI9A 4EPZA 4FLHA 5ENSD 2XZDG 2C2LA 4HBDA 5A23A 4RG9A 3TL5A 3MZLB 2V0PA 2IEJA 4I1AA 3FU3A 4F1SA 1ZBPA 3ONLA 3ZYLA 4JC8A 2YHEA 3RKVA 1N0QA 4YDEA 4I17A 1U3DA 3FUMA 2XS1A 3ZXSA 3SY2A 4HXIA 2OVFA 3JUEA 2B0OE 4DUIA 4HRNA 3BUAA 2WQ6A 3UUXA 3NQPA 4XIFA 4B8AA 2WXFA 2OCCE 5ANRA 1XNFA 1PC2A 5CMYA 3VTXA 3NOCD 2P9UG 1TN8A 1BPOA 4YVQC 5JA4D 2X6HA 3CHOA 1U2VG 3RO2A 3Q73A 1TEZA 4EBAG 3D9MA 3ZUVB 2GW1A 3U66A 1RW2A 2CG2A 1UW4B 3VLEA 4B8CB 4FHJA 1BD8A 4DI3A 2M63A 1H0AA 2NC9A 3ZU7B 1Z3XA 4EQFA 3R9AB 2XHEA 2FF4A 4WNEA 2HO1A 4JZYA 3E32A 1EDUA 4G1TA 3AU4A 5CMWA 4KVOA 3L08A 3I4GA 2XGMA 1OY3D 3B7TA 4U7EB 4L2YA 2VTBB 2FEZA 2KXPC 4O6FA 2YHCA 3FP3A 3JYSA 1JCSA 1N11A 3QKYA 4UUCA 3P1UA 2NSZA 4DK5A 2ILRA 3TG5A 4KXKB 1NP7A 2FO7A 2GRMA 4ILHB 2IO3C 4N2SA 3PH0C 4Q96A 4I6JA 4DPRA 1Z6TA 1SZAA 1H6KA 4JXTA 1G3NB 3U3WA 1L5JA 3BG0B 3RIBA 1JPLA 3LYAA 2MOWA 4GU5A 1WG0A 2RKKA 3OTNA 2DYRE 3ZYQA 5G55A 1DCEA 4JW1A 4YNDA 1JCRA 3ZYMA 2GRPB 3D9HA 4GZDA 3FUJA 3CQCB 3CVPA 3CHSA 3HYMB 5EILA 1FVFA 4GYOA 3HXEA 3TWUA 4P29A 3IBEA 4WUYA 3PZ1A 5G04J 2HYZA 3FH7A 1WM5A 3HXCA 3NOGD 4DX1A 2WXGA 3SFZA 1LD8A 3EDTB 1HG2A 5KJNA 3KS2A 3CVYA 4A1GA 4U07A 1NL4A 3ZKJA 3Q15A 2RG8A 4CEMA 1HG5A 2F8YA 3EU5A 4HNAD 5LOZA 1OWOA 3DSSA 3FUHA 3FUEA 4CCAA 2P9SG 5CEDB 2J09A 3BEEA 4J8SA 3E37A 4L23A 3B7BA 5ANLA 3SF4A 3CVXA 3SHFA 1V55E 1KZOA 3CIAA 2KCKA 5DIZA 4XKCA 4AOFA 3RRMB 1EYHA 4N3CA 2UY1B 3Q49B 2LNIA 4F53A 5ENNA 3FTWA 3HG0D 4B89A 4HRLA 5D2MC 4GPMA 4NQ0A 3FU5A 4ZFHA 2NYJA 1EPUA 4AP2A 3URZA 2JLBA 2A5UA 1E8WA 5ENQD 4XEIG 3UX4A 3GW4A 2X38A 2RD0A 4UWGA 4TXRA 3EHQA 2WMOA 2IF4A 4E85A 3ONKA 4IRUA 5CRVA 3CLJA 4LERA 2CFUA 2UWJG 5FQ7A 2I9CA 3PZ4A 2R03A 2DBAA 4K5AB 2OOEA 4BEPA 3LVRE 3OXGA 1B89A 1JWFA 4GTQA 3UT4A 1HXIA 5EX0A 1EF1C 4GA0A 3MV3B 2OEVA 5LX8A 1TNOA 4JVSA 3MEKA 3L82A 3RU0A 3C3OA 2XCBA 3DBSA 4KMOA 4NACA 3I4RB 1O1SA 1LD7A 4BT9A 1N4PA 3MJWA 3T5XA 3HIZA 5KBAA 2IQCA 3R9MA 1KT1A 4IULA 3NAWA 5BW8C 3UKUG 2Y4TA 1NZNA 2DVWA 4JHJA 5CERB 4ANWA 3G2VA 1E96B 4MRUA 3RAUA 2CFZA 2EQXA 3X2QE 2AVPA 4CDRA 4CRWA 4ATGA 4GTSA 4JL0A 2R05A 2E2EA 3AS4A 1INZA 1VDYA 3ABKE 4CDMA 4OVUA 2PM6A 4MKTA 1HU3A 3JXJA 1E7UA 3RSEG 4XI9A 4GYYA 2IJGX 3CK9A 3F6QA 2LSUA 5CCLA 4GPKA 3PS6A 5AQAA 3Q7FA 2VQ2A 1UG3A 4KVMA 1MX6A 3ESLA 5LCWC 3Q4AB 4UWHA 3UM0A 5T8IA 4YDYA 1YCSB 5BUZA 3ULYA 2VGXB 3B7SA 2V5QC 1P5QA 1X81A 3D9IA 3E34A 1N9AA 1SA4A 3UT8A 2JEKA 2EINE 3PEUB 4TV3A 3CK8A 2X3MA 2PM7A 3HXFA 2KCLA 2QC9A 2KCVA 4QQIA 4GAAA 5HKPA 5C1DA 2J4BA 1K8KG 4A55A 4HOTA 4LRZA 2KC7A 2QYUA 2Y1LE 3MX3A 3EIQC 2DCPA 1HFAA 4AVXA 3APCA 3PE3A 3CVVA 3FUFA 4U8HA 2L6BA 2H6HA 3CVWA 3AJIA 3U4TA 2P2CP 5EIBE 1NA3A 1N4SA 3IXEA 3V2OA 2XRYA 2WVIA 4FC8A 1UJJA 4U63A 3Q79A 2IO2C 3QK0A 2WXKA 4L7TA 3FTUA 4KZCA 2UY1A 5JHAA 2A5EA 3WG7E 2WXHA 3ML8A 3L6AA 2P9PG 1A5EA 3FTVA 4RSYA 3DSXA 4PS7A 5AQBA 3QC1A 1JWGA 3FHEA 2PQRA 4JD2G 2ONDA 4ZHBA 3JUIA 4ATZD 4HS2A 4BESA 5BXUA 4AEZC 1IYGA 4GTTA 2F8XK 3D9OA 2ETBA 4AJWA 2XCCA 3ZYKA 3QJZA 4EZJA 4CGWA 4GZ6A 5C2YA 3ASGA 2VGEA 3QARA 4DLOA 5A6CA 1HF8A 1XGWA 3V31A 2BF0X 5FJYA 2VSNA 4AXHA 3SI5A 5FQ4A 3G2UA 3UKRG 1Y8MA 4B0ZA 3DPDA 1OCOE 1TNZA 1OT8A 4I1MA 1N52A 3JQ0A 3IHVA 1TYQG 4DX2A 2V4HC 4A1SA 2KZTB 5KWDA 2ZISA 3FTSA 5FWQA 5E75A 3T8KA 3BU8A 5BT1A 2BKGA 3LY7A 1K3ZD 2RFMA 4YDOA 4MS6A 4G8LA 3D9NA 4HLEA 1DCQA 3QB2A 4DRXE 1Q2ZA 1MX2A 1IHBA 4WWOA 3HXBA 3CSFA 4I2WA 1YMPA 3ZHEB 3CVQA 2YINA 3CVNA 2VSYA 3UTMA 4EBAA 3TWTA 1H2VC 3GYZA 2H6IA 3TXMA 3PREA 1BI7B 2H6GA 5EX3A 1SQMA 4G25A 4DX6D 3RK6A 3ASDA 4U8VD 5FZRA 5EKQD 4GCOA 1KZPA 3GZSA 2J08A 3LEWA 4CDNA 2XZTG 4A3TA 4G11A 5BPPA 2EIKE 4UQZA 3QNKA 2QFCA 4OYSA 3CV0A 1IKND 3AG2E 4ANXA 4X8QA 3ENEA 2VGXA 5JMND 3ULEG 3W9FA 1HH8A 2LSVA 2ZGGA 4BETA 1FT1A 3ASNE 5HS0A 2XPYA 3SBTB 1AWCB 2ETAA 2HE0A 4KT6B 5CBNA 1KLXA 3CHMA 3PNTB 1X5BA 3UT7A 4BWRA 1N4RA 5ENTD 3DSWA 4U96D 2R2LA 1YA0A 3IV0A 3QWVA 2R5SA 3WXXA 3MKQB 2PNNA 4JHRA 2AWIA 4EHMA 2WXIA 2VSXE 4R7LA 3TWQA 2HR2A 4UI9J 2OEWA 3TWWA 2H6FA 3CKBA 2XENA 3Q47B 4I6GA 5G2NA 3J5QB 2L0TB 1U3CA 3CK7A 1QBQA 5EDSA 4IN3B 3Q78A 4GMJA 4TUUA 2IOLA 3FUNA 4J8YA 5KJKA 4BTBA 1H6PA 5DBKA 4QFVA 4NIKA 5LP0A 3L17A 3CR3A 2GGFA 1LF8A 1UN9A 1UJKA 4F7AA 4LSZE 2L0IA 4I6EA 3DSTA 1GW6A 3ESKA 1E8ZA 3LJNA 2ZU6B 5AARA 4DX7D 1BLXB 3DPYA 4GZCA 2XQ0A 4JA7A 2EIME 4C0MA 3Q75A 1PY1A 2GRLA 4O1OA 5B1AE 4F3VA 3ZVVA 5EIDA 4U95D 5FQ6A 1H19A 3L13A 3UQ3A 3ZEFA 3ABLE 1UOHA 1HS6A 3EIJA 2X6KA 2WXLA 3FH8A 1SZ9A 1Y6IA 4U0UA 3UPVA 2A4ZA 3BQOA 4GCNA 4GA2A 4PDXA 3PZDA 1OCZE 2OV8A 4J8EA 4FP7A 2VGYA 3U9WA 2YNQA 1TR4A 4XKBA 3FTYA 1HZ4A 3HDXA 3QOUA 1DC2A 2KZTA 3FEYA 2V5FA 4A3VA 3MKRA 4H7XA 3C5RA 3ABME 1MYOA 4HOQA 3EJNA 3Q9NC 1SVXA 3NZSA 2X6FA 1DVPA 2AJAA 3SBSA 3ZHEA 3VLDA 4TRQA 2XS8A 2F0YA 2EILE 4HORA 3D9PA
chains in the Genus database with same CATH topology
4GTSA 1DCEA 1S63A 3PZ3A 1JCRA 3Q7AA 2ZIRA 4GTRA 3Q75A 2H6HA 1D8EA 1O1TA 1TNZA 3Q73A 1FT1A 1N4QA 1O1RA 4LNBA 1N4SA 3KSQA 3HXEA 3EUVA 1FT2A 2ZISA 3C72A 3PZ2A 3Q79A 1N4RA 3HXDA 3DSVA 4GTPA 1N95A 3DSWA 3PZ1A 2R2LA 1TNYA 1MZCA 1TN6A 3DRAA 4GTMA 3HXCA 4YDOA 3E33A 1D8DA 3PZ4A 1LD8A 1TN7A 3E32A 4EHMA 4MBGA 3Q7FA 3HXBA 1NL4A 3DSXA 1TNUA 3EU5A 1NI1A 2H6FA 1TNBA 1FPPA 2IEJA 2H6IA 3DSSA 1JCSA 4GTQA 4L9PA 4LNGA 1QBQA 1SA5A 4GTTA 3Q78A 2H6GA 3E37A 1JCQA 3SFXA 1TNOA 1X81A 3E34A 1N9AA 1N94A 1SA4A 4GTVA 1LTXA 3DSUA 2BEDA 4YDEA 3HXFA 1O5MA 4GTOA 1O1SA 1LD7A 1N4PA 1KZOA 3E30A 3SFYA 1KZPA 1S64A 3KSLA 3DSTA 2F0YA 3DPYA 1TN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTS A;  1DCE A;  1S63 A;  3PZ3 A;  1JCR A;  3Q7A A;  2ZIR A;  4GTR A;  3Q75 A;  2H6H A;  1D8E A;  1O1T A;  1TNZ A;  3Q73 A;  1FT1 A;  1N4Q A;  1O1R A;  4LNB A;  1N4S A;  3KSQ A;  3HXE A;  3EUV A;  1FT2 A;  2ZIS A;  3C72 A;  3PZ2 A;  3Q79 A;  1N4R A;  3HXD A;  3DSV A;  4GTP A;  1N95 A;  3DSW A;  3PZ1 A;  2R2L A;  1TNY A;  1MZC A;  1TN6 A;  3DRA A;  4GTM A;  3HXC A;  4YDO A;  3E33 A;  1D8D A;  3PZ4 A;  1LD8 A;  1TN7 A;  3E32 A;  4EHM A;  4MBG A;  3Q7F A;  3HXB A;  1NL4 A;  3DSX A;  1TNU A;  3EU5 A;  1NI1 A;  2H6F A;  1TNB A;  1FPP A;  2IEJ A;  2H6I A;  3DSS A;  1JCS A;  4GTQ A;  4L9P A;  4LNG A;  1QBQ A;  1SA5 A;  4GTT A;  3Q78 A;  2H6G A;  3E37 A;  1JCQ A;  3SFX A;  1TNO A;  1X81 A;  3E34 A;  1N9A A;  1N94 A;  1SA4 A;  4GTV A;  1LTX A;  3DSU A;  2BED A;  4YDE A;  3HXF A;  1O5M A;  4GTO A;  1O1S A;  1LD7 A;  1N4P A;  1KZO A;  3E30 A;  3SFY A;  1KZP A;  1S64 A;  3KSL A;  3DST A;  2F0Y A;  3DPY A;  1TN8 A; 
#chains in the Genus database with same CATH topology
 2R59 A;  3OAW A;  4KBQ A;  3PE4 A;  1W3B A;  3PZ3 A;  4G23 A;  2AXU A;  1D8E A;  2BKK B;  4LNU D;  4TXQ A;  4Z68 A;  2FI7 A;  4JEU A;  4LNB A;  5LFA A;  3O4Z A;  2VTB A;  4BER A;  3T5V A;  2I2O A;  1PAQ A;  3FUD A;  3PZ2 A;  5HQ8 A;  4AM9 A;  2J4D A;  3SNX A;  3LPZ A;  3AG3 E;  1JUQ A;  4WNG A;  2DZN A;  4ANV A;  3E33 A;  2V4L A;  4BSX A;  4HLL A;  3FWV A;  2LO6 A;  1Z3Y A;  3ZGQ A;  1TNU A;  3ZIM A;  5AJD A;  1NI1 A;  3S2A A;  3NB2 A;  2DIW A;  1OXJ A;  4JHK A;  4XI0 A;  3MV2 B;  3CHP A;  4U04 A;  3UM3 A;  4FLB A;  4I1O B;  4NRH B;  3SO8 A;  5KJM A;  5CHE E;  2BED A;  2VJ8 A;  4G2V A;  1QZ2 A;  3E30 A;  3FY4 A;  3N71 A;  3OXF A;  2CHZ A;  4J8D A;  3KSL A;  3QDN A;  2J49 A;  2P9K G;  4BFR A;  3B7U X;  2ION A;  4AY5 A;  3G2S A;  1IXV A;  2C0L A;  1FCH A;  4C48 B;  1H2T C;  1MQS A;  3EU9 A;  2WQH A;  5AQ9 A;  3T8M A;  4BT8 A;  3V79 K;  4ACL A;  1QQE A;  3APF A;  3LS8 A;  1OWM A;  3FFL A;  3UIO C;  5G05 C;  3HXD A;  2J9Q A;  4FJZ A;  3DSV A;  4O60 A;  3KEZ A;  3ZN3 A;  2DZO A;  4J0U A;  4LUN U;  4DI4 A;  3C3R A;  4UQY A;  2PL2 A;  4N3B A;  3D9J A;  1NA0 A;  3PEV B;  2CG3 A;  4Q69 A;  2WXR A;  4B94 A;  4UWF A;  5FZS A;  2ZXW E;  5H7P A;  3VLF A;  5AN8 A;  1TNB A;  2BUG A;  4I43 A;  5AJL A;  5JHB A;  1K1B A;  3MYV A;  2WPV A;  2IFU A;  1SA5 A;  4JPS A;  1IQU A;  1E8X A;  3FUL A;  5JJ7 A;  1SW6 A;  2PQN A;  3UI2 A;  3GZ2 A;  5M72 A;  2LUH A;  3DEO A;  4F6R D;  4HQD A;  3ZFW A;  4C9B B;  2IY0 C;  2R02 A;  4MLP A;  2CHX A;  1ZB1 A;  2BTD A;  4ACK A;  1BU9 A;  1OCR E;  5FTP A;  1OWN A;  3ASO E;  2WXN A;  3Q7A A;  4TUM A;  4TXP A;  1RZ4 A;  4HOU A;  3AG4 E;  3ASH A;  5ENR D;  5ENP D;  3LXU X;  1ZU2 A;  5EYP F;  1QNF A;  4XZ4 A;  3G2T A;  2LAI A;  5KNG A;  4URK A;  4APF A;  2YQ8 A;  3PNL B;  4GB9 A;  4J8F A;  5ENO D;  4ABN A;  3DXK G;  4CT4 A;  3AU5 A;  4N2Q A;  2AW6 A;  1E90 A;  1TN6 A;  3DRA A;  3ZRH A;  4U8Y D;  3PRZ A;  3HVE B;  1D8D A;  3UMV A;  1BI8 B;  1TN7 A;  4F1P A;  2FUL A;  3S7J A;  2XPZ A;  1OWL A;  1UN8 A;  4FA6 A;  3B13 A;  4AV7 A;  5JJT A;  5AAO A;  4G26 A;  4LNG A;  1MHQ A;  4M7C A;  2MRI A;  2QYJ A;  2L9B A;  5CCM A;  3RRN B;  5B1B E;  2X6J A;  2J8S D;  3MCX A;  4GTO A;  3VTY A;  3FU0 A;  2F37 A;  2QY7 A;  3OXL A;  3ASF A;  2WXO A;  3FTZ A;  1IQR A;  3S7B A;  2KAT A;  5AEN A;  4U0Z A;  4FAD A;  3O48 A;  3ZW3 A;  4NUR A;  2P58 C;  4OVV A;  1S0P A;  3V30 A;  5B3S E;  1HX8 A;  4LCT A;  4Y6C A;  4XX5 A;  3KD7 A;  3NBN B;  3UM2 A;  4N5C A;  2AXZ A;  4I9E A;  4FJY A;  5ARG A;  3CQG B;  4HI8 A;  3B7R L;  1N0R A;  2FBN A;  3KSQ A;  3LY9 A;  3FEX A;  4GTP A;  3T9K A;  3CHQ A;  1KPS B;  5T4Y A;  4BY6 A;  4I9C A;  5D66 A;  3QAQ A;  3MGB A;  3QWW A;  4CYM D;  4I2Z A;  4MBG A;  3ZXP A;  3JXI A;  3RO3 A;  3SD5 A;  3AS5 A;  4E6H A;  1NFI E;  3DXM G;  4ILG A;  4AIF A;  3U64 A;  3L22 A;  3TWS A;  3GZ1 A;  3RRU A;  1JCQ A;  3UM1 A;  5CEC B;  3HHM A;  2MYO A;  1TJF A;  2WXQ A;  1WDY A;  2XEE A;  1HO8 A;  2QZA A;  5D0Q D;  1D9S A;  2LXM A;  1DNP A;  2XPI A;  4M3O A;  5A7D B;  3SFY A;  4BX8 A;  4RQI A;  3V2X A;  4B93 B;  4FUL A;  5CEA A;  4ILI A;  2CHW A;  3FUI A;  5AYW D;  4WNF A;  3P2B A;  2XEH A;  2R17 C;  3PDN A;  3IKO B;  3EHM A;  4GTR A;  2I1K A;  3CHR A;  4WWN A;  1E7V A;  4GZ5 A;  4IYP A;  4HRM B;  1OWP A;  2VYI A;  3JCK C;  1YYH A;  4O1P A;  4PS8 A;  1H2U A;  2GRR B;  3B95 A;  4UI9 K;  4K0R A;  3CGH A;  1FT2 A;  2DWZ A;  2KBX A;  3Q9U C;  4JA9 A;  2C0M A;  3CVL A;  2XGS A;  3J5P A;  4WWP A;  4V3I A;  2GRQ B;  3FH5 A;  1ELW A;  5ARF A;  1KT0 A;  3HRA A;  4DJA A;  4GMR A;  5BV1 A;  2V8S E;  5BV0 A;  2WM9 A;  4GYW A;  2P9L G;  3ULQ A;  1WAO 1;  2OVB A;  1FPP A;  5T3R A;  2AXV A;  2XGO A;  4G8K A;  5D0O D;  2PZI A;  3TWR A;  2L6J A;  2XEV A;  1Z5S C;  3UXG A;  3NF1 A;  5FQ8 A;  2ETC A;  4GML A;  4KYO B;  3HVE A;  2KM4 A;  4UI9 C;  4GZ3 A;  5FIO A;  3TG4 A;  4BSZ B;  3I5P A;  3LKU A;  2FO1 E;  3LVQ E;  1S64 A;  5G04 C;  3LJ3 A;  3G2W A;  3FDH A;  2P9N G;  1V54 E;  1H6O A;  3R7R A;  1MJ0 A;  2EIJ E;  3ZNG A;  2WMN A;  3SQV A;  1S70 B;  3ML9 A;  1ELK A;  5FIN A;  2LAH A;  5JJ6 A;  4CZ2 D;  5J90 A;  1O1R A;  4K03 A;  4C0E A;  4OAU C;  3PUJ A;  5KCM A;  5AQ7 A;  5LCW J;  4BTA A;  5HI7 A;  4LEU A;  3TWX A;  4APO A;  5KNH D;  2WQ7 A;  3UIP C;  4A63 B;  2HM8 A;  3C3Q A;  1TNY A;  2DYS E;  3EHR A;  4EZK A;  1ELR A;  5J08 A;  2RFA A;  4JB8 P;  3UIN C;  3KAE A;  1IHG A;  4WND A;  3AAA C;  4UQX A;  4J7W A;  1K1A A;  5BNW A;  3D9L A;  5ITZ F;  3JQ1 A;  4ANU A;  3DWL G;  3IHY A;  4WAF A;  5CRU A;  2I1J A;  4JEH A;  5G05 J;  1OCC E;  4RVB A;  3TXN A;  4GTV A;  1LTX A;  4N3A A;  3DSU A;  4UWK A;  4CT0 A;  3APD A;  5BXO A;  3CKC A;  1N54 A;  2Y3A A;  1AP7 A;  5IY5 E;  3AG1 E;  3ISM C;  2E0I A;  3SGH A;  4DX5 D;  2IU1 A;  2P9I G;  4N5Q A;  2VSO E;  1S63 A;  4L1B A;  3FUK A;  3D9K A;  2ZIR A;  3BG1 B;  3I3N A;  3MKQ A;  2GRO B;  3RJV A;  2X6I A;  2MHK A;  3C98 A;  2NXP A;  4CGV A;  4J6I A;  4FHK A;  3E4B A;  3EUV A;  2Y4U A;  4HB5 A;  4GA1 A;  3R7Q A;  3LY8 A;  1N95 A;  2Q7F A;  3LCA A;  1MZC A;  5FT9 A;  4Y6W A;  4GTM A;  3D3M A;  2IOS A;  3IEG A;  3QWP A;  4DLQ A;  3CST A;  4OAV B;  3SZ7 A;  3NZU A;  2I6H A;  2LXL A;  3LDZ A;  4YVO A;  3TAX A;  2JAB A;  5AIJ A;  3FU6 A;  5HRY A;  5EN5 D;  3ZPJ A;  1MX4 A;  2GRN B;  4N39 A;  4XE0 A;  4L9P A;  2WXM A;  1A17 A;  4YDW A;  4EEC A;  3SFX A;  1WY6 A;  4HFG A;  3L16 A;  4FU3 A;  1N94 A;  4AY6 A;  3S7D A;  3PVL A;  4W9R A;  5FZQ A;  2WB2 A;  4HOS A;  1O5M A;  2WXJ A;  4D10 C;  2J07 A;  5CBO A;  2WXP A;  3KEA A;  3L54 A;  4PH4 B;  3K9I A;  3L9T A;  2Y69 E;  4KZ0 A;  3CEQ A;  3DEP A;  3TJP A;  3TWV A;  3MA5 A;  4H7Y A;  4LG6 A;  3AS8 A;  4K5C A;  3TGO A;  3CVU A;  3EHN A;  3Q5M A;  1HE8 A;  4ME2 A;  3FTX A;  4Q94 A;  4UWL A;  5E76 A;  1E8Y A;  4EZL A;  1O1T A;  2XRZ A;  1QYM A;  5KJL A;  4K5B A;  1N4Q A;  5EYL A;  4PUC A;  4U0S A;  1OUV A;  3PUK A;  4BX9 A;  2B6C A;  3W9G A;  2Y0B G;  3C72 A;  4L2L A;  3S7F A;  4RLY A;  1FVH A;  4RG6 A;  4PS3 A;  1TJC A;  2ZGD A;  4HVB A;  4G24 A;  4HI9 A;  4EPZ A;  4FLH A;  5ENS D;  2XZD G;  2C2L A;  4HBD A;  5A23 A;  4RG9 A;  3TL5 A;  3MZL B;  2V0P A;  2IEJ A;  4I1A A;  3FU3 A;  4F1S A;  1ZBP A;  3ONL A;  3ZYL A;  4JC8 A;  2YHE A;  3RKV A;  1N0Q A;  4YDE A;  4I17 A;  1U3D A;  3FUM A;  2XS1 A;  3ZXS A;  3SY2 A;  4HXI A;  2OVF A;  3JUE A;  2B0O E;  4DUI A;  4HRN A;  3BUA A;  2WQ6 A;  3UUX A;  3NQP A;  4XIF A;  4B8A A;  2WXF A;  2OCC E;  5ANR A;  1XNF A;  1PC2 A;  5CMY A;  3VTX A;  3NOC D;  2P9U G;  1TN8 A;  1BPO A;  4YVQ C;  5JA4 D;  2X6H A;  3CHO A;  1U2V G;  3RO2 A;  3Q73 A;  1TEZ A;  4EBA G;  3D9M A;  3ZUV B;  2GW1 A;  3U66 A;  1RW2 A;  2CG2 A;  1UW4 B;  3VLE A;  4B8C B;  4FHJ A;  1BD8 A;  4DI3 A;  2M63 A;  1H0A A;  2NC9 A;  3ZU7 B;  1Z3X A;  4EQF A;  3R9A B;  2XHE A;  2FF4 A;  4WNE A;  2HO1 A;  4JZY A;  3E32 A;  1EDU A;  4G1T A;  3AU4 A;  5CMW A;  4KVO A;  3L08 A;  3I4G A;  2XGM A;  1OY3 D;  3B7T A;  4U7E B;  4L2Y A;  2VTB B;  2FEZ A;  2KXP C;  4O6F A;  2YHC A;  3FP3 A;  3JYS A;  1JCS A;  1N11 A;  3QKY A;  4UUC A;  3P1U A;  2NSZ A;  4DK5 A;  2ILR A;  3TG5 A;  4KXK B;  1NP7 A;  2FO7 A;  2GRM A;  4ILH B;  2IO3 C;  4N2S A;  3PH0 C;  4Q96 A;  4I6J A;  4DPR A;  1Z6T A;  1SZA A;  1H6K A;  4JXT A;  1G3N B;  3U3W A;  1L5J A;  3BG0 B;  3RIB A;  1JPL A;  3LYA A;  2MOW A;  4GU5 A;  1WG0 A;  2RKK A;  3OTN A;  2DYR E;  3ZYQ A;  5G55 A;  1DCE A;  4JW1 A;  4YND A;  1JCR A;  3ZYM A;  2GRP B;  3D9H A;  4GZD A;  3FUJ A;  3CQC B;  3CVP A;  3CHS A;  3HYM B;  5EIL A;  1FVF A;  4GYO A;  3HXE A;  3TWU A;  4P29 A;  3IBE A;  4WUY A;  3PZ1 A;  5G04 J;  2HYZ A;  3FH7 A;  1WM5 A;  3HXC A;  3NOG D;  4DX1 A;  2WXG A;  3SFZ A;  1LD8 A;  3EDT B;  1HG2 A;  5KJN A;  3KS2 A;  3CVY A;  4A1G A;  4U07 A;  1NL4 A;  3ZKJ A;  3Q15 A;  2RG8 A;  4CEM A;  1HG5 A;  2F8Y A;  3EU5 A;  4HNA D;  5LOZ A;  1OWO A;  3DSS A;  3FUH A;  3FUE A;  4CCA A;  2P9S G;  5CED B;  2J09 A;  3BEE A;  4J8S A;  3E37 A;  4L23 A;  3B7B A;  5ANL A;  3SF4 A;  3CVX A;  3SHF A;  1V55 E;  1KZO A;  3CIA A;  2KCK A;  5DIZ A;  4XKC A;  4AOF A;  3RRM B;  1EYH A;  4N3C A;  2UY1 B;  3Q49 B;  2LNI A;  4F53 A;  5ENN A;  3FTW A;  3HG0 D;  4B89 A;  4HRL A;  5D2M C;  4GPM A;  4NQ0 A;  3FU5 A;  4ZFH A;  2NYJ A;  1EPU A;  4AP2 A;  3URZ A;  2JLB A;  2A5U A;  1E8W A;  5ENQ D;  4XEI G;  3UX4 A;  3GW4 A;  2X38 A;  2RD0 A;  4UWG A;  4TXR A;  3EHQ A;  2WMO A;  2IF4 A;  4E85 A;  3ONK A;  4IRU A;  5CRV A;  3CLJ A;  4LER A;  2CFU A;  2UWJ G;  5FQ7 A;  2I9C A;  3PZ4 A;  2R03 A;  2DBA A;  4K5A B;  2OOE A;  4BEP A;  3LVR E;  3OXG A;  1B89 A;  1JWF A;  4GTQ A;  3UT4 A;  1HXI A;  5EX0 A;  1EF1 C;  4GA0 A;  3MV3 B;  2OEV A;  5LX8 A;  1TNO A;  4JVS A;  3MEK A;  3L82 A;  3RU0 A;  3C3O A;  2XCB A;  3DBS A;  4KMO A;  4NAC A;  3I4R B;  1O1S A;  1LD7 A;  4BT9 A;  1N4P A;  3MJW A;  3T5X A;  3HIZ A;  5KBA A;  2IQC A;  3R9M A;  1KT1 A;  4IUL A;  3NAW A;  5BW8 C;  3UKU G;  2Y4T A;  1NZN A;  2DVW A;  4JHJ A;  5CER B;  4ANW A;  3G2V A;  1E96 B;  4MRU A;  3RAU A;  2CFZ A;  2EQX A;  3X2Q E;  2AVP A;  4CDR A;  4CRW A;  4ATG A;  4GTS A;  4JL0 A;  2R05 A;  2E2E A;  3AS4 A;  1INZ A;  1VDY A;  3ABK E;  4CDM A;  4OVU A;  2PM6 A;  4MKT A;  1HU3 A;  3JXJ A;  1E7U A;  3RSE G;  4XI9 A;  4GYY A;  2IJG X;  3CK9 A;  3F6Q A;  2LSU A;  5CCL A;  4GPK A;  3PS6 A;  5AQA A;  3Q7F A;  2VQ2 A;  1UG3 A;  4KVM A;  1MX6 A;  3ESL A;  5LCW C;  3Q4A B;  4UWH A;  3UM0 A;  5T8I A;  4YDY A;  1YCS B;  5BUZ A;  3ULY A;  2VGX B;  3B7S A;  2V5Q C;  1P5Q A;  1X81 A;  3D9I A;  3E34 A;  1N9A A;  1SA4 A;  3UT8 A;  2JEK A;  2EIN E;  3PEU B;  4TV3 A;  3CK8 A;  2X3M A;  2PM7 A;  3HXF A;  2KCL A;  2QC9 A;  2KCV A;  4QQI A;  4GAA A;  5HKP A;  5C1D A;  2J4B A;  1K8K G;  4A55 A;  4HOT A;  4LRZ A;  2KC7 A;  2QYU A;  2Y1L E;  3MX3 A;  3EIQ C;  2DCP A;  1HFA A;  4AVX A;  3APC A;  3PE3 A;  3CVV A;  3FUF A;  4U8H A;  2L6B A;  2H6H A;  3CVW A;  3AJI A;  3U4T A;  2P2C P;  5EIB E;  1NA3 A;  1N4S A;  3IXE A;  3V2O A;  2XRY A;  2WVI A;  4FC8 A;  1UJJ A;  4U63 A;  3Q79 A;  2IO2 C;  3QK0 A;  2WXK A;  4L7T A;  3FTU A;  4KZC A;  2UY1 A;  5JHA A;  2A5E A;  3WG7 E;  2WXH A;  3ML8 A;  3L6A A;  2P9P G;  1A5E A;  3FTV A;  4RSY A;  3DSX A;  4PS7 A;  5AQB A;  3QC1 A;  1JWG A;  3FHE A;  2PQR A;  4JD2 G;  2OND A;  4ZHB A;  3JUI A;  4ATZ D;  4HS2 A;  4BES A;  5BXU A;  4AEZ C;  1IYG A;  4GTT A;  2F8X K;  3D9O A;  2ETB A;  4AJW A;  2XCC A;  3ZYK A;  3QJZ A;  4EZJ A;  4CGW A;  4GZ6 A;  5C2Y A;  3ASG A;  2VGE A;  3QAR A;  4DLO A;  5A6C A;  1HF8 A;  1XGW A;  3V31 A;  2BF0 X;  5FJY A;  2VSN A;  4AXH A;  3SI5 A;  5FQ4 A;  3G2U A;  3UKR G;  1Y8M A;  4B0Z A;  3DPD A;  1OCO E;  1TNZ A;  1OT8 A;  4I1M A;  1N52 A;  3JQ0 A;  3IHV A;  1TYQ G;  4DX2 A;  2V4H C;  4A1S A;  2KZT B;  5KWD A;  2ZIS A;  3FTS A;  5FWQ A;  5E75 A;  3T8K A;  3BU8 A;  5BT1 A;  2BKG A;  3LY7 A;  1K3Z D;  2RFM A;  4YDO A;  4MS6 A;  4G8L A;  3D9N A;  4HLE A;  1DCQ A;  3QB2 A;  4DRX E;  1Q2Z A;  1MX2 A;  1IHB A;  4WWO A;  3HXB A;  3CSF A;  4I2W A;  1YMP A;  3ZHE B;  3CVQ A;  2YIN A;  3CVN A;  2VSY A;  3UTM A;  4EBA A;  3TWT A;  1H2V C;  3GYZ A;  2H6I A;  3TXM A;  3PRE A;  1BI7 B;  2H6G A;  5EX3 A;  1SQM A;  4G25 A;  4DX6 D;  3RK6 A;  3ASD A;  4U8V D;  5FZR A;  5EKQ D;  4GCO A;  1KZP A;  3GZS A;  2J08 A;  3LEW A;  4CDN A;  2XZT G;  4A3T A;  4G11 A;  5BPP A;  2EIK E;  4UQZ A;  3QNK A;  2QFC A;  4OYS A;  3CV0 A;  1IKN D;  3AG2 E;  4ANX A;  4X8Q A;  3ENE A;  2VGX A;  5JMN D;  3ULE G;  3W9F A;  1HH8 A;  2LSV A;  2ZGG A;  4BET A;  1FT1 A;  3ASN E;  5HS0 A;  2XPY A;  3SBT B;  1AWC B;  2ETA A;  2HE0 A;  4KT6 B;  5CBN A;  1KLX A;  3CHM A;  3PNT B;  1X5B A;  3UT7 A;  4BWR A;  1N4R A;  5ENT D;  3DSW A;  4U96 D;  2R2L A;  1YA0 A;  3IV0 A;  3QWV A;  2R5S A;  3WXX A;  3MKQ B;  2PNN A;  4JHR A;  2AWI A;  4EHM A;  2WXI A;  2VSX E;  4R7L A;  3TWQ A;  2HR2 A;  4UI9 J;  2OEW A;  3TWW A;  2H6F A;  3CKB A;  2XEN A;  3Q47 B;  4I6G A;  5G2N A;  3J5Q B;  2L0T B;  1U3C A;  3CK7 A;  1QBQ A;  5EDS A;  4IN3 B;  3Q78 A;  4GMJ A;  4TUU A;  2IOL A;  3FUN A;  4J8Y A;  5KJK A;  4BTB A;  1H6P A;  5DBK A;  4QFV A;  4NIK A;  5LP0 A;  3L17 A;  3CR3 A;  2GGF A;  1LF8 A;  1UN9 A;  1UJK A;  4F7A A;  4LSZ E;  2L0I A;  4I6E A;  3DST A;  1GW6 A;  3ESK A;  1E8Z A;  3LJN A;  2ZU6 B;  5AAR A;  4DX7 D;  1BLX B;  3DPY A;  4GZC A;  2XQ0 A;  4JA7 A;  2EIM E;  4C0M A;  3Q75 A;  1PY1 A;  2GRL A;  4O1O A;  5B1A E;  4F3V A;  3ZVV A;  5EID A;  4U95 D;  5FQ6 A;  1H19 A;  3L13 A;  3UQ3 A;  3ZEF A;  3ABL E;  1UOH A;  1HS6 A;  3EIJ A;  2X6K A;  2WXL A;  3FH8 A;  1SZ9 A;  1Y6I A;  4U0U A;  3UPV A;  2A4Z A;  3BQO A;  4GCN A;  4GA2 A;  4PDX A;  3PZD A;  1OCZ E;  2OV8 A;  4J8E A;  4FP7 A;  2VGY A;  3U9W A;  2YNQ A;  1TR4 A;  4XKB A;  3FTY A;  1HZ4 A;  3HDX A;  3QOU A;  1DC2 A;  2KZT A;  3FEY A;  2V5F A;  4A3V A;  3MKR A;  4H7X A;  3C5R A;  3ABM E;  1MYO A;  4HOQ A;  3EJN A;  3Q9N C;  1SVX A;  3NZS A;  2X6F A;  1DVP A;  2AJA A;  3SBS A;  3ZHE A;  3VLD A;  4TRQ A;  2XS8 A;  2F0Y A;  2EIL E;  4HOR A;  3D9P A; 
#chains in the Genus database with same CATH homology
 4GTS A;  1DCE A;  1S63 A;  3PZ3 A;  1JCR A;  3Q7A A;  2ZIR A;  4GTR A;  3Q75 A;  2H6H A;  1D8E A;  1O1T A;  1TNZ A;  3Q73 A;  1FT1 A;  1N4Q A;  1O1R A;  4LNB A;  1N4S A;  3KSQ A;  3HXE A;  3EUV A;  1FT2 A;  2ZIS A;  3C72 A;  3PZ2 A;  3Q79 A;  1N4R A;  3HXD A;  3DSV A;  4GTP A;  1N95 A;  3DSW A;  3PZ1 A;  2R2L A;  1TNY A;  1MZC A;  1TN6 A;  3DRA A;  4GTM A;  3HXC A;  4YDO A;  3E33 A;  1D8D A;  3PZ4 A;  1LD8 A;  1TN7 A;  3E32 A;  4EHM A;  4MBG A;  3Q7F A;  3HXB A;  1NL4 A;  3DSX A;  1TNU A;  3EU5 A;  1NI1 A;  2H6F A;  1TNB A;  1FPP A;  2IEJ A;  2H6I A;  3DSS A;  1JCS A;  4GTQ A;  4L9P A;  4LNG A;  1QBQ A;  1SA5 A;  4GTT A;  3Q78 A;  2H6G A;  3E37 A;  1JCQ A;  3SFX A;  1TNO A;  1X81 A;  3E34 A;  1N9A A;  1N94 A;  1SA4 A;  4GTV A;  1LTX A;  3DSU A;  2BED A;  4YDE A;  3HXF A;  1O5M A;  4GTO A;  1O1S A;  1LD7 A;  1N4P A;  1KZO A;  3E30 A;  3SFY A;  1KZP A;  1S64 A;  3KSL A;  3DST A;  2F0Y A;  3DPY A;  1TN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...