2R2LA

Structure of farnesyl protein transferase bound to pb-93
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Efficacy, pharmacokinetics, and metabolism of tetrahydroquinoline inhibitors of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Farnesyltransferase subunit alpha
total genus 124
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2r2lA00
1TNOA 1TNUA 3E37A 3PZ3A 1LD7A 1TNBA 2H6GA 1JCSA 4MBGA 1LTXA 3KSQA 1N94A 3DSTA 3Q78A 3HXEA 1TN7A 2BEDA 3C72A 3Q79A 2ZISA 1S63A 4YDEA 3HXDA 1FT2A 1D8DA 1O1RA 3Q7AA 1TNZA 1MZCA 4LNBA 3DSWA 3Q73A 4L9PA 3EU5A 3E30A 1DCEA 4GTQA 2IEJA 4GTPA 1JCQA 2H6HA 1JCRA 3SFYA 4GTRA 1O5MA 1X81A 4EHMA 3DSSA 2R2LA 1N4RA 1QBQA 2H6FA 1O1SA 1O1TA 2H6IA 3E33A 4GTMA 4GTTA 3E32A 3PZ2A 3Q75A 3SFXA 3PZ1A 3DSXA 1KZPA 1SA4A 3PZ4A 3KSLA 3DRAA 3DSUA 3HXCA 2F0YA 4GTSA 1FPPA 4YDOA 1N4PA 1SA5A 1NL4A 1TN6A 3HXBA 1N4SA 3Q7FA 3DSVA 1N9AA 1TNYA 1FT1A 1LD8A 1KZOA 1S64A 4GTOA 1TN8A 3DPYA 4GTVA 1NI1A 1N4QA 3EUVA 3E34A 1D8EA 4LNGA 3HXFA 1N95A 2ZIRA
chains in the Genus database with same CATH superfamily
3UXGA 3FH8A 5AAOA 5JJ6A 3S7JA 3C5RA 4OYSA 3PZ3A 3FUFA 4K0RA 3QNKA 5AJDA 1ZU2A 4HOSA 3R9AB 4KXKB 3VTYA 4DJAA 2RFAA 2WXHA 5JHBA 4ANUA 3C98A 2DWZA 3L13A 4GZ5A 4Y6CA 5D2MC 4BERA 1E7VA 4UQZA 2I1JA 1SQMA 3ESLA 2WXJA 4J8FA 3P1UA 3E33A 4ANXA 3D9NA 4MKTA 3CVXA 3CVQA 5ITZF 1L5JA 4IN3B 5G04C 3DWLG 5ARGA 3FU5A 4ANWA 2RD0A 3UIPC 3WG7E 4V3IA 3T8KA 4TRQA 3G2SA 4TXQA 1OUVA 2KCKA 4ZHBA 1UOHA 1SZ9A 5KCMA 5JMND 3QKYA 3UM2A 3CVUA 1U2VG 3AG1E 4DX2A 4Z68A 3QAQA 3ULQA 1TNOA 2BTDA 5FQ7A 3UKUG 3PDNA 1JCSA 1DCQA 4HS2A 4GA2A 3BG0B 1UJJA 3TGOA 4I1OB 4EZLA 5KNGA 2GRQB 3CSFA 1K3ZD 3Q7AA 4I2ZA 1MZCA 4FLHA 3KAEA 2GW1A 1PAQA 4ME2A 4I9EA 4JEHA 4WNEA 2WXOA 2BKGA 3BEEA 1NA0A 2YQ8A 3SFYA 5CCLA 2MOWA 2AXUA 4GU5A 4WNFA 3UQ3A 1IKND 4YVQC 4HBDA 3SFXA 3SFZA 1OWMA 3VLDA 5KBAA 1N54A 4CCAA 4BESA 1KT1A 3PREA 4HI8A 4ILHB 4C48B 5G05C 2HM8A 1H6KA 2PQRA 4YDOA 5AARA 3L08A 2WQ7A 3I3NA 3V30A 2AVPA 2VSYA 4U8YD 2L6JA 3FH5A 4ACLA 1KZOA 4ATGA 2DYRE 4DRXE 3ZNGA 2ONDA 5EX3A 4FJYA 2AWIA 3E34A 3NQPA 5D66A 3AG4E 3UPVA 3BU8A 4BY6A 3FUIA 4GMJA 3E37A 4AEZC 5KJKA 3ZYLA 2ETBA 3AS8A 4E6HA 4HLEA 4G25A 2RKKA 1TN7A 4HNAD 4ANVA 1BI7B 2I2OA 4I2WA 1E96B 3QJZA 3ZPJA 4BWRA 4L2YA 2MHKA 4I9CA 4KZCA 3T9KA 5AIJA 4GTQA 5T3RA 3ZFWA 3JCKC 5AN8A 3HVEB 5G55A 1X81A 5ENQD 4O1OA 4O1PA 3RKVA 2GRLA 1O1SA 4KVMA 2FO7A 1EPUA 3SNXA 4TUUA 4GTMA 5IY5E 3PEUB 2J4DA 2WQ6A 2L0IA 5EX0A 3JQ0A 3PZ4A 2RG8A 3FULA 2XZDG 2R17C 3JXJA 3AG2E 4AY6A 3EHMA 4XI0A 3UKRG 4A3TA 4HORA 3SY2A 3R7RA 3TWSA 4F6RD 2FEZA 3UX4A 4KMOA 4HI9A 4R7LA 4YDYA 3SO8A 3QWWA 3CVWA 4OAVB 1N95A 2J07A 1E8XA 4JHRA 4J8SA 2L9BA 4B93B 4GAAA 5LX8A 2R59A 4FLBA 4E85A 5ENOD 3Q49B 1D8DA 5C2YA 2XCBA 4B89A 4GMRA 4N3CA 4UQYA 5M72A 3EU5A 3L9TA 3RU0A 2V5FA 4G2VA 5KJNA 3PEVB 5ENNA 3DSSA 2CHZA 2HE0A 4KT6B 1HF8A 3SBSA 4J6IA 2AXVA 2XGSA 5KNHD 1H2TC 2P9LG 3PZDA 2H6IA 2OVFA 2IOLA 5HRYA 5T8IA 3APDA 2PM7A 3CHOA 2X6JA 1V55E 2R5SA 3GZ2A 3ZYMA 3UT7A 4F3VA 4RQIA 2BF0X 3B95A 5LCWC 2XZTG 3UINC 1N4PA 1HFAA 2VYIA 3CLJA 4AXHA 4GZCA 5EDSA 3HXBA 1Z3XA 2ETAA 3Q7FA 4APFA 4KBQA 3U9WA 1KT0A 3T5XA 3PVLA 3PNLB 1IHBA 5B1BE 5ENRD 4UWKA 4CT0A 4G8KA 1ZB1A 1OCCE 3CVPA 4JPSA 3U66A 2PL2A 2DVWA 4A3VA 4UQXA 5LP0A 4LNGA 4CZ2D 2XGOA 3EIQC 4A63B 4RSYA 5G2NA 3MV2B 1MX4A 4L23A 4N3BA 5KJMA 3ZYKA 5LFAA 2VGXA 3EJNA 3FEXA 4AY5A 2BEDA 2IF4A 5H7PA 5J08A 2WXLA 2XRYA 3QWPA 3VTXA 3CQGB 3RIBA 4GYOA 3GZSA 2P58C 3FFLA 3MZLB 1K8KG 3LPZA 4NACA 5EKQD 4N5QA 4O60A 1DC2A 1H2UA 1TR4A 4MLPA 4EHMA 3FWVA 2CHWA 5EN5D 2XPYA 5CCMA 1IYGA 4HRMB 2MYOA 4GZ6A 4BSXA 1IXVA 2DBAA 3Q5MA 3KEZA 3TWQA 3ASNE 3AG3E 5FTPA 4I1AA 3OXFA 3MX3A 2IY0C 3HG0D 3FP3A 3RO2A 3I4GA 3MJWA 5JA4D 2IFUA 4AM9A 1JWFA 2VSNA 3LXUX 1TJFA 2PQNA 1V54E 3ML9A 4A1SA 5FZRA 4GMLA 5CMWA 4AOFA 3PH0C 2UY1A 3EU9A 4X8QA 3IV0A 4I43A 2P9UG 1QZ2A 1N52A 2X6IA 3TJPA 3NF1A 3MYVA 4BTBA 1KLXA 1DNPA 4N39A 4IULA 3PRZA 4WUYA 3C3RA 5ENTD 1TNZA 1Q2ZA 2J4BA 3TL5A 1U3DA 3FTVA 1YA0A 3ASHA 2P9NG 3LJ3A 4Y6WA 2WXNA 1OT8A 1OWOA 1NA3A 2J08A 4U0UA 5HI7A 3FU3A 5HS0A 4B94A 4EBAG 5DIZA 5CERB 5LOZA 2VGEA 4FA6A 4AP2A 3MCXA 2DCPA 3ENEA 1H2VC 1E8YA 5CBOA 1HO8A 3LJNA 2UWJG 4Q94A 3IHVA 4NRHB 2M63A 2F0YA 5AQAA 2XGMA 2HR2A 3ASFA 5FQ8A 4JW1A 4JEUA 5LCWJ 3G2VA 3V2XA 4UWLA 2LSVA 3NOGD 1HE8A 4JC8A 1WY6A 4URKA 3F6QA 3TXNA 4AVXA 2CG3A 5E75A 1MYOA 3OXLA 1N0QA 4DUIA 4GTOA 5J90A 3J5PA 1TN8A 3LY7A 3ZUVB 3FUHA 1A5EA 3ZKJA 3D9HA 2I6HA 2DYSE 3OXGA 4KVOA 5JJ7A 4BT9A 3IBEA 4FHJA 4HOQA 4WWOA 1HG5A 3ZXPA 5EIBE 2IU1A 3APFA 1Z6TA 1TNBA 3FUMA 3PUJA 4MBGA 5FZQA 3R9MA 3KSQA 3FUJA 3DSTA 2C0MA 5FT9A 3V79K 3LEWA 2AW6A 5ENSD 4XEIG 3R7QA 2IO3C 5EIDA 3PNTB 4Q96A 2VGYA 3QWVA 4CRWA 4CEMA 1QYMA 2UY1B 2HYZA 3NZUA 2KC7A 1JPLA 1TYQG 3CGHA 3S7FA 4PS8A 3V31A 5BV1A 1O1TA 2R03A 2IO2C 3DXMG 4AIFA 4WNDA 2WXKA 3CK8A 3D3MA 2P9PG 5A7DB 1X5BA 3NBNB 5ANRA 4GTSA 2Q7FA 2OVBA 3ZGQA 4GZ3A 4U0ZA 2LO6A 3L82A 4TV3A 2WXMA 2X38A 1N9AA 4HVBA 3CHMA 1ELWA 4ZFHA 1BLXB 3D9MA 3HYMB 3SI5A 4UI9K 3B7SA 4NIKA 4GYWA 2XRZA 1N4QA 3OAWA 2AXZA 1ELRA 4EZJA 3Q4AB 4CDRA 5FQ4A 3MEKA 1NFIE 5AQ9A 1JWGA 3VLEA 1H0AA 3ULEG 3D9JA 3UM0A 2NXPA 5FINA 3RAUA 4LNBA 1H6PA 3ABKE 3Q73A 1EDUA 3E30A 4BTAA 3Q9UC 3C3OA 4JL0A 4ABNA 2GGFA 3AS5A 2A4ZA 3EHRA 3EIJA 2H6FA 2EQXA 2QC9A 2WXGA 2IQCA 3HVEA 3RRMB 3FTSA 4XIFA 2E0IA 3DRAA 2GRNB 1Z3YA 4IYPA 3HXCA 5CEDB 4IRUA 3IKOB 1SA5A 2CHXA 3RK6A 2V5QC 3DSVA 3FDHA 1Z5SC 1FCHA 3ZVVA 5CHEE 2PZIA 4JB8P 3G2WA 1HX8A 4LG6A 4DX6D 5BT1A 3Q15A 1BI8B 2P2CP 3D9PA 2ZIRA 3TG4A 1QQEA 3URZA 4B8AA 2KBXA 4GPKA 4G24A 3W9GA 3B7TA 3ZHEB 2ZGGA 1LTXA 3FU6A 3S7BA 3CEQA 3EHQA 1KPSB 3LS8A 2KCLA 1FT2A 5BXOA 1O1RA 3CKCA 4CT4A 1DCEA 3BUAA 4LCTA 3G2UA 2IEJA 1QNFA 4JA9A 1OWNA 2WXIA 1WDYA 4OVUA 2YHEA 4U8HA 3J5QB 4KYOB 3ASOE 3EDTB 2LNIA 2FO1E 4J8YA 1GW6A 1AWCB 1BPOA 4HRNA 2QFCA 3VLFA 5BPPA 3E32A 4RG6A 3PZ2A 3D9KA 2EIKE 2XEVA 2Y4UA 3CSTA 3DBSA 3DSXA 4JHJA 4JXTA 4AV7A 4XX5A 3ZHEA 5AQBA 2KCVA 1JUQA 3T5VA 3SD5A 1OCZE 1UG3A 3L16A 3S2AA 2LAIA 2QYUA 2YINA 1WM5A 2KATA 4GCNA 2ZU6B 1TEZA 1FVHA 3UIOC 2XHEA 4XE0A 2J9QA 1N11A 2LAHA 3GW4A 1MJ0A 1TNUA 1RZ4A 3FTUA 4JHKA 2L0TB 3DXKG 2XCCA 2XEHA 3Q78A 3JUEA 2KXPC 2IJGX 3HHMA 4PS7A 1S63A 2RFMA 3O4ZA 4M3OA 4ILGA 1HH8A 4LRZA 4EBAA 3QDNA 3UI2A 3C3QA 2WVIA 3PE4A 2QZAA 4DPRA 4GTPA 3KS2A 3FTWA 1O5MA 3TWTA 1ELKA 2NSZA 4JZYA 4N5CA 3CVVA 4YNDA 3AU4A 3JQ1A 3N71A 3CQCB 1HS6A 3D9OA 2Y1LE 1ZBPA 1SA4A 3L22A 5BV0A 5BXUA 4G23A 4GCOA 1D9SA 4UI9C 4U04A 2CG2A 1NL4A 1N4SA 4GZDA 2MRIA 2OCCE 3MA5A 4TXRA 3LCAA 5AENA 1S64A 4U07A 4F1PA 3Q9NC 3MKQA 4G26A 3ZYQA 4JD2G 2XENA 4GYYA 2VTBB 4BEPA 3TWUA 3IHYA 4UI9J 1OY3D 2Y3AA 3P2BA 4FULA 2A5EA 2B6CA 3ZEFA 4YDWA 1P5QA 3PUKA 4P29A 3TG5A 1PY1A 2DZNA 4U96D 3QARA 3ONKA 3G2TA 3ABLE 3AU5A 3LYAA 2CFUA 2C0LA 3Q47B 2J49A 2IOSA 2V0PA 4QQIA 1K1AA 2H6HA 1JCRA 3RRNB 2WPVA 3FU0A 3CHPA 2ZXWE 4D10C 2E2EA 1OCRE 3MGBA 2VQ2A 2VSXE 4BSZB 2PNNA 4OVVA 1H19A 4XKBA 3PZ1A 3SZ7A 4M7CA 3ZU7B 5CECB 2WM9A 2GRRB 4DK5A 4TUMA 4FU3A 3TAXA 2WMNA 4YVOA 1TNYA 1SW6A 3QB2A 4N2SA 3LDZA 3ZIMA 4BT8A 3CHSA 5CEAA 4XI9A 4UWFA 4K03A 4H7YA 3FHEA 3UT8A 1E8WA 1MHQA 1SVXA 5EYLA 4U7EB 3V2OA 1A17A 4BX9A 2L6BA 1UN9A 4Q69A 2EINE 1LD7A 3FUNA 1S0PA 2H6GA 2X6FA 1N0RA 3Q79A 2VJ8A 2ZISA 4HLLA 5A23A 4APOA 4L7TA 3IEGA 4L9PA 5HKPA 1Y8MA 2P9KG 1XGWA 3ASGA 3TWXA 3W9FA 3L6AA 4I6JA 1HG2A 4J8DA 4BETA 4I17A 2XQ0A 4PUCA 4FADA 4FC8A 1XNFA 1N4RA 2C2LA 3ASDA 3TWWA 4N3AA 4AJWA 2I1KA 3D9LA 1Y6IA 2EIJE 4FJZA 4CYMD 3OTNA 3QC1A 2YHCA 2V4LA 3SHFA 1KZPA 2KZTB 3KSLA 4UWHA 2A5UA 1SZAA 2IONA 3AAAC 3HDXA 4UUCA 5FZSA 3HIZA 2QYJA 3RSEG 5CRVA 5D0OD 2BUGA 3ESKA 3FTZA 2XEEA 1MQSA 4HRLA 1YYHA 3JUIA 4F7AA 4DX1A 4U63A 5FWQA 5A6CA 3EUVA 4LERA 3UM1A 3FUDA 5CBNA 2WXFA 2B0OE 5BW8C 4EQFA 2WXPA 3SF4A 3ZW3A 1FVFA 2LXMA 3EHNA 3ISMC 5D0QD 4O6FA 4KZ0A 3BQOA 1AP7A 1N94A 3L17A 1NZNA 3AS4A 3C72A 4PS3A 1U3CA 1WG0A 3B7RL 4GA0A 3MV3B 1E8ZA 1IQUA 2XPIA 4WNGA 4LUNU 4PDXA 4U0SA 4GA1A 2GROB 4F53A 1MX6A 3B7UX 1EF1C 3K9IA 2HO1A 2WB2A 2KM4A 3Q75A 5E76A 4C0MA 5EYPF 3U4TA 1UN8A 5G05J 2VGXB 1TJCA 4ATZD 4DLOA 3DEOA 4TXPA 2BKKB 4CDMA 3FUKA 2J8SD 4XKCA 1PC2A 3LVRE 3NZSA 2QY7A 2OV8A 4K5AB 2GRPB 2I9CA 2WMOA 3LVQE 1BD8A 2NYJA 4WWPA 3RRUA 4CGWA 2FBNA 1UW4B 2XS1A 4FHKA 3FH7A 4I1MA 2JABA 3L54A 5DBKA 1HZ4A 1E7UA 2X3MA 1YCSB 4MS6A 2V8SE 3RJVA 4C0EA 5FIOA 2Y69E 3BG1B 4FP7A 2WXRA 3X2QE 4EPZA 4B8CB 4WWNA 3PE3A 4CGVA 3E4BA 4RVBA 3KEAA 4QFVA 4ILIA 3AJIA 1OCOE 1JCQA 4ACKA 2WQHA 4I6GA 4DX5D 2AJAA 3I5PA 4GTRA 3DEPA 3QOUA 2DIWA 3U64A 2XS8A 1QBQA 3NOCD 5AJLA 1VDYA 3APCA 4DI3A 3ONLA 4GTTA 3CVYA 4J7WA 3CK9A 3S7DA 2VTBA 1MX2A 1NP7A 2OEWA 3DSUA 3FY4A 4MRUA 3SGHA 4G1TA 4J0UA 5T4YA 3TXMA 4N2QA 4G8LA 1B89A 3KD7A 1INZA 3ZRHA 4DX7D 2NC9A 5FJYA 1FT1A 1LD8A 3T8MA 4JVSA 3ZXSA 2LUHA 3PS6A 3JYSA 4RLYA 2ZGDA 5ARFA 3QK0A 1W3BA 4K5CA 1IQRA 5KJLA 3I4RB 3CK7A 1DVPA 2GRMA 3IXEA 1IHGA 3HRAA 5BNWA 5BUZA 2X6HA 3HXEA 4H7XA 3FTXA 3UTMA 3HXDA 3LY9A 2XPZA 4LSZE 4DLQA 2VSOE 2R02A 3DSWA 1HU3A 2F8YA 5EILA 4W9RA 4A55A 2P9SG 4WAFA 2EIME 4L1BA 4PH4B 5B3SE 1UJKA 2R2LA 2Y0BG 4U8VD 5FQ6A 3CHQA 3LY8A 4EECA 3CIAA 2OOEA 3FUEA 5JJTA 4C9BB 4J8EA 1YMPA 3NB2A 3O48A 1FPPA 3SBTB 1EYHA 4HB5A 4XZ4A 1TN6A 1HXIA 4F1SA 3CKBA 4LEUA 4A1GA 3ULYA 3B13A 2ETCA 5KWDA 3UMVA 4BX8A 5JHAA 3MKQB 2YNQA 4HXIA 2F8XK 4GPMA 4LNUD 1D8EA 2KZTA 3D9IA 2JEKA 3HXFA 5C1DA 4RG9A 5B1AE 1S70B 2CFZA 1LF8A 1RW2A 4HOUA 4UWGA 2EILE 2Y4TA 3WXXA 4YDEA 3JXIA 5HQ8A 3CHRA 4EZKA 4NURA 3SQVA 3FEYA 1K1BA 2DZOA 3LKUA 2J09A 2FULA 4HOTA 3ABME 3CR3A 1OWPA 4B0ZA 2P9IG 4BFRA 4NQ0A 4HQDA 3UT4A 1BU9A 1WAO1 4CDNA 2R05A 3FTYA 2PM6A 5CRUA 4G11A 5AYWD 3GZ1A 3TWRA 1OWLA 5G04J 2WXQA 5AQ7A 4U95D 3CVLA 3TWVA 2ILRA 2F37A 5ENPD 2FI7A 3CV0A 3MKRA 5ANLA 3ZN3A 4DI4A 3NAWA 3RO3A 3UM3A 3GYZA 4I6EA 1G3NB 4GB9A 4HFGA 5CMYA 4JA7A 2JLBA 4OAUC 2FF4A 2OEVA 3B7BA 3U3WA 1E90A 3DPDA 2LSUA 4K5BA 1H6OA 3ML8A 3UUXA 4L2LA 3DPYA 4GTVA 2LXLA 2X6KA 1OXJA 1NI1A 3CVNA 2V4HC
chains in the Genus database with same CATH topology
1TNOA 1TNUA 3E37A 3PZ3A 1LD7A 1TNBA 2H6GA 1JCSA 4MBGA 1LTXA 3KSQA 1N94A 3DSTA 3Q78A 3HXEA 1TN7A 2BEDA 3C72A 3Q79A 2ZISA 1S63A 4YDEA 3HXDA 1FT2A 1D8DA 1O1RA 3Q7AA 1TNZA 1MZCA 4LNBA 3DSWA 3Q73A 4L9PA 3EU5A 3E30A 1DCEA 4GTQA 2IEJA 4GTPA 1JCQA 2H6HA 1JCRA 3SFYA 4GTRA 1O5MA 1X81A 4EHMA 3DSSA 2R2LA 1N4RA 1QBQA 2H6FA 1O1SA 1O1TA 2H6IA 3E33A 4GTMA 4GTTA 3E32A 3PZ2A 3Q75A 3SFXA 3PZ1A 3DSXA 1KZPA 1SA4A 3PZ4A 3KSLA 3DRAA 3DSUA 3HXCA 2F0YA 4GTSA 1FPPA 4YDOA 1N4PA 1SA5A 1NL4A 1TN6A 3HXBA 1N4SA 3Q7FA 3DSVA 1N9AA 1TNYA 1FT1A 1LD8A 1KZOA 1S64A 4GTOA 1TN8A 3DPYA 4GTVA 1NI1A 1N4QA 3EUVA 3E34A 1D8EA 4LNGA 3HXFA 1N95A 2ZIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNO A;  1TNU A;  3E37 A;  3PZ3 A;  1LD7 A;  1TNB A;  2H6G A;  1JCS A;  4MBG A;  1LTX A;  3KSQ A;  1N94 A;  3DST A;  3Q78 A;  3HXE A;  1TN7 A;  2BED A;  3C72 A;  3Q79 A;  2ZIS A;  1S63 A;  4YDE A;  3HXD A;  1FT2 A;  1D8D A;  1O1R A;  3Q7A A;  1TNZ A;  1MZC A;  4LNB A;  3DSW A;  3Q73 A;  4L9P A;  3EU5 A;  3E30 A;  1DCE A;  4GTQ A;  2IEJ A;  4GTP A;  1JCQ A;  2H6H A;  1JCR A;  3SFY A;  4GTR A;  1O5M A;  1X81 A;  4EHM A;  3DSS A;  2R2L A;  1N4R A;  1QBQ A;  2H6F A;  1O1S A;  1O1T A;  2H6I A;  3E33 A;  4GTM A;  4GTT A;  3E32 A;  3PZ2 A;  3Q75 A;  3SFX A;  3PZ1 A;  3DSX A;  1KZP A;  1SA4 A;  3PZ4 A;  3KSL A;  3DRA A;  3DSU A;  3HXC A;  2F0Y A;  4GTS A;  1FPP A;  4YDO A;  1N4P A;  1SA5 A;  1NL4 A;  1TN6 A;  3HXB A;  1N4S A;  3Q7F A;  3DSV A;  1N9A A;  1TNY A;  1FT1 A;  1LD8 A;  1KZO A;  1S64 A;  4GTO A;  1TN8 A;  3DPY A;  4GTV A;  1NI1 A;  1N4Q A;  3EUV A;  3E34 A;  1D8E A;  4LNG A;  3HXF A;  1N95 A;  2ZIR A; 
#chains in the Genus database with same CATH topology
 3UXG A;  3FH8 A;  5AAO A;  5JJ6 A;  3S7J A;  3C5R A;  4OYS A;  3PZ3 A;  3FUF A;  4K0R A;  3QNK A;  5AJD A;  1ZU2 A;  4HOS A;  3R9A B;  4KXK B;  3VTY A;  4DJA A;  2RFA A;  2WXH A;  5JHB A;  4ANU A;  3C98 A;  2DWZ A;  3L13 A;  4GZ5 A;  4Y6C A;  5D2M C;  4BER A;  1E7V A;  4UQZ A;  2I1J A;  1SQM A;  3ESL A;  2WXJ A;  4J8F A;  3P1U A;  3E33 A;  4ANX A;  3D9N A;  4MKT A;  3CVX A;  3CVQ A;  5ITZ F;  1L5J A;  4IN3 B;  5G04 C;  3DWL G;  5ARG A;  3FU5 A;  4ANW A;  2RD0 A;  3UIP C;  3WG7 E;  4V3I A;  3T8K A;  4TRQ A;  3G2S A;  4TXQ A;  1OUV A;  2KCK A;  4ZHB A;  1UOH A;  1SZ9 A;  5KCM A;  5JMN D;  3QKY A;  3UM2 A;  3CVU A;  1U2V G;  3AG1 E;  4DX2 A;  4Z68 A;  3QAQ A;  3ULQ A;  1TNO A;  2BTD A;  5FQ7 A;  3UKU G;  3PDN A;  1JCS A;  1DCQ A;  4HS2 A;  4GA2 A;  3BG0 B;  1UJJ A;  3TGO A;  4I1O B;  4EZL A;  5KNG A;  2GRQ B;  3CSF A;  1K3Z D;  3Q7A A;  4I2Z A;  1MZC A;  4FLH A;  3KAE A;  2GW1 A;  1PAQ A;  4ME2 A;  4I9E A;  4JEH A;  4WNE A;  2WXO A;  2BKG A;  3BEE A;  1NA0 A;  2YQ8 A;  3SFY A;  5CCL A;  2MOW A;  2AXU A;  4GU5 A;  4WNF A;  3UQ3 A;  1IKN D;  4YVQ C;  4HBD A;  3SFX A;  3SFZ A;  1OWM A;  3VLD A;  5KBA A;  1N54 A;  4CCA A;  4BES A;  1KT1 A;  3PRE A;  4HI8 A;  4ILH B;  4C48 B;  5G05 C;  2HM8 A;  1H6K A;  2PQR A;  4YDO A;  5AAR A;  3L08 A;  2WQ7 A;  3I3N A;  3V30 A;  2AVP A;  2VSY A;  4U8Y D;  2L6J A;  3FH5 A;  4ACL A;  1KZO A;  4ATG A;  2DYR E;  4DRX E;  3ZNG A;  2OND A;  5EX3 A;  4FJY A;  2AWI A;  3E34 A;  3NQP A;  5D66 A;  3AG4 E;  3UPV A;  3BU8 A;  4BY6 A;  3FUI A;  4GMJ A;  3E37 A;  4AEZ C;  5KJK A;  3ZYL A;  2ETB A;  3AS8 A;  4E6H A;  4HLE A;  4G25 A;  2RKK A;  1TN7 A;  4HNA D;  4ANV A;  1BI7 B;  2I2O A;  4I2W A;  1E96 B;  3QJZ A;  3ZPJ A;  4BWR A;  4L2Y A;  2MHK A;  4I9C A;  4KZC A;  3T9K A;  5AIJ A;  4GTQ A;  5T3R A;  3ZFW A;  3JCK C;  5AN8 A;  3HVE B;  5G55 A;  1X81 A;  5ENQ D;  4O1O A;  4O1P A;  3RKV A;  2GRL A;  1O1S A;  4KVM A;  2FO7 A;  1EPU A;  3SNX A;  4TUU A;  4GTM A;  5IY5 E;  3PEU B;  2J4D A;  2WQ6 A;  2L0I A;  5EX0 A;  3JQ0 A;  3PZ4 A;  2RG8 A;  3FUL A;  2XZD G;  2R17 C;  3JXJ A;  3AG2 E;  4AY6 A;  3EHM A;  4XI0 A;  3UKR G;  4A3T A;  4HOR A;  3SY2 A;  3R7R A;  3TWS A;  4F6R D;  2FEZ A;  3UX4 A;  4KMO A;  4HI9 A;  4R7L A;  4YDY A;  3SO8 A;  3QWW A;  3CVW A;  4OAV B;  1N95 A;  2J07 A;  1E8X A;  4JHR A;  4J8S A;  2L9B A;  4B93 B;  4GAA A;  5LX8 A;  2R59 A;  4FLB A;  4E85 A;  5ENO D;  3Q49 B;  1D8D A;  5C2Y A;  2XCB A;  4B89 A;  4GMR A;  4N3C A;  4UQY A;  5M72 A;  3EU5 A;  3L9T A;  3RU0 A;  2V5F A;  4G2V A;  5KJN A;  3PEV B;  5ENN A;  3DSS A;  2CHZ A;  2HE0 A;  4KT6 B;  1HF8 A;  3SBS A;  4J6I A;  2AXV A;  2XGS A;  5KNH D;  1H2T C;  2P9L G;  3PZD A;  2H6I A;  2OVF A;  2IOL A;  5HRY A;  5T8I A;  3APD A;  2PM7 A;  3CHO A;  2X6J A;  1V55 E;  2R5S A;  3GZ2 A;  3ZYM A;  3UT7 A;  4F3V A;  4RQI A;  2BF0 X;  3B95 A;  5LCW C;  2XZT G;  3UIN C;  1N4P A;  1HFA A;  2VYI A;  3CLJ A;  4AXH A;  4GZC A;  5EDS A;  3HXB A;  1Z3X A;  2ETA A;  3Q7F A;  4APF A;  4KBQ A;  3U9W A;  1KT0 A;  3T5X A;  3PVL A;  3PNL B;  1IHB A;  5B1B E;  5ENR D;  4UWK A;  4CT0 A;  4G8K A;  1ZB1 A;  1OCC E;  3CVP A;  4JPS A;  3U66 A;  2PL2 A;  2DVW A;  4A3V A;  4UQX A;  5LP0 A;  4LNG A;  4CZ2 D;  2XGO A;  3EIQ C;  4A63 B;  4RSY A;  5G2N A;  3MV2 B;  1MX4 A;  4L23 A;  4N3B A;  5KJM A;  3ZYK A;  5LFA A;  2VGX A;  3EJN A;  3FEX A;  4AY5 A;  2BED A;  2IF4 A;  5H7P A;  5J08 A;  2WXL A;  2XRY A;  3QWP A;  3VTX A;  3CQG B;  3RIB A;  4GYO A;  3GZS A;  2P58 C;  3FFL A;  3MZL B;  1K8K G;  3LPZ A;  4NAC A;  5EKQ D;  4N5Q A;  4O60 A;  1DC2 A;  1H2U A;  1TR4 A;  4MLP A;  4EHM A;  3FWV A;  2CHW A;  5EN5 D;  2XPY A;  5CCM A;  1IYG A;  4HRM B;  2MYO A;  4GZ6 A;  4BSX A;  1IXV A;  2DBA A;  3Q5M A;  3KEZ A;  3TWQ A;  3ASN E;  3AG3 E;  5FTP A;  4I1A A;  3OXF A;  3MX3 A;  2IY0 C;  3HG0 D;  3FP3 A;  3RO2 A;  3I4G A;  3MJW A;  5JA4 D;  2IFU A;  4AM9 A;  1JWF A;  2VSN A;  3LXU X;  1TJF A;  2PQN A;  1V54 E;  3ML9 A;  4A1S A;  5FZR A;  4GML A;  5CMW A;  4AOF A;  3PH0 C;  2UY1 A;  3EU9 A;  4X8Q A;  3IV0 A;  4I43 A;  2P9U G;  1QZ2 A;  1N52 A;  2X6I A;  3TJP A;  3NF1 A;  3MYV A;  4BTB A;  1KLX A;  1DNP A;  4N39 A;  4IUL A;  3PRZ A;  4WUY A;  3C3R A;  5ENT D;  1TNZ A;  1Q2Z A;  2J4B A;  3TL5 A;  1U3D A;  3FTV A;  1YA0 A;  3ASH A;  2P9N G;  3LJ3 A;  4Y6W A;  2WXN A;  1OT8 A;  1OWO A;  1NA3 A;  2J08 A;  4U0U A;  5HI7 A;  3FU3 A;  5HS0 A;  4B94 A;  4EBA G;  5DIZ A;  5CER B;  5LOZ A;  2VGE A;  4FA6 A;  4AP2 A;  3MCX A;  2DCP A;  3ENE A;  1H2V C;  1E8Y A;  5CBO A;  1HO8 A;  3LJN A;  2UWJ G;  4Q94 A;  3IHV A;  4NRH B;  2M63 A;  2F0Y A;  5AQA A;  2XGM A;  2HR2 A;  3ASF A;  5FQ8 A;  4JW1 A;  4JEU A;  5LCW J;  3G2V A;  3V2X A;  4UWL A;  2LSV A;  3NOG D;  1HE8 A;  4JC8 A;  1WY6 A;  4URK A;  3F6Q A;  3TXN A;  4AVX A;  2CG3 A;  5E75 A;  1MYO A;  3OXL A;  1N0Q A;  4DUI A;  4GTO A;  5J90 A;  3J5P A;  1TN8 A;  3LY7 A;  3ZUV B;  3FUH A;  1A5E A;  3ZKJ A;  3D9H A;  2I6H A;  2DYS E;  3OXG A;  4KVO A;  5JJ7 A;  4BT9 A;  3IBE A;  4FHJ A;  4HOQ A;  4WWO A;  1HG5 A;  3ZXP A;  5EIB E;  2IU1 A;  3APF A;  1Z6T A;  1TNB A;  3FUM A;  3PUJ A;  4MBG A;  5FZQ A;  3R9M A;  3KSQ A;  3FUJ A;  3DST A;  2C0M A;  5FT9 A;  3V79 K;  3LEW A;  2AW6 A;  5ENS D;  4XEI G;  3R7Q A;  2IO3 C;  5EID A;  3PNT B;  4Q96 A;  2VGY A;  3QWV A;  4CRW A;  4CEM A;  1QYM A;  2UY1 B;  2HYZ A;  3NZU A;  2KC7 A;  1JPL A;  1TYQ G;  3CGH A;  3S7F A;  4PS8 A;  3V31 A;  5BV1 A;  1O1T A;  2R03 A;  2IO2 C;  3DXM G;  4AIF A;  4WND A;  2WXK A;  3CK8 A;  3D3M A;  2P9P G;  5A7D B;  1X5B A;  3NBN B;  5ANR A;  4GTS A;  2Q7F A;  2OVB A;  3ZGQ A;  4GZ3 A;  4U0Z A;  2LO6 A;  3L82 A;  4TV3 A;  2WXM A;  2X38 A;  1N9A A;  4HVB A;  3CHM A;  1ELW A;  4ZFH A;  1BLX B;  3D9M A;  3HYM B;  3SI5 A;  4UI9 K;  3B7S A;  4NIK A;  4GYW A;  2XRZ A;  1N4Q A;  3OAW A;  2AXZ A;  1ELR A;  4EZJ A;  3Q4A B;  4CDR A;  5FQ4 A;  3MEK A;  1NFI E;  5AQ9 A;  1JWG A;  3VLE A;  1H0A A;  3ULE G;  3D9J A;  3UM0 A;  2NXP A;  5FIN A;  3RAU A;  4LNB A;  1H6P A;  3ABK E;  3Q73 A;  1EDU A;  3E30 A;  4BTA A;  3Q9U C;  3C3O A;  4JL0 A;  4ABN A;  2GGF A;  3AS5 A;  2A4Z A;  3EHR A;  3EIJ A;  2H6F A;  2EQX A;  2QC9 A;  2WXG A;  2IQC A;  3HVE A;  3RRM B;  3FTS A;  4XIF A;  2E0I A;  3DRA A;  2GRN B;  1Z3Y A;  4IYP A;  3HXC A;  5CED B;  4IRU A;  3IKO B;  1SA5 A;  2CHX A;  3RK6 A;  2V5Q C;  3DSV A;  3FDH A;  1Z5S C;  1FCH A;  3ZVV A;  5CHE E;  2PZI A;  4JB8 P;  3G2W A;  1HX8 A;  4LG6 A;  4DX6 D;  5BT1 A;  3Q15 A;  1BI8 B;  2P2C P;  3D9P A;  2ZIR A;  3TG4 A;  1QQE A;  3URZ A;  4B8A A;  2KBX A;  4GPK A;  4G24 A;  3W9G A;  3B7T A;  3ZHE B;  2ZGG A;  1LTX A;  3FU6 A;  3S7B A;  3CEQ A;  3EHQ A;  1KPS B;  3LS8 A;  2KCL A;  1FT2 A;  5BXO A;  1O1R A;  3CKC A;  4CT4 A;  1DCE A;  3BUA A;  4LCT A;  3G2U A;  2IEJ A;  1QNF A;  4JA9 A;  1OWN A;  2WXI A;  1WDY A;  4OVU A;  2YHE A;  4U8H A;  3J5Q B;  4KYO B;  3ASO E;  3EDT B;  2LNI A;  2FO1 E;  4J8Y A;  1GW6 A;  1AWC B;  1BPO A;  4HRN A;  2QFC A;  3VLF A;  5BPP A;  3E32 A;  4RG6 A;  3PZ2 A;  3D9K A;  2EIK E;  2XEV A;  2Y4U A;  3CST A;  3DBS A;  3DSX A;  4JHJ A;  4JXT A;  4AV7 A;  4XX5 A;  3ZHE A;  5AQB A;  2KCV A;  1JUQ A;  3T5V A;  3SD5 A;  1OCZ E;  1UG3 A;  3L16 A;  3S2A A;  2LAI A;  2QYU A;  2YIN A;  1WM5 A;  2KAT A;  4GCN A;  2ZU6 B;  1TEZ A;  1FVH A;  3UIO C;  2XHE A;  4XE0 A;  2J9Q A;  1N11 A;  2LAH A;  3GW4 A;  1MJ0 A;  1TNU A;  1RZ4 A;  3FTU A;  4JHK A;  2L0T B;  3DXK G;  2XCC A;  2XEH A;  3Q78 A;  3JUE A;  2KXP C;  2IJG X;  3HHM A;  4PS7 A;  1S63 A;  2RFM A;  3O4Z A;  4M3O A;  4ILG A;  1HH8 A;  4LRZ A;  4EBA A;  3QDN A;  3UI2 A;  3C3Q A;  2WVI A;  3PE4 A;  2QZA A;  4DPR A;  4GTP A;  3KS2 A;  3FTW A;  1O5M A;  3TWT A;  1ELK A;  2NSZ A;  4JZY A;  4N5C A;  3CVV A;  4YND A;  3AU4 A;  3JQ1 A;  3N71 A;  3CQC B;  1HS6 A;  3D9O A;  2Y1L E;  1ZBP A;  1SA4 A;  3L22 A;  5BV0 A;  5BXU A;  4G23 A;  4GCO A;  1D9S A;  4UI9 C;  4U04 A;  2CG2 A;  1NL4 A;  1N4S A;  4GZD A;  2MRI A;  2OCC E;  3MA5 A;  4TXR A;  3LCA A;  5AEN A;  1S64 A;  4U07 A;  4F1P A;  3Q9N C;  3MKQ A;  4G26 A;  3ZYQ A;  4JD2 G;  2XEN A;  4GYY A;  2VTB B;  4BEP A;  3TWU A;  3IHY A;  4UI9 J;  1OY3 D;  2Y3A A;  3P2B A;  4FUL A;  2A5E A;  2B6C A;  3ZEF A;  4YDW A;  1P5Q A;  3PUK A;  4P29 A;  3TG5 A;  1PY1 A;  2DZN A;  4U96 D;  3QAR A;  3ONK A;  3G2T A;  3ABL E;  3AU5 A;  3LYA A;  2CFU A;  2C0L A;  3Q47 B;  2J49 A;  2IOS A;  2V0P A;  4QQI A;  1K1A A;  2H6H A;  1JCR A;  3RRN B;  2WPV A;  3FU0 A;  3CHP A;  2ZXW E;  4D10 C;  2E2E A;  1OCR E;  3MGB A;  2VQ2 A;  2VSX E;  4BSZ B;  2PNN A;  4OVV A;  1H19 A;  4XKB A;  3PZ1 A;  3SZ7 A;  4M7C A;  3ZU7 B;  5CEC B;  2WM9 A;  2GRR B;  4DK5 A;  4TUM A;  4FU3 A;  3TAX A;  2WMN A;  4YVO A;  1TNY A;  1SW6 A;  3QB2 A;  4N2S A;  3LDZ A;  3ZIM A;  4BT8 A;  3CHS A;  5CEA A;  4XI9 A;  4UWF A;  4K03 A;  4H7Y A;  3FHE A;  3UT8 A;  1E8W A;  1MHQ A;  1SVX A;  5EYL A;  4U7E B;  3V2O A;  1A17 A;  4BX9 A;  2L6B A;  1UN9 A;  4Q69 A;  2EIN E;  1LD7 A;  3FUN A;  1S0P A;  2H6G A;  2X6F A;  1N0R A;  3Q79 A;  2VJ8 A;  2ZIS A;  4HLL A;  5A23 A;  4APO A;  4L7T A;  3IEG A;  4L9P A;  5HKP A;  1Y8M A;  2P9K G;  1XGW A;  3ASG A;  3TWX A;  3W9F A;  3L6A A;  4I6J A;  1HG2 A;  4J8D A;  4BET A;  4I17 A;  2XQ0 A;  4PUC A;  4FAD A;  4FC8 A;  1XNF A;  1N4R A;  2C2L A;  3ASD A;  3TWW A;  4N3A A;  4AJW A;  2I1K A;  3D9L A;  1Y6I A;  2EIJ E;  4FJZ A;  4CYM D;  3OTN A;  3QC1 A;  2YHC A;  2V4L A;  3SHF A;  1KZP A;  2KZT B;  3KSL A;  4UWH A;  2A5U A;  1SZA A;  2ION A;  3AAA C;  3HDX A;  4UUC A;  5FZS A;  3HIZ A;  2QYJ A;  3RSE G;  5CRV A;  5D0O D;  2BUG A;  3ESK A;  3FTZ A;  2XEE A;  1MQS A;  4HRL A;  1YYH A;  3JUI A;  4F7A A;  4DX1 A;  4U63 A;  5FWQ A;  5A6C A;  3EUV A;  4LER A;  3UM1 A;  3FUD A;  5CBN A;  2WXF A;  2B0O E;  5BW8 C;  4EQF A;  2WXP A;  3SF4 A;  3ZW3 A;  1FVF A;  2LXM A;  3EHN A;  3ISM C;  5D0Q D;  4O6F A;  4KZ0 A;  3BQO A;  1AP7 A;  1N94 A;  3L17 A;  1NZN A;  3AS4 A;  3C72 A;  4PS3 A;  1U3C A;  1WG0 A;  3B7R L;  4GA0 A;  3MV3 B;  1E8Z A;  1IQU A;  2XPI A;  4WNG A;  4LUN U;  4PDX A;  4U0S A;  4GA1 A;  2GRO B;  4F53 A;  1MX6 A;  3B7U X;  1EF1 C;  3K9I A;  2HO1 A;  2WB2 A;  2KM4 A;  3Q75 A;  5E76 A;  4C0M A;  5EYP F;  3U4T A;  1UN8 A;  5G05 J;  2VGX B;  1TJC A;  4ATZ D;  4DLO A;  3DEO A;  4TXP A;  2BKK B;  4CDM A;  3FUK A;  2J8S D;  4XKC A;  1PC2 A;  3LVR E;  3NZS A;  2QY7 A;  2OV8 A;  4K5A B;  2GRP B;  2I9C A;  2WMO A;  3LVQ E;  1BD8 A;  2NYJ A;  4WWP A;  3RRU A;  4CGW A;  2FBN A;  1UW4 B;  2XS1 A;  4FHK A;  3FH7 A;  4I1M A;  2JAB A;  3L54 A;  5DBK A;  1HZ4 A;  1E7U A;  2X3M A;  1YCS B;  4MS6 A;  2V8S E;  3RJV A;  4C0E A;  5FIO A;  2Y69 E;  3BG1 B;  4FP7 A;  2WXR A;  3X2Q E;  4EPZ A;  4B8C B;  4WWN A;  3PE3 A;  4CGV A;  3E4B A;  4RVB A;  3KEA A;  4QFV A;  4ILI A;  3AJI A;  1OCO E;  1JCQ A;  4ACK A;  2WQH A;  4I6G A;  4DX5 D;  2AJA A;  3I5P A;  4GTR A;  3DEP A;  3QOU A;  2DIW A;  3U64 A;  2XS8 A;  1QBQ A;  3NOC D;  5AJL A;  1VDY A;  3APC A;  4DI3 A;  3ONL A;  4GTT A;  3CVY A;  4J7W A;  3CK9 A;  3S7D A;  2VTB A;  1MX2 A;  1NP7 A;  2OEW A;  3DSU A;  3FY4 A;  4MRU A;  3SGH A;  4G1T A;  4J0U A;  5T4Y A;  3TXM A;  4N2Q A;  4G8L A;  1B89 A;  3KD7 A;  1INZ A;  3ZRH A;  4DX7 D;  2NC9 A;  5FJY A;  1FT1 A;  1LD8 A;  3T8M A;  4JVS A;  3ZXS A;  2LUH A;  3PS6 A;  3JYS A;  4RLY A;  2ZGD A;  5ARF A;  3QK0 A;  1W3B A;  4K5C A;  1IQR A;  5KJL A;  3I4R B;  3CK7 A;  1DVP A;  2GRM A;  3IXE A;  1IHG A;  3HRA A;  5BNW A;  5BUZ A;  2X6H A;  3HXE A;  4H7X A;  3FTX A;  3UTM A;  3HXD A;  3LY9 A;  2XPZ A;  4LSZ E;  4DLQ A;  2VSO E;  2R02 A;  3DSW A;  1HU3 A;  2F8Y A;  5EIL A;  4W9R A;  4A55 A;  2P9S G;  4WAF A;  2EIM E;  4L1B A;  4PH4 B;  5B3S E;  1UJK A;  2R2L A;  2Y0B G;  4U8V D;  5FQ6 A;  3CHQ A;  3LY8 A;  4EEC A;  3CIA A;  2OOE A;  3FUE A;  5JJT A;  4C9B B;  4J8E A;  1YMP A;  3NB2 A;  3O48 A;  1FPP A;  3SBT B;  1EYH A;  4HB5 A;  4XZ4 A;  1TN6 A;  1HXI A;  4F1S A;  3CKB A;  4LEU A;  4A1G A;  3ULY A;  3B13 A;  2ETC A;  5KWD A;  3UMV A;  4BX8 A;  5JHA A;  3MKQ B;  2YNQ A;  4HXI A;  2F8X K;  4GPM A;  4LNU D;  1D8E A;  2KZT A;  3D9I A;  2JEK A;  3HXF A;  5C1D A;  4RG9 A;  5B1A E;  1S70 B;  2CFZ A;  1LF8 A;  1RW2 A;  4HOU A;  4UWG A;  2EIL E;  2Y4T A;  3WXX A;  4YDE A;  3JXI A;  5HQ8 A;  3CHR A;  4EZK A;  4NUR A;  3SQV A;  3FEY A;  1K1B A;  2DZO A;  3LKU A;  2J09 A;  2FUL A;  4HOT A;  3ABM E;  3CR3 A;  1OWP A;  4B0Z A;  2P9I G;  4BFR A;  4NQ0 A;  4HQD A;  3UT4 A;  1BU9 A;  1WAO 1;  4CDN A;  2R05 A;  3FTY A;  2PM6 A;  5CRU A;  4G11 A;  5AYW D;  3GZ1 A;  3TWR A;  1OWL A;  5G04 J;  2WXQ A;  5AQ7 A;  4U95 D;  3CVL A;  3TWV A;  2ILR A;  2F37 A;  5ENP D;  2FI7 A;  3CV0 A;  3MKR A;  5ANL A;  3ZN3 A;  4DI4 A;  3NAW A;  3RO3 A;  3UM3 A;  3GYZ A;  4I6E A;  1G3N B;  4GB9 A;  4HFG A;  5CMY A;  4JA7 A;  2JLB A;  4OAU C;  2FF4 A;  2OEV A;  3B7B A;  3U3W A;  1E90 A;  3DPD A;  2LSU A;  4K5B A;  1H6O A;  3ML8 A;  3UUX A;  4L2L A;  3DPY A;  4GTV A;  2LXL A;  2X6K A;  1OXJ A;  1NI1 A;  3CVN A;  2V4H C; 
#chains in the Genus database with same CATH homology
 1TNO A;  1TNU A;  3E37 A;  3PZ3 A;  1LD7 A;  1TNB A;  2H6G A;  1JCS A;  4MBG A;  1LTX A;  3KSQ A;  1N94 A;  3DST A;  3Q78 A;  3HXE A;  1TN7 A;  2BED A;  3C72 A;  3Q79 A;  2ZIS A;  1S63 A;  4YDE A;  3HXD A;  1FT2 A;  1D8D A;  1O1R A;  3Q7A A;  1TNZ A;  1MZC A;  4LNB A;  3DSW A;  3Q73 A;  4L9P A;  3EU5 A;  3E30 A;  1DCE A;  4GTQ A;  2IEJ A;  4GTP A;  1JCQ A;  2H6H A;  1JCR A;  3SFY A;  4GTR A;  1O5M A;  1X81 A;  4EHM A;  3DSS A;  2R2L A;  1N4R A;  1QBQ A;  2H6F A;  1O1S A;  1O1T A;  2H6I A;  3E33 A;  4GTM A;  4GTT A;  3E32 A;  3PZ2 A;  3Q75 A;  3SFX A;  3PZ1 A;  3DSX A;  1KZP A;  1SA4 A;  3PZ4 A;  3KSL A;  3DRA A;  3DSU A;  3HXC A;  2F0Y A;  4GTS A;  1FPP A;  4YDO A;  1N4P A;  1SA5 A;  1NL4 A;  1TN6 A;  3HXB A;  1N4S A;  3Q7F A;  3DSV A;  1N9A A;  1TNY A;  1FT1 A;  1LD8 A;  1KZO A;  1S64 A;  4GTO A;  1TN8 A;  3DPY A;  4GTV A;  1NI1 A;  1N4Q A;  3EUV A;  3E34 A;  1D8E A;  4LNG A;  3HXF A;  1N95 A;  2ZIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...