2R2LA

Structure of farnesyl protein transferase bound to pb-93
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyltransferase subunit alpha
publication title Efficacy, pharmacokinetics, and metabolism of tetrahydroquinoline inhibitors of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 124
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2r2lA00
1TN6A 3SFXA 1SA5A 3DSXA 3C72A 3SFYA 1O1SA 4LNBA 1FT1A 2H6GA 2H6HA 3PZ3A 1N4QA 1N4RA 4MBGA 1D8DA 1FT2A 2H6FA 3Q7AA 1N95A 4YDOA 1FPPA 2IEJA 2ZIRA 1SA4A 3E37A 4GTMA 1JCQA 3Q7FA 1TN7A 4GTVA 1N4SA 1LD7A 3HXEA 3HXCA 1TN8A 3EUVA 1S64A 1LTXA 2ZISA 4GTRA 3E30A 3E34A 4GTPA 3DSVA 3Q73A 1NL4A 4L9PA 3DSUA 3HXFA 1N4PA 3DSSA 3PZ2A 3E33A 1LD8A 4YDEA 1KZOA 1D8EA 4EHMA 1QBQA 1TNOA 3Q75A 3HXBA 3DRAA 1KZPA 3PZ4A 3KSLA 4GTSA 1X81A 3Q78A 1MZCA 1TNBA 3DPYA 1NI1A 4GTTA 1N9AA 3EU5A 3KSQA 1TNUA 3DSWA 3E32A 1TNYA 2H6IA 2R2LA 4GTQA 1DCEA 3HXDA 4LNGA 3PZ1A 1O1RA 1N94A 1JCRA 1S63A 1TNZA 1O1TA 3DSTA 3Q79A 4GTOA 1JCSA 2F0YA 1O5MA 2BEDA
chains in the Genus database with same CATH superfamily
2XQ0A 4WNFA 3FEYA 4RG9A 2H6GA 3MV2B 3ABKE 1BI7B 4TXQA 3ZYLA 3O48A 3MJWA 4C9BB 1JUQA 1S70B 1MX2A 4FJYA 1FPPA 2OVBA 4XEIG 3NOCD 4EZKA 1YCSB 3FTXA 3Q7FA 3QB2A 3ONKA 4CDRA 3OTNA 4YDYA 4F53A 3HXEA 3GW4A 4J8SA 2QFCA 2LSVA 4L9PA 2KZTB 3HXFA 3D9HA 4GYWA 4L2LA 5AQAA 2DWZA 5AN8A 4DX1A 3JUIA 2ETBA 2WXNA 1QNFA 3LJNA 4UUCA 1KPSB 2WM9A 4AM9A 1X81A 3VTXA 3FTSA 4EZLA 3Q9UC 4BERA 5HKPA 3CQGB 3KSQA 3TL5A 4TRQA 3SBSA 3QAQA 3UMVA 5HS0A 2KCLA 1IQUA 4GZCA 4RG6A 2V4HC 2AXVA 3W9GA 4KXKB 1HXIA 3UUXA 5FJYA 5C1DA 1BI8B 2WXRA 4JC8A 4HQDA 2WQ7A 3Q79A 3UI2A 2FI7A 3CSFA 4J8DA 2WXMA 3NAWA 2C2LA 4F1SA 1SA5A 3MV3B 4UWLA 3SI5A 5ENOD 5CHEE 1BD8A 5T4YA 4A3TA 3BG0B 2X6IA 3Q7AA 4YDOA 4O6FA 1VDYA 5DIZA 4K0RA 1HS6A 1V54E 1JCQA 4GMJA 2OV8A 3RO2A 3J5QB 3FP3A 2AW6A 1D9SA 2IJGX 1BU9A 4DX5D 3G2SA 2LXLA 4I6JA 5BXUA 4YDEA 3PE3A 4DI4A 4CEMA 2UWJG 4ZFHA 4O1PA 3ASGA 5FTPA 2L0IA 2DVWA 5JHBA 4JZYA 2P2CP 4FC8A 1MX6A 2ZGDA 4FADA 1SZAA 5ANRA 5KJLA 4OAVB 5G04J 3V79K 4RQIA 3BQOA 3BUAA 1MQSA 2V0PA 3JCKC 5CRUA 1TR4A 4YVOA 2Q7FA 3AS8A 4RVBA 4A1GA 1H2UA 2J09A 3HXDA 5FINA 5B3SE 5CRVA 2IF4A 1JWFA 2L6JA 1O1RA 4GB9A 1OCRE 2LSUA 4PUCA 3TWQA 4YDWA 4URKA 3PVLA 2AJAA 2VGEA 3FUMA 2F0YA 1G3NB 1EPUA 3RO3A 2QYJA 4RLYA 3SQVA 2VTBB 2XEVA 4ILGA 4UQXA 5ENSD 3R7QA 2CHZA 3S2AA 2R5SA 1U3DA 2VJ8A 4GPKA 1TN7A 4FHJA 2B0OE 3LJ3A 3ZFWA 3APDA 4HNAD 4HLEA 3DSVA 4JEUA 1OCZE 3CHQA 3Q4AB 4KT6B 4CDNA 1D8EA 2X6FA 4EZJA 3IHVA 4Q96A 4F3VA 3GZ2A 4A55A 4G23A 3DEOA 2CHXA 3U3WA 1HH8A 1IHGA 2PM7A 4A1SA 5IY5E 2J07A 3ULQA 3UQ3A 1TNBA 3PE4A 3ZRHA 3CQCB 3TWXA 1N9AA 5T3RA 4V3IA 1UJJA 1N0QA 1OWPA 3EHQA 3LCAA 4XKBA 4LNUD 4HORA 2XS8A 3HRAA 2XHEA 4N5QA 2LNIA 2FO1E 2IOSA 2J08A 4X8QA 5FQ4A 3CKCA 2GW1A 4AOFA 3DSXA 4J7WA 2AXZA 4JW1A 4DX7D 5CBNA 3DPDA 2XCBA 2H6FA 3PNTB 3TWRA 3VLFA 3FTUA 4UWFA 1IYGA 4JHKA 1SA4A 3L17A 2EIKE 4LRZA 3MEKA 3JXIA 5KJNA 2PM6A 4MS6A 1ZU2A 5BNWA 4G11A 2LO6A 3ISMC 2Y3AA 2HYZA 3U66A 2YNQA 2WMNA 3ZYKA 3DSSA 2HO1A 1HFAA 5FZSA 5BXOA 2C0MA 2J9QA 5CERB 2XEHA 1WDYA 4KYOB 4J8EA 4HB5A 4MKTA 3GZ1A 1PAQA 3Q75A 1K3ZD 4EBAA 5A7DB 1E90A 2FO7A 2XGSA 4B0ZA 3HVEB 4K5BA 3E4BA 3LS8A 2A5UA 4UWGA 3APFA 5J08A 3FUDA 2E2EA 2J4DA 2P9UG 4O60A 2KZTA 1H6PA 1OWLA 4LUNU 3MKRA 4QQIA 2WXHA 2DYRE 4UQZA 2L0TB 2P9LG 4FA6A 5KWDA 2XRZA 3QC1A 2XENA 4U0UA 3ULEG 4NURA 4IN3B 1NFIE 3RK6A 2X6HA 4NRHB 2WXJA 3RKVA 1SZ9A 4LEUA 4UWKA 3ZKJA 3R9MA 2I1KA 3EUVA 4RSYA 4JXTA 5ARFA 4G26A 3D9OA 4WNDA 3PZ2A 4UI9C 2RG8A 5LFAA 4EHMA 3TG5A 1H2VC 3ZU7B 2NYJA 3QNKA 3EHNA 4KZ0A 3TWVA 3CVQA 4FLHA 3RSEG 3ZIMA 4CGVA 4H7XA 5JJ7A 5CEDB 1MZCA 2FEZA 1UG3A 4L1BA 2R59A 2R2LA 2WXIA 1DCEA 2UY1B 3EHMA 1EDUA 1HG5A 5T8IA 4ANXA 2XZDG 2Y69E 4L7TA 5A23A 1N94A 2QY7A 3DBSA 3FUEA 3ZYMA 3ZUVB 2DZNA 1XNFA 3I4RB 2CFZA 5AYWD 2WXOA 5CMWA 2KM4A 4B94A 3UIPC 3PZ3A 3NB2A 1D8DA 3QWVA 2X3MA 4BT9A 4FULA 1BPOA 2C0LA 4I1AA 4PDXA 4JPSA 3CVUA 1OWOA 3UIOC 4GZ5A 1TN8A 3B7BA 1LTXA 2YHCA 3Q73A 4U95D 1E96B 4DLOA 2A5EA 3D9MA 3RRMB 1LF8A 1KZOA 1Q2ZA 3FFLA 3SHFA 4D10C 5KNGA 1E8WA 1Z5SC 2OOEA 1NA3A 1TEZA 3SFZA 2OEWA 3NZUA 2VTBA 4K5CA 3CHMA 5ARGA 4I17A 3FTYA 2GRMA 2ZXWE 4FLBA 1HE8A 1TNYA 2H6IA 2IQCA 3B7RL 2IY0C 3R9AB 2OVFA 3FY4A 2HE0A 3ZNGA 4BEPA 4I6EA 3FU6A 2WQHA 3OXFA 4FHKA 1S63A 2WXPA 1YA0A 3CHOA 3CK7A 1ELRA 4GTOA 3ZXSA 3OAWA 1IXVA 1KT0A 3LY7A 4M7CA 4HRNA 4OVUA 1HX8A 4Y6CA 3CKBA 3CK9A 4J8FA 3ZVVA 3LVQE 4JA9A 1N95A 4OVVA 3AG1E 2EIME 1UOHA 3V30A 2HR2A 3IBEA 2BUGA 3PEVB 4CT0A 3UT7A 4HXIA 3JUEA 1LD7A 3B13A 5D2MC 3P2BA 5FQ7A 4HLLA 4HBDA 1OWNA 4KBQA 1S64A 3D9JA 1BLXB 1NL4A 3RIBA 2ETAA 5G05J 4I1MA 2I6HA 2IFUA 1QBQA 3EU9A 1KT1A 1KLXA 2KC7A 2RKKA 1RW2A 2XPZA 2NSZA 4JL0A 1YYHA 4EPZA 4AV7A 5KCMA 4G8LA 1NI1A 4BX9A 3F6QA 4N3BA 4TV3A 3LY8A 4JD2G 2WPVA 1EYHA 2E0IA 2VSNA 3FTWA 4CRWA 1ZBPA 1ELWA 4N39A 4BX8A 3QKYA 2MHKA 3KS2A 4ILIA 3G2WA 1SVXA 1NA0A 1QQEA 5A6CA 4F1PA 4DPRA 4GCNA 4OYSA 2XRYA 3L22A 4AJWA 1TJCA 3TWSA 4J8YA 2RFMA 3U9WA 3HVEA 5AENA 3FTZA 4BFRA 1OT8A 3TXMA 2HM8A 4ANVA 5ITZF 4BTAA 3S7DA 5KJMA 4Q69A 5ENPD 2F8XK 5DBKA 1PY1A 3V2OA 2V5FA 3CVXA 2OCCE 4UI9J 3LXUX 2PQNA 4AY5A 3ML9A 1HF8A 3V2XA 2EINE 5FIOA 5E75A 4ILHB 4WWPA 3C5RA 3FU3A 3PZDA 3PH0C 5CECB 2KCKA 2DYSE 4DRXE 3RAUA 4UI9K 4GTTA 4CGWA 4GU5A 4I2ZA 5LP0A 5EDSA 2GRNB 2M63A 4DI3A 2Y0BG 4ACKA 3HDXA 4ATGA 2LXMA 4IULA 4APFA 1K8KG 2AWIA 3CVVA 1Z3XA 3ZGQA 3B7TA 1TJFA 3HG0D 4U63A 2OEVA 2J49A 2GRPB 5BPPA 1TNZA 3DSTA 4GZDA 3TJPA 4N3AA 4JEHA 5KNHD 4GMLA 3KAEA 1K1BA 5D66A 3SFYA 3IV0A 4MRUA 4U0SA 3ASNE 4ANWA 1N4QA 2MYOA 2ONDA 1UN9A 4C48B 4CYMD 2A4ZA 4Z68A 3JXJA 5H7PA 4XI0A 3X2QE 4GTVA 3L82A 3FUIA 3OXLA 2UY1A 3PUJA 3I5PA 3UKRG 1U2VG 2FBNA 2Y1LE 3RU0A 2DZOA 2CHWA 3GZSA 3L13A 2XPYA 4L23A 1E7UA 3T8KA 5M72A 2RD0A 2R17C 3UKUG 3ML8A 2XPIA 1KZPA 5EIDA 4LCTA 4TUUA 4GYYA 5JJ6A 2NC9A 4GTSA 3B7UX 1WG0A 1HO8A 5FZRA 1H6OA 4IRUA 3CLJA 3VLEA 3T8MA 2DBAA 4DUIA 2P9PG 5C2YA 4K5AB 1UJKA 2P9NG 5G55A 3S7JA 1Y6IA 5LOZA 3CK8A 3L9TA 3K9IA 2YHEA 4U96D 4E6HA 3L08A 5ENTD 1JCSA 2PZIA 2R02A 2ETCA 2VSYA 1W3BA 2BEDA 3MGBA 1XGWA 2WVIA 2PQRA 4NACA 1DVPA 3D9NA 4PS7A 2B6CA 4L2YA 3PDNA 3L6AA 3FU0A 2ZGGA 4Y6WA 4N2SA 2X6KA 3SY2A 4APOA 3JYSA 4I9EA 3URZA 1MJ0A 2VGXB 1H19A 3UINC 3AG2E 3C3OA 2I2OA 3SNXA 3O4ZA 2P9IG 3FH7A 1P5QA 4B8AA 2IOLA 3AJIA 3E34A 3TWTA 5BV1A 2XGMA 4ANUA 4LSZE 3N71A 4XIFA 2V5QC 4GCOA 5AAOA 3HIZA 3EIQC 1A17A 4GA1A 2AVPA 3ABLE 3B95A 5CCMA 1UN8A 3ZYQA 4XZ4A 3DPYA 4MLPA 4AP2A 1OY3D 2WQ6A 2BKKB 4DX2A 1NP7A 3J5PA 3TG4A 3ESKA 5JMND 3D3MA 2DCPA 3U64A 3PZ1A 4HOTA 3LY9A 2GGFA 5BW8C 2RFAA 3ASHA 3ZHEB 3FHEA 2GRLA 5ENNA 2VYIA 2V8SE 4DK5A 1Z6TA 2PL2A 3C72A 5BT1A 3ZN3A 4WNEA 4XKCA 1MYOA 2LAHA 3RRUA 4B93B 3SD5A 2IEJA 3EDTB 2VGYA 4M3OA 4JB8P 4BY6A 2KXPC 2GRQB 3HYMB 3LKUA 4AIFA 1DNPA 3TWUA 4I2WA 5FWQA 3CEQA 4ME2A 3E33A 3CVNA 1AP7A 3KEZA 4CDMA 4PH4B 1IQRA 1N52A 1OUVA 3HXBA 4HOSA 2XZTG 3C98A 3KD7A 3DWLG 2BKGA 3GYZA 3CHSA 2WXQA 3FUHA 3NQPA 3PNLB 3AU5A 3EU5A 4XX5A 3T9KA 3T5XA 5AQ9A 5EX3A 3WXXA 3G2UA 4U0ZA 3UTMA 2WMOA 4HOQA 4XE0A 4U8VD 3EHRA 4C0MA 3D9PA 3TAXA 3FU5A 3UM2A 4HVBA 4DX6D 3ASDA 4HRMB 4PS8A 3FUKA 4FP7A 2IO2C 2F37A 1FT1A 1E8YA 4LERA 5EKQD 4I9CA 1PC2A 2Y4UA 3IXEA 2PNNA 5LX8A 3ASOE 3FEXA 3ASFA 4KZCA 3V31A 5KBAA 5HRYA 5FQ6A 4U7EB 2BTDA 3CR3A 5EYLA 4PS3A 1IHBA 2P9KG 4GYOA 5B1BE 3RJVA 2DIWA 2WXGA 3JQ1A 3QARA 4BT8A 4U04A 1X5BA 5ENQD 1U3CA 1Y8MA 4JVSA 2XGOA 5EILA 4A63B 2GROB 3DRAA 4GZ6A 2VQ2A 3S7BA 1OWMA 3UT4A 3UXGA 3UM3A 4U8YD 1SQMA 3MCXA 1RZ4A 2EQXA 3AS4A 5HI7A 4G24A 2X38A 4TXRA 3KEAA 3LEWA 4GTQA 2EILE 4BESA 4EQFA 3AG3E 1L5JA 3ENEA 3FUNA 3FWVA 2P58C 3BG1B 3PEUB 1O1TA 3PREA 2IO3C 4N2QA 4OAUC 3I4GA 2LUHA 3U4TA 2KATA 3Q9NC 1AWCB 1EF1C 2R05A 1Z3YA 4JHRA 2YINA 4CZ2D 2R03A 3CGHA 4FU3A 5EX0A 3SFXA 3UM1A 5AQBA 3ZW3A 5LCWC 4I6GA 2QYUA 3CVLA 2J8SD 3NOGD 1FT2A 1OCCE 2Y4TA 2QC9A 3AU4A 4AVXA 2JEKA 3SGHA 4C0EA 3S7FA 2ZIRA 2V4LA 4NQ0A 4F7AA 4HI8A 3FDHA 5D0OD 4FJZA 3CVYA 5AARA 3D9KA 3G2VA 2ZISA 4GTRA 3DXMG 3QK0A 1FVHA 2WXLA 4AEZC 4YNDA 1N4PA 3Q15A 4N5CA 4TUMA 1LD8A 5JJTA 1OXJA 2JLBA 3D9IA 3P1UA 2ILRA 3APCA 2XCCA 1FVFA 1JWGA 4ACLA 3CHRA 5ANLA 1ELKA 2VSXE 1E8XA 3MZLB 4I43A 4LG6A 2NXPA 4DJAA 3MYVA 3IEGA 4EBAG 3WG7E 2J4BA 4R7LA 1GW6A 3CVWA 2L9BA 3E32A 1WAO1 4NIKA 2KBXA 2VGXA 4CT4A 5JA4D 1ZB1A 4GPMA 3FH8A 4B89A 2XEEA 3OXGA 4U8HA 5D0QD 4WAFA 3SO8A 4AXHA 3EJNA 1DC2A 4WNGA 4TXPA 3Q49B 4HRLA 1B89A 3LPZA 3VLDA 4ABNA 2BF0X 2L6BA 2H6HA 4HOUA 3PUKA 3ULYA 3Q47B 1SW6A 3TWWA 5CBOA 1NZNA 3LDZA 3NBNB 3L54A 2X6JA 3QWPA 3UPVA 4G8KA 4WUYA 2EIJE 3NZSA 3E30A 4WWOA 4GTPA 3BU8A 3IKOB 4ZHBA 3ZHEA 5JHAA 1TYQG 2FF4A 4I1OB 4CCAA 3NF1A 5AJDA 3Q5MA 1OCOE 4P29A 2AXUA 1MHQA 4JHJA 5G2NA 1YMPA 3HHMA 3L16A 4KVOA 3R7RA 4N3CA 2KCVA 3Q78A 3AAAC 3SZ7A 3DSWA 5AIJA 5CCLA 3TXNA 5CMYA 3QDNA 3AS5A 5B1AE 2LAIA 3DEPA 3B7SA 4BSZB 1N0RA 5CEAA 3CV0A 5EIBE 2CG2A 3ZXPA 1MX4A 3UM0A 1WM5A 1S0PA 3FH5A 3FUFA 1TN6A 2GRRB 1O1SA 4KMOA 1DCQA 5FQ8A 3PRZA 5HQ8A 4MBGA 3MKQA 1WY6A 5G05C 4Q94A 2MOWA 1A5EA 4O1OA 5EN5D 3CVPA 1V55E 3G2TA 3E37A 3UT8A 1N4SA 4HI9A 1N11A 4GZ3A 2ZU6B 2WB2A 4A3VA 4BSXA 5KJKA 3DSUA 4BTBA 3SF4A 2I1JA 1H6KA 2F8YA 4JA7A 2WXFA 5ENRD 3MA5A 3W9FA 4YVQC 1E8ZA 3EIJA 3QOUA 4E85A 5G04C 1N54A 4HFGA 3ABME 2CG3A 3I3NA 1H0AA 3RRNB 4WWNA 4UQYA 4GA2A 4GA0A 1INZA 3CSTA 3C3RA 3AG4E 1E7VA 4UWHA 3PS6A 4QFVA 1JPLA 2P9SG 4U07A 1QYMA 1O5MA 4IYPA 5LCWJ 4HS2A 4LNBA 4BETA 4GMRA 4XI9A 1UW4B 1N4RA 4ATZD 5BV0A 2YQ8A 4EECA 4KVMA 3JQ0A 5AJLA 2WXKA 1IKND 2IONA 2I9CA 3C3QA 4GTMA 3TGOA 3FULA 3ZEFA 4GAAA 3LVRE 3HXCA 4B8CB 3QJZA 3ZPJA 1H2TC 3FTVA 3SBTB 4J6IA 4DLQA 2JABA 2IU1A 5E76A 5FZQA 5FT9A 3MX3A 1TNOA 3ONLA 4K03A 3FUJA 4F6RD 3UX4A 4AY6A 4J0UA 5EYPF 2VSOE 3T5VA 3CIAA 3PZ4A 3KSLA 3VTYA 1QZ2A 3BEEA 4H7YA 1HU3A 2MRIA 5AQ7A 1HG2A 1TNUA 3CHPA 1HZ4A 1K1AA 3LYAA 2FULA 3IHYA 3ESLA 4LNGA 4G2VA 3MKQB 5BUZA 2XS1A 3D9LA 2CFUA 1JCRA 4W9RA 4G25A 2QZAA 4BWRA 1FCHA 3QWWA 5J90A 3DXKG 4G1TA
chains in the Genus database with same CATH topology
1TN6A 3SFXA 1SA5A 3DSXA 3C72A 3SFYA 1O1SA 4LNBA 1FT1A 2H6GA 2H6HA 3PZ3A 1N4QA 1N4RA 4MBGA 1D8DA 1FT2A 2H6FA 3Q7AA 1N95A 4YDOA 1FPPA 2IEJA 2ZIRA 1SA4A 3E37A 4GTMA 1JCQA 3Q7FA 1TN7A 4GTVA 1N4SA 1LD7A 3HXEA 3HXCA 1TN8A 3EUVA 1S64A 1LTXA 2ZISA 4GTRA 3E30A 3E34A 4GTPA 3DSVA 3Q73A 1NL4A 4L9PA 3DSUA 3HXFA 1N4PA 3DSSA 3PZ2A 3E33A 1LD8A 4YDEA 1KZOA 1D8EA 4EHMA 1QBQA 1TNOA 3Q75A 3HXBA 3DRAA 1KZPA 3PZ4A 3KSLA 4GTSA 1X81A 3Q78A 1MZCA 1TNBA 3DPYA 1NI1A 4GTTA 1N9AA 3EU5A 3KSQA 1TNUA 3DSWA 3E32A 1TNYA 2H6IA 2R2LA 4GTQA 1DCEA 3HXDA 4LNGA 3PZ1A 1O1RA 1N94A 1JCRA 1S63A 1TNZA 1O1TA 3DSTA 3Q79A 4GTOA 1JCSA 2F0YA 1O5MA 2BEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN6 A;  3SFX A;  1SA5 A;  3DSX A;  3C72 A;  3SFY A;  1O1S A;  4LNB A;  1FT1 A;  2H6G A;  2H6H A;  3PZ3 A;  1N4Q A;  1N4R A;  4MBG A;  1D8D A;  1FT2 A;  2H6F A;  3Q7A A;  1N95 A;  4YDO A;  1FPP A;  2IEJ A;  2ZIR A;  1SA4 A;  3E37 A;  4GTM A;  1JCQ A;  3Q7F A;  1TN7 A;  4GTV A;  1N4S A;  1LD7 A;  3HXE A;  3HXC A;  1TN8 A;  3EUV A;  1S64 A;  1LTX A;  2ZIS A;  4GTR A;  3E30 A;  3E34 A;  4GTP A;  3DSV A;  3Q73 A;  1NL4 A;  4L9P A;  3DSU A;  3HXF A;  1N4P A;  3DSS A;  3PZ2 A;  3E33 A;  1LD8 A;  4YDE A;  1KZO A;  1D8E A;  4EHM A;  1QBQ A;  1TNO A;  3Q75 A;  3HXB A;  3DRA A;  1KZP A;  3PZ4 A;  3KSL A;  4GTS A;  1X81 A;  3Q78 A;  1MZC A;  1TNB A;  3DPY A;  1NI1 A;  4GTT A;  1N9A A;  3EU5 A;  3KSQ A;  1TNU A;  3DSW A;  3E32 A;  1TNY A;  2H6I A;  2R2L A;  4GTQ A;  1DCE A;  3HXD A;  4LNG A;  3PZ1 A;  1O1R A;  1N94 A;  1JCR A;  1S63 A;  1TNZ A;  1O1T A;  3DST A;  3Q79 A;  4GTO A;  1JCS A;  2F0Y A;  1O5M A;  2BED A; 
#chains in the Genus database with same CATH topology
 2XQ0 A;  4WNF A;  3FEY A;  4RG9 A;  2H6G A;  3MV2 B;  3ABK E;  1BI7 B;  4TXQ A;  3ZYL A;  3O48 A;  3MJW A;  4C9B B;  1JUQ A;  1S70 B;  1MX2 A;  4FJY A;  1FPP A;  2OVB A;  4XEI G;  3NOC D;  4EZK A;  1YCS B;  3FTX A;  3Q7F A;  3QB2 A;  3ONK A;  4CDR A;  3OTN A;  4YDY A;  4F53 A;  3HXE A;  3GW4 A;  4J8S A;  2QFC A;  2LSV A;  4L9P A;  2KZT B;  3HXF A;  3D9H A;  4GYW A;  4L2L A;  5AQA A;  2DWZ A;  5AN8 A;  4DX1 A;  3JUI A;  2ETB A;  2WXN A;  1QNF A;  3LJN A;  4UUC A;  1KPS B;  2WM9 A;  4AM9 A;  1X81 A;  3VTX A;  3FTS A;  4EZL A;  3Q9U C;  4BER A;  5HKP A;  3CQG B;  3KSQ A;  3TL5 A;  4TRQ A;  3SBS A;  3QAQ A;  3UMV A;  5HS0 A;  2KCL A;  1IQU A;  4GZC A;  4RG6 A;  2V4H C;  2AXV A;  3W9G A;  4KXK B;  1HXI A;  3UUX A;  5FJY A;  5C1D A;  1BI8 B;  2WXR A;  4JC8 A;  4HQD A;  2WQ7 A;  3Q79 A;  3UI2 A;  2FI7 A;  3CSF A;  4J8D A;  2WXM A;  3NAW A;  2C2L A;  4F1S A;  1SA5 A;  3MV3 B;  4UWL A;  3SI5 A;  5ENO D;  5CHE E;  1BD8 A;  5T4Y A;  4A3T A;  3BG0 B;  2X6I A;  3Q7A A;  4YDO A;  4O6F A;  1VDY A;  5DIZ A;  4K0R A;  1HS6 A;  1V54 E;  1JCQ A;  4GMJ A;  2OV8 A;  3RO2 A;  3J5Q B;  3FP3 A;  2AW6 A;  1D9S A;  2IJG X;  1BU9 A;  4DX5 D;  3G2S A;  2LXL A;  4I6J A;  5BXU A;  4YDE A;  3PE3 A;  4DI4 A;  4CEM A;  2UWJ G;  4ZFH A;  4O1P A;  3ASG A;  5FTP A;  2L0I A;  2DVW A;  5JHB A;  4JZY A;  2P2C P;  4FC8 A;  1MX6 A;  2ZGD A;  4FAD A;  1SZA A;  5ANR A;  5KJL A;  4OAV B;  5G04 J;  3V79 K;  4RQI A;  3BQO A;  3BUA A;  1MQS A;  2V0P A;  3JCK C;  5CRU A;  1TR4 A;  4YVO A;  2Q7F A;  3AS8 A;  4RVB A;  4A1G A;  1H2U A;  2J09 A;  3HXD A;  5FIN A;  5B3S E;  5CRV A;  2IF4 A;  1JWF A;  2L6J A;  1O1R A;  4GB9 A;  1OCR E;  2LSU A;  4PUC A;  3TWQ A;  4YDW A;  4URK A;  3PVL A;  2AJA A;  2VGE A;  3FUM A;  2F0Y A;  1G3N B;  1EPU A;  3RO3 A;  2QYJ A;  4RLY A;  3SQV A;  2VTB B;  2XEV A;  4ILG A;  4UQX A;  5ENS D;  3R7Q A;  2CHZ A;  3S2A A;  2R5S A;  1U3D A;  2VJ8 A;  4GPK A;  1TN7 A;  4FHJ A;  2B0O E;  3LJ3 A;  3ZFW A;  3APD A;  4HNA D;  4HLE A;  3DSV A;  4JEU A;  1OCZ E;  3CHQ A;  3Q4A B;  4KT6 B;  4CDN A;  1D8E A;  2X6F A;  4EZJ A;  3IHV A;  4Q96 A;  4F3V A;  3GZ2 A;  4A55 A;  4G23 A;  3DEO A;  2CHX A;  3U3W A;  1HH8 A;  1IHG A;  2PM7 A;  4A1S A;  5IY5 E;  2J07 A;  3ULQ A;  3UQ3 A;  1TNB A;  3PE4 A;  3ZRH A;  3CQC B;  3TWX A;  1N9A A;  5T3R A;  4V3I A;  1UJJ A;  1N0Q A;  1OWP A;  3EHQ A;  3LCA A;  4XKB A;  4LNU D;  4HOR A;  2XS8 A;  3HRA A;  2XHE A;  4N5Q A;  2LNI A;  2FO1 E;  2IOS A;  2J08 A;  4X8Q A;  5FQ4 A;  3CKC A;  2GW1 A;  4AOF A;  3DSX A;  4J7W A;  2AXZ A;  4JW1 A;  4DX7 D;  5CBN A;  3DPD A;  2XCB A;  2H6F A;  3PNT B;  3TWR A;  3VLF A;  3FTU A;  4UWF A;  1IYG A;  4JHK A;  1SA4 A;  3L17 A;  2EIK E;  4LRZ A;  3MEK A;  3JXI A;  5KJN A;  2PM6 A;  4MS6 A;  1ZU2 A;  5BNW A;  4G11 A;  2LO6 A;  3ISM C;  2Y3A A;  2HYZ A;  3U66 A;  2YNQ A;  2WMN A;  3ZYK A;  3DSS A;  2HO1 A;  1HFA A;  5FZS A;  5BXO A;  2C0M A;  2J9Q A;  5CER B;  2XEH A;  1WDY A;  4KYO B;  4J8E A;  4HB5 A;  4MKT A;  3GZ1 A;  1PAQ A;  3Q75 A;  1K3Z D;  4EBA A;  5A7D B;  1E90 A;  2FO7 A;  2XGS A;  4B0Z A;  3HVE B;  4K5B A;  3E4B A;  3LS8 A;  2A5U A;  4UWG A;  3APF A;  5J08 A;  3FUD A;  2E2E A;  2J4D A;  2P9U G;  4O60 A;  2KZT A;  1H6P A;  1OWL A;  4LUN U;  3MKR A;  4QQI A;  2WXH A;  2DYR E;  4UQZ A;  2L0T B;  2P9L G;  4FA6 A;  5KWD A;  2XRZ A;  3QC1 A;  2XEN A;  4U0U A;  3ULE G;  4NUR A;  4IN3 B;  1NFI E;  3RK6 A;  2X6H A;  4NRH B;  2WXJ A;  3RKV A;  1SZ9 A;  4LEU A;  4UWK A;  3ZKJ A;  3R9M A;  2I1K A;  3EUV A;  4RSY A;  4JXT A;  5ARF A;  4G26 A;  3D9O A;  4WND A;  3PZ2 A;  4UI9 C;  2RG8 A;  5LFA A;  4EHM A;  3TG5 A;  1H2V C;  3ZU7 B;  2NYJ A;  3QNK A;  3EHN A;  4KZ0 A;  3TWV A;  3CVQ A;  4FLH A;  3RSE G;  3ZIM A;  4CGV A;  4H7X A;  5JJ7 A;  5CED B;  1MZC A;  2FEZ A;  1UG3 A;  4L1B A;  2R59 A;  2R2L A;  2WXI A;  1DCE A;  2UY1 B;  3EHM A;  1EDU A;  1HG5 A;  5T8I A;  4ANX A;  2XZD G;  2Y69 E;  4L7T A;  5A23 A;  1N94 A;  2QY7 A;  3DBS A;  3FUE A;  3ZYM A;  3ZUV B;  2DZN A;  1XNF A;  3I4R B;  2CFZ A;  5AYW D;  2WXO A;  5CMW A;  2KM4 A;  4B94 A;  3UIP C;  3PZ3 A;  3NB2 A;  1D8D A;  3QWV A;  2X3M A;  4BT9 A;  4FUL A;  1BPO A;  2C0L A;  4I1A A;  4PDX A;  4JPS A;  3CVU A;  1OWO A;  3UIO C;  4GZ5 A;  1TN8 A;  3B7B A;  1LTX A;  2YHC A;  3Q73 A;  4U95 D;  1E96 B;  4DLO A;  2A5E A;  3D9M A;  3RRM B;  1LF8 A;  1KZO A;  1Q2Z A;  3FFL A;  3SHF A;  4D10 C;  5KNG A;  1E8W A;  1Z5S C;  2OOE A;  1NA3 A;  1TEZ A;  3SFZ A;  2OEW A;  3NZU A;  2VTB A;  4K5C A;  3CHM A;  5ARG A;  4I17 A;  3FTY A;  2GRM A;  2ZXW E;  4FLB A;  1HE8 A;  1TNY A;  2H6I A;  2IQC A;  3B7R L;  2IY0 C;  3R9A B;  2OVF A;  3FY4 A;  2HE0 A;  3ZNG A;  4BEP A;  4I6E A;  3FU6 A;  2WQH A;  3OXF A;  4FHK A;  1S63 A;  2WXP A;  1YA0 A;  3CHO A;  3CK7 A;  1ELR A;  4GTO A;  3ZXS A;  3OAW A;  1IXV A;  1KT0 A;  3LY7 A;  4M7C A;  4HRN A;  4OVU A;  1HX8 A;  4Y6C A;  3CKB A;  3CK9 A;  4J8F A;  3ZVV A;  3LVQ E;  4JA9 A;  1N95 A;  4OVV A;  3AG1 E;  2EIM E;  1UOH A;  3V30 A;  2HR2 A;  3IBE A;  2BUG A;  3PEV B;  4CT0 A;  3UT7 A;  4HXI A;  3JUE A;  1LD7 A;  3B13 A;  5D2M C;  3P2B A;  5FQ7 A;  4HLL A;  4HBD A;  1OWN A;  4KBQ A;  1S64 A;  3D9J A;  1BLX B;  1NL4 A;  3RIB A;  2ETA A;  5G05 J;  4I1M A;  2I6H A;  2IFU A;  1QBQ A;  3EU9 A;  1KT1 A;  1KLX A;  2KC7 A;  2RKK A;  1RW2 A;  2XPZ A;  2NSZ A;  4JL0 A;  1YYH A;  4EPZ A;  4AV7 A;  5KCM A;  4G8L A;  1NI1 A;  4BX9 A;  3F6Q A;  4N3B A;  4TV3 A;  3LY8 A;  4JD2 G;  2WPV A;  1EYH A;  2E0I A;  2VSN A;  3FTW A;  4CRW A;  1ZBP A;  1ELW A;  4N39 A;  4BX8 A;  3QKY A;  2MHK A;  3KS2 A;  4ILI A;  3G2W A;  1SVX A;  1NA0 A;  1QQE A;  5A6C A;  4F1P A;  4DPR A;  4GCN A;  4OYS A;  2XRY A;  3L22 A;  4AJW A;  1TJC A;  3TWS A;  4J8Y A;  2RFM A;  3U9W A;  3HVE A;  5AEN A;  3FTZ A;  4BFR A;  1OT8 A;  3TXM A;  2HM8 A;  4ANV A;  5ITZ F;  4BTA A;  3S7D A;  5KJM A;  4Q69 A;  5ENP D;  2F8X K;  5DBK A;  1PY1 A;  3V2O A;  2V5F A;  3CVX A;  2OCC E;  4UI9 J;  3LXU X;  2PQN A;  4AY5 A;  3ML9 A;  1HF8 A;  3V2X A;  2EIN E;  5FIO A;  5E75 A;  4ILH B;  4WWP A;  3C5R A;  3FU3 A;  3PZD A;  3PH0 C;  5CEC B;  2KCK A;  2DYS E;  4DRX E;  3RAU A;  4UI9 K;  4GTT A;  4CGW A;  4GU5 A;  4I2Z A;  5LP0 A;  5EDS A;  2GRN B;  2M63 A;  4DI3 A;  2Y0B G;  4ACK A;  3HDX A;  4ATG A;  2LXM A;  4IUL A;  4APF A;  1K8K G;  2AWI A;  3CVV A;  1Z3X A;  3ZGQ A;  3B7T A;  1TJF A;  3HG0 D;  4U63 A;  2OEV A;  2J49 A;  2GRP B;  5BPP A;  1TNZ A;  3DST A;  4GZD A;  3TJP A;  4N3A A;  4JEH A;  5KNH D;  4GML A;  3KAE A;  1K1B A;  5D66 A;  3SFY A;  3IV0 A;  4MRU A;  4U0S A;  3ASN E;  4ANW A;  1N4Q A;  2MYO A;  2OND A;  1UN9 A;  4C48 B;  4CYM D;  2A4Z A;  4Z68 A;  3JXJ A;  5H7P A;  4XI0 A;  3X2Q E;  4GTV A;  3L82 A;  3FUI A;  3OXL A;  2UY1 A;  3PUJ A;  3I5P A;  3UKR G;  1U2V G;  2FBN A;  2Y1L E;  3RU0 A;  2DZO A;  2CHW A;  3GZS A;  3L13 A;  2XPY A;  4L23 A;  1E7U A;  3T8K A;  5M72 A;  2RD0 A;  2R17 C;  3UKU G;  3ML8 A;  2XPI A;  1KZP A;  5EID A;  4LCT A;  4TUU A;  4GYY A;  5JJ6 A;  2NC9 A;  4GTS A;  3B7U X;  1WG0 A;  1HO8 A;  5FZR A;  1H6O A;  4IRU A;  3CLJ A;  3VLE A;  3T8M A;  2DBA A;  4DUI A;  2P9P G;  5C2Y A;  4K5A B;  1UJK A;  2P9N G;  5G55 A;  3S7J A;  1Y6I A;  5LOZ A;  3CK8 A;  3L9T A;  3K9I A;  2YHE A;  4U96 D;  4E6H A;  3L08 A;  5ENT D;  1JCS A;  2PZI A;  2R02 A;  2ETC A;  2VSY A;  1W3B A;  2BED A;  3MGB A;  1XGW A;  2WVI A;  2PQR A;  4NAC A;  1DVP A;  3D9N A;  4PS7 A;  2B6C A;  4L2Y A;  3PDN A;  3L6A A;  3FU0 A;  2ZGG A;  4Y6W A;  4N2S A;  2X6K A;  3SY2 A;  4APO A;  3JYS A;  4I9E A;  3URZ A;  1MJ0 A;  2VGX B;  1H19 A;  3UIN C;  3AG2 E;  3C3O A;  2I2O A;  3SNX A;  3O4Z A;  2P9I G;  3FH7 A;  1P5Q A;  4B8A A;  2IOL A;  3AJI A;  3E34 A;  3TWT A;  5BV1 A;  2XGM A;  4ANU A;  4LSZ E;  3N71 A;  4XIF A;  2V5Q C;  4GCO A;  5AAO A;  3HIZ A;  3EIQ C;  1A17 A;  4GA1 A;  2AVP A;  3ABL E;  3B95 A;  5CCM A;  1UN8 A;  3ZYQ A;  4XZ4 A;  3DPY A;  4MLP A;  4AP2 A;  1OY3 D;  2WQ6 A;  2BKK B;  4DX2 A;  1NP7 A;  3J5P A;  3TG4 A;  3ESK A;  5JMN D;  3D3M A;  2DCP A;  3U64 A;  3PZ1 A;  4HOT A;  3LY9 A;  2GGF A;  5BW8 C;  2RFA A;  3ASH A;  3ZHE B;  3FHE A;  2GRL A;  5ENN A;  2VYI A;  2V8S E;  4DK5 A;  1Z6T A;  2PL2 A;  3C72 A;  5BT1 A;  3ZN3 A;  4WNE A;  4XKC A;  1MYO A;  2LAH A;  3RRU A;  4B93 B;  3SD5 A;  2IEJ A;  3EDT B;  2VGY A;  4M3O A;  4JB8 P;  4BY6 A;  2KXP C;  2GRQ B;  3HYM B;  3LKU A;  4AIF A;  1DNP A;  3TWU A;  4I2W A;  5FWQ A;  3CEQ A;  4ME2 A;  3E33 A;  3CVN A;  1AP7 A;  3KEZ A;  4CDM A;  4PH4 B;  1IQR A;  1N52 A;  1OUV A;  3HXB A;  4HOS A;  2XZT G;  3C98 A;  3KD7 A;  3DWL G;  2BKG A;  3GYZ A;  3CHS A;  2WXQ A;  3FUH A;  3NQP A;  3PNL B;  3AU5 A;  3EU5 A;  4XX5 A;  3T9K A;  3T5X A;  5AQ9 A;  5EX3 A;  3WXX A;  3G2U A;  4U0Z A;  3UTM A;  2WMO A;  4HOQ A;  4XE0 A;  4U8V D;  3EHR A;  4C0M A;  3D9P A;  3TAX A;  3FU5 A;  3UM2 A;  4HVB A;  4DX6 D;  3ASD A;  4HRM B;  4PS8 A;  3FUK A;  4FP7 A;  2IO2 C;  2F37 A;  1FT1 A;  1E8Y A;  4LER A;  5EKQ D;  4I9C A;  1PC2 A;  2Y4U A;  3IXE A;  2PNN A;  5LX8 A;  3ASO E;  3FEX A;  3ASF A;  4KZC A;  3V31 A;  5KBA A;  5HRY A;  5FQ6 A;  4U7E B;  2BTD A;  3CR3 A;  5EYL A;  4PS3 A;  1IHB A;  2P9K G;  4GYO A;  5B1B E;  3RJV A;  2DIW A;  2WXG A;  3JQ1 A;  3QAR A;  4BT8 A;  4U04 A;  1X5B A;  5ENQ D;  1U3C A;  1Y8M A;  4JVS A;  2XGO A;  5EIL A;  4A63 B;  2GRO B;  3DRA A;  4GZ6 A;  2VQ2 A;  3S7B A;  1OWM A;  3UT4 A;  3UXG A;  3UM3 A;  4U8Y D;  1SQM A;  3MCX A;  1RZ4 A;  2EQX A;  3AS4 A;  5HI7 A;  4G24 A;  2X38 A;  4TXR A;  3KEA A;  3LEW A;  4GTQ A;  2EIL E;  4BES A;  4EQF A;  3AG3 E;  1L5J A;  3ENE A;  3FUN A;  3FWV A;  2P58 C;  3BG1 B;  3PEU B;  1O1T A;  3PRE A;  2IO3 C;  4N2Q A;  4OAU C;  3I4G A;  2LUH A;  3U4T A;  2KAT A;  3Q9N C;  1AWC B;  1EF1 C;  2R05 A;  1Z3Y A;  4JHR A;  2YIN A;  4CZ2 D;  2R03 A;  3CGH A;  4FU3 A;  5EX0 A;  3SFX A;  3UM1 A;  5AQB A;  3ZW3 A;  5LCW C;  4I6G A;  2QYU A;  3CVL A;  2J8S D;  3NOG D;  1FT2 A;  1OCC E;  2Y4T A;  2QC9 A;  3AU4 A;  4AVX A;  2JEK A;  3SGH A;  4C0E A;  3S7F A;  2ZIR A;  2V4L A;  4NQ0 A;  4F7A A;  4HI8 A;  3FDH A;  5D0O D;  4FJZ A;  3CVY A;  5AAR A;  3D9K A;  3G2V A;  2ZIS A;  4GTR A;  3DXM G;  3QK0 A;  1FVH A;  2WXL A;  4AEZ C;  4YND A;  1N4P A;  3Q15 A;  4N5C A;  4TUM A;  1LD8 A;  5JJT A;  1OXJ A;  2JLB A;  3D9I A;  3P1U A;  2ILR A;  3APC A;  2XCC A;  1FVF A;  1JWG A;  4ACL A;  3CHR A;  5ANL A;  1ELK A;  2VSX E;  1E8X A;  3MZL B;  4I43 A;  4LG6 A;  2NXP A;  4DJA A;  3MYV A;  3IEG A;  4EBA G;  3WG7 E;  2J4B A;  4R7L A;  1GW6 A;  3CVW A;  2L9B A;  3E32 A;  1WAO 1;  4NIK A;  2KBX A;  2VGX A;  4CT4 A;  5JA4 D;  1ZB1 A;  4GPM A;  3FH8 A;  4B89 A;  2XEE A;  3OXG A;  4U8H A;  5D0Q D;  4WAF A;  3SO8 A;  4AXH A;  3EJN A;  1DC2 A;  4WNG A;  4TXP A;  3Q49 B;  4HRL A;  1B89 A;  3LPZ A;  3VLD A;  4ABN A;  2BF0 X;  2L6B A;  2H6H A;  4HOU A;  3PUK A;  3ULY A;  3Q47 B;  1SW6 A;  3TWW A;  5CBO A;  1NZN A;  3LDZ A;  3NBN B;  3L54 A;  2X6J A;  3QWP A;  3UPV A;  4G8K A;  4WUY A;  2EIJ E;  3NZS A;  3E30 A;  4WWO A;  4GTP A;  3BU8 A;  3IKO B;  4ZHB A;  3ZHE A;  5JHA A;  1TYQ G;  2FF4 A;  4I1O B;  4CCA A;  3NF1 A;  5AJD A;  3Q5M A;  1OCO E;  4P29 A;  2AXU A;  1MHQ A;  4JHJ A;  5G2N A;  1YMP A;  3HHM A;  3L16 A;  4KVO A;  3R7R A;  4N3C A;  2KCV A;  3Q78 A;  3AAA C;  3SZ7 A;  3DSW A;  5AIJ A;  5CCL A;  3TXN A;  5CMY A;  3QDN A;  3AS5 A;  5B1A E;  2LAI A;  3DEP A;  3B7S A;  4BSZ B;  1N0R A;  5CEA A;  3CV0 A;  5EIB E;  2CG2 A;  3ZXP A;  1MX4 A;  3UM0 A;  1WM5 A;  1S0P A;  3FH5 A;  3FUF A;  1TN6 A;  2GRR B;  1O1S A;  4KMO A;  1DCQ A;  5FQ8 A;  3PRZ A;  5HQ8 A;  4MBG A;  3MKQ A;  1WY6 A;  5G05 C;  4Q94 A;  2MOW A;  1A5E A;  4O1O A;  5EN5 D;  3CVP A;  1V55 E;  3G2T A;  3E37 A;  3UT8 A;  1N4S A;  4HI9 A;  1N11 A;  4GZ3 A;  2ZU6 B;  2WB2 A;  4A3V A;  4BSX A;  5KJK A;  3DSU A;  4BTB A;  3SF4 A;  2I1J A;  1H6K A;  2F8Y A;  4JA7 A;  2WXF A;  5ENR D;  3MA5 A;  3W9F A;  4YVQ C;  1E8Z A;  3EIJ A;  3QOU A;  4E85 A;  5G04 C;  1N54 A;  4HFG A;  3ABM E;  2CG3 A;  3I3N A;  1H0A A;  3RRN B;  4WWN A;  4UQY A;  4GA2 A;  4GA0 A;  1INZ A;  3CST A;  3C3R A;  3AG4 E;  1E7V A;  4UWH A;  3PS6 A;  4QFV A;  1JPL A;  2P9S G;  4U07 A;  1QYM A;  1O5M A;  4IYP A;  5LCW J;  4HS2 A;  4LNB A;  4BET A;  4GMR A;  4XI9 A;  1UW4 B;  1N4R A;  4ATZ D;  5BV0 A;  2YQ8 A;  4EEC A;  4KVM A;  3JQ0 A;  5AJL A;  2WXK A;  1IKN D;  2ION A;  2I9C A;  3C3Q A;  4GTM A;  3TGO A;  3FUL A;  3ZEF A;  4GAA A;  3LVR E;  3HXC A;  4B8C B;  3QJZ A;  3ZPJ A;  1H2T C;  3FTV A;  3SBT B;  4J6I A;  4DLQ A;  2JAB A;  2IU1 A;  5E76 A;  5FZQ A;  5FT9 A;  3MX3 A;  1TNO A;  3ONL A;  4K03 A;  3FUJ A;  4F6R D;  3UX4 A;  4AY6 A;  4J0U A;  5EYP F;  2VSO E;  3T5V A;  3CIA A;  3PZ4 A;  3KSL A;  3VTY A;  1QZ2 A;  3BEE A;  4H7Y A;  1HU3 A;  2MRI A;  5AQ7 A;  1HG2 A;  1TNU A;  3CHP A;  1HZ4 A;  1K1A A;  3LYA A;  2FUL A;  3IHY A;  3ESL A;  4LNG A;  4G2V A;  3MKQ B;  5BUZ A;  2XS1 A;  3D9L A;  2CFU A;  1JCR A;  4W9R A;  4G25 A;  2QZA A;  4BWR A;  1FCH A;  3QWW A;  5J90 A;  3DXK G;  4G1T A; 
#chains in the Genus database with same CATH homology
 1TN6 A;  3SFX A;  1SA5 A;  3DSX A;  3C72 A;  3SFY A;  1O1S A;  4LNB A;  1FT1 A;  2H6G A;  2H6H A;  3PZ3 A;  1N4Q A;  1N4R A;  4MBG A;  1D8D A;  1FT2 A;  2H6F A;  3Q7A A;  1N95 A;  4YDO A;  1FPP A;  2IEJ A;  2ZIR A;  1SA4 A;  3E37 A;  4GTM A;  1JCQ A;  3Q7F A;  1TN7 A;  4GTV A;  1N4S A;  1LD7 A;  3HXE A;  3HXC A;  1TN8 A;  3EUV A;  1S64 A;  1LTX A;  2ZIS A;  4GTR A;  3E30 A;  3E34 A;  4GTP A;  3DSV A;  3Q73 A;  1NL4 A;  4L9P A;  3DSU A;  3HXF A;  1N4P A;  3DSS A;  3PZ2 A;  3E33 A;  1LD8 A;  4YDE A;  1KZO A;  1D8E A;  4EHM A;  1QBQ A;  1TNO A;  3Q75 A;  3HXB A;  3DRA A;  1KZP A;  3PZ4 A;  3KSL A;  4GTS A;  1X81 A;  3Q78 A;  1MZC A;  1TNB A;  3DPY A;  1NI1 A;  4GTT A;  1N9A A;  3EU5 A;  3KSQ A;  1TNU A;  3DSW A;  3E32 A;  1TNY A;  2H6I A;  2R2L A;  4GTQ A;  1DCE A;  3HXD A;  4LNG A;  3PZ1 A;  1O1R A;  1N94 A;  1JCR A;  1S63 A;  1TNZ A;  1O1T A;  3DST A;  3Q79 A;  4GTO A;  1JCS A;  2F0Y A;  1O5M A;  2BED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...