2R2LA

Structure of farnesyl protein transferase bound to pb-93
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
315
structure length
315
Chain Sequence
b'GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase subunit alpha
publication title Efficacy, pharmacokinetics, and metabolism of tetrahydroquinoline inhibitors of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2r2lA00
1N9AA 3C72A 1FT1A 1TNYA 1DCEA 3Q7AA 3DSWA 4YDEA 1TN7A 4LNBA 1KZOA 3EUVA 1TN6A 1D8EA 1NI1A 1JCSA 3HXDA 3EU5A 3DSUA 3KSLA 1N4SA 4GTSA 3DRAA 3Q78A 3SFXA 1TNBA 4GTMA 3DSXA 4LNGA 3PZ2A 1N4PA 3E32A 3E37A 3Q73A 4GTTA 4L9PA 3PZ3A 3E30A 4YDOA 2ZISA 1O5MA 3HXCA 4MBGA 1O1RA 2H6GA 4GTQA 1JCQA 3Q79A 1NL4A 2H6IA 1QBQA 3KSQA 3DSTA 3DSVA 4GTRA 3PZ4A 1TNOA 1JCRA 3E33A 1O1SA 1O1TA 4GTOA 1LD8A 1TNUA 2IEJA 1FT2A 3DPYA 1KZPA 1TN8A 2H6FA 1MZCA 1D8DA 1N94A 3Q75A 1TNZA 2R2LA 1N95A 1SA4A 2F0YA 3HXFA 1N4RA 3DSSA 3E34A 1S63A 1SA5A 3Q7FA 3SFYA 4GTPA 1X81A 1LD7A 1LTXA 2H6HA 3HXEA 1FPPA 4GTVA 3PZ1A 2BEDA 1N4QA 3HXBA 2ZIRA 4EHMA 1S64A
chains in the Genus database with same CATH superfamily
3B7TA 1Y8MA 2Y69E 4EBAA 3D9LA 3UT8A 5AAOA 5DBKA 1KZOA 3CVVA 2VQ2A 3ZVVA 2Y0BG 2Y4TA 3HXDA 2AXVA 4GZ5A 3MYVA 2DBAA 3UM0A 2ILRA 3B95A 3TWXA 3R7RA 4YDWA 4GTTA 3TWTA 4L9PA 2XPIA 3IXEA 3RJVA 4I2ZA 1SZAA 2FO1E 2XHEA 5EKQD 2WXPA 3TXMA 1MYOA 3BEEA 4NRHB 3FU0A 4CZ2D 2V4HC 3CHSA 1AP7A 4AOFA 3G2VA 4FLHA 3C5RA 3ESKA 4PH4B 1HO8A 3AJIA 2LO6A 4TXQA 1HE8A 2AJAA 4A1GA 1IXVA 3V2XA 2XS1A 1OT8A 4UQYA 2VGEA 2VTBA 3SGHA 1MX2A 4UQZA 5KJMA 3EIQC 1D9SA 4ILHB 3L82A 4KMOA 4C0EA 5B3SE 3RKVA 2QYJA 3OAWA 5CMWA 3FUNA 3FTUA 3ONKA 4OVVA 4QQIA 2WQ7A 5AQ9A 1N4QA 3HXBA 5BW8C 2KC7A 1HFAA 4G11A 4EHMA 2KM4A 3FU5A 3LJ3A 3SF4A 1BU9A 4LNBA 2WXIA 3APCA 4W9RA 4K5BA 3FUHA 3T8MA 1JCSA 2Y4UA 4CEMA 4PUCA 3RSEG 2RFMA 1N4SA 3RRUA 5AQ7A 2ETAA 3PVLA 4LNGA 3E37A 4EZJA 4FA6A 3T8KA 3GW4A 4U8VD 2L0TB 4G23A 2DZNA 3CSTA 2JLBA 2WMOA 4WNGA 3E33A 5BV0A 3SBSA 3UI2A 1IQRA 3U64A 4XX5A 5D66A 4LUNU 3ZXPA 4F6RD 4HFGA 4H7YA 2AWIA 2DWZA 4J8DA 2P9IG 2BTDA 4I6JA 4JA7A 2VSXE 3HG0D 4E6HA 1H19A 3UINC 1TR4A 2MHKA 4YVQC 4RG6A 2KATA 4GTPA 3L54A 4FADA 1OXJA 5KNGA 4N2QA 4J8SA 3TWWA 2XGSA 3MV3B 3ZRHA 2VJ8A 4BFRA 4NACA 3QB2A 3CVNA 3ABKE 2AXUA 2I2OA 2C0LA 5KCMA 3CQCB 1JWGA 3FUJA 4AEZC 4HI8A 5CEDB 4B93B 2QY7A 2VGXA 3DWLG 4G24A 1NZNA 3CK7A 4J8EA 4I2WA 4YDYA 4V3IA 4BETA 4H7XA 3T5XA 3S7DA 3TWRA 1WM5A 3LVRE 3ZKJA 3HIZA 4TXRA 2H6FA 2ZXWE 2OEWA 4U0SA 3ULYA 4LRZA 4E85A 4DPRA 2VYIA 3RU0A 3EHNA 1E8YA 3FTVA 5LFAA 4GYWA 3FUEA 5EYLA 5KJNA 4APOA 3ZYMA 2X38A 3AAAC 3G2UA 4U8YD 1G3NB 2GRLA 4LERA 2P2CP 3WXXA 4IULA 3W9GA 3CHMA 5EN5D 3NB2A 3VLEA 3JYSA 3F6QA 3G2SA 3O48A 5G05J 3RAUA 3PH0C 4DX6D 3G2WA 4ILGA 3CK9A 4FHJA 1HF8A 4JEHA 2OEVA 3CVPA 2V8SE 4AM9A 2P9UG 3IHYA 3CVUA 4LCTA 3ENEA 4GYOA 4EPZA 3VLFA 3DRAA 3FUFA 2V5QC 3ULEG 4OAVB 2LXLA 3ZEFA 4A1SA 3S7FA 1H2TC 3QOUA 4XEIG 1U3CA 4DLQA 3SD5A 3JUEA 4BT9A 1LF8A 4GU5A 1JCQA 4K5CA 3TWSA 4HRMB 2YHCA 3QKYA 4M7CA 3NQPA 2NSZA 3U66A 1TNUA 1FT2A 3OTNA 3I4GA 3B7UX 4RQIA 1FVFA 1B89A 3QWWA 5HS0A 4B0ZA 2XRZA 4BTBA 4WUYA 3UX4A 2PQNA 2YNQA 2GRNB 1S63A 5AJDA 3SZ7A 2CHXA 4GZDA 3QWVA 4APFA 3FTZA 2DZOA 1DC2A 4DLOA 3FH5A 4HOQA 3L17A 4WWPA 3C72A 3MZLB 1FT1A 2VTBB 3L22A 2LUHA 3I5PA 1EYHA 2DYRE 3JUIA 1MJ0A 3FTYA 5FZSA 3TL5A 3CHQA 1U3DA 4O1PA 2E0IA 5D0OD 4XI9A 5AYWD 2VGYA 4GTSA 4FULA 4BTAA 2AXZA 3IKOB 3PZ2A 1N4PA 3D3MA 4G8LA 3FDHA 1H6KA 4HLEA 3FY4A 1WDYA 3MV2B 1O1RA 4OVUA 1YMPA 4JC8A 2PZIA 2H6IA 5CERB 3EHMA 3W9FA 1EF1C 4LNUD 4DK5A 3C3RA 1INZA 5HI7A 2ETCA 3UM3A 3C3QA 1TN8A 2J09A 2HO1A 1ZB1A 4BT8A 5KWDA 3MKQA 1HU3A 3IEGA 2M63A 5FQ4A 1Z6TA 1UJJA 3LYAA 2EIKE 5HQ8A 2P9SG 4LSZE 3UIPC 3MKRA 4C0MA 5E75A 4J6IA 4Y6WA 2XZTG 4ATZD 3PEUB 2FF4A 4BY6A 2AW6A 4FU3A 1HG2A 3PNTB 4GTVA 2BEDA 4TRQA 3EHQA 5CBNA 2L0IA 1TNYA 3IV0A 4U0UA 4GPMA 3SFZA 5ENTD 3EJNA 2BF0X 2A5UA 2FULA 5ENSD 2IONA 2XRYA 3FTXA 5H7PA 3NBNB 5EX3A 1HZ4A 4U7EB 2XCBA 3ASFA 4Y6CA 2Y1LE 1H2UA 5LCWC 4EECA 3ONLA 2GW1A 3Q78A 2I1KA 4CDNA 4K03A 4U07A 5ITZF 4U0ZA 4TUUA 4XZ4A 2I1JA 4DJAA 3FH7A 4HBDA 4J7WA 1KT0A 3HXCA 3APDA 1Y6IA 5FIOA 1JUQA 4MLPA 3DSTA 3KSQA 4G1TA 4ME2A 2X6FA 4JEUA 5CEAA 4GTRA 4IN3B 4L7TA 1NA3A 3PNLB 3CVQA 3TJPA 4BX8A 3CVLA 3ZN3A 2GRQB 4GCNA 4HLLA 2VGXB 3LDZA 5ENPD 1N94A 4PS8A 1UG3A 2EQXA 2R05A 3BU8A 2F0YA 4JW1A 4K5AB 3BUAA 4O60A 3BG1B 4C9BB 1N4RA 1PC2A 2LXMA 3VTYA 3FUIA 2XGMA 3JXJA 4I1AA 2FEZA 1OUVA 1V55E 2KCLA 4G2VA 3G2TA 3PZ1A 4F1SA 2WXJA 2ZIRA 4GYYA 3ASDA 5ENOD 1DCEA 1NFIE 4DRXE 1UN8A 4ILIA 2KCVA 1BI7B 3QWPA 2KCKA 1MX6A 4KYOB 4XI0A 1D8EA 4I17A 4U95D 5BXOA 4BERA 3UUXA 2L6BA 2IOLA 4I9EA 3UM2A 2RD0A 4IYPA 2C0MA 3QC1A 2QZAA 4DUIA 4AV7A 4B89A 1QZ2A 4UI9K 5EYPF 4L2LA 5C2YA 2UY1A 1O5MA 2P9LG 4NQ0A 2WXOA 4P29A 1OWMA 4MRUA 2J07A 2XS8A 4CDMA 3D9NA 4HOSA 2BKGA 1O1SA 4JHRA 1O1TA 4WNEA 3V30A 3FUKA 3AG4E 1KZPA 2NC9A 2EINE 2RFAA 1KT1A 3ZHEB 3FP3A 3QAQA 3Q75A 3GZ2A 1DVPA 3CR3A 3VTXA 5JJ6A 3LXUX 3HXFA 3V79K 2HYZA 4A55A 3B13A 3ZYQA 4RSYA 1K1BA 3CKBA 5J90A 3L9TA 3NOGD 3NF1A 3LS8A 3S2AA 1N9AA 2GRPB 3ISMC 3RRMB 4B8AA 5B1AE 5A6CA 4ZHBA 2P9PG 2A4ZA 4DI3A 4JB8P 3PUKA 4FJZA 3PUJA 5BNWA 3VLDA 4B94A 1P5QA 1YCSB 2VSOE 5ENNA 4WWOA 4WNFA 1ZBPA 3FEXA 2BKKB 4KZCA 2XZDG 2F8YA 4N5CA 1YA0A 2NXPA 1IHGA 3CHPA 5EILA 3HVEA 2IO3C 4MBGA 5CCLA 4GTQA 4CT0A 1OCRE 1TYQG 1QBQA 2L9BA 4C48B 3EU9A 4TXPA 2CFZA 3MX3A 2KXPC 3KD7A 4RVBA 4F3VA 2OCCE 1OWLA 2RG8A 2HE0A 3LPZA 5FZRA 4A3TA 3ZUVB 3I3NA 4PS3A 2R2LA 2OVBA 4O1OA 3CHRA 1JPLA 1NA0A 2XPZA 5ANLA 3ZYKA 1TEZA 1HH8A 1WG0A 3ZPJA 3SHFA 4YVOA 3FU3A 4J0UA 2H6HA 4A63B 3MKQB 1OWPA 4CCAA 1E96B 2V4LA 3I4RB 4HOUA 4WWNA 2QYUA 2P9NG 4HXIA 5KJKA 1TN7A 4JVSA 5G55A 4KT6B 3GYZA 4K0RA 3L6AA 3DSUA 4AY6A 3JQ0A 3TWUA 4GMLA 5FWQA 2J9QA 1MHQA 3ABME 4IRUA 2MOWA 4G25A 1SVXA 2J08A 1QQEA 2FBNA 4N3BA 2B6CA 5A23A 2L6JA 3D9JA 4WNDA 3BQOA 2HM8A 5E76A 4BSXA 1BLXB 1N54A 2KBXA 2OOEA 3T5VA 5ARGA 4DI4A 4U8HA 2DIWA 4J8FA 3CVWA 2DYSE 4KVMA 1LD8A 3ML8A 4N3CA 1H6PA 3R9MA 4GMRA 3OXGA 1OY3D 3CK8A 2X6HA 4HRLA 3C98A 3TWQA 3WG7E 2WXHA 1E8WA 1FCHA 2EIJE 1E8XA 4QFVA 3UIOC 3NOCD 2JEKA 3Q9UC 3AG3E 1DNPA 3FHEA 3PREA 1NP7A 4ABNA 4NURA 3ASNE 3AS4A 1QNFA 1ZU2A 4TV3A 2LSUA 5HKPA 3CIAA 3R7QA 4M3OA 2X6KA 5DIZA 2FO7A 1K1AA 2WXKA 3LY7A 4X8QA 4EQFA 3FUDA 4CRWA 3QK0A 3CKCA 2WMNA 4I6GA 3FFLA 3LY8A 4OYSA 3LVQE 1PY1A 4Q96A 4Q69A 3Q73A 2CFUA 3E4BA 4MKTA 4TUMA 2X6IA 3D9IA 3DXMG 3UTMA 5T3RA 2ETBA 1E90A 5BT1A 2UWJG 4WAFA 4ANXA 5KNHD 4GMJA 5BV1A 2OV8A 4GA0A 1BD8A 3DEOA 5M72A 5T8IA 2IOSA 2IEJA 3DPYA 3V2OA 1MZCA 1E7UA 4EZKA 2AVPA 4GZCA 2UY1B 3PRZA 5AENA 3CLJA 1N0QA 3CHOA 1QYMA 2XENA 4L23A 3ULQA 4UUCA 2XEEA 4CGVA 1BPOA 1K3ZD 3ESLA 3ZW3A 3K9IA 3FTWA 2CG3A 4HOTA 4FLBA 4KBQA 1S64A 5ANRA 4XIFA 2KZTA 3KAEA 1EPUA 3U3WA 2R02A 5AN8A 4HRNA 1H0AA 3TXNA 2MRIA 5JMND 3AG1E 4L1BA 3UPVA 3EUVA 5CRVA 3N71A 3LKUA 4B8CB 2NYJA 1V54E 3HHMA 4UWHA 3NAWA 3LY9A 3P1UA 3S7BA 3MCXA 4UWKA 1N0RA 4FC8A 5BPPA 4URKA 4NIKA 4HB5A 4YDOA 1W3BA 3FEYA 2MYOA 4JL0A 3CSFA 1GW6A 1XNFA 1Q2ZA 1JWFA 3KEZA 4EBAG 3LJNA 1ELRA 1TNOA 1JCRA 1SZ9A 4HS2A 4G26A 2DVWA 3HVEB 4I9CA 1D8DA 3UKRG 3IHVA 4XE0A 2I6HA 4HORA 1ELKA 2DCPA 1WY6A 3AG2E 1EDUA 3SFYA 2PNNA 1X81A 4JHJA 1HX8A 3Q15A 2J4DA 5CCMA 2R17C 3UT7A 3CGHA 2I9CA 3QJZA 4FP7A 4I43A 3Q9NC 1S0PA 3UKUG 3FTSA 1HS6A 1UW4B 3DSWA 2PL2A 2C2LA 4YDEA 5IY5E 5CBOA 2WM9A 2WXNA 3TAXA 3ZFWA 2WPVA 2F8XK 4AJWA 3EU5A 2QFCA 3P2BA 2JABA 5EX0A 4GAAA 4HVBA 3DXKG 2PQRA 4GTMA 4I6EA 1YYHA 1WAO1 2J49A 4JXTA 3R9AB 4O6FA 1BI8B 1E7VA 5FZQA 4I1OB 4J8YA 5FT9A 3ZNGA 3Q79A 5KJLA 3SY2A 1IHBA 3JXIA 3ZGQA 2V0PA 4GTOA 4CYMD 4BWRA 5AARA 2IJGX 2R03A 2WQHA 2CHZA 3JQ1A 3RIBA 2B0OE 2V5FA 3Q49B 2LAHA 3LCAA 4ZFHA 2VSYA 2R59A 4DX5D 5LCWJ 4YNDA 4GZ6A 2ZGGA 5G2NA 2FI7A 3ZYLA 4MS6A 3MGBA 3D9PA 2IU1A 4JPSA 2XEVA 5LX8A 4OAUC 3PS6A 1U2VG 5BXUA 1E8ZA 2X3MA 1OCCE 2XPYA 4HI9A 2LNIA 2R5SA 5HRYA 5JHAA 3C3OA 4XKBA 1NI1A 1HXIA 3KS2A 4FJYA 4L2YA 1DCQA 2GRMA 4EZLA 3TG5A 5D0QD 5A7DB 3AU4A 2E2EA 1KPSB 2Q7FA 2LAIA 1Z3YA 3B7RL 4AY5A 3O4ZA 3HYMB 4UQXA 4G8KA 2XGOA 3CVXA 2WXMA 4JD2G 2WVIA 2WXFA 3RRNB 5G05C 4CT4A 4ACKA 3EHRA 2WXLA 4RLYA 3PDNA 3KEAA 3UT4A 3IBEA 4ANUA 3B7SA 2XQ0A 2YQ8A 3RO2A 1SW6A 3OXLA 4GA2A 4ATGA 2WQ6A 3LEWA 3RO3A 4ANWA 5JJTA 3FU6A 3DEPA 4Q94A 3Q7FA 2EILE 4BESA 1N11A 4UWGA 5EDSA 2GGFA 2J8SD 3TGOA 3HXEA 1FPPA 4I1MA 3V31A 4AP2A 2YINA 2IY0C 3FWVA 2IF4A 3ZIMA 4KXKB 5FQ7A 3UMVA 5AJLA 5FQ8A 1A5EA 4DX2A 5G04C 4PS7A 3X2QE 4CGWA 3D9OA 5CECB 2XEHA 4F53A 1SQMA 4JA9A 1RW2A 4UWLA 4HQDA 3U9WA 3UM1A 3SFXA 2P58C 3D9KA 1OWNA 2KZTB 2XCCA 3E32A 3GZSA 3PZDA 3UXGA 1L5JA 3D9MA 5B1BE 3E30A 2ZISA 2PM6A 5ARFA 1TJCA 3MA5A 4ACLA 2RKKA 5KBAA 4D10C 3AS8A 5BUZA 3PE4A 3QARA 1MX4A 4UWFA 1PAQA 1XGWA 3ZXSA 2QC9A 3J5QB 1H2VC 4U63A 4KVOA 2CHWA 5FQ6A 5AQBA 1Z3XA 3UQ3A 2CG2A 4N39A 4UI9C 3L13A 4U96D 2WXRA 4AXHA 4DX7D 4N2SA 2IO2C 1LTXA 5LP0A 3FUMA 4DX1A 4F1PA 3Q7AA 3CVYA 1OCZE 4GA1A 3FH8A 1K8KG 3QDNA 3ZHEA 4LG6A 1TN6A 3APFA 4AIFA 3QNKA 2VSNA 1FVHA 3AU5A 1S70B 2PM7A 3L08A 1UN9A 1IYGA 3RK6A 3U4TA 5J08A 1RZ4A 3ML9A 3PE3A 1TNBA 3DSXA 3PZ3A 2WXQA 3MJWA 1UOHA 4HNAD 5G04J 3GZ1A 4N3AA 3HRAA 2A5EA 3Q5MA 5EIBE 1NL4A 1TJFA 5CRUA 3CV0A 1ELWA 4KZ0A 3TG4A 3DSVA 4LEUA 2GROB 1N52A 3SBTB 3J5PA 5JA4D 2J4BA 5C1DA 1TNZA 1N95A 5FINA 1SA4A 3JCKC 5EIDA 3SNXA 1UJKA 2X6JA 4JHKA 4ANVA 3DSSA 1OWOA 3SI5A 4PDXA 4CDRA 3BG0B 1SA5A 2HR2A 3S7JA 5AQAA 3NZUA 3PEVB 5AIJA 2WB2A 3EIJA 4AVXA 4GPKA 3ASHA 3D9HA 5FTPA 4BX9A 3EDTB 3NZSA 1IKND 4F7AA 3Q4AB 2IQCA 5JJ7A 1IQUA 3TWVA 2LSVA 5LOZA 4UI9J 3T9KA 3DPDA 2F37A 2WXGA 3FULA 1OCOE 5CMYA 2Y3AA 1A17A 3Q47B 4GZ3A 3KSLA 3SO8A 4A3VA 1Z5SC 3ASOE 4JZYA 4R7LA 3DBSA 3SQVA 2BUGA 4Z68A 1HG5A 4GB9A 3ABLE 5CHEE 2ZU6B 4N5QA 1VDYA 1X5BA 2P9KG 2H6GA 3ASGA 3MEKA 3L16A 1MQSA 2GRRB 3URZA 3AS5A 2ZGDA 1H6OA 2EIME 3PZ4A 5T4YA 4BSZB 4BEPA 4XKCA 5FJYA 2IFUA 5JHBA 4GCOA 3ZU7B 3OXFA 3HDXA 4RG9A 5ENRD 4U04A 3E34A 1AWCB 5D2MC 2ONDA 3CEQA 2OVFA 1KLXA 1LD7A 3B7BA 5ENQD 4FHKA 3CQGB 2YHEA
chains in the Genus database with same CATH topology
1N9AA 3C72A 1FT1A 1TNYA 1DCEA 3Q7AA 3DSWA 4YDEA 1TN7A 4LNBA 1KZOA 3EUVA 1TN6A 1D8EA 1NI1A 1JCSA 3HXDA 3EU5A 3DSUA 3KSLA 1N4SA 4GTSA 3DRAA 3Q78A 3SFXA 1TNBA 4GTMA 3DSXA 4LNGA 3PZ2A 1N4PA 3E32A 3E37A 3Q73A 4GTTA 4L9PA 3PZ3A 3E30A 4YDOA 2ZISA 1O5MA 3HXCA 4MBGA 1O1RA 2H6GA 4GTQA 1JCQA 3Q79A 1NL4A 2H6IA 1QBQA 3KSQA 3DSTA 3DSVA 4GTRA 3PZ4A 1TNOA 1JCRA 3E33A 1O1SA 1O1TA 4GTOA 1LD8A 1TNUA 2IEJA 1FT2A 3DPYA 1KZPA 1TN8A 2H6FA 1MZCA 1D8DA 1N94A 3Q75A 1TNZA 2R2LA 1N95A 1SA4A 2F0YA 3HXFA 1N4RA 3DSSA 3E34A 1S63A 1SA5A 3Q7FA 3SFYA 4GTPA 1X81A 1LD7A 1LTXA 2H6HA 3HXEA 1FPPA 4GTVA 3PZ1A 2BEDA 1N4QA 3HXBA 2ZIRA 4EHMA 1S64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9A A;  3C72 A;  1FT1 A;  1TNY A;  1DCE A;  3Q7A A;  3DSW A;  4YDE A;  1TN7 A;  4LNB A;  1KZO A;  3EUV A;  1TN6 A;  1D8E A;  1NI1 A;  1JCS A;  3HXD A;  3EU5 A;  3DSU A;  3KSL A;  1N4S A;  4GTS A;  3DRA A;  3Q78 A;  3SFX A;  1TNB A;  4GTM A;  3DSX A;  4LNG A;  3PZ2 A;  1N4P A;  3E32 A;  3E37 A;  3Q73 A;  4GTT A;  4L9P A;  3PZ3 A;  3E30 A;  4YDO A;  2ZIS A;  1O5M A;  3HXC A;  4MBG A;  1O1R A;  2H6G A;  4GTQ A;  1JCQ A;  3Q79 A;  1NL4 A;  2H6I A;  1QBQ A;  3KSQ A;  3DST A;  3DSV A;  4GTR A;  3PZ4 A;  1TNO A;  1JCR A;  3E33 A;  1O1S A;  1O1T A;  4GTO A;  1LD8 A;  1TNU A;  2IEJ A;  1FT2 A;  3DPY A;  1KZP A;  1TN8 A;  2H6F A;  1MZC A;  1D8D A;  1N94 A;  3Q75 A;  1TNZ A;  2R2L A;  1N95 A;  1SA4 A;  2F0Y A;  3HXF A;  1N4R A;  3DSS A;  3E34 A;  1S63 A;  1SA5 A;  3Q7F A;  3SFY A;  4GTP A;  1X81 A;  1LD7 A;  1LTX A;  2H6H A;  3HXE A;  1FPP A;  4GTV A;  3PZ1 A;  2BED A;  1N4Q A;  3HXB A;  2ZIR A;  4EHM A;  1S64 A; 
#chains in the Genus database with same CATH topology
 3B7T A;  1Y8M A;  2Y69 E;  4EBA A;  3D9L A;  3UT8 A;  5AAO A;  5DBK A;  1KZO A;  3CVV A;  2VQ2 A;  3ZVV A;  2Y0B G;  2Y4T A;  3HXD A;  2AXV A;  4GZ5 A;  3MYV A;  2DBA A;  3UM0 A;  2ILR A;  3B95 A;  3TWX A;  3R7R A;  4YDW A;  4GTT A;  3TWT A;  4L9P A;  2XPI A;  3IXE A;  3RJV A;  4I2Z A;  1SZA A;  2FO1 E;  2XHE A;  5EKQ D;  2WXP A;  3TXM A;  1MYO A;  3BEE A;  4NRH B;  3FU0 A;  4CZ2 D;  2V4H C;  3CHS A;  1AP7 A;  4AOF A;  3G2V A;  4FLH A;  3C5R A;  3ESK A;  4PH4 B;  1HO8 A;  3AJI A;  2LO6 A;  4TXQ A;  1HE8 A;  2AJA A;  4A1G A;  1IXV A;  3V2X A;  2XS1 A;  1OT8 A;  4UQY A;  2VGE A;  2VTB A;  3SGH A;  1MX2 A;  4UQZ A;  5KJM A;  3EIQ C;  1D9S A;  4ILH B;  3L82 A;  4KMO A;  4C0E A;  5B3S E;  3RKV A;  2QYJ A;  3OAW A;  5CMW A;  3FUN A;  3FTU A;  3ONK A;  4OVV A;  4QQI A;  2WQ7 A;  5AQ9 A;  1N4Q A;  3HXB A;  5BW8 C;  2KC7 A;  1HFA A;  4G11 A;  4EHM A;  2KM4 A;  3FU5 A;  3LJ3 A;  3SF4 A;  1BU9 A;  4LNB A;  2WXI A;  3APC A;  4W9R A;  4K5B A;  3FUH A;  3T8M A;  1JCS A;  2Y4U A;  4CEM A;  4PUC A;  3RSE G;  2RFM A;  1N4S A;  3RRU A;  5AQ7 A;  2ETA A;  3PVL A;  4LNG A;  3E37 A;  4EZJ A;  4FA6 A;  3T8K A;  3GW4 A;  4U8V D;  2L0T B;  4G23 A;  2DZN A;  3CST A;  2JLB A;  2WMO A;  4WNG A;  3E33 A;  5BV0 A;  3SBS A;  3UI2 A;  1IQR A;  3U64 A;  4XX5 A;  5D66 A;  4LUN U;  3ZXP A;  4F6R D;  4HFG A;  4H7Y A;  2AWI A;  2DWZ A;  4J8D A;  2P9I G;  2BTD A;  4I6J A;  4JA7 A;  2VSX E;  3HG0 D;  4E6H A;  1H19 A;  3UIN C;  1TR4 A;  2MHK A;  4YVQ C;  4RG6 A;  2KAT A;  4GTP A;  3L54 A;  4FAD A;  1OXJ A;  5KNG A;  4N2Q A;  4J8S A;  3TWW A;  2XGS A;  3MV3 B;  3ZRH A;  2VJ8 A;  4BFR A;  4NAC A;  3QB2 A;  3CVN A;  3ABK E;  2AXU A;  2I2O A;  2C0L A;  5KCM A;  3CQC B;  1JWG A;  3FUJ A;  4AEZ C;  4HI8 A;  5CED B;  4B93 B;  2QY7 A;  2VGX A;  3DWL G;  4G24 A;  1NZN A;  3CK7 A;  4J8E A;  4I2W A;  4YDY A;  4V3I A;  4BET A;  4H7X A;  3T5X A;  3S7D A;  3TWR A;  1WM5 A;  3LVR E;  3ZKJ A;  3HIZ A;  4TXR A;  2H6F A;  2ZXW E;  2OEW A;  4U0S A;  3ULY A;  4LRZ A;  4E85 A;  4DPR A;  2VYI A;  3RU0 A;  3EHN A;  1E8Y A;  3FTV A;  5LFA A;  4GYW A;  3FUE A;  5EYL A;  5KJN A;  4APO A;  3ZYM A;  2X38 A;  3AAA C;  3G2U A;  4U8Y D;  1G3N B;  2GRL A;  4LER A;  2P2C P;  3WXX A;  4IUL A;  3W9G A;  3CHM A;  5EN5 D;  3NB2 A;  3VLE A;  3JYS A;  3F6Q A;  3G2S A;  3O48 A;  5G05 J;  3RAU A;  3PH0 C;  4DX6 D;  3G2W A;  4ILG A;  3CK9 A;  4FHJ A;  1HF8 A;  4JEH A;  2OEV A;  3CVP A;  2V8S E;  4AM9 A;  2P9U G;  3IHY A;  3CVU A;  4LCT A;  3ENE A;  4GYO A;  4EPZ A;  3VLF A;  3DRA A;  3FUF A;  2V5Q C;  3ULE G;  4OAV B;  2LXL A;  3ZEF A;  4A1S A;  3S7F A;  1H2T C;  3QOU A;  4XEI G;  1U3C A;  4DLQ A;  3SD5 A;  3JUE A;  4BT9 A;  1LF8 A;  4GU5 A;  1JCQ A;  4K5C A;  3TWS A;  4HRM B;  2YHC A;  3QKY A;  4M7C A;  3NQP A;  2NSZ A;  3U66 A;  1TNU A;  1FT2 A;  3OTN A;  3I4G A;  3B7U X;  4RQI A;  1FVF A;  1B89 A;  3QWW A;  5HS0 A;  4B0Z A;  2XRZ A;  4BTB A;  4WUY A;  3UX4 A;  2PQN A;  2YNQ A;  2GRN B;  1S63 A;  5AJD A;  3SZ7 A;  2CHX A;  4GZD A;  3QWV A;  4APF A;  3FTZ A;  2DZO A;  1DC2 A;  4DLO A;  3FH5 A;  4HOQ A;  3L17 A;  4WWP A;  3C72 A;  3MZL B;  1FT1 A;  2VTB B;  3L22 A;  2LUH A;  3I5P A;  1EYH A;  2DYR E;  3JUI A;  1MJ0 A;  3FTY A;  5FZS A;  3TL5 A;  3CHQ A;  1U3D A;  4O1P A;  2E0I A;  5D0O D;  4XI9 A;  5AYW D;  2VGY A;  4GTS A;  4FUL A;  4BTA A;  2AXZ A;  3IKO B;  3PZ2 A;  1N4P A;  3D3M A;  4G8L A;  3FDH A;  1H6K A;  4HLE A;  3FY4 A;  1WDY A;  3MV2 B;  1O1R A;  4OVU A;  1YMP A;  4JC8 A;  2PZI A;  2H6I A;  5CER B;  3EHM A;  3W9F A;  1EF1 C;  4LNU D;  4DK5 A;  3C3R A;  1INZ A;  5HI7 A;  2ETC A;  3UM3 A;  3C3Q A;  1TN8 A;  2J09 A;  2HO1 A;  1ZB1 A;  4BT8 A;  5KWD A;  3MKQ A;  1HU3 A;  3IEG A;  2M63 A;  5FQ4 A;  1Z6T A;  1UJJ A;  3LYA A;  2EIK E;  5HQ8 A;  2P9S G;  4LSZ E;  3UIP C;  3MKR A;  4C0M A;  5E75 A;  4J6I A;  4Y6W A;  2XZT G;  4ATZ D;  3PEU B;  2FF4 A;  4BY6 A;  2AW6 A;  4FU3 A;  1HG2 A;  3PNT B;  4GTV A;  2BED A;  4TRQ A;  3EHQ A;  5CBN A;  2L0I A;  1TNY A;  3IV0 A;  4U0U A;  4GPM A;  3SFZ A;  5ENT D;  3EJN A;  2BF0 X;  2A5U A;  2FUL A;  5ENS D;  2ION A;  2XRY A;  3FTX A;  5H7P A;  3NBN B;  5EX3 A;  1HZ4 A;  4U7E B;  2XCB A;  3ASF A;  4Y6C A;  2Y1L E;  1H2U A;  5LCW C;  4EEC A;  3ONL A;  2GW1 A;  3Q78 A;  2I1K A;  4CDN A;  4K03 A;  4U07 A;  5ITZ F;  4U0Z A;  4TUU A;  4XZ4 A;  2I1J A;  4DJA A;  3FH7 A;  4HBD A;  4J7W A;  1KT0 A;  3HXC A;  3APD A;  1Y6I A;  5FIO A;  1JUQ A;  4MLP A;  3DST A;  3KSQ A;  4G1T A;  4ME2 A;  2X6F A;  4JEU A;  5CEA A;  4GTR A;  4IN3 B;  4L7T A;  1NA3 A;  3PNL B;  3CVQ A;  3TJP A;  4BX8 A;  3CVL A;  3ZN3 A;  2GRQ B;  4GCN A;  4HLL A;  2VGX B;  3LDZ A;  5ENP D;  1N94 A;  4PS8 A;  1UG3 A;  2EQX A;  2R05 A;  3BU8 A;  2F0Y A;  4JW1 A;  4K5A B;  3BUA A;  4O60 A;  3BG1 B;  4C9B B;  1N4R A;  1PC2 A;  2LXM A;  3VTY A;  3FUI A;  2XGM A;  3JXJ A;  4I1A A;  2FEZ A;  1OUV A;  1V55 E;  2KCL A;  4G2V A;  3G2T A;  3PZ1 A;  4F1S A;  2WXJ A;  2ZIR A;  4GYY A;  3ASD A;  5ENO D;  1DCE A;  1NFI E;  4DRX E;  1UN8 A;  4ILI A;  2KCV A;  1BI7 B;  3QWP A;  2KCK A;  1MX6 A;  4KYO B;  4XI0 A;  1D8E A;  4I17 A;  4U95 D;  5BXO A;  4BER A;  3UUX A;  2L6B A;  2IOL A;  4I9E A;  3UM2 A;  2RD0 A;  4IYP A;  2C0M A;  3QC1 A;  2QZA A;  4DUI A;  4AV7 A;  4B89 A;  1QZ2 A;  4UI9 K;  5EYP F;  4L2L A;  5C2Y A;  2UY1 A;  1O5M A;  2P9L G;  4NQ0 A;  2WXO A;  4P29 A;  1OWM A;  4MRU A;  2J07 A;  2XS8 A;  4CDM A;  3D9N A;  4HOS A;  2BKG A;  1O1S A;  4JHR A;  1O1T A;  4WNE A;  3V30 A;  3FUK A;  3AG4 E;  1KZP A;  2NC9 A;  2EIN E;  2RFA A;  1KT1 A;  3ZHE B;  3FP3 A;  3QAQ A;  3Q75 A;  3GZ2 A;  1DVP A;  3CR3 A;  3VTX A;  5JJ6 A;  3LXU X;  3HXF A;  3V79 K;  2HYZ A;  4A55 A;  3B13 A;  3ZYQ A;  4RSY A;  1K1B A;  3CKB A;  5J90 A;  3L9T A;  3NOG D;  3NF1 A;  3LS8 A;  3S2A A;  1N9A A;  2GRP B;  3ISM C;  3RRM B;  4B8A A;  5B1A E;  5A6C A;  4ZHB A;  2P9P G;  2A4Z A;  4DI3 A;  4JB8 P;  3PUK A;  4FJZ A;  3PUJ A;  5BNW A;  3VLD A;  4B94 A;  1P5Q A;  1YCS B;  2VSO E;  5ENN A;  4WWO A;  4WNF A;  1ZBP A;  3FEX A;  2BKK B;  4KZC A;  2XZD G;  2F8Y A;  4N5C A;  1YA0 A;  2NXP A;  1IHG A;  3CHP A;  5EIL A;  3HVE A;  2IO3 C;  4MBG A;  5CCL A;  4GTQ A;  4CT0 A;  1OCR E;  1TYQ G;  1QBQ A;  2L9B A;  4C48 B;  3EU9 A;  4TXP A;  2CFZ A;  3MX3 A;  2KXP C;  3KD7 A;  4RVB A;  4F3V A;  2OCC E;  1OWL A;  2RG8 A;  2HE0 A;  3LPZ A;  5FZR A;  4A3T A;  3ZUV B;  3I3N A;  4PS3 A;  2R2L A;  2OVB A;  4O1O A;  3CHR A;  1JPL A;  1NA0 A;  2XPZ A;  5ANL A;  3ZYK A;  1TEZ A;  1HH8 A;  1WG0 A;  3ZPJ A;  3SHF A;  4YVO A;  3FU3 A;  4J0U A;  2H6H A;  4A63 B;  3MKQ B;  1OWP A;  4CCA A;  1E96 B;  2V4L A;  3I4R B;  4HOU A;  4WWN A;  2QYU A;  2P9N G;  4HXI A;  5KJK A;  1TN7 A;  4JVS A;  5G55 A;  4KT6 B;  3GYZ A;  4K0R A;  3L6A A;  3DSU A;  4AY6 A;  3JQ0 A;  3TWU A;  4GML A;  5FWQ A;  2J9Q A;  1MHQ A;  3ABM E;  4IRU A;  2MOW A;  4G25 A;  1SVX A;  2J08 A;  1QQE A;  2FBN A;  4N3B A;  2B6C A;  5A23 A;  2L6J A;  3D9J A;  4WND A;  3BQO A;  2HM8 A;  5E76 A;  4BSX A;  1BLX B;  1N54 A;  2KBX A;  2OOE A;  3T5V A;  5ARG A;  4DI4 A;  4U8H A;  2DIW A;  4J8F A;  3CVW A;  2DYS E;  4KVM A;  1LD8 A;  3ML8 A;  4N3C A;  1H6P A;  3R9M A;  4GMR A;  3OXG A;  1OY3 D;  3CK8 A;  2X6H A;  4HRL A;  3C98 A;  3TWQ A;  3WG7 E;  2WXH A;  1E8W A;  1FCH A;  2EIJ E;  1E8X A;  4QFV A;  3UIO C;  3NOC D;  2JEK A;  3Q9U C;  3AG3 E;  1DNP A;  3FHE A;  3PRE A;  1NP7 A;  4ABN A;  4NUR A;  3ASN E;  3AS4 A;  1QNF A;  1ZU2 A;  4TV3 A;  2LSU A;  5HKP A;  3CIA A;  3R7Q A;  4M3O A;  2X6K A;  5DIZ A;  2FO7 A;  1K1A A;  2WXK A;  3LY7 A;  4X8Q A;  4EQF A;  3FUD A;  4CRW A;  3QK0 A;  3CKC A;  2WMN A;  4I6G A;  3FFL A;  3LY8 A;  4OYS A;  3LVQ E;  1PY1 A;  4Q96 A;  4Q69 A;  3Q73 A;  2CFU A;  3E4B A;  4MKT A;  4TUM A;  2X6I A;  3D9I A;  3DXM G;  3UTM A;  5T3R A;  2ETB A;  1E90 A;  5BT1 A;  2UWJ G;  4WAF A;  4ANX A;  5KNH D;  4GMJ A;  5BV1 A;  2OV8 A;  4GA0 A;  1BD8 A;  3DEO A;  5M72 A;  5T8I A;  2IOS A;  2IEJ A;  3DPY A;  3V2O A;  1MZC A;  1E7U A;  4EZK A;  2AVP A;  4GZC A;  2UY1 B;  3PRZ A;  5AEN A;  3CLJ A;  1N0Q A;  3CHO A;  1QYM A;  2XEN A;  4L23 A;  3ULQ A;  4UUC A;  2XEE A;  4CGV A;  1BPO A;  1K3Z D;  3ESL A;  3ZW3 A;  3K9I A;  3FTW A;  2CG3 A;  4HOT A;  4FLB A;  4KBQ A;  1S64 A;  5ANR A;  4XIF A;  2KZT A;  3KAE A;  1EPU A;  3U3W A;  2R02 A;  5AN8 A;  4HRN A;  1H0A A;  3TXN A;  2MRI A;  5JMN D;  3AG1 E;  4L1B A;  3UPV A;  3EUV A;  5CRV A;  3N71 A;  3LKU A;  4B8C B;  2NYJ A;  1V54 E;  3HHM A;  4UWH A;  3NAW A;  3LY9 A;  3P1U A;  3S7B A;  3MCX A;  4UWK A;  1N0R A;  4FC8 A;  5BPP A;  4URK A;  4NIK A;  4HB5 A;  4YDO A;  1W3B A;  3FEY A;  2MYO A;  4JL0 A;  3CSF A;  1GW6 A;  1XNF A;  1Q2Z A;  1JWF A;  3KEZ A;  4EBA G;  3LJN A;  1ELR A;  1TNO A;  1JCR A;  1SZ9 A;  4HS2 A;  4G26 A;  2DVW A;  3HVE B;  4I9C A;  1D8D A;  3UKR G;  3IHV A;  4XE0 A;  2I6H A;  4HOR A;  1ELK A;  2DCP A;  1WY6 A;  3AG2 E;  1EDU A;  3SFY A;  2PNN A;  1X81 A;  4JHJ A;  1HX8 A;  3Q15 A;  2J4D A;  5CCM A;  2R17 C;  3UT7 A;  3CGH A;  2I9C A;  3QJZ A;  4FP7 A;  4I43 A;  3Q9N C;  1S0P A;  3UKU G;  3FTS A;  1HS6 A;  1UW4 B;  3DSW A;  2PL2 A;  2C2L A;  4YDE A;  5IY5 E;  5CBO A;  2WM9 A;  2WXN A;  3TAX A;  3ZFW A;  2WPV A;  2F8X K;  4AJW A;  3EU5 A;  2QFC A;  3P2B A;  2JAB A;  5EX0 A;  4GAA A;  4HVB A;  3DXK G;  2PQR A;  4GTM A;  4I6E A;  1YYH A;  1WAO 1;  2J49 A;  4JXT A;  3R9A B;  4O6F A;  1BI8 B;  1E7V A;  5FZQ A;  4I1O B;  4J8Y A;  5FT9 A;  3ZNG A;  3Q79 A;  5KJL A;  3SY2 A;  1IHB A;  3JXI A;  3ZGQ A;  2V0P A;  4GTO A;  4CYM D;  4BWR A;  5AAR A;  2IJG X;  2R03 A;  2WQH A;  2CHZ A;  3JQ1 A;  3RIB A;  2B0O E;  2V5F A;  3Q49 B;  2LAH A;  3LCA A;  4ZFH A;  2VSY A;  2R59 A;  4DX5 D;  5LCW J;  4YND A;  4GZ6 A;  2ZGG A;  5G2N A;  2FI7 A;  3ZYL A;  4MS6 A;  3MGB A;  3D9P A;  2IU1 A;  4JPS A;  2XEV A;  5LX8 A;  4OAU C;  3PS6 A;  1U2V G;  5BXU A;  1E8Z A;  2X3M A;  1OCC E;  2XPY A;  4HI9 A;  2LNI A;  2R5S A;  5HRY A;  5JHA A;  3C3O A;  4XKB A;  1NI1 A;  1HXI A;  3KS2 A;  4FJY A;  4L2Y A;  1DCQ A;  2GRM A;  4EZL A;  3TG5 A;  5D0Q D;  5A7D B;  3AU4 A;  2E2E A;  1KPS B;  2Q7F A;  2LAI A;  1Z3Y A;  3B7R L;  4AY5 A;  3O4Z A;  3HYM B;  4UQX A;  4G8K A;  2XGO A;  3CVX A;  2WXM A;  4JD2 G;  2WVI A;  2WXF A;  3RRN B;  5G05 C;  4CT4 A;  4ACK A;  3EHR A;  2WXL A;  4RLY A;  3PDN A;  3KEA A;  3UT4 A;  3IBE A;  4ANU A;  3B7S A;  2XQ0 A;  2YQ8 A;  3RO2 A;  1SW6 A;  3OXL A;  4GA2 A;  4ATG A;  2WQ6 A;  3LEW A;  3RO3 A;  4ANW A;  5JJT A;  3FU6 A;  3DEP A;  4Q94 A;  3Q7F A;  2EIL E;  4BES A;  1N11 A;  4UWG A;  5EDS A;  2GGF A;  2J8S D;  3TGO A;  3HXE A;  1FPP A;  4I1M A;  3V31 A;  4AP2 A;  2YIN A;  2IY0 C;  3FWV A;  2IF4 A;  3ZIM A;  4KXK B;  5FQ7 A;  3UMV A;  5AJL A;  5FQ8 A;  1A5E A;  4DX2 A;  5G04 C;  4PS7 A;  3X2Q E;  4CGW A;  3D9O A;  5CEC B;  2XEH A;  4F53 A;  1SQM A;  4JA9 A;  1RW2 A;  4UWL A;  4HQD A;  3U9W A;  3UM1 A;  3SFX A;  2P58 C;  3D9K A;  1OWN A;  2KZT B;  2XCC A;  3E32 A;  3GZS A;  3PZD A;  3UXG A;  1L5J A;  3D9M A;  5B1B E;  3E30 A;  2ZIS A;  2PM6 A;  5ARF A;  1TJC A;  3MA5 A;  4ACL A;  2RKK A;  5KBA A;  4D10 C;  3AS8 A;  5BUZ A;  3PE4 A;  3QAR A;  1MX4 A;  4UWF A;  1PAQ A;  1XGW A;  3ZXS A;  2QC9 A;  3J5Q B;  1H2V C;  4U63 A;  4KVO A;  2CHW A;  5FQ6 A;  5AQB A;  1Z3X A;  3UQ3 A;  2CG2 A;  4N39 A;  4UI9 C;  3L13 A;  4U96 D;  2WXR A;  4AXH A;  4DX7 D;  4N2S A;  2IO2 C;  1LTX A;  5LP0 A;  3FUM A;  4DX1 A;  4F1P A;  3Q7A A;  3CVY A;  1OCZ E;  4GA1 A;  3FH8 A;  1K8K G;  3QDN A;  3ZHE A;  4LG6 A;  1TN6 A;  3APF A;  4AIF A;  3QNK A;  2VSN A;  1FVH A;  3AU5 A;  1S70 B;  2PM7 A;  3L08 A;  1UN9 A;  1IYG A;  3RK6 A;  3U4T A;  5J08 A;  1RZ4 A;  3ML9 A;  3PE3 A;  1TNB A;  3DSX A;  3PZ3 A;  2WXQ A;  3MJW A;  1UOH A;  4HNA D;  5G04 J;  3GZ1 A;  4N3A A;  3HRA A;  2A5E A;  3Q5M A;  5EIB E;  1NL4 A;  1TJF A;  5CRU A;  3CV0 A;  1ELW A;  4KZ0 A;  3TG4 A;  3DSV A;  4LEU A;  2GRO B;  1N52 A;  3SBT B;  3J5P A;  5JA4 D;  2J4B A;  5C1D A;  1TNZ A;  1N95 A;  5FIN A;  1SA4 A;  3JCK C;  5EID A;  3SNX A;  1UJK A;  2X6J A;  4JHK A;  4ANV A;  3DSS A;  1OWO A;  3SI5 A;  4PDX A;  4CDR A;  3BG0 B;  1SA5 A;  2HR2 A;  3S7J A;  5AQA A;  3NZU A;  3PEV B;  5AIJ A;  2WB2 A;  3EIJ A;  4AVX A;  4GPK A;  3ASH A;  3D9H A;  5FTP A;  4BX9 A;  3EDT B;  3NZS A;  1IKN D;  4F7A A;  3Q4A B;  2IQC A;  5JJ7 A;  1IQU A;  3TWV A;  2LSV A;  5LOZ A;  4UI9 J;  3T9K A;  3DPD A;  2F37 A;  2WXG A;  3FUL A;  1OCO E;  5CMY A;  2Y3A A;  1A17 A;  3Q47 B;  4GZ3 A;  3KSL A;  3SO8 A;  4A3V A;  1Z5S C;  3ASO E;  4JZY A;  4R7L A;  3DBS A;  3SQV A;  2BUG A;  4Z68 A;  1HG5 A;  4GB9 A;  3ABL E;  5CHE E;  2ZU6 B;  4N5Q A;  1VDY A;  1X5B A;  2P9K G;  2H6G A;  3ASG A;  3MEK A;  3L16 A;  1MQS A;  2GRR B;  3URZ A;  3AS5 A;  2ZGD A;  1H6O A;  2EIM E;  3PZ4 A;  5T4Y A;  4BSZ B;  4BEP A;  4XKC A;  5FJY A;  2IFU A;  5JHB A;  4GCO A;  3ZU7 B;  3OXF A;  3HDX A;  4RG9 A;  5ENR D;  4U04 A;  3E34 A;  1AWC B;  5D2M C;  2OND A;  3CEQ A;  2OVF A;  1KLX A;  1LD7 A;  3B7B A;  5ENQ D;  4FHK A;  3CQG B;  2YHE A; 
#chains in the Genus database with same CATH homology
 1N9A A;  3C72 A;  1FT1 A;  1TNY A;  1DCE A;  3Q7A A;  3DSW A;  4YDE A;  1TN7 A;  4LNB A;  1KZO A;  3EUV A;  1TN6 A;  1D8E A;  1NI1 A;  1JCS A;  3HXD A;  3EU5 A;  3DSU A;  3KSL A;  1N4S A;  4GTS A;  3DRA A;  3Q78 A;  3SFX A;  1TNB A;  4GTM A;  3DSX A;  4LNG A;  3PZ2 A;  1N4P A;  3E32 A;  3E37 A;  3Q73 A;  4GTT A;  4L9P A;  3PZ3 A;  3E30 A;  4YDO A;  2ZIS A;  1O5M A;  3HXC A;  4MBG A;  1O1R A;  2H6G A;  4GTQ A;  1JCQ A;  3Q79 A;  1NL4 A;  2H6I A;  1QBQ A;  3KSQ A;  3DST A;  3DSV A;  4GTR A;  3PZ4 A;  1TNO A;  1JCR A;  3E33 A;  1O1S A;  1O1T A;  4GTO A;  1LD8 A;  1TNU A;  2IEJ A;  1FT2 A;  3DPY A;  1KZP A;  1TN8 A;  2H6F A;  1MZC A;  1D8D A;  1N94 A;  3Q75 A;  1TNZ A;  2R2L A;  1N95 A;  1SA4 A;  2F0Y A;  3HXF A;  1N4R A;  3DSS A;  3E34 A;  1S63 A;  1SA5 A;  3Q7F A;  3SFY A;  4GTP A;  1X81 A;  1LD7 A;  1LTX A;  2H6H A;  3HXE A;  1FPP A;  4GTV A;  3PZ1 A;  2BED A;  1N4Q A;  3HXB A;  2ZIR A;  4EHM A;  1S64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...