2R2LA

Structure of farnesyl protein transferase bound to pb-93
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase subunit alpha
publication title Efficacy, pharmacokinetics, and metabolism of tetrahydroquinoline inhibitors of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2r2lA00
4GTVA 1JCSA 2H6IA 3Q79A 1N95A 1TNUA 1TN8A 1NL4A 1N4PA 1KZOA 1LD7A 4GTPA 4YDOA 3DSSA 3DRAA 4GTSA 3HXBA 1X81A 2BEDA 4GTTA 1TNBA 1TNOA 3DPYA 3E33A 1JCRA 1KZPA 1N4RA 1FT2A 3DSVA 1SA4A 2ZISA 3C72A 3Q7FA 1N94A 3Q78A 1D8EA 3DSXA 2R2LA 3HXCA 1LD8A 1TNZA 1O1TA 1S63A 2H6HA 1S64A 3DSWA 3EU5A 3PZ1A 4MBGA 4GTQA 1O5MA 1NI1A 3Q7AA 4EHMA 1O1SA 1FPPA 3KSLA 3SFYA 1N9AA 4L9PA 3E32A 4GTMA 2H6FA 1SA5A 3Q73A 1QBQA 4YDEA 1FT1A 3HXDA 3PZ3A 3KSQA 3PZ2A 1TNYA 3HXEA 1JCQA 1MZCA 3DSUA 3E37A 3PZ4A 3E34A 1TN6A 1D8DA 3DSTA 3SFXA 2ZIRA 4LNGA 3HXFA 3E30A 2F0YA 1N4QA 1TN7A 1O1RA 4GTOA 2H6GA 3EUVA 1LTXA 3Q75A 1N4SA 1DCEA 4GTRA 2IEJA 4LNBA
chains in the Genus database with same CATH superfamily
3LPZA 3Q79A 4ANUA 3KD7A 3D9PA 5HRYA 1KZOA 2ZU6B 3X2QE 1UOHA 1KPSB 2V0PA 1WY6A 4YVOA 3FU6A 3RRNB 3L9TA 3DWLG 5AENA 3ABLE 4ILHB 4K5AB 3TG4A 1OWOA 3LY9A 3SO8A 1O1TA 2JLBA 2H6HA 5ENSD 3L16A 4I1AA 3RO3A 2NSZA 2WXIA 5BV0A 1VDYA 2GRMA 3ML9A 5CEDB 3SFYA 3ZIMA 3ASOE 1XNFA 2RKKA 2WMNA 5AARA 3PZ2A 3PZDA 3WG7E 1DCQA 2KCKA 3TWRA 3CVLA 2DBAA 3L08A 2VGYA 3CQGB 4LSZE 4ANXA 4U0SA 2R59A 3IBEA 4FHJA 1KT1A 2WMOA 4GCNA 3CV0A 2H6GA 2PL2A 3U64A 3AAAC 3FTVA 1N54A 3LY8A 4RQIA 2V4HC 4KT6B 3VLFA 4APOA 5ITZF 3FUFA 1K3ZD 4U0ZA 2EIJE 4CT0A 4YDOA 3HVEB 3OXFA 3TXMA 3RO2A 3UM0A 3OAWA 5ARGA 3Q9UC 3OXLA 2PM7A 3EHNA 1K1BA 1JCRA 4DX1A 2L0IA 3AJIA 3FTZA 3TGOA 1OT8A 2LSVA 4BT8A 5KBAA 2LAHA 3VTYA 3P2BA 3ULYA 1PY1A 2J08A 5J90A 2AXUA 2I6HA 3I5PA 4J0UA 3UMVA 3FUEA 4L2YA 4DLOA 4D10C 3ZYKA 3UT8A 3LKUA 2QC9A 2BKKB 5B1BE 2LUHA 4EQFA 2ZGGA 1ELKA 3CEQA 2AXVA 5FZQA 5FTPA 4WAFA 5LCWJ 3FUMA 3RJVA 2F8XK 1PAQA 2CHWA 3G2UA 1NA3A 2FBNA 4HORA 2KXPC 2WPVA 3D9NA 3FTSA 5EYLA 5G05C 3JQ0A 3T9KA 1JWFA 3C3QA 3V31A 1TN7A 2E2EA 4GTOA 5FWQA 2V4LA 4LNUD 4KZCA 3SGHA 3PNLB 3QNKA 3V2XA 2J49A 3MX3A 4FADA 4HOSA 4GMRA 3Q4AB 4FU3A 4ILIA 5G04C 1JUQA 4JEUA 2H6IA 5FQ6A 1OWNA 1MX4A 3FUDA 3PREA 5C2YA 2XEEA 3S7JA 4Q94A 2VSOE 2IY0C 3L13A 2F37A 2BTDA 1DVPA 2B6CA 3TL5A 3ESKA 4JPSA 3LY7A 4H7XA 1V54E 2V5FA 3O48A 1WM5A 3PNTB 3ABKE 3DSVA 1HZ4A 3HYMB 3JCKC 4IULA 4MBGA 3BEEA 2CG3A 5BW8C 3T5XA 2IJGX 2P9LG 1O1SA 1FPPA 2DVWA 4B8CB 5CECB 1N9AA 5CBNA 2MYOA 4I6GA 2VSNA 2V5QC 1B89A 2Y0BG 4U0UA 2Y1LE 2BKGA 3AG1E 2HYZA 3KSQA 2QZAA 3KEZA 1FVFA 3RRUA 1N52A 4N5CA 3HDXA 3EIJA 3CVWA 5KCMA 5CBOA 4PS7A 4IYPA 1H6PA 4U04A 3GYZA 4FLHA 1S70B 3MKRA 4HRNA 2ONDA 3GW4A 3SF4A 4WWNA 4GTRA 4IRUA 3TJPA 3LXUX 4A55A 3AU4A 5C1DA 5BXOA 1NL4A 3G2TA 2NC9A 3D9KA 2QY7A 2QYJA 3MKQA 4TXRA 2WXPA 4J8YA 4I9CA 1X81A 3TG5A 4GTTA 1TNBA 3D9HA 3EU9A 4BTBA 3FWVA 1D9SA 3E33A 2FO1E 1HU3A 3QAQA 5ENOD 4FP7A 1KZPA 3SNXA 5T4YA 1N94A 3IEGA 3V2OA 3FU5A 3T8KA 4GZ5A 3FH8A 3AS4A 3LS8A 5CEAA 4RG9A 4BSXA 3CVYA 2GROB 3UX4A 3FDHA 4OVVA 3KSLA 2P9KG 5AQ7A 3Q73A 3HXDA 5CERB 4A3VA 1RW2A 1UW4B 2I2OA 2VQ2A 4FC8A 4UUCA 4U95D 3S7FA 5LCWC 2X38A 5AQAA 4JL0A 1S0PA 2IO3C 4CT4A 4CRWA 1OXJA 3TXNA 4U63A 1DCEA 1N11A 2UY1A 4JA7A 3JYSA 5ANRA 4I1OB 4B93B 3MGBA 3KAEA 1Z5SC 2XGSA 4FULA 4GPMA 2QYUA 2XZDG 5G2NA 1OY3D 1BPOA 5CCMA 5ENRD 2MRIA 2M63A 3CVVA 4Y6CA 4AP2A 4ATGA 1YMPA 2XCBA 3DXKG 1ELRA 3FTUA 3Q78A 4HRMB 2WXGA 5HI7A 2GRPB 2P9PG 3NQPA 4ME2A 2P9UG 1SQMA 5EX3A 2VGEA 4G8LA 1JPLA 4UWGA 4NRHB 1EDUA 2P2CP 4EHMA 4EBAG 3HRAA 2IO2C 2MHKA 3QB2A 1NZNA 1HFAA 2FULA 1NFIE 4B8AA 3ABME 1UG3A 1QBQA 2X6KA 3ULQA 3OTNA 3HXEA 1JCQA 3S7BA 3E37A 5JMND 2L9BA 3CHSA 3R7QA 3V30A 2ZIRA 2DYRE 2IF4A 2ETBA 2PM6A 2DIWA 3NBNB 3NOCD 2IOSA 3ZXPA 2WQ6A 3QWVA 2WQ7A 3UM1A 3K9IA 1UN8A 2CFUA 4JZYA 5AIJA 1N95A 1TNUA 4RVBA 2R17C 4DX6D 3ZHEB 1SZ9A 2Y4UA 4FLBA 1N4PA 4RSYA 3OXGA 5G04J 2J8SD 3ZFWA 4BERA 3HXBA 3ESLA 4U7EB 5LFAA 3DPYA 1Y6IA 2KATA 4NQ0A 5J08A 3O4ZA 5DBKA 2J4DA 4TXPA 3AG2E 3ASFA 4OAVB 4V3IA 3GZ2A 4J8FA 3ASHA 3UKUG 2XENA 4J7WA 1BU9A 1N0QA 4XI9A 2WXLA 4L23A 1AWCB 4A1SA 3E32A 1BD8A 4MRUA 3BQOA 3TWXA 4N2QA 2R05A 3PZ3A 2I1JA 4RLYA 4GPKA 4N3BA 2KZTA 3Q47B 1QYMA 3B7RL 3BU8A 3DXMG 2ETAA 3E30A 3CVNA 3KEAA 4OVUA 3NB2A 3Q5MA 2WM9A 4HOUA 1OWMA 3IKOB 4ACKA 2A5UA 4BESA 2ILRA 1Z6TA 5JJ7A 3PE3A 5CCLA 4BT9A 5ANLA 1E90A 4BSZB 3U9WA 3FHEA 3CK7A 2GRLA 2X6HA 3LDZA 2RFMA 4U8VD 3CVPA 3FUJA 1ZB1A 2IQCA 4AEZC 1MYOA 2P9IG 2PNNA 4JA9A 3R9MA 4N3AA 1IHBA 5FIOA 3NZSA 3TWSA 1MJ0A 4G24A 3FY4A 2DYSE 1DNPA 3D9LA 4BFRA 4KBQA 1SA4A 3CKBA 4CYMD 4O1OA 4M3OA 2P9NG 1KT0A 1BI8B 2F8YA 4YDWA 4F7AA 5KJKA 4BX9A 3EHRA 3Q49B 4HVBA 4GCOA 3LCAA 2ZGDA 3E4BA 4TUMA 4I43A 4GB9A 4K5CA 3D9MA 2DWZA 5EN5D 4I2WA 1TJFA 1H6KA 3CKCA 3L17A 4U96D 4W9RA 4LCTA 4G2VA 4G11A 2VGXA 4A63B 3QC1A 1OCOE 3SHFA 3DSTA 3G2SA 4LNGA 4Q96A 2HO1A 3FTXA 1N4QA 4WNFA 4OAUC 3ZVVA 1OUVA 1E8XA 2VSXE 2X6FA 4DX2A 3ZXSA 4G8KA 4YNDA 3C3RA 3TWWA 5CHEE 4XX5A 4OYSA 1ZBPA 3EDTB 4N39A 5FQ4A 2C0LA 1K1AA 4EZLA 4WWOA 4A3TA 3W9GA 4JXTA 2WXJA 3CLJA 3LJNA 4XEIG 3MA5A 4FJYA 3AG3E 3VLDA 2NYJA 3AU5A 4L2LA 3CVXA 5EYPF 3B7BA 4JW1A 4PDXA 2I1KA 1S63A 3FU3A 2VTBA 3TWTA 3DSWA 1FVHA 5JHBA 3FH7A 3D9OA 1EPUA 3J5QB 4KVMA 3EJNA 2XQ0A 3UPVA 2WQHA 4CDNA 4C9BB 4UQYA 1TR4A 1OWPA 3ZUVB 4BETA 4CCAA 3Q9NC 3PZ4A 1YCSB 5FZRA 4HS2A 2XRYA 3C3OA 4G1TA 4HXIA 3UI2A 3CQCB 4HQDA 4E6HA 4CDRA 3UM2A 2IOLA 3EUVA 3JXJA 3LVQE 5KJNA 4LUNU 2A4ZA 3PRZA 4WNGA 2IFUA 3CHPA 4KXKB 3QK0A 4UWLA 2WXNA 2PQNA 3FUNA 2KBXA 4BEPA 1HXIA 1ZU2A 4KZ0A 2XZTG 4KYOB 3UQ3A 3ULEG 4N5QA 1KLXA 3ISMC 4XE0A 1MQSA 3CSTA 4GYOA 4UQZA 5FJYA 4PH4B 3ZN3A 2R03A 2ZISA 5CMWA 3C72A 1Z3YA 2R2LA 4YVQC 3FP3A 3EHQA 1EF1C 3PZ1A 4F53A 2CFZA 4J8EA 4KVOA 1X5BA 2X6JA 4TUUA 3Q7AA 3SY2A 2JEKA 4HI9A 4MLPA 4L9PA 5M72A 3AG4E 4AIFA 3CSFA 4JC8A 4APFA 2RFAA 4DLQA 5FZSA 4YDEA 5LX8A 4C0MA 1H6OA 5BUZA 1MZCA 2DZOA 1H2TC 3MV3B 3QKYA 4BWRA 5D0OD 3SFXA 4E85A 3IHYA 4HRLA 1OCZE 4EECA 4GYYA 4I9EA 3B7TA 4BTAA 2OV8A 5KJMA 1DC2A 2LNIA 5CMYA 3DBSA 2WXOA 1MX2A 5B1AE 5EDSA 4RG6A 3HG0D 3ZGQA 2J4BA 4YDYA 1IQRA 3DEOA 1G3NB 1H19A 2Y3AA 2HE0A 3PE4A 1IYGA 3TAXA 2OOEA 5E75A 1RZ4A 4GZ3A 3WXXA 5ENTD 5EIDA 4EPZA 1U2VG 2XCCA 4J8SA 1E8WA 4AV7A 1S64A 1WG0A 4FJZA 4O60A 3LEWA 4G23A 4B89A 4AY6A 3MYVA 5EKQD 3UINC 2GRNB 2XHEA 2XPZA 4UI9K 1GW6A 2RD0A 3RSEG 2HM8A 4JHJA 3PS6A 3ENEA 3R9AB 3N71A 3DSUA 2YNQA 5G55A 3ZEFA 3L6AA 2Q7FA 3ASGA 3I3NA 4WNEA 1V55E 4CGWA 3HVEA 3RRMB 3MZLB 4Q69A 5BT1A 3KS2A 4UWHA 1E8ZA 1OCRE 5HKPA 4I2ZA 1OCCE 3FUIA 3SD5A 3SI5A 1U3CA 3FEYA 2XS1A 3UTMA 1LD7A 5FINA 2IU1A 3NAWA 3DSSA 4U8YD 2X6IA 2YINA 3JXIA 4K0RA 2DCPA 2ZXWE 2R02A 3ONLA 3VTXA 2PQRA 1N4RA 4B0ZA 3U66A 3Q7FA 1SZAA 3MKQB 4BY6A 4XKCA 4G26A 4NURA 4GTQA 2C2LA 2R5SA 5A7DB 5JHAA 2QFCA 3QWPA 3MEKA 4XZ4A 4IN3B 5D0QD 4HBDA 1L5JA 5E76A 3TWVA 4JEHA 5AQ9A 3HHMA 1HG5A 1U3DA 4EZKA 1NP7A 4AY5A 1N0RA 3URZA 5ENQD 4JB8P 4XI0A 4GMJA 1UJKA 1NA0A 3LVRE 2CHXA 3ZYMA 3IHVA 3EIQC 2WXMA 5JJTA 2XEVA 1YYHA 3UKRG 2AXZA 4AOFA 4L7TA 2FI7A 3GZ1A 3S7DA 1HF8A 3APFA 3CHRA 3PEUB 1E7VA 3UIPC 4AXHA 3MJWA 2HR2A 3S2AA 5D2MC 3G2WA 4U07A 4GTSA 4WWPA 2KC7A 2P58C 1MHQA 2WXRA 5DIZA 3LJ3A 1BLXB 2UY1B 5CRUA 5BXUA 1H0AA 2BF0X 3CK8A 2XPIA 1XGWA 3HXCA 1LD8A 2J9QA 3R7RA 4ABNA 3TWQA 5H7PA 2WXQA 4HI8A 5BV1A 4B94A 3FFLA 1O5MA 4I1MA 4PS3A 2CG2A 3ASNE 3B13A 3B7SA 2P9SG 2V8SE 5A6CA 5AQBA 2WXKA 4PUCA 3SBSA 3E34A 4O6FA 3UXGA 1OWLA 3ZU7B 4X8QA 3L82A 3VLEA 4ILGA 4J8DA 3DEPA 2L0TB 4DPRA 2I9CA 2Y69E 1LF8A 2RG8A 3Q75A 1N4SA 4ANVA 5ARFA 2B0OE 4UQXA 4GTVA 1MX6A 3FTYA 4HLLA 4GZCA 4MS6A 3NZUA 1PC2A 4XIFA 3PUJA 2E0IA 2DZNA 4HOTA 3JQ1A 4MKTA 3SQVA 4EZJA 2J07A 4M7CA 3CIAA 1Z3XA 1P5QA 3CK9A 3CHOA 3PDNA 2YHEA 4UWKA 3QARA 4I6JA 1SW6A 5AYWD 4N3CA 1FT2A 2YQ8A 3Q15A 1D8EA 4TRQA 1BI7B 4ANWA 4Z68A 4O1PA 2UWJG 2VSYA 4G25A 2LXLA 4ACLA 1K8KG 2XS8A 3FEXA 3ZPJA 1IKND 3PEVB 4GZDA 1Q2ZA 4JHKA 4UI9C 4ATZD 3GZSA 4JHRA 4HNAD 4A1GA 2J09A 4K5BA 2EIME 2OCCE 1WDYA 1EYHA 4JVSA 5D66A 4F1PA 3TWUA 2WXHA 2GGFA 5KJLA 4GA2A 3SFZA 2ETCA 5B3SE 2Y4TA 5AJLA 4R7LA 1UN9A 4XKBA 3UT4A 4AJWA 2C0MA 5AAOA 3T8MA 2FF4A 3MV2B 4DX7D 3I4RB 4F1SA 1HO8A 1A17A 2EQXA 4K03A 2KM4A 4P29A 2FO7A 3BUAA 5CRVA 2WB2A 2L6JA 1LTXA 4Y6WA 2GRQB 1QZ2A 1JWGA 3HIZA 4L1BA 3CVUA 4DI3A 2KZTB 3AS5A 4LERA 5FQ8A 1AP7A 1TYQG 5T8IA 5HQ8A 3CR3A 2XGMA 3V79K 4GTPA 1H2UA 4URKA 4DI4A 1SVXA 4HB5A 5LP0A 3W9FA 4J6IA 1TNOA 3ZKJA 1IXVA 3CHQA 2BUGA 4KMOA 3MCXA 4FHKA 4TV3A 1TNZA 3JUIA 2WXFA 4DJAA 2KCVA 4TXQA 3UM3A 4LEUA 4DK5A 3ONKA 1Y8MA 3CGHA 3BG1B 3RU0A 2PZIA 1E96B 2H6FA 3IV0A 3I4GA 3L54A 3UIOC 3QJZA 5ENNA 1WAO1 4AM9A 2VYIA 2XPYA 2LXMA 3FULA 1HX8A 3D9JA 3F6QA 3NOGD 2XEHA 4GMLA 3ZHEA 5JJ6A 5KWDA 1H2VC 1IQUA 1O1RA 1UJJA 3AS8A 3LYAA 1ELWA 4LRZA 3SZ7A 3IXEA 3FH5A 2FEZA 4U8HA 3QDNA 2IEJA 4LNBA 4DUIA 3P1UA 2VGXB 1TN8A 4DRXE 4QQIA 5FT9A 3RIBA 4JD2G 1HH8A 4NIKA 2EILE 4F3VA 5EX0A 3D9IA 1YA0A 3FTWA 5A23A 4GZ6A 5EIBE 2BEDA 1HE8A 3APCA 4NACA 4C48B 3U4TA 3RAUA 3RK6A 2GRRB 5LOZA 3L22A 2OEVA 2CHZA 3DPDA 3FUHA 2AWIA 3PH0C 3CHMA 4HLEA 4I6EA 3ZRHA 1NI1A 1A5EA 3ZYLA 5AN8A 3ZYQA 4GAAA 2GW1A 1FT1A 3C5RA 1FCHA 4QFVA 2AVPA 2VTBB 1TNYA 3J5PA 3U3WA 4GA0A 4GA1A 4FA6A 1D8DA 1TJCA 1HG2A 2AW6A 4EBAA 4I17A 1IHGA 2LO6A 5ENPD 2MOWA 3C98A 3PVLA 3PUKA 4F6RD 2EINE 1TEZA 2NXPA 3JUEA 2EIKE 2L6BA 2OVFA 1JCSA 4ZHBA 2XRZA 4HFGA 4UWFA 3CVQA 4HOQA 3DRAA 2LAIA 5AJDA 3ZW3A 4GU5A 3BG0B 2VJ8A 3ZNGA 4AVXA 3ASDA 2AJAA 5HS0A 3QOUA 1HS6A 5BNWA 3FU0A 2YHCA 2WVIA 3FUKA 4CEMA 3G2VA 2JABA 3UT7A 3DSXA 4H7YA 5KNHD 1QQEA 5BPPA 3EU5A 5JA4D 3EHMA 5T3RA 4BX8A 4CGVA 2KCLA 2OVBA 4CZ2D 4PS8A 5FQ7A 3RKVA 3D3MA 3B7UX 2OEWA 3APDA 4C0EA 1E7UA 4GTMA 1SA5A 4WUYA 2X3MA 1E8YA 2A5EA 5G05J 4UI9J 4LG6A 4CDMA 4ZFHA 5EILA 2IONA 1TN6A 1W3BA 4DX5D 3B95A 3HXFA 3T5VA 2XGOA 2F0YA 3QWWA 4N2SA 3NF1A 1INZA 5KNGA 5IY5E 2LSUA 1QNFA 3UUXA 3ML8A 4GYWA 3SBTB 4WNDA
chains in the Genus database with same CATH topology
4GTVA 1JCSA 2H6IA 3Q79A 1N95A 1TNUA 1TN8A 1NL4A 1N4PA 1KZOA 1LD7A 4GTPA 4YDOA 3DSSA 3DRAA 4GTSA 3HXBA 1X81A 2BEDA 4GTTA 1TNBA 1TNOA 3DPYA 3E33A 1JCRA 1KZPA 1N4RA 1FT2A 3DSVA 1SA4A 2ZISA 3C72A 3Q7FA 1N94A 3Q78A 1D8EA 3DSXA 2R2LA 3HXCA 1LD8A 1TNZA 1O1TA 1S63A 2H6HA 1S64A 3DSWA 3EU5A 3PZ1A 4MBGA 4GTQA 1O5MA 1NI1A 3Q7AA 4EHMA 1O1SA 1FPPA 3KSLA 3SFYA 1N9AA 4L9PA 3E32A 4GTMA 2H6FA 1SA5A 3Q73A 1QBQA 4YDEA 1FT1A 3HXDA 3PZ3A 3KSQA 3PZ2A 1TNYA 3HXEA 1JCQA 1MZCA 3DSUA 3E37A 3PZ4A 3E34A 1TN6A 1D8DA 3DSTA 3SFXA 2ZIRA 4LNGA 3HXFA 3E30A 2F0YA 1N4QA 1TN7A 1O1RA 4GTOA 2H6GA 3EUVA 1LTXA 3Q75A 1N4SA 1DCEA 4GTRA 2IEJA 4LNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTV A;  1JCS A;  2H6I A;  3Q79 A;  1N95 A;  1TNU A;  1TN8 A;  1NL4 A;  1N4P A;  1KZO A;  1LD7 A;  4GTP A;  4YDO A;  3DSS A;  3DRA A;  4GTS A;  3HXB A;  1X81 A;  2BED A;  4GTT A;  1TNB A;  1TNO A;  3DPY A;  3E33 A;  1JCR A;  1KZP A;  1N4R A;  1FT2 A;  3DSV A;  1SA4 A;  2ZIS A;  3C72 A;  3Q7F A;  1N94 A;  3Q78 A;  1D8E A;  3DSX A;  2R2L A;  3HXC A;  1LD8 A;  1TNZ A;  1O1T A;  1S63 A;  2H6H A;  1S64 A;  3DSW A;  3EU5 A;  3PZ1 A;  4MBG A;  4GTQ A;  1O5M A;  1NI1 A;  3Q7A A;  4EHM A;  1O1S A;  1FPP A;  3KSL A;  3SFY A;  1N9A A;  4L9P A;  3E32 A;  4GTM A;  2H6F A;  1SA5 A;  3Q73 A;  1QBQ A;  4YDE A;  1FT1 A;  3HXD A;  3PZ3 A;  3KSQ A;  3PZ2 A;  1TNY A;  3HXE A;  1JCQ A;  1MZC A;  3DSU A;  3E37 A;  3PZ4 A;  3E34 A;  1TN6 A;  1D8D A;  3DST A;  3SFX A;  2ZIR A;  4LNG A;  3HXF A;  3E30 A;  2F0Y A;  1N4Q A;  1TN7 A;  1O1R A;  4GTO A;  2H6G A;  3EUV A;  1LTX A;  3Q75 A;  1N4S A;  1DCE A;  4GTR A;  2IEJ A;  4LNB A; 
#chains in the Genus database with same CATH topology
 3LPZ A;  3Q79 A;  4ANU A;  3KD7 A;  3D9P A;  5HRY A;  1KZO A;  2ZU6 B;  3X2Q E;  1UOH A;  1KPS B;  2V0P A;  1WY6 A;  4YVO A;  3FU6 A;  3RRN B;  3L9T A;  3DWL G;  5AEN A;  3ABL E;  4ILH B;  4K5A B;  3TG4 A;  1OWO A;  3LY9 A;  3SO8 A;  1O1T A;  2JLB A;  2H6H A;  5ENS D;  3L16 A;  4I1A A;  3RO3 A;  2NSZ A;  2WXI A;  5BV0 A;  1VDY A;  2GRM A;  3ML9 A;  5CED B;  3SFY A;  3ZIM A;  3ASO E;  1XNF A;  2RKK A;  2WMN A;  5AAR A;  3PZ2 A;  3PZD A;  3WG7 E;  1DCQ A;  2KCK A;  3TWR A;  3CVL A;  2DBA A;  3L08 A;  2VGY A;  3CQG B;  4LSZ E;  4ANX A;  4U0S A;  2R59 A;  3IBE A;  4FHJ A;  1KT1 A;  2WMO A;  4GCN A;  3CV0 A;  2H6G A;  2PL2 A;  3U64 A;  3AAA C;  3FTV A;  1N54 A;  3LY8 A;  4RQI A;  2V4H C;  4KT6 B;  3VLF A;  4APO A;  5ITZ F;  3FUF A;  1K3Z D;  4U0Z A;  2EIJ E;  4CT0 A;  4YDO A;  3HVE B;  3OXF A;  3TXM A;  3RO2 A;  3UM0 A;  3OAW A;  5ARG A;  3Q9U C;  3OXL A;  2PM7 A;  3EHN A;  1K1B A;  1JCR A;  4DX1 A;  2L0I A;  3AJI A;  3FTZ A;  3TGO A;  1OT8 A;  2LSV A;  4BT8 A;  5KBA A;  2LAH A;  3VTY A;  3P2B A;  3ULY A;  1PY1 A;  2J08 A;  5J90 A;  2AXU A;  2I6H A;  3I5P A;  4J0U A;  3UMV A;  3FUE A;  4L2Y A;  4DLO A;  4D10 C;  3ZYK A;  3UT8 A;  3LKU A;  2QC9 A;  2BKK B;  5B1B E;  2LUH A;  4EQF A;  2ZGG A;  1ELK A;  3CEQ A;  2AXV A;  5FZQ A;  5FTP A;  4WAF A;  5LCW J;  3FUM A;  3RJV A;  2F8X K;  1PAQ A;  2CHW A;  3G2U A;  1NA3 A;  2FBN A;  4HOR A;  2KXP C;  2WPV A;  3D9N A;  3FTS A;  5EYL A;  5G05 C;  3JQ0 A;  3T9K A;  1JWF A;  3C3Q A;  3V31 A;  1TN7 A;  2E2E A;  4GTO A;  5FWQ A;  2V4L A;  4LNU D;  4KZC A;  3SGH A;  3PNL B;  3QNK A;  3V2X A;  2J49 A;  3MX3 A;  4FAD A;  4HOS A;  4GMR A;  3Q4A B;  4FU3 A;  4ILI A;  5G04 C;  1JUQ A;  4JEU A;  2H6I A;  5FQ6 A;  1OWN A;  1MX4 A;  3FUD A;  3PRE A;  5C2Y A;  2XEE A;  3S7J A;  4Q94 A;  2VSO E;  2IY0 C;  3L13 A;  2F37 A;  2BTD A;  1DVP A;  2B6C A;  3TL5 A;  3ESK A;  4JPS A;  3LY7 A;  4H7X A;  1V54 E;  2V5F A;  3O48 A;  1WM5 A;  3PNT B;  3ABK E;  3DSV A;  1HZ4 A;  3HYM B;  3JCK C;  4IUL A;  4MBG A;  3BEE A;  2CG3 A;  5BW8 C;  3T5X A;  2IJG X;  2P9L G;  1O1S A;  1FPP A;  2DVW A;  4B8C B;  5CEC B;  1N9A A;  5CBN A;  2MYO A;  4I6G A;  2VSN A;  2V5Q C;  1B89 A;  2Y0B G;  4U0U A;  2Y1L E;  2BKG A;  3AG1 E;  2HYZ A;  3KSQ A;  2QZA A;  3KEZ A;  1FVF A;  3RRU A;  1N52 A;  4N5C A;  3HDX A;  3EIJ A;  3CVW A;  5KCM A;  5CBO A;  4PS7 A;  4IYP A;  1H6P A;  4U04 A;  3GYZ A;  4FLH A;  1S70 B;  3MKR A;  4HRN A;  2OND A;  3GW4 A;  3SF4 A;  4WWN A;  4GTR A;  4IRU A;  3TJP A;  3LXU X;  4A55 A;  3AU4 A;  5C1D A;  5BXO A;  1NL4 A;  3G2T A;  2NC9 A;  3D9K A;  2QY7 A;  2QYJ A;  3MKQ A;  4TXR A;  2WXP A;  4J8Y A;  4I9C A;  1X81 A;  3TG5 A;  4GTT A;  1TNB A;  3D9H A;  3EU9 A;  4BTB A;  3FWV A;  1D9S A;  3E33 A;  2FO1 E;  1HU3 A;  3QAQ A;  5ENO D;  4FP7 A;  1KZP A;  3SNX A;  5T4Y A;  1N94 A;  3IEG A;  3V2O A;  3FU5 A;  3T8K A;  4GZ5 A;  3FH8 A;  3AS4 A;  3LS8 A;  5CEA A;  4RG9 A;  4BSX A;  3CVY A;  2GRO B;  3UX4 A;  3FDH A;  4OVV A;  3KSL A;  2P9K G;  5AQ7 A;  3Q73 A;  3HXD A;  5CER B;  4A3V A;  1RW2 A;  1UW4 B;  2I2O A;  2VQ2 A;  4FC8 A;  4UUC A;  4U95 D;  3S7F A;  5LCW C;  2X38 A;  5AQA A;  4JL0 A;  1S0P A;  2IO3 C;  4CT4 A;  4CRW A;  1OXJ A;  3TXN A;  4U63 A;  1DCE A;  1N11 A;  2UY1 A;  4JA7 A;  3JYS A;  5ANR A;  4I1O B;  4B93 B;  3MGB A;  3KAE A;  1Z5S C;  2XGS A;  4FUL A;  4GPM A;  2QYU A;  2XZD G;  5G2N A;  1OY3 D;  1BPO A;  5CCM A;  5ENR D;  2MRI A;  2M63 A;  3CVV A;  4Y6C A;  4AP2 A;  4ATG A;  1YMP A;  2XCB A;  3DXK G;  1ELR A;  3FTU A;  3Q78 A;  4HRM B;  2WXG A;  5HI7 A;  2GRP B;  2P9P G;  3NQP A;  4ME2 A;  2P9U G;  1SQM A;  5EX3 A;  2VGE A;  4G8L A;  1JPL A;  4UWG A;  4NRH B;  1EDU A;  2P2C P;  4EHM A;  4EBA G;  3HRA A;  2IO2 C;  2MHK A;  3QB2 A;  1NZN A;  1HFA A;  2FUL A;  1NFI E;  4B8A A;  3ABM E;  1UG3 A;  1QBQ A;  2X6K A;  3ULQ A;  3OTN A;  3HXE A;  1JCQ A;  3S7B A;  3E37 A;  5JMN D;  2L9B A;  3CHS A;  3R7Q A;  3V30 A;  2ZIR A;  2DYR E;  2IF4 A;  2ETB A;  2PM6 A;  2DIW A;  3NBN B;  3NOC D;  2IOS A;  3ZXP A;  2WQ6 A;  3QWV A;  2WQ7 A;  3UM1 A;  3K9I A;  1UN8 A;  2CFU A;  4JZY A;  5AIJ A;  1N95 A;  1TNU A;  4RVB A;  2R17 C;  4DX6 D;  3ZHE B;  1SZ9 A;  2Y4U A;  4FLB A;  1N4P A;  4RSY A;  3OXG A;  5G04 J;  2J8S D;  3ZFW A;  4BER A;  3HXB A;  3ESL A;  4U7E B;  5LFA A;  3DPY A;  1Y6I A;  2KAT A;  4NQ0 A;  5J08 A;  3O4Z A;  5DBK A;  2J4D A;  4TXP A;  3AG2 E;  3ASF A;  4OAV B;  4V3I A;  3GZ2 A;  4J8F A;  3ASH A;  3UKU G;  2XEN A;  4J7W A;  1BU9 A;  1N0Q A;  4XI9 A;  2WXL A;  4L23 A;  1AWC B;  4A1S A;  3E32 A;  1BD8 A;  4MRU A;  3BQO A;  3TWX A;  4N2Q A;  2R05 A;  3PZ3 A;  2I1J A;  4RLY A;  4GPK A;  4N3B A;  2KZT A;  3Q47 B;  1QYM A;  3B7R L;  3BU8 A;  3DXM G;  2ETA A;  3E30 A;  3CVN A;  3KEA A;  4OVU A;  3NB2 A;  3Q5M A;  2WM9 A;  4HOU A;  1OWM A;  3IKO B;  4ACK A;  2A5U A;  4BES A;  2ILR A;  1Z6T A;  5JJ7 A;  3PE3 A;  5CCL A;  4BT9 A;  5ANL A;  1E90 A;  4BSZ B;  3U9W A;  3FHE A;  3CK7 A;  2GRL A;  2X6H A;  3LDZ A;  2RFM A;  4U8V D;  3CVP A;  3FUJ A;  1ZB1 A;  2IQC A;  4AEZ C;  1MYO A;  2P9I G;  2PNN A;  4JA9 A;  3R9M A;  4N3A A;  1IHB A;  5FIO A;  3NZS A;  3TWS A;  1MJ0 A;  4G24 A;  3FY4 A;  2DYS E;  1DNP A;  3D9L A;  4BFR A;  4KBQ A;  1SA4 A;  3CKB A;  4CYM D;  4O1O A;  4M3O A;  2P9N G;  1KT0 A;  1BI8 B;  2F8Y A;  4YDW A;  4F7A A;  5KJK A;  4BX9 A;  3EHR A;  3Q49 B;  4HVB A;  4GCO A;  3LCA A;  2ZGD A;  3E4B A;  4TUM A;  4I43 A;  4GB9 A;  4K5C A;  3D9M A;  2DWZ A;  5EN5 D;  4I2W A;  1TJF A;  1H6K A;  3CKC A;  3L17 A;  4U96 D;  4W9R A;  4LCT A;  4G2V A;  4G11 A;  2VGX A;  4A63 B;  3QC1 A;  1OCO E;  3SHF A;  3DST A;  3G2S A;  4LNG A;  4Q96 A;  2HO1 A;  3FTX A;  1N4Q A;  4WNF A;  4OAU C;  3ZVV A;  1OUV A;  1E8X A;  2VSX E;  2X6F A;  4DX2 A;  3ZXS A;  4G8K A;  4YND A;  3C3R A;  3TWW A;  5CHE E;  4XX5 A;  4OYS A;  1ZBP A;  3EDT B;  4N39 A;  5FQ4 A;  2C0L A;  1K1A A;  4EZL A;  4WWO A;  4A3T A;  3W9G A;  4JXT A;  2WXJ A;  3CLJ A;  3LJN A;  4XEI G;  3MA5 A;  4FJY A;  3AG3 E;  3VLD A;  2NYJ A;  3AU5 A;  4L2L A;  3CVX A;  5EYP F;  3B7B A;  4JW1 A;  4PDX A;  2I1K A;  1S63 A;  3FU3 A;  2VTB A;  3TWT A;  3DSW A;  1FVH A;  5JHB A;  3FH7 A;  3D9O A;  1EPU A;  3J5Q B;  4KVM A;  3EJN A;  2XQ0 A;  3UPV A;  2WQH A;  4CDN A;  4C9B B;  4UQY A;  1TR4 A;  1OWP A;  3ZUV B;  4BET A;  4CCA A;  3Q9N C;  3PZ4 A;  1YCS B;  5FZR A;  4HS2 A;  2XRY A;  3C3O A;  4G1T A;  4HXI A;  3UI2 A;  3CQC B;  4HQD A;  4E6H A;  4CDR A;  3UM2 A;  2IOL A;  3EUV A;  3JXJ A;  3LVQ E;  5KJN A;  4LUN U;  2A4Z A;  3PRZ A;  4WNG A;  2IFU A;  3CHP A;  4KXK B;  3QK0 A;  4UWL A;  2WXN A;  2PQN A;  3FUN A;  2KBX A;  4BEP A;  1HXI A;  1ZU2 A;  4KZ0 A;  2XZT G;  4KYO B;  3UQ3 A;  3ULE G;  4N5Q A;  1KLX A;  3ISM C;  4XE0 A;  1MQS A;  3CST A;  4GYO A;  4UQZ A;  5FJY A;  4PH4 B;  3ZN3 A;  2R03 A;  2ZIS A;  5CMW A;  3C72 A;  1Z3Y A;  2R2L A;  4YVQ C;  3FP3 A;  3EHQ A;  1EF1 C;  3PZ1 A;  4F53 A;  2CFZ A;  4J8E A;  4KVO A;  1X5B A;  2X6J A;  4TUU A;  3Q7A A;  3SY2 A;  2JEK A;  4HI9 A;  4MLP A;  4L9P A;  5M72 A;  3AG4 E;  4AIF A;  3CSF A;  4JC8 A;  4APF A;  2RFA A;  4DLQ A;  5FZS A;  4YDE A;  5LX8 A;  4C0M A;  1H6O A;  5BUZ A;  1MZC A;  2DZO A;  1H2T C;  3MV3 B;  3QKY A;  4BWR A;  5D0O D;  3SFX A;  4E85 A;  3IHY A;  4HRL A;  1OCZ E;  4EEC A;  4GYY A;  4I9E A;  3B7T A;  4BTA A;  2OV8 A;  5KJM A;  1DC2 A;  2LNI A;  5CMY A;  3DBS A;  2WXO A;  1MX2 A;  5B1A E;  5EDS A;  4RG6 A;  3HG0 D;  3ZGQ A;  2J4B A;  4YDY A;  1IQR A;  3DEO A;  1G3N B;  1H19 A;  2Y3A A;  2HE0 A;  3PE4 A;  1IYG A;  3TAX A;  2OOE A;  5E75 A;  1RZ4 A;  4GZ3 A;  3WXX A;  5ENT D;  5EID A;  4EPZ A;  1U2V G;  2XCC A;  4J8S A;  1E8W A;  4AV7 A;  1S64 A;  1WG0 A;  4FJZ A;  4O60 A;  3LEW A;  4G23 A;  4B89 A;  4AY6 A;  3MYV A;  5EKQ D;  3UIN C;  2GRN B;  2XHE A;  2XPZ A;  4UI9 K;  1GW6 A;  2RD0 A;  3RSE G;  2HM8 A;  4JHJ A;  3PS6 A;  3ENE A;  3R9A B;  3N71 A;  3DSU A;  2YNQ A;  5G55 A;  3ZEF A;  3L6A A;  2Q7F A;  3ASG A;  3I3N A;  4WNE A;  1V55 E;  4CGW A;  3HVE A;  3RRM B;  3MZL B;  4Q69 A;  5BT1 A;  3KS2 A;  4UWH A;  1E8Z A;  1OCR E;  5HKP A;  4I2Z A;  1OCC E;  3FUI A;  3SD5 A;  3SI5 A;  1U3C A;  3FEY A;  2XS1 A;  3UTM A;  1LD7 A;  5FIN A;  2IU1 A;  3NAW A;  3DSS A;  4U8Y D;  2X6I A;  2YIN A;  3JXI A;  4K0R A;  2DCP A;  2ZXW E;  2R02 A;  3ONL A;  3VTX A;  2PQR A;  1N4R A;  4B0Z A;  3U66 A;  3Q7F A;  1SZA A;  3MKQ B;  4BY6 A;  4XKC A;  4G26 A;  4NUR A;  4GTQ A;  2C2L A;  2R5S A;  5A7D B;  5JHA A;  2QFC A;  3QWP A;  3MEK A;  4XZ4 A;  4IN3 B;  5D0Q D;  4HBD A;  1L5J A;  5E76 A;  3TWV A;  4JEH A;  5AQ9 A;  3HHM A;  1HG5 A;  1U3D A;  4EZK A;  1NP7 A;  4AY5 A;  1N0R A;  3URZ A;  5ENQ D;  4JB8 P;  4XI0 A;  4GMJ A;  1UJK A;  1NA0 A;  3LVR E;  2CHX A;  3ZYM A;  3IHV A;  3EIQ C;  2WXM A;  5JJT A;  2XEV A;  1YYH A;  3UKR G;  2AXZ A;  4AOF A;  4L7T A;  2FI7 A;  3GZ1 A;  3S7D A;  1HF8 A;  3APF A;  3CHR A;  3PEU B;  1E7V A;  3UIP C;  4AXH A;  3MJW A;  2HR2 A;  3S2A A;  5D2M C;  3G2W A;  4U07 A;  4GTS A;  4WWP A;  2KC7 A;  2P58 C;  1MHQ A;  2WXR A;  5DIZ A;  3LJ3 A;  1BLX B;  2UY1 B;  5CRU A;  5BXU A;  1H0A A;  2BF0 X;  3CK8 A;  2XPI A;  1XGW A;  3HXC A;  1LD8 A;  2J9Q A;  3R7R A;  4ABN A;  3TWQ A;  5H7P A;  2WXQ A;  4HI8 A;  5BV1 A;  4B94 A;  3FFL A;  1O5M A;  4I1M A;  4PS3 A;  2CG2 A;  3ASN E;  3B13 A;  3B7S A;  2P9S G;  2V8S E;  5A6C A;  5AQB A;  2WXK A;  4PUC A;  3SBS A;  3E34 A;  4O6F A;  3UXG A;  1OWL A;  3ZU7 B;  4X8Q A;  3L82 A;  3VLE A;  4ILG A;  4J8D A;  3DEP A;  2L0T B;  4DPR A;  2I9C A;  2Y69 E;  1LF8 A;  2RG8 A;  3Q75 A;  1N4S A;  4ANV A;  5ARF A;  2B0O E;  4UQX A;  4GTV A;  1MX6 A;  3FTY A;  4HLL A;  4GZC A;  4MS6 A;  3NZU A;  1PC2 A;  4XIF A;  3PUJ A;  2E0I A;  2DZN A;  4HOT A;  3JQ1 A;  4MKT A;  3SQV A;  4EZJ A;  2J07 A;  4M7C A;  3CIA A;  1Z3X A;  1P5Q A;  3CK9 A;  3CHO A;  3PDN A;  2YHE A;  4UWK A;  3QAR A;  4I6J A;  1SW6 A;  5AYW D;  4N3C A;  1FT2 A;  2YQ8 A;  3Q15 A;  1D8E A;  4TRQ A;  1BI7 B;  4ANW A;  4Z68 A;  4O1P A;  2UWJ G;  2VSY A;  4G25 A;  2LXL A;  4ACL A;  1K8K G;  2XS8 A;  3FEX A;  3ZPJ A;  1IKN D;  3PEV B;  4GZD A;  1Q2Z A;  4JHK A;  4UI9 C;  4ATZ D;  3GZS A;  4JHR A;  4HNA D;  4A1G A;  2J09 A;  4K5B A;  2EIM E;  2OCC E;  1WDY A;  1EYH A;  4JVS A;  5D66 A;  4F1P A;  3TWU A;  2WXH A;  2GGF A;  5KJL A;  4GA2 A;  3SFZ A;  2ETC A;  5B3S E;  2Y4T A;  5AJL A;  4R7L A;  1UN9 A;  4XKB A;  3UT4 A;  4AJW A;  2C0M A;  5AAO A;  3T8M A;  2FF4 A;  3MV2 B;  4DX7 D;  3I4R B;  4F1S A;  1HO8 A;  1A17 A;  2EQX A;  4K03 A;  2KM4 A;  4P29 A;  2FO7 A;  3BUA A;  5CRV A;  2WB2 A;  2L6J A;  1LTX A;  4Y6W A;  2GRQ B;  1QZ2 A;  1JWG A;  3HIZ A;  4L1B A;  3CVU A;  4DI3 A;  2KZT B;  3AS5 A;  4LER A;  5FQ8 A;  1AP7 A;  1TYQ G;  5T8I A;  5HQ8 A;  3CR3 A;  2XGM A;  3V79 K;  4GTP A;  1H2U A;  4URK A;  4DI4 A;  1SVX A;  4HB5 A;  5LP0 A;  3W9F A;  4J6I A;  1TNO A;  3ZKJ A;  1IXV A;  3CHQ A;  2BUG A;  4KMO A;  3MCX A;  4FHK A;  4TV3 A;  1TNZ A;  3JUI A;  2WXF A;  4DJA A;  2KCV A;  4TXQ A;  3UM3 A;  4LEU A;  4DK5 A;  3ONK A;  1Y8M A;  3CGH A;  3BG1 B;  3RU0 A;  2PZI A;  1E96 B;  2H6F A;  3IV0 A;  3I4G A;  3L54 A;  3UIO C;  3QJZ A;  5ENN A;  1WAO 1;  4AM9 A;  2VYI A;  2XPY A;  2LXM A;  3FUL A;  1HX8 A;  3D9J A;  3F6Q A;  3NOG D;  2XEH A;  4GML A;  3ZHE A;  5JJ6 A;  5KWD A;  1H2V C;  1IQU A;  1O1R A;  1UJJ A;  3AS8 A;  3LYA A;  1ELW A;  4LRZ A;  3SZ7 A;  3IXE A;  3FH5 A;  2FEZ A;  4U8H A;  3QDN A;  2IEJ A;  4LNB A;  4DUI A;  3P1U A;  2VGX B;  1TN8 A;  4DRX E;  4QQI A;  5FT9 A;  3RIB A;  4JD2 G;  1HH8 A;  4NIK A;  2EIL E;  4F3V A;  5EX0 A;  3D9I A;  1YA0 A;  3FTW A;  5A23 A;  4GZ6 A;  5EIB E;  2BED A;  1HE8 A;  3APC A;  4NAC A;  4C48 B;  3U4T A;  3RAU A;  3RK6 A;  2GRR B;  5LOZ A;  3L22 A;  2OEV A;  2CHZ A;  3DPD A;  3FUH A;  2AWI A;  3PH0 C;  3CHM A;  4HLE A;  4I6E A;  3ZRH A;  1NI1 A;  1A5E A;  3ZYL A;  5AN8 A;  3ZYQ A;  4GAA A;  2GW1 A;  1FT1 A;  3C5R A;  1FCH A;  4QFV A;  2AVP A;  2VTB B;  1TNY A;  3J5P A;  3U3W A;  4GA0 A;  4GA1 A;  4FA6 A;  1D8D A;  1TJC A;  1HG2 A;  2AW6 A;  4EBA A;  4I17 A;  1IHG A;  2LO6 A;  5ENP D;  2MOW A;  3C98 A;  3PVL A;  3PUK A;  4F6R D;  2EIN E;  1TEZ A;  2NXP A;  3JUE A;  2EIK E;  2L6B A;  2OVF A;  1JCS A;  4ZHB A;  2XRZ A;  4HFG A;  4UWF A;  3CVQ A;  4HOQ A;  3DRA A;  2LAI A;  5AJD A;  3ZW3 A;  4GU5 A;  3BG0 B;  2VJ8 A;  3ZNG A;  4AVX A;  3ASD A;  2AJA A;  5HS0 A;  3QOU A;  1HS6 A;  5BNW A;  3FU0 A;  2YHC A;  2WVI A;  3FUK A;  4CEM A;  3G2V A;  2JAB A;  3UT7 A;  3DSX A;  4H7Y A;  5KNH D;  1QQE A;  5BPP A;  3EU5 A;  5JA4 D;  3EHM A;  5T3R A;  4BX8 A;  4CGV A;  2KCL A;  2OVB A;  4CZ2 D;  4PS8 A;  5FQ7 A;  3RKV A;  3D3M A;  3B7U X;  2OEW A;  3APD A;  4C0E A;  1E7U A;  4GTM A;  1SA5 A;  4WUY A;  2X3M A;  1E8Y A;  2A5E A;  5G05 J;  4UI9 J;  4LG6 A;  4CDM A;  4ZFH A;  5EIL A;  2ION A;  1TN6 A;  1W3B A;  4DX5 D;  3B95 A;  3HXF A;  3T5V A;  2XGO A;  2F0Y A;  3QWW A;  4N2S A;  3NF1 A;  1INZ A;  5KNG A;  5IY5 E;  2LSU A;  1QNF A;  3UUX A;  3ML8 A;  4GYW A;  3SBT B;  4WND A; 
#chains in the Genus database with same CATH homology
 4GTV A;  1JCS A;  2H6I A;  3Q79 A;  1N95 A;  1TNU A;  1TN8 A;  1NL4 A;  1N4P A;  1KZO A;  1LD7 A;  4GTP A;  4YDO A;  3DSS A;  3DRA A;  4GTS A;  3HXB A;  1X81 A;  2BED A;  4GTT A;  1TNB A;  1TNO A;  3DPY A;  3E33 A;  1JCR A;  1KZP A;  1N4R A;  1FT2 A;  3DSV A;  1SA4 A;  2ZIS A;  3C72 A;  3Q7F A;  1N94 A;  3Q78 A;  1D8E A;  3DSX A;  2R2L A;  3HXC A;  1LD8 A;  1TNZ A;  1O1T A;  1S63 A;  2H6H A;  1S64 A;  3DSW A;  3EU5 A;  3PZ1 A;  4MBG A;  4GTQ A;  1O5M A;  1NI1 A;  3Q7A A;  4EHM A;  1O1S A;  1FPP A;  3KSL A;  3SFY A;  1N9A A;  4L9P A;  3E32 A;  4GTM A;  2H6F A;  1SA5 A;  3Q73 A;  1QBQ A;  4YDE A;  1FT1 A;  3HXD A;  3PZ3 A;  3KSQ A;  3PZ2 A;  1TNY A;  3HXE A;  1JCQ A;  1MZC A;  3DSU A;  3E37 A;  3PZ4 A;  3E34 A;  1TN6 A;  1D8D A;  3DST A;  3SFX A;  2ZIR A;  4LNG A;  3HXF A;  3E30 A;  2F0Y A;  1N4Q A;  1TN7 A;  1O1R A;  4GTO A;  2H6G A;  3EUV A;  1LTX A;  3Q75 A;  1N4S A;  1DCE A;  4GTR A;  2IEJ A;  4LNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...