5CBOA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
molecule keywords mbp3-16,Immunoglobulin G-binding protein A
total genus 55
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cboA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cboA01
4K35A 5K5GB 4O1PA 4HB1A 1EDLA 3EU9A 3NOCD 4K5BA 5ENRD 3ZU7B 2XEHA 3V79K 3Q9UC 3MHVA 5ENSD 1BLXB 5AAOA 5EYPF 2ZGGA 5CEAA 1AP7A 1DEEG 1YYHA 2M5AB 5HKPA 2DWZA 5DJUB 2PNNA 4CZ2D 4DX5D 2P58A 2SPZA 2B88A 3B95A 4K5CA 2J8SD 1IKND 4ZFHA 4HQDA 2M0BA 2RFMA 3DEOA 5DJTB 5CECB 2ETCA 3KEAA 3W9GA 2OTKE 3ZNGA 4LNUD 4DX7D 1EC5A 4F6RD 2Y0BG 1H0TA 1SW6A 4U8VD 3QWOC 2KIKA 3Q9NC 5KWDA 2M5AA 4U96D 4C48B 4HNAD 2XENA 5CERB 4JB8P 5ITZF 1BDCA 2DZNA 4G8LA 1MX2A 2JABA 1H0TB 1WDYA 1X0TA 4QQIA 4ZHBA 2F8XK 4GMRA 1OVVA 1K1BA 5AN8A 4DX1A 1S70B 2ETAA 1ZW0A 4JBZA 4CYMD 5BXUA 1BDDA 1U7JA 3IXEA 4LG6A 1S3JA 2KI7B 2V5QC 2KBXA 1D9SA 2K3RA 1N0RA 4HRLA 1TR4A 5AQ7A 4G8KA 2QC9A 1NFIE 2MYOA 5ENTD 3NBNB 2DVWA 4UUCA 2ZGDA 2KUBA 3UXGA 3T8KA 4BSZB 4ASVA 1N0QA 1N11A 4J7WA 5EILA 4NPEA 1SVXA 3J5PA 3PH0A 4ZNCA 1JM0A 2P2CP 1LT1A 2Y1LE 1BD8A 2LR2A 4HB5A 5ENPD 4K3AA 3FXDA 4U8YD 3SO8A 4Z68A 4WWIA 2WMMA 3MZWB 1Y47A 1MYOA 4B93B 3UI2A 4HJGH 4HLLA 2ETBA 1LP1A 2QRXA 1BU9A 1AWCB 3TWVA 2V4HC 3TWXA 1EDKA 4J8YA 3TWUA 4GPMA 5CBOA 3F6QA 5ENOD 5EN5D 2A5EA 1UOHA 4ZMDA 2VGEA 2L6BA 2B87B 4O1OA 2QVAA 4YDWA 3TWSA 4ASWA 2LXBA 3EHQA 3AAAC 2B0OE 2BKGA 5HS0A 4KJMA 3S1KA 4EYYQ 4A63B 4NPFX 1EDIA 5JA4D 2KZJA 4GOEA 1MX4A 2KZIA 5AQ9A 5AQBA 3T9KA 3C5RA 2KS1B 1DCQA 1OT8A 3TWTA 4QFVA 4DUIA 1OY3D 2XEEA 2B89A 2B87A 4OAVB 5EFWB 3D9HA 3HG0D 4GOFA 5KNGA 2F8YA 4NPDA 1FC2C 2KXPC 1U7MA 2HE0A 2RFAA 3TWQA 3LJNA 1JMBA 3J5QB 2RKLA 2I8DA 5D66A 2XZTG 4BERA 1A5EA 4RLYA 3FXEA 3TWWA 3ZUVB 2BKKB 4IOIH 2JWDA 5JMND 4DRXE 2XZDG 1MX6A 4U95D 4BETA 1NVOA 2NYJA 3HRAA 3NOGD 2Q1KA 2LXCB 1BI7B 3JXIA 4HI8A 5EIDA 3B7BA 5KNHD 4HBDA 5EYLA 3V2XA 4BESA 1YMPA 3DEPA 3JXJA 1G3NB 1K1AA 1EDJA 4K5AB 1OVUA 3V2OA 2R44A 2QYJA 1MJ0A 1IHBA 3JUEA 4HI9A 4HRNA 5AQAA 5FINA 1MFTA 4GODA 2AJAA 5AARA 3TWRA 1YCSB 5BXOA 5CEDB 4F1PA 5FIOA 3ZKJA 5KBAA 2UWJE 4TUMA 1OVRA 4ATZD 4N5QA 1Q2NA 1SS1A 3V31A 4BXLA 4CPGA 1ZXGA 2DZOA 3V30A 1QYMA 3EHRA 3W9FA 2F37A 5ENQD 1K3ZD 4DX2A 4OAUC 5CBNA 2HR3A 5C39A 4DX6D 3RGUA 4NIKA 3UTMA 4BEPA 2ZAEB 3AJIA 4MN4C 4YDYA 4LSZE 5HRYA 1LP1B 1BI8B 1WG0A 4HKZH 4O60A 5EIBE 2FO1E 3ZDMA 4HRMB 1IXVA 1DC2A
chains in the Genus database with same CATH superfamily
1YJWP 3AE1C 2E74C 4BY6A 3I4GA 4I9CA 1D8EA 2FXMA 2IU1A 4R4LA 4PD4I 3OTNA 1AP7A 5A7DB 1OCRE 3DXKG 2KSJA 4NRHB 2KP8A 4AOFA 1QVGO 2O1JA 3L9TA 1Y8AA 2OYHA 3VTYA 1EC5A 4FHJA 4WAFA 3RBXA 2KIKA 4CT4A 2X6JA 3V4WA 3CK9A 3JQ0A 2W83C 3CKCA 1J1EC 1MX2A 3GYZA 1HO8A 3FWLA 3D9LA 1A17A 5LCWC 1A02J 1OCOE 3CLJA 1W5CE 1M1JA 3CWBJ 3H1JE 4LLHA 3D9PA 1PC2A 3EFGA 5AW7B 4AJWA 3U3WA 2MYOA 2AXTE 3PZ3A 1RF0A 2HO1A 3W67A 4J7WA 4E6HA 1OCZE 4XKBA 4HB5A 1JM0A 3IHVA 2QJYC 3A0BH 1HJBA 2M8RA 3WU2H 4I1AA 1H6PA 1W3BA 2E2EA 2M3EA 1Y47A 3IFMA 5KLVJ 4ILGA 5FQ8A 5AW1B 2O01H 3CHSA 1EDKA 5KTBA 3F6QA 3Q49B 1ZP0C 3L74D 1JNMA 3RK2D 2A5EA 3T97A 4I6EA 4YDWA 3BU8A 4G2VA 3S7BA 3O8ZA 4JW1A 3L70J 3P32A 2DCPA 3Q78A 3IF4A 4L75A 3TGOA 3G71P 3CX5H 3LY9A 3FUHA 1RE4A 4N78D 3L37A 4D6TJ 2WZ7A 3RK2C 1WAO1 1QZ2A 5FQ6A 3EUVA 2FF4A 1AFOA 1NTZE 5KKZB 1JO5A 3NAWA 3PREA 1SQQK 4TXPA 3DPYA 1BSNA 1S63A 2Q1KA 3JXIA 1ZN5A 3UIOC 4I1LA 1Q90D 4AQRD 2XU6A 3MA5A 5BPPA 2QG4A 4H0LC 1K1AA 1E96B 3V2OA 3DSVA 1ZB1A 4WY4D 1VQ4P 2KK7A 1JCRA 4N5CA 1L4AC 3V31A 3W9FA 3RBZA 3CHQA 1X8YA 4EHMA 1SQXJ 3C3OA 3UTMA 2ZAEB 4I7ZB 3RK3E 2WSEJ 1OX3A 4OYSA 1Y6IA 2FO7A 5ENRD 4BX9A 4WY4C 1FZBA 1NYHA 3GF3A 5KJ7A 1OWOA 3Q9UC 4I1OB 1SLQA 2K9YA 1DIPA 3NZUA 3CX5E 2ZGGA 3VMZA 2BTDA 3B95A 3IEGA 3X2QE 5DJTB 3L72J 1SQXG 5AW5B 1FZCB 1GDTA 3HDXA 4GU5A 3W9GA 1USDA 4HVBA 3N7NA 4LNUD 4F6RD 4AY6A 4DK5A 1Q82Q 3EDTB 1FOSF 1XGWA 5ANLA 4L73A 2J4BA 3HUSB 4ZHBA 3MTUE 1SQXK 3APDA 2OQQA 4OGQC 1YQ3C 2ZT9C 2IBZI 2V4HA 2BEZF 5C2YA 2K1AA 2N1TA 5AQ7A 1NFIE 2NZ2A 3FULA 4RG6A 1SFCC 1GW3A 1M1KQ 3PRJA 2KCLA 3NZSA 5CRVA 3MZLB 1MZCA 2HYZA 3B7RL 1JEKA 3HD7A 3O6QB 4GTMA 2QJPC 4Y6WA 3ASNE 4H0LB 1SFCD 2NPSC 4PH4B 5L8RJ 3KDPB 2L6BA 2B87B 2VGEA 1NWQA 3SFEC 1TNUA 4UB8H 1OWPA 1ELWA 4UI9C 1Z3YA 1VF5B 2POHA 4ANVA 1BGYJ 1NGMB 4QFVA 2XEEA 2PAJA 1HFAA 1VQ5P 1FAVA 3CD6P 5J90A 3SWYA 1TN6A 3B4SA 2ZISA 1NTZG 2BEQD 1Q2ZA 5FZRA 4CDMA 2B9BA 4DRXE 1TEZA 2YMYA 3CVNA 3NOGD 5TISH 3MKQB 3D3MA 3JXJA 4B94A 3CVUA 1OVUA 3KQGA 4HI9A 4G11A 2ZIRA 5AARA 2AXVA 3V2RA 1WM5A 2HPCB 2L5GB 2K88A 4TUMA 3JCUH 4W7ZA 4FHKA 2GRQB 1GMJA 4C7RA 1XNFA 2H6GA 4FJYA 4DLOA 1JOCA 3ESKA 3R9AB 3ZDMA 3ZRHA 5H7PA 3KSQA 1UN8A 5GTHE 4N2QA 4HLEA 4NACA 5KLVD 5CEAA 3E30A 1ELRA 1SVFA 1QQEA 2NXPA 3U4TA 1U3CA 3ASHA 1IK7A 2OTKE 5CHXA 2HG5D 4JA7A 4BRYA 2XENA 3KZIE 2P9PG 1OWLA 5FQ4A 5T3RA 4WNFA 3HD7D 3RL0B 3AEBC 4AY5A 3MV3B 1S3JA 4TRQA 2XRZA 4PD4D 2VYIA 4L23A 4DLQA 5ARGA 2ONDA 2QM8A 2X6IA 3T8KA 3FEXA 5AJLA 4XX5A 5G05C 3J5PA 2E75D 3ABME 4GCOA 2WXLA 1ELKA 4QMAA 2WSFH 1NZNA 4J8YA 3A0HE 4JYCA 1GL2B 3CC4P 1LWUC 2WSFJ 3I56P 3KS2A 4KXKB 3EIJA 3TSIA 1VQMP 1VQ7P 2E75C 3DSXA 1NTKG 3EHQA 2BCCG 1KT1A 2B0OE 4F53A 3R4YA 4L74A 1IJDB 2OYIA 3DRAA 1KILE 1LTJC 3HXEA 1PV3A 2VQ2A 2AWIA 1OY3D 4UWLA 5EDSA 4GZ5A 2FYUE 3R7QA 1VDFA 5IY5E 3H1JD 3Q1MA 3LKUA 5KNGA 1L0LE 1DX7A 4MBGA 5AW8B 5LCWJ 4EZLA 2RKLA 3HTKA 1A5EA 1ZOYC 1L0LG 4ANWA 3OAKA 2ITAA 3TK1A 1S5LX 1BCCG 1X79B 2WMOA 1N73C 2B6CA 2Y69E 3OXLA 3B7UX 4BESA 5AVQB 4CDNA 1PP9G 5ARFA 1BE3G 1MFZA 3GLMA 3ZKJA 3H1LJ 3VLFA 1JCSA 2XCCA 1P5QA 4BXLA 1WT6A 4PJ0E 4PUCA 3BCCE 4EPZA 2WXIA 2IZ1A 2BEDA 1V55E 2KLUA 1WG0A 3Q7FA 4KMOA 5EN5D 4HRMB 1HGZA 2V0PA 3AS4A 3PDNA 3ZEFA 4DI4A 2JP3A 5EYPF 1JCQA 4YPCA 1PP9E 3E1RA 4DX5D 1H6KA 1IKND 4UWFA 2RKKA 3HXCA 1FZGA 2BCCJ 4AP2A 4WWPA 4CEMA 3ABVC 2R5SA 5HQ8A 3TG5A 2N9BA 4C48B 1P84E 3CVWA 2GRRB 4JL0A 2KSEA 3RK3C 1TN8A 3TF5A 1X9VA 2DZNA 3UM3A 3UT8A 2Y4UA 3BG0B 4M3OA 5AN8A 1S70B 4WUYA 1JMMA 4JBZA 1FJKA 4LG6A 4U7EB 2K3RA 3PUKA 4HRLA 4C7NB 3PNTB 2R2LA 2KUBA 3RK3D 1JCCA 3CVQA 4HOQA 3UKUG 4RVBA 4DUIA 3SO8A 1LGHB 1HH8A 3BATA 3L73E 3H1KE 3B7SA 4TV3A 2GRLA 1N94A 2HR2A 2IEJA 3SWKA 1L4AD 2IO3C 2XQ0A 3B7TA 4UQYA 2P58C 5FJYA 5ANRA 3U1AA 4CGVA 4EOTA 3H1IJ 3NF1A 3SGHA 3ABLE 3AG2E 3L4FA 3DSWA 3TWTA 2H6IA 2IBZD 3ABKE 2KYVA 1EDUA 1AQTA 4GOFA 4JXTA 3CI9A 2KXPC 3CIAA 2CG2A 3AS8A 2JR8A 2OYIB 4UWHA 3V2NA 4G1TA 4U63A 1L0NE 3G2VA 2I8DA 4J0UA 3TWWA 3UKRG 2WTYA 1NTKJ 3MKQA 3CCQP 3VP9A 3SNXA 2QFCA 2BASA 2HLOA 1LT9C 1LJ2A 4EBAA 3D9NA 3RK2B 3CCRP 1MHQA 3CEQA 4K5AB 2E76C 2WXQA 3HE4A 4K0RA 3CQGB 1MFTA 3M9BA 3E33A 4G24A 4DI3A 3VTPC 2WT7A 4L1BA 4X8QA 4A3VA 3L71E 2HM8A 3AG1E 3PS6A 5AIJA 4KVOA 1IFIA 3RGUA 1JWFA 3ZYMA 2OYHC 3C8VA 2IONA 2E76D 5CCHA 1GL2D 3VMYA 3QC1A 5JHAA 2R3CA 4UQXA 1KN7A 3EWKA 1NTKK 3OXFA 3K9IA 1L4AA 1X81A 1N7SB 2I1KA 4XI0A 3HUSC 1FVHA 2P58A 4BRYB 3UM0A 2NPSD 4F7AA 3V2QA 4WY4B 1PAQA 5AVUB 4U96D 2J9QA 2O3JA 3F5HA 2I6HA 3Q3DA 2WSSH 2JEEA 2XPZA 2R5BA 3MV2B 2XPYA 5G04J 3CXHD 4I2ZA 5APQA 2QM7A 4CDRA 3ASFA 1M56D 2PRRA 1RW2A 3TNUA 1K05A 3IKOB 2XGMA 4I9EA 2YINA 4K3AA 1JUQA 1JY3O 3RJVA 4WWIA 4PV1C 3ML8A 3MUDA 1BE3D 1LP1A 1P84I 1VQKP 3D9JA 4A1SA 1O1TA 1NAYA 2XS1A 2I2OA 4H44D 1HBWA 1JCDA 2PM6A 2PQNA 1KFNA 4PS7A 1D7MA 1RH5B 2LSUA 2AXCA 4O1OA 1NL4A 4ME2A 2CFUA 2WB2A 5CJ0A 2WXRA 5CHEE 4OGQB 4KJMA 2N1TB 3S1KA 3GG2A 4J8SA 1N7SA 1O1SA 3AEFC 3P2BA 5KAIH 2XCBA 3M9HA 1OW7A 1FZCA 1URQA 2L9BA 2AXZA 3Q79A 1YI2P 1LTGC 1KPSB 3JQ1A 5T8IA 3AE8C 1E8XA 1KLXA 4GKGA 1SQVG 5T4YA 2R32A 3P8CD 4BETA 3QWPA 3WUUA 4TXQA 4AVXA 2QIWA 1CSBA 3AEAC 3ESLA 2FEZA 3B5NA 2F0YA 3VMXA 1Y9BA 1RQUA 3L22A 3CV0A 1OFCX 1PGOA 3BEEA 4UQZA 4W9RA 3G3ZA 3GW4A 1VQLP 1PGQA 3HD7C 1OVRA 1PPJD 1SS1A 4KT0J 3VN0A 2DZOA 4ZKPA 1EXJA 2VSYA 2UWJG 1FE6A 3T8MA 2EINE 3CX5D 5D0QD 5B66H 5B5EH 1YJNP 2NRGA 3UIAA 1LP1B 4A1GA 5A23A 5TISE 2DW3A 3EU9A 4HOUA 3CHPA 2OYIC 4LNGA 1NHLA 1SQPD 5KAIE 2AEMA 1EYHA 4ABNA 3ULYA 2RD0A 3TAXA 5G05J 4AYCA 2FBNA 1J1EB 4CZ2D 1FPPA 4RQIA 3QWWA 4XEIG 1SQPK 2FFDB 3SI5A 2HODB 2FYNB 5CMWA 4HNAD 2X6HA 2GGFA 3AE4C 1E8ZA 4LRZA 3ZYLA 3D9MA 1RY3A 2VSOE 4FJZA 3H1IG 2VGXA 5KLVG 1NKNA 2ZVOB 1S64A 3ZN3A 4F3VA 2OYHB 2P9NG 5BU8B 3KYQA 1TNZA 2KBXA 4PV1B 1N0RA 2H7HA 4FLHA 1FDOA 3APFA 4LUNU 3UXGA 3I5CA 3CK7A 2E42A 3B5NC 1HZ4A 4NPEA 1IC2A 4XFJA 3PH0A 4XA4A 3CVLA 3O4ZA 3LVRE 5KJ7C 3FH5A 2X6KA 4PD4H 3FTZA 5BU5A 3BRTB 1H88A 4KVMA 1BCCJ 3C3QA 3I3NA 1OWAA 3AU4A 1N95A 1KD1Q 1NU1E 4GA1A 1UJJA 1N7SD 3P8CE 2Y3AA 3HD7B 3RL0D 1BE3E 2C0LA 3ASDA 4HS2A 1G1JA 3SFDC 4B8CB 5AW3B 2XRYA 3CSFA 3K5BA 3RO2A 3G6EP 5JJTA 3FTUA 3PZ2A 1DCQA 2L6JA 4J8EA 2RG8A 3UT4A 3UMVA 2B87A 1PIXA 1NTZK 4Q96A 1KB9H 2D2CD 1AA0A 5ENNA 5CJ4A 2WVRA 3L73D 3S9OA 2GA1A 4RG9A 3CLQA 4HI8A 3ULEG 2YKOA 1ZR4A 4J6IA 4L76A 4IFFA 3TDKA 5JHBA 4WNEA 3ZIMA 4FP7A 1KQGB 4KBQA 5FIOA 2AEJA 3P8MC 3RK3B 4HOTA 3PJSK 3L75D 3UM2A 4Z1MH 2LXMA 2W90A 4EECA 1T6AA 4EZJA 1LTSC 1QVFO 4R4MA 3CX5I 2LAIA 3CWBG 1KB9E 1N73A 5CERB 3NOCD 2PGDA 3ULQA 3KZIH 1S9KD 5ENSD 4GYWA 5AW0B 1QL2A 2N1TD 2C0XA 4BWNA 2YKPA 1DD4A 3FU3A 3Q73A 1HWTC 4TLFA 1GD2E 3ZYKA 2B88A 1HJ0A 2M0BA 4I17A 4N3CA 5CECB 2PFXA 2WXJA 2QJPB 1T3UA 1Q86Q 2E74D 3E7KA 1TYQG 3PNLB 1SW6A 3L36A 1HX8A 5CCMA 2WPQA 4BTBA 3UINC 1BDCA 1L2PA 1SQVK 1NU1D 3U66A 4AEZC 2H43A 4I7ZC 4CYMD 1DNPA 3L70G 1BDDA 1JB0J 3V4QA 4ILHB 1YBKA 3H1JJ 2O1KA 3SQVA 4ANXA 2A45I 4U8HA 1VF5D 5CRUA 1AJYA 1IQRA 2VTBB 4H13C 3L75J 1UG3A 3G2TA 3P7KA 2YXRB 1PFIA 3BG1B 3I55P 3L73G 2NC9A 3CMAP 2OTLP 3SFXA 1SQXD 1K73Q 4GAAA 4UB6E 4Y28J 4TUUA 1NH4A 3G2SA 4JPZB 2BUGA 3CSTA 2IPPA 4U7JA 3L08A 3BCCG 4J8DA 2RMZA 5AVRB 4GZDA 4KYOB 3OAWA 2W6BA 1SQQG 2WXFA 3GF7A 3SY2A 2JJLA 4NPDA 1NI1A 3A5TA 1KB9D 4I43A 2HE0A 4FU3A 2VRSA 3D70A 5D66A 4DZOA 4BERA 4U04A 2EIJE 3ZUVB 1OMIA 4U95D 4E85A 4IYPA 2NYJA 4H7XA 1DD3A 1KTMA 1EF1C 2MOWA 3EU5A 2FYUK 4HRNA 1BCCD 3UQ3A 4I6JA 3L70D 4CT0A 3FUJA 1PP9D 4N3AA 3KHUA 3BVHA 4DX2A 2LXLA 3VLEA 5ENQD 1KZUB 3ZPJA 3II6A 3PLNA 1JTHB 1HTLC 4BEPA 2BCCE 2WPVB 4H0LD 1DCEA 3AS5A 1TN7A 2WXHA 4UB8E 2WSEH 4I2WA 1TNBA 4O6FA 2J5UA 2LO6A 3TXNA 4ACLA 3RSEG 3AEDC 3QWVA 3FFLA 3CCMP 2KATA 3DSUA 4K5CA 1KORA 5G04C 2HODA 1K04A 4RSYA 3HE5A 2ETCA 3TG4A 3A0HH 5APUA 2Y9ZA 2Y0BG 2D2CB 3H1LG 3V2PA 1RF1A 4G25A 2P9LG 3O6QA 1E8YA 2J08A 4G8LA 3HXBA 4QQIA 3V6IA 1UJKA 1E8WA 1HG5A 3LDZA 4N2SA 5APWA 1TJFA 3CHMA 5E76A 1QEXA 1FBMA 3ISMC 4J8FA 4IFDK 1OIPA 3VTXA 4B8AA 2UY1A 4GZ3A 3WG7E 2IYOA 1ZMEC 3FUEA 4UUCA 4N3BA 1JY3P 3HVEB 3H1KG 2EILE 4CGWA 1RQVA 3DSTA 3H1HE 2H88C 1NAFA 2C0MA 2MJZA 1WMKA 3T5XA 4GTQA 2VTBA 4GTPA 3TWUA 3PP5A 3ONLA 3I5PA 3QB2A 2R17C 2QJYB 1HUCA 1SFCA 1IQUA 5CCLA 1LT9A 5KJLA 3LY8A 1RF1C 2W6JH 4JHRA 2KZIA 4P29A 3M06A 4XI9A 2KOGA 3H1IE 2P9IG 2WVIA 2IBZG 3CVPA 1LNQA 3OJAB 1T2KC 4I6GA 3LJNA 3OA7A 3J5QB 3DPDA 1J1DC 2GUVA 4RLYA 5AVXB 2BKKB 2IBZE 1G2CB 2KZTB 2XZDG 4EZKA 3JCUE 3FUKA 3L16A 5AJDA 2LXCB 3FUDA 1SQQE 5D0OD 1Q81Q 1G1IA 2O01N 5DBKA 2R44A 1DVPA 2QYJA 1JWGA 3WU2E 3C9IA 3FDHA 5KBAA 4V3IA 2E75B 3V30A 4MKTA 1K3ZD 1NTZD 2AXTH 5CBNA 4LNBA 5H2FH 2A45G 1N73B 4MS6A 1XTCC 2ZT9B 4KZ0A 1KV4A 3NFQA 5HRYA 3NQPA 4JYBA 3QARA 3GMAA 4K35A 1W2BO 1X5BA 1BLXB 5KKZC 2OOEA 1Z6TA 2CPSA 4C46A 3FWVA 3CXHE 5KLIB 2H6HA 3UT7A 4GMLA 3DXMG 1URQB 1FU1A 1D8DA 3H1KJ 2WITA 1FOSE 3ZHEA 3LIDA 2WQ7A 3H1HD 4LGDE 3R2PA 3SD5A 2P9UG 4YNDA 1BPOA 1WDYA 4EBAG 2OGUA 3CC2P 4G26A 3QAQA 1D9SA 5FWQA 2LAHA 4HFGA 1HVVA 1SP4A 2QC9A 5ENTD 2NPSA 1UN9A 1O5MA 1FZEA 4GTRA 2WXNA 2GRMA 2M3BA 1M1JB 2X6FA 1SQQJ 1MYOA 3M9QA 1FJPA 2WWWA 4B89A 2QSIA 3L74J 1RHZB 1AVOA 3FTSA 2P7JA 3EJNA 2XKMA 3G2UA 1L0LJ 1H19A 2JEKA 2CFZA 1BSHA 1R8EA 1P84D 4M3LA 1MX4A 3UX4A 3VYIA 1FDMA 4XKCA 3I4RB 5KAFE 3HG0D 2DIWA 4IFMA 1TNYA 2ZT9D 1PPJE 4IL6H 1M8OB 1FCHA 4BSXA 1GW4A 3H1LE 5CCGC 2AVPA 2WSCJ 1PPJG 2YHCA 3H1ID 1RZ4A 4GYYA 4LCTA 3RAUA 2V7QH 3G9RA 1BI7B 4YTPC 4A7PA 4EI2A 1S0PA 1SQPG 3U9WA 3F89A 5KNHD 1SQVE 3RKVA 5EYLA 1YMPA 5CMZA 1NA3A 3CCLP 3Q5RA 1URQC 5M72A 2NPSB 1K8AQ 1A02F 3NMDA 1L0LK 1KQLA 1PL5A 1M90Q 3OXGA 3B13A 4JPSA 2XNDH 4CPGA 4DCKA 4GB9A 2JWAA 1VPCA 4C0MA 5C39A 3KAEA 1LWUA 3HE4B 4LSZE 2M5AA 4HKZH 1GW6A 2G3AA 2C2LA 1QNFA 4R7LA 5JJ6A 3D71A 4K5BA 4H13D 3MUDC 3ML9A 2WPRA 2ZXEB 2Q5UA 4D6TE 1KYOE 2YIUB 1E7UA 1FZAA 1H8AA 2GROB 2C0WA 4Y99B 3B8EB 3L70E 1SQBK 4MLPA 1BE3J 3VMAA 3BUAA 4DX7D 3OW2O 3TYYA 4U8VD 5LFAA 3LJ3A 3AE6C 3Q9NC 3Q75A 3AE7C 5APVA 3HXDA 1NU1G 2IY0C 3Q4AB 3BQOA 1H89A 2HFED 2KB7P 4TXRA 2KI7B 1V54E 4G8KA 2XZRA 1B89A 3VLDA 4U0ZA 1HU3A 1NOHA 2ZGDA 3L17A 2XDJA 2Z5HA 2YQ8A 2LSVA 3V2XA 5E75A 2V4LA 3FGAD 2E5TA 3CWBE 3FTWA 4IL6E 3RIBA 1IFJA 2IQCA 3RU0A 2E0IA 1JY2P 3L54A 2P2UA 1VL2A 1H2TC 4ZMDA 3T5VA 3KEZA 1CI6B 3U1CA 2LXBA 2OV8A 5HS0A 3SSUA 4JEUA 3FUMA 5B5EE 4KHXA 3PUJA 2KS1B 2B89A 3D9HA 1MUUA 1HF8A 3AE9C 2F8YA 3KXDA 4AV7A 3FH7A 1MKMA 5JJ7A 5H2FE 3ASOE 2GRPB 2FYUG 3QJZA 1GL2A 3WUTA 3TGUJ 5CCHD 1JY2N 1L0NG 1S72P 4GZCA 4AXHA 5AVZB 3CMEP 3MIWA 5FZQA 3D9OA 2KM4A 4I1MA 4C7NA 3FH8A 3AE2C 2UWJE 1FDIA 1QLED 3S2AA 1LTAC 5TJHA 1RF0C 3E32A 3N4XA 2KLVA 3LVQE 1IYGA 4O60A 2FO1E 2Q7CA 4HXIA 5B3SE 4O9BA 4HB1A 2J07A 3E34A 5KJKA 3EHMA 1LTJA 3AG3E 2PM7A 3HVEA 3QNKA 2A06D 4WBAA 3AG4E 4OVNF 2M5AB 2PQRA 4L2LA 5G55A 2J8SD 1KYOH 4HQDA 4UI9K 3SWFA 4EIJA 3SFYA 4KT6B 5BW8C 1ZR2A 4IN3B 3ZW3A 1IFPA 3NXSA 4GDOA 2LUHA 1NTMG 4U0UA 2WPVA 1SFCB 4M7CA 4CRWA 4GMRA 4DJGA 2ZYGA 1UIXA 1ZW0A 3FP3A 5CMYA 3UUXA 1U7JA 3IXEA 1SQXE 3PEVB 3QDNA 3H1HJ 1LD8A 2KNCB 2HYNA 3IV0A 4LEUA 1E79H 3GZSA 4GA2A 1OXZA 2Y0DA 1MQSA 4GYOA 4GCNA 1SVXA 5BUZA 3FXDA 3PZ1A 2WT7B 3PVLA 1E90A 1VQ8P 1FZCC 4HJGH 3LPZA 2WQ6A 3FU0A 1N4QA 3L35A 3CCVP 1M57D 1XTGB 2VGYA 3TWXA 4GPMA 2OARA 4JZYA 4GPKA 1H0AA 3RRNB 4GTSA 1LD7A 3AAAC 1N8RQ 2QY7A 4U3FD 1J1DB 1R5LA 1CI6A 4FLBA 4F1SA 3CVYA 2Z4EA 2ILRA 3H1KD 2GM4A 1SZ9A 5BNWA 3HUSA 3A7OA 1LTBC 3KD7A 1T3JA 2XGOA 3P1UA 1EQ7A 3RL0g 3L71J 1RF1B 2QYUA 1BCCE 2XZTG 3Q7AA 4IOIH 3H32B 2A06E 2BCCD 1H6OA 3WXXA 3M0DA 4C9BB 3EQ2A 1SQVJ 2AW6A 4UWKA 2JDIH 2QA4P 1M7LA 2MRIA 2ZYAA 1RE4C 2UY1B 1PGPA 1MJ0A 4YDEA 5BXOA 3JUIA 1PZQA 1EZVD 2WQYC 2E74B 3E1IA 1N4SA 1NTZJ 3PE3A 3AE3C 1AV1A 4ACKA 2IZ0A 3EFFK 2OEWA 5CCGA 1S1CX 4DX6D 3R9MA 2EIKE 4UWGA 1GTWA 4DX1A 2XV5A 2R59A 4JHJA 4A3TA 3ZU7B 2XEHA 4CCAA 3H1LD 3UPVA 3CCJP 3CXHH 1SA4A 4B0ZA 1M1JC 5HKPA 1LT9B 2PNNA 4OGQD 1Z3XA 4GIFA 5EX3A 3WMM0 1EZVG 5C1DA 3H1JG 1RE3A 1H0TA 3E37A 2YNQA 1ZU2A 4FC8A 1VQNP 4GA0A 4GZ6A 2IOSA 5KWDA 2NSZA 2YNYA 3Q5MA 3QOUA 3A2AA 5APYA 5KLIC 3L6AA 2FULA 1K1BA 1SQBJ 2OVBA 3MGBA 3DSSA 3BASA 3LS8A 4JQ0D 1G2CA 2HPCA 1TR4A 1OZHA 1SQBE 4Q69A 3TJPA 4N39A 5CCGD 3CVXA 2IFMA 1O1RA 3CL3D 3CKBA 4JD2G 4XZ4A 3FWNA 2FYUD 1P84H 4ZKUA 1N0QA 5EILA 1GL2C 2OCCE 3HRNA 4RKUJ 2L91A 1NP7A 3G4SP 1TJCA 1BGYG 3CCEP 4W7YA 4WY4A 4U8YD 1N4PA 1JY2O 1YHQP 1NO4A 1URQD 3Q5PA 4B93B 5BVZA 3UI2A 3MGNA 3FU5A 3MD0A 1INZA 1BGYE 3H1HG 3CC7P 5ENOD 1EXIA 2KCVA 3ZGQA 1NTMJ 4AM9A 1KZOA 2QVAA 3L71G 1U3DA 1OW6A 2KS1A 4H13B 1K9MQ 4LERA 3AEEC 1SQBG 2BKGA 3VOPA 4A63B 2FKWB 2M63A 5JA4D 2KZJA 5FQ7A 3IN6A 2WXGA 1PP9J 3ASGA 4D10C 1U7MA 3TL5A 3PZ4A 2IFUA 1NA0A 3DBSA 2V7QJ 4WWOA 1QGKB 2CHWA 1KILA 4FULA 2IOLA 5EKQD 1X22A 5AVTB 2X3MA 2ZVNB 2ZYDA 2XNXA 4WNGA 3W68A 3S7FA 2J59M 2ZXXA 4PV1D 1N7LA 5FINA 2D2CC 3CCUP 4GTOA 3QH9A 3ZFWA 1WRGA 4H44C 3CCSP 1DEBA 4B86A 5G2NA 1ZXGA 1TNOA 2HR3A 5APSA 4K03A 2FYZA 4KZCA 3D6YA 1BI8B 4GT1A 4BT9A 1EZVI 1CZQA 3G2WA 4O1PA 2IFNA 1VQ9P 1AQ5A 3L82A 1YITP 5AAOA 2MKVA 2E5YA 4W80A 2FYUJ 1DEEG 2P9KG 3MX3A 4LC1A 3RRMB 5DJUB 3JYSA 3L75G 4HYTB 3UM1A 4GTTA 3AU5A 2OTJP 4DPRA 3USSA 1LTTC 1PGJA 3KEAA 3CK8A 3ZXSA 1Z56A 2IO2C 3HYMB 2RH0A 3WUVA 1L4AB 1HXIA 1H0TB 1X0TA 3MYVA 2F8XK 3GW6A 3HE5B 2XGSA 4UI9J 1BGYD 4DOJA 1VDYA 2AXUA 2GW1A 2FYNC 3NBNB 1N9AA 4XE0A 4OWFA 1IFMA 3APCA 4D6TG 4JF7A 1HH0A 3IR9A 5CCHC 1GU4A 4RJTA 1OUVA 3E4BA 2LR2A 3FUIA 4Z68A 1SQBD 4PS8A 2DYSE 4AIFA 1BU9A 1AWCB 1ZBPA 3ZVVA 3L72D 5AYWD 3CR3A 1VF5C 1HF9A 2V8SE 5CBOA 1L0NJ 2P67A 2K9JA 2G8YA 1UOHA 2H6FA 1UW4B 2VSNA 1IZNB 3IHYA 1EPUA 1NU1J 3MCXA 2EIME 2H89C 1EDIA 4DT0A 4GOEA 5AQ9A 3T9KA 3ENEA 2AEFA 2J09A 5EFWB 4GMJA 3BRVB 1FZFA 1FC2C 3H32A 2QJKB 4PD4E 2RFAA 1OWMA 5DIZA 4N6JA 4OVUA 2Q9IA 4N78E 3SBSA 3RRUA 3B5ND 4I2LC 3FTYA 5EIDA 3L75E 3L73J 4HORA 2IYPA 4WWNA 4YXWH 1G3NB 3CQCB 4NQ0A 3JUEA 3C3RA 3TWRA 2WXMA 1YQ4C 4N5QA 4BTAA 1KC8Q 1SQVD 2QEXP 4L9PA 2YXQB 3U59A 1S9KE 4RESB 4IULA 4D6TD 3AECC 3D9KA 1KQFB 2YKQA 2PL2A 2IX7C 2EQXA 2R05A 4DJAA 3Q47B 5J08A 2Y0CA 3C1LA 1EDLA 2R3SA 3T97B 4RO0A 2H8PD 4JVSA 4BT8A 2W8ZA 3RO3A 3HTKB 3C98A 5KJNA 5M1BA 3FUNA 2DYRE 4ILIA 2DWZA 1HGVA 4OVVA 3S4RA 3B71A 4UB6H 5GTIH 1SA5A 2BF0X 3ZNGA 1OCCE 1Y8MA 2GRNB 4TT3H 2XHEA 3KPEA 1KMIZ 4U3FE 1JTHA 4H44B 2IDBA 3PH0C 3AEGC 5ITZF 2A4ZA 1JUNA 3D9IA 1KYOD 2ETAA 3BCCJ 2X38A 2V5QC 2A45H 3L74G 4ATGA 1AVYA 2WXPA 3CWBD 4L2YA 2DVWA 3L72G 1IO4A 1WY6A 4BSZB 1E5WA 4ASVA 3FY4A 1N11A 2QJKC 4PS3A 3CVVA 1QL1A 4JEHA 2L0IA 2O01J 2KZTA 3A3YB 3MZWB 1QBQA 2VSXE 5LP0A 4HLLA 2QRXA 2V4HC 4XIFA 1SQPJ 1NTMD 3Q15A 2CG3A 2WXKA 1GK6A 4YDOA 2JKVA 1CW5A 3ITKA 4ASWA 3H25A 3MJWA 3SFZA 1L5JA 3QK0A 2R02A 4NPFX 2Q7FA 3CGHA 4U3FG 4H7YA 3FTXA 3C5RA 1IK9A 2K9JB 3TGUD 2OEVA 3UIPC 1NTMK 2KC7A 2R03A 1KILB 5KLVK 1R5SA 2WMNA 3C72A 3TWQA 3Q2YA 4EQFA 5BV0A 1GZLA 1SQPE 2ZFCA 3SBTB 4JHKA 5FZSA 1MX6A 3AE5C 1YA0A 2YMKA 4ANUA 3B7BA 4WVZA 4HBDA 3GHGA 3PZDA 5KCMA 5KJMA 2KNCA 1LTXA 1T2KD 2Y4TA 3A0BE 4GODA 1YCSB 3LIEA 2Q3IA 3CHOA 3O48A 2E43A 3AJIA 1KB9I 5EIBE 5CEDB 2XPIA 1DC2A 2WPSA 4PDXA 4YVOA 2FFDC 3DWLG 5KJ7D 4WB4A 2C9NY 3ONKA 1HE8A 1YYHA 1N2DC 3JSVC 3EIQC 2SPZA 3JCKC 4ZFHA 3L74E 3DEOA 4BWRA 1PY1A 3S7JA 4N3YB 2CHZA 3LW5J 3LEWA 3PEUB 1SQMA 5D2MC 1OW8A 3LW5H 1JPLA 3PTZA 1J2JB 3LY7A 1MZ9A 3V5BA 2A5UA 4JB8P 1QX8A 4Y99C 5AVVB 3B5NB 5KLVE 3L71D 5BXUA 4HOSA 3TXMA 2KCKA 1S5LH 1KZPA 2XEVA 1TU3F 2YIUC 3FU6A 2QE7H 4YDYA 2RN0A 5ENPD 1KILD 2OYOA 4ZNCA 1LT1A 4U3FJ 2W6AA 2Y1LE 3HXFA 3KSLA 3QKYA 3PHLA 1ZRTE 2CK3H 2WMMA 1W2EA 2J58A 5FT9A 3ZHEB 2ETBA 5LX8A 4FADA 5LOZA 3FX0A 2FXOA 2QZAA 2E76B 1IHGA 4JA9A 3LXUX 4XE5B 5E79E 5BV1A 5E79H 5GTIE 3CPWO 3TWSA 2Q6QA 1KILC 2K37A 3CXHI 4MRUA 5A6CA 2LKMA 3FUFA 2PP6A 2W27A 1NTME 1Q7YQ 1FVFA 2CPBA 2FFDA 3URZA 3GHGC 1S2EA 5AW2B 2YO2A 4OAVB 3TNUB 1JY3N 2I1JA 3HIZA 3NB2A 5B1AE 5B66E 1JMBA 1YTZI 3LYAA 3FXEA 4GTVA 3ZXPA 1EZVE 1Z5SC 2P9SG 3FEYA 3GZ1A 1NVOA 5AENA 1FT2A 2WSCH 3JC22 3SZ7A 2YO3A 4A55A 2N9YB 3DEPA 2KXPB 4APFA 2V5FA 2ZU6B 2VJ8A 3LCAA 1LF8A 5B1BE 4BFRA 1YYCA 3S7DA 2AJAA 1S5LE 2FI7A 4G23A 2WXOA 2WM9A 1L0LD 2MHKA 1VQPP 3RK6A 4BX8A 2P1JA 1LTIC 5EX0A 4FA6A 3D6ZA 4MN4C 3MP7B 3PRZA 1YTZT 1VQOP 1IXVA 4NIKA 3IAOA 1FS0E 1SQQD 5K5GB 5FTPA 3V79K 2P10A 3MHVA 4JC8A 1ZLLA 2OVFA 1KFMA 1T8ZA 3BCCD 1SZAA 2PZIA 1NKZB 1NTKD 5AW9B 3L72E 2GUSA 1OXJA 1GU5A 1DH3A 2RFMA 4OH8B 1ZRTD 1U57A 2L0TB 2C9LY 2CHXA 3QWOC 3CHRA 3M0DC 1LWUB 4YVQC 5BT1A 1USEA 4IL6X 2JABA 2FBWC 2DBAA 2R5DA 4PJ0H 2ZJSE 4WNDA 1OVVA 1GK4A 1UIIA 2JO1A 1ZV8A 1H2UA 3R7RA 3H6PA 5AVSB 5AVWB 1KT0A 1E7VA 3M0AA 1HG2A 3ZYQA 3FTVA 1NU1K 1N4RA 1FT1A 5APTA 1OWNA 1YIJP 1N52A 1MV8A 4IRUA 1N54A 1N7SC 2P2CP 3L13A 3HHMA 1BD8A 3RL0C 1K8KG 2ZXWE 4NURA 3SF4A 3TWVA 3GZ2A 3TGUG 5KAFH 1KYOI 1H2VC 5AW4B 3VP8A 1YJ9P 2FY8A 2VGXB 3N71A 5HI7A 1S4XA 4EYYQ 4APOA 5AQBA 2Y0EA 4YXDC 1NJIQ 1OT8A 2WQHA 5AVYB 1N86A 5GTHH 4EDFA 1IFDA 1HS6A 2I9CA 4HH2A 3IBEA 2Q3EA 4U07A 1KQSO 2YHEA 3MEKA 3M91A 1LTJB 2JWDA 3GHGB 4L7TA 5JMND 3EHNA 3HRAA 2A06G 4AUWA 4U0SA 2JLBA 5APXA 3PE4A 4C0EA 2IF4A 1EDJA 2FXPA 1L0ND 4I6MC 4Y6CA 5AQAA 1IHBA 3U64A 3MKRA 3FHEA 4URKA 1NTKE 2IJGX 1IFNA 4F1PA 2XS8A 4ATZD 1Q2NA 2J49A 2N1TC 4OAUC 1QYMA 3EHRA 2F37A 1L0NK 3TGUE 5AW6B 1VQ6P 3SHFA 2Y9YA 2Z5IA 4Q94A 2LNIA 1U2VG 1RE3C 2J4DA 3NTNA 3Q5SA
chains in the Genus database with same CATH topology
4K35A 5K5GB 4O1PA 4HB1A 1EDLA 3EU9A 3NOCD 4K5BA 5ENRD 3ZU7B 2XEHA 3V79K 3Q9UC 3MHVA 5ENSD 1BLXB 5AAOA 5EYPF 2ZGGA 5CEAA 1AP7A 1DEEG 1YYHA 2M5AB 5HKPA 2DWZA 5DJUB 2PNNA 4CZ2D 4DX5D 2P58A 2SPZA 2B88A 3B95A 4K5CA 2J8SD 1IKND 4ZFHA 4HQDA 2M0BA 2RFMA 3DEOA 5DJTB 5CECB 2ETCA 3KEAA 3W9GA 2OTKE 3ZNGA 4LNUD 4DX7D 1EC5A 4F6RD 2Y0BG 1H0TA 1SW6A 4U8VD 3QWOC 2KIKA 3Q9NC 5KWDA 2M5AA 4U96D 4C48B 4HNAD 2XENA 5CERB 4JB8P 5ITZF 1BDCA 2DZNA 4G8LA 1MX2A 2JABA 1H0TB 1WDYA 1X0TA 4QQIA 4ZHBA 2F8XK 4GMRA 1OVVA 1K1BA 5AN8A 4DX1A 1S70B 2ETAA 1ZW0A 4JBZA 4CYMD 5BXUA 1BDDA 1U7JA 3IXEA 4LG6A 1S3JA 2KI7B 2V5QC 2KBXA 1D9SA 2K3RA 1N0RA 4HRLA 1TR4A 5AQ7A 4G8KA 2QC9A 1NFIE 2MYOA 5ENTD 3NBNB 2DVWA 4UUCA 2ZGDA 2KUBA 3UXGA 3T8KA 4BSZB 4ASVA 1N0QA 1N11A 4J7WA 5EILA 4NPEA 1SVXA 3J5PA 3PH0A 4ZNCA 1JM0A 2P2CP 1LT1A 2Y1LE 1BD8A 2LR2A 4HB5A 5ENPD 4K3AA 3FXDA 4U8YD 3SO8A 4Z68A 4WWIA 2WMMA 3MZWB 1Y47A 1MYOA 4B93B 3UI2A 4HJGH 4HLLA 2ETBA 1LP1A 2QRXA 1BU9A 1AWCB 3TWVA 2V4HC 3TWXA 1EDKA 4J8YA 3TWUA 4GPMA 5CBOA 3F6QA 5ENOD 5EN5D 2A5EA 1UOHA 4ZMDA 2VGEA 2L6BA 2B87B 4O1OA 2QVAA 4YDWA 3TWSA 4ASWA 2LXBA 3EHQA 3AAAC 2B0OE 2BKGA 5HS0A 4KJMA 3S1KA 4EYYQ 4A63B 4NPFX 1EDIA 5JA4D 2KZJA 4GOEA 1MX4A 2KZIA 5AQ9A 5AQBA 3T9KA 3C5RA 2KS1B 1DCQA 1OT8A 3TWTA 4QFVA 4DUIA 1OY3D 2XEEA 2B89A 2B87A 4OAVB 5EFWB 3D9HA 3HG0D 4GOFA 5KNGA 2F8YA 4NPDA 1FC2C 2KXPC 1U7MA 2HE0A 2RFAA 3TWQA 3LJNA 1JMBA 3J5QB 2RKLA 2I8DA 5D66A 2XZTG 4BERA 1A5EA 4RLYA 3FXEA 3TWWA 3ZUVB 2BKKB 4IOIH 2JWDA 5JMND 4DRXE 2XZDG 1MX6A 4U95D 4BETA 1NVOA 2NYJA 3HRAA 3NOGD 2Q1KA 2LXCB 1BI7B 3JXIA 4HI8A 5EIDA 3B7BA 5KNHD 4HBDA 5EYLA 3V2XA 4BESA 1YMPA 3DEPA 3JXJA 1G3NB 1K1AA 1EDJA 4K5AB 1OVUA 3V2OA 2R44A 2QYJA 1MJ0A 1IHBA 3JUEA 4HI9A 4HRNA 5AQAA 5FINA 1MFTA 4GODA 2AJAA 5AARA 3TWRA 1YCSB 5BXOA 5CEDB 4F1PA 5FIOA 3ZKJA 5KBAA 2UWJE 4TUMA 1OVRA 4ATZD 4N5QA 1Q2NA 1SS1A 3V31A 4BXLA 4CPGA 1ZXGA 2DZOA 3V30A 1QYMA 3EHRA 3W9FA 2F37A 5ENQD 1K3ZD 4DX2A 4OAUC 5CBNA 2HR3A 5C39A 4DX6D 3RGUA 4NIKA 3UTMA 4BEPA 2ZAEB 3AJIA 4MN4C 4YDYA 4LSZE 5HRYA 1LP1B 1BI8B 1WG0A 4HKZH 4O60A 5EIBE 2FO1E 3ZDMA 4HRMB 1IXVA 1DC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K35 A;  5K5G B;  4O1P A;  4HB1 A;  1EDL A;  3EU9 A;  3NOC D;  4K5B A;  5ENR D;  3ZU7 B;  2XEH A;  3V79 K;  3Q9U C;  3MHV A;  5ENS D;  1BLX B;  5AAO A;  5EYP F;  2ZGG A;  5CEA A;  1AP7 A;  1DEE G;  1YYH A;  2M5A B;  5HKP A;  2DWZ A;  5DJU B;  2PNN A;  4CZ2 D;  4DX5 D;  2P58 A;  2SPZ A;  2B88 A;  3B95 A;  4K5C A;  2J8S D;  1IKN D;  4ZFH A;  4HQD A;  2M0B A;  2RFM A;  3DEO A;  5DJT B;  5CEC B;  2ETC A;  3KEA A;  3W9G A;  2OTK E;  3ZNG A;  4LNU D;  4DX7 D;  1EC5 A;  4F6R D;  2Y0B G;  1H0T A;  1SW6 A;  4U8V D;  3QWO C;  2KIK A;  3Q9N C;  5KWD A;  2M5A A;  4U96 D;  4C48 B;  4HNA D;  2XEN A;  5CER B;  4JB8 P;  5ITZ F;  1BDC A;  2DZN A;  4G8L A;  1MX2 A;  2JAB A;  1H0T B;  1WDY A;  1X0T A;  4QQI A;  4ZHB A;  2F8X K;  4GMR A;  1OVV A;  1K1B A;  5AN8 A;  4DX1 A;  1S70 B;  2ETA A;  1ZW0 A;  4JBZ A;  4CYM D;  5BXU A;  1BDD A;  1U7J A;  3IXE A;  4LG6 A;  1S3J A;  2KI7 B;  2V5Q C;  2KBX A;  1D9S A;  2K3R A;  1N0R A;  4HRL A;  1TR4 A;  5AQ7 A;  4G8K A;  2QC9 A;  1NFI E;  2MYO A;  5ENT D;  3NBN B;  2DVW A;  4UUC A;  2ZGD A;  2KUB A;  3UXG A;  3T8K A;  4BSZ B;  4ASV A;  1N0Q A;  1N11 A;  4J7W A;  5EIL A;  4NPE A;  1SVX A;  3J5P A;  3PH0 A;  4ZNC A;  1JM0 A;  2P2C P;  1LT1 A;  2Y1L E;  1BD8 A;  2LR2 A;  4HB5 A;  5ENP D;  4K3A A;  3FXD A;  4U8Y D;  3SO8 A;  4Z68 A;  4WWI A;  2WMM A;  3MZW B;  1Y47 A;  1MYO A;  4B93 B;  3UI2 A;  4HJG H;  4HLL A;  2ETB A;  1LP1 A;  2QRX A;  1BU9 A;  1AWC B;  3TWV A;  2V4H C;  3TWX A;  1EDK A;  4J8Y A;  3TWU A;  4GPM A;  5CBO A;  3F6Q A;  5ENO D;  5EN5 D;  2A5E A;  1UOH A;  4ZMD A;  2VGE A;  2L6B A;  2B87 B;  4O1O A;  2QVA A;  4YDW A;  3TWS A;  4ASW A;  2LXB A;  3EHQ A;  3AAA C;  2B0O E;  2BKG A;  5HS0 A;  4KJM A;  3S1K A;  4EYY Q;  4A63 B;  4NPF X;  1EDI A;  5JA4 D;  2KZJ A;  4GOE A;  1MX4 A;  2KZI A;  5AQ9 A;  5AQB A;  3T9K A;  3C5R A;  2KS1 B;  1DCQ A;  1OT8 A;  3TWT A;  4QFV A;  4DUI A;  1OY3 D;  2XEE A;  2B89 A;  2B87 A;  4OAV B;  5EFW B;  3D9H A;  3HG0 D;  4GOF A;  5KNG A;  2F8Y A;  4NPD A;  1FC2 C;  2KXP C;  1U7M A;  2HE0 A;  2RFA A;  3TWQ A;  3LJN A;  1JMB A;  3J5Q B;  2RKL A;  2I8D A;  5D66 A;  2XZT G;  4BER A;  1A5E A;  4RLY A;  3FXE A;  3TWW A;  3ZUV B;  2BKK B;  4IOI H;  2JWD A;  5JMN D;  4DRX E;  2XZD G;  1MX6 A;  4U95 D;  4BET A;  1NVO A;  2NYJ A;  3HRA A;  3NOG D;  2Q1K A;  2LXC B;  1BI7 B;  3JXI A;  4HI8 A;  5EID A;  3B7B A;  5KNH D;  4HBD A;  5EYL A;  3V2X A;  4BES A;  1YMP A;  3DEP A;  3JXJ A;  1G3N B;  1K1A A;  1EDJ A;  4K5A B;  1OVU A;  3V2O A;  2R44 A;  2QYJ A;  1MJ0 A;  1IHB A;  3JUE A;  4HI9 A;  4HRN A;  5AQA A;  5FIN A;  1MFT A;  4GOD A;  2AJA A;  5AAR A;  3TWR A;  1YCS B;  5BXO A;  5CED B;  4F1P A;  5FIO A;  3ZKJ A;  5KBA A;  2UWJ E;  4TUM A;  1OVR A;  4ATZ D;  4N5Q A;  1Q2N A;  1SS1 A;  3V31 A;  4BXL A;  4CPG A;  1ZXG A;  2DZO A;  3V30 A;  1QYM A;  3EHR A;  3W9F A;  2F37 A;  5ENQ D;  1K3Z D;  4DX2 A;  4OAU C;  5CBN A;  2HR3 A;  5C39 A;  4DX6 D;  3RGU A;  4NIK A;  3UTM A;  4BEP A;  2ZAE B;  3AJI A;  4MN4 C;  4YDY A;  4LSZ E;  5HRY A;  1LP1 B;  1BI8 B;  1WG0 A;  4HKZ H;  4O60 A;  5EIB E;  2FO1 E;  3ZDM A;  4HRM B;  1IXV A;  1DC2 A; 
#chains in the Genus database with same CATH topology
 1YJW P;  3AE1 C;  2E74 C;  4BY6 A;  3I4G A;  4I9C A;  1D8E A;  2FXM A;  2IU1 A;  4R4L A;  4PD4 I;  3OTN A;  1AP7 A;  5A7D B;  1OCR E;  3DXK G;  2KSJ A;  4NRH B;  2KP8 A;  4AOF A;  1QVG O;  2O1J A;  3L9T A;  1Y8A A;  2OYH A;  3VTY A;  1EC5 A;  4FHJ A;  4WAF A;  3RBX A;  2KIK A;  4CT4 A;  2X6J A;  3V4W A;  3CK9 A;  3JQ0 A;  2W83 C;  3CKC A;  1J1E C;  1MX2 A;  3GYZ A;  1HO8 A;  3FWL A;  3D9L A;  1A17 A;  5LCW C;  1A02 J;  1OCO E;  3CLJ A;  1W5C E;  1M1J A;  3CWB J;  3H1J E;  4LLH A;  3D9P A;  1PC2 A;  3EFG A;  5AW7 B;  4AJW A;  3U3W A;  2MYO A;  2AXT E;  3PZ3 A;  1RF0 A;  2HO1 A;  3W67 A;  4J7W A;  4E6H A;  1OCZ E;  4XKB A;  4HB5 A;  1JM0 A;  3IHV A;  2QJY C;  3A0B H;  1HJB A;  2M8R A;  3WU2 H;  4I1A A;  1H6P A;  1W3B A;  2E2E A;  2M3E A;  1Y47 A;  3IFM A;  5KLV J;  4ILG A;  5FQ8 A;  5AW1 B;  2O01 H;  3CHS A;  1EDK A;  5KTB A;  3F6Q A;  3Q49 B;  1ZP0 C;  3L74 D;  1JNM A;  3RK2 D;  2A5E A;  3T97 A;  4I6E A;  4YDW A;  3BU8 A;  4G2V A;  3S7B A;  3O8Z A;  4JW1 A;  3L70 J;  3P32 A;  2DCP A;  3Q78 A;  3IF4 A;  4L75 A;  3TGO A;  3G71 P;  3CX5 H;  3LY9 A;  3FUH A;  1RE4 A;  4N78 D;  3L37 A;  4D6T J;  2WZ7 A;  3RK2 C;  1WAO 1;  1QZ2 A;  5FQ6 A;  3EUV A;  2FF4 A;  1AFO A;  1NTZ E;  5KKZ B;  1JO5 A;  3NAW A;  3PRE A;  1SQQ K;  4TXP A;  3DPY A;  1BSN A;  1S63 A;  2Q1K A;  3JXI A;  1ZN5 A;  3UIO C;  4I1L A;  1Q90 D;  4AQR D;  2XU6 A;  3MA5 A;  5BPP A;  2QG4 A;  4H0L C;  1K1A A;  1E96 B;  3V2O A;  3DSV A;  1ZB1 A;  4WY4 D;  1VQ4 P;  2KK7 A;  1JCR A;  4N5C A;  1L4A C;  3V31 A;  3W9F A;  3RBZ A;  3CHQ A;  1X8Y A;  4EHM A;  1SQX J;  3C3O A;  3UTM A;  2ZAE B;  4I7Z B;  3RK3 E;  2WSE J;  1OX3 A;  4OYS A;  1Y6I A;  2FO7 A;  5ENR D;  4BX9 A;  4WY4 C;  1FZB A;  1NYH A;  3GF3 A;  5KJ7 A;  1OWO A;  3Q9U C;  4I1O B;  1SLQ A;  2K9Y A;  1DIP A;  3NZU A;  3CX5 E;  2ZGG A;  3VMZ A;  2BTD A;  3B95 A;  3IEG A;  3X2Q E;  5DJT B;  3L72 J;  1SQX G;  5AW5 B;  1FZC B;  1GDT A;  3HDX A;  4GU5 A;  3W9G A;  1USD A;  4HVB A;  3N7N A;  4LNU D;  4F6R D;  4AY6 A;  4DK5 A;  1Q82 Q;  3EDT B;  1FOS F;  1XGW A;  5ANL A;  4L73 A;  2J4B A;  3HUS B;  4ZHB A;  3MTU E;  1SQX K;  3APD A;  2OQQ A;  4OGQ C;  1YQ3 C;  2ZT9 C;  2IBZ I;  2V4H A;  2BEZ F;  5C2Y A;  2K1A A;  2N1T A;  5AQ7 A;  1NFI E;  2NZ2 A;  3FUL A;  4RG6 A;  1SFC C;  1GW3 A;  1M1K Q;  3PRJ A;  2KCL A;  3NZS A;  5CRV A;  3MZL B;  1MZC A;  2HYZ A;  3B7R L;  1JEK A;  3HD7 A;  3O6Q B;  4GTM A;  2QJP C;  4Y6W A;  3ASN E;  4H0L B;  1SFC D;  2NPS C;  4PH4 B;  5L8R J;  3KDP B;  2L6B A;  2B87 B;  2VGE A;  1NWQ A;  3SFE C;  1TNU A;  4UB8 H;  1OWP A;  1ELW A;  4UI9 C;  1Z3Y A;  1VF5 B;  2POH A;  4ANV A;  1BGY J;  1NGM B;  4QFV A;  2XEE A;  2PAJ A;  1HFA A;  1VQ5 P;  1FAV A;  3CD6 P;  5J90 A;  3SWY A;  1TN6 A;  3B4S A;  2ZIS A;  1NTZ G;  2BEQ D;  1Q2Z A;  5FZR A;  4CDM A;  2B9B A;  4DRX E;  1TEZ A;  2YMY A;  3CVN A;  3NOG D;  5TIS H;  3MKQ B;  3D3M A;  3JXJ A;  4B94 A;  3CVU A;  1OVU A;  3KQG A;  4HI9 A;  4G11 A;  2ZIR A;  5AAR A;  2AXV A;  3V2R A;  1WM5 A;  2HPC B;  2L5G B;  2K88 A;  4TUM A;  3JCU H;  4W7Z A;  4FHK A;  2GRQ B;  1GMJ A;  4C7R A;  1XNF A;  2H6G A;  4FJY A;  4DLO A;  1JOC A;  3ESK A;  3R9A B;  3ZDM A;  3ZRH A;  5H7P A;  3KSQ A;  1UN8 A;  5GTH E;  4N2Q A;  4HLE A;  4NAC A;  5KLV D;  5CEA A;  3E30 A;  1ELR A;  1SVF A;  1QQE A;  2NXP A;  3U4T A;  1U3C A;  3ASH A;  1IK7 A;  2OTK E;  5CHX A;  2HG5 D;  4JA7 A;  4BRY A;  2XEN A;  3KZI E;  2P9P G;  1OWL A;  5FQ4 A;  5T3R A;  4WNF A;  3HD7 D;  3RL0 B;  3AEB C;  4AY5 A;  3MV3 B;  1S3J A;  4TRQ A;  2XRZ A;  4PD4 D;  2VYI A;  4L23 A;  4DLQ A;  5ARG A;  2OND A;  2QM8 A;  2X6I A;  3T8K A;  3FEX A;  5AJL A;  4XX5 A;  5G05 C;  3J5P A;  2E75 D;  3ABM E;  4GCO A;  2WXL A;  1ELK A;  4QMA A;  2WSF H;  1NZN A;  4J8Y A;  3A0H E;  4JYC A;  1GL2 B;  3CC4 P;  1LWU C;  2WSF J;  3I56 P;  3KS2 A;  4KXK B;  3EIJ A;  3TSI A;  1VQM P;  1VQ7 P;  2E75 C;  3DSX A;  1NTK G;  3EHQ A;  2BCC G;  1KT1 A;  2B0O E;  4F53 A;  3R4Y A;  4L74 A;  1IJD B;  2OYI A;  3DRA A;  1KIL E;  1LTJ C;  3HXE A;  1PV3 A;  2VQ2 A;  2AWI A;  1OY3 D;  4UWL A;  5EDS A;  4GZ5 A;  2FYU E;  3R7Q A;  1VDF A;  5IY5 E;  3H1J D;  3Q1M A;  3LKU A;  5KNG A;  1L0L E;  1DX7 A;  4MBG A;  5AW8 B;  5LCW J;  4EZL A;  2RKL A;  3HTK A;  1A5E A;  1ZOY C;  1L0L G;  4ANW A;  3OAK A;  2ITA A;  3TK1 A;  1S5L X;  1BCC G;  1X79 B;  2WMO A;  1N73 C;  2B6C A;  2Y69 E;  3OXL A;  3B7U X;  4BES A;  5AVQ B;  4CDN A;  1PP9 G;  5ARF A;  1BE3 G;  1MFZ A;  3GLM A;  3ZKJ A;  3H1L J;  3VLF A;  1JCS A;  2XCC A;  1P5Q A;  4BXL A;  1WT6 A;  4PJ0 E;  4PUC A;  3BCC E;  4EPZ A;  2WXI A;  2IZ1 A;  2BED A;  1V55 E;  2KLU A;  1WG0 A;  3Q7F A;  4KMO A;  5EN5 D;  4HRM B;  1HGZ A;  2V0P A;  3AS4 A;  3PDN A;  3ZEF A;  4DI4 A;  2JP3 A;  5EYP F;  1JCQ A;  4YPC A;  1PP9 E;  3E1R A;  4DX5 D;  1H6K A;  1IKN D;  4UWF A;  2RKK A;  3HXC A;  1FZG A;  2BCC J;  4AP2 A;  4WWP A;  4CEM A;  3ABV C;  2R5S A;  5HQ8 A;  3TG5 A;  2N9B A;  4C48 B;  1P84 E;  3CVW A;  2GRR B;  4JL0 A;  2KSE A;  3RK3 C;  1TN8 A;  3TF5 A;  1X9V A;  2DZN A;  3UM3 A;  3UT8 A;  2Y4U A;  3BG0 B;  4M3O A;  5AN8 A;  1S70 B;  4WUY A;  1JMM A;  4JBZ A;  1FJK A;  4LG6 A;  4U7E B;  2K3R A;  3PUK A;  4HRL A;  4C7N B;  3PNT B;  2R2L A;  2KUB A;  3RK3 D;  1JCC A;  3CVQ A;  4HOQ A;  3UKU G;  4RVB A;  4DUI A;  3SO8 A;  1LGH B;  1HH8 A;  3BAT A;  3L73 E;  3H1K E;  3B7S A;  4TV3 A;  2GRL A;  1N94 A;  2HR2 A;  2IEJ A;  3SWK A;  1L4A D;  2IO3 C;  2XQ0 A;  3B7T A;  4UQY A;  2P58 C;  5FJY A;  5ANR A;  3U1A A;  4CGV A;  4EOT A;  3H1I J;  3NF1 A;  3SGH A;  3ABL E;  3AG2 E;  3L4F A;  3DSW A;  3TWT A;  2H6I A;  2IBZ D;  3ABK E;  2KYV A;  1EDU A;  1AQT A;  4GOF A;  4JXT A;  3CI9 A;  2KXP C;  3CIA A;  2CG2 A;  3AS8 A;  2JR8 A;  2OYI B;  4UWH A;  3V2N A;  4G1T A;  4U63 A;  1L0N E;  3G2V A;  2I8D A;  4J0U A;  3TWW A;  3UKR G;  2WTY A;  1NTK J;  3MKQ A;  3CCQ P;  3VP9 A;  3SNX A;  2QFC A;  2BAS A;  2HLO A;  1LT9 C;  1LJ2 A;  4EBA A;  3D9N A;  3RK2 B;  3CCR P;  1MHQ A;  3CEQ A;  4K5A B;  2E76 C;  2WXQ A;  3HE4 A;  4K0R A;  3CQG B;  1MFT A;  3M9B A;  3E33 A;  4G24 A;  4DI3 A;  3VTP C;  2WT7 A;  4L1B A;  4X8Q A;  4A3V A;  3L71 E;  2HM8 A;  3AG1 E;  3PS6 A;  5AIJ A;  4KVO A;  1IFI A;  3RGU A;  1JWF A;  3ZYM A;  2OYH C;  3C8V A;  2ION A;  2E76 D;  5CCH A;  1GL2 D;  3VMY A;  3QC1 A;  5JHA A;  2R3C A;  4UQX A;  1KN7 A;  3EWK A;  1NTK K;  3OXF A;  3K9I A;  1L4A A;  1X81 A;  1N7S B;  2I1K A;  4XI0 A;  3HUS C;  1FVH A;  2P58 A;  4BRY B;  3UM0 A;  2NPS D;  4F7A A;  3V2Q A;  4WY4 B;  1PAQ A;  5AVU B;  4U96 D;  2J9Q A;  2O3J A;  3F5H A;  2I6H A;  3Q3D A;  2WSS H;  2JEE A;  2XPZ A;  2R5B A;  3MV2 B;  2XPY A;  5G04 J;  3CXH D;  4I2Z A;  5APQ A;  2QM7 A;  4CDR A;  3ASF A;  1M56 D;  2PRR A;  1RW2 A;  3TNU A;  1K05 A;  3IKO B;  2XGM A;  4I9E A;  2YIN A;  4K3A A;  1JUQ A;  1JY3 O;  3RJV A;  4WWI A;  4PV1 C;  3ML8 A;  3MUD A;  1BE3 D;  1LP1 A;  1P84 I;  1VQK P;  3D9J A;  4A1S A;  1O1T A;  1NAY A;  2XS1 A;  2I2O A;  4H44 D;  1HBW A;  1JCD A;  2PM6 A;  2PQN A;  1KFN A;  4PS7 A;  1D7M A;  1RH5 B;  2LSU A;  2AXC A;  4O1O A;  1NL4 A;  4ME2 A;  2CFU A;  2WB2 A;  5CJ0 A;  2WXR A;  5CHE E;  4OGQ B;  4KJM A;  2N1T B;  3S1K A;  3GG2 A;  4J8S A;  1N7S A;  1O1S A;  3AEF C;  3P2B A;  5KAI H;  2XCB A;  3M9H A;  1OW7 A;  1FZC A;  1URQ A;  2L9B A;  2AXZ A;  3Q79 A;  1YI2 P;  1LTG C;  1KPS B;  3JQ1 A;  5T8I A;  3AE8 C;  1E8X A;  1KLX A;  4GKG A;  1SQV G;  5T4Y A;  2R32 A;  3P8C D;  4BET A;  3QWP A;  3WUU A;  4TXQ A;  4AVX A;  2QIW A;  1CSB A;  3AEA C;  3ESL A;  2FEZ A;  3B5N A;  2F0Y A;  3VMX A;  1Y9B A;  1RQU A;  3L22 A;  3CV0 A;  1OFC X;  1PGO A;  3BEE A;  4UQZ A;  4W9R A;  3G3Z A;  3GW4 A;  1VQL P;  1PGQ A;  3HD7 C;  1OVR A;  1PPJ D;  1SS1 A;  4KT0 J;  3VN0 A;  2DZO A;  4ZKP A;  1EXJ A;  2VSY A;  2UWJ G;  1FE6 A;  3T8M A;  2EIN E;  3CX5 D;  5D0Q D;  5B66 H;  5B5E H;  1YJN P;  2NRG A;  3UIA A;  1LP1 B;  4A1G A;  5A23 A;  5TIS E;  2DW3 A;  3EU9 A;  4HOU A;  3CHP A;  2OYI C;  4LNG A;  1NHL A;  1SQP D;  5KAI E;  2AEM A;  1EYH A;  4ABN A;  3ULY A;  2RD0 A;  3TAX A;  5G05 J;  4AYC A;  2FBN A;  1J1E B;  4CZ2 D;  1FPP A;  4RQI A;  3QWW A;  4XEI G;  1SQP K;  2FFD B;  3SI5 A;  2HOD B;  2FYN B;  5CMW A;  4HNA D;  2X6H A;  2GGF A;  3AE4 C;  1E8Z A;  4LRZ A;  3ZYL A;  3D9M A;  1RY3 A;  2VSO E;  4FJZ A;  3H1I G;  2VGX A;  5KLV G;  1NKN A;  2ZVO B;  1S64 A;  3ZN3 A;  4F3V A;  2OYH B;  2P9N G;  5BU8 B;  3KYQ A;  1TNZ A;  2KBX A;  4PV1 B;  1N0R A;  2H7H A;  4FLH A;  1FDO A;  3APF A;  4LUN U;  3UXG A;  3I5C A;  3CK7 A;  2E42 A;  3B5N C;  1HZ4 A;  4NPE A;  1IC2 A;  4XFJ A;  3PH0 A;  4XA4 A;  3CVL A;  3O4Z A;  3LVR E;  5KJ7 C;  3FH5 A;  2X6K A;  4PD4 H;  3FTZ A;  5BU5 A;  3BRT B;  1H88 A;  4KVM A;  1BCC J;  3C3Q A;  3I3N A;  1OWA A;  3AU4 A;  1N95 A;  1KD1 Q;  1NU1 E;  4GA1 A;  1UJJ A;  1N7S D;  3P8C E;  2Y3A A;  3HD7 B;  3RL0 D;  1BE3 E;  2C0L A;  3ASD A;  4HS2 A;  1G1J A;  3SFD C;  4B8C B;  5AW3 B;  2XRY A;  3CSF A;  3K5B A;  3RO2 A;  3G6E P;  5JJT A;  3FTU A;  3PZ2 A;  1DCQ A;  2L6J A;  4J8E A;  2RG8 A;  3UT4 A;  3UMV A;  2B87 A;  1PIX A;  1NTZ K;  4Q96 A;  1KB9 H;  2D2C D;  1AA0 A;  5ENN A;  5CJ4 A;  2WVR A;  3L73 D;  3S9O A;  2GA1 A;  4RG9 A;  3CLQ A;  4HI8 A;  3ULE G;  2YKO A;  1ZR4 A;  4J6I A;  4L76 A;  4IFF A;  3TDK A;  5JHB A;  4WNE A;  3ZIM A;  4FP7 A;  1KQG B;  4KBQ A;  5FIO A;  2AEJ A;  3P8M C;  3RK3 B;  4HOT A;  3PJS K;  3L75 D;  3UM2 A;  4Z1M H;  2LXM A;  2W90 A;  4EEC A;  1T6A A;  4EZJ A;  1LTS C;  1QVF O;  4R4M A;  3CX5 I;  2LAI A;  3CWB G;  1KB9 E;  1N73 A;  5CER B;  3NOC D;  2PGD A;  3ULQ A;  3KZI H;  1S9K D;  5ENS D;  4GYW A;  5AW0 B;  1QL2 A;  2N1T D;  2C0X A;  4BWN A;  2YKP A;  1DD4 A;  3FU3 A;  3Q73 A;  1HWT C;  4TLF A;  1GD2 E;  3ZYK A;  2B88 A;  1HJ0 A;  2M0B A;  4I17 A;  4N3C A;  5CEC B;  2PFX A;  2WXJ A;  2QJP B;  1T3U A;  1Q86 Q;  2E74 D;  3E7K A;  1TYQ G;  3PNL B;  1SW6 A;  3L36 A;  1HX8 A;  5CCM A;  2WPQ A;  4BTB A;  3UIN C;  1BDC A;  1L2P A;  1SQV K;  1NU1 D;  3U66 A;  4AEZ C;  2H43 A;  4I7Z C;  4CYM D;  1DNP A;  3L70 G;  1BDD A;  1JB0 J;  3V4Q A;  4ILH B;  1YBK A;  3H1J J;  2O1K A;  3SQV A;  4ANX A;  2A45 I;  4U8H A;  1VF5 D;  5CRU A;  1AJY A;  1IQR A;  2VTB B;  4H13 C;  3L75 J;  1UG3 A;  3G2T A;  3P7K A;  2YXR B;  1PFI A;  3BG1 B;  3I55 P;  3L73 G;  2NC9 A;  3CMA P;  2OTL P;  3SFX A;  1SQX D;  1K73 Q;  4GAA A;  4UB6 E;  4Y28 J;  4TUU A;  1NH4 A;  3G2S A;  4JPZ B;  2BUG A;  3CST A;  2IPP A;  4U7J A;  3L08 A;  3BCC G;  4J8D A;  2RMZ A;  5AVR B;  4GZD A;  4KYO B;  3OAW A;  2W6B A;  1SQQ G;  2WXF A;  3GF7 A;  3SY2 A;  2JJL A;  4NPD A;  1NI1 A;  3A5T A;  1KB9 D;  4I43 A;  2HE0 A;  4FU3 A;  2VRS A;  3D70 A;  5D66 A;  4DZO A;  4BER A;  4U04 A;  2EIJ E;  3ZUV B;  1OMI A;  4U95 D;  4E85 A;  4IYP A;  2NYJ A;  4H7X A;  1DD3 A;  1KTM A;  1EF1 C;  2MOW A;  3EU5 A;  2FYU K;  4HRN A;  1BCC D;  3UQ3 A;  4I6J A;  3L70 D;  4CT0 A;  3FUJ A;  1PP9 D;  4N3A A;  3KHU A;  3BVH A;  4DX2 A;  2LXL A;  3VLE A;  5ENQ D;  1KZU B;  3ZPJ A;  3II6 A;  3PLN A;  1JTH B;  1HTL C;  4BEP A;  2BCC E;  2WPV B;  4H0L D;  1DCE A;  3AS5 A;  1TN7 A;  2WXH A;  4UB8 E;  2WSE H;  4I2W A;  1TNB A;  4O6F A;  2J5U A;  2LO6 A;  3TXN A;  4ACL A;  3RSE G;  3AED C;  3QWV A;  3FFL A;  3CCM P;  2KAT A;  3DSU A;  4K5C A;  1KOR A;  5G04 C;  2HOD A;  1K04 A;  4RSY A;  3HE5 A;  2ETC A;  3TG4 A;  3A0H H;  5APU A;  2Y9Z A;  2Y0B G;  2D2C B;  3H1L G;  3V2P A;  1RF1 A;  4G25 A;  2P9L G;  3O6Q A;  1E8Y A;  2J08 A;  4G8L A;  3HXB A;  4QQI A;  3V6I A;  1UJK A;  1E8W A;  1HG5 A;  3LDZ A;  4N2S A;  5APW A;  1TJF A;  3CHM A;  5E76 A;  1QEX A;  1FBM A;  3ISM C;  4J8F A;  4IFD K;  1OIP A;  3VTX A;  4B8A A;  2UY1 A;  4GZ3 A;  3WG7 E;  2IYO A;  1ZME C;  3FUE A;  4UUC A;  4N3B A;  1JY3 P;  3HVE B;  3H1K G;  2EIL E;  4CGW A;  1RQV A;  3DST A;  3H1H E;  2H88 C;  1NAF A;  2C0M A;  2MJZ A;  1WMK A;  3T5X A;  4GTQ A;  2VTB A;  4GTP A;  3TWU A;  3PP5 A;  3ONL A;  3I5P A;  3QB2 A;  2R17 C;  2QJY B;  1HUC A;  1SFC A;  1IQU A;  5CCL A;  1LT9 A;  5KJL A;  3LY8 A;  1RF1 C;  2W6J H;  4JHR A;  2KZI A;  4P29 A;  3M06 A;  4XI9 A;  2KOG A;  3H1I E;  2P9I G;  2WVI A;  2IBZ G;  3CVP A;  1LNQ A;  3OJA B;  1T2K C;  4I6G A;  3LJN A;  3OA7 A;  3J5Q B;  3DPD A;  1J1D C;  2GUV A;  4RLY A;  5AVX B;  2BKK B;  2IBZ E;  1G2C B;  2KZT B;  2XZD G;  4EZK A;  3JCU E;  3FUK A;  3L16 A;  5AJD A;  2LXC B;  3FUD A;  1SQQ E;  5D0O D;  1Q81 Q;  1G1I A;  2O01 N;  5DBK A;  2R44 A;  1DVP A;  2QYJ A;  1JWG A;  3WU2 E;  3C9I A;  3FDH A;  5KBA A;  4V3I A;  2E75 B;  3V30 A;  4MKT A;  1K3Z D;  1NTZ D;  2AXT H;  5CBN A;  4LNB A;  5H2F H;  2A45 G;  1N73 B;  4MS6 A;  1XTC C;  2ZT9 B;  4KZ0 A;  1KV4 A;  3NFQ A;  5HRY A;  3NQP A;  4JYB A;  3QAR A;  3GMA A;  4K35 A;  1W2B O;  1X5B A;  1BLX B;  5KKZ C;  2OOE A;  1Z6T A;  2CPS A;  4C46 A;  3FWV A;  3CXH E;  5KLI B;  2H6H A;  3UT7 A;  4GML A;  3DXM G;  1URQ B;  1FU1 A;  1D8D A;  3H1K J;  2WIT A;  1FOS E;  3ZHE A;  3LID A;  2WQ7 A;  3H1H D;  4LGD E;  3R2P A;  3SD5 A;  2P9U G;  4YND A;  1BPO A;  1WDY A;  4EBA G;  2OGU A;  3CC2 P;  4G26 A;  3QAQ A;  1D9S A;  5FWQ A;  2LAH A;  4HFG A;  1HVV A;  1SP4 A;  2QC9 A;  5ENT D;  2NPS A;  1UN9 A;  1O5M A;  1FZE A;  4GTR A;  2WXN A;  2GRM A;  2M3B A;  1M1J B;  2X6F A;  1SQQ J;  1MYO A;  3M9Q A;  1FJP A;  2WWW A;  4B89 A;  2QSI A;  3L74 J;  1RHZ B;  1AVO A;  3FTS A;  2P7J A;  3EJN A;  2XKM A;  3G2U A;  1L0L J;  1H19 A;  2JEK A;  2CFZ A;  1BSH A;  1R8E A;  1P84 D;  4M3L A;  1MX4 A;  3UX4 A;  3VYI A;  1FDM A;  4XKC A;  3I4R B;  5KAF E;  3HG0 D;  2DIW A;  4IFM A;  1TNY A;  2ZT9 D;  1PPJ E;  4IL6 H;  1M8O B;  1FCH A;  4BSX A;  1GW4 A;  3H1L E;  5CCG C;  2AVP A;  2WSC J;  1PPJ G;  2YHC A;  3H1I D;  1RZ4 A;  4GYY A;  4LCT A;  3RAU A;  2V7Q H;  3G9R A;  1BI7 B;  4YTP C;  4A7P A;  4EI2 A;  1S0P A;  1SQP G;  3U9W A;  3F89 A;  5KNH D;  1SQV E;  3RKV A;  5EYL A;  1YMP A;  5CMZ A;  1NA3 A;  3CCL P;  3Q5R A;  1URQ C;  5M72 A;  2NPS B;  1K8A Q;  1A02 F;  3NMD A;  1L0L K;  1KQL A;  1PL5 A;  1M90 Q;  3OXG A;  3B13 A;  4JPS A;  2XND H;  4CPG A;  4DCK A;  4GB9 A;  2JWA A;  1VPC A;  4C0M A;  5C39 A;  3KAE A;  1LWU A;  3HE4 B;  4LSZ E;  2M5A A;  4HKZ H;  1GW6 A;  2G3A A;  2C2L A;  1QNF A;  4R7L A;  5JJ6 A;  3D71 A;  4K5B A;  4H13 D;  3MUD C;  3ML9 A;  2WPR A;  2ZXE B;  2Q5U A;  4D6T E;  1KYO E;  2YIU B;  1E7U A;  1FZA A;  1H8A A;  2GRO B;  2C0W A;  4Y99 B;  3B8E B;  3L70 E;  1SQB K;  4MLP A;  1BE3 J;  3VMA A;  3BUA A;  4DX7 D;  3OW2 O;  3TYY A;  4U8V D;  5LFA A;  3LJ3 A;  3AE6 C;  3Q9N C;  3Q75 A;  3AE7 C;  5APV A;  3HXD A;  1NU1 G;  2IY0 C;  3Q4A B;  3BQO A;  1H89 A;  2HFE D;  2KB7 P;  4TXR A;  2KI7 B;  1V54 E;  4G8K A;  2XZR A;  1B89 A;  3VLD A;  4U0Z A;  1HU3 A;  1NOH A;  2ZGD A;  3L17 A;  2XDJ A;  2Z5H A;  2YQ8 A;  2LSV A;  3V2X A;  5E75 A;  2V4L A;  3FGA D;  2E5T A;  3CWB E;  3FTW A;  4IL6 E;  3RIB A;  1IFJ A;  2IQC A;  3RU0 A;  2E0I A;  1JY2 P;  3L54 A;  2P2U A;  1VL2 A;  1H2T C;  4ZMD A;  3T5V A;  3KEZ A;  1CI6 B;  3U1C A;  2LXB A;  2OV8 A;  5HS0 A;  3SSU A;  4JEU A;  3FUM A;  5B5E E;  4KHX A;  3PUJ A;  2KS1 B;  2B89 A;  3D9H A;  1MUU A;  1HF8 A;  3AE9 C;  2F8Y A;  3KXD A;  4AV7 A;  3FH7 A;  1MKM A;  5JJ7 A;  5H2F E;  3ASO E;  2GRP B;  2FYU G;  3QJZ A;  1GL2 A;  3WUT A;  3TGU J;  5CCH D;  1JY2 N;  1L0N G;  1S72 P;  4GZC A;  4AXH A;  5AVZ B;  3CME P;  3MIW A;  5FZQ A;  3D9O A;  2KM4 A;  4I1M A;  4C7N A;  3FH8 A;  3AE2 C;  2UWJ E;  1FDI A;  1QLE D;  3S2A A;  1LTA C;  5TJH A;  1RF0 C;  3E32 A;  3N4X A;  2KLV A;  3LVQ E;  1IYG A;  4O60 A;  2FO1 E;  2Q7C A;  4HXI A;  5B3S E;  4O9B A;  4HB1 A;  2J07 A;  3E34 A;  5KJK A;  3EHM A;  1LTJ A;  3AG3 E;  2PM7 A;  3HVE A;  3QNK A;  2A06 D;  4WBA A;  3AG4 E;  4OVN F;  2M5A B;  2PQR A;  4L2L A;  5G55 A;  2J8S D;  1KYO H;  4HQD A;  4UI9 K;  3SWF A;  4EIJ A;  3SFY A;  4KT6 B;  5BW8 C;  1ZR2 A;  4IN3 B;  3ZW3 A;  1IFP A;  3NXS A;  4GDO A;  2LUH A;  1NTM G;  4U0U A;  2WPV A;  1SFC B;  4M7C A;  4CRW A;  4GMR A;  4DJG A;  2ZYG A;  1UIX A;  1ZW0 A;  3FP3 A;  5CMY A;  3UUX A;  1U7J A;  3IXE A;  1SQX E;  3PEV B;  3QDN A;  3H1H J;  1LD8 A;  2KNC B;  2HYN A;  3IV0 A;  4LEU A;  1E79 H;  3GZS A;  4GA2 A;  1OXZ A;  2Y0D A;  1MQS A;  4GYO A;  4GCN A;  1SVX A;  5BUZ A;  3FXD A;  3PZ1 A;  2WT7 B;  3PVL A;  1E90 A;  1VQ8 P;  1FZC C;  4HJG H;  3LPZ A;  2WQ6 A;  3FU0 A;  1N4Q A;  3L35 A;  3CCV P;  1M57 D;  1XTG B;  2VGY A;  3TWX A;  4GPM A;  2OAR A;  4JZY A;  4GPK A;  1H0A A;  3RRN B;  4GTS A;  1LD7 A;  3AAA C;  1N8R Q;  2QY7 A;  4U3F D;  1J1D B;  1R5L A;  1CI6 A;  4FLB A;  4F1S A;  3CVY A;  2Z4E A;  2ILR A;  3H1K D;  2GM4 A;  1SZ9 A;  5BNW A;  3HUS A;  3A7O A;  1LTB C;  3KD7 A;  1T3J A;  2XGO A;  3P1U A;  1EQ7 A;  3RL0 g;  3L71 J;  1RF1 B;  2QYU A;  1BCC E;  2XZT G;  3Q7A A;  4IOI H;  3H32 B;  2A06 E;  2BCC D;  1H6O A;  3WXX A;  3M0D A;  4C9B B;  3EQ2 A;  1SQV J;  2AW6 A;  4UWK A;  2JDI H;  2QA4 P;  1M7L A;  2MRI A;  2ZYA A;  1RE4 C;  2UY1 B;  1PGP A;  1MJ0 A;  4YDE A;  5BXO A;  3JUI A;  1PZQ A;  1EZV D;  2WQY C;  2E74 B;  3E1I A;  1N4S A;  1NTZ J;  3PE3 A;  3AE3 C;  1AV1 A;  4ACK A;  2IZ0 A;  3EFF K;  2OEW A;  5CCG A;  1S1C X;  4DX6 D;  3R9M A;  2EIK E;  4UWG A;  1GTW A;  4DX1 A;  2XV5 A;  2R59 A;  4JHJ A;  4A3T A;  3ZU7 B;  2XEH A;  4CCA A;  3H1L D;  3UPV A;  3CCJ P;  3CXH H;  1SA4 A;  4B0Z A;  1M1J C;  5HKP A;  1LT9 B;  2PNN A;  4OGQ D;  1Z3X A;  4GIF A;  5EX3 A;  3WMM 0;  1EZV G;  5C1D A;  3H1J G;  1RE3 A;  1H0T A;  3E37 A;  2YNQ A;  1ZU2 A;  4FC8 A;  1VQN P;  4GA0 A;  4GZ6 A;  2IOS A;  5KWD A;  2NSZ A;  2YNY A;  3Q5M A;  3QOU A;  3A2A A;  5APY A;  5KLI C;  3L6A A;  2FUL A;  1K1B A;  1SQB J;  2OVB A;  3MGB A;  3DSS A;  3BAS A;  3LS8 A;  4JQ0 D;  1G2C A;  2HPC A;  1TR4 A;  1OZH A;  1SQB E;  4Q69 A;  3TJP A;  4N39 A;  5CCG D;  3CVX A;  2IFM A;  1O1R A;  3CL3 D;  3CKB A;  4JD2 G;  4XZ4 A;  3FWN A;  2FYU D;  1P84 H;  4ZKU A;  1N0Q A;  5EIL A;  1GL2 C;  2OCC E;  3HRN A;  4RKU J;  2L91 A;  1NP7 A;  3G4S P;  1TJC A;  1BGY G;  3CCE P;  4W7Y A;  4WY4 A;  4U8Y D;  1N4P A;  1JY2 O;  1YHQ P;  1NO4 A;  1URQ D;  3Q5P A;  4B93 B;  5BVZ A;  3UI2 A;  3MGN A;  3FU5 A;  3MD0 A;  1INZ A;  1BGY E;  3H1H G;  3CC7 P;  5ENO D;  1EXI A;  2KCV A;  3ZGQ A;  1NTM J;  4AM9 A;  1KZO A;  2QVA A;  3L71 G;  1U3D A;  1OW6 A;  2KS1 A;  4H13 B;  1K9M Q;  4LER A;  3AEE C;  1SQB G;  2BKG A;  3VOP A;  4A63 B;  2FKW B;  2M63 A;  5JA4 D;  2KZJ A;  5FQ7 A;  3IN6 A;  2WXG A;  1PP9 J;  3ASG A;  4D10 C;  1U7M A;  3TL5 A;  3PZ4 A;  2IFU A;  1NA0 A;  3DBS A;  2V7Q J;  4WWO A;  1QGK B;  2CHW A;  1KIL A;  4FUL A;  2IOL A;  5EKQ D;  1X22 A;  5AVT B;  2X3M A;  2ZVN B;  2ZYD A;  2XNX A;  4WNG A;  3W68 A;  3S7F A;  2J59 M;  2ZXX A;  4PV1 D;  1N7L A;  5FIN A;  2D2C C;  3CCU P;  4GTO A;  3QH9 A;  3ZFW A;  1WRG A;  4H44 C;  3CCS P;  1DEB A;  4B86 A;  5G2N A;  1ZXG A;  1TNO A;  2HR3 A;  5APS A;  4K03 A;  2FYZ A;  4KZC A;  3D6Y A;  1BI8 B;  4GT1 A;  4BT9 A;  1EZV I;  1CZQ A;  3G2W A;  4O1P A;  2IFN A;  1VQ9 P;  1AQ5 A;  3L82 A;  1YIT P;  5AAO A;  2MKV A;  2E5Y A;  4W80 A;  2FYU J;  1DEE G;  2P9K G;  3MX3 A;  4LC1 A;  3RRM B;  5DJU B;  3JYS A;  3L75 G;  4HYT B;  3UM1 A;  4GTT A;  3AU5 A;  2OTJ P;  4DPR A;  3USS A;  1LTT C;  1PGJ A;  3KEA A;  3CK8 A;  3ZXS A;  1Z56 A;  2IO2 C;  3HYM B;  2RH0 A;  3WUV A;  1L4A B;  1HXI A;  1H0T B;  1X0T A;  3MYV A;  2F8X K;  3GW6 A;  3HE5 B;  2XGS A;  4UI9 J;  1BGY D;  4DOJ A;  1VDY A;  2AXU A;  2GW1 A;  2FYN C;  3NBN B;  1N9A A;  4XE0 A;  4OWF A;  1IFM A;  3APC A;  4D6T G;  4JF7 A;  1HH0 A;  3IR9 A;  5CCH C;  1GU4 A;  4RJT A;  1OUV A;  3E4B A;  2LR2 A;  3FUI A;  4Z68 A;  1SQB D;  4PS8 A;  2DYS E;  4AIF A;  1BU9 A;  1AWC B;  1ZBP A;  3ZVV A;  3L72 D;  5AYW D;  3CR3 A;  1VF5 C;  1HF9 A;  2V8S E;  5CBO A;  1L0N J;  2P67 A;  2K9J A;  2G8Y A;  1UOH A;  2H6F A;  1UW4 B;  2VSN A;  1IZN B;  3IHY A;  1EPU A;  1NU1 J;  3MCX A;  2EIM E;  2H89 C;  1EDI A;  4DT0 A;  4GOE A;  5AQ9 A;  3T9K A;  3ENE A;  2AEF A;  2J09 A;  5EFW B;  4GMJ A;  3BRV B;  1FZF A;  1FC2 C;  3H32 A;  2QJK B;  4PD4 E;  2RFA A;  1OWM A;  5DIZ A;  4N6J A;  4OVU A;  2Q9I A;  4N78 E;  3SBS A;  3RRU A;  3B5N D;  4I2L C;  3FTY A;  5EID A;  3L75 E;  3L73 J;  4HOR A;  2IYP A;  4WWN A;  4YXW H;  1G3N B;  3CQC B;  4NQ0 A;  3JUE A;  3C3R A;  3TWR A;  2WXM A;  1YQ4 C;  4N5Q A;  4BTA A;  1KC8 Q;  1SQV D;  2QEX P;  4L9P A;  2YXQ B;  3U59 A;  1S9K E;  4RES B;  4IUL A;  4D6T D;  3AEC C;  3D9K A;  1KQF B;  2YKQ A;  2PL2 A;  2IX7 C;  2EQX A;  2R05 A;  4DJA A;  3Q47 B;  5J08 A;  2Y0C A;  3C1L A;  1EDL A;  2R3S A;  3T97 B;  4RO0 A;  2H8P D;  4JVS A;  4BT8 A;  2W8Z A;  3RO3 A;  3HTK B;  3C98 A;  5KJN A;  5M1B A;  3FUN A;  2DYR E;  4ILI A;  2DWZ A;  1HGV A;  4OVV A;  3S4R A;  3B71 A;  4UB6 H;  5GTI H;  1SA5 A;  2BF0 X;  3ZNG A;  1OCC E;  1Y8M A;  2GRN B;  4TT3 H;  2XHE A;  3KPE A;  1KMI Z;  4U3F E;  1JTH A;  4H44 B;  2IDB A;  3PH0 C;  3AEG C;  5ITZ F;  2A4Z A;  1JUN A;  3D9I A;  1KYO D;  2ETA A;  3BCC J;  2X38 A;  2V5Q C;  2A45 H;  3L74 G;  4ATG A;  1AVY A;  2WXP A;  3CWB D;  4L2Y A;  2DVW A;  3L72 G;  1IO4 A;  1WY6 A;  4BSZ B;  1E5W A;  4ASV A;  3FY4 A;  1N11 A;  2QJK C;  4PS3 A;  3CVV A;  1QL1 A;  4JEH A;  2L0I A;  2O01 J;  2KZT A;  3A3Y B;  3MZW B;  1QBQ A;  2VSX E;  5LP0 A;  4HLL A;  2QRX A;  2V4H C;  4XIF A;  1SQP J;  1NTM D;  3Q15 A;  2CG3 A;  2WXK A;  1GK6 A;  4YDO A;  2JKV A;  1CW5 A;  3ITK A;  4ASW A;  3H25 A;  3MJW A;  3SFZ A;  1L5J A;  3QK0 A;  2R02 A;  4NPF X;  2Q7F A;  3CGH A;  4U3F G;  4H7Y A;  3FTX A;  3C5R A;  1IK9 A;  2K9J B;  3TGU D;  2OEV A;  3UIP C;  1NTM K;  2KC7 A;  2R03 A;  1KIL B;  5KLV K;  1R5S A;  2WMN A;  3C72 A;  3TWQ A;  3Q2Y A;  4EQF A;  5BV0 A;  1GZL A;  1SQP E;  2ZFC A;  3SBT B;  4JHK A;  5FZS A;  1MX6 A;  3AE5 C;  1YA0 A;  2YMK A;  4ANU A;  3B7B A;  4WVZ A;  4HBD A;  3GHG A;  3PZD A;  5KCM A;  5KJM A;  2KNC A;  1LTX A;  1T2K D;  2Y4T A;  3A0B E;  4GOD A;  1YCS B;  3LIE A;  2Q3I A;  3CHO A;  3O48 A;  2E43 A;  3AJI A;  1KB9 I;  5EIB E;  5CED B;  2XPI A;  1DC2 A;  2WPS A;  4PDX A;  4YVO A;  2FFD C;  3DWL G;  5KJ7 D;  4WB4 A;  2C9N Y;  3ONK A;  1HE8 A;  1YYH A;  1N2D C;  3JSV C;  3EIQ C;  2SPZ A;  3JCK C;  4ZFH A;  3L74 E;  3DEO A;  4BWR A;  1PY1 A;  3S7J A;  4N3Y B;  2CHZ A;  3LW5 J;  3LEW A;  3PEU B;  1SQM A;  5D2M C;  1OW8 A;  3LW5 H;  1JPL A;  3PTZ A;  1J2J B;  3LY7 A;  1MZ9 A;  3V5B A;  2A5U A;  4JB8 P;  1QX8 A;  4Y99 C;  5AVV B;  3B5N B;  5KLV E;  3L71 D;  5BXU A;  4HOS A;  3TXM A;  2KCK A;  1S5L H;  1KZP A;  2XEV A;  1TU3 F;  2YIU C;  3FU6 A;  2QE7 H;  4YDY A;  2RN0 A;  5ENP D;  1KIL D;  2OYO A;  4ZNC A;  1LT1 A;  4U3F J;  2W6A A;  2Y1L E;  3HXF A;  3KSL A;  3QKY A;  3PHL A;  1ZRT E;  2CK3 H;  2WMM A;  1W2E A;  2J58 A;  5FT9 A;  3ZHE B;  2ETB A;  5LX8 A;  4FAD A;  5LOZ A;  3FX0 A;  2FXO A;  2QZA A;  2E76 B;  1IHG A;  4JA9 A;  3LXU X;  4XE5 B;  5E79 E;  5BV1 A;  5E79 H;  5GTI E;  3CPW O;  3TWS A;  2Q6Q A;  1KIL C;  2K37 A;  3CXH I;  4MRU A;  5A6C A;  2LKM A;  3FUF A;  2PP6 A;  2W27 A;  1NTM E;  1Q7Y Q;  1FVF A;  2CPB A;  2FFD A;  3URZ A;  3GHG C;  1S2E A;  5AW2 B;  2YO2 A;  4OAV B;  3TNU B;  1JY3 N;  2I1J A;  3HIZ A;  3NB2 A;  5B1A E;  5B66 E;  1JMB A;  1YTZ I;  3LYA A;  3FXE A;  4GTV A;  3ZXP A;  1EZV E;  1Z5S C;  2P9S G;  3FEY A;  3GZ1 A;  1NVO A;  5AEN A;  1FT2 A;  2WSC H;  3JC2 2;  3SZ7 A;  2YO3 A;  4A55 A;  2N9Y B;  3DEP A;  2KXP B;  4APF A;  2V5F A;  2ZU6 B;  2VJ8 A;  3LCA A;  1LF8 A;  5B1B E;  4BFR A;  1YYC A;  3S7D A;  2AJA A;  1S5L E;  2FI7 A;  4G23 A;  2WXO A;  2WM9 A;  1L0L D;  2MHK A;  1VQP P;  3RK6 A;  4BX8 A;  2P1J A;  1LTI C;  5EX0 A;  4FA6 A;  3D6Z A;  4MN4 C;  3MP7 B;  3PRZ A;  1YTZ T;  1VQO P;  1IXV A;  4NIK A;  3IAO A;  1FS0 E;  1SQQ D;  5K5G B;  5FTP A;  3V79 K;  2P10 A;  3MHV A;  4JC8 A;  1ZLL A;  2OVF A;  1KFM A;  1T8Z A;  3BCC D;  1SZA A;  2PZI A;  1NKZ B;  1NTK D;  5AW9 B;  3L72 E;  2GUS A;  1OXJ A;  1GU5 A;  1DH3 A;  2RFM A;  4OH8 B;  1ZRT D;  1U57 A;  2L0T B;  2C9L Y;  2CHX A;  3QWO C;  3CHR A;  3M0D C;  1LWU B;  4YVQ C;  5BT1 A;  1USE A;  4IL6 X;  2JAB A;  2FBW C;  2DBA A;  2R5D A;  4PJ0 H;  2ZJS E;  4WND A;  1OVV A;  1GK4 A;  1UII A;  2JO1 A;  1ZV8 A;  1H2U A;  3R7R A;  3H6P A;  5AVS B;  5AVW B;  1KT0 A;  1E7V A;  3M0A A;  1HG2 A;  3ZYQ A;  3FTV A;  1NU1 K;  1N4R A;  1FT1 A;  5APT A;  1OWN A;  1YIJ P;  1N52 A;  1MV8 A;  4IRU A;  1N54 A;  1N7S C;  2P2C P;  3L13 A;  3HHM A;  1BD8 A;  3RL0 C;  1K8K G;  2ZXW E;  4NUR A;  3SF4 A;  3TWV A;  3GZ2 A;  3TGU G;  5KAF H;  1KYO I;  1H2V C;  5AW4 B;  3VP8 A;  1YJ9 P;  2FY8 A;  2VGX B;  3N71 A;  5HI7 A;  1S4X A;  4EYY Q;  4APO A;  5AQB A;  2Y0E A;  4YXD C;  1NJI Q;  1OT8 A;  2WQH A;  5AVY B;  1N86 A;  5GTH H;  4EDF A;  1IFD A;  1HS6 A;  2I9C A;  4HH2 A;  3IBE A;  2Q3E A;  4U07 A;  1KQS O;  2YHE A;  3MEK A;  3M91 A;  1LTJ B;  2JWD A;  3GHG B;  4L7T A;  5JMN D;  3EHN A;  3HRA A;  2A06 G;  4AUW A;  4U0S A;  2JLB A;  5APX A;  3PE4 A;  4C0E A;  2IF4 A;  1EDJ A;  2FXP A;  1L0N D;  4I6M C;  4Y6C A;  5AQA A;  1IHB A;  3U64 A;  3MKR A;  3FHE A;  4URK A;  1NTK E;  2IJG X;  1IFN A;  4F1P A;  2XS8 A;  4ATZ D;  1Q2N A;  2J49 A;  2N1T C;  4OAU C;  1QYM A;  3EHR A;  2F37 A;  1L0N K;  3TGU E;  5AW6 B;  1VQ6 P;  3SHF A;  2Y9Y A;  2Z5I A;  4Q94 A;  2LNI A;  1U2V G;  1RE3 C;  2J4D A;  3NTN A;  3Q5S A; 
#chains in the Genus database with same CATH homology
 4K35 A;  5K5G B;  4O1P A;  4HB1 A;  1EDL A;  3EU9 A;  3NOC D;  4K5B A;  5ENR D;  3ZU7 B;  2XEH A;  3V79 K;  3Q9U C;  3MHV A;  5ENS D;  1BLX B;  5AAO A;  5EYP F;  2ZGG A;  5CEA A;  1AP7 A;  1DEE G;  1YYH A;  2M5A B;  5HKP A;  2DWZ A;  5DJU B;  2PNN A;  4CZ2 D;  4DX5 D;  2P58 A;  2SPZ A;  2B88 A;  3B95 A;  4K5C A;  2J8S D;  1IKN D;  4ZFH A;  4HQD A;  2M0B A;  2RFM A;  3DEO A;  5DJT B;  5CEC B;  2ETC A;  3KEA A;  3W9G A;  2OTK E;  3ZNG A;  4LNU D;  4DX7 D;  1EC5 A;  4F6R D;  2Y0B G;  1H0T A;  1SW6 A;  4U8V D;  3QWO C;  2KIK A;  3Q9N C;  5KWD A;  2M5A A;  4U96 D;  4C48 B;  4HNA D;  2XEN A;  5CER B;  4JB8 P;  5ITZ F;  1BDC A;  2DZN A;  4G8L A;  1MX2 A;  2JAB A;  1H0T B;  1WDY A;  1X0T A;  4QQI A;  4ZHB A;  2F8X K;  4GMR A;  1OVV A;  1K1B A;  5AN8 A;  4DX1 A;  1S70 B;  2ETA A;  1ZW0 A;  4JBZ A;  4CYM D;  5BXU A;  1BDD A;  1U7J A;  3IXE A;  4LG6 A;  1S3J A;  2KI7 B;  2V5Q C;  2KBX A;  1D9S A;  2K3R A;  1N0R A;  4HRL A;  1TR4 A;  5AQ7 A;  4G8K A;  2QC9 A;  1NFI E;  2MYO A;  5ENT D;  3NBN B;  2DVW A;  4UUC A;  2ZGD A;  2KUB A;  3UXG A;  3T8K A;  4BSZ B;  4ASV A;  1N0Q A;  1N11 A;  4J7W A;  5EIL A;  4NPE A;  1SVX A;  3J5P A;  3PH0 A;  4ZNC A;  1JM0 A;  2P2C P;  1LT1 A;  2Y1L E;  1BD8 A;  2LR2 A;  4HB5 A;  5ENP D;  4K3A A;  3FXD A;  4U8Y D;  3SO8 A;  4Z68 A;  4WWI A;  2WMM A;  3MZW B;  1Y47 A;  1MYO A;  4B93 B;  3UI2 A;  4HJG H;  4HLL A;  2ETB A;  1LP1 A;  2QRX A;  1BU9 A;  1AWC B;  3TWV A;  2V4H C;  3TWX A;  1EDK A;  4J8Y A;  3TWU A;  4GPM A;  5CBO A;  3F6Q A;  5ENO D;  5EN5 D;  2A5E A;  1UOH A;  4ZMD A;  2VGE A;  2L6B A;  2B87 B;  4O1O A;  2QVA A;  4YDW A;  3TWS A;  4ASW A;  2LXB A;  3EHQ A;  3AAA C;  2B0O E;  2BKG A;  5HS0 A;  4KJM A;  3S1K A;  4EYY Q;  4A63 B;  4NPF X;  1EDI A;  5JA4 D;  2KZJ A;  4GOE A;  1MX4 A;  2KZI A;  5AQ9 A;  5AQB A;  3T9K A;  3C5R A;  2KS1 B;  1DCQ A;  1OT8 A;  3TWT A;  4QFV A;  4DUI A;  1OY3 D;  2XEE A;  2B89 A;  2B87 A;  4OAV B;  5EFW B;  3D9H A;  3HG0 D;  4GOF A;  5KNG A;  2F8Y A;  4NPD A;  1FC2 C;  2KXP C;  1U7M A;  2HE0 A;  2RFA A;  3TWQ A;  3LJN A;  1JMB A;  3J5Q B;  2RKL A;  2I8D A;  5D66 A;  2XZT G;  4BER A;  1A5E A;  4RLY A;  3FXE A;  3TWW A;  3ZUV B;  2BKK B;  4IOI H;  2JWD A;  5JMN D;  4DRX E;  2XZD G;  1MX6 A;  4U95 D;  4BET A;  1NVO A;  2NYJ A;  3HRA A;  3NOG D;  2Q1K A;  2LXC B;  1BI7 B;  3JXI A;  4HI8 A;  5EID A;  3B7B A;  5KNH D;  4HBD A;  5EYL A;  3V2X A;  4BES A;  1YMP A;  3DEP A;  3JXJ A;  1G3N B;  1K1A A;  1EDJ A;  4K5A B;  1OVU A;  3V2O A;  2R44 A;  2QYJ A;  1MJ0 A;  1IHB A;  3JUE A;  4HI9 A;  4HRN A;  5AQA A;  5FIN A;  1MFT A;  4GOD A;  2AJA A;  5AAR A;  3TWR A;  1YCS B;  5BXO A;  5CED B;  4F1P A;  5FIO A;  3ZKJ A;  5KBA A;  2UWJ E;  4TUM A;  1OVR A;  4ATZ D;  4N5Q A;  1Q2N A;  1SS1 A;  3V31 A;  4BXL A;  4CPG A;  1ZXG A;  2DZO A;  3V30 A;  1QYM A;  3EHR A;  3W9F A;  2F37 A;  5ENQ D;  1K3Z D;  4DX2 A;  4OAU C;  5CBN A;  2HR3 A;  5C39 A;  4DX6 D;  3RGU A;  4NIK A;  3UTM A;  4BEP A;  2ZAE B;  3AJI A;  4MN4 C;  4YDY A;  4LSZ E;  5HRY A;  1LP1 B;  1BI8 B;  1WG0 A;  4HKZ H;  4O60 A;  5EIB E;  2FO1 E;  3ZDM A;  4HRM B;  1IXV A;  1DC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...