5CBOA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
molecule keywords mbp3-16,Immunoglobulin G-binding protein A
total genus 55
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cboA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cboA01
4HB1A 2QC9A 3NOCD 4GPMA 5AAOA 2V4HC 2QVAA 4NPEA 4K35A 1IKND 5HRYA 4K5BA 4K3AA 3Q9UC 4K5AB 4DX2A 3B95A 1G3NB 2ZAEB 1MX6A 2BKGA 2DZNA 2Y0BG 2NYJA 1AWCB 2DWZA 5FIOA 1EDLA 3JUEA 3UI2A 1K3ZD 4DX7D 3LJNA 2XZDG 4ZFHA 4LG6A 5ENOD 2ZGGA 5HKPA 2ETAA 2V5QC 3ZU7B 2A5EA 5EN5D 2VGEA 3RGUA 4HI9A 2SPZA 5CEDB 1BI7B 2JABA 1N0RA 3DEOA 4U8YD 4HRNA 2ZGDA 5EIDA 1QYMA 1N0QA 3KEAA 4U96D 3W9GA 4BXLA 1S3JA 5ENQD 5KNHD 5EIBE 5ITZF 2PNNA 1DEEG 2LR2A 4DX6D 3AJIA 4OAVB 1DC2A 2QYJA 4BETA 5C39A 4G8KA 4UUCA 5CECB 3TWTA 1K1BA 1BD8A 3JXIA 4DUIA 2KIKA 1JM0A 2P58A 1OY3D 2XZTG 1OT8A 5BXUA 1MX4A 3V30A 5KWDA 2R44A 3EU9A 1MX2A 1H0TA 3TWQA 2K3RA 2RFMA 4YDYA 3TWRA 1BU9A 1SS1A 3V2XA 1MYOA 4O60A 2ETBA 3QWOC 5KNGA 3UXGA 4BERA 1D9SA 2M5AB 3ZNGA 1LP1A 2KI7B 1LP1B 2MYOA 3T8KA 2M0BA 4O1OA 2DVWA 2I8DA 2HE0A 3B7BA 4BSZB 2KZJA 3ZDMA 1A5EA 4NPDA 4HKZH 1OVVA 5ENPD 5ENTD 3JXJA 4U8VD 1MFTA 4ZNCA 1WG0A 4IOIH 4KJMA 3J5QB 3TWXA 1BDCA 4B93B 3AAAC 2DZOA 2QRXA 3DEPA 2BKKB 3MZWB 5FINA 3TWVA 4BESA 1TR4A 1JMBA 1DCQA 2KBXA 3Q9NC 1EC5A 1BDDA 1EDIA 2UWJE 1Y47A 2XEHA 1SW6A 1YCSB 3EHRA 4G8LA 4DX1A 1EDKA 4RLYA 4K5CA 3V31A 4F1PA 4ASWA 1LT1A 4WWIA 1U7JA 2XEEA 5EILA 4Z68A 5EFWB 1BI8B 2KXPC 4HBDA 4HRMB 1K1AA 4N5QA 1Q2NA 1YYHA 1ZW0A 1WDYA 2F37A 1AP7A 2JWDA 3F6QA 5CBOA 4LNUD 5D66A 1X0TA 4OAUC 3UTMA 4CPGA 4MN4C 1BLXB 2B88A 2P2CP 4HI8A 3J5PA 5K5GB 4CZ2D 2B0OE 3W9FA 5DJUB 5ENSD 2B87A 4GOFA 3TWSA 4ASVA 3S1KA 2KZIA 4HB5A 4HRLA 4TUMA 3HG0D 4QQIA 5AN8A 4HLLA 4JBZA 1H0TB 5AQ7A 2XENA 5EYPF 5KBAA 3PH0A 3T9KA 3ZKJA 3V79K 5ENRD 2KUBA 3FXDA 3IXEA 2OTKE 1SVXA 5AQAA 4BEPA 1OVUA 1NVOA 2B87B 4O1PA 1NFIE 5CEAA 3EHQA 5BXOA 4A63B 4GOEA 2LXBA 5CBNA 3C5RA 1IXVA 5AQBA 4HNAD 4C48B 4NPFX 5AARA 2RKLA 2FO1E 4ZHBA 2AJAA 5JA4D 4J7WA 2ETCA 2RFAA 1YMPA 4HQDA 3TWWA 1MJ0A 4J8YA 3SO8A 2KS1B 2WMMA 2LXCB 4JB8P 4NIKA 1OVRA 2L6BA 3TWUA 5EYLA 2Q1KA 2J8SD 1ZXGA 4HJGH 3V2OA 5CERB 5AQ9A 2F8XK 5JMND 4ZMDA 2B89A 5DJTB 3NBNB 4U95D 4F6RD 4EYYQ 1S70B 4ATZD 4GODA 3HRAA 1EDJA 1IHBA 2Y1LE 1N11A 4LSZE 1FC2C 2HR3A 2M5AA 2F8YA 3NOGD 4YDWA 3ZUVB 4DRXE 4DX5D 1U7MA 3FXEA 4CYMD 4QFVA 5HS0A 3D9HA 1UOHA 3MHVA 4GMRA
chains in the Genus database with same CATH superfamily
2QC9A 3NOCD 1N4QA 1MUUA 4R7LA 2I9CA 1FBMA 2BKGA 1YTZT 2P2UA 3TGOA 5LFAA 1R5LA 2IBZI 3PRJA 2F0YA 1L4AC 5AW4B 1FZGA 3GZSA 5GTIH 4F7AA 4IFDK 2XS1A 1ZRTE 1KD1Q 2KM4A 3CVVA 3DEOA 5KAFE 5JHBA 4U0UA 3UKUG 4JYBA 2OYIC 1LJ2A 3VMZA 3S7BA 1K1BA 3NFQA 3Q5SA 2ITAA 3EU9A 1J1EB 1N73B 2CG2A 3FWLA 3HDXA 1EZVG 1MYOA 4L76A 3WUTA 1KB9I 1LP1B 1GDTA 2OCCE 1TU3F 4Y99C 1IFMA 3AG4E 4DX7D 2W83C 3E1RA 3MA5A 1GU4A 1UIIA 3SBTB 3HE4A 1TR4A 3CCQP 3CCSP 3Q7AA 2N1TD 2KBXA 2XHEA 1Q81Q 4RLYA 3WUVA 1VQ9P 5ANLA 3L70G 4Z68A 3TGUE 1QBQA 1IK7A 3BRVB 1BLXB 4Q94A 3P8MC 3U1CA 1BGYD 1GK4A 3QWPA 3VLDA 5H7PA 3MGNA 5FZSA 3FU6A 4N2QA 2N1TB 3MGBA 1M90Q 4WB4A 1SVXA 3RK6A 2ZYDA 3DPDA 3EHQA 1KYOD 2I1JA 1KQFB 1IXVA 1R5SA 4GZ3A 3B7TA 3ML9A 5JA4D 4J7WA 3KYQA 4HQDA 4DJAA 4KYOB 4JB8P 2XGMA 2N9BA 4GZDA 2F8XK 4C0EA 1CSBA 2FYZA 5AIJA 1L4AD 3HRAA 3TNUB 4TLFA 2BTDA 1S2EA 5B5EE 1FC2C 2M5AA 3NOGD 3L6AA 2V7QH 3FXEA 3H1HD 3V2RA 1FJPA 2EIME 3V31A 4YXDC 3DSTA 2GUSA 3SFXA 1OX3A 3FUHA 1RHZB 1AWCB 4J8SA 3FUJA 2CK3H 3P8CD 2GW1A 4WY4C 3WXXA 3KSQA 5KJ7D 5EN5D 2GGFA 3RGUA 4HI9A 3R9AB 3DBSA 5BPPA 3FUIA 1KT0A 2ZGDA 4AOFA 3MUDA 4LEUA 3KZIE 4BETA 4GA1A 1ZR4A 1YQ3C 2QM7A 2C0XA 3FTUA 4DUIA 2C0MA 1JM0A 1UJJA 1O1TA 3H1JG 2GRLA 3UINC 3HTKB 1NP7A 1SQBK 1MX2A 3TWQA 3OTNA 4FC8A 2PZIA 2X6HA 2HYNA 1HWTC 3F5HA 2KI7B 3O48A 4F53A 5JJ7A 4PJ0E 2PAJA 4KZCA 4B93B 1BDCA 5KAIH 3TWVA 2D2CD 1NTZE 3AE3C 1GTWA 1SQXE 4W7YA 4G8LA 2DYRE 2E42A 4G1TA 4F1PA 2I6HA 1HGZA 1QEXA 1ZBPA 3UIAA 3RBXA 1HVVA 2X38A 4LNUD 4IULA 2H89C 1KILB 3ULYA 3SBSA 3W9FA 1P5QA 3CSTA 4JPSA 2YIUB 2KZIA 5B66H 3E30A 2VGYA 4HRLA 4MLPA 3SFDC 3ZGQA 1U57A 2J4DA 5AW9B 4JBZA 4PV1D 1X79B 3AEEC 4YDOA 2KNCB 1H2TC 3I4GA 2HFED 1D7MA 1Q90D 1EZVI 2IFUA 3BCCE 1S64A 3ULEG 2H6FA 2YQ8A 1EZVD 2RKLA 3M9BA 2WTYA 1UIXA 2BASA 2JDIH 2ETCA 1SQPE 1HE8A 4J8YA 1SP4A 3M0DA 4GYYA 1Y8AA 3UM1A 4GU5A 4HJGH 1DX7A 1JCCA 2Y4UA 3ZYKA 4U95D 1L0LD 3Q5MA 2H6GA 2QJYC 1IHBA 1HJ0A 1H2UA 5EX3A 3CGHA 4IFFA 1VQLP 5APTA 2KK7A 3R7RA 1SQPG 3KS2A 3L74E 1SFCD 4I2LC 3EFGA 1FAVA 3CCMP 3DSXA 3IEGA 3FEXA 1SQXK 4PS7A 4D6TE 1L0LK 1LGHB 1LT9B 2ZVNB 5AJDA 5ITZF 1U3DA 3SHFA 2PNNA 2OTLP 3K5BA 3L72D 3AE4C 1JY2O 1QGKB 3L75D 4I9EA 3O6QA 1H6PA 2E75D 1VQ7P 2YO3A 1G1IA 5AW7B 1LTJC 2RD0A 4HYTB 2CHXA 1SS1A 4EOTA 4DJGA 5KJKA 1D8EA 5H2FE 5T4YA 1S5LE 1W5CE 3CMEP 2WSCJ 1E8YA 2MYOA 2IFNA 3T8KA 3RKVA 1BGYJ 1A5EA 3D9KA 4N3AA 3EFFK 1WY6A 3JXJA 3EHMA 3T97B 2FXMA 4IOIH 3IAOA 3Q79A 4P29A 3FX0A 2WSCH 1P84E 2YHEA 3BEEA 3TSIA 1YCSB 4ZKPA 1INZA 5IY5E 2OQQA 1BI8B 4HBDA 2W6BA 1NTKD 2Y0DA 2WVIA 3RK2B 3G2SA 2AXZA 3L70J 2WPRA 2YNQA 1SQXJ 2IO3C 4GZ5A 4NRHB 1YITP 3W67A 2WQYC 1N7SA 2Z5HA 3ASNE 2XENA 3I5PA 4CEMA 2KUBA 1O5MA 1VL2A 2Z5IA 1RE3A 2P9SG 1SQPK 1GD2E 3ZEFA 5AARA 5ARGA 2EILE 2AXTH 1FOSE 1DD4A 1YMPA 3SO8A 2Z4EA 2L6BA 4GB9A 1S0PA 2IF4A 1Q82Q 3MUDC 3ASOE 2FY8A 3CVXA 5LOZA 3QDNA 2KYVA 1S9KE 5KLVD 3JQ1A 1M57D 4AY5A 2Y9ZA 1M56D 2OYOA 3RU0A 1LNQA 4JYCA 1VDYA 3UM3A 1OCCE 1QNFA 4DLQA 4GA2A 4EI2A 1OZHA 3ASGA 3EDTB 1N86A 4K3AA 2H6HA 3OXLA 2Y9YA 1TYQG 4YVOA 4L2LA 5CCMA 4OYSA 1URQC 3DSSA 4HXIA 2XRZA 3JUEA 3FEYA 4ZFHA 2LAIA 2H88C 3CVPA 4GAAA 3CVQA 1KB9H 2SPZA 4ME2A 2GRPB 4AQRD 2WXFA 3H1JJ 4H44B 3HYMB 3Q49B 4GTOA 1PPJG 1S3JA 4BXLA 5G05J 3CMAP 3HE5A 2LR2A 1NTME 1SQQE 3E32A 4OGQD 5FWQA 4EECA 2IY0C 2QIWA 2O3JA 5A6CA 4TXRA 2IQCA 4TRQA 4BX8A 1H0AA 3JXIA 2C0LA 2XZTG 4MRUA 1YTZI 3CCRP 3AEFC 1SFCA 2B9BA 3VMXA 3TWRA 1HBWA 2I1KA 3DPYA 4YXWH 5KKZB 2M3BA 5CMZA 3UXGA 2A06D 3URZA 2W8ZA 2M0BA 3AEBC 1PZQA 2QA4P 4RESB 2XDJA 3E1IA 3SWYA 4UI9J 1N9AA 4KJMA 3MD0A 4A7PA 4GCNA 4JHRA 4LERA 2QJPC 1M1JA 1FDIA 4K03A 2XEHA 4A3VA 2P9KG 2W27A 3M91A 1U7JA 3UMVA 4FADA 4MS6A 1YQ4C 4N5QA 1ZW0A 4KHXA 5APYA 4AM9A 5EDSA 5CBOA 4DI4A 2QFCA 1YYCA 2FXOA 3HD7B 4HI8A 1RW2A 3G4SP 1JCSA 4KVOA 1M1KQ 2I2OA 3ZRHA 4UB8E 2B87A 2OTJP 3KSLA 2BUGA 2X3MA 2WXJA 5BUZA 1L0NG 3SD5A 5CCGD 1LTBC 1RF1A 3D9LA 3Q75A 3CK8A 1TNBA 4XZ4A 3FXDA 3ZYMA 2W6AA 1TN7A 1E8ZA 1IQRA 1LTIC 3B5NA 4N3BA 1URQD 4E85A 1G1JA 3AEDC 3P1UA 3ML8A 5J90A 1E8XA 1VQ5P 2LXLA 3RJVA 2J4BA 1T8ZA 4OWFA 4LGDE 3BQOA 4UWKA 3A3YB 4N2SA 2E5YA 3C1LA 4WY4A 1UG3A 2KOGA 3UUXA 3ITKA 1W3BA 3V6IA 4N39A 2WXIA 1IFDA 1DIPA 4GZ6A 1EDJA 3WU2H 3DXMG 2Q3IA 3A0BH 3CK7A 4RSYA 2LSVA 2WMOA 2VTBA 3RL0C 4F3VA 4BT9A 4N3YB 3IHYA 4F1SA 4GPMA 1J2JB 4BTBA 2QVAA 2AW6A 4UWGA 1KQLA 3A0BE 2GRQB 1VQOP 3B95A 4C7RA 1G3NB 2OEVA 2E74D 3BVHA 3OW2O 1GK6A 4FULA 3OAWA 2XQ0A 2IZ1A 3L75G 4AV7A 2DCPA 1SA4A 5HKPA 3ZU7B 5JJ6A 1OIPA 2VGEA 3A5TA 1SQBG 1SQBD 2J09A 1QYMA 3KEAA 1N54A 2FYNC 1FZCB 3HXBA 2KCVA 5G55A 4CDNA 2XZRA 4I7ZB 2IU1A 2HPCB 4G24A 3MKQA 4ILIA 2ETBA 3D70A 1LP1A 1BGYE 1NTZG 4H0LB 3SWKA 3ZDMA 2A5UA 2XCCA 1TN8A 4XX5A 3L82A 2R02A 3HUSC 1DEBA 4EIJA 2DIWA 5CCLA 2UWJE 1FDMA 3PEUB 4ANXA 3ABKE 1JUNA 3P2BA 4K5CA 4A55A 1JY2N 3H1HE 4ASWA 5EILA 4U0ZA 2E75C 4UI9K 1YHQP 1Y9BA 5C1DA 3LDZA 3AE9C 5CRVA 1N8RQ 4GCOA 3CX5H 5DJUB 4TXPA 2RMZA 3IR9A 1RQVA 3D9NA 2PRRA 4HB5A 5AVWB 3AE5C 3TYYA 4APFA 4OAUC 3H1LJ 1HJBA 5KBAA 1HU3A 2E76B 5ENRD 4XE0A 4FJYA 2FFDA 2WPVA 4UB6H 3AU4A 3ENEA 3D9IA 1L0LJ 2KB7P 2PM7A 2QZAA 1L0NK 1N7SD 3CHSA 3TXNA 2VSOE 3TWUA 5KAFH 3HXCA 3CWBJ 3RK2C 5CERB 3D9OA 5AQ9A 4ZMDA 3PVLA 1QVGO 5FZQA 4WAFA 3GF7A 3TG4A 4YDWA 2NPSC 1N11A 3V2OA 2F8YA 3UT7A 4BTAA 3VTPC 1XNFA 3ZUVB 5APXA 2ZXEB 1TEZA 3BCCJ 3L71G 4I2WA 1N95A 4XEIG 3X2QE 3RAUA 2EIKE 2G8YA 4GTTA 5T3RA 2XPZA 2YMKA 1OW6A 4NPEA 4K35A 4DX2A 1TNUA 2OYIB 4N3CA 1N52A 3BUAA 3ISMC 5E76A 4GTVA 1Z3YA 2V5QC 2UY1A 3HHMA 4J0UA 2R5DA 1TNOA 4R4LA 3ZPJA 3GZ1A 1FZCA 1J1DC 2KZTA 5LP0A 3RO2A 2VJ8A 5CECB 3BU8A 3IHVA 3TF5A 2FI7A 2Y69E 1BD8A 3HVEB 3MP7B 2GRRB 3L37A 3CWBE 3C9IA 4U0SA 2NPSB 4KT6B 2E0IA 3RRUA 3QK0A 5APQA 3RK2D 4HOSA 1IHGA 3CI9A 2IDBA 1VQKP 3JUIA 3G2TA 1HUCA 1OMIA 5FINA 2RG8A 4BESA 3QAQA 2V7QJ 1L0LE 1SVFA 2WXNA 2BCCJ 1K73Q 3EUVA 4UB6E 3U64A 2X6KA 3AG2E 1Z56A 4HOQA 1KZOA 2WXOA 4EZLA 1NTZK 3SFEC 2WQHA 3I3NA 2WSEH 1PPJE 1K8AQ 2KXPB 1NTKG 3B5ND 3KHUA 4L73A 1XTGB 4JEHA 1QX8A 3J5PA 2Q7CA 5AJLA 3CHPA 1TN6A 4Y6WA 3RL0D 5BVZA 2QM8A 3JYSA 2EIJE 1SQQD 2IYOA 1KB9D 2KCLA 2K9YA 1PL5A 1LF8A 2WZ7A 2LSUA 1NTKK 2OTKE 3LY9A 3CVLA 4JVSA 3Q78A 5CEAA 4JL0A 4ABNA 3USSA 1SQVJ 4GOEA 2DYSE 2PGDA 3CCLP 2DBAA 1NGMB 3C5RA 1KN7A 1D8DA 5AQBA 4C48B 1IFJA 4UQZA 2FO1E 3ONKA 3CHRA 2XNDH 4RVBA 1FT2A 1KILD 1CI6A 1PGJA 2P58C 3D3MA 3ZHEB 1HH0A 3LIDA 1H19A 2M63A 4HH2A 4CGWA 2JP3A 4H44D 4DOJA 3HXEA 3QNKA 1SQQJ 4PV1B 1AQTA 4LC1A 5AVVB 2J9QA 2W6JH 4CDMA 3BATA 4IFMA 4GMRA 4U07A 5AAOA 1S4XA 3L54A 3B7RL 2WSEJ 5HRYA 1KLXA 1JTHA 4EBAG 2GRNB 3PRZA 1MV8A 5KLIB 2XZDG 3SZ7A 1AV1A 1JB0J 1JY3N 2ETAA 1JY2P 3Q5RA 3H1IG 1A17A 5EIDA 4I1AA 2WXKA 5KNHD 3BASA 3G3ZA 2KZTB 5TISH 1NAYA 3FH5A 3CVWA 2AXUA 3BG1B 1NTZJ 1OCOE 1H6KA 4GTPA 2NXPA 5TISE 3H1JD 4WUYA 2WWWA 3G2UA 1TNYA 1FZEA 3QKYA 5KJ7A 4JHJA 2K37A 1SQPJ 4N6JA 2WXPA 1SQQK 2ZYAA 4PD4I 1JCDA 1ZRTD 3TWXA 3A0HE 1NJIQ 3RRNB 3IBEA 2H8PD 4PD4D 4W9RA 3AS8A 4YNDA 2JR8A 2IO2C 2OYHA 2IOSA 2YXRB 2MHKA 3MYVA 1URQA 3B5NC 4HLEA 5AVQB 1HG5A 3DWLG 2VGXA 4DK5A 5CCGC 3EIJA 3CQCB 1S1CX 3M0DC 1K1AA 1X22A 3Q73A 3TGUJ 3OJAB 1SLQA 1X0TA 4Q96A 2N1TA 2OV8A 5AVUB 2WT7B 1FOSF 1FCHA 2B0OE 2E43A 1U3CA 4ASVA 2BEQD 3Q2YA 1S63A 4AY6A 5EYPF 1LWUA 1XTCC 3QWWA 2J07A 3B4SA 2WSSH 3B8EB 4O1PA 3GHGB 3PUKA 2QEXP 4KZ0A 4CRWA 3W68A 3UQ3A 4BX9A 3LVQE 2P7JA 2WQ7A 2FF4A 1IQUA 4UI9C 3DSVA 3TNUA 3TWWA 3WMM0 2L91A 2NRGA 1IO4A 2HM8A 2AEMA 2VSXE 4ANVA 2B89A 5DJTB 3RL0B 2X6JA 3AE6C 5EX0A 3PJSK 2HR3A 4R4MA 4DX5D 3N71A 2XS8A 1KQGB 1NU1E 2Q6QA 4M7CA 4U04A 1UOHA 1OW8A 1FZFA 1EXJA 3LS8A 1ZN5A 1KYOE 2ZT9B 1M1JC 1GW6A 1IFIA 1RH5B 1K3ZD 5BU8B 2ZGGA 4G23A 4EHMA 4FA6A 1E90A 4U3FD 3ZXPA 1PY1A 3PDNA 4UQXA 2XU6A 1N0RA 2KC7A 2IBZE 5APSA 3R9MA 4H13D 2IYPA 3PZ4A 5KLIC 1S72P 1OY3D 1MX4A 5LX8A 1Q2ZA 2OARA 1AQ5A 2A45G 1BSHA 2J59M 4H13C 1P84I 3K9IA 4ZKUA 2H6IA 2FYUJ 4HORA 4FLBA 1UN8A 2GA1A 3HD7D 1AFOA 4U63A 3S4RA 4TXQA 2KSEA 1FDOA 2P9NG 2MRIA 4U8VD 3PP5A 4IYPA 1WT6A 2R32A 1YIJP 3PEVB 3RO3A 4W80A 4OGQB 3JSVC 4H13B 4RJTA 1E79H 3FUFA 1LT1A 3QWVA 1SQQG 3AG1E 4C9BB 4HRMB 3H1KE 4LLHA 4PH4B 2JWDA 3EHNA 2JO1A 1UJKA 1N4PA 4AJWA 2WPSA 2E2EA 1SQVD 1DNPA 1K04A 1NTKJ 1T3JA 1SQBE 5BT1A 2J08A 1MZCA 2ZIRA 5AW1B 4C7NA 5G04C 5B66E 4L74A 3CWBD 1SQXD 3AE1C 1UW4B 3HVEA 2HR2A 2LXBA 3ASHA 3CX5I 4HNAD 2M3EA 3FUNA 3LY7A 3FUKA 1J1EC 1N73C 4EPZA 1OCZE 4NIKA 4KT0J 2LXMA 2J8SD 3WG7E 3HRNA 2A06G 3KZIH 5AVZB 1JCRA 3DSWA 4GODA 4XI9A 3Q47B 2LKMA 3CXHE 1KMIZ 2JLBA 3AG3E 5HS0A 1NTMJ 2C2LA 1DVPA 3FH7A 3MEKA 3SGHA 3VOPA 2MKVA 5KLVJ 2ZAEB 1FT1A 1MX6A 5HI7A 1SZAA 1RE3C 3AE7C 1R8EA 2WXQA 1SQPD 2WSFJ 3Q15A 3RK3C 1GL2A 3Q5PA 1BE3G 1BI7B 1W2BO 2OVBA 4AIFA 4U96D 3JCUE 4A1GA 3VP9A 4J6IA 1VQMP 4U8HA 3AJIA 3LW5J 2QYJA 1KORA 1JUQA 4ACLA 2R3SA 1OXJA 1BGYG 1T6AA 4GPKA 3LY8A 1PIXA 3ULQA 5CRUA 3UKRG 4BY6A 3CIAA 3T97A 2CPBA 4A1SA 1QLED 4UB8H 1N94A 3AU5A 3QWOC 2M5AB 3NAWA 2C9NY 2KSJA 3G6EP 1N4RA 4HKZH 1OVVA 1NA3A 3NZSA 4CT0A 1AVOA 4ZNCA 5B3SE 1WG0A 3HIZA 2K9JA 2ZVOB 2BEDA 4CGVA 3T8MA 1FS0E 2FULA 4CDRA 2ILRA 4BWRA 3HUSA 4D6TJ 1USDA 3L75E 5AVYB 4I17A 1M7LA 3C3QA 5KLVK 1JCQA 2WXHA 1WDYA 2BCCG 4XKBA 1NU1J 1NTMG 2A45H 3L36A 3WU2E 3GYZA 3L74J 3ASDA 4TUMA 3U4TA 3PE4A 3HTKA 4XE5B 1H0TB 1EXIA 3SSUA 1HS6A 3ZIMA 1LD8A 5CJ0A 3FY4A 3LKUA 2O01H 1OVUA 3ABME 1FE6A 1OWLA 1ELRA 1USEA 3KDPB 1NTMK 1PAQA 1T2KD 5AW0B 3C98A 3CX5D 1VF5C 2KS1B 2QJYB 4OGQC 1NA0A 1ZV8A 2WB2A 1RE4C 3VN0A 3NBNB 3VP8A 3V5BA 4PD4E 3CEQA 1XGWA 3V2QA 4DX1A 3L73D 3D9MA 3TGUG 1PP9J 3L70E 4RG9A 1FPPA 2V5FA 4I1LA 4LCTA 4U3FJ 2P67A 3APFA 1X81A 3RBZA 5HQ8A 1LWUC 3HE4B 1KC8Q 2Y0BG 3VTYA 2NYJA 2FYUK 3CXHI 1JWFA 3Q4AB 3IFMA 1HTLC 2KLVA 3M9HA 3IKOB 4LG6A 2KNCA 3EJNA 3SY2A 2XRYA 4H7XA 5CEDB 3G2WA 1L4AB 2N1TC 3AE2C 4HVBA 1LTJB 3JCKC 4JZYA 2IEJA 5KLVE 3AE8C 3HD7A 1KB9E 1ZLLA 3U1AA 1AJYA 3GLMA 1PP9D 2YIUC 1Q7YQ 1PV3A 2P58A 3L22A 3FTVA 5BXUA 1WMKA 3ZW3A 1PPJD 3FTSA 1O1RA 1TNZA 2GUVA 1IZNB 3V4QA 3DXKG 4XIFA 2Q5UA 1GL2D 4C46A 2DVWA 2HE0A 3Q7FA 2PM6A 4TT3H 1U2VG 5ENTD 5ENPD 3MX3A 3PZ1A 2XGSA 3Q9NC 1VDFA 1O1SA 3T5VA 1Y47A 5AVRB 1NTMD 1SW6A 3B7SA 3PE3A 4FU3A 5KCMA 4WNDA 3KD7A 4WWIA 2E74C 3A7OA 3G9RA 2V0PA 2HODA 2KXPC 4PDXA 4GIFA 3H1LG 3L08A 5FQ6A 1KILE 5G05C 1L0NJ 4G11A 4U3FE 1HH8A 1ZOYC 4BRYA 3ZVVA 3CCEP 4J8DA 2C0WA 4H0LD 2A06E 3HD7C 1JNMA 1G2CB 3LVRE 3C3RA 2YMYA 4N5CA 3MCXA 4EZKA 5M72A 3BRTB 3CC4P 5AW3B 3FULA 1T2KC 2D2CB 1OFCX 2OOEA 1N7SC 1KYOI 3UT4A 1NFIE 4GTQA 2HPCA 2VQ2A 4Y28J 3H6PA 3PLNA 5E75A 4OH8B 2LXCB 3NXSA 3MKRA 5E79H 3FU5A 1TJFA 1KT1A 2R5BA 3B71A 4YPCA 2X6FA 4XFJA 3CCUP 5GTHH 4WWOA 1ZMEC 5CHEE 2X6IA 2ZU6B 1BCCG 1V55E 3KEZA 3QOUA 2GRMA 2ONDA 3UIOC 3Q1MA 2V4HC 3H1KD 3Q9UC 1BE3J 4GTRA 2P10A 2DZNA 4UWHA 1A02J 3L17A 3NZUA 1N7SB 2DWZA 4JXTA 4V3IA 4D10C 4HOUA 5BNWA 2EINE 1IC2A 4DCKA 5ENOD 1FZAA 3GW4A 3CV0A 3FU0A 4BSXA 1L0NE 2JEKA 5CHXA 2O01N 1KILC 1PFIA 1VQNP 1DEEG 1EF1C 2OEWA 4O9BA 4I6JA 3P32A 5CCHD 2KIKA 2QJKB 1UN9A 4WWPA 1GMJA 5T8IA 2LNIA 3HE5B 2K3RA 3CK9A 3S2AA 2L0IA 4O60A 4IRUA 3OAKA 3ZNGA 1A02F 1RF0C 1OXZA 2JWAA 4JF7A 3SI5A 4BSZB 3TG5A 4NPDA 3ASFA 3S9OA 5KJLA 3CKBA 2QRXA 3PNLB 3RIBA 3L73J 1DCQA 3GW6A 1JPLA 1EDIA 1URQB 4WBAA 3F89A 1NU1D 1NU1G 5EFWB 4GYOA 1VQ4P 3PREA 1NL4A 1LTTC 5ARFA 4BT8A 4GDOA 5FT9A 2NZ2A 3APCA 2B88A 2FEZA 1BE3E 3VMAA 1BCCE 2WXRA 4WY4D 4A3TA 3FTWA 2Q9IA 3S1KA 2FFDB 2DW3A 2QSIA 4FLHA 3LEWA 5AN8A 2AXVA 2ZFCA 3CR3A 1KTMA 4H0LC 2IBZD 4I9CA 5KAIE 3H1ID 3CCVP 2A45I 1HXIA 2OGUA 3UM0A 4WNEA 1NHLA 2FO7A 3LYAA 3AEGC 4H7YA 3BCCG 1JEKA 5EYLA 2ZXWE 2HG5D 4TV3A 3I4RB 3NTNA 5CMWA 4JC8A 5KJNA 3SWFA 3APDA 2M8RA 3AS5A 1V54E 2IFMA 2P9IG 4LSZE 4JA7A 4B89A 5C2YA 1E8WA 4DRXE 3PHLA 4CYMD 3EIQC 3MHVA 3H1HG 4HB1A 4APOA 1H6OA 2JEEA 5A23A 1JO5A 5CMYA 3H1LE 2V4LA 4G25A 5AW2B 1EDLA 3UI2A 5APVA 2XV5A 1H2VC 3SFYA 1KZPA 2HYZA 2OYHC 1LTSC 4I6EA 4ANWA 1NWQA 4HS2A 3FDHA 2K1AA 5AW8B 2QYUA 4BWNA 3L35A 2YKPA 2XEVA 3AEAC 3ABLE 4U7JA 3M9QA 3SQVA 5FJYA 1RQUA 2FKWB 2BCCE 3MV3B 3G71P 3V2NA 2JKVA 3E33A 1EYHA 3V30A 2PQRA 2ZJSE 3CX5E 5J08A 3LJ3A 1PGPA 4BFRA 2P1JA 3PZ3A 3GG2A 1CI6B 5L8RJ 5KTBA 1RZ4A 2PFXA 3B7BA 4IL6H 2XGOA 5KLVG 2RKKA 1KQSO 2DZOA 3DEPA 3IV0A 3R2PA 3P7KA 1JMBA 2C9LY 3CD6P 2E76D 1EC5A 3VLEA 3Q3DA 3EHRA 3BCCD 3U59A 5CCHA 3CXHD 4JEUA 4AXHA 1EZVE 2WPQA 3WUUA 3PZ2A 1JTHB 4UWFA 3I56P 3VMYA 3F6QA 3CSFA 3KPEA 2FYNB 4MN4C 3TDKA 1QZ2A 2P2CP 1YBKA 3SF4A 4MBGA 4CZ2D 3TWSA 4Z1MH 3HG0D 2IX7C 3IN6A 2VYIA 2WMNA 2IPPA 3E7KA 1KILA 4RG6A 3T9KA 3V79K 5BV1A 3GHGC 3A0HH 3L75J 2YKQA 4N78D 2WXGA 4U7EB 2L0TB 2IONA 5BXOA 5DIZA 3L74D 5AVTB 4YTPC 5CBNA 4L75A 3L74G 1NAFA 4EBAA 3FTXA 5AENA 1Z6TA 1FZCC 2E74B 4YVQC 2ZT9C 2WVRA 4IN3B 1OVRA 3E34A 5APUA 2WPVB 4NQ0A 4AYCA 1ZXGA 3CXHH 2YXQB 4F6RD 1NH4A 2FYUG 3L72E 4GMLA 1KZUB 3JQ0A 2RH0A 2QJPB 2HODB 4JD2G 4K5AB 3UT8A 2NPSD 3QARA 3L4FA 3VLFA 1FVFA 5AVXB 4UWLA 4AUWA 5AW6B 2XKMA 3LJNA 1OWPA 2WT7A 1GL2B 3RK3E 3L71J 4KXKB 1G2CA 2OYIA 3O8ZA 3FHEA 4U8YD 2O1KA 5JJTA 3PTZA 3EWKA 1N0QA 3CLJA 5EIBE 5ENQD 1BU9A 4O6FA 1L5JA 3CCJP 2J5UA 3MJWA 4G8KA 3CWBG 3H1IJ 5EKQD 2UY1B 2WXMA 1H88A 1LT9A 1OT8A 5AYWD 1KV4A 3CQGB 2KLUA 3VYIA 3TXMA 4L9PA 1L2PA 3LW5H 1MHQA 1ZB1A 1LWUB 2E76C 1QVFO 1K8KG 2KCKA 2RFMA 4G26A 1X5BA 4Q69A 1FJKA 5TJHA 4Y6CA 1KFNA 1GW4A 3CC7P 2AEFA 1GZLA 3LCAA 4O1OA 2KZJA 3VTXA 2WSFH 3OXGA 4TUUA 4GTMA 4PS8A 2Y4TA 1MFTA 2WM9A 1E96B 1VQPP 5FQ8A 3TAXA 5D0OD 5CJ4A 3S7JA 2B6CA 2J58A 4I1OB 1NKNA 3L70D 3DSUA 3L71E 4JQ0D 2KP8A 3V2PA 3UTMA 2F37A 3ONLA 3H1JE 2VTBB 3BG0B 5D66A 3MV2B 3MTUE 1NOHA 3H32A 1ZR2A 1SZ9A 3N7NA 5KJMA 2VSNA 4GOFA 2LO6A 2R5SA 3L73E 4ILGA 3FP3A 5AQ7A 3PH0A 1Y6IA 3ZKJA 3ABVC 4I2ZA 4KVMA 3CVUA 4BEPA 1IYGA 1Y8MA 4I7ZC 2AXTE 4XA4A 4A63B 2IJGX 1PP9E 1DD3A 1JMMA 3D9PA 4NPFX 1VPCA 3RRMB 2VSYA 3SNXA 1FU1A 3TGUD 1WAO1 2CPSA 4FJZA 4PV1C 4X8QA 3L73G 4I1MA 3CLQA 2EQXA 3B7UX 4B8CB 4I6MC 3RK3B 2R3CA 3DRAA 3I5CA 4EYYQ 3RSEG 5CCGA 1E5WA 1NZNA 4RO0A 3FWNA 4KBQA 1U7MA 1YJWP 3T5XA 4RKUJ 3HXFA 2ZYGA 1YJNP 4CCAA 2E75B 1N4SA 4AP2A 3H1KG 3OXFA 4PS3A 5ENNA 4AVXA 5FIOA 4W7ZA 1HX8A 1BCCD 3M0AA 3H1HJ 1FVHA 1NI1A 3KXDA 1KYOH 3PUJA 3D9JA 3TJPA 1X9VA 2WITA 2JABA 5B1BE 4GTSA 2ZXXA 2K88A 2R2LA 4B8AA 2Q7FA 3U66A 4DT0A 2JJLA 4GYWA 1M8OB 2CFUA 3FUDA 3FGAD 1VQ6P 5D0QD 1LT9C 1PC2A 3QJZA 2R05A 4WNGA 4BERA 1D9SA 1PGQA 3I55P 2FXPA 2O01J 1NU1K 1YI2P 4FP7A 4UQYA 1FZBA 1LD7A 5KJ7C 3GMAA 3TL5A 2V4HA 2FYUD 1GL2C 3L16A 4PJ0H 2FBNA 3CVYA 1IFNA 1GU5A 5D2MC 4Y99B 3AS4A 1EDKA 2QE7H 4K0RA 4L23A 4XI0A 2QJKC 2CFZA 2R03A 4WWNA 3P8CE 1OWMA 3ZXSA 1AP7A 4DZOA 1QL2A 4L1BA 4BRYB 1EPUA 2E5TA 4PD4H 3H32B 1KPSB 4M3LA 1CW5A 2VGXB 2L6JA 3FTZA 2XNXA 4NACA 3PS6A 1J1DB 2V8SE 1N7LA 2PP6A 1NYHA 1L0ND 5A7DB 1AA0A 3IXEA 2VRSA 5JHAA 4FHJA 1NTZD 1EQ7A 2B87B 5BW8C 2GM4A 1E7VA 3N4XA 5AW5B 1ZU2A 1RY3A 4ZHBA 2AJAA 1SFCB 1IFPA 4J8EA 1MJ0A 1PP9G 3B5NB 3GHGA 1HO8A 5APWA 3PNTB 4I6GA 3RL0g 2OYHB 2Q1KA 3CVNA 4LUNU 5JMND 2PL2A 2NPSA 3IF4A 5FZRA 4LNBA 1S70B 4ATZD 1GW3A 3MIWA 1RF1C 1SQVE 3ZYQA 2AXCA 1M1JB 3FU3A 3MZLB 1SFCC 1RF0A 3D9HA 4JW1A 5GTIE 4ACKA 3LIEA 3QH9A 5FTPA 3H25A 2HLOA 1JY3O 1SQBJ 3C72A 2LAHA 1N2DC 3U3WA 3FUEA 1RF1B 3LXUX 2FBWC 3HUSB 2P9UG 5B1AE 1K05A 2A5EA 2Y3AA 2OVFA 1BE3D 3AECC 3C3OA 3ZN3A 3ZFWA 1ZP0C 2YINA 3W9GA 1DC2A 1DCEA 1ELWA 1B89A 2YNYA 2QG4A 3PZDA 4QMAA 3O6QB 1OWOA 4GT1A 2AWIA 4ILHB 1H0TA 1JY3P 4JA9A 2PQNA 4YDYA 3NF1A 2MOWA 3L72J 1EDUA 1W2EA 3KQGA 3V2XA 2KS1A 1YA0A 1NKZB 1HF8A 1MQSA 2FFDC 2WXLA 4WY4B 3CKCA 1L0LG 1E7UA 4HOTA 5H2FH 4CT4A 1S5LH 1LTGC 1OW7A 1Z3XA 3MZWB 2BKKB 4I43A 2BF0X 4M3OA 2RN0A 3H1IE 4B94A 1BDDA 3V4WA 2R59A 3M06A 4WVZA 3CL3D 2MJZA 4NURA 1P84H 2AEJA 3GF3A 4RQIA 2CHWA 2Q3EA 5KKZC 5G04J 4B86A 3D6ZA 3QB2A 1KFMA 5E79E 1DH3A 1BCCJ 3H1LD 3C8VA 4B0ZA 4D6TG 2H43A 4D6TD 1YJ9P 3L9TA 4GMJA 5ENSD 2IBZG 2NSZA 4WNFA 2H7HA 3S7DA 3FFLA 1SQVG 1LTJA 3L72G 3FTYA 3MKQB 1OWAA 4FHKA 1IJDB 5AQAA 1NVOA 1HG2A 1CZQA 3SFZA 3ZHEA 3A2AA 3TK1A 1L4AA 3E37A 5AVSB 3NMDA 4ATGA 3OA7A 2CHZA 4PUCA 4C7NB 4YDEA 2R17C 2LUHA 3GZ2A 3UX4A 2WMMA 1RE4A 4HFGA 4GZCA 4GA0A 5B5EH 3JCUH 5M1BA 2A4ZA 4KMOA 4IL6X 3CHQA 4JHKA 3NB2A 1VF5D 4OVUA 2L9BA 2BCCD 1VQ8P 1JWGA 3L71D 1T3UA 2YKOA 1IKND 1NTKE 1MZ9A 2XPIA 3PH0C 3QC1A 1QL1A 4K5BA 1WM5A 1JOCA 3FH8A 4EQFA 2Y0EA 1OCRE 3LPZA 4L7TA 3EQ2A 1MKMA 1MFZA 1AVYA 3H1KJ 5DBKA 3FWVA 4U3FG 4L2YA 4HRNA 3NQPA 5BV0A 2P9PG 1VF5B 1BPOA 4XKCA 4DX6D 3R7QA 4OAVB 1OWNA 4DPRA 4E6HA 5C39A 5LCWC 4UUCA 3TWTA 2L5GB 5GTHE 2Y0CA 3EU5A 3KAEA 1X8YA 4OVNF 4EDFA 1HF9A 2CG3A 1SQXG 2O1JA 3FUMA 5KWDA 1K9MQ 2R44A 4OVVA 1N73A 4IL6E 1H89A 2ZT9D 3CHMA 1LTXA 1PGOA 2IZ0A 5BU5A 5KNGA 3UIPC 2UWJG 2AVPA 4LNGA 2I8DA 2NC9A 1S9KD 2BEZF 4H44C 2XCBA 2W90A 3CPWO 2KATA 3HXDA 4C0MA 3J5QB 3AAAC 1SQVK 3O4ZA 3JC22 4N78E 3II6A 1WRGA 3UM2A 1SQMA 2WQ6A 1NO4A 1S5LX 1ELKA 2ZISA 1BSNA 2XEEA 5ANRA 5FQ4A 1TJCA 1HZ4A 2K9JB 3G2VA 2D2CC 3E4BA 3ZYLA 1Q2NA 1YYHA 2P9LG 1Z5SC 3D6YA 4CPGA 5K5GB 4AEZC 4J8FA 4JPZB 2YHCA 3RK3D 2IOLA 5FQ7A 3U9WA 2YO2A 4QQIA 1QQEA 3R4YA 4HLLA 4URKA 3ESLA 2N9YB 3S7FA 4DLOA 1HGVA 5G2NA 2QY7A 3D71A 3UPVA 4ANUA 3CHOA 4LRZA 4MKTA 2RFAA 4EZJA 2POHA 1LTAC 1OUVA 5LCWJ 1HFAA 3ESKA 3L13A 1SA5A 2GROB 2FYUE 4G2VA 1Q86Q 4DI3A 4GKGA 1IK9A 2Y1LE 2HO1A 2G3AA 2XPYA 5CCHC 1P84D 3CC2P 3B13A 2J49A 4QFVA 1H8AA
chains in the Genus database with same CATH topology
4HB1A 2QC9A 3NOCD 4GPMA 5AAOA 2V4HC 2QVAA 4NPEA 4K35A 1IKND 5HRYA 4K5BA 4K3AA 3Q9UC 4K5AB 4DX2A 3B95A 1G3NB 2ZAEB 1MX6A 2BKGA 2DZNA 2Y0BG 2NYJA 1AWCB 2DWZA 5FIOA 1EDLA 3JUEA 3UI2A 1K3ZD 4DX7D 3LJNA 2XZDG 4ZFHA 4LG6A 5ENOD 2ZGGA 5HKPA 2ETAA 2V5QC 3ZU7B 2A5EA 5EN5D 2VGEA 3RGUA 4HI9A 2SPZA 5CEDB 1BI7B 2JABA 1N0RA 3DEOA 4U8YD 4HRNA 2ZGDA 5EIDA 1QYMA 1N0QA 3KEAA 4U96D 3W9GA 4BXLA 1S3JA 5ENQD 5KNHD 5EIBE 5ITZF 2PNNA 1DEEG 2LR2A 4DX6D 3AJIA 4OAVB 1DC2A 2QYJA 4BETA 5C39A 4G8KA 4UUCA 5CECB 3TWTA 1K1BA 1BD8A 3JXIA 4DUIA 2KIKA 1JM0A 2P58A 1OY3D 2XZTG 1OT8A 5BXUA 1MX4A 3V30A 5KWDA 2R44A 3EU9A 1MX2A 1H0TA 3TWQA 2K3RA 2RFMA 4YDYA 3TWRA 1BU9A 1SS1A 3V2XA 1MYOA 4O60A 2ETBA 3QWOC 5KNGA 3UXGA 4BERA 1D9SA 2M5AB 3ZNGA 1LP1A 2KI7B 1LP1B 2MYOA 3T8KA 2M0BA 4O1OA 2DVWA 2I8DA 2HE0A 3B7BA 4BSZB 2KZJA 3ZDMA 1A5EA 4NPDA 4HKZH 1OVVA 5ENPD 5ENTD 3JXJA 4U8VD 1MFTA 4ZNCA 1WG0A 4IOIH 4KJMA 3J5QB 3TWXA 1BDCA 4B93B 3AAAC 2DZOA 2QRXA 3DEPA 2BKKB 3MZWB 5FINA 3TWVA 4BESA 1TR4A 1JMBA 1DCQA 2KBXA 3Q9NC 1EC5A 1BDDA 1EDIA 2UWJE 1Y47A 2XEHA 1SW6A 1YCSB 3EHRA 4G8LA 4DX1A 1EDKA 4RLYA 4K5CA 3V31A 4F1PA 4ASWA 1LT1A 4WWIA 1U7JA 2XEEA 5EILA 4Z68A 5EFWB 1BI8B 2KXPC 4HBDA 4HRMB 1K1AA 4N5QA 1Q2NA 1YYHA 1ZW0A 1WDYA 2F37A 1AP7A 2JWDA 3F6QA 5CBOA 4LNUD 5D66A 1X0TA 4OAUC 3UTMA 4CPGA 4MN4C 1BLXB 2B88A 2P2CP 4HI8A 3J5PA 5K5GB 4CZ2D 2B0OE 3W9FA 5DJUB 5ENSD 2B87A 4GOFA 3TWSA 4ASVA 3S1KA 2KZIA 4HB5A 4HRLA 4TUMA 3HG0D 4QQIA 5AN8A 4HLLA 4JBZA 1H0TB 5AQ7A 2XENA 5EYPF 5KBAA 3PH0A 3T9KA 3ZKJA 3V79K 5ENRD 2KUBA 3FXDA 3IXEA 2OTKE 1SVXA 5AQAA 4BEPA 1OVUA 1NVOA 2B87B 4O1PA 1NFIE 5CEAA 3EHQA 5BXOA 4A63B 4GOEA 2LXBA 5CBNA 3C5RA 1IXVA 5AQBA 4HNAD 4C48B 4NPFX 5AARA 2RKLA 2FO1E 4ZHBA 2AJAA 5JA4D 4J7WA 2ETCA 2RFAA 1YMPA 4HQDA 3TWWA 1MJ0A 4J8YA 3SO8A 2KS1B 2WMMA 2LXCB 4JB8P 4NIKA 1OVRA 2L6BA 3TWUA 5EYLA 2Q1KA 2J8SD 1ZXGA 4HJGH 3V2OA 5CERB 5AQ9A 2F8XK 5JMND 4ZMDA 2B89A 5DJTB 3NBNB 4U95D 4F6RD 4EYYQ 1S70B 4ATZD 4GODA 3HRAA 1EDJA 1IHBA 2Y1LE 1N11A 4LSZE 1FC2C 2HR3A 2M5AA 2F8YA 3NOGD 4YDWA 3ZUVB 4DRXE 4DX5D 1U7MA 3FXEA 4CYMD 4QFVA 5HS0A 3D9HA 1UOHA 3MHVA 4GMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB1 A;  2QC9 A;  3NOC D;  4GPM A;  5AAO A;  2V4H C;  2QVA A;  4NPE A;  4K35 A;  1IKN D;  5HRY A;  4K5B A;  4K3A A;  3Q9U C;  4K5A B;  4DX2 A;  3B95 A;  1G3N B;  2ZAE B;  1MX6 A;  2BKG A;  2DZN A;  2Y0B G;  2NYJ A;  1AWC B;  2DWZ A;  5FIO A;  1EDL A;  3JUE A;  3UI2 A;  1K3Z D;  4DX7 D;  3LJN A;  2XZD G;  4ZFH A;  4LG6 A;  5ENO D;  2ZGG A;  5HKP A;  2ETA A;  2V5Q C;  3ZU7 B;  2A5E A;  5EN5 D;  2VGE A;  3RGU A;  4HI9 A;  2SPZ A;  5CED B;  1BI7 B;  2JAB A;  1N0R A;  3DEO A;  4U8Y D;  4HRN A;  2ZGD A;  5EID A;  1QYM A;  1N0Q A;  3KEA A;  4U96 D;  3W9G A;  4BXL A;  1S3J A;  5ENQ D;  5KNH D;  5EIB E;  5ITZ F;  2PNN A;  1DEE G;  2LR2 A;  4DX6 D;  3AJI A;  4OAV B;  1DC2 A;  2QYJ A;  4BET A;  5C39 A;  4G8K A;  4UUC A;  5CEC B;  3TWT A;  1K1B A;  1BD8 A;  3JXI A;  4DUI A;  2KIK A;  1JM0 A;  2P58 A;  1OY3 D;  2XZT G;  1OT8 A;  5BXU A;  1MX4 A;  3V30 A;  5KWD A;  2R44 A;  3EU9 A;  1MX2 A;  1H0T A;  3TWQ A;  2K3R A;  2RFM A;  4YDY A;  3TWR A;  1BU9 A;  1SS1 A;  3V2X A;  1MYO A;  4O60 A;  2ETB A;  3QWO C;  5KNG A;  3UXG A;  4BER A;  1D9S A;  2M5A B;  3ZNG A;  1LP1 A;  2KI7 B;  1LP1 B;  2MYO A;  3T8K A;  2M0B A;  4O1O A;  2DVW A;  2I8D A;  2HE0 A;  3B7B A;  4BSZ B;  2KZJ A;  3ZDM A;  1A5E A;  4NPD A;  4HKZ H;  1OVV A;  5ENP D;  5ENT D;  3JXJ A;  4U8V D;  1MFT A;  4ZNC A;  1WG0 A;  4IOI H;  4KJM A;  3J5Q B;  3TWX A;  1BDC A;  4B93 B;  3AAA C;  2DZO A;  2QRX A;  3DEP A;  2BKK B;  3MZW B;  5FIN A;  3TWV A;  4BES A;  1TR4 A;  1JMB A;  1DCQ A;  2KBX A;  3Q9N C;  1EC5 A;  1BDD A;  1EDI A;  2UWJ E;  1Y47 A;  2XEH A;  1SW6 A;  1YCS B;  3EHR A;  4G8L A;  4DX1 A;  1EDK A;  4RLY A;  4K5C A;  3V31 A;  4F1P A;  4ASW A;  1LT1 A;  4WWI A;  1U7J A;  2XEE A;  5EIL A;  4Z68 A;  5EFW B;  1BI8 B;  2KXP C;  4HBD A;  4HRM B;  1K1A A;  4N5Q A;  1Q2N A;  1YYH A;  1ZW0 A;  1WDY A;  2F37 A;  1AP7 A;  2JWD A;  3F6Q A;  5CBO A;  4LNU D;  5D66 A;  1X0T A;  4OAU C;  3UTM A;  4CPG A;  4MN4 C;  1BLX B;  2B88 A;  2P2C P;  4HI8 A;  3J5P A;  5K5G B;  4CZ2 D;  2B0O E;  3W9F A;  5DJU B;  5ENS D;  2B87 A;  4GOF A;  3TWS A;  4ASV A;  3S1K A;  2KZI A;  4HB5 A;  4HRL A;  4TUM A;  3HG0 D;  4QQI A;  5AN8 A;  4HLL A;  4JBZ A;  1H0T B;  5AQ7 A;  2XEN A;  5EYP F;  5KBA A;  3PH0 A;  3T9K A;  3ZKJ A;  3V79 K;  5ENR D;  2KUB A;  3FXD A;  3IXE A;  2OTK E;  1SVX A;  5AQA A;  4BEP A;  1OVU A;  1NVO A;  2B87 B;  4O1P A;  1NFI E;  5CEA A;  3EHQ A;  5BXO A;  4A63 B;  4GOE A;  2LXB A;  5CBN A;  3C5R A;  1IXV A;  5AQB A;  4HNA D;  4C48 B;  4NPF X;  5AAR A;  2RKL A;  2FO1 E;  4ZHB A;  2AJA A;  5JA4 D;  4J7W A;  2ETC A;  2RFA A;  1YMP A;  4HQD A;  3TWW A;  1MJ0 A;  4J8Y A;  3SO8 A;  2KS1 B;  2WMM A;  2LXC B;  4JB8 P;  4NIK A;  1OVR A;  2L6B A;  3TWU A;  5EYL A;  2Q1K A;  2J8S D;  1ZXG A;  4HJG H;  3V2O A;  5CER B;  5AQ9 A;  2F8X K;  5JMN D;  4ZMD A;  2B89 A;  5DJT B;  3NBN B;  4U95 D;  4F6R D;  4EYY Q;  1S70 B;  4ATZ D;  4GOD A;  3HRA A;  1EDJ A;  1IHB A;  2Y1L E;  1N11 A;  4LSZ E;  1FC2 C;  2HR3 A;  2M5A A;  2F8Y A;  3NOG D;  4YDW A;  3ZUV B;  4DRX E;  4DX5 D;  1U7M A;  3FXE A;  4CYM D;  4QFV A;  5HS0 A;  3D9H A;  1UOH A;  3MHV A;  4GMR A; 
#chains in the Genus database with same CATH topology
 2QC9 A;  3NOC D;  1N4Q A;  1MUU A;  4R7L A;  2I9C A;  1FBM A;  2BKG A;  1YTZ T;  2P2U A;  3TGO A;  5LFA A;  1R5L A;  2IBZ I;  3PRJ A;  2F0Y A;  1L4A C;  5AW4 B;  1FZG A;  3GZS A;  5GTI H;  4F7A A;  4IFD K;  2XS1 A;  1ZRT E;  1KD1 Q;  2KM4 A;  3CVV A;  3DEO A;  5KAF E;  5JHB A;  4U0U A;  3UKU G;  4JYB A;  2OYI C;  1LJ2 A;  3VMZ A;  3S7B A;  1K1B A;  3NFQ A;  3Q5S A;  2ITA A;  3EU9 A;  1J1E B;  1N73 B;  2CG2 A;  3FWL A;  3HDX A;  1EZV G;  1MYO A;  4L76 A;  3WUT A;  1KB9 I;  1LP1 B;  1GDT A;  2OCC E;  1TU3 F;  4Y99 C;  1IFM A;  3AG4 E;  4DX7 D;  2W83 C;  3E1R A;  3MA5 A;  1GU4 A;  1UII A;  3SBT B;  3HE4 A;  1TR4 A;  3CCQ P;  3CCS P;  3Q7A A;  2N1T D;  2KBX A;  2XHE A;  1Q81 Q;  4RLY A;  3WUV A;  1VQ9 P;  5ANL A;  3L70 G;  4Z68 A;  3TGU E;  1QBQ A;  1IK7 A;  3BRV B;  1BLX B;  4Q94 A;  3P8M C;  3U1C A;  1BGY D;  1GK4 A;  3QWP A;  3VLD A;  5H7P A;  3MGN A;  5FZS A;  3FU6 A;  4N2Q A;  2N1T B;  3MGB A;  1M90 Q;  4WB4 A;  1SVX A;  3RK6 A;  2ZYD A;  3DPD A;  3EHQ A;  1KYO D;  2I1J A;  1KQF B;  1IXV A;  1R5S A;  4GZ3 A;  3B7T A;  3ML9 A;  5JA4 D;  4J7W A;  3KYQ A;  4HQD A;  4DJA A;  4KYO B;  4JB8 P;  2XGM A;  2N9B A;  4GZD A;  2F8X K;  4C0E A;  1CSB A;  2FYZ A;  5AIJ A;  1L4A D;  3HRA A;  3TNU B;  4TLF A;  2BTD A;  1S2E A;  5B5E E;  1FC2 C;  2M5A A;  3NOG D;  3L6A A;  2V7Q H;  3FXE A;  3H1H D;  3V2R A;  1FJP A;  2EIM E;  3V31 A;  4YXD C;  3DST A;  2GUS A;  3SFX A;  1OX3 A;  3FUH A;  1RHZ B;  1AWC B;  4J8S A;  3FUJ A;  2CK3 H;  3P8C D;  2GW1 A;  4WY4 C;  3WXX A;  3KSQ A;  5KJ7 D;  5EN5 D;  2GGF A;  3RGU A;  4HI9 A;  3R9A B;  3DBS A;  5BPP A;  3FUI A;  1KT0 A;  2ZGD A;  4AOF A;  3MUD A;  4LEU A;  3KZI E;  4BET A;  4GA1 A;  1ZR4 A;  1YQ3 C;  2QM7 A;  2C0X A;  3FTU A;  4DUI A;  2C0M A;  1JM0 A;  1UJJ A;  1O1T A;  3H1J G;  2GRL A;  3UIN C;  3HTK B;  1NP7 A;  1SQB K;  1MX2 A;  3TWQ A;  3OTN A;  4FC8 A;  2PZI A;  2X6H A;  2HYN A;  1HWT C;  3F5H A;  2KI7 B;  3O48 A;  4F53 A;  5JJ7 A;  4PJ0 E;  2PAJ A;  4KZC A;  4B93 B;  1BDC A;  5KAI H;  3TWV A;  2D2C D;  1NTZ E;  3AE3 C;  1GTW A;  1SQX E;  4W7Y A;  4G8L A;  2DYR E;  2E42 A;  4G1T A;  4F1P A;  2I6H A;  1HGZ A;  1QEX A;  1ZBP A;  3UIA A;  3RBX A;  1HVV A;  2X38 A;  4LNU D;  4IUL A;  2H89 C;  1KIL B;  3ULY A;  3SBS A;  3W9F A;  1P5Q A;  3CST A;  4JPS A;  2YIU B;  2KZI A;  5B66 H;  3E30 A;  2VGY A;  4HRL A;  4MLP A;  3SFD C;  3ZGQ A;  1U57 A;  2J4D A;  5AW9 B;  4JBZ A;  4PV1 D;  1X79 B;  3AEE C;  4YDO A;  2KNC B;  1H2T C;  3I4G A;  2HFE D;  1D7M A;  1Q90 D;  1EZV I;  2IFU A;  3BCC E;  1S64 A;  3ULE G;  2H6F A;  2YQ8 A;  1EZV D;  2RKL A;  3M9B A;  2WTY A;  1UIX A;  2BAS A;  2JDI H;  2ETC A;  1SQP E;  1HE8 A;  4J8Y A;  1SP4 A;  3M0D A;  4GYY A;  1Y8A A;  3UM1 A;  4GU5 A;  4HJG H;  1DX7 A;  1JCC A;  2Y4U A;  3ZYK A;  4U95 D;  1L0L D;  3Q5M A;  2H6G A;  2QJY C;  1IHB A;  1HJ0 A;  1H2U A;  5EX3 A;  3CGH A;  4IFF A;  1VQL P;  5APT A;  2KK7 A;  3R7R A;  1SQP G;  3KS2 A;  3L74 E;  1SFC D;  4I2L C;  3EFG A;  1FAV A;  3CCM P;  3DSX A;  3IEG A;  3FEX A;  1SQX K;  4PS7 A;  4D6T E;  1L0L K;  1LGH B;  1LT9 B;  2ZVN B;  5AJD A;  5ITZ F;  1U3D A;  3SHF A;  2PNN A;  2OTL P;  3K5B A;  3L72 D;  3AE4 C;  1JY2 O;  1QGK B;  3L75 D;  4I9E A;  3O6Q A;  1H6P A;  2E75 D;  1VQ7 P;  2YO3 A;  1G1I A;  5AW7 B;  1LTJ C;  2RD0 A;  4HYT B;  2CHX A;  1SS1 A;  4EOT A;  4DJG A;  5KJK A;  1D8E A;  5H2F E;  5T4Y A;  1S5L E;  1W5C E;  3CME P;  2WSC J;  1E8Y A;  2MYO A;  2IFN A;  3T8K A;  3RKV A;  1BGY J;  1A5E A;  3D9K A;  4N3A A;  3EFF K;  1WY6 A;  3JXJ A;  3EHM A;  3T97 B;  2FXM A;  4IOI H;  3IAO A;  3Q79 A;  4P29 A;  3FX0 A;  2WSC H;  1P84 E;  2YHE A;  3BEE A;  3TSI A;  1YCS B;  4ZKP A;  1INZ A;  5IY5 E;  2OQQ A;  1BI8 B;  4HBD A;  2W6B A;  1NTK D;  2Y0D A;  2WVI A;  3RK2 B;  3G2S A;  2AXZ A;  3L70 J;  2WPR A;  2YNQ A;  1SQX J;  2IO3 C;  4GZ5 A;  4NRH B;  1YIT P;  3W67 A;  2WQY C;  1N7S A;  2Z5H A;  3ASN E;  2XEN A;  3I5P A;  4CEM A;  2KUB A;  1O5M A;  1VL2 A;  2Z5I A;  1RE3 A;  2P9S G;  1SQP K;  1GD2 E;  3ZEF A;  5AAR A;  5ARG A;  2EIL E;  2AXT H;  1FOS E;  1DD4 A;  1YMP A;  3SO8 A;  2Z4E A;  2L6B A;  4GB9 A;  1S0P A;  2IF4 A;  1Q82 Q;  3MUD C;  3ASO E;  2FY8 A;  3CVX A;  5LOZ A;  3QDN A;  2KYV A;  1S9K E;  5KLV D;  3JQ1 A;  1M57 D;  4AY5 A;  2Y9Z A;  1M56 D;  2OYO A;  3RU0 A;  1LNQ A;  4JYC A;  1VDY A;  3UM3 A;  1OCC E;  1QNF A;  4DLQ A;  4GA2 A;  4EI2 A;  1OZH A;  3ASG A;  3EDT B;  1N86 A;  4K3A A;  2H6H A;  3OXL A;  2Y9Y A;  1TYQ G;  4YVO A;  4L2L A;  5CCM A;  4OYS A;  1URQ C;  3DSS A;  4HXI A;  2XRZ A;  3JUE A;  3FEY A;  4ZFH A;  2LAI A;  2H88 C;  3CVP A;  4GAA A;  3CVQ A;  1KB9 H;  2SPZ A;  4ME2 A;  2GRP B;  4AQR D;  2WXF A;  3H1J J;  4H44 B;  3HYM B;  3Q49 B;  4GTO A;  1PPJ G;  1S3J A;  4BXL A;  5G05 J;  3CMA P;  3HE5 A;  2LR2 A;  1NTM E;  1SQQ E;  3E32 A;  4OGQ D;  5FWQ A;  4EEC A;  2IY0 C;  2QIW A;  2O3J A;  5A6C A;  4TXR A;  2IQC A;  4TRQ A;  4BX8 A;  1H0A A;  3JXI A;  2C0L A;  2XZT G;  4MRU A;  1YTZ I;  3CCR P;  3AEF C;  1SFC A;  2B9B A;  3VMX A;  3TWR A;  1HBW A;  2I1K A;  3DPY A;  4YXW H;  5KKZ B;  2M3B A;  5CMZ A;  3UXG A;  2A06 D;  3URZ A;  2W8Z A;  2M0B A;  3AEB C;  1PZQ A;  2QA4 P;  4RES B;  2XDJ A;  3E1I A;  3SWY A;  4UI9 J;  1N9A A;  4KJM A;  3MD0 A;  4A7P A;  4GCN A;  4JHR A;  4LER A;  2QJP C;  1M1J A;  1FDI A;  4K03 A;  2XEH A;  4A3V A;  2P9K G;  2W27 A;  3M91 A;  1U7J A;  3UMV A;  4FAD A;  4MS6 A;  1YQ4 C;  4N5Q A;  1ZW0 A;  4KHX A;  5APY A;  4AM9 A;  5EDS A;  5CBO A;  4DI4 A;  2QFC A;  1YYC A;  2FXO A;  3HD7 B;  4HI8 A;  1RW2 A;  3G4S P;  1JCS A;  4KVO A;  1M1K Q;  2I2O A;  3ZRH A;  4UB8 E;  2B87 A;  2OTJ P;  3KSL A;  2BUG A;  2X3M A;  2WXJ A;  5BUZ A;  1L0N G;  3SD5 A;  5CCG D;  1LTB C;  1RF1 A;  3D9L A;  3Q75 A;  3CK8 A;  1TNB A;  4XZ4 A;  3FXD A;  3ZYM A;  2W6A A;  1TN7 A;  1E8Z A;  1IQR A;  1LTI C;  3B5N A;  4N3B A;  1URQ D;  4E85 A;  1G1J A;  3AED C;  3P1U A;  3ML8 A;  5J90 A;  1E8X A;  1VQ5 P;  2LXL A;  3RJV A;  2J4B A;  1T8Z A;  4OWF A;  4LGD E;  3BQO A;  4UWK A;  3A3Y B;  4N2S A;  2E5Y A;  3C1L A;  4WY4 A;  1UG3 A;  2KOG A;  3UUX A;  3ITK A;  1W3B A;  3V6I A;  4N39 A;  2WXI A;  1IFD A;  1DIP A;  4GZ6 A;  1EDJ A;  3WU2 H;  3DXM G;  2Q3I A;  3A0B H;  3CK7 A;  4RSY A;  2LSV A;  2WMO A;  2VTB A;  3RL0 C;  4F3V A;  4BT9 A;  4N3Y B;  3IHY A;  4F1S A;  4GPM A;  1J2J B;  4BTB A;  2QVA A;  2AW6 A;  4UWG A;  1KQL A;  3A0B E;  2GRQ B;  1VQO P;  3B95 A;  4C7R A;  1G3N B;  2OEV A;  2E74 D;  3BVH A;  3OW2 O;  1GK6 A;  4FUL A;  3OAW A;  2XQ0 A;  2IZ1 A;  3L75 G;  4AV7 A;  2DCP A;  1SA4 A;  5HKP A;  3ZU7 B;  5JJ6 A;  1OIP A;  2VGE A;  3A5T A;  1SQB G;  1SQB D;  2J09 A;  1QYM A;  3KEA A;  1N54 A;  2FYN C;  1FZC B;  3HXB A;  2KCV A;  5G55 A;  4CDN A;  2XZR A;  4I7Z B;  2IU1 A;  2HPC B;  4G24 A;  3MKQ A;  4ILI A;  2ETB A;  3D70 A;  1LP1 A;  1BGY E;  1NTZ G;  4H0L B;  3SWK A;  3ZDM A;  2A5U A;  2XCC A;  1TN8 A;  4XX5 A;  3L82 A;  2R02 A;  3HUS C;  1DEB A;  4EIJ A;  2DIW A;  5CCL A;  2UWJ E;  1FDM A;  3PEU B;  4ANX A;  3ABK E;  1JUN A;  3P2B A;  4K5C A;  4A55 A;  1JY2 N;  3H1H E;  4ASW A;  5EIL A;  4U0Z A;  2E75 C;  4UI9 K;  1YHQ P;  1Y9B A;  5C1D A;  3LDZ A;  3AE9 C;  5CRV A;  1N8R Q;  4GCO A;  3CX5 H;  5DJU B;  4TXP A;  2RMZ A;  3IR9 A;  1RQV A;  3D9N A;  2PRR A;  4HB5 A;  5AVW B;  3AE5 C;  3TYY A;  4APF A;  4OAU C;  3H1L J;  1HJB A;  5KBA A;  1HU3 A;  2E76 B;  5ENR D;  4XE0 A;  4FJY A;  2FFD A;  2WPV A;  4UB6 H;  3AU4 A;  3ENE A;  3D9I A;  1L0L J;  2KB7 P;  2PM7 A;  2QZA A;  1L0N K;  1N7S D;  3CHS A;  3TXN A;  2VSO E;  3TWU A;  5KAF H;  3HXC A;  3CWB J;  3RK2 C;  5CER B;  3D9O A;  5AQ9 A;  4ZMD A;  3PVL A;  1QVG O;  5FZQ A;  4WAF A;  3GF7 A;  3TG4 A;  4YDW A;  2NPS C;  1N11 A;  3V2O A;  2F8Y A;  3UT7 A;  4BTA A;  3VTP C;  1XNF A;  3ZUV B;  5APX A;  2ZXE B;  1TEZ A;  3BCC J;  3L71 G;  4I2W A;  1N95 A;  4XEI G;  3X2Q E;  3RAU A;  2EIK E;  2G8Y A;  4GTT A;  5T3R A;  2XPZ A;  2YMK A;  1OW6 A;  4NPE A;  4K35 A;  4DX2 A;  1TNU A;  2OYI B;  4N3C A;  1N52 A;  3BUA A;  3ISM C;  5E76 A;  4GTV A;  1Z3Y A;  2V5Q C;  2UY1 A;  3HHM A;  4J0U A;  2R5D A;  1TNO A;  4R4L A;  3ZPJ A;  3GZ1 A;  1FZC A;  1J1D C;  2KZT A;  5LP0 A;  3RO2 A;  2VJ8 A;  5CEC B;  3BU8 A;  3IHV A;  3TF5 A;  2FI7 A;  2Y69 E;  1BD8 A;  3HVE B;  3MP7 B;  2GRR B;  3L37 A;  3CWB E;  3C9I A;  4U0S A;  2NPS B;  4KT6 B;  2E0I A;  3RRU A;  3QK0 A;  5APQ A;  3RK2 D;  4HOS A;  1IHG A;  3CI9 A;  2IDB A;  1VQK P;  3JUI A;  3G2T A;  1HUC A;  1OMI A;  5FIN A;  2RG8 A;  4BES A;  3QAQ A;  2V7Q J;  1L0L E;  1SVF A;  2WXN A;  2BCC J;  1K73 Q;  3EUV A;  4UB6 E;  3U64 A;  2X6K A;  3AG2 E;  1Z56 A;  4HOQ A;  1KZO A;  2WXO A;  4EZL A;  1NTZ K;  3SFE C;  2WQH A;  3I3N A;  2WSE H;  1PPJ E;  1K8A Q;  2KXP B;  1NTK G;  3B5N D;  3KHU A;  4L73 A;  1XTG B;  4JEH A;  1QX8 A;  3J5P A;  2Q7C A;  5AJL A;  3CHP A;  1TN6 A;  4Y6W A;  3RL0 D;  5BVZ A;  2QM8 A;  3JYS A;  2EIJ E;  1SQQ D;  2IYO A;  1KB9 D;  2KCL A;  2K9Y A;  1PL5 A;  1LF8 A;  2WZ7 A;  2LSU A;  1NTK K;  2OTK E;  3LY9 A;  3CVL A;  4JVS A;  3Q78 A;  5CEA A;  4JL0 A;  4ABN A;  3USS A;  1SQV J;  4GOE A;  2DYS E;  2PGD A;  3CCL P;  2DBA A;  1NGM B;  3C5R A;  1KN7 A;  1D8D A;  5AQB A;  4C48 B;  1IFJ A;  4UQZ A;  2FO1 E;  3ONK A;  3CHR A;  2XND H;  4RVB A;  1FT2 A;  1KIL D;  1CI6 A;  1PGJ A;  2P58 C;  3D3M A;  3ZHE B;  1HH0 A;  3LID A;  1H19 A;  2M63 A;  4HH2 A;  4CGW A;  2JP3 A;  4H44 D;  4DOJ A;  3HXE A;  3QNK A;  1SQQ J;  4PV1 B;  1AQT A;  4LC1 A;  5AVV B;  2J9Q A;  2W6J H;  4CDM A;  3BAT A;  4IFM A;  4GMR A;  4U07 A;  5AAO A;  1S4X A;  3L54 A;  3B7R L;  2WSE J;  5HRY A;  1KLX A;  1JTH A;  4EBA G;  2GRN B;  3PRZ A;  1MV8 A;  5KLI B;  2XZD G;  3SZ7 A;  1AV1 A;  1JB0 J;  1JY3 N;  2ETA A;  1JY2 P;  3Q5R A;  3H1I G;  1A17 A;  5EID A;  4I1A A;  2WXK A;  5KNH D;  3BAS A;  3G3Z A;  2KZT B;  5TIS H;  1NAY A;  3FH5 A;  3CVW A;  2AXU A;  3BG1 B;  1NTZ J;  1OCO E;  1H6K A;  4GTP A;  2NXP A;  5TIS E;  3H1J D;  4WUY A;  2WWW A;  3G2U A;  1TNY A;  1FZE A;  3QKY A;  5KJ7 A;  4JHJ A;  2K37 A;  1SQP J;  4N6J A;  2WXP A;  1SQQ K;  2ZYA A;  4PD4 I;  1JCD A;  1ZRT D;  3TWX A;  3A0H E;  1NJI Q;  3RRN B;  3IBE A;  2H8P D;  4PD4 D;  4W9R A;  3AS8 A;  4YND A;  2JR8 A;  2IO2 C;  2OYH A;  2IOS A;  2YXR B;  2MHK A;  3MYV A;  1URQ A;  3B5N C;  4HLE A;  5AVQ B;  1HG5 A;  3DWL G;  2VGX A;  4DK5 A;  5CCG C;  3EIJ A;  3CQC B;  1S1C X;  3M0D C;  1K1A A;  1X22 A;  3Q73 A;  3TGU J;  3OJA B;  1SLQ A;  1X0T A;  4Q96 A;  2N1T A;  2OV8 A;  5AVU B;  2WT7 B;  1FOS F;  1FCH A;  2B0O E;  2E43 A;  1U3C A;  4ASV A;  2BEQ D;  3Q2Y A;  1S63 A;  4AY6 A;  5EYP F;  1LWU A;  1XTC C;  3QWW A;  2J07 A;  3B4S A;  2WSS H;  3B8E B;  4O1P A;  3GHG B;  3PUK A;  2QEX P;  4KZ0 A;  4CRW A;  3W68 A;  3UQ3 A;  4BX9 A;  3LVQ E;  2P7J A;  2WQ7 A;  2FF4 A;  1IQU A;  4UI9 C;  3DSV A;  3TNU A;  3TWW A;  3WMM 0;  2L91 A;  2NRG A;  1IO4 A;  2HM8 A;  2AEM A;  2VSX E;  4ANV A;  2B89 A;  5DJT B;  3RL0 B;  2X6J A;  3AE6 C;  5EX0 A;  3PJS K;  2HR3 A;  4R4M A;  4DX5 D;  3N71 A;  2XS8 A;  1KQG B;  1NU1 E;  2Q6Q A;  4M7C A;  4U04 A;  1UOH A;  1OW8 A;  1FZF A;  1EXJ A;  3LS8 A;  1ZN5 A;  1KYO E;  2ZT9 B;  1M1J C;  1GW6 A;  1IFI A;  1RH5 B;  1K3Z D;  5BU8 B;  2ZGG A;  4G23 A;  4EHM A;  4FA6 A;  1E90 A;  4U3F D;  3ZXP A;  1PY1 A;  3PDN A;  4UQX A;  2XU6 A;  1N0R A;  2KC7 A;  2IBZ E;  5APS A;  3R9M A;  4H13 D;  2IYP A;  3PZ4 A;  5KLI C;  1S72 P;  1OY3 D;  1MX4 A;  5LX8 A;  1Q2Z A;  2OAR A;  1AQ5 A;  2A45 G;  1BSH A;  2J59 M;  4H13 C;  1P84 I;  3K9I A;  4ZKU A;  2H6I A;  2FYU J;  4HOR A;  4FLB A;  1UN8 A;  2GA1 A;  3HD7 D;  1AFO A;  4U63 A;  3S4R A;  4TXQ A;  2KSE A;  1FDO A;  2P9N G;  2MRI A;  4U8V D;  3PP5 A;  4IYP A;  1WT6 A;  2R32 A;  1YIJ P;  3PEV B;  3RO3 A;  4W80 A;  4OGQ B;  3JSV C;  4H13 B;  4RJT A;  1E79 H;  3FUF A;  1LT1 A;  3QWV A;  1SQQ G;  3AG1 E;  4C9B B;  4HRM B;  3H1K E;  4LLH A;  4PH4 B;  2JWD A;  3EHN A;  2JO1 A;  1UJK A;  1N4P A;  4AJW A;  2WPS A;  2E2E A;  1SQV D;  1DNP A;  1K04 A;  1NTK J;  1T3J A;  1SQB E;  5BT1 A;  2J08 A;  1MZC A;  2ZIR A;  5AW1 B;  4C7N A;  5G04 C;  5B66 E;  4L74 A;  3CWB D;  1SQX D;  3AE1 C;  1UW4 B;  3HVE A;  2HR2 A;  2LXB A;  3ASH A;  3CX5 I;  4HNA D;  2M3E A;  3FUN A;  3LY7 A;  3FUK A;  1J1E C;  1N73 C;  4EPZ A;  1OCZ E;  4NIK A;  4KT0 J;  2LXM A;  2J8S D;  3WG7 E;  3HRN A;  2A06 G;  3KZI H;  5AVZ B;  1JCR A;  3DSW A;  4GOD A;  4XI9 A;  3Q47 B;  2LKM A;  3CXH E;  1KMI Z;  2JLB A;  3AG3 E;  5HS0 A;  1NTM J;  2C2L A;  1DVP A;  3FH7 A;  3MEK A;  3SGH A;  3VOP A;  2MKV A;  5KLV J;  2ZAE B;  1FT1 A;  1MX6 A;  5HI7 A;  1SZA A;  1RE3 C;  3AE7 C;  1R8E A;  2WXQ A;  1SQP D;  2WSF J;  3Q15 A;  3RK3 C;  1GL2 A;  3Q5P A;  1BE3 G;  1BI7 B;  1W2B O;  2OVB A;  4AIF A;  4U96 D;  3JCU E;  4A1G A;  3VP9 A;  4J6I A;  1VQM P;  4U8H A;  3AJI A;  3LW5 J;  2QYJ A;  1KOR A;  1JUQ A;  4ACL A;  2R3S A;  1OXJ A;  1BGY G;  1T6A A;  4GPK A;  3LY8 A;  1PIX A;  3ULQ A;  5CRU A;  3UKR G;  4BY6 A;  3CIA A;  3T97 A;  2CPB A;  4A1S A;  1QLE D;  4UB8 H;  1N94 A;  3AU5 A;  3QWO C;  2M5A B;  3NAW A;  2C9N Y;  2KSJ A;  3G6E P;  1N4R A;  4HKZ H;  1OVV A;  1NA3 A;  3NZS A;  4CT0 A;  1AVO A;  4ZNC A;  5B3S E;  1WG0 A;  3HIZ A;  2K9J A;  2ZVO B;  2BED A;  4CGV A;  3T8M A;  1FS0 E;  2FUL A;  4CDR A;  2ILR A;  4BWR A;  3HUS A;  4D6T J;  1USD A;  3L75 E;  5AVY B;  4I17 A;  1M7L A;  3C3Q A;  5KLV K;  1JCQ A;  2WXH A;  1WDY A;  2BCC G;  4XKB A;  1NU1 J;  1NTM G;  2A45 H;  3L36 A;  3WU2 E;  3GYZ A;  3L74 J;  3ASD A;  4TUM A;  3U4T A;  3PE4 A;  3HTK A;  4XE5 B;  1H0T B;  1EXI A;  3SSU A;  1HS6 A;  3ZIM A;  1LD8 A;  5CJ0 A;  3FY4 A;  3LKU A;  2O01 H;  1OVU A;  3ABM E;  1FE6 A;  1OWL A;  1ELR A;  1USE A;  3KDP B;  1NTM K;  1PAQ A;  1T2K D;  5AW0 B;  3C98 A;  3CX5 D;  1VF5 C;  2KS1 B;  2QJY B;  4OGQ C;  1NA0 A;  1ZV8 A;  2WB2 A;  1RE4 C;  3VN0 A;  3NBN B;  3VP8 A;  3V5B A;  4PD4 E;  3CEQ A;  1XGW A;  3V2Q A;  4DX1 A;  3L73 D;  3D9M A;  3TGU G;  1PP9 J;  3L70 E;  4RG9 A;  1FPP A;  2V5F A;  4I1L A;  4LCT A;  4U3F J;  2P67 A;  3APF A;  1X81 A;  3RBZ A;  5HQ8 A;  1LWU C;  3HE4 B;  1KC8 Q;  2Y0B G;  3VTY A;  2NYJ A;  2FYU K;  3CXH I;  1JWF A;  3Q4A B;  3IFM A;  1HTL C;  2KLV A;  3M9H A;  3IKO B;  4LG6 A;  2KNC A;  3EJN A;  3SY2 A;  2XRY A;  4H7X A;  5CED B;  3G2W A;  1L4A B;  2N1T C;  3AE2 C;  4HVB A;  1LTJ B;  3JCK C;  4JZY A;  2IEJ A;  5KLV E;  3AE8 C;  3HD7 A;  1KB9 E;  1ZLL A;  3U1A A;  1AJY A;  3GLM A;  1PP9 D;  2YIU C;  1Q7Y Q;  1PV3 A;  2P58 A;  3L22 A;  3FTV A;  5BXU A;  1WMK A;  3ZW3 A;  1PPJ D;  3FTS A;  1O1R A;  1TNZ A;  2GUV A;  1IZN B;  3V4Q A;  3DXK G;  4XIF A;  2Q5U A;  1GL2 D;  4C46 A;  2DVW A;  2HE0 A;  3Q7F A;  2PM6 A;  4TT3 H;  1U2V G;  5ENT D;  5ENP D;  3MX3 A;  3PZ1 A;  2XGS A;  3Q9N C;  1VDF A;  1O1S A;  3T5V A;  1Y47 A;  5AVR B;  1NTM D;  1SW6 A;  3B7S A;  3PE3 A;  4FU3 A;  5KCM A;  4WND A;  3KD7 A;  4WWI A;  2E74 C;  3A7O A;  3G9R A;  2V0P A;  2HOD A;  2KXP C;  4PDX A;  4GIF A;  3H1L G;  3L08 A;  5FQ6 A;  1KIL E;  5G05 C;  1L0N J;  4G11 A;  4U3F E;  1HH8 A;  1ZOY C;  4BRY A;  3ZVV A;  3CCE P;  4J8D A;  2C0W A;  4H0L D;  2A06 E;  3HD7 C;  1JNM A;  1G2C B;  3LVR E;  3C3R A;  2YMY A;  4N5C A;  3MCX A;  4EZK A;  5M72 A;  3BRT B;  3CC4 P;  5AW3 B;  3FUL A;  1T2K C;  2D2C B;  1OFC X;  2OOE A;  1N7S C;  1KYO I;  3UT4 A;  1NFI E;  4GTQ A;  2HPC A;  2VQ2 A;  4Y28 J;  3H6P A;  3PLN A;  5E75 A;  4OH8 B;  2LXC B;  3NXS A;  3MKR A;  5E79 H;  3FU5 A;  1TJF A;  1KT1 A;  2R5B A;  3B71 A;  4YPC A;  2X6F A;  4XFJ A;  3CCU P;  5GTH H;  4WWO A;  1ZME C;  5CHE E;  2X6I A;  2ZU6 B;  1BCC G;  1V55 E;  3KEZ A;  3QOU A;  2GRM A;  2OND A;  3UIO C;  3Q1M A;  2V4H C;  3H1K D;  3Q9U C;  1BE3 J;  4GTR A;  2P10 A;  2DZN A;  4UWH A;  1A02 J;  3L17 A;  3NZU A;  1N7S B;  2DWZ A;  4JXT A;  4V3I A;  4D10 C;  4HOU A;  5BNW A;  2EIN E;  1IC2 A;  4DCK A;  5ENO D;  1FZA A;  3GW4 A;  3CV0 A;  3FU0 A;  4BSX A;  1L0N E;  2JEK A;  5CHX A;  2O01 N;  1KIL C;  1PFI A;  1VQN P;  1DEE G;  1EF1 C;  2OEW A;  4O9B A;  4I6J A;  3P32 A;  5CCH D;  2KIK A;  2QJK B;  1UN9 A;  4WWP A;  1GMJ A;  5T8I A;  2LNI A;  3HE5 B;  2K3R A;  3CK9 A;  3S2A A;  2L0I A;  4O60 A;  4IRU A;  3OAK A;  3ZNG A;  1A02 F;  1RF0 C;  1OXZ A;  2JWA A;  4JF7 A;  3SI5 A;  4BSZ B;  3TG5 A;  4NPD A;  3ASF A;  3S9O A;  5KJL A;  3CKB A;  2QRX A;  3PNL B;  3RIB A;  3L73 J;  1DCQ A;  3GW6 A;  1JPL A;  1EDI A;  1URQ B;  4WBA A;  3F89 A;  1NU1 D;  1NU1 G;  5EFW B;  4GYO A;  1VQ4 P;  3PRE A;  1NL4 A;  1LTT C;  5ARF A;  4BT8 A;  4GDO A;  5FT9 A;  2NZ2 A;  3APC A;  2B88 A;  2FEZ A;  1BE3 E;  3VMA A;  1BCC E;  2WXR A;  4WY4 D;  4A3T A;  3FTW A;  2Q9I A;  3S1K A;  2FFD B;  2DW3 A;  2QSI A;  4FLH A;  3LEW A;  5AN8 A;  2AXV A;  2ZFC A;  3CR3 A;  1KTM A;  4H0L C;  2IBZ D;  4I9C A;  5KAI E;  3H1I D;  3CCV P;  2A45 I;  1HXI A;  2OGU A;  3UM0 A;  4WNE A;  1NHL A;  2FO7 A;  3LYA A;  3AEG C;  4H7Y A;  3BCC G;  1JEK A;  5EYL A;  2ZXW E;  2HG5 D;  4TV3 A;  3I4R B;  3NTN A;  5CMW A;  4JC8 A;  5KJN A;  3SWF A;  3APD A;  2M8R A;  3AS5 A;  1V54 E;  2IFM A;  2P9I G;  4LSZ E;  4JA7 A;  4B89 A;  5C2Y A;  1E8W A;  4DRX E;  3PHL A;  4CYM D;  3EIQ C;  3MHV A;  3H1H G;  4HB1 A;  4APO A;  1H6O A;  2JEE A;  5A23 A;  1JO5 A;  5CMY A;  3H1L E;  2V4L A;  4G25 A;  5AW2 B;  1EDL A;  3UI2 A;  5APV A;  2XV5 A;  1H2V C;  3SFY A;  1KZP A;  2HYZ A;  2OYH C;  1LTS C;  4I6E A;  4ANW A;  1NWQ A;  4HS2 A;  3FDH A;  2K1A A;  5AW8 B;  2QYU A;  4BWN A;  3L35 A;  2YKP A;  2XEV A;  3AEA C;  3ABL E;  4U7J A;  3M9Q A;  3SQV A;  5FJY A;  1RQU A;  2FKW B;  2BCC E;  3MV3 B;  3G71 P;  3V2N A;  2JKV A;  3E33 A;  1EYH A;  3V30 A;  2PQR A;  2ZJS E;  3CX5 E;  5J08 A;  3LJ3 A;  1PGP A;  4BFR A;  2P1J A;  3PZ3 A;  3GG2 A;  1CI6 B;  5L8R J;  5KTB A;  1RZ4 A;  2PFX A;  3B7B A;  4IL6 H;  2XGO A;  5KLV G;  2RKK A;  1KQS O;  2DZO A;  3DEP A;  3IV0 A;  3R2P A;  3P7K A;  1JMB A;  2C9L Y;  3CD6 P;  2E76 D;  1EC5 A;  3VLE A;  3Q3D A;  3EHR A;  3BCC D;  3U59 A;  5CCH A;  3CXH D;  4JEU A;  4AXH A;  1EZV E;  2WPQ A;  3WUU A;  3PZ2 A;  1JTH B;  4UWF A;  3I56 P;  3VMY A;  3F6Q A;  3CSF A;  3KPE A;  2FYN B;  4MN4 C;  3TDK A;  1QZ2 A;  2P2C P;  1YBK A;  3SF4 A;  4MBG A;  4CZ2 D;  3TWS A;  4Z1M H;  3HG0 D;  2IX7 C;  3IN6 A;  2VYI A;  2WMN A;  2IPP A;  3E7K A;  1KIL A;  4RG6 A;  3T9K A;  3V79 K;  5BV1 A;  3GHG C;  3A0H H;  3L75 J;  2YKQ A;  4N78 D;  2WXG A;  4U7E B;  2L0T B;  2ION A;  5BXO A;  5DIZ A;  3L74 D;  5AVT B;  4YTP C;  5CBN A;  4L75 A;  3L74 G;  1NAF A;  4EBA A;  3FTX A;  5AEN A;  1Z6T A;  1FZC C;  2E74 B;  4YVQ C;  2ZT9 C;  2WVR A;  4IN3 B;  1OVR A;  3E34 A;  5APU A;  2WPV B;  4NQ0 A;  4AYC A;  1ZXG A;  3CXH H;  2YXQ B;  4F6R D;  1NH4 A;  2FYU G;  3L72 E;  4GML A;  1KZU B;  3JQ0 A;  2RH0 A;  2QJP B;  2HOD B;  4JD2 G;  4K5A B;  3UT8 A;  2NPS D;  3QAR A;  3L4F A;  3VLF A;  1FVF A;  5AVX B;  4UWL A;  4AUW A;  5AW6 B;  2XKM A;  3LJN A;  1OWP A;  2WT7 A;  1GL2 B;  3RK3 E;  3L71 J;  4KXK B;  1G2C A;  2OYI A;  3O8Z A;  3FHE A;  4U8Y D;  2O1K A;  5JJT A;  3PTZ A;  3EWK A;  1N0Q A;  3CLJ A;  5EIB E;  5ENQ D;  1BU9 A;  4O6F A;  1L5J A;  3CCJ P;  2J5U A;  3MJW A;  4G8K A;  3CWB G;  3H1I J;  5EKQ D;  2UY1 B;  2WXM A;  1H88 A;  1LT9 A;  1OT8 A;  5AYW D;  1KV4 A;  3CQG B;  2KLU A;  3VYI A;  3TXM A;  4L9P A;  1L2P A;  3LW5 H;  1MHQ A;  1ZB1 A;  1LWU B;  2E76 C;  1QVF O;  1K8K G;  2KCK A;  2RFM A;  4G26 A;  1X5B A;  4Q69 A;  1FJK A;  5TJH A;  4Y6C A;  1KFN A;  1GW4 A;  3CC7 P;  2AEF A;  1GZL A;  3LCA A;  4O1O A;  2KZJ A;  3VTX A;  2WSF H;  3OXG A;  4TUU A;  4GTM A;  4PS8 A;  2Y4T A;  1MFT A;  2WM9 A;  1E96 B;  1VQP P;  5FQ8 A;  3TAX A;  5D0O D;  5CJ4 A;  3S7J A;  2B6C A;  2J58 A;  4I1O B;  1NKN A;  3L70 D;  3DSU A;  3L71 E;  4JQ0 D;  2KP8 A;  3V2P A;  3UTM A;  2F37 A;  3ONL A;  3H1J E;  2VTB B;  3BG0 B;  5D66 A;  3MV2 B;  3MTU E;  1NOH A;  3H32 A;  1ZR2 A;  1SZ9 A;  3N7N A;  5KJM A;  2VSN A;  4GOF A;  2LO6 A;  2R5S A;  3L73 E;  4ILG A;  3FP3 A;  5AQ7 A;  3PH0 A;  1Y6I A;  3ZKJ A;  3ABV C;  4I2Z A;  4KVM A;  3CVU A;  4BEP A;  1IYG A;  1Y8M A;  4I7Z C;  2AXT E;  4XA4 A;  4A63 B;  2IJG X;  1PP9 E;  1DD3 A;  1JMM A;  3D9P A;  4NPF X;  1VPC A;  3RRM B;  2VSY A;  3SNX A;  1FU1 A;  3TGU D;  1WAO 1;  2CPS A;  4FJZ A;  4PV1 C;  4X8Q A;  3L73 G;  4I1M A;  3CLQ A;  2EQX A;  3B7U X;  4B8C B;  4I6M C;  3RK3 B;  2R3C A;  3DRA A;  3I5C A;  4EYY Q;  3RSE G;  5CCG A;  1E5W A;  1NZN A;  4RO0 A;  3FWN A;  4KBQ A;  1U7M A;  1YJW P;  3T5X A;  4RKU J;  3HXF A;  2ZYG A;  1YJN P;  4CCA A;  2E75 B;  1N4S A;  4AP2 A;  3H1K G;  3OXF A;  4PS3 A;  5ENN A;  4AVX A;  5FIO A;  4W7Z A;  1HX8 A;  1BCC D;  3M0A A;  3H1H J;  1FVH A;  1NI1 A;  3KXD A;  1KYO H;  3PUJ A;  3D9J A;  3TJP A;  1X9V A;  2WIT A;  2JAB A;  5B1B E;  4GTS A;  2ZXX A;  2K88 A;  2R2L A;  4B8A A;  2Q7F A;  3U66 A;  4DT0 A;  2JJL A;  4GYW A;  1M8O B;  2CFU A;  3FUD A;  3FGA D;  1VQ6 P;  5D0Q D;  1LT9 C;  1PC2 A;  3QJZ A;  2R05 A;  4WNG A;  4BER A;  1D9S A;  1PGQ A;  3I55 P;  2FXP A;  2O01 J;  1NU1 K;  1YI2 P;  4FP7 A;  4UQY A;  1FZB A;  1LD7 A;  5KJ7 C;  3GMA A;  3TL5 A;  2V4H A;  2FYU D;  1GL2 C;  3L16 A;  4PJ0 H;  2FBN A;  3CVY A;  1IFN A;  1GU5 A;  5D2M C;  4Y99 B;  3AS4 A;  1EDK A;  2QE7 H;  4K0R A;  4L23 A;  4XI0 A;  2QJK C;  2CFZ A;  2R03 A;  4WWN A;  3P8C E;  1OWM A;  3ZXS A;  1AP7 A;  4DZO A;  1QL2 A;  4L1B A;  4BRY B;  1EPU A;  2E5T A;  4PD4 H;  3H32 B;  1KPS B;  4M3L A;  1CW5 A;  2VGX B;  2L6J A;  3FTZ A;  2XNX A;  4NAC A;  3PS6 A;  1J1D B;  2V8S E;  1N7L A;  2PP6 A;  1NYH A;  1L0N D;  5A7D B;  1AA0 A;  3IXE A;  2VRS A;  5JHA A;  4FHJ A;  1NTZ D;  1EQ7 A;  2B87 B;  5BW8 C;  2GM4 A;  1E7V A;  3N4X A;  5AW5 B;  1ZU2 A;  1RY3 A;  4ZHB A;  2AJA A;  1SFC B;  1IFP A;  4J8E A;  1MJ0 A;  1PP9 G;  3B5N B;  3GHG A;  1HO8 A;  5APW A;  3PNT B;  4I6G A;  3RL0 g;  2OYH B;  2Q1K A;  3CVN A;  4LUN U;  5JMN D;  2PL2 A;  2NPS A;  3IF4 A;  5FZR A;  4LNB A;  1S70 B;  4ATZ D;  1GW3 A;  3MIW A;  1RF1 C;  1SQV E;  3ZYQ A;  2AXC A;  1M1J B;  3FU3 A;  3MZL B;  1SFC C;  1RF0 A;  3D9H A;  4JW1 A;  5GTI E;  4ACK A;  3LIE A;  3QH9 A;  5FTP A;  3H25 A;  2HLO A;  1JY3 O;  1SQB J;  3C72 A;  2LAH A;  1N2D C;  3U3W A;  3FUE A;  1RF1 B;  3LXU X;  2FBW C;  3HUS B;  2P9U G;  5B1A E;  1K05 A;  2A5E A;  2Y3A A;  2OVF A;  1BE3 D;  3AEC C;  3C3O A;  3ZN3 A;  3ZFW A;  1ZP0 C;  2YIN A;  3W9G A;  1DC2 A;  1DCE A;  1ELW A;  1B89 A;  2YNY A;  2QG4 A;  3PZD A;  4QMA A;  3O6Q B;  1OWO A;  4GT1 A;  2AWI A;  4ILH B;  1H0T A;  1JY3 P;  4JA9 A;  2PQN A;  4YDY A;  3NF1 A;  2MOW A;  3L72 J;  1EDU A;  1W2E A;  3KQG A;  3V2X A;  2KS1 A;  1YA0 A;  1NKZ B;  1HF8 A;  1MQS A;  2FFD C;  2WXL A;  4WY4 B;  3CKC A;  1L0L G;  1E7U A;  4HOT A;  5H2F H;  4CT4 A;  1S5L H;  1LTG C;  1OW7 A;  1Z3X A;  3MZW B;  2BKK B;  4I43 A;  2BF0 X;  4M3O A;  2RN0 A;  3H1I E;  4B94 A;  1BDD A;  3V4W A;  2R59 A;  3M06 A;  4WVZ A;  3CL3 D;  2MJZ A;  4NUR A;  1P84 H;  2AEJ A;  3GF3 A;  4RQI A;  2CHW A;  2Q3E A;  5KKZ C;  5G04 J;  4B86 A;  3D6Z A;  3QB2 A;  1KFM A;  5E79 E;  1DH3 A;  1BCC J;  3H1L D;  3C8V A;  4B0Z A;  4D6T G;  2H43 A;  4D6T D;  1YJ9 P;  3L9T A;  4GMJ A;  5ENS D;  2IBZ G;  2NSZ A;  4WNF A;  2H7H A;  3S7D A;  3FFL A;  1SQV G;  1LTJ A;  3L72 G;  3FTY A;  3MKQ B;  1OWA A;  4FHK A;  1IJD B;  5AQA A;  1NVO A;  1HG2 A;  1CZQ A;  3SFZ A;  3ZHE A;  3A2A A;  3TK1 A;  1L4A A;  3E37 A;  5AVS B;  3NMD A;  4ATG A;  3OA7 A;  2CHZ A;  4PUC A;  4C7N B;  4YDE A;  2R17 C;  2LUH A;  3GZ2 A;  3UX4 A;  2WMM A;  1RE4 A;  4HFG A;  4GZC A;  4GA0 A;  5B5E H;  3JCU H;  5M1B A;  2A4Z A;  4KMO A;  4IL6 X;  3CHQ A;  4JHK A;  3NB2 A;  1VF5 D;  4OVU A;  2L9B A;  2BCC D;  1VQ8 P;  1JWG A;  3L71 D;  1T3U A;  2YKO A;  1IKN D;  1NTK E;  1MZ9 A;  2XPI A;  3PH0 C;  3QC1 A;  1QL1 A;  4K5B A;  1WM5 A;  1JOC A;  3FH8 A;  4EQF A;  2Y0E A;  1OCR E;  3LPZ A;  4L7T A;  3EQ2 A;  1MKM A;  1MFZ A;  1AVY A;  3H1K J;  5DBK A;  3FWV A;  4U3F G;  4L2Y A;  4HRN A;  3NQP A;  5BV0 A;  2P9P G;  1VF5 B;  1BPO A;  4XKC A;  4DX6 D;  3R7Q A;  4OAV B;  1OWN A;  4DPR A;  4E6H A;  5C39 A;  5LCW C;  4UUC A;  3TWT A;  2L5G B;  5GTH E;  2Y0C A;  3EU5 A;  3KAE A;  1X8Y A;  4OVN F;  4EDF A;  1HF9 A;  2CG3 A;  1SQX G;  2O1J A;  3FUM A;  5KWD A;  1K9M Q;  2R44 A;  4OVV A;  1N73 A;  4IL6 E;  1H89 A;  2ZT9 D;  3CHM A;  1LTX A;  1PGO A;  2IZ0 A;  5BU5 A;  5KNG A;  3UIP C;  2UWJ G;  2AVP A;  4LNG A;  2I8D A;  2NC9 A;  1S9K D;  2BEZ F;  4H44 C;  2XCB A;  2W90 A;  3CPW O;  2KAT A;  3HXD A;  4C0M A;  3J5Q B;  3AAA C;  1SQV K;  3O4Z A;  3JC2 2;  4N78 E;  3II6 A;  1WRG A;  3UM2 A;  1SQM A;  2WQ6 A;  1NO4 A;  1S5L X;  1ELK A;  2ZIS A;  1BSN A;  2XEE A;  5ANR A;  5FQ4 A;  1TJC A;  1HZ4 A;  2K9J B;  3G2V A;  2D2C C;  3E4B A;  3ZYL A;  1Q2N A;  1YYH A;  2P9L G;  1Z5S C;  3D6Y A;  4CPG A;  5K5G B;  4AEZ C;  4J8F A;  4JPZ B;  2YHC A;  3RK3 D;  2IOL A;  5FQ7 A;  3U9W A;  2YO2 A;  4QQI A;  1QQE A;  3R4Y A;  4HLL A;  4URK A;  3ESL A;  2N9Y B;  3S7F A;  4DLO A;  1HGV A;  5G2N A;  2QY7 A;  3D71 A;  3UPV A;  4ANU A;  3CHO A;  4LRZ A;  4MKT A;  2RFA A;  4EZJ A;  2POH A;  1LTA C;  1OUV A;  5LCW J;  1HFA A;  3ESK A;  3L13 A;  1SA5 A;  2GRO B;  2FYU E;  4G2V A;  1Q86 Q;  4DI3 A;  4GKG A;  1IK9 A;  2Y1L E;  2HO1 A;  2G3A A;  2XPY A;  5CCH C;  1P84 D;  3CC2 P;  3B13 A;  2J49 A;  4QFV A;  1H8A A; 
#chains in the Genus database with same CATH homology
 4HB1 A;  2QC9 A;  3NOC D;  4GPM A;  5AAO A;  2V4H C;  2QVA A;  4NPE A;  4K35 A;  1IKN D;  5HRY A;  4K5B A;  4K3A A;  3Q9U C;  4K5A B;  4DX2 A;  3B95 A;  1G3N B;  2ZAE B;  1MX6 A;  2BKG A;  2DZN A;  2Y0B G;  2NYJ A;  1AWC B;  2DWZ A;  5FIO A;  1EDL A;  3JUE A;  3UI2 A;  1K3Z D;  4DX7 D;  3LJN A;  2XZD G;  4ZFH A;  4LG6 A;  5ENO D;  2ZGG A;  5HKP A;  2ETA A;  2V5Q C;  3ZU7 B;  2A5E A;  5EN5 D;  2VGE A;  3RGU A;  4HI9 A;  2SPZ A;  5CED B;  1BI7 B;  2JAB A;  1N0R A;  3DEO A;  4U8Y D;  4HRN A;  2ZGD A;  5EID A;  1QYM A;  1N0Q A;  3KEA A;  4U96 D;  3W9G A;  4BXL A;  1S3J A;  5ENQ D;  5KNH D;  5EIB E;  5ITZ F;  2PNN A;  1DEE G;  2LR2 A;  4DX6 D;  3AJI A;  4OAV B;  1DC2 A;  2QYJ A;  4BET A;  5C39 A;  4G8K A;  4UUC A;  5CEC B;  3TWT A;  1K1B A;  1BD8 A;  3JXI A;  4DUI A;  2KIK A;  1JM0 A;  2P58 A;  1OY3 D;  2XZT G;  1OT8 A;  5BXU A;  1MX4 A;  3V30 A;  5KWD A;  2R44 A;  3EU9 A;  1MX2 A;  1H0T A;  3TWQ A;  2K3R A;  2RFM A;  4YDY A;  3TWR A;  1BU9 A;  1SS1 A;  3V2X A;  1MYO A;  4O60 A;  2ETB A;  3QWO C;  5KNG A;  3UXG A;  4BER A;  1D9S A;  2M5A B;  3ZNG A;  1LP1 A;  2KI7 B;  1LP1 B;  2MYO A;  3T8K A;  2M0B A;  4O1O A;  2DVW A;  2I8D A;  2HE0 A;  3B7B A;  4BSZ B;  2KZJ A;  3ZDM A;  1A5E A;  4NPD A;  4HKZ H;  1OVV A;  5ENP D;  5ENT D;  3JXJ A;  4U8V D;  1MFT A;  4ZNC A;  1WG0 A;  4IOI H;  4KJM A;  3J5Q B;  3TWX A;  1BDC A;  4B93 B;  3AAA C;  2DZO A;  2QRX A;  3DEP A;  2BKK B;  3MZW B;  5FIN A;  3TWV A;  4BES A;  1TR4 A;  1JMB A;  1DCQ A;  2KBX A;  3Q9N C;  1EC5 A;  1BDD A;  1EDI A;  2UWJ E;  1Y47 A;  2XEH A;  1SW6 A;  1YCS B;  3EHR A;  4G8L A;  4DX1 A;  1EDK A;  4RLY A;  4K5C A;  3V31 A;  4F1P A;  4ASW A;  1LT1 A;  4WWI A;  1U7J A;  2XEE A;  5EIL A;  4Z68 A;  5EFW B;  1BI8 B;  2KXP C;  4HBD A;  4HRM B;  1K1A A;  4N5Q A;  1Q2N A;  1YYH A;  1ZW0 A;  1WDY A;  2F37 A;  1AP7 A;  2JWD A;  3F6Q A;  5CBO A;  4LNU D;  5D66 A;  1X0T A;  4OAU C;  3UTM A;  4CPG A;  4MN4 C;  1BLX B;  2B88 A;  2P2C P;  4HI8 A;  3J5P A;  5K5G B;  4CZ2 D;  2B0O E;  3W9F A;  5DJU B;  5ENS D;  2B87 A;  4GOF A;  3TWS A;  4ASV A;  3S1K A;  2KZI A;  4HB5 A;  4HRL A;  4TUM A;  3HG0 D;  4QQI A;  5AN8 A;  4HLL A;  4JBZ A;  1H0T B;  5AQ7 A;  2XEN A;  5EYP F;  5KBA A;  3PH0 A;  3T9K A;  3ZKJ A;  3V79 K;  5ENR D;  2KUB A;  3FXD A;  3IXE A;  2OTK E;  1SVX A;  5AQA A;  4BEP A;  1OVU A;  1NVO A;  2B87 B;  4O1P A;  1NFI E;  5CEA A;  3EHQ A;  5BXO A;  4A63 B;  4GOE A;  2LXB A;  5CBN A;  3C5R A;  1IXV A;  5AQB A;  4HNA D;  4C48 B;  4NPF X;  5AAR A;  2RKL A;  2FO1 E;  4ZHB A;  2AJA A;  5JA4 D;  4J7W A;  2ETC A;  2RFA A;  1YMP A;  4HQD A;  3TWW A;  1MJ0 A;  4J8Y A;  3SO8 A;  2KS1 B;  2WMM A;  2LXC B;  4JB8 P;  4NIK A;  1OVR A;  2L6B A;  3TWU A;  5EYL A;  2Q1K A;  2J8S D;  1ZXG A;  4HJG H;  3V2O A;  5CER B;  5AQ9 A;  2F8X K;  5JMN D;  4ZMD A;  2B89 A;  5DJT B;  3NBN B;  4U95 D;  4F6R D;  4EYY Q;  1S70 B;  4ATZ D;  4GOD A;  3HRA A;  1EDJ A;  1IHB A;  2Y1L E;  1N11 A;  4LSZ E;  1FC2 C;  2HR3 A;  2M5A A;  2F8Y A;  3NOG D;  4YDW A;  3ZUV B;  4DRX E;  4DX5 D;  1U7M A;  3FXE A;  4CYM D;  4QFV A;  5HS0 A;  3D9H A;  1UOH A;  3MHV A;  4GMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...