5CBOA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbp3-16,Immunoglobulin G-binding protein A
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
total genus 55
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cboA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cboA01
1EDJA 4DX7D 1NFIE 2B89A 3RGUA 1K1BA 4J8YA 1BU9A 1LP1A 1H0TA 4DX2A 2XENA 3ZDMA 2BKKB 4OAUC 3UTMA 1DEEG 1JM0A 3ZKJA 4NPFX 5CBNA 3MHVA 5HRYA 3UXGA 4O1OA 3KEAA 1SS1A 3PH0A 5AQBA 2M5AA 2DZOA 4HBDA 2HR3A 2ETBA 5KNHD 4A63B 4OAVB 4RLYA 3J5QB 2J8SD 1NVOA 4O1PA 1A5EA 1U7MA 4Z68A 4ATZD 2QC9A 5CEAA 1BI8B 3TWXA 1U7JA 2DWZA 3MZWB 1SVXA 1EC5A 1N0RA 4YDWA 4K5BA 4HNAD 2KZJA 4HI9A 1UOHA 4O60A 2RKLA 4NIKA 3V30A 3B7BA 5ENSD 4HRMB 3FXDA 1S3JA 5BXOA 1JMBA 2M0BA 2DZNA 2WMMA 4LSZE 1BD8A 1DC2A 4DX1A 1WG0A 4F1PA 5AQ7A 1YYHA 2XZTG 3EHRA 5AQ9A 4UUCA 4YDYA 4IOIH 3V79K 1SW6A 5ENOD 4NPDA 2ZAEB 1OT8A 2HE0A 4B93B 1QYMA 3TWUA 4TUMA 5EN5D 2ETCA 1AP7A 2KXPC 5CBOA 4ZFHA 2RFAA 2B87A 3EHQA 1MX4A 1LP1B 1H0TB 4QQIA 4ASWA 2P2CP 3AJIA 5K5GB 1K1AA 4K5AB 3ZUVB 4GOEA 3EU9A 5HS0A 4HB1A 3J5PA 5KWDA 4C48B 5C39A 4F6RD 5FIOA 1IXVA 2LXBA 2JABA 4HI8A 5EYPF 4K3AA 4BESA 4QFVA 3V31A 4GMRA 5JMND 2UWJE 2R44A 2BKGA 3HRAA 1YMPA 1ZW0A 1OY3D 4BETA 3DEOA 1YCSB 1MFTA 1S70B 4GODA 1G3NB 3T9KA 2VGEA 3JXIA 4U96D 5ITZF 4ZNCA 1MJ0A 2V4HC 5EYLA 3S1KA 5D66A 4K5CA 3TWTA 3W9GA 4MN4C 4KJMA 5JA4D 5EILA 4CYMD 4HRNA 5BXUA 4HLLA 2XEHA 4LNUD 1N11A 4BERA 4ASVA 2I8DA 3Q9NC 1BLXB 2SPZA 3D9HA 4JB8P 3NBNB 2ETAA 4CZ2D 2XEEA 3C5RA 4GOFA 4HQDA 2ZGGA 4DX5D 1EDLA 2KS1B 4EYYQ 1FC2C 3JXJA 2KI7B 2KZIA 4G8LA 1LT1A 5AQAA 3TWWA 3F6QA 2LR2A 2JWDA 4BXLA 3TWSA 2B87B 4DUIA 2L6BA 3JUEA 4HJGH 2KBXA 3IXEA 3Q9UC 3NOCD 4NPEA 3B95A 3DEPA 2P58A 1D9SA 1MX6A 1TR4A 5KBAA 2MYOA 3V2XA 1EDKA 3T8KA 1IKND 1MX2A 5FINA 3TWQA 3ZU7B 3LJNA 3FXEA 2M5AB 3V2OA 3SO8A 4U95D 4G8KA 2Q1KA 1OVRA 2RFMA 5DJUB 3UI2A 1IHBA 4ZHBA 1EDIA 2DVWA 3HG0D 4U8YD 5ENTD 4HKZH 1BI7B 1AWCB 2AJAA 4J7WA 2KUBA 1WDYA 1Y47A 5CEDB 2V5QC 4HRLA 1BDCA 1MYOA 5CECB 1X0TA 2QVAA 4DRXE 4WWIA 2PNNA 3TWVA 2A5EA 5CERB 2FO1E 4U8VD 2F8XK 4K35A 2XZDG 4GPMA 4DX6D 2F37A 5ENQD 5KNGA 1ZXGA 1N0QA 4CPGA 5AN8A 4ZMDA 3ZNGA 2QYJA 2ZGDA 3QWOC 2B88A 4HB5A 1BDDA 5ENPD 2B0OE 1K3ZD 1OVUA 4N5QA 1Q2NA 5AARA 5EFWB 4BEPA 2KIKA 2K3RA 4JBZA 5ENRD 5DJTB 4BSZB 1DCQA 3W9FA 2NYJA 2OTKE 5EIDA 5AAOA 2Y1LE 2QRXA 4LG6A 1OVVA 5EIBE 2LXCB 3TWRA 2Y0BG 5HKPA 3NOGD 2F8YA 3AAAC
chains in the Genus database with same CATH superfamily
2X6FA 1NTMK 1EDJA 2OVFA 2A06D 1OXJA 3IKOB 2E5TA 5CMYA 3V4QA 2E75D 5KCMA 2FBNA 2WSEH 1VQ4P 3RRMB 1SQMA 3OXFA 2PFXA 4KT0J 2OYIA 1IK7A 1H0TA 1UN9A 3F89A 1GTWA 2P9NG 3Q7FA 4WAFA 4JL0A 2XGSA 3UTMA 3SFEC 5BVZA 2XCCA 3GMAA 3APDA 3OAKA 1JMMA 3VMXA 2O01J 4DK5A 4XE5B 5B66H 1KTMA 5FJYA 4JYBA 2YKOA 5CBNA 3L73E 3MHVA 1IFMA 4N3BA 5CHXA 1KZPA 4JZYA 2H6GA 4O1OA 2JEEA 2WXIA 3H1IE 3CCMP 1IC2A 2CHZA 2X6JA 3MKQA 2XRZA 4KXKB 2B6CA 2ILRA 3ZYKA 2VQ2A 5B1AE 2WSCJ 3DSXA 2VSXE 1RW2A 4WNFA 2FXPA 4PUCA 3CVYA 5G05J 1G2CA 2FFDA 3L4FA 4ZKPA 1NL4A 1OX3A 3V6IA 1SVFA 1KC8Q 1T3UA 2FKWB 4MS6A 4EI2A 1WY6A 1JY3O 2R03A 2HR3A 1S64A 2EIME 4G25A 3U64A 1UIIA 4A63B 5C1DA 2CHWA 4AVXA 1RH5B 1NTKG 4WBAA 1KD1Q 2J8SD 4BX9A 4O1PA 1U7MA 4GIFA 1L0NG 1H8AA 3L75E 4JHRA 1Z3YA 2E2EA 2QC9A 4UQYA 5CEAA 4OGQD 2KM4A 1ZRTD 4IN3B 2IQCA 4KMOA 3R7QA 2A45H 1RF1A 1AVOA 1QZ2A 1SVXA 4UI9C 2YO3A 5CMZA 4FADA 1HO8A 1VPCA 3S9OA 2HYZA 1CI6A 2I1KA 2KZJA 3GW4A 3P1UA 3OXLA 1QVGO 4N5CA 3C98A 1KB9H 2Z5IA 5A23A 1LNQA 4HI9A 3M0DA 3MIWA 1ZB1A 4O60A 4BY6A 2RKLA 3FUFA 1U3DA 3V30A 4PDXA 2J59M 1KQGB 1FZBA 5BXOA 1LTAC 2FYZA 5E76A 2E74C 5KJNA 3AE9C 2QJYB 1HZ4A 5CJ0A 3G2TA 4K0RA 4AV7A 3AEAC 3FUMA 2QJYC 2WMMA 3S7FA 1Q86Q 4JPSA 1DC2A 1ZLLA 1WG0A 3L13A 2E5YA 1LGHB 1SZ9A 3FTVA 3L72J 1USDA 2WXJA 3LYAA 4U3FE 1YYHA 1MKMA 3P8CE 2X6KA 2WXQA 1SQQD 5KLVE 1OWPA 3ZFWA 4NQ0A 1URQD 2KS1A 1H88A 1SP4A 4EPZA 2VGXA 1OT8A 2IDBA 3LDZA 1QYMA 1DEBA 3BASA 2FXOA 2WSFH 1BPOA 4F1SA 1NKZB 3EIQC 2XU6A 4LNBA 2ETCA 3CCSP 1JB0J 3FU5A 3RU0A 2H8PD 1LJ2A 3M0AA 1AP7A 3GZ1A 1MFZA 2FYUG 4ZFHA 2RFAA 4PS7A 1SQXG 1KV4A 3EHQA 3Q5SA 1LP1B 4QQIA 3VTYA 1PPJE 3PRJA 2LSUA 3AE7C 3R9MA 1K1AA 2AEFA 1FOSE 5KJ7D 1BGYJ 4GOEA 3RL0g 4TLFA 3HD7B 3J5PA 2D2CD 3HD7C 5KTBA 4B8CB 1P5QA 3PZDA 2N9YB 1H0AA 1EQ7A 1LD7A 3CK9A 1NAFA 3A0BH 4UI9J 4N6JA 3CXHD 2JABA 4HI8A 2P1JA 3AE2C 4R7LA 3HXBA 2VTBA 4H13B 3RL0D 3FEYA 4BESA 3NZSA 4H13C 1YITP 5DBKA 1BCCG 3FHEA 1HGVA 5AVZB 2IBZE 3CSTA 2JEKA 4GMRA 2JP3A 2UWJE 2R44A 4B89A 3D6ZA 2EIKE 3PREA 5KLVG 4PV1C 3D9LA 1J1DB 3N71A 1HGZA 4JXTA 3E33A 2ZYDA 4M3OA 1G3NB 2C0WA 2GRMA 1VQPP 4U96D 1S4XA 2KNCB 5M72A 1PP9D 5EYLA 1CSBA 3VLEA 1K8AQ 4R4LA 3H25A 5D66A 3MKRA 4G26A 2ONDA 1E5WA 4MN4C 4RO0A 1EZVE 4I6MC 4HRNA 3FTWA 2YHEA 2HPCB 3L73J 2OGUA 2XZRA 2C0MA 1JY3N 2YQ8A 4LNUD 1NTKK 2Z4EA 5LCWC 1N7SB 4ASVA 3II6A 3GF3A 4V3IA 4U07A 1N4QA 4PH4B 1BE3E 4GAAA 3NZUA 2OEVA 4CT4A 2DIWA 1Y8MA 4AOFA 3CL3D 2C9NY 4JB8P 1DD3A 3TNUB 3CD6P 1ELKA 1N73B 1QX8A 2FYNB 4GDOA 2P9IG 2VSOE 4I17A 5KJMA 1N73C 2VSNA 3ZW3A 4IULA 2XQ0A 4MRUA 4CZ2D 1QVFO 2P9UG 3CCVP 1H6PA 1JCQA 2WXLA 3M06A 1M1JA 4DJGA 3ABME 3QC1A 1T2KC 3JCUH 4L7TA 3T97A 1A02J 3HE4B 3FWVA 4HQDA 3KZIE 2IBZG 4GKGA 3L75J 3NFQA 3PUJA 3MTUE 5TISE 4H0LC 1GDTA 3JXJA 1UG3A 2KZIA 4WY4B 1LT1A 1K04A 4AM9A 1INZA 4GZ5A 2HM8A 3QWWA 5LFAA 3CKCA 3F6QA 4PD4D 3E7KA 1H6KA 5AW8B 3I4GA 2X3MA 3D9OA 5T4YA 1IK9A 1NTZG 1PY1A 5FQ7A 3RKVA 3C3OA 1JY3P 4BXLA 4GB9A 4L2LA 3G2WA 3L71G 4WNGA 3B8EB 3Q79A 2WXFA 4D6TE 3IXEA 3IV0A 5AW0B 3H1LG 3NOCD 5AVWB 3B95A 4YVQC 3UT7A 3L16A 1D9SA 1QL1A 3TGUD 3UT4A 1CW5A 1LTJB 1TR4A 2LXLA 5APXA 2M8RA 1BCCJ 1BE3G 1EDKA 2IYPA 1KT1A 2RN0A 2E75B 4U3FJ 3FUJA 3T8KA 3HIZA 5LOZA 1GW6A 1MX2A 2KZTA 1M56D 1X5BA 5KLVJ 3ZU7B 3Q73A 2IZ0A 3O4ZA 2M5AB 1TJCA 3A3YB 4U95D 1UIXA 2Q1KA 1PL5A 4N39A 2KLUA 1OVRA 3KEZA 3CC2P 3CCLP 3UI2A 2DYRE 1PC2A 4ZHBA 2AXVA 3P2BA 5LCWJ 2DVWA 1SFCA 2C9LY 4GMJA 3GF7A 3HG0D 1GL2C 1SQQE 5ENTD 4ZKUA 4GCOA 3USSA 4J7WA 1WDYA 3VMYA 5CEDB 3FUNA 1W2BO 1JNMA 3I5CA 3U9WA 4XE0A 1OWNA 3SZ7A 3VMAA 3QARA 4JEHA 2AXCA 3IFMA 3FY4A 4G11A 1QL2A 3BQOA 5AJDA 5C2YA 1NTME 4TXPA 3FH5A 1RE4A 4IRUA 3A2AA 4J8SA 3HUSC 1AV1A 1X0TA 3AS8A 2QVAA 3CWBE 1EPUA 4ACLA 1SQVE 5JJ7A 3TWVA 2BCCG 2W83C 1KMIZ 2FO1E 3D71A 1N86A 2JDIH 3B13A 4I2ZA 1KYOD 1OXZA 3BU8A 4BFRA 3P7KA 1NTKD 2XZDG 2XDJA 4JW1A 4DPRA 3RK2D 4I2LC 3D6YA 4DX6D 1P84I 1L0ND 4H7XA 1ZV8A 1QEXA 1RE3A 1B89A 1VF5D 2L0IA 3A7OA 2E43A 4RJTA 3MA5A 4OGQB 2YKPA 1KFNA 3KZIH 3QK0A 4H44C 2Y4UA 4P29A 5AN8A 5TISH 4JA7A 3L54A 4GMLA 2WXRA 3JUIA 1W5CE 3PZ4A 3H1HE 2O01N 3QWOC 5E79H 2B88A 3ONKA 1BDDA 5AW1B 2KSEA 4J8DA 3CX5E 2IONA 2B0OE 2KCKA 4N3AA 2M3EA 2IJGX 5AW9B 1Q2NA 2CG2A 5AARA 3VP8A 4Y28J 4I1LA 4BEPA 2NPSD 5CCLA 2KIKA 1X81A 1E8YA 1YTZT 3B5NC 2CFUA 2QA4P 4C7NA 3RK3E 3CCUP 4L75A 2WT7A 2NYJA 3R4YA 3ASHA 2WITA 2WQYC 3IAOA 1Y9BA 3E1RA 3LY7A 1L4AA 3UM1A 2ZISA 1USEA 3TL5A 3D9PA 3VLFA 3ULEG 5EIBE 1OUVA 4U0UA 1S9KD 3WXXA 4TUUA 1NZNA 3VN0A 2AXTE 3G2UA 2DCPA 3TWRA 3E1IA 5CRUA 1VQ5P 4FC8A 1H2UA 5HKPA 1S5LH 2Q9IA 2IOSA 3AE6C 1NA0A 1SQPG 3H1KG 3L08A 1BE3J 4YDEA 1URQB 3CHRA 4KT6B 2B89A 1LWUB 1URQC 2IFNA 3AEDC 5AENA 4J8YA 2XS8A 5KLIB 3RO3A 1L5JA 1ZR2A 4LERA 3UIAA 5KLIC 1LT9B 1E90A 3SWYA 2WXMA 4DX2A 4UQZA 1T8ZA 3ZIMA 3TAXA 3ZDMA 2FYUD 4OAUC 1SQXD 2V7QH 3CI9A 1TN8A 2PQNA 4ACKA 2Q7CA 1KQLA 4O9BA 1UJKA 1JM0A 1RY3A 4GTRA 3PRZA 2AEJA 1OFCX 2N1TB 1RF0C 1OMIA 3CVWA 1YTZI 1WRGA 2N1TC 2HG5D 3EFGA 4CT0A 3KEAA 4TV3A 2NXPA 2D2CB 4KVMA 4O6FA 3U3WA 3NAWA 2FI7A 5B66E 2R2LA 5J90A 3G3ZA 1E96B 3UKRG 2WPQA 1YJNP 3SWFA 2JLBA 4EECA 2I6HA 3FWLA 2QE7H 1NU1K 2A4ZA 3C9IA 4D6TJ 2ETBA 5D0OD 4UB6E 3SD5A 3RL0B 4AP2A 4PD4E 2ZYGA 3AE4C 3HVEA 2W8ZA 1NVOA 3L70G 2JR8A 4R4MA 2L91A 4ATZD 2V4HA 5EDSA 2PL2A 3RK3C 3FP3A 3KSQA 3TWXA 3DPYA 3U66A 2XPIA 2DWZA 1N8RQ 2IPPA 3FDHA 3PE3A 1H6OA 4EOTA 4YDWA 3TXMA 4GTOA 2Q5UA 3ZPJA 3DSUA 4HNAD 4LNGA 3TK1A 2HODA 2W27A 3PEUB 3QH9A 3O6QA 2XCBA 1JEKA 1NI1A 3K5BA 5JHBA 2LXMA 1E7VA 5BPPA 3VLDA 4W9RA 2V8SE 5ENSD 2XGOA 3B71A 3UT8A 1S3JA 1BSHA 1QLED 3WUVA 2M0BA 2RG8A 1L0LE 4LSZE 3FUDA 3E37A 1KB9E 4BTBA 5H2FE 1DX7A 2PRRA 5FZQA 1VQMP 1TNBA 4CDRA 5APYA 1FZFA 4K03A 3RRUA 5GTHH 3CWBJ 2XZTG 3EHRA 3C72A 3OXGA 4UUCA 3UMVA 1SQVJ 2P10A 2Y0CA 1WAO1 4JC8A 4BWRA 3CCRP 1E8WA 1O1TA 4NPDA 1KQFB 3WMM0 4HOSA 1TN7A 3L6AA 1SQBE 2K88A 1NKNA 1JPLA 4B93B 4Y99C 1YBKA 2PM7A 3BRTB 1PAQA 1RQUA 3TWUA 3U4TA 4GA0A 3T5XA 2C0LA 5AVUB 2GRPB 1ZR4A 3D70A 2P58C 4L1BA 1KILA 3H1HJ 2B87A 4UWLA 1H0TB 1U2VG 1NTZD 4RVBA 1K8KG 2WVRA 2P2CP 3AJIA 3L71D 3FEXA 1KFMA 1XTGB 4K5AB 2X6IA 4XI9A 3CEQA 4U8HA 3UINC 3NF1A 2QIWA 3EU9A 1SQPK 4HB1A 1FJPA 1R5LA 3TGOA 1GK4A 4BT9A 3H1LD 3Q15A 3SBTB 4GU5A 4EBAG 2WPVB 5C39A 5KWDA 4AJWA 4C46A 2YNYA 3S7BA 5BV0A 4YXWH 4NACA 4UB6H 2Y0DA 3AG1E 3MKQB 4PD4H 4LCTA 1BGYG 3A0HE 3Q2YA 1MQSA 2FFDB 1Z5SC 4E6HA 2QM8A 2K37A 3L70J 3FULA 1FZCA 1NU1D 3BG0B 4AY6A 1HE8A 4Y6CA 5IY5E 3C8VA 3GHGB 1YMPA 3SY2A 3GZ2A 3GHGC 1HX8A 3DEOA 1MFTA 1NA3A 3A0BE 3WUTA 1S70B 4GODA 2OVBA 4GA1A 5EKQD 3T9KA 1Q7YQ 2R5DA 3V2NA 3ABKE 4EBAA 1SQBG 2CHXA 4UWGA 3CLJA 1JCSA 3EQ2A 1IFIA 1TN6A 3SSUA 3GYZA 4F3VA 1SLQA 2ZVOB 3HXDA 3CVVA 1OCRE 2PM6A 1QBQA 1VQ6P 1HXIA 4DLQA 1T6AA 3GG2A 1CI6B 3CC7P 2KSJA 2ITAA 2WSEJ 4UWFA 3T5VA 5H2FH 3AU5A 3D9JA 3LJ3A 2BCCD 4CDNA 1MHQA 3H1JE 4JYCA 1TYQG 1AQ5A 3FH8A 3M0DC 1A17A 4HORA 1KZOA 3RIBA 4HYTB 1RQVA 3L73G 2X6HA 3D9HA 1VQOP 3Q1MA 4M7CA 1L4AD 3ZYQA 4DI4A 3RK2B 3EDTB 1OCZE 2CPSA 4AYCA 1VQKP 1EYHA 1LD8A 3NBNB 3H1IG 1JTHB 3RK2C 4I43A 1LTTC 1VF5B 2PGDA 3ZN3A 2XV5A 3QKYA 2IO2C 3FUIA 3ASFA 3TG5A 1HFAA 3Q78A 3U59A 3ML8A 2OCCE 2R02A 3ULQA 1ZP0C 2IFMA 2XNDH 1V55E 1IQUA 3PDNA 1KYOH 2QY7A 2WXOA 4OWFA 1KT0A 4ME2A 2BF0X 2KS1B 3V2PA 1Q81Q 2PQRA 2WZ7A 1DCEA 1OW7A 2VGXB 5AQAA 2NPSB 2QJKB 3HTKA 2BEQD 2WPSA 1JUNA 2NPSC 2QJKC 3FFLA 2GRLA 4ABNA 2AEMA 3L75G 2YINA 3JCUE 2K9JB 3ASGA 3ENEA 2R3SA 4DCKA 1AJYA 4XEIG 2JWDA 4U7EB 1LTXA 2KYVA 1YA0A 4FLHA 3B7UX 4DUIA 2L6BA 3JUEA 3UIPC 3M9BA 5AVSB 3RBXA 1UJJA 3A0HH 5G04C 3WUUA 2LAIA 1JCRA 3ISMC 3BCCD 1OCCE 1SQPD 4G23A 1JCDA 3H1KD 1S72P 1MX6A 2GGFA 1L0LJ 2IBZI 3ZHEA 2CK3H 3CIAA 4AUWA 2WQ7A 4AEZC 4EZLA 5AVQB 3IHYA 3ASDA 4YXDC 1O1RA 3L74D 2QZAA 2HO1A 4N78E 5CCGC 3QJZA 1IFDA 3RK6A 5DIZA 2RH0A 3PH0C 3HD7A 3DPDA 3SBSA 3SO8A 1NJIQ 3L22A 4G8KA 2Q7FA 3CC4P 4RQIA 2WXHA 2DBAA 4U3FG 2RFMA 2IFUA 5HI7A 1SQBJ 3EWKA 1EDIA 3NTNA 1SZAA 4CGWA 1D8DA 1EZVI 4U8YD 2Y4TA 1J1DC 1GD2E 1BI7B 3DRAA 1VDFA 1P84D 3HE5A 4YTPC 1YQ4C 3ABVC 1FDMA 4HH2A 4XZ4A 2Y9YA 2WVIA 5FQ4A 3GLMA 2A06E 5ANRA 1BDCA 1MYOA 2BEZF 1OWLA 4X8QA 2WSFJ 4CEMA 1HG5A 4WNDA 1X22A 1E79H 1FAVA 1J1EB 3ULYA 4RESB 3O8ZA 4U8VD 2P9PG 3ZVVA 1PPJG 2KNCA 1W3BA 2V0PA 3H1IJ 2YMYA 2QEXP 1HH0A 1N7SC 1L0NK 2M3BA 3FU6A 1A02F 4YVOA 2P9LG 1FZEA 2IO3C 3KHUA 4WNEA 1ZXGA 4HOTA 2J09A 3MEKA 2RD0A 3F5HA 1HVVA 4GYOA 3DXMG 3NMDA 2UY1B 4MBGA 2FYNC 1FZGA 4HB5A 1DIPA 5ENPD 1K3ZD 3MCXA 4MKTA 5G04J 2OYHB 4FHKA 1M1JB 3ML9A 3WG7E 3BG1B 2OYHC 1M1JC 3T97B 3Q47B 4N3CA 5CCHA 1N73A 2UWJG 2KATA 3FTXA 5AW4B 5CRVA 2P67A 5E79E 5APSA 2OTKE 4WY4C 1H89A 1XGWA 1KILD 1Q90D 5AAOA 1PGOA 3EFFK 3H6PA 4DOJA 3FU3A 3I4RB 1VQ8P 5T3RA 1PIXA 2AWIA 4I6GA 5G55A 1Y8AA 3AEEC 4WVZA 1S5LX 1U57A 1ZRTE 1KLXA 3R9AB 2XS1A 2O3JA 3H1JJ 4CDMA 4L74A 3AAAC 3IEGA 3L72D 1EZVG 3MD0A 3I55P 4DX7D 4GTPA 3JCKC 4WWOA 5B5EH 3PHLA 1K1BA 1VL2A 3LIDA 1LTJC 1XNFA 4PJ0E 1BU9A 2OARA 4ILIA 3KD7A 3D9IA 5BU8B 2LO6A 3PZ1A 1S5LE 2PP6A 5CHEE 2FBWC 2FYUK 2FULA 2E75C 2KZTB 2GUVA 3H32B 1SQXK 1DEEG 3B4SA 1FZAA 5J08A 1M90Q 2E76D 3EHNA 1Y6IA 2YXQB 4NPFX 1N95A 4W7ZA 3CQGB 5ENNA 5HRYA 3UXGA 4XIFA 1M7LA 5TJHA 5AW3B 2XEVA 1SS1A 3D9KA 4NURA 1NH4A 3FH7A 1IFJA 5FT9A 3ZGQA 2EINE 5AQBA 4FP7A 3CSFA 2M5AA 1BGYD 4HVBA 5HQ8A 4C9BB 3LW5H 3RJVA 3PJSK 3AU4A 3LY9A 2POHA 3EUVA 1HUCA 4J8FA 4A1SA 4E85A 3V4WA 5KNHD 1GL2A 3AEGC 3FUEA 4MLPA 1IFPA 1RE4C 1H2TC 3KS2A 2WXNA 3D9MA 1NP7A 1GMJA 1JY2O 3URZA 1OWMA 4Z68A 2W6AA 2IU1A 5KLVK 3X2QE 1M57D 3Q5MA 3CX5I 4D6TG 1N4SA 1OWAA 1BI8B 3HUSA 4Q94A 2KCLA 3Q3DA 3MZWB 1QNFA 2ZXEB 4PS8A 3BCCE 3DWLG 3C3RA 1N4RA 1GK6A 2E74D 4OGQC 3FU0A 3SHFA 2H88C 1EXIA 3CPWO 4OVUA 2W6BA 3CCQP 3UIOC 4GYYA 1HH8A 3VOPA 3CXHE 1LTGC 3LPZA 1JOCA 3MUDA 3I5PA 2DZNA 3E32A 5AW5B 4F1PA 4A3VA 3E4BA 3L73D 3AS4A 1SA4A 3FTUA 1SQQG 1LF8A 5AQ7A 5G2NA 1N52A 2X38A 1L4AB 5AQ9A 1PFIA 2OTLP 3B5NA 4YDYA 4IOIH 3BEEA 3V79K 4PJ0H 4DI3A 1NTMG 1SW6A 5ENOD 1PP9E 2L5GB 1KORA 2JWAA 3LEWA 3DBSA 3CWBG 2HE0A 1SQVG 2DYSE 2R5BA 2R5SA 1PZQA 5APTA 1X79B 5GTHE 5B1BE 3UM3A 3MP7B 2C2LA 4TUMA 3JQ1A 3RO2A 4A55A 1D8EA 1LWUC 3G71P 4KVOA 5KAFH 4QMAA 2KLVA 2N9BA 1MX4A 3B7RL 1YQ3C 3L75D 2HLOA 1LT9C 5FZSA 3ZRHA 4U7JA 1E8XA 1NTZK 3N4XA 2RKKA 5AW2B 3ESKA 3L82A 5AIJA 5FQ6A 4G24A 3IF4A 3AG4E 4J6IA 1AQTA 1FVHA 3CK8A 2H6HA 3H1HG 3M9QA 5HS0A 4BT8A 1WT6A 1NAYA 4HOUA 2V5FA 2WXKA 3KAEA 3EHMA 4F6RD 4EIJA 4PD4I 2YMKA 2I2OA 3APFA 2WM9A 4L73A 1IXVA 5KJ7C 1X9VA 2MOWA 2WMOA 2LXBA 4JD2G 2D2CC 4PV1D 3SF4A 1VDYA 5EYPF 3AE1C 3QWVA 4K3AA 1RF0A 3G6EP 4QFVA 2N1TA 4BWNA 1VQNP 3HYMB 3FWNA 1FDIA 3V31A 3M91A 5JMND 4EZKA 5T8IA 3HRAA 1BCCD 1TNZA 2YNQA 1NHLA 1OY3D 4U3FD 4ATGA 4BETA 1YCSB 3RL0C 4AY5A 3PUKA 3P8CD 3UM0A 3HVEB 2XKMA 5KLVD 2H6FA 3EIJA 2AVPA 2A45I 2V4HC 4ANXA 3VYIA 4EDFA 3G4SP 3W67A 3DXKG 4APFA 1IO4A 2QYUA 3CXHH 4WB4A 3KQGA 4XX5A 3TWTA 5JJTA 3UKUG 2FXMA 5AW6B 3TGUE 5JA4D 1KB9I 3VTPC 5EILA 3E34A 4CYMD 3LVQE 3KDPB 2HODB 4FU3A 2VRSA 5BXUA 3MGBA 4HLLA 1V54E 2XEHA 3O6QB 1ZU2A 4GZDA 2ZVNB 2GW1A 5EX0A 1GW4A 1JWFA 1N11A 4GZ6A 5CCHD 4BERA 3TJPA 2XRYA 2I8DA 2F0YA 2XPZA 1SQQJ 2V7QJ 1Q2ZA 3KYQA 2KB7P 3PVLA 1P84H 3Q49B 4FLBA 1JY2N 4I7ZB 1EF1C 2KOGA 2SPZA 3OW2O 2O01H 5G05C 2MRIA 4I7ZC 4FJZA 2HFED 1HBWA 2ETAA 4U63A 4A7PA 2P9KG 5ARFA 4FHJA 1NTMJ 4HLEA 4H0LD 3QNKA 3GW6A 3W68A 2MKVA 3O48A 1ELWA 2WSCH 3FTYA 3FUKA 4GOFA 2ZGGA 5H7PA 4EYYQ 5CJ4A 2KI7B 2V4LA 3I3NA 4Q96A 3L9TA 2IBZD 1RHZB 4ANUA 3FTSA 2OYOA 5CMWA 3M9HA 2LR2A 2YXRB 4BRYA 1QQEA 3HHMA 2AXUA 1KYOE 1NTKE 4AQRD 1KILB 2P2UA 3E30A 2OYIB 2B87B 1AVYA 4GPKA 1KILC 2OYIC 1L0NE 4GCNA 1N9AA 4OYSA 4YDOA 1JY2P 3TGUG 3V2QA 2EQXA 3Q9UC 4GZCA 4NPEA 1SFCD 1OZHA 2HYNA 2P58A 4W80A 3SGHA 2VGYA 1EZVD 1SQVK 5KBAA 3MGNA 4GTVA 1D7MA 1S2EA 2A45G 2VSYA 3EJNA 3A5TA 4A1GA 2OEWA 2LUHA 3V2XA 4Y6WA 5B3SE 2KC7A 4CCAA 2PAJA 3ZXPA 3FGAD 3FUHA 3OTNA 2OTJP 3TWQA 1L0LG 1PGPA 1BE3D 2EIJE 3CVLA 4TXRA 5E75A 2W90A 1FS0E 1GL2D 1BSNA 3KXDA 5APUA 1G2CB 4HFGA 5KJLA 4D10C 3V2OA 2LSVA 2FFDC 1PP9J 2WPVA 1DH3A 1FZCB 1FZCC 1L2PA 2E76B 3IBEA 4WUYA 5AVRB 1HU3A 2E76C 5AVTB 3TSIA 3ASNE 3MZLB 4DJAA 1S9KE 3VTXA 1X8YA 2AJAA 2KUBA 1Y47A 1HS6A 2ZT9D 3C3QA 1R8EA 2CFZA 2V5QC 3RBZA 5KJKA 3CHPA 4GTSA 3AEFC 3G9RA 2KCVA 1TU3F 4HRLA 3GHGA 1RF1B 1E8ZA 5GTIH 1RF1C 3APCA 2XNXA 4WWIA 2PNNA 2A5EA 3CGHA 5D0QD 2XPYA 5APWA 2BASA 1M1KQ 2NRGA 4H44D 2FYUE 4GPMA 3DSTA 4IFMA 3UUXA 1SQXE 3OA7A 3CVNA 2F37A 3L35A 1YJ9P 1YYCA 3AE5C 4D6TD 2H43A 1WM5A 5KNGA 2QSIA 4JA9A 2WSSH 3IN6A 4BTAA 1N0QA 4CPGA 1EXJA 4ZMDA 2WQ6A 3B5ND 2ZGDA 3R7RA 1VF5C 2AW6A 3VMZA 2C0XA 1S63A 2YO2A 2E74B 3UX4A 3Q75A 1AA0A 2LNIA 3AE3C 2J4BA 3B7SA 4JBZA 5ENRD 2YIUB 2KP8A 5DJTB 1OW6A 4BSZB 4I6EA 2YIUC 1DCQA 5CCMA 4C0MA 1JTHA 3AG3E 3W9FA 5M1BA 4B0ZA 2M63A 4YNDA 3QWPA 1BCCE 3BRVB 3HTKB 1FE6A 2QRXA 4LG6A 3CMEP 1OVVA 5BW8C 1N94A 2R05A 3MYVA 3LS8A 3TGUJ 1Z3XA 5L8RJ 1MZ9A 2Y0BG 1E7UA 3NOGD 2GRQB 1YJWP 4GA2A 2NPSA 4ANWA 1J2JB 1NTMD 2IEJA 1NFIE 1FU1A 4XKCA 4LRZA 3CWBD 2K9JA 3S7JA 1SQVD 3RGUA 2WWWA 1G1IA 3BATA 3ZHEB 3H1JG 1K9MQ 1O1SA 2GROB 1LP1A 1DVPA 4NRHB 3RSEG 3ZYLA 3G2SA 1YIJP 4UWHA 2XENA 4F53A 4U0ZA 1N2DC 2BKKB 4L2YA 2N1TD 5FTPA 1QGKB 3EU5A 2A5UA 3D3MA 3SNXA 4LC1A 3PZ3A 3S7DA 2Y0EA 3C1LA 2VTBB 3CLQA 2BEDA 3ZKJA 1WMKA 5B5EE 4FA6A 2OV8A 4GTQA 1IZNB 3H1HD 1YHQP 5D2MC 5KAIE 2IZ1A 3U1CA 4DT0A 2GRNB 4ILHB 3CX5D 2L9BA 5CCGA 2GRRB 1N4PA 3PH0A 4DZOA 5FQ8A 2DZOA 3HE5B 5JJ6A 1MUUA 1NTKJ 2H7HA 3SFDC 2O1JA 4HBDA 3TDKA 1L0LK 1L0NJ 2LKMA 1ZMEC 3CV0A 2CG3A 3RK3D 3QB2A 4J0UA 4PV1B 2IYOA 2J58A 4OAVB 4RLYA 2I1JA 4I1MA 1KZUB 4IYPA 3TXNA 3LXUX 4OVVA 3J5QB 4UI9K 1A5EA 2IY0C 2R59A 5ARGA 1J1EC 1S0PA 5BU5A 4I1AA 3ONLA 1OW8A 3L37A 4J8EA 2P9SG 1IQRA 1NTZE 3OAWA 1KQSO 5BV1A 4WWNA 4TRQA 3CK7A 3L70D 1JO5A 1U7JA 3L71E 3CMAP 4N3YB 4XA4A 4LLHA 3CVPA 4FJYA 1HJBA 1EC5A 4L76A 1SQBK 1N0RA 2IOLA 3Q7AA 4CRWA 4K5BA 2J5UA 3PZ2A 3AECC 2O1KA 3H1LE 2HPCA 1HTLC 1SA5A 3KPEA 3UQ3A 4PS3A 4IL6X 2J49A 1G1JA 4EZJA 1N7SA 1UOHA 1R5SA 2FO7A 1TNUA 4NIKA 3B7BA 2WQHA 4HRMB 4KZ0A 3CKBA 3FXDA 5EX3A 4RKUJ 4EHMA 4RG9A 2Q6QA 4Q69A 1JMBA 1ZBPA 3TNUA 4XI0A 3ZYMA 1FPPA 1NU1E 1BD8A 5CCHC 2UY1A 4DX1A 1M8OB 4WWPA 1Z56A 1FT2A 3LY8A 3MX3A 3PNTB 2QJPB 4L23A 1LTSC 4U04A 3Q5RA 1HF9A 3RAUA 4IL6E 2QJPC 2MHKA 1H19A 3PS6A 2OYHA 4C0EA 2JKVA 2YHCA 3HE4A 4KBQA 1IJDB 3CQCB 4H0LB 4KYOB 2J4DA 2A06G 3I56P 3DSWA 2ZAEB 4WY4A 3BVHA 2FYUJ 1SQXJ 3MV3B 2ZJSE 2K9YA 1VQ7P 3TG4A 4HS2A 1NO4A 4GTTA 1OIPA 1GW3A 1FBMA 1EDUA 3RRNB 5EN5D 3SWKA 2KXPB 2ZU6B 2KXPC 5CBOA 4I1OB 2BCCE 2QM7A 1KN7A 1HWTC 3ZXSA 5KAIH 4ASWA 4GTMA 3FX0A 1Q82Q 1UN8A 1PGQA 5K5GB 2L0TB 4TXQA 5FZRA 3ZUVB 1UW4B 4UWKA 3CHSA 1LTJA 3DSSA 5KAFE 4C48B 4LGDE 1FT1A 4I9CA 3D9NA 2GM4A 4KHXA 1FOSF 4GZ3A 1PGJA 2MJZA 1MV8A 1CZQA 1SFCB 2JO1A 4OH8B 3LKUA 5FIOA 1ZN5A 3H32A 1SFCC 3U1AA 1Z6TA 2WPRA 1MZCA 3BUAA 2FEZA 3LVRE 1NU1G 3JSVC 2E42A 4LUNU 2B9BA 2LAHA 2XGMA 1OCOE 1L0LD 5KKZB 2QG4A 1VQ9P 4LEUA 1KB9D 5KKZC 2BKGA 2BUGA 3V5BA 1ZW0A 5A6CA 1GL2B 2E0IA 1JWGA 3QAQA 3AE8C 2RMZA 2VJ8A 4H7YA 2Y69E 3KSLA 2NC9A 2FY8A 4JQ0D 2VGEA 2XHEA 3JXIA 3WU2E 5ITZF 4ZNCA 4JHKA 2WXPA 3SI5A 2OOEA 1MJ0A 4N2QA 3JQ0A 1JUQA 3S1KA 2IF4A 3CXHI 3SFYA 3HUSB 3PE4A 3NXSA 2I9CA 5JHAA 1SQBD 3MJWA 4APOA 2WTYA 4K5CA 5BNWA 2ZT9B 1RE3C 3W9GA 3Q4AB 1SQPE 4KJMA 3H1KE 2ZT9C 4UQXA 4AIFA 4FULA 5LP0A 2FF4A 4ANVA 1HJ0A 2ZYAA 2Q3EA 3L36A 1NWQA 4U0SA 3LCAA 1W2EA 4EQFA 3NB2A 3PNLB 4IL6H 3ITKA 5AVXB 3L74E 5LX8A 4C7RA 4IFDK 1TJFA 2EILE 2H6IA 1JCCA 3Q9NC 1BLXB 1YI2P 2WXGA 4L9PA 4H44B 4KZCA 3MUDC 1O5MA 3K9IA 3TYYA 2Y3AA 1TNOA 3AS5A 4C7NB 3CCJP 2VYIA 4AXHA 2WT7B 4GT1A 4GYWA 3HRNA 2XEEA 1NYHA 3C5RA 4HOQA 1AFOA 3H1ID 1K73Q 3ZEFA 3HXCA 1L4AC 1P84E 4BSXA 4JPZB 4JHJA 4I2WA 1ZOYC 2WMNA 3B5NB 2NZ2A 5BT1A 3PTZA 4JEUA 2JJLA 1EDLA 4JF7A 4DX5D 3MV2B 3UPVA 4B94A 3LW5J 1FC2C 1NTZJ 4G8LA 3CR3A 3L71J 2R32A 3TWWA 2G8YA 3CHOA 4F7AA 2Z5HA 4TT3H 3ASOE 3FTZA 4W7YA 3H1LJ 1ELRA 1RZ4A 5AYWD 3R2PA 3QOUA 4B86A 3TWSA 3IHVA 5AJLA 3L70E 3HD7D 1DNPA 3BCCG 3OJAB 4RSYA 4HJGH 2KBXA 2J9QA 5ANLA 2KK7A 4XKBA 3N7NA 4RG6A 3AEBC 4UB8E 1URQA 2OQQA 3JYSA 3DEPA 3SFZA 1LWUA 3Q5PA 1PV3A 3CVQA 5CCGD 1NU1J 2Q3IA 1GZLA 1LT9A 4URKA 1OWOA 3L74G 2W6JH 2MYOA 4H13D 3CVXA 1IHGA 5A7DB 3HXFA 3IR9A 4B8AA 3B7TA 1GU5A 1IKND 2WB2A 3H1JD 5FINA 3UM2A 1IYGA 1LTIC 4DLOA 4YPCA 2GUSA 2ZFCA 3LJNA 2Y9ZA 4IFFA 3FXEA 3AG2E 1FVFA 3CHMA 1IFNA 3WU2H 2R17C 3PP5A 4I9EA 2ZXWE 4XFJA 1XTCC 5DJUB 4I6JA 1KILE 1IHBA 2YKQA 3JC22 5APVA 5KJ7A 2J07A 1U3CA 3PLNA 3LIEA 1FCHA 1LTBC 3S2AA 2GA1A 4N2SA 4HKZH 2L6JA 3L17A 1AWCB 4G1TA 3SQVA 1PP9G 1TEZA 5AW7B 3TF5A 2BCCJ 4A3TA 2PZIA 4HXIA 3DSVA 3L72E 4BX8A 2HR2A 5CECB 1T3JA 3CHQA 5AVYB 4DRXE 1NGMB 1N7SD 1HG2A 5CERB 4ILGA 1FJKA 1N54A 3RK3B 3CVUA 2F8XK 2G3AA 4K35A 1FDOA 3PEVB 5APQA 3SFXA 3CX5H 1PPJD 5ENQD 5GTIE 1N7LA 3ESLA 4G2VA 3VP9A 4JVSA 1T2KD 2J08A 2CPBA 1KPSB 3ZNGA 2QYJA 3T8MA 2ZXXA 1HF8A 1S1CX 2BTDA 1OVUA 2K1AA 4N5QA 4M3LA 4WY4D 1KYOI 3CCEP 5EFWB 5BUZA 1TNYA 1H2VC 1K05A 3ABLE 2ZIRA 1BGYE 3G2VA 2DW3A 4N78D 2K3RA 2AXTH 2NSZA 3S4RA 2P7JA 1DD4A 3V2RA 5FWQA 3NQPA 4CGVA 3HDXA 2R3CA 4Z1MH 5EIDA 3HXEA 2Y1LE 4OVNF 2QFCA 3QDNA 4UB8H 3BCCJ 1VQLP 2IX7C 1SQPJ 3H1KJ 3P8MC 5AVVB 2H89C 4BRYB 3GZSA 1SQQK 2LXCB 2AXZA 1NOHA 3P32A 3L72G 1GU4A 2F8YA 3L74J 4Y99B
chains in the Genus database with same CATH topology
1EDJA 4DX7D 1NFIE 2B89A 3RGUA 1K1BA 4J8YA 1BU9A 1LP1A 1H0TA 4DX2A 2XENA 3ZDMA 2BKKB 4OAUC 3UTMA 1DEEG 1JM0A 3ZKJA 4NPFX 5CBNA 3MHVA 5HRYA 3UXGA 4O1OA 3KEAA 1SS1A 3PH0A 5AQBA 2M5AA 2DZOA 4HBDA 2HR3A 2ETBA 5KNHD 4A63B 4OAVB 4RLYA 3J5QB 2J8SD 1NVOA 4O1PA 1A5EA 1U7MA 4Z68A 4ATZD 2QC9A 5CEAA 1BI8B 3TWXA 1U7JA 2DWZA 3MZWB 1SVXA 1EC5A 1N0RA 4YDWA 4K5BA 4HNAD 2KZJA 4HI9A 1UOHA 4O60A 2RKLA 4NIKA 3V30A 3B7BA 5ENSD 4HRMB 3FXDA 1S3JA 5BXOA 1JMBA 2M0BA 2DZNA 2WMMA 4LSZE 1BD8A 1DC2A 4DX1A 1WG0A 4F1PA 5AQ7A 1YYHA 2XZTG 3EHRA 5AQ9A 4UUCA 4YDYA 4IOIH 3V79K 1SW6A 5ENOD 4NPDA 2ZAEB 1OT8A 2HE0A 4B93B 1QYMA 3TWUA 4TUMA 5EN5D 2ETCA 1AP7A 2KXPC 5CBOA 4ZFHA 2RFAA 2B87A 3EHQA 1MX4A 1LP1B 1H0TB 4QQIA 4ASWA 2P2CP 3AJIA 5K5GB 1K1AA 4K5AB 3ZUVB 4GOEA 3EU9A 5HS0A 4HB1A 3J5PA 5KWDA 4C48B 5C39A 4F6RD 5FIOA 1IXVA 2LXBA 2JABA 4HI8A 5EYPF 4K3AA 4BESA 4QFVA 3V31A 4GMRA 5JMND 2UWJE 2R44A 2BKGA 3HRAA 1YMPA 1ZW0A 1OY3D 4BETA 3DEOA 1YCSB 1MFTA 1S70B 4GODA 1G3NB 3T9KA 2VGEA 3JXIA 4U96D 5ITZF 4ZNCA 1MJ0A 2V4HC 5EYLA 3S1KA 5D66A 4K5CA 3TWTA 3W9GA 4MN4C 4KJMA 5JA4D 5EILA 4CYMD 4HRNA 5BXUA 4HLLA 2XEHA 4LNUD 1N11A 4BERA 4ASVA 2I8DA 3Q9NC 1BLXB 2SPZA 3D9HA 4JB8P 3NBNB 2ETAA 4CZ2D 2XEEA 3C5RA 4GOFA 4HQDA 2ZGGA 4DX5D 1EDLA 2KS1B 4EYYQ 1FC2C 3JXJA 2KI7B 2KZIA 4G8LA 1LT1A 5AQAA 3TWWA 3F6QA 2LR2A 2JWDA 4BXLA 3TWSA 2B87B 4DUIA 2L6BA 3JUEA 4HJGH 2KBXA 3IXEA 3Q9UC 3NOCD 4NPEA 3B95A 3DEPA 2P58A 1D9SA 1MX6A 1TR4A 5KBAA 2MYOA 3V2XA 1EDKA 3T8KA 1IKND 1MX2A 5FINA 3TWQA 3ZU7B 3LJNA 3FXEA 2M5AB 3V2OA 3SO8A 4U95D 4G8KA 2Q1KA 1OVRA 2RFMA 5DJUB 3UI2A 1IHBA 4ZHBA 1EDIA 2DVWA 3HG0D 4U8YD 5ENTD 4HKZH 1BI7B 1AWCB 2AJAA 4J7WA 2KUBA 1WDYA 1Y47A 5CEDB 2V5QC 4HRLA 1BDCA 1MYOA 5CECB 1X0TA 2QVAA 4DRXE 4WWIA 2PNNA 3TWVA 2A5EA 5CERB 2FO1E 4U8VD 2F8XK 4K35A 2XZDG 4GPMA 4DX6D 2F37A 5ENQD 5KNGA 1ZXGA 1N0QA 4CPGA 5AN8A 4ZMDA 3ZNGA 2QYJA 2ZGDA 3QWOC 2B88A 4HB5A 1BDDA 5ENPD 2B0OE 1K3ZD 1OVUA 4N5QA 1Q2NA 5AARA 5EFWB 4BEPA 2KIKA 2K3RA 4JBZA 5ENRD 5DJTB 4BSZB 1DCQA 3W9FA 2NYJA 2OTKE 5EIDA 5AAOA 2Y1LE 2QRXA 4LG6A 1OVVA 5EIBE 2LXCB 3TWRA 2Y0BG 5HKPA 3NOGD 2F8YA 3AAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDJ A;  4DX7 D;  1NFI E;  2B89 A;  3RGU A;  1K1B A;  4J8Y A;  1BU9 A;  1LP1 A;  1H0T A;  4DX2 A;  2XEN A;  3ZDM A;  2BKK B;  4OAU C;  3UTM A;  1DEE G;  1JM0 A;  3ZKJ A;  4NPF X;  5CBN A;  3MHV A;  5HRY A;  3UXG A;  4O1O A;  3KEA A;  1SS1 A;  3PH0 A;  5AQB A;  2M5A A;  2DZO A;  4HBD A;  2HR3 A;  2ETB A;  5KNH D;  4A63 B;  4OAV B;  4RLY A;  3J5Q B;  2J8S D;  1NVO A;  4O1P A;  1A5E A;  1U7M A;  4Z68 A;  4ATZ D;  2QC9 A;  5CEA A;  1BI8 B;  3TWX A;  1U7J A;  2DWZ A;  3MZW B;  1SVX A;  1EC5 A;  1N0R A;  4YDW A;  4K5B A;  4HNA D;  2KZJ A;  4HI9 A;  1UOH A;  4O60 A;  2RKL A;  4NIK A;  3V30 A;  3B7B A;  5ENS D;  4HRM B;  3FXD A;  1S3J A;  5BXO A;  1JMB A;  2M0B A;  2DZN A;  2WMM A;  4LSZ E;  1BD8 A;  1DC2 A;  4DX1 A;  1WG0 A;  4F1P A;  5AQ7 A;  1YYH A;  2XZT G;  3EHR A;  5AQ9 A;  4UUC A;  4YDY A;  4IOI H;  3V79 K;  1SW6 A;  5ENO D;  4NPD A;  2ZAE B;  1OT8 A;  2HE0 A;  4B93 B;  1QYM A;  3TWU A;  4TUM A;  5EN5 D;  2ETC A;  1AP7 A;  2KXP C;  5CBO A;  4ZFH A;  2RFA A;  2B87 A;  3EHQ A;  1MX4 A;  1LP1 B;  1H0T B;  4QQI A;  4ASW A;  2P2C P;  3AJI A;  5K5G B;  1K1A A;  4K5A B;  3ZUV B;  4GOE A;  3EU9 A;  5HS0 A;  4HB1 A;  3J5P A;  5KWD A;  4C48 B;  5C39 A;  4F6R D;  5FIO A;  1IXV A;  2LXB A;  2JAB A;  4HI8 A;  5EYP F;  4K3A A;  4BES A;  4QFV A;  3V31 A;  4GMR A;  5JMN D;  2UWJ E;  2R44 A;  2BKG A;  3HRA A;  1YMP A;  1ZW0 A;  1OY3 D;  4BET A;  3DEO A;  1YCS B;  1MFT A;  1S70 B;  4GOD A;  1G3N B;  3T9K A;  2VGE A;  3JXI A;  4U96 D;  5ITZ F;  4ZNC A;  1MJ0 A;  2V4H C;  5EYL A;  3S1K A;  5D66 A;  4K5C A;  3TWT A;  3W9G A;  4MN4 C;  4KJM A;  5JA4 D;  5EIL A;  4CYM D;  4HRN A;  5BXU A;  4HLL A;  2XEH A;  4LNU D;  1N11 A;  4BER A;  4ASV A;  2I8D A;  3Q9N C;  1BLX B;  2SPZ A;  3D9H A;  4JB8 P;  3NBN B;  2ETA A;  4CZ2 D;  2XEE A;  3C5R A;  4GOF A;  4HQD A;  2ZGG A;  4DX5 D;  1EDL A;  2KS1 B;  4EYY Q;  1FC2 C;  3JXJ A;  2KI7 B;  2KZI A;  4G8L A;  1LT1 A;  5AQA A;  3TWW A;  3F6Q A;  2LR2 A;  2JWD A;  4BXL A;  3TWS A;  2B87 B;  4DUI A;  2L6B A;  3JUE A;  4HJG H;  2KBX A;  3IXE A;  3Q9U C;  3NOC D;  4NPE A;  3B95 A;  3DEP A;  2P58 A;  1D9S A;  1MX6 A;  1TR4 A;  5KBA A;  2MYO A;  3V2X A;  1EDK A;  3T8K A;  1IKN D;  1MX2 A;  5FIN A;  3TWQ A;  3ZU7 B;  3LJN A;  3FXE A;  2M5A B;  3V2O A;  3SO8 A;  4U95 D;  4G8K A;  2Q1K A;  1OVR A;  2RFM A;  5DJU B;  3UI2 A;  1IHB A;  4ZHB A;  1EDI A;  2DVW A;  3HG0 D;  4U8Y D;  5ENT D;  4HKZ H;  1BI7 B;  1AWC B;  2AJA A;  4J7W A;  2KUB A;  1WDY A;  1Y47 A;  5CED B;  2V5Q C;  4HRL A;  1BDC A;  1MYO A;  5CEC B;  1X0T A;  2QVA A;  4DRX E;  4WWI A;  2PNN A;  3TWV A;  2A5E A;  5CER B;  2FO1 E;  4U8V D;  2F8X K;  4K35 A;  2XZD G;  4GPM A;  4DX6 D;  2F37 A;  5ENQ D;  5KNG A;  1ZXG A;  1N0Q A;  4CPG A;  5AN8 A;  4ZMD A;  3ZNG A;  2QYJ A;  2ZGD A;  3QWO C;  2B88 A;  4HB5 A;  1BDD A;  5ENP D;  2B0O E;  1K3Z D;  1OVU A;  4N5Q A;  1Q2N A;  5AAR A;  5EFW B;  4BEP A;  2KIK A;  2K3R A;  4JBZ A;  5ENR D;  5DJT B;  4BSZ B;  1DCQ A;  3W9F A;  2NYJ A;  2OTK E;  5EID A;  5AAO A;  2Y1L E;  2QRX A;  4LG6 A;  1OVV A;  5EIB E;  2LXC B;  3TWR A;  2Y0B G;  5HKP A;  3NOG D;  2F8Y A;  3AAA C; 
#chains in the Genus database with same CATH topology
 2X6F A;  1NTM K;  1EDJ A;  2OVF A;  2A06 D;  1OXJ A;  3IKO B;  2E5T A;  5CMY A;  3V4Q A;  2E75 D;  5KCM A;  2FBN A;  2WSE H;  1VQ4 P;  3RRM B;  1SQM A;  3OXF A;  2PFX A;  4KT0 J;  2OYI A;  1IK7 A;  1H0T A;  1UN9 A;  3F89 A;  1GTW A;  2P9N G;  3Q7F A;  4WAF A;  4JL0 A;  2XGS A;  3UTM A;  3SFE C;  5BVZ A;  2XCC A;  3GMA A;  3APD A;  3OAK A;  1JMM A;  3VMX A;  2O01 J;  4DK5 A;  4XE5 B;  5B66 H;  1KTM A;  5FJY A;  4JYB A;  2YKO A;  5CBN A;  3L73 E;  3MHV A;  1IFM A;  4N3B A;  5CHX A;  1KZP A;  4JZY A;  2H6G A;  4O1O A;  2JEE A;  2WXI A;  3H1I E;  3CCM P;  1IC2 A;  2CHZ A;  2X6J A;  3MKQ A;  2XRZ A;  4KXK B;  2B6C A;  2ILR A;  3ZYK A;  2VQ2 A;  5B1A E;  2WSC J;  3DSX A;  2VSX E;  1RW2 A;  4WNF A;  2FXP A;  4PUC A;  3CVY A;  5G05 J;  1G2C A;  2FFD A;  3L4F A;  4ZKP A;  1NL4 A;  1OX3 A;  3V6I A;  1SVF A;  1KC8 Q;  1T3U A;  2FKW B;  4MS6 A;  4EI2 A;  1WY6 A;  1JY3 O;  2R03 A;  2HR3 A;  1S64 A;  2EIM E;  4G25 A;  3U64 A;  1UII A;  4A63 B;  5C1D A;  2CHW A;  4AVX A;  1RH5 B;  1NTK G;  4WBA A;  1KD1 Q;  2J8S D;  4BX9 A;  4O1P A;  1U7M A;  4GIF A;  1L0N G;  1H8A A;  3L75 E;  4JHR A;  1Z3Y A;  2E2E A;  2QC9 A;  4UQY A;  5CEA A;  4OGQ D;  2KM4 A;  1ZRT D;  4IN3 B;  2IQC A;  4KMO A;  3R7Q A;  2A45 H;  1RF1 A;  1AVO A;  1QZ2 A;  1SVX A;  4UI9 C;  2YO3 A;  5CMZ A;  4FAD A;  1HO8 A;  1VPC A;  3S9O A;  2HYZ A;  1CI6 A;  2I1K A;  2KZJ A;  3GW4 A;  3P1U A;  3OXL A;  1QVG O;  4N5C A;  3C98 A;  1KB9 H;  2Z5I A;  5A23 A;  1LNQ A;  4HI9 A;  3M0D A;  3MIW A;  1ZB1 A;  4O60 A;  4BY6 A;  2RKL A;  3FUF A;  1U3D A;  3V30 A;  4PDX A;  2J59 M;  1KQG B;  1FZB A;  5BXO A;  1LTA C;  2FYZ A;  5E76 A;  2E74 C;  5KJN A;  3AE9 C;  2QJY B;  1HZ4 A;  5CJ0 A;  3G2T A;  4K0R A;  4AV7 A;  3AEA C;  3FUM A;  2QJY C;  2WMM A;  3S7F A;  1Q86 Q;  4JPS A;  1DC2 A;  1ZLL A;  1WG0 A;  3L13 A;  2E5Y A;  1LGH B;  1SZ9 A;  3FTV A;  3L72 J;  1USD A;  2WXJ A;  3LYA A;  4U3F E;  1YYH A;  1MKM A;  3P8C E;  2X6K A;  2WXQ A;  1SQQ D;  5KLV E;  1OWP A;  3ZFW A;  4NQ0 A;  1URQ D;  2KS1 A;  1H88 A;  1SP4 A;  4EPZ A;  2VGX A;  1OT8 A;  2IDB A;  3LDZ A;  1QYM A;  1DEB A;  3BAS A;  2FXO A;  2WSF H;  1BPO A;  4F1S A;  1NKZ B;  3EIQ C;  2XU6 A;  4LNB A;  2ETC A;  3CCS P;  1JB0 J;  3FU5 A;  3RU0 A;  2H8P D;  1LJ2 A;  3M0A A;  1AP7 A;  3GZ1 A;  1MFZ A;  2FYU G;  4ZFH A;  2RFA A;  4PS7 A;  1SQX G;  1KV4 A;  3EHQ A;  3Q5S A;  1LP1 B;  4QQI A;  3VTY A;  1PPJ E;  3PRJ A;  2LSU A;  3AE7 C;  3R9M A;  1K1A A;  2AEF A;  1FOS E;  5KJ7 D;  1BGY J;  4GOE A;  3RL0 g;  4TLF A;  3HD7 B;  3J5P A;  2D2C D;  3HD7 C;  5KTB A;  4B8C B;  1P5Q A;  3PZD A;  2N9Y B;  1H0A A;  1EQ7 A;  1LD7 A;  3CK9 A;  1NAF A;  3A0B H;  4UI9 J;  4N6J A;  3CXH D;  2JAB A;  4HI8 A;  2P1J A;  3AE2 C;  4R7L A;  3HXB A;  2VTB A;  4H13 B;  3RL0 D;  3FEY A;  4BES A;  3NZS A;  4H13 C;  1YIT P;  5DBK A;  1BCC G;  3FHE A;  1HGV A;  5AVZ B;  2IBZ E;  3CST A;  2JEK A;  4GMR A;  2JP3 A;  2UWJ E;  2R44 A;  4B89 A;  3D6Z A;  2EIK E;  3PRE A;  5KLV G;  4PV1 C;  3D9L A;  1J1D B;  3N71 A;  1HGZ A;  4JXT A;  3E33 A;  2ZYD A;  4M3O A;  1G3N B;  2C0W A;  2GRM A;  1VQP P;  4U96 D;  1S4X A;  2KNC B;  5M72 A;  1PP9 D;  5EYL A;  1CSB A;  3VLE A;  1K8A Q;  4R4L A;  3H25 A;  5D66 A;  3MKR A;  4G26 A;  2OND A;  1E5W A;  4MN4 C;  4RO0 A;  1EZV E;  4I6M C;  4HRN A;  3FTW A;  2YHE A;  2HPC B;  3L73 J;  2OGU A;  2XZR A;  2C0M A;  1JY3 N;  2YQ8 A;  4LNU D;  1NTK K;  2Z4E A;  5LCW C;  1N7S B;  4ASV A;  3II6 A;  3GF3 A;  4V3I A;  4U07 A;  1N4Q A;  4PH4 B;  1BE3 E;  4GAA A;  3NZU A;  2OEV A;  4CT4 A;  2DIW A;  1Y8M A;  4AOF A;  3CL3 D;  2C9N Y;  4JB8 P;  1DD3 A;  3TNU B;  3CD6 P;  1ELK A;  1N73 B;  1QX8 A;  2FYN B;  4GDO A;  2P9I G;  2VSO E;  4I17 A;  5KJM A;  1N73 C;  2VSN A;  3ZW3 A;  4IUL A;  2XQ0 A;  4MRU A;  4CZ2 D;  1QVF O;  2P9U G;  3CCV P;  1H6P A;  1JCQ A;  2WXL A;  3M06 A;  1M1J A;  4DJG A;  3ABM E;  3QC1 A;  1T2K C;  3JCU H;  4L7T A;  3T97 A;  1A02 J;  3HE4 B;  3FWV A;  4HQD A;  3KZI E;  2IBZ G;  4GKG A;  3L75 J;  3NFQ A;  3PUJ A;  3MTU E;  5TIS E;  4H0L C;  1GDT A;  3JXJ A;  1UG3 A;  2KZI A;  4WY4 B;  1LT1 A;  1K04 A;  4AM9 A;  1INZ A;  4GZ5 A;  2HM8 A;  3QWW A;  5LFA A;  3CKC A;  3F6Q A;  4PD4 D;  3E7K A;  1H6K A;  5AW8 B;  3I4G A;  2X3M A;  3D9O A;  5T4Y A;  1IK9 A;  1NTZ G;  1PY1 A;  5FQ7 A;  3RKV A;  3C3O A;  1JY3 P;  4BXL A;  4GB9 A;  4L2L A;  3G2W A;  3L71 G;  4WNG A;  3B8E B;  3Q79 A;  2WXF A;  4D6T E;  3IXE A;  3IV0 A;  5AW0 B;  3H1L G;  3NOC D;  5AVW B;  3B95 A;  4YVQ C;  3UT7 A;  3L16 A;  1D9S A;  1QL1 A;  3TGU D;  3UT4 A;  1CW5 A;  1LTJ B;  1TR4 A;  2LXL A;  5APX A;  2M8R A;  1BCC J;  1BE3 G;  1EDK A;  2IYP A;  1KT1 A;  2RN0 A;  2E75 B;  4U3F J;  3FUJ A;  3T8K A;  3HIZ A;  5LOZ A;  1GW6 A;  1MX2 A;  2KZT A;  1M56 D;  1X5B A;  5KLV J;  3ZU7 B;  3Q73 A;  2IZ0 A;  3O4Z A;  2M5A B;  1TJC A;  3A3Y B;  4U95 D;  1UIX A;  2Q1K A;  1PL5 A;  4N39 A;  2KLU A;  1OVR A;  3KEZ A;  3CC2 P;  3CCL P;  3UI2 A;  2DYR E;  1PC2 A;  4ZHB A;  2AXV A;  3P2B A;  5LCW J;  2DVW A;  1SFC A;  2C9L Y;  4GMJ A;  3GF7 A;  3HG0 D;  1GL2 C;  1SQQ E;  5ENT D;  4ZKU A;  4GCO A;  3USS A;  4J7W A;  1WDY A;  3VMY A;  5CED B;  3FUN A;  1W2B O;  1JNM A;  3I5C A;  3U9W A;  4XE0 A;  1OWN A;  3SZ7 A;  3VMA A;  3QAR A;  4JEH A;  2AXC A;  3IFM A;  3FY4 A;  4G11 A;  1QL2 A;  3BQO A;  5AJD A;  5C2Y A;  1NTM E;  4TXP A;  3FH5 A;  1RE4 A;  4IRU A;  3A2A A;  4J8S A;  3HUS C;  1AV1 A;  1X0T A;  3AS8 A;  2QVA A;  3CWB E;  1EPU A;  4ACL A;  1SQV E;  5JJ7 A;  3TWV A;  2BCC G;  2W83 C;  1KMI Z;  2FO1 E;  3D71 A;  1N86 A;  2JDI H;  3B13 A;  4I2Z A;  1KYO D;  1OXZ A;  3BU8 A;  4BFR A;  3P7K A;  1NTK D;  2XZD G;  2XDJ A;  4JW1 A;  4DPR A;  3RK2 D;  4I2L C;  3D6Y A;  4DX6 D;  1P84 I;  1L0N D;  4H7X A;  1ZV8 A;  1QEX A;  1RE3 A;  1B89 A;  1VF5 D;  2L0I A;  3A7O A;  2E43 A;  4RJT A;  3MA5 A;  4OGQ B;  2YKP A;  1KFN A;  3KZI H;  3QK0 A;  4H44 C;  2Y4U A;  4P29 A;  5AN8 A;  5TIS H;  4JA7 A;  3L54 A;  4GML A;  2WXR A;  3JUI A;  1W5C E;  3PZ4 A;  3H1H E;  2O01 N;  3QWO C;  5E79 H;  2B88 A;  3ONK A;  1BDD A;  5AW1 B;  2KSE A;  4J8D A;  3CX5 E;  2ION A;  2B0O E;  2KCK A;  4N3A A;  2M3E A;  2IJG X;  5AW9 B;  1Q2N A;  2CG2 A;  5AAR A;  3VP8 A;  4Y28 J;  4I1L A;  4BEP A;  2NPS D;  5CCL A;  2KIK A;  1X81 A;  1E8Y A;  1YTZ T;  3B5N C;  2CFU A;  2QA4 P;  4C7N A;  3RK3 E;  3CCU P;  4L75 A;  2WT7 A;  2NYJ A;  3R4Y A;  3ASH A;  2WIT A;  2WQY C;  3IAO A;  1Y9B A;  3E1R A;  3LY7 A;  1L4A A;  3UM1 A;  2ZIS A;  1USE A;  3TL5 A;  3D9P A;  3VLF A;  3ULE G;  5EIB E;  1OUV A;  4U0U A;  1S9K D;  3WXX A;  4TUU A;  1NZN A;  3VN0 A;  2AXT E;  3G2U A;  2DCP A;  3TWR A;  3E1I A;  5CRU A;  1VQ5 P;  4FC8 A;  1H2U A;  5HKP A;  1S5L H;  2Q9I A;  2IOS A;  3AE6 C;  1NA0 A;  1SQP G;  3H1K G;  3L08 A;  1BE3 J;  4YDE A;  1URQ B;  3CHR A;  4KT6 B;  2B89 A;  1LWU B;  1URQ C;  2IFN A;  3AED C;  5AEN A;  4J8Y A;  2XS8 A;  5KLI B;  3RO3 A;  1L5J A;  1ZR2 A;  4LER A;  3UIA A;  5KLI C;  1LT9 B;  1E90 A;  3SWY A;  2WXM A;  4DX2 A;  4UQZ A;  1T8Z A;  3ZIM A;  3TAX A;  3ZDM A;  2FYU D;  4OAU C;  1SQX D;  2V7Q H;  3CI9 A;  1TN8 A;  2PQN A;  4ACK A;  2Q7C A;  1KQL A;  4O9B A;  1UJK A;  1JM0 A;  1RY3 A;  4GTR A;  3PRZ A;  2AEJ A;  1OFC X;  2N1T B;  1RF0 C;  1OMI A;  3CVW A;  1YTZ I;  1WRG A;  2N1T C;  2HG5 D;  3EFG A;  4CT0 A;  3KEA A;  4TV3 A;  2NXP A;  2D2C B;  4KVM A;  4O6F A;  3U3W A;  3NAW A;  2FI7 A;  5B66 E;  2R2L A;  5J90 A;  3G3Z A;  1E96 B;  3UKR G;  2WPQ A;  1YJN P;  3SWF A;  2JLB A;  4EEC A;  2I6H A;  3FWL A;  2QE7 H;  1NU1 K;  2A4Z A;  3C9I A;  4D6T J;  2ETB A;  5D0O D;  4UB6 E;  3SD5 A;  3RL0 B;  4AP2 A;  4PD4 E;  2ZYG A;  3AE4 C;  3HVE A;  2W8Z A;  1NVO A;  3L70 G;  2JR8 A;  4R4M A;  2L91 A;  4ATZ D;  2V4H A;  5EDS A;  2PL2 A;  3RK3 C;  3FP3 A;  3KSQ A;  3TWX A;  3DPY A;  3U66 A;  2XPI A;  2DWZ A;  1N8R Q;  2IPP A;  3FDH A;  3PE3 A;  1H6O A;  4EOT A;  4YDW A;  3TXM A;  4GTO A;  2Q5U A;  3ZPJ A;  3DSU A;  4HNA D;  4LNG A;  3TK1 A;  2HOD A;  2W27 A;  3PEU B;  3QH9 A;  3O6Q A;  2XCB A;  1JEK A;  1NI1 A;  3K5B A;  5JHB A;  2LXM A;  1E7V A;  5BPP A;  3VLD A;  4W9R A;  2V8S E;  5ENS D;  2XGO A;  3B71 A;  3UT8 A;  1S3J A;  1BSH A;  1QLE D;  3WUV A;  2M0B A;  2RG8 A;  1L0L E;  4LSZ E;  3FUD A;  3E37 A;  1KB9 E;  4BTB A;  5H2F E;  1DX7 A;  2PRR A;  5FZQ A;  1VQM P;  1TNB A;  4CDR A;  5APY A;  1FZF A;  4K03 A;  3RRU A;  5GTH H;  3CWB J;  2XZT G;  3EHR A;  3C72 A;  3OXG A;  4UUC A;  3UMV A;  1SQV J;  2P10 A;  2Y0C A;  1WAO 1;  4JC8 A;  4BWR A;  3CCR P;  1E8W A;  1O1T A;  4NPD A;  1KQF B;  3WMM 0;  4HOS A;  1TN7 A;  3L6A A;  1SQB E;  2K88 A;  1NKN A;  1JPL A;  4B93 B;  4Y99 C;  1YBK A;  2PM7 A;  3BRT B;  1PAQ A;  1RQU A;  3TWU A;  3U4T A;  4GA0 A;  3T5X A;  2C0L A;  5AVU B;  2GRP B;  1ZR4 A;  3D70 A;  2P58 C;  4L1B A;  1KIL A;  3H1H J;  2B87 A;  4UWL A;  1H0T B;  1U2V G;  1NTZ D;  4RVB A;  1K8K G;  2WVR A;  2P2C P;  3AJI A;  3L71 D;  3FEX A;  1KFM A;  1XTG B;  4K5A B;  2X6I A;  4XI9 A;  3CEQ A;  4U8H A;  3UIN C;  3NF1 A;  2QIW A;  3EU9 A;  1SQP K;  4HB1 A;  1FJP A;  1R5L A;  3TGO A;  1GK4 A;  4BT9 A;  3H1L D;  3Q15 A;  3SBT B;  4GU5 A;  4EBA G;  2WPV B;  5C39 A;  5KWD A;  4AJW A;  4C46 A;  2YNY A;  3S7B A;  5BV0 A;  4YXW H;  4NAC A;  4UB6 H;  2Y0D A;  3AG1 E;  3MKQ B;  4PD4 H;  4LCT A;  1BGY G;  3A0H E;  3Q2Y A;  1MQS A;  2FFD B;  1Z5S C;  4E6H A;  2QM8 A;  2K37 A;  3L70 J;  3FUL A;  1FZC A;  1NU1 D;  3BG0 B;  4AY6 A;  1HE8 A;  4Y6C A;  5IY5 E;  3C8V A;  3GHG B;  1YMP A;  3SY2 A;  3GZ2 A;  3GHG C;  1HX8 A;  3DEO A;  1MFT A;  1NA3 A;  3A0B E;  3WUT A;  1S70 B;  4GOD A;  2OVB A;  4GA1 A;  5EKQ D;  3T9K A;  1Q7Y Q;  2R5D A;  3V2N A;  3ABK E;  4EBA A;  1SQB G;  2CHX A;  4UWG A;  3CLJ A;  1JCS A;  3EQ2 A;  1IFI A;  1TN6 A;  3SSU A;  3GYZ A;  4F3V A;  1SLQ A;  2ZVO B;  3HXD A;  3CVV A;  1OCR E;  2PM6 A;  1QBQ A;  1VQ6 P;  1HXI A;  4DLQ A;  1T6A A;  3GG2 A;  1CI6 B;  3CC7 P;  2KSJ A;  2ITA A;  2WSE J;  4UWF A;  3T5V A;  5H2F H;  3AU5 A;  3D9J A;  3LJ3 A;  2BCC D;  4CDN A;  1MHQ A;  3H1J E;  4JYC A;  1TYQ G;  1AQ5 A;  3FH8 A;  3M0D C;  1A17 A;  4HOR A;  1KZO A;  3RIB A;  4HYT B;  1RQV A;  3L73 G;  2X6H A;  3D9H A;  1VQO P;  3Q1M A;  4M7C A;  1L4A D;  3ZYQ A;  4DI4 A;  3RK2 B;  3EDT B;  1OCZ E;  2CPS A;  4AYC A;  1VQK P;  1EYH A;  1LD8 A;  3NBN B;  3H1I G;  1JTH B;  3RK2 C;  4I43 A;  1LTT C;  1VF5 B;  2PGD A;  3ZN3 A;  2XV5 A;  3QKY A;  2IO2 C;  3FUI A;  3ASF A;  3TG5 A;  1HFA A;  3Q78 A;  3U59 A;  3ML8 A;  2OCC E;  2R02 A;  3ULQ A;  1ZP0 C;  2IFM A;  2XND H;  1V55 E;  1IQU A;  3PDN A;  1KYO H;  2QY7 A;  2WXO A;  4OWF A;  1KT0 A;  4ME2 A;  2BF0 X;  2KS1 B;  3V2P A;  1Q81 Q;  2PQR A;  2WZ7 A;  1DCE A;  1OW7 A;  2VGX B;  5AQA A;  2NPS B;  2QJK B;  3HTK A;  2BEQ D;  2WPS A;  1JUN A;  2NPS C;  2QJK C;  3FFL A;  2GRL A;  4ABN A;  2AEM A;  3L75 G;  2YIN A;  3JCU E;  2K9J B;  3ASG A;  3ENE A;  2R3S A;  4DCK A;  1AJY A;  4XEI G;  2JWD A;  4U7E B;  1LTX A;  2KYV A;  1YA0 A;  4FLH A;  3B7U X;  4DUI A;  2L6B A;  3JUE A;  3UIP C;  3M9B A;  5AVS B;  3RBX A;  1UJJ A;  3A0H H;  5G04 C;  3WUU A;  2LAI A;  1JCR A;  3ISM C;  3BCC D;  1OCC E;  1SQP D;  4G23 A;  1JCD A;  3H1K D;  1S72 P;  1MX6 A;  2GGF A;  1L0L J;  2IBZ I;  3ZHE A;  2CK3 H;  3CIA A;  4AUW A;  2WQ7 A;  4AEZ C;  4EZL A;  5AVQ B;  3IHY A;  3ASD A;  4YXD C;  1O1R A;  3L74 D;  2QZA A;  2HO1 A;  4N78 E;  5CCG C;  3QJZ A;  1IFD A;  3RK6 A;  5DIZ A;  2RH0 A;  3PH0 C;  3HD7 A;  3DPD A;  3SBS A;  3SO8 A;  1NJI Q;  3L22 A;  4G8K A;  2Q7F A;  3CC4 P;  4RQI A;  2WXH A;  2DBA A;  4U3F G;  2RFM A;  2IFU A;  5HI7 A;  1SQB J;  3EWK A;  1EDI A;  3NTN A;  1SZA A;  4CGW A;  1D8D A;  1EZV I;  4U8Y D;  2Y4T A;  1J1D C;  1GD2 E;  1BI7 B;  3DRA A;  1VDF A;  1P84 D;  3HE5 A;  4YTP C;  1YQ4 C;  3ABV C;  1FDM A;  4HH2 A;  4XZ4 A;  2Y9Y A;  2WVI A;  5FQ4 A;  3GLM A;  2A06 E;  5ANR A;  1BDC A;  1MYO A;  2BEZ F;  1OWL A;  4X8Q A;  2WSF J;  4CEM A;  1HG5 A;  4WND A;  1X22 A;  1E79 H;  1FAV A;  1J1E B;  3ULY A;  4RES B;  3O8Z A;  4U8V D;  2P9P G;  3ZVV A;  1PPJ G;  2KNC A;  1W3B A;  2V0P A;  3H1I J;  2YMY A;  2QEX P;  1HH0 A;  1N7S C;  1L0N K;  2M3B A;  3FU6 A;  1A02 F;  4YVO A;  2P9L G;  1FZE A;  2IO3 C;  3KHU A;  4WNE A;  1ZXG A;  4HOT A;  2J09 A;  3MEK A;  2RD0 A;  3F5H A;  1HVV A;  4GYO A;  3DXM G;  3NMD A;  2UY1 B;  4MBG A;  2FYN C;  1FZG A;  4HB5 A;  1DIP A;  5ENP D;  1K3Z D;  3MCX A;  4MKT A;  5G04 J;  2OYH B;  4FHK A;  1M1J B;  3ML9 A;  3WG7 E;  3BG1 B;  2OYH C;  1M1J C;  3T97 B;  3Q47 B;  4N3C A;  5CCH A;  1N73 A;  2UWJ G;  2KAT A;  3FTX A;  5AW4 B;  5CRV A;  2P67 A;  5E79 E;  5APS A;  2OTK E;  4WY4 C;  1H89 A;  1XGW A;  1KIL D;  1Q90 D;  5AAO A;  1PGO A;  3EFF K;  3H6P A;  4DOJ A;  3FU3 A;  3I4R B;  1VQ8 P;  5T3R A;  1PIX A;  2AWI A;  4I6G A;  5G55 A;  1Y8A A;  3AEE C;  4WVZ A;  1S5L X;  1U57 A;  1ZRT E;  1KLX A;  3R9A B;  2XS1 A;  2O3J A;  3H1J J;  4CDM A;  4L74 A;  3AAA C;  3IEG A;  3L72 D;  1EZV G;  3MD0 A;  3I55 P;  4DX7 D;  4GTP A;  3JCK C;  4WWO A;  5B5E H;  3PHL A;  1K1B A;  1VL2 A;  3LID A;  1LTJ C;  1XNF A;  4PJ0 E;  1BU9 A;  2OAR A;  4ILI A;  3KD7 A;  3D9I A;  5BU8 B;  2LO6 A;  3PZ1 A;  1S5L E;  2PP6 A;  5CHE E;  2FBW C;  2FYU K;  2FUL A;  2E75 C;  2KZT B;  2GUV A;  3H32 B;  1SQX K;  1DEE G;  3B4S A;  1FZA A;  5J08 A;  1M90 Q;  2E76 D;  3EHN A;  1Y6I A;  2YXQ B;  4NPF X;  1N95 A;  4W7Z A;  3CQG B;  5ENN A;  5HRY A;  3UXG A;  4XIF A;  1M7L A;  5TJH A;  5AW3 B;  2XEV A;  1SS1 A;  3D9K A;  4NUR A;  1NH4 A;  3FH7 A;  1IFJ A;  5FT9 A;  3ZGQ A;  2EIN E;  5AQB A;  4FP7 A;  3CSF A;  2M5A A;  1BGY D;  4HVB A;  5HQ8 A;  4C9B B;  3LW5 H;  3RJV A;  3PJS K;  3AU4 A;  3LY9 A;  2POH A;  3EUV A;  1HUC A;  4J8F A;  4A1S A;  4E85 A;  3V4W A;  5KNH D;  1GL2 A;  3AEG C;  3FUE A;  4MLP A;  1IFP A;  1RE4 C;  1H2T C;  3KS2 A;  2WXN A;  3D9M A;  1NP7 A;  1GMJ A;  1JY2 O;  3URZ A;  1OWM A;  4Z68 A;  2W6A A;  2IU1 A;  5KLV K;  3X2Q E;  1M57 D;  3Q5M A;  3CX5 I;  4D6T G;  1N4S A;  1OWA A;  1BI8 B;  3HUS A;  4Q94 A;  2KCL A;  3Q3D A;  3MZW B;  1QNF A;  2ZXE B;  4PS8 A;  3BCC E;  3DWL G;  3C3R A;  1N4R A;  1GK6 A;  2E74 D;  4OGQ C;  3FU0 A;  3SHF A;  2H88 C;  1EXI A;  3CPW O;  4OVU A;  2W6B A;  3CCQ P;  3UIO C;  4GYY A;  1HH8 A;  3VOP A;  3CXH E;  1LTG C;  3LPZ A;  1JOC A;  3MUD A;  3I5P A;  2DZN A;  3E32 A;  5AW5 B;  4F1P A;  4A3V A;  3E4B A;  3L73 D;  3AS4 A;  1SA4 A;  3FTU A;  1SQQ G;  1LF8 A;  5AQ7 A;  5G2N A;  1N52 A;  2X38 A;  1L4A B;  5AQ9 A;  1PFI A;  2OTL P;  3B5N A;  4YDY A;  4IOI H;  3BEE A;  3V79 K;  4PJ0 H;  4DI3 A;  1NTM G;  1SW6 A;  5ENO D;  1PP9 E;  2L5G B;  1KOR A;  2JWA A;  3LEW A;  3DBS A;  3CWB G;  2HE0 A;  1SQV G;  2DYS E;  2R5B A;  2R5S A;  1PZQ A;  5APT A;  1X79 B;  5GTH E;  5B1B E;  3UM3 A;  3MP7 B;  2C2L A;  4TUM A;  3JQ1 A;  3RO2 A;  4A55 A;  1D8E A;  1LWU C;  3G71 P;  4KVO A;  5KAF H;  4QMA A;  2KLV A;  2N9B A;  1MX4 A;  3B7R L;  1YQ3 C;  3L75 D;  2HLO A;  1LT9 C;  5FZS A;  3ZRH A;  4U7J A;  1E8X A;  1NTZ K;  3N4X A;  2RKK A;  5AW2 B;  3ESK A;  3L82 A;  5AIJ A;  5FQ6 A;  4G24 A;  3IF4 A;  3AG4 E;  4J6I A;  1AQT A;  1FVH A;  3CK8 A;  2H6H A;  3H1H G;  3M9Q A;  5HS0 A;  4BT8 A;  1WT6 A;  1NAY A;  4HOU A;  2V5F A;  2WXK A;  3KAE A;  3EHM A;  4F6R D;  4EIJ A;  4PD4 I;  2YMK A;  2I2O A;  3APF A;  2WM9 A;  4L73 A;  1IXV A;  5KJ7 C;  1X9V A;  2MOW A;  2WMO A;  2LXB A;  4JD2 G;  2D2C C;  4PV1 D;  3SF4 A;  1VDY A;  5EYP F;  3AE1 C;  3QWV A;  4K3A A;  1RF0 A;  3G6E P;  4QFV A;  2N1T A;  4BWN A;  1VQN P;  3HYM B;  3FWN A;  1FDI A;  3V31 A;  3M91 A;  5JMN D;  4EZK A;  5T8I A;  3HRA A;  1BCC D;  1TNZ A;  2YNQ A;  1NHL A;  1OY3 D;  4U3F D;  4ATG A;  4BET A;  1YCS B;  3RL0 C;  4AY5 A;  3PUK A;  3P8C D;  3UM0 A;  3HVE B;  2XKM A;  5KLV D;  2H6F A;  3EIJ A;  2AVP A;  2A45 I;  2V4H C;  4ANX A;  3VYI A;  4EDF A;  3G4S P;  3W67 A;  3DXK G;  4APF A;  1IO4 A;  2QYU A;  3CXH H;  4WB4 A;  3KQG A;  4XX5 A;  3TWT A;  5JJT A;  3UKU G;  2FXM A;  5AW6 B;  3TGU E;  5JA4 D;  1KB9 I;  3VTP C;  5EIL A;  3E34 A;  4CYM D;  3LVQ E;  3KDP B;  2HOD B;  4FU3 A;  2VRS A;  5BXU A;  3MGB A;  4HLL A;  1V54 E;  2XEH A;  3O6Q B;  1ZU2 A;  4GZD A;  2ZVN B;  2GW1 A;  5EX0 A;  1GW4 A;  1JWF A;  1N11 A;  4GZ6 A;  5CCH D;  4BER A;  3TJP A;  2XRY A;  2I8D A;  2F0Y A;  2XPZ A;  1SQQ J;  2V7Q J;  1Q2Z A;  3KYQ A;  2KB7 P;  3PVL A;  1P84 H;  3Q49 B;  4FLB A;  1JY2 N;  4I7Z B;  1EF1 C;  2KOG A;  2SPZ A;  3OW2 O;  2O01 H;  5G05 C;  2MRI A;  4I7Z C;  4FJZ A;  2HFE D;  1HBW A;  2ETA A;  4U63 A;  4A7P A;  2P9K G;  5ARF A;  4FHJ A;  1NTM J;  4HLE A;  4H0L D;  3QNK A;  3GW6 A;  3W68 A;  2MKV A;  3O48 A;  1ELW A;  2WSC H;  3FTY A;  3FUK A;  4GOF A;  2ZGG A;  5H7P A;  4EYY Q;  5CJ4 A;  2KI7 B;  2V4L A;  3I3N A;  4Q96 A;  3L9T A;  2IBZ D;  1RHZ B;  4ANU A;  3FTS A;  2OYO A;  5CMW A;  3M9H A;  2LR2 A;  2YXR B;  4BRY A;  1QQE A;  3HHM A;  2AXU A;  1KYO E;  1NTK E;  4AQR D;  1KIL B;  2P2U A;  3E30 A;  2OYI B;  2B87 B;  1AVY A;  4GPK A;  1KIL C;  2OYI C;  1L0N E;  4GCN A;  1N9A A;  4OYS A;  4YDO A;  1JY2 P;  3TGU G;  3V2Q A;  2EQX A;  3Q9U C;  4GZC A;  4NPE A;  1SFC D;  1OZH A;  2HYN A;  2P58 A;  4W80 A;  3SGH A;  2VGY A;  1EZV D;  1SQV K;  5KBA A;  3MGN A;  4GTV A;  1D7M A;  1S2E A;  2A45 G;  2VSY A;  3EJN A;  3A5T A;  4A1G A;  2OEW A;  2LUH A;  3V2X A;  4Y6W A;  5B3S E;  2KC7 A;  4CCA A;  2PAJ A;  3ZXP A;  3FGA D;  3FUH A;  3OTN A;  2OTJ P;  3TWQ A;  1L0L G;  1PGP A;  1BE3 D;  2EIJ E;  3CVL A;  4TXR A;  5E75 A;  2W90 A;  1FS0 E;  1GL2 D;  1BSN A;  3KXD A;  5APU A;  1G2C B;  4HFG A;  5KJL A;  4D10 C;  3V2O A;  2LSV A;  2FFD C;  1PP9 J;  2WPV A;  1DH3 A;  1FZC B;  1FZC C;  1L2P A;  2E76 B;  3IBE A;  4WUY A;  5AVR B;  1HU3 A;  2E76 C;  5AVT B;  3TSI A;  3ASN E;  3MZL B;  4DJA A;  1S9K E;  3VTX A;  1X8Y A;  2AJA A;  2KUB A;  1Y47 A;  1HS6 A;  2ZT9 D;  3C3Q A;  1R8E A;  2CFZ A;  2V5Q C;  3RBZ A;  5KJK A;  3CHP A;  4GTS A;  3AEF C;  3G9R A;  2KCV A;  1TU3 F;  4HRL A;  3GHG A;  1RF1 B;  1E8Z A;  5GTI H;  1RF1 C;  3APC A;  2XNX A;  4WWI A;  2PNN A;  2A5E A;  3CGH A;  5D0Q D;  2XPY A;  5APW A;  2BAS A;  1M1K Q;  2NRG A;  4H44 D;  2FYU E;  4GPM A;  3DST A;  4IFM A;  3UUX A;  1SQX E;  3OA7 A;  3CVN A;  2F37 A;  3L35 A;  1YJ9 P;  1YYC A;  3AE5 C;  4D6T D;  2H43 A;  1WM5 A;  5KNG A;  2QSI A;  4JA9 A;  2WSS H;  3IN6 A;  4BTA A;  1N0Q A;  4CPG A;  1EXJ A;  4ZMD A;  2WQ6 A;  3B5N D;  2ZGD A;  3R7R A;  1VF5 C;  2AW6 A;  3VMZ A;  2C0X A;  1S63 A;  2YO2 A;  2E74 B;  3UX4 A;  3Q75 A;  1AA0 A;  2LNI A;  3AE3 C;  2J4B A;  3B7S A;  4JBZ A;  5ENR D;  2YIU B;  2KP8 A;  5DJT B;  1OW6 A;  4BSZ B;  4I6E A;  2YIU C;  1DCQ A;  5CCM A;  4C0M A;  1JTH A;  3AG3 E;  3W9F A;  5M1B A;  4B0Z A;  2M63 A;  4YND A;  3QWP A;  1BCC E;  3BRV B;  3HTK B;  1FE6 A;  2QRX A;  4LG6 A;  3CME P;  1OVV A;  5BW8 C;  1N94 A;  2R05 A;  3MYV A;  3LS8 A;  3TGU J;  1Z3X A;  5L8R J;  1MZ9 A;  2Y0B G;  1E7U A;  3NOG D;  2GRQ B;  1YJW P;  4GA2 A;  2NPS A;  4ANW A;  1J2J B;  1NTM D;  2IEJ A;  1NFI E;  1FU1 A;  4XKC A;  4LRZ A;  3CWB D;  2K9J A;  3S7J A;  1SQV D;  3RGU A;  2WWW A;  1G1I A;  3BAT A;  3ZHE B;  3H1J G;  1K9M Q;  1O1S A;  2GRO B;  1LP1 A;  1DVP A;  4NRH B;  3RSE G;  3ZYL A;  3G2S A;  1YIJ P;  4UWH A;  2XEN A;  4F53 A;  4U0Z A;  1N2D C;  2BKK B;  4L2Y A;  2N1T D;  5FTP A;  1QGK B;  3EU5 A;  2A5U A;  3D3M A;  3SNX A;  4LC1 A;  3PZ3 A;  3S7D A;  2Y0E A;  3C1L A;  2VTB B;  3CLQ A;  2BED A;  3ZKJ A;  1WMK A;  5B5E E;  4FA6 A;  2OV8 A;  4GTQ A;  1IZN B;  3H1H D;  1YHQ P;  5D2M C;  5KAI E;  2IZ1 A;  3U1C A;  4DT0 A;  2GRN B;  4ILH B;  3CX5 D;  2L9B A;  5CCG A;  2GRR B;  1N4P A;  3PH0 A;  4DZO A;  5FQ8 A;  2DZO A;  3HE5 B;  5JJ6 A;  1MUU A;  1NTK J;  2H7H A;  3SFD C;  2O1J A;  4HBD A;  3TDK A;  1L0L K;  1L0N J;  2LKM A;  1ZME C;  3CV0 A;  2CG3 A;  3RK3 D;  3QB2 A;  4J0U A;  4PV1 B;  2IYO A;  2J58 A;  4OAV B;  4RLY A;  2I1J A;  4I1M A;  1KZU B;  4IYP A;  3TXN A;  3LXU X;  4OVV A;  3J5Q B;  4UI9 K;  1A5E A;  2IY0 C;  2R59 A;  5ARG A;  1J1E C;  1S0P A;  5BU5 A;  4I1A A;  3ONL A;  1OW8 A;  3L37 A;  4J8E A;  2P9S G;  1IQR A;  1NTZ E;  3OAW A;  1KQS O;  5BV1 A;  4WWN A;  4TRQ A;  3CK7 A;  3L70 D;  1JO5 A;  1U7J A;  3L71 E;  3CMA P;  4N3Y B;  4XA4 A;  4LLH A;  3CVP A;  4FJY A;  1HJB A;  1EC5 A;  4L76 A;  1SQB K;  1N0R A;  2IOL A;  3Q7A A;  4CRW A;  4K5B A;  2J5U A;  3PZ2 A;  3AEC C;  2O1K A;  3H1L E;  2HPC A;  1HTL C;  1SA5 A;  3KPE A;  3UQ3 A;  4PS3 A;  4IL6 X;  2J49 A;  1G1J A;  4EZJ A;  1N7S A;  1UOH A;  1R5S A;  2FO7 A;  1TNU A;  4NIK A;  3B7B A;  2WQH A;  4HRM B;  4KZ0 A;  3CKB A;  3FXD A;  5EX3 A;  4RKU J;  4EHM A;  4RG9 A;  2Q6Q A;  4Q69 A;  1JMB A;  1ZBP A;  3TNU A;  4XI0 A;  3ZYM A;  1FPP A;  1NU1 E;  1BD8 A;  5CCH C;  2UY1 A;  4DX1 A;  1M8O B;  4WWP A;  1Z56 A;  1FT2 A;  3LY8 A;  3MX3 A;  3PNT B;  2QJP B;  4L23 A;  1LTS C;  4U04 A;  3Q5R A;  1HF9 A;  3RAU A;  4IL6 E;  2QJP C;  2MHK A;  1H19 A;  3PS6 A;  2OYH A;  4C0E A;  2JKV A;  2YHC A;  3HE4 A;  4KBQ A;  1IJD B;  3CQC B;  4H0L B;  4KYO B;  2J4D A;  2A06 G;  3I56 P;  3DSW A;  2ZAE B;  4WY4 A;  3BVH A;  2FYU J;  1SQX J;  3MV3 B;  2ZJS E;  2K9Y A;  1VQ7 P;  3TG4 A;  4HS2 A;  1NO4 A;  4GTT A;  1OIP A;  1GW3 A;  1FBM A;  1EDU A;  3RRN B;  5EN5 D;  3SWK A;  2KXP B;  2ZU6 B;  2KXP C;  5CBO A;  4I1O B;  2BCC E;  2QM7 A;  1KN7 A;  1HWT C;  3ZXS A;  5KAI H;  4ASW A;  4GTM A;  3FX0 A;  1Q82 Q;  1UN8 A;  1PGQ A;  5K5G B;  2L0T B;  4TXQ A;  5FZR A;  3ZUV B;  1UW4 B;  4UWK A;  3CHS A;  1LTJ A;  3DSS A;  5KAF E;  4C48 B;  4LGD E;  1FT1 A;  4I9C A;  3D9N A;  2GM4 A;  4KHX A;  1FOS F;  4GZ3 A;  1PGJ A;  2MJZ A;  1MV8 A;  1CZQ A;  1SFC B;  2JO1 A;  4OH8 B;  3LKU A;  5FIO A;  1ZN5 A;  3H32 A;  1SFC C;  3U1A A;  1Z6T A;  2WPR A;  1MZC A;  3BUA A;  2FEZ A;  3LVR E;  1NU1 G;  3JSV C;  2E42 A;  4LUN U;  2B9B A;  2LAH A;  2XGM A;  1OCO E;  1L0L D;  5KKZ B;  2QG4 A;  1VQ9 P;  4LEU A;  1KB9 D;  5KKZ C;  2BKG A;  2BUG A;  3V5B A;  1ZW0 A;  5A6C A;  1GL2 B;  2E0I A;  1JWG A;  3QAQ A;  3AE8 C;  2RMZ A;  2VJ8 A;  4H7Y A;  2Y69 E;  3KSL A;  2NC9 A;  2FY8 A;  4JQ0 D;  2VGE A;  2XHE A;  3JXI A;  3WU2 E;  5ITZ F;  4ZNC A;  4JHK A;  2WXP A;  3SI5 A;  2OOE A;  1MJ0 A;  4N2Q A;  3JQ0 A;  1JUQ A;  3S1K A;  2IF4 A;  3CXH I;  3SFY A;  3HUS B;  3PE4 A;  3NXS A;  2I9C A;  5JHA A;  1SQB D;  3MJW A;  4APO A;  2WTY A;  4K5C A;  5BNW A;  2ZT9 B;  1RE3 C;  3W9G A;  3Q4A B;  1SQP E;  4KJM A;  3H1K E;  2ZT9 C;  4UQX A;  4AIF A;  4FUL A;  5LP0 A;  2FF4 A;  4ANV A;  1HJ0 A;  2ZYA A;  2Q3E A;  3L36 A;  1NWQ A;  4U0S A;  3LCA A;  1W2E A;  4EQF A;  3NB2 A;  3PNL B;  4IL6 H;  3ITK A;  5AVX B;  3L74 E;  5LX8 A;  4C7R A;  4IFD K;  1TJF A;  2EIL E;  2H6I A;  1JCC A;  3Q9N C;  1BLX B;  1YI2 P;  2WXG A;  4L9P A;  4H44 B;  4KZC A;  3MUD C;  1O5M A;  3K9I A;  3TYY A;  2Y3A A;  1TNO A;  3AS5 A;  4C7N B;  3CCJ P;  2VYI A;  4AXH A;  2WT7 B;  4GT1 A;  4GYW A;  3HRN A;  2XEE A;  1NYH A;  3C5R A;  4HOQ A;  1AFO A;  3H1I D;  1K73 Q;  3ZEF A;  3HXC A;  1L4A C;  1P84 E;  4BSX A;  4JPZ B;  4JHJ A;  4I2W A;  1ZOY C;  2WMN A;  3B5N B;  2NZ2 A;  5BT1 A;  3PTZ A;  4JEU A;  2JJL A;  1EDL A;  4JF7 A;  4DX5 D;  3MV2 B;  3UPV A;  4B94 A;  3LW5 J;  1FC2 C;  1NTZ J;  4G8L A;  3CR3 A;  3L71 J;  2R32 A;  3TWW A;  2G8Y A;  3CHO A;  4F7A A;  2Z5H A;  4TT3 H;  3ASO E;  3FTZ A;  4W7Y A;  3H1L J;  1ELR A;  1RZ4 A;  5AYW D;  3R2P A;  3QOU A;  4B86 A;  3TWS A;  3IHV A;  5AJL A;  3L70 E;  3HD7 D;  1DNP A;  3BCC G;  3OJA B;  4RSY A;  4HJG H;  2KBX A;  2J9Q A;  5ANL A;  2KK7 A;  4XKB A;  3N7N A;  4RG6 A;  3AEB C;  4UB8 E;  1URQ A;  2OQQ A;  3JYS A;  3DEP A;  3SFZ A;  1LWU A;  3Q5P A;  1PV3 A;  3CVQ A;  5CCG D;  1NU1 J;  2Q3I A;  1GZL A;  1LT9 A;  4URK A;  1OWO A;  3L74 G;  2W6J H;  2MYO A;  4H13 D;  3CVX A;  1IHG A;  5A7D B;  3HXF A;  3IR9 A;  4B8A A;  3B7T A;  1GU5 A;  1IKN D;  2WB2 A;  3H1J D;  5FIN A;  3UM2 A;  1IYG A;  1LTI C;  4DLO A;  4YPC A;  2GUS A;  2ZFC A;  3LJN A;  2Y9Z A;  4IFF A;  3FXE A;  3AG2 E;  1FVF A;  3CHM A;  1IFN A;  3WU2 H;  2R17 C;  3PP5 A;  4I9E A;  2ZXW E;  4XFJ A;  1XTC C;  5DJU B;  4I6J A;  1KIL E;  1IHB A;  2YKQ A;  3JC2 2;  5APV A;  5KJ7 A;  2J07 A;  1U3C A;  3PLN A;  3LIE A;  1FCH A;  1LTB C;  3S2A A;  2GA1 A;  4N2S A;  4HKZ H;  2L6J A;  3L17 A;  1AWC B;  4G1T A;  3SQV A;  1PP9 G;  1TEZ A;  5AW7 B;  3TF5 A;  2BCC J;  4A3T A;  2PZI A;  4HXI A;  3DSV A;  3L72 E;  4BX8 A;  2HR2 A;  5CEC B;  1T3J A;  3CHQ A;  5AVY B;  4DRX E;  1NGM B;  1N7S D;  1HG2 A;  5CER B;  4ILG A;  1FJK A;  1N54 A;  3RK3 B;  3CVU A;  2F8X K;  2G3A A;  4K35 A;  1FDO A;  3PEV B;  5APQ A;  3SFX A;  3CX5 H;  1PPJ D;  5ENQ D;  5GTI E;  1N7L A;  3ESL A;  4G2V A;  3VP9 A;  4JVS A;  1T2K D;  2J08 A;  2CPB A;  1KPS B;  3ZNG A;  2QYJ A;  3T8M A;  2ZXX A;  1HF8 A;  1S1C X;  2BTD A;  1OVU A;  2K1A A;  4N5Q A;  4M3L A;  4WY4 D;  1KYO I;  3CCE P;  5EFW B;  5BUZ A;  1TNY A;  1H2V C;  1K05 A;  3ABL E;  2ZIR A;  1BGY E;  3G2V A;  2DW3 A;  4N78 D;  2K3R A;  2AXT H;  2NSZ A;  3S4R A;  2P7J A;  1DD4 A;  3V2R A;  5FWQ A;  3NQP A;  4CGV A;  3HDX A;  2R3C A;  4Z1M H;  5EID A;  3HXE A;  2Y1L E;  4OVN F;  2QFC A;  3QDN A;  4UB8 H;  3BCC J;  1VQL P;  2IX7 C;  1SQP J;  3H1K J;  3P8M C;  5AVV B;  2H89 C;  4BRY B;  3GZS A;  1SQQ K;  2LXC B;  2AXZ A;  1NOH A;  3P32 A;  3L72 G;  1GU4 A;  2F8Y A;  3L74 J;  4Y99 B; 
#chains in the Genus database with same CATH homology
 1EDJ A;  4DX7 D;  1NFI E;  2B89 A;  3RGU A;  1K1B A;  4J8Y A;  1BU9 A;  1LP1 A;  1H0T A;  4DX2 A;  2XEN A;  3ZDM A;  2BKK B;  4OAU C;  3UTM A;  1DEE G;  1JM0 A;  3ZKJ A;  4NPF X;  5CBN A;  3MHV A;  5HRY A;  3UXG A;  4O1O A;  3KEA A;  1SS1 A;  3PH0 A;  5AQB A;  2M5A A;  2DZO A;  4HBD A;  2HR3 A;  2ETB A;  5KNH D;  4A63 B;  4OAV B;  4RLY A;  3J5Q B;  2J8S D;  1NVO A;  4O1P A;  1A5E A;  1U7M A;  4Z68 A;  4ATZ D;  2QC9 A;  5CEA A;  1BI8 B;  3TWX A;  1U7J A;  2DWZ A;  3MZW B;  1SVX A;  1EC5 A;  1N0R A;  4YDW A;  4K5B A;  4HNA D;  2KZJ A;  4HI9 A;  1UOH A;  4O60 A;  2RKL A;  4NIK A;  3V30 A;  3B7B A;  5ENS D;  4HRM B;  3FXD A;  1S3J A;  5BXO A;  1JMB A;  2M0B A;  2DZN A;  2WMM A;  4LSZ E;  1BD8 A;  1DC2 A;  4DX1 A;  1WG0 A;  4F1P A;  5AQ7 A;  1YYH A;  2XZT G;  3EHR A;  5AQ9 A;  4UUC A;  4YDY A;  4IOI H;  3V79 K;  1SW6 A;  5ENO D;  4NPD A;  2ZAE B;  1OT8 A;  2HE0 A;  4B93 B;  1QYM A;  3TWU A;  4TUM A;  5EN5 D;  2ETC A;  1AP7 A;  2KXP C;  5CBO A;  4ZFH A;  2RFA A;  2B87 A;  3EHQ A;  1MX4 A;  1LP1 B;  1H0T B;  4QQI A;  4ASW A;  2P2C P;  3AJI A;  5K5G B;  1K1A A;  4K5A B;  3ZUV B;  4GOE A;  3EU9 A;  5HS0 A;  4HB1 A;  3J5P A;  5KWD A;  4C48 B;  5C39 A;  4F6R D;  5FIO A;  1IXV A;  2LXB A;  2JAB A;  4HI8 A;  5EYP F;  4K3A A;  4BES A;  4QFV A;  3V31 A;  4GMR A;  5JMN D;  2UWJ E;  2R44 A;  2BKG A;  3HRA A;  1YMP A;  1ZW0 A;  1OY3 D;  4BET A;  3DEO A;  1YCS B;  1MFT A;  1S70 B;  4GOD A;  1G3N B;  3T9K A;  2VGE A;  3JXI A;  4U96 D;  5ITZ F;  4ZNC A;  1MJ0 A;  2V4H C;  5EYL A;  3S1K A;  5D66 A;  4K5C A;  3TWT A;  3W9G A;  4MN4 C;  4KJM A;  5JA4 D;  5EIL A;  4CYM D;  4HRN A;  5BXU A;  4HLL A;  2XEH A;  4LNU D;  1N11 A;  4BER A;  4ASV A;  2I8D A;  3Q9N C;  1BLX B;  2SPZ A;  3D9H A;  4JB8 P;  3NBN B;  2ETA A;  4CZ2 D;  2XEE A;  3C5R A;  4GOF A;  4HQD A;  2ZGG A;  4DX5 D;  1EDL A;  2KS1 B;  4EYY Q;  1FC2 C;  3JXJ A;  2KI7 B;  2KZI A;  4G8L A;  1LT1 A;  5AQA A;  3TWW A;  3F6Q A;  2LR2 A;  2JWD A;  4BXL A;  3TWS A;  2B87 B;  4DUI A;  2L6B A;  3JUE A;  4HJG H;  2KBX A;  3IXE A;  3Q9U C;  3NOC D;  4NPE A;  3B95 A;  3DEP A;  2P58 A;  1D9S A;  1MX6 A;  1TR4 A;  5KBA A;  2MYO A;  3V2X A;  1EDK A;  3T8K A;  1IKN D;  1MX2 A;  5FIN A;  3TWQ A;  3ZU7 B;  3LJN A;  3FXE A;  2M5A B;  3V2O A;  3SO8 A;  4U95 D;  4G8K A;  2Q1K A;  1OVR A;  2RFM A;  5DJU B;  3UI2 A;  1IHB A;  4ZHB A;  1EDI A;  2DVW A;  3HG0 D;  4U8Y D;  5ENT D;  4HKZ H;  1BI7 B;  1AWC B;  2AJA A;  4J7W A;  2KUB A;  1WDY A;  1Y47 A;  5CED B;  2V5Q C;  4HRL A;  1BDC A;  1MYO A;  5CEC B;  1X0T A;  2QVA A;  4DRX E;  4WWI A;  2PNN A;  3TWV A;  2A5E A;  5CER B;  2FO1 E;  4U8V D;  2F8X K;  4K35 A;  2XZD G;  4GPM A;  4DX6 D;  2F37 A;  5ENQ D;  5KNG A;  1ZXG A;  1N0Q A;  4CPG A;  5AN8 A;  4ZMD A;  3ZNG A;  2QYJ A;  2ZGD A;  3QWO C;  2B88 A;  4HB5 A;  1BDD A;  5ENP D;  2B0O E;  1K3Z D;  1OVU A;  4N5Q A;  1Q2N A;  5AAR A;  5EFW B;  4BEP A;  2KIK A;  2K3R A;  4JBZ A;  5ENR D;  5DJT B;  4BSZ B;  1DCQ A;  3W9F A;  2NYJ A;  2OTK E;  5EID A;  5AAO A;  2Y1L E;  2QRX A;  4LG6 A;  1OVV A;  5EIB E;  2LXC B;  3TWR A;  2Y0B G;  5HKP A;  3NOG D;  2F8Y A;  3AAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...