5CBOA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbp3-16,Immunoglobulin G-binding protein A
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
total genus 55
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cboA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cboA01
4HB5A 4NPFX 4NPEA 4ASVA 5AN8A 4OAVB 5ENTD 5JMND 3RGUA 3TWSA 1AWCB 1LT1A 3J5QB 5CEAA 2DZOA 1BDCA 4HB1A 1SS1A 1Y47A 2LR2A 2ETCA 5KNHD 3EHQA 4ZFHA 3JXJA 3TWRA 2HR3A 4HRMB 1EC5A 4G8LA 4B93B 5JA4D 3V31A 5CEDB 3V30A 5AQ9A 1BLXB 3EHRA 2KS1B 3NOCD 1LP1B 2JWDA 1DEEG 1IKND 2XEHA 3S1KA 1WG0A 1FC2C 4YDWA 3ZNGA 2QC9A 5ENOD 2PNNA 1OVVA 2DVWA 2M5AB 4CYMD 2LXBA 5K5GB 1SVXA 4LG6A 1YMPA 3HRAA 1OVUA 1H0TA 5FIOA 4K5BA 4KJMA 2KBXA 1AP7A 4JBZA 2QVAA 5EN5D 4K35A 2QYJA 4GPMA 3TWQA 2KI7B 4EYYQ 2KXPC 4NPDA 1X0TA 2B87B 1G3NB 2XZTG 5DJUB 1DC2A 3AAAC 1MX6A 2KZIA 4F1PA 3MHVA 1NFIE 4DX1A 4MN4C 5BXUA 4K5CA 4BEPA 3IXEA 3TWWA 1K3ZD 2BKGA 1EDLA 3J5PA 4A63B 1IXVA 2V5QC 3TWVA 2DZNA 5AAOA 2I8DA 1LP1A 4K3AA 3JXIA 3TWUA 2DWZA 2AJAA 1BI7B 5CBOA 4BERA 1D9SA 4TUMA 4IOIH 2M5AA 1MX4A 3W9FA 2K3RA 4U95D 4U8YD 2Y0BG 2XENA 1MJ0A 5ENSD 1EDKA 3C5RA 3ZUVB 5ENRD 4DRXE 3ZDMA 1MFTA 5AQAA 1N11A 3EU9A 3V79K 3JUEA 1WDYA 5CERB 2P2CP 5EIBE 1EDIA 2HE0A 4YDYA 5ITZF 2XZDG 4O1PA 4HI9A 5AQ7A 2P58A 3W9GA 3ZU7B 4WWIA 1IHBA 2B87A 3T8KA 2ZGGA 4F6RD 1K1AA 4HNAD 2ETAA 2RFMA 5CBNA 4DX7D 5EILA 3PH0A 4RLYA 4C48B 5AQBA 1JMBA 4QFVA 4BESA 5HKPA 1U7JA 5EIDA 4NIKA 1OVRA 1N0QA 4GMRA 5HS0A 3TWTA 3DEOA 4BSZB 2F8XK 2F8YA 5KBAA 3UI2A 3UTMA 2KIKA 3Q9NC 4HBDA 1EDJA 1ZW0A 4LSZE 4O1OA 2KZJA 1S70B 2JABA 2B0OE 4J8YA 2L6BA 4OAUC 4ASWA 4HKZH 3KEAA 2KUBA 2QRXA 4QQIA 3LJNA 5EYLA 2VGEA 1ZXGA 1TR4A 2LXCB 2M0BA 4ATZD 1BI8B 5HRYA 3D9HA 4ZNCA 4K5AB 5ENPD 2Y1LE 1JM0A 1UOHA 4O60A 2UWJE 3F6QA 2V4HC 4HI8A 2F37A 3NOGD 3B95A 4DX6D 1A5EA 4CZ2D 1S3JA 4GOFA 2Q1KA 3UXGA 3TWXA 3AJIA 2SPZA 1K1BA 4GODA 3MZWB 1Q2NA 3HG0D 5KNGA 2OTKE 2MYOA 4JB8P 3B7BA 1SW6A 2ETBA 4N5QA 5D66A 3Q9UC 4G8KA 4LNUD 5AARA 4U96D 5KWDA 2ZAEB 1DCQA 3FXEA 2A5EA 1MX2A 2FO1E 3V2OA 2B89A 2B88A 4J7WA 1OT8A 4HRNA 3FXDA 4ZMDA 5BXOA 5C39A 4HQDA 3NBNB 4CPGA 1OY3D 5EFWB 1BD8A 2J8SD 3ZKJA 2RKLA 1N0RA 3V2XA 4HRLA 4HLLA 5EYPF 2XEEA 4DX2A 4BXLA 2WMMA 1QYMA 2R44A 4DX5D 2BKKB 4ZHBA 1BDDA 4Z68A 1H0TB 4BETA 4UUCA 5ENQD 3DEPA 4DUIA 2RFAA 4GOEA 1NVOA 1BU9A 5DJTB 5FINA 2ZGDA 4HJGH 1MYOA 2NYJA 4U8VD 1U7MA 1YCSB 3QWOC 5CECB 1YYHA 3SO8A 3T9KA
chains in the Genus database with same CATH superfamily
1KQFB 3DSXA 1H6OA 4ASVA 2RKKA 1DD3A 1NTZJ 3AE9C 1KMIZ 5KJKA 3RGUA 4B89A 1JWGA 1HX8A 5G04C 4B0ZA 1LT1A 4LUNU 4A1GA 2DZOA 2GA1A 5FZSA 3TGOA 2LO6A 1NTKJ 4UI9C 4U8HA 5KNHD 1DH3A 2R17C 3Q7AA 1DVPA 3ESKA 4RO0A 3HE5B 2QY7A 2Y0DA 1SQPD 3NFQA 2P9KG 1CI6A 2WT7A 4B93B 3A5TA 5D0OD 1BGYJ 2WWWA 2J09A 1FCHA 3LIDA 4UQZA 3V30A 2E5TA 1BLXB 3EHRA 2KS1B 2OOEA 3V6IA 3TSIA 3HTKA 2IYPA 2E75B 5GTIH 1N94A 5GTHH 2G8YA 4I2LC 3G4SP 3CCEP 1FC2C 1HWTC 2IO3C 4YDWA 4EPZA 1FS0E 3UIAA 1IFPA 3RK3C 3CVYA 3PUKA 4I43A 3CVVA 3JQ1A 3L13A 4BT9A 1WM5A 2Q7FA 4WWNA 2Y0EA 4CYMD 1SQVG 2VTBA 2GRPB 3ZXPA 4AV7A 3L70G 2X6IA 3C3RA 3WUTA 2ZIRA 4WNFA 3UKUG 3BU8A 3NAWA 3Q3DA 2XNDH 4W7YA 3G2VA 4I7ZB 2GROB 3HD7D 4MRUA 4GCNA 1N8RQ 3FEYA 4U7EB 1SQBK 3ML8A 3ZN3A 2XRYA 3RBXA 4G26A 1GTWA 1AP7A 4AXHA 1ZN5A 4JBZA 5E79H 1M57D 4F3VA 2UY1A 1NGMB 5FQ7A 3HXBA 1NTMD 1G2CB 5AVRB 3HHMA 4M7CA 2QYJA 4I6JA 4GKGA 2KXPC 3USSA 2CFZA 5AW0B 1PPJD 3PZ2A 1UIIA 2VGXB 1FBMA 2NRGA 1FVHA 3FTWA 3TGUJ 2P9NG 1EZVD 5KLVG 1SQPE 4K0RA 3PJSK 2FYUK 2YINA 2XZTG 2E74D 3CX5I 3GZ1A 3AAAC 3BQOA 4H13C 1MX6A 1Q7YQ 1K73Q 5AIJA 4MKTA 1KQLA 1Q90D 3MTUE 4PS3A 4MN4C 3CVQA 2J07A 3L71D 4WY4A 1QZ2A 1VQPP 5LX8A 1R5SA 2BEZF 3ITKA 4UI9K 5CCMA 3IXEA 2IO2C 5AW7B 2P10A 3II6A 1RF0A 3WG7E 2V5QC 4OGQD 2VJ8A 3RRUA 4M3OA 2WXQA 3CCLP 3CV0A 5AAOA 1ZBPA 3ZW3A 1QLED 3N4XA 4K3AA 2FI7A 1IJDB 1VF5D 3JXIA 3ZHEA 3BCCG 3I4RB 2KCKA 1BGYE 3VP8A 1IFMA 3TWUA 3ZGQA 1N4QA 2AJAA 3T5VA 5T8IA 3H1KD 3SWKA 2HYNA 1OCCE 3L75D 2NPSC 3PREA 5CBOA 1JUNA 1D9SA 2R32A 3VTXA 3CPWO 1LF8A 3M06A 4B8AA 3AECC 2XCBA 1MX4A 3W9FA 2KSEA 4IL6H 1NTME 4GCOA 2K3RA 2N1TC 4U8YD 3JQ0A 3RK3B 4TT3H 2AXCA 2XPYA 1PPJE 5ENSD 5E75A 2W27A 1EDKA 3OTNA 3C5RA 3AG1E 3FUEA 5L8RJ 1EZVE 2GGFA 1P84I 3LCAA 4FULA 1KORA 1MFTA 5AENA 4WNEA 5FWQA 2K9YA 3RL0g 3VMAA 3FTXA 2GUVA 2KZTB 4U0SA 2Y4TA 2V7QH 5AW1B 5CERB 3KSQA 2M3BA 3G2TA 4A3TA 2BF0X 2ZYAA 2L9BA 3CWBJ 3R4YA 3VLEA 1U3CA 5ANRA 5ITZF 2DYRE 3QWVA 2JR8A 3PTZA 4HI9A 2WXIA 4I17A 4CRWA 2E75D 1EXJA 1IHBA 4GPKA 3L72D 3R9MA 4L75A 2XPIA 3JSVC 3KS2A 3L74D 4F6RD 1SQBJ 3N7NA 2P9IG 3L16A 3G71P 5GTIE 4GTOA 4RG9A 2KXPB 2WMNA 1NU1G 5GTHE 2FFDA 3C8VA 2Y69E 2IPPA 4V3IA 4HNAD 3KSLA 2PRRA 2MKVA 3HRNA 1SQQK 3VYIA 2A06D 4IYPA 2YQ8A 3P8CD 4HVBA 3PH0A 4RLYA 1JY3O 4H13B 3L75E 2XS8A 2LSVA 1OIPA 1E8YA 4G24A 3RIBA 3OXGA 2YXRB 1A02F 3D9IA 5CCHC 1GU4A 1BE3G 2Q7CA 3OW2O 1U7JA 2FYUJ 4JW1A 1Q2ZA 3FH8A 2ZXEB 2OGUA 3H1JD 4GZ6A 4NIKA 1OVRA 4Y99C 1N0QA 2V7QJ 1YHQP 1HH0A 3LS8A 3TJPA 3AE3C 3B71A 1KYOH 3CK9A 5BW8C 3O48A 1H0AA 1K05A 2P7JA 2GRNB 2KLVA 1QVFO 2WXKA 3TWTA 1E8ZA 5CHEE 1RHZB 2J49A 3FU3A 4JEUA 5KBAA 3U66A 3PZ1A 3RRMB 4PS8A 4F7AA 1KYOI 3Q9NC 4Y6WA 3HVEB 2KATA 4A1SA 4NQ0A 1LTXA 2NPSB 1D8DA 4HH2A 5CJ4A 2J4BA 1JY3P 3V2PA 2JABA 3EIQC 2B0OE 4J8YA 5CMYA 3L72E 1LTIC 1OCZE 2N1TB 3L74E 1PP9D 3DBSA 3SY2A 3VMYA 4Q96A 2XGSA 1YTZT 2QIWA 2QE7H 2L91A 4ILGA 3HDXA 1ZXGA 2JO1A 1V55E 1TU3F 3L70J 3CWBE 3CVXA 1WRGA 3AE7C 1FZGA 2IOSA 1AQTA 1XTCC 3UIOC 3L35A 3A0HH 4JEHA 5DBKA 3FUMA 4HORA 5ENPD 3ONLA 4JHJA 3U59A 1JEKA 2YKOA 1IK7A 3Q15A 1SQBE 5AJDA 3U4TA 1CZQA 1RE3C 4BY6A 4H7XA 1N9AA 4G23A 2F37A 4AUWA 3RK3D 4IL6E 4YVOA 5APVA 3D3MA 1M1JC 2D2CC 1S3JA 3ASHA 3ULQA 1UN9A 3G6EP 3UXGA 2Z5IA 2YXQB 2AEFA 4GA1A 3Q1MA 3BATA 3QWPA 3QJZA 4XKBA 1W2BO 1LT9C 3JCKC 3AJIA 3IEGA 2A4ZA 4NACA 2SPZA 2FYUE 3GW4A 5B1AE 3E30A 2RG8A 4YPCA 1SQQJ 2OEVA 2WQHA 3ABLE 1KLXA 3W67A 4UB6E 5KKZC 4KVMA 1S4XA 2KYVA 3CK7A 1U3DA 3B4SA 3VN0A 3HE4B 4Y99B 1PP9E 2MYOA 3SI5A 3FH5A 3SFYA 4XE0A 1NKNA 4GTSA 5B5EH 3MV2B 2WB2A 2ETBA 3SWFA 4N5QA 5KJ7C 3JYSA 1K8AQ 5JJTA 2AXUA 2YKPA 3FU6A 4U3FD 2POHA 1GL2C 4LNUD 1RZ4A 2BASA 4CT4A 3LW5H 1LWUC 1JNMA 1T3UA 3ZXSA 1S5LH 1MX2A 3FFLA 2FO1E 1L0LG 3BCCJ 1HGZA 5C2YA 1EXIA 4H13D 1NWQA 5LCWJ 4GU5A 2ZISA 1KFMA 2B89A 1RF1B 1YJWP 1PC2A 3SF4A 2HPCA 1GK4A 2M3EA 3B5NA 3Q4AB 4J8DA 3VLDA 3FTYA 1UN8A 1VDYA 2I2OA 1USEA 2EINE 3N71A 5BXOA 3RK3E 4GA2A 3UT7A 3NBNB 1FJPA 3G9RA 3IFMA 4YXWH 1BD8A 3D9LA 1YITP 4WAFA 1N0RA 2AEMA 2IZ0A 4HLLA 5EYPF 2XEEA 1ZP0C 4DI3A 2FF4A 2IFMA 2YMYA 3IAOA 2R44A 1N73A 4ZHBA 4CEMA 2NPSD 3LW5J 4TXRA 4UWFA 4XKCA 4UUCA 4IFFA 1BCCJ 1KQGB 2XV5A 1JCQA 1RH5B 4A7PA 3M0DC 1TYQG 4U3FE 2N1TD 1VQOP 1NVOA 1NTMG 3W68A 1KV4A 4AP2A 1M1JB 2D2CB 3FGAD 2BCCJ 1OWOA 4JF7A 2IX7C 1U7MA 4XI9A 4XZ4A 1EZVG 3QARA 3FUNA 4HYTB 1YYHA 1LT9B 1X8YA 5KAIE 1SQXK 2AXZA 5AW4B 1SQQE 2M8RA 1KB9H 3CGHA 4NPEA 3D9NA 5JMND 3IV0A 3UPVA 2W6BA 5KKZB 2WTYA 3ABKE 2AEJA 3U1AA 5TISH 1E8XA 1BE3J 1VQ7P 3DSSA 4XEIG 3J5QB 5CEAA 3HD7A 2Q3IA 3ML9A 4FHJA 3L71G 1KB9I 3A0HE 3HUSA 1NTZK 4L1BA 2LR2A 3EHQA 3H1LD 2H89C 1GL2B 4XA4A 3HYMB 1W2EA 3B7TA 5J90A 2HG5D 4LERA 5LP0A 4HOUA 3KAEA 2IONA 1LWUB 3Q5RA 4G8LA 4B94A 1OFCX 2WQ7A 4PUCA 1NTKK 2AWIA 3V31A 2FBNA 1E90A 3CLQA 1N86A 1YTZI 5CHXA 2WXLA 2OEWA 4GA0A 4OVUA 2JWDA 3CC2P 3PVLA 1IFIA 1IKND 5CCHD 2K88A 2NZ2A 3H1KG 1JCCA 3CD6P 3L75G 3S1KA 4N78E 2YHEA 3ZNGA 2QC9A 1KILC 5ENOD 2XDJA 1E7UA 3KZIH 4G25A 3FEXA 4UWHA 3AE5C 4U07A 3CVPA 5CRVA 5B5EE 1ELRA 4KXKB 3NF1A 3CHRA 2FXPA 3B7SA 5K5GB 3H25A 3GHGA 1JCSA 3UT4A 1H0TA 4BT8A 2V4LA 1DEBA 5KCMA 1S63A 4K03A 3H32A 2IEJA 1M8OB 2BTDA 3AE8C 1AV1A 4NURA 3U3WA 2OTJP 3UIPC 1AA0A 1S5LE 1J2JB 3FDHA 1X22A 3QWWA 1H2VC 1QBQA 2JP3A 4JPSA 1KB9D 4NPDA 3H1LE 3MX3A 3R7RA 2BCCE 3KD7A 3RL0C 2FY8A 2P67A 1X0TA 3P7KA 1S0PA 2DYSE 2HODB 1MUUA 5DJUB 3D9MA 1Z6TA 2A06G 1HS6A 4EBAA 1HBWA 4DCKA 2E76C 4DX1A 4FLBA 4AY5A 5BV1A 4L74A 5BXUA 2WZ7A 1SFCC 3EHNA 3L08A 3EHMA 4WBAA 1NHLA 2PL2A 4GTMA 1ZMEC 1G1IA 5AW3B 3PRZA 2WQYC 3TWWA 3H1JG 1OWNA 3CVLA 3L82A 2WXMA 3ASNE 1TNBA 3SQVA 4DPRA 4PD4H 2DW3A 2DZNA 1NAFA 2KS1A 1JMMA 4I1OB 2D2CD 4H44C 1T2KC 3GLMA 4KZCA 4PD4I 4EZJA 2KNCB 2AW6A 1FDOA 3WUUA 3VMZA 3RK2C 1EYHA 1PL5A 2EIME 5AVVB 1NAYA 3FWNA 4ACKA 3PZDA 4U63A 3CK8A 1L0LJ 3G2SA 5CMWA 2O01J 3MA5A 4U95D 1KILB 1SQXD 4PH4B 1KB9E 4U04A 3MUDA 3EQ2A 2C0XA 4FJZA 4LGDE 4WUYA 5ENRD 5E76A 1MKMA 5KJ7D 4GAAA 3AEEC 4RQIA 2JEEA 4U7JA 3AS4A 1LTTC 1FVFA 3C9IA 3ZPJA 1GL2D 1LTBC 2WPSA 3V79K 3LVQE 3IR9A 1NTZD 2Z4EA 1WDYA 3TL5A 4UB8H 5FQ6A 1T3JA 5FT9A 4JHKA 3L6AA 2KOGA 3NB2A 5D2MC 4YDYA 3ULYA 2VGXA 4D6TG 3ENEA 4O1PA 3ZU7B 4IRUA 1NTKD 4WWIA 3CLJA 1MHQA 3IN6A 2XZRA 1S64A 3I3NA 4N3BA 3RL0B 3L37A 3K9IA 2ETAA 2RFMA 3LVRE 3PEVB 3FY4A 4GTQA 3O8ZA 1BGYD 4PS7A 2H6GA 2V4HA 1LTJB 3KZIE 2GM4A 1OMIA 1D8EA 4RKUJ 1S5LX 1KZUB 4ME2A 2KB7P 1JY2O 1XGWA 4I6EA 2E76B 1RF0C 3GG2A 5EIDA 3UM0A 4C0MA 1A02J 1SFCB 3ASGA 1SQXE 1YIJP 3CX5H 2IBZG 3KYQA 1OUVA 1TN7A 3DSVA 3GZSA 3V4QA 2F8YA 2QJPC 5AW8B 4AVXA 2X6KA 2Q6QA 2A45G 1H88A 3EDTB 4H44B 2MRIA 1RW2A 1NTZE 2H8PD 4JZYA 3AG4E 4CGVA 5M72A 1Y6IA 3UT8A 4B8CB 1NKZB 4RESB 1ZW0A 2R05A 1FZCC 4W7ZA 2FULA 3AE4C 3H1HG 4JA9A 4N3AA 3RK2B 4E85A 4F53A 2KZJA 2VTBB 3E1RA 2QJKC 3A3YB 1CW5A 4H0LC 1NTKE 1VQ9P 1Q86Q 1JY2P 3V2RA 2LKMA 4ASWA 3ESLA 1KT0A 3TGUD 4N5CA 2WPVB 2KZTA 2IFNA 1KZOA 4GZCA 3H1IG 3Q47B 5JHBA 3SSUA 1N54A 1FDMA 1N7SC 2DCPA 4L9PA 3OA7A 4JYBA 5LCWC 1HXIA 5CRUA 1MZCA 3Q78A 2LXCB 1HJ0A 3SBTB 2YIUC 1BI8B 3UM1A 1P84H 5ENNA 2WXFA 3D9JA 3ZVVA 1FU1A 3QH9A 2FFDC 4E6HA 4K5AB 2CHWA 3U1CA 2PZIA 3IKOB 3B7RL 4O60A 2UWJE 2VGYA 4L2LA 1DNPA 4EHMA 4KT0J 2X38A 3BRVB 3B7UX 4FC8A 3FUJA 2WITA 1YYCA 5BV0A 2ZJSE 4L7TA 3AEAC 2Q1KA 1HVVA 1X9VA 3CX5D 4C7RA 2WQ6A 1R5LA 5APUA 4YTPC 3WU2H 3DXMG 2CHZA 3TWXA 1N4PA 1L0NJ 4GYOA 3EJNA 3A0BH 1E7VA 1YA0A 4EZLA 1XNFA 3O4ZA 1AFOA 4LRZA 1K1BA 5CJ0A 2QJYC 3MZWB 1BSHA 2O3JA 1UJKA 4N39A 3UMVA 3TG4A 4XFJA 3V2QA 5KNGA 2VSOE 1N4SA 3C98A 4LEUA 4UB8E 3JCUH 4Y6CA 3TGUE 2OTKE 5KLVK 1HF8A 3CHQA 3RO3A 3SGHA 3B7BA 2JWAA 4XE5B 4JD2G 4PDXA 2I1JA 1RE4C 1FOSE 1IYGA 2I9CA 3HVEA 3D70A 2PM6A 1TNYA 3Q9UC 3L73J 4JA7A 4FADA 3URZA 2NPSA 1OWMA 5AARA 5KWDA 3KDPB 4L2YA 1SVFA 3NQPA 3RL0D 1LTSC 1DCQA 4N3CA 3CWBD 3L17A 4LNGA 2WPQA 1Q82Q 3IF4A 4WNDA 4Y28J 2N1TA 3C72A 1FZCB 1T8ZA 4YNDA 3JUIA 4DZOA 1TJCA 2E76D 1SQBD 3S7BA 1Y8MA 1PGOA 1HF9A 3Q75A 4N3YB 3H6PA 2XCCA 5E79E 2WXPA 1SFCD 5CCGC 4ZMDA 3FWLA 5C39A 2MOWA 1KILE 1P84D 1GK6A 5KTBA 3D6ZA 2OYHC 1O1TA 1NOHA 2JKVA 3CX5E 2QEXP 1N7SB 1JUQA 1QGKB 3G3ZA 5APTA 2Y4UA 1TN6A 2ZYDA 4JHRA 3V2XA 1NH4A 1PGJA 5AVYB 2FYUD 3SWYA 4H44D 2H7HA 2ZXXA 3QAQA 4DX2A 1OCRE 5BU8B 3DWLG 2WMMA 3OAKA 2M63A 1BPOA 1L5JA 4ATGA 4DX5D 2J58A 2BKKB 2Q3EA 2FFDB 1TNZA 3WXXA 1Z5SC 1BDDA 3RK2D 5KJNA 5H2FH 2VSXE 3GF3A 4ZKPA 1IK9A 3TG5A 1LTGC 5FZQA 4PV1C 5FJYA 3L54A 3DSWA 4DUIA 3C3OA 4D6TJ 4GOEA 1NP7A 2OVFA 2QG4A 5DJTB 4RJTA 1SQVJ 2ZGDA 5CCHA 2P58C 2R5DA 2NYJA 1L0NE 3CC7P 4OYSA 3FUDA 1UIXA 4KZ0A 1KQSO 1X79B 2R5SA 3SFZA 1YCSB 3HE4A 2A45I 5CECB 3Q73A 2ZT9C 2WXNA 2A5UA 2FKWB 3T97B 3LPZA 4FJYA 3T9KA 2QJYB 5APXA 3G2UA 1NU1K 4AQRD 5AN8A 1AWCB 5CMZA 1OW7A 1LJ2A 2RMZA 4R7LA 1VDFA 1KPSB 1P84E 2IZ1A 4C46A 1BDCA 3L73E 2OQQA 1SQMA 3B13A 3RSEG 4DLOA 1KYOD 1KC8Q 2OYIC 1SS1A 1NJIQ 2KCVA 3C1LA 3KPEA 5D0QD 1IZNB 3KQGA 3PUJA 3L70D 1NZNA 1O1RA 3ASOE 3KHUA 3TWRA 4HRMB 5KLVJ 3CXHI 3S7JA 1KTMA 1RF1A 1TN8A 4JPZB 2WM9A 1JO5A 3B5NC 3PLNA 3D9KA 1L2PA 2ZVOB 4XIFA 5JA4D 5CEDB 5BU5A 5AQ9A 2HLOA 4EDFA 3RRNB 3WU2E 1LP1B 2WXOA 4G2VA 2FEZA 1LGHB 5EX0A 2XEHA 4LLHA 4AYCA 3A0BE 4R4LA 1L4AC 3ABVC 3F5HA 2O1JA 1LD8A 3PZ4A 3H1HJ 4Q69A 1ELKA 2PNNA 4BTBA 3CL3D 2WXJA 1NL4A 2OYHB 2M5AB 2XQ0A 3MGNA 3JCUE 2WSCH 2EIKE 3RAUA 4W9RA 1BSNA 1SQPG 3H1IJ 4A55A 3BRTB 1SVXA 3PEUB 1YMPA 1URQC 1OVUA 5FIOA 4K5BA 4KJMA 3RKVA 1X5BA 1ZV8A 1SQQD 3AU4A 4WB4A 1ZB1A 5APWA 1HZ4A 1OXJA 2CK3H 4ZKUA 1NTZG 2KK7A 3LKUA 3D9PA 3FUIA 3AEGC 1UJJA 5LFAA 1M1JA 5A6CA 3M9HA 3QDNA 4I1LA 3ASDA 2QVAA 5EN5D 3MD0A 3CSTA 4K35A 4GPMA 1ZRTE 1KYOE 2LUHA 1O5MA 1SQVE 5JJ7A 1S1CX 1N52A 1LT9A 3ZRHA 3L70E 3X2QE 3BEEA 3OXFA 1PV3A 2L0TB 5KAFH 4ANWA 2B87B 5BVZA 3OXLA 1G3NB 2KC7A 4YDOA 3BCCD 1N7SD 1E5WA 2E42A 2IJGX 1IFNA 3Q5PA 1DC2A 4BX9A 1BGYG 2NC9A 2ZT9B 4BX8A 4F1PA 1E96B 3B8EB 3MHVA 3I56P 2WSCJ 2HM8A 1KN7A 1HG5A 3HUSC 3M9BA 5KJ7A 1N95A 1TEZA 4N78D 1S9KE 1N7LA 1PIXA 2XU6A 3AE6C 2XPZA 4K5CA 1GL2A 4DLQA 3I4GA 2RN0A 3HXDA 3J5PA 4A63B 1LWUA 4N2SA 1HH8A 1NO4A 2OYIB 1NU1J 1PPJG 2J59M 2KSJA 3FHEA 4IN3B 3TWVA 2HYZA 4I1AA 5KLVE 4AIFA 2ZVNB 2UWJG 2L5GB 2I8DA 4GB9A 3DRAA 3SD5A 3NTNA 4YDEA 2K9JB 3S9OA 2KP8A 4Z1MH 2PP6A 5IY5E 2KM4A 1BI7B 4IL6X 1BCCD 4BERA 1GD2E 4IOIH 3EIJA 3DXKG 1GW4A 2RD0A 1IQRA 2HO1A 1L4AB 1T6AA 2PGDA 1M7LA 1OZHA 3SHFA 3MJWA 3CQCB 1M1KQ 2BCCD 4C7NA 1MJ0A 2J4DA 4KVOA 2MJZA 3UINC 3CVWA 3ZUVB 1DCEA 3UM2A 4DRXE 2H88C 3CVUA 5T3RA 1AVOA 2YO2A 1L0LK 4ANXA 3BCCE 1IO4A 2C2LA 5AQAA 1N11A 5BPPA 3TYYA 1URQB 1WAO1 1VQ6P 4CDNA 2HFED 2XHEA 1QNFA 2VRSA 2X6JA 2QZAA 1KT1A 1JB0J 3M0DA 1OWAA 1MV8A 4BWRA 5EIBE 5EDSA 1BE3D 3EFGA 3TNUB 1USDA 3CCUP 4J0UA 2ITAA 4TXQA 5APSA 2IF4A 3UQ3A 5AQ7A 3W9GA 1QQEA 2IQCA 2HODA 2AXVA 3O6QB 2ZGGA 1H89A 2I6HA 4B86A 1TNOA 1Z3XA 5CCGD 3ONKA 3DPDA 1HFAA 4EBAG 1H2TC 4A3VA 4GZ3A 3P1UA 4TRQA 3PHLA 3F89A 3GYZA 2P9LG 4DX7D 3M0AA 2R2LA 2XEVA 5EILA 3PP5A 1FZFA 3CEQA 2K37A 3LYAA 4C48B 4HOSA 1JMBA 4FHKA 3BG0B 1BCCE 4ILIA 4J8SA 4QFVA 4YVQC 4BESA 1XTGB 2W6JH 3D6YA 5HKPA 2FXOA 1SLQA 3Q79A 2H43A 3E34A 3HIZA 4FU3A 2WSSH 3L72G 3JC22 2XS1A 4GMRA 3HXCA 2X3MA 3L74G 1NU1E 5HS0A 1INZA 1JPLA 4BSZB 3MEKA 2KNCA 1IFDA 4C0EA 3UI2A 2O01H 1SZAA 2KIKA 2PQNA 4MLPA 1SA4A 4HBDA 3R2PA 3SZ7A 1EDJA 4ACLA 1RQUA 4UWKA 5AJLA 1PFIA 3MUDC 1BE3E 3CWBG 5KAFE 3ZYKA 2ZT9D 3AS5A 3MKRA 4O1OA 1OXZA 2WXRA 1DD4A 3HE5A 3IHYA 1K9MQ 2L6BA 3MKQB 1UW4B 4J8FA 3KEAA 2FO7A 1JTHB 1SQBG 2XNXA 2IU1A 3DSTA 3HXEA 2KUBA 2QRXA 3AEFC 2OYOA 3CMAP 1WY6A 4XX5A 3MGBA 1A17A 1J1EC 3VLFA 1OX3A 3CCVP 3WMM0 1FJKA 1VQKP 1TR4A 3FU5A 3R9AB 4ATZD 3KEZA 3GMAA 3I5PA 2LSUA 3Q5MA 2R3SA 1EQ7A 1AQ5A 1SQPJ 2JJLA 4BRYB 5HRYA 2FYUG 4ZNCA 3S7DA 2ZYGA 2ONDA 5LOZA 4CGWA 2J9QA 3F6QA 4M3LA 2ILRA 5TISE 1PP9G 2V4HC 1L4AD 3QB2A 1LTJA 2OARA 3APCA 5KJMA 3NOGD 3TAXA 3B95A 1GZLA 4DX6D 2E43A 1V54E 3FX0A 4CZ2D 2N9BA 1YQ4C 1VQMP 2HR2A 2P1JA 1HE8A 1G2CA 2IYOA 4J8EA 1EZVI 1SFCA 1VQLP 4GMJA 1URQD 5G05J 3CCJP 3NZUA 1L0LD 2C0LA 1FZBA 2JLBA 1J1DC 1UG3A 3ZIMA 1PY1A 4JVSA 1FT1A 1Q2NA 2R03A 2O01N 1L0NK 1EF1C 1O1SA 4EIJA 4C9BB 1K8KG 4JB8P 2J5UA 4H7YA 3AE2C 2DIWA 4NRHB 1Y9BA 3ASFA 1NTMJ 4WY4C 1ELWA 1W3BA 4G8KA 3VTPC 3MV3B 1H8AA 4PD4D 3PNTB 1HG2A 1B89A 2PQRA 2A5EA 2H6HA 5EKQD 1FZAA 3PE4A 1GDTA 2WPVA 4CDRA 4HS2A 2CG2A 2B88A 2YHCA 1CI6B 2WT7B 4HFGA 4J7WA 1NI1A 1R8EA 3V5BA 4HRNA 3G2WA 4TXPA 3UUXA 2CPSA 3T8MA 3MCXA 4AOFA 3QC1A 3I5CA 3L71J 1EDUA 2J08A 3HTKB 2P9UG 1OWPA 2FXMA 4CPGA 3CSFA 4U3FG 1VQ8P 4HXIA 2VSNA 3EUVA 1SZ9A 2C0MA 2BEDA 3RJVA 5EFWB 3SFXA 3BUAA 2J8SD 1J1EB 4JQ0D 3ZKJA 4G1TA 2WVRA 2RKLA 4IFMA 4KHXA 5AVTB 1PAQA 2YNQA 4HRLA 5AVWB 4GYYA 2Z5HA 1L0LE 3GW6A 3LY8A 1QYMA 1CSBA 1SQQG 3FTZA 3LIEA 3E1IA 4WWPA 4Z68A 2MHKA 3H1KJ 3CKBA 2X6FA 3L75J 4I6GA 3LDZA 4RVBA 4CT0A 3FH7A 3DEPA 2RFAA 2QM8A 4N2QA 4GTPA 4TV3A 1BU9A 5FINA 1AJYA 3UM3A 4HJGH 3L36A 1OW6A 4PD4E 1MYOA 3BG1B 2AVPA 4UWGA 2UY1B 1OWLA 3ZEFA 5BNWA 3E37A 5AW9B 1GMJA 5B66H 4TLFA 1JY2N 2QM7A 3TXNA 3SO8A 4APFA 1SQVK 5AVQB 3EFFK 3VTYA 4XI0A 4HB5A 4NPFX 1J1DB 5KLIC 5JHAA 2PAJA 5HQ8A 3PS6A 1FT2A 3TXMA 5ENTD 3TWSA 1AVYA 4OAVB 1QEXA 4KT6B 1H19A 3PH0C 2VQ2A 2C9LY 1KILD 1ZR2A 4W80A 1K04A 4GYWA 4OVNF 1QL1A 3CMEP 5AVZB 1P5QA 2XGMA 3LY7A 4HB1A 1FPPA 1Y47A 4U0UA 3L72J 1JCDA 2ETCA 5G55A 4WY4B 4OVVA 1FZCA 3L74J 4ZFHA 3JXJA 4DOJA 2HR3A 1EC5A 4OWFA 3E32A 4JXTA 4ABNA 1HO8A 2Y9ZA 2L6JA 2QYUA 1IFJA 5C1DA 4L76A 3D71A 1FAVA 3P2BA 2ZXWE 4UB6H 3NOCD 1DEEG 1WT6A 1X81A 1MQSA 3ULEG 3TDKA 3ZHEB 3A7OA 2B6CA 3AU5A 2NXPA 3S4RA 1WG0A 1BCCG 1N7SA 1Z56A 4DI4A 3L71E 2QJPB 1OVVA 3CHPA 3H1JJ 1MZ9A 2LXBA 3H1LG 1L0ND 2JEKA 2BCCG 2WVIA 1PZQA 2FBWC 2C0WA 4U0ZA 4O6FA 3T5XA 4BSXA 4BWNA 4LG6A 4GTTA 3HRAA 3AS8A 5HI7A 3LJ3A 2WSFH 3OAWA 3U64A 4KYOB 3APFA 2Y0CA 3A2AA 2WXGA 1JWFA 2QJKB 3KXDA 3APDA 3QOUA 5B1BE 2XRZA 4H0LB 5A23A 2KLUA 2KBXA 3H1KE 5FZRA 1EPUA 5ARGA 2BEQD 3FULA 3FTUA 1WMKA 2V5FA 3L73D 2OCCE 3WUVA 2EIJE 3TWQA 5A7DB 1KD1Q 1GW6A 2KI7B 4EYYQ 5APQA 3RBZA 1FOSF 4I9CA 1Z3YA 1PP9J 2CPBA 4JYCA 3T97A 4URKA 5ANLA 5G04J 3L22A 5AYWD 3NXSA 3Q5SA 1M90Q 3BVHA 2GRRB 4AJWA 3GF7A 2YIUB 4KMOA 1T2KD 1JCRA 3RO2A 4UI9J 2KZIA 4G11A 4Q94A 2H6IA 1NFIE 1RE4A 2PM7A 4GZDA 2QFCA 2EQXA 5KLIB 4GT1A 3RU0A 2O1KA 3Q7FA 4BEPA 2WSFJ 4BFRA 2AXTH 2A45H 2R5BA 3DSUA 1RF1C 4FLHA 4DK5A 2IBZI 2F0YA 4JC8A 1K3ZD 2BKGA 1EDLA 4WVZA 1IXVA 2VSYA 4UQXA 4RG6A 1JY3N 2R3CA 2R59A 3D9OA 3MIWA 1LP1A 1RY3A 2KCLA 4PJ0H 3AEBC 3QNKA 5KAIH 2A06E 3MZLB 1YI2P 2DWZA 3P8CE 3C3QA 3S7FA 3QKYA 5CCGA 1MFZA 3E4BA 4WNGA 3VOPA 3CCRP 3QK0A 4GTRA 4UQYA 2LAIA 3ABME 4TUMA 2OYHA 3CXHH 2M5AA 2Q5UA 4HLEA 4D6TD 2CFUA 5B66E 1YQ3C 3UX4A 3ZYMA 4RSYA 1ZRTD 3CHOA 3H1JE 1SQVD 2Y0BG 2XENA 3PZ3A 3PDNA 4I2ZA 3CHSA 5G2NA 2LNIA 1QX8A 3ZDMA 1H6KA 1LNQA 1YJNP 2H6FA 1YJ9P 3LEWA 4GTVA 1D7MA 4WY4D 4U3FJ 1N4RA 3EU9A 4UWLA 2B9BA 3JUEA 2OTLP 2P2CP 3PNLB 4JL0A 4I1MA 2JDIH 2YKQA 1S9KD 1EDIA 3UKRG 3AEDC 1Y8AA 2HE0A 2WSEH 2R02A 2FYNC 1ZR4A 2XZDG 1HJBA 2P58A 2WPRA 2Q9IA 2LAHA 2YNYA 4LCTA 1U2VG 2B87A 1SQXG 3T8KA 2IBZD 5APYA 3CC4P 5B3SE 5KLVD 1N73C 2G3AA 2LXMA 4I9EA 4X8QA 4N6JA 1K1AA 4D10C 3CCMP 4AEZC 1VPCA 3ISMC 1RE3A 3VP9A 5CBNA 2X6HA 3CIAA 1LD7A 2W90A 2DBAA 3L4FA 4ANUA 5AQBA 4EI2A 3FUFA 1KZPA 5JJ6A 1H2UA 2W6AA 3H1HD 1S72P 4D6TE 2BUGA 4H0LD 4PV1B 2OYIA 2LXLA 2XKMA 1YBKA 4OH8B 1NTKG 4I6MC 3K5BA 3GZ2A 5H7PA 2K9JA 1QVGO 3FWVA 3DEOA 3MP7B 2F8XK 3H1ID 3CXHD 2WSEJ 5FQ4A 2C9NY 5G05C 3UTMA 1VQ5P 2GRMA 1HU3A 1G1JA 4GDOA 3IHVA 3HD7C 3EU5A 4GZ5A 3CCQP 1L4AA 4FA6A 1PGPA 1HUCA 4TUUA 4ILHB 1FE6A 4LSZE 2QA4P 4HOQA 1S70B 2EILE 4AM9A 1HGVA 4OAUC 1VL2A 2IBZE 2GUSA 4IULA 4HKZH 2N9YB 5H2FE 4L73A 3OJAB 3FUKA 1URQA 2CG3A 2P9SG 1S2EA 2NSZA 3FUHA 3LY9A 3CCSP 4QQIA 4MS6A 5FQ8A 3AE1C 2HPCB 1IC2A 1N2DC 2AXTE 3B5NB 3LJNA 5EYLA 2E74C 5FTPA 3TNUA 4APOA 2VGEA 3E7KA 1OW8A 3TF5A 2M0BA 3H1LJ 2W83C 3PRJA 5AVSB 3R7QA 2E5YA 4F1SA 4EOTA 3FTSA 2P9PG 3H1HE 3O6QA 4EZKA 4R4MA 2V0PA 1NYHA 4PJ0E 4DT0A 2IFUA 3CHMA 2GRQB 3D9HA 3V4WA 2FYNB 1OCOE 2YO3A 3PE3A 5BT1A 3GHGC 4P29A 3NZSA 2Y1LE 3FU0A 1JM0A 1NU1D 1ZLLA 1UOHA 1GW3A 2ZU6B 3TGUG 1LTAC 1DIPA 4HI8A 1SQPK 4OGQC 3H1IE 3CXHE 3DPYA 1N73B 3TK1A 3U9WA 1ZU2A 4EQFA 2FYZA 1VF5C 5AW2B 3MYVA 4LNBA 5BUZA 1A5EA 4GOFA 2V8SE 3HXFA 3EWKA 5ARFA 3P8MC 1GU5A 2E0IA 3LXUX 2YMKA 5AVXB 4GODA 2P2UA 4AY6A 4IFDK 4GMLA 4J6IA 1KFNA 3HG0D 2ZFCA 2Y3AA 4WWOA 3V2NA 1NA3A 4YXDC 3AG3E 1SW6A 2PFXA 2GRLA 3ZYLA 5D66A 3L9TA 4DJAA 3M9QA 2WXHA 4FP7A 3SFEC 1SA5A 2VYIA 1M56D 4U96D 2ZAEB 4I2WA 3HD7B 1HTLC 3FXEA 5DIZA 2Y9YA 1IQUA 3HUSB 3MKQA 1VQ4P 1ZOYC 1E8WA 1QL2A 3FP3A 3AG2E 1E79H 1NTMK 1JOCA 1JTHA 4L23A 4C7NB 1FZEA 5TJHA 3V2OA 2E75C 1H6PA 1IHGA 4MBGA 4HOTA 2E2EA 3Q49B 5T4YA 5KJLA 4LC1A 1Q81Q 3FXDA 4PV1D 1OT8A 3ZYQA 4BTAA 3I55P 5EX3A 3NMDA 1TJFA 3P32A 2IDBA 4HQDA 4CCAA 1RQVA 1OY3D 2OV8A 3SNXA 3CKCA 2RH0A 4GIFA 3VMXA 4QMAA 3S2AA 5AW5B 4BRYA 1U57A 2E74B 3IBEA 2GW1A 1KILA 2IOLA 1L0NG 1SP4A 3FTVA 4I7ZC 4BXLA 3E33A 2IY0C 2CHXA 3CVNA 1LTJC 5M1BA 5AVUB 2QSIA 2I1KA 3GHGB 1H0TB 4O9BA 4BETA 2XGOA 5ENQD 3ZFWA 1PGQA 1VQNP 1NA0A 3SBSA 4ANVA 3H32B 3CI9A 3CQGB 4OGQB 4EECA 2WMOA 1W5CE 3CR3A 4KBQA 2K1AA 2L0IA 4CDMA 3L73G 1DX7A 1SQXJ 1VF5B 3RK6A 5CCLA 1FDIA 3Q2YA 4U8VD 3B5ND 3SFDC 3M91A 2OVBA 5J08A 3QWOC 4DJGA 2W8ZA 1TNUA 3BASA 5AW6B 2DVWA
chains in the Genus database with same CATH topology
4HB5A 4NPFX 4NPEA 4ASVA 5AN8A 4OAVB 5ENTD 5JMND 3RGUA 3TWSA 1AWCB 1LT1A 3J5QB 5CEAA 2DZOA 1BDCA 4HB1A 1SS1A 1Y47A 2LR2A 2ETCA 5KNHD 3EHQA 4ZFHA 3JXJA 3TWRA 2HR3A 4HRMB 1EC5A 4G8LA 4B93B 5JA4D 3V31A 5CEDB 3V30A 5AQ9A 1BLXB 3EHRA 2KS1B 3NOCD 1LP1B 2JWDA 1DEEG 1IKND 2XEHA 3S1KA 1WG0A 1FC2C 4YDWA 3ZNGA 2QC9A 5ENOD 2PNNA 1OVVA 2DVWA 2M5AB 4CYMD 2LXBA 5K5GB 1SVXA 4LG6A 1YMPA 3HRAA 1OVUA 1H0TA 5FIOA 4K5BA 4KJMA 2KBXA 1AP7A 4JBZA 2QVAA 5EN5D 4K35A 2QYJA 4GPMA 3TWQA 2KI7B 4EYYQ 2KXPC 4NPDA 1X0TA 2B87B 1G3NB 2XZTG 5DJUB 1DC2A 3AAAC 1MX6A 2KZIA 4F1PA 3MHVA 1NFIE 4DX1A 4MN4C 5BXUA 4K5CA 4BEPA 3IXEA 3TWWA 1K3ZD 2BKGA 1EDLA 3J5PA 4A63B 1IXVA 2V5QC 3TWVA 2DZNA 5AAOA 2I8DA 1LP1A 4K3AA 3JXIA 3TWUA 2DWZA 2AJAA 1BI7B 5CBOA 4BERA 1D9SA 4TUMA 4IOIH 2M5AA 1MX4A 3W9FA 2K3RA 4U95D 4U8YD 2Y0BG 2XENA 1MJ0A 5ENSD 1EDKA 3C5RA 3ZUVB 5ENRD 4DRXE 3ZDMA 1MFTA 5AQAA 1N11A 3EU9A 3V79K 3JUEA 1WDYA 5CERB 2P2CP 5EIBE 1EDIA 2HE0A 4YDYA 5ITZF 2XZDG 4O1PA 4HI9A 5AQ7A 2P58A 3W9GA 3ZU7B 4WWIA 1IHBA 2B87A 3T8KA 2ZGGA 4F6RD 1K1AA 4HNAD 2ETAA 2RFMA 5CBNA 4DX7D 5EILA 3PH0A 4RLYA 4C48B 5AQBA 1JMBA 4QFVA 4BESA 5HKPA 1U7JA 5EIDA 4NIKA 1OVRA 1N0QA 4GMRA 5HS0A 3TWTA 3DEOA 4BSZB 2F8XK 2F8YA 5KBAA 3UI2A 3UTMA 2KIKA 3Q9NC 4HBDA 1EDJA 1ZW0A 4LSZE 4O1OA 2KZJA 1S70B 2JABA 2B0OE 4J8YA 2L6BA 4OAUC 4ASWA 4HKZH 3KEAA 2KUBA 2QRXA 4QQIA 3LJNA 5EYLA 2VGEA 1ZXGA 1TR4A 2LXCB 2M0BA 4ATZD 1BI8B 5HRYA 3D9HA 4ZNCA 4K5AB 5ENPD 2Y1LE 1JM0A 1UOHA 4O60A 2UWJE 3F6QA 2V4HC 4HI8A 2F37A 3NOGD 3B95A 4DX6D 1A5EA 4CZ2D 1S3JA 4GOFA 2Q1KA 3UXGA 3TWXA 3AJIA 2SPZA 1K1BA 4GODA 3MZWB 1Q2NA 3HG0D 5KNGA 2OTKE 2MYOA 4JB8P 3B7BA 1SW6A 2ETBA 4N5QA 5D66A 3Q9UC 4G8KA 4LNUD 5AARA 4U96D 5KWDA 2ZAEB 1DCQA 3FXEA 2A5EA 1MX2A 2FO1E 3V2OA 2B89A 2B88A 4J7WA 1OT8A 4HRNA 3FXDA 4ZMDA 5BXOA 5C39A 4HQDA 3NBNB 4CPGA 1OY3D 5EFWB 1BD8A 2J8SD 3ZKJA 2RKLA 1N0RA 3V2XA 4HRLA 4HLLA 5EYPF 2XEEA 4DX2A 4BXLA 2WMMA 1QYMA 2R44A 4DX5D 2BKKB 4ZHBA 1BDDA 4Z68A 1H0TB 4BETA 4UUCA 5ENQD 3DEPA 4DUIA 2RFAA 4GOEA 1NVOA 1BU9A 5DJTB 5FINA 2ZGDA 4HJGH 1MYOA 2NYJA 4U8VD 1U7MA 1YCSB 3QWOC 5CECB 1YYHA 3SO8A 3T9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB5 A;  4NPF X;  4NPE A;  4ASV A;  5AN8 A;  4OAV B;  5ENT D;  5JMN D;  3RGU A;  3TWS A;  1AWC B;  1LT1 A;  3J5Q B;  5CEA A;  2DZO A;  1BDC A;  4HB1 A;  1SS1 A;  1Y47 A;  2LR2 A;  2ETC A;  5KNH D;  3EHQ A;  4ZFH A;  3JXJ A;  3TWR A;  2HR3 A;  4HRM B;  1EC5 A;  4G8L A;  4B93 B;  5JA4 D;  3V31 A;  5CED B;  3V30 A;  5AQ9 A;  1BLX B;  3EHR A;  2KS1 B;  3NOC D;  1LP1 B;  2JWD A;  1DEE G;  1IKN D;  2XEH A;  3S1K A;  1WG0 A;  1FC2 C;  4YDW A;  3ZNG A;  2QC9 A;  5ENO D;  2PNN A;  1OVV A;  2DVW A;  2M5A B;  4CYM D;  2LXB A;  5K5G B;  1SVX A;  4LG6 A;  1YMP A;  3HRA A;  1OVU A;  1H0T A;  5FIO A;  4K5B A;  4KJM A;  2KBX A;  1AP7 A;  4JBZ A;  2QVA A;  5EN5 D;  4K35 A;  2QYJ A;  4GPM A;  3TWQ A;  2KI7 B;  4EYY Q;  2KXP C;  4NPD A;  1X0T A;  2B87 B;  1G3N B;  2XZT G;  5DJU B;  1DC2 A;  3AAA C;  1MX6 A;  2KZI A;  4F1P A;  3MHV A;  1NFI E;  4DX1 A;  4MN4 C;  5BXU A;  4K5C A;  4BEP A;  3IXE A;  3TWW A;  1K3Z D;  2BKG A;  1EDL A;  3J5P A;  4A63 B;  1IXV A;  2V5Q C;  3TWV A;  2DZN A;  5AAO A;  2I8D A;  1LP1 A;  4K3A A;  3JXI A;  3TWU A;  2DWZ A;  2AJA A;  1BI7 B;  5CBO A;  4BER A;  1D9S A;  4TUM A;  4IOI H;  2M5A A;  1MX4 A;  3W9F A;  2K3R A;  4U95 D;  4U8Y D;  2Y0B G;  2XEN A;  1MJ0 A;  5ENS D;  1EDK A;  3C5R A;  3ZUV B;  5ENR D;  4DRX E;  3ZDM A;  1MFT A;  5AQA A;  1N11 A;  3EU9 A;  3V79 K;  3JUE A;  1WDY A;  5CER B;  2P2C P;  5EIB E;  1EDI A;  2HE0 A;  4YDY A;  5ITZ F;  2XZD G;  4O1P A;  4HI9 A;  5AQ7 A;  2P58 A;  3W9G A;  3ZU7 B;  4WWI A;  1IHB A;  2B87 A;  3T8K A;  2ZGG A;  4F6R D;  1K1A A;  4HNA D;  2ETA A;  2RFM A;  5CBN A;  4DX7 D;  5EIL A;  3PH0 A;  4RLY A;  4C48 B;  5AQB A;  1JMB A;  4QFV A;  4BES A;  5HKP A;  1U7J A;  5EID A;  4NIK A;  1OVR A;  1N0Q A;  4GMR A;  5HS0 A;  3TWT A;  3DEO A;  4BSZ B;  2F8X K;  2F8Y A;  5KBA A;  3UI2 A;  3UTM A;  2KIK A;  3Q9N C;  4HBD A;  1EDJ A;  1ZW0 A;  4LSZ E;  4O1O A;  2KZJ A;  1S70 B;  2JAB A;  2B0O E;  4J8Y A;  2L6B A;  4OAU C;  4ASW A;  4HKZ H;  3KEA A;  2KUB A;  2QRX A;  4QQI A;  3LJN A;  5EYL A;  2VGE A;  1ZXG A;  1TR4 A;  2LXC B;  2M0B A;  4ATZ D;  1BI8 B;  5HRY A;  3D9H A;  4ZNC A;  4K5A B;  5ENP D;  2Y1L E;  1JM0 A;  1UOH A;  4O60 A;  2UWJ E;  3F6Q A;  2V4H C;  4HI8 A;  2F37 A;  3NOG D;  3B95 A;  4DX6 D;  1A5E A;  4CZ2 D;  1S3J A;  4GOF A;  2Q1K A;  3UXG A;  3TWX A;  3AJI A;  2SPZ A;  1K1B A;  4GOD A;  3MZW B;  1Q2N A;  3HG0 D;  5KNG A;  2OTK E;  2MYO A;  4JB8 P;  3B7B A;  1SW6 A;  2ETB A;  4N5Q A;  5D66 A;  3Q9U C;  4G8K A;  4LNU D;  5AAR A;  4U96 D;  5KWD A;  2ZAE B;  1DCQ A;  3FXE A;  2A5E A;  1MX2 A;  2FO1 E;  3V2O A;  2B89 A;  2B88 A;  4J7W A;  1OT8 A;  4HRN A;  3FXD A;  4ZMD A;  5BXO A;  5C39 A;  4HQD A;  3NBN B;  4CPG A;  1OY3 D;  5EFW B;  1BD8 A;  2J8S D;  3ZKJ A;  2RKL A;  1N0R A;  3V2X A;  4HRL A;  4HLL A;  5EYP F;  2XEE A;  4DX2 A;  4BXL A;  2WMM A;  1QYM A;  2R44 A;  4DX5 D;  2BKK B;  4ZHB A;  1BDD A;  4Z68 A;  1H0T B;  4BET A;  4UUC A;  5ENQ D;  3DEP A;  4DUI A;  2RFA A;  4GOE A;  1NVO A;  1BU9 A;  5DJT B;  5FIN A;  2ZGD A;  4HJG H;  1MYO A;  2NYJ A;  4U8V D;  1U7M A;  1YCS B;  3QWO C;  5CEC B;  1YYH A;  3SO8 A;  3T9K A; 
#chains in the Genus database with same CATH topology
 1KQF B;  3DSX A;  1H6O A;  4ASV A;  2RKK A;  1DD3 A;  1NTZ J;  3AE9 C;  1KMI Z;  5KJK A;  3RGU A;  4B89 A;  1JWG A;  1HX8 A;  5G04 C;  4B0Z A;  1LT1 A;  4LUN U;  4A1G A;  2DZO A;  2GA1 A;  5FZS A;  3TGO A;  2LO6 A;  1NTK J;  4UI9 C;  4U8H A;  5KNH D;  1DH3 A;  2R17 C;  3Q7A A;  1DVP A;  3ESK A;  4RO0 A;  3HE5 B;  2QY7 A;  2Y0D A;  1SQP D;  3NFQ A;  2P9K G;  1CI6 A;  2WT7 A;  4B93 B;  3A5T A;  5D0O D;  1BGY J;  2WWW A;  2J09 A;  1FCH A;  3LID A;  4UQZ A;  3V30 A;  2E5T A;  1BLX B;  3EHR A;  2KS1 B;  2OOE A;  3V6I A;  3TSI A;  3HTK A;  2IYP A;  2E75 B;  5GTI H;  1N94 A;  5GTH H;  2G8Y A;  4I2L C;  3G4S P;  3CCE P;  1FC2 C;  1HWT C;  2IO3 C;  4YDW A;  4EPZ A;  1FS0 E;  3UIA A;  1IFP A;  3RK3 C;  3CVY A;  3PUK A;  4I43 A;  3CVV A;  3JQ1 A;  3L13 A;  4BT9 A;  1WM5 A;  2Q7F A;  4WWN A;  2Y0E A;  4CYM D;  1SQV G;  2VTB A;  2GRP B;  3ZXP A;  4AV7 A;  3L70 G;  2X6I A;  3C3R A;  3WUT A;  2ZIR A;  4WNF A;  3UKU G;  3BU8 A;  3NAW A;  3Q3D A;  2XND H;  4W7Y A;  3G2V A;  4I7Z B;  2GRO B;  3HD7 D;  4MRU A;  4GCN A;  1N8R Q;  3FEY A;  4U7E B;  1SQB K;  3ML8 A;  3ZN3 A;  2XRY A;  3RBX A;  4G26 A;  1GTW A;  1AP7 A;  4AXH A;  1ZN5 A;  4JBZ A;  5E79 H;  1M57 D;  4F3V A;  2UY1 A;  1NGM B;  5FQ7 A;  3HXB A;  1NTM D;  1G2C B;  5AVR B;  3HHM A;  4M7C A;  2QYJ A;  4I6J A;  4GKG A;  2KXP C;  3USS A;  2CFZ A;  5AW0 B;  1PPJ D;  3PZ2 A;  1UII A;  2VGX B;  1FBM A;  2NRG A;  1FVH A;  3FTW A;  3TGU J;  2P9N G;  1EZV D;  5KLV G;  1SQP E;  4K0R A;  3PJS K;  2FYU K;  2YIN A;  2XZT G;  2E74 D;  3CX5 I;  3GZ1 A;  3AAA C;  3BQO A;  4H13 C;  1MX6 A;  1Q7Y Q;  1K73 Q;  5AIJ A;  4MKT A;  1KQL A;  1Q90 D;  3MTU E;  4PS3 A;  4MN4 C;  3CVQ A;  2J07 A;  3L71 D;  4WY4 A;  1QZ2 A;  1VQP P;  5LX8 A;  1R5S A;  2BEZ F;  3ITK A;  4UI9 K;  5CCM A;  3IXE A;  2IO2 C;  5AW7 B;  2P10 A;  3II6 A;  1RF0 A;  3WG7 E;  2V5Q C;  4OGQ D;  2VJ8 A;  3RRU A;  4M3O A;  2WXQ A;  3CCL P;  3CV0 A;  5AAO A;  1ZBP A;  3ZW3 A;  1QLE D;  3N4X A;  4K3A A;  2FI7 A;  1IJD B;  1VF5 D;  3JXI A;  3ZHE A;  3BCC G;  3I4R B;  2KCK A;  1BGY E;  3VP8 A;  1IFM A;  3TWU A;  3ZGQ A;  1N4Q A;  2AJA A;  3T5V A;  5T8I A;  3H1K D;  3SWK A;  2HYN A;  1OCC E;  3L75 D;  2NPS C;  3PRE A;  5CBO A;  1JUN A;  1D9S A;  2R32 A;  3VTX A;  3CPW O;  1LF8 A;  3M06 A;  4B8A A;  3AEC C;  2XCB A;  1MX4 A;  3W9F A;  2KSE A;  4IL6 H;  1NTM E;  4GCO A;  2K3R A;  2N1T C;  4U8Y D;  3JQ0 A;  3RK3 B;  4TT3 H;  2AXC A;  2XPY A;  1PPJ E;  5ENS D;  5E75 A;  2W27 A;  1EDK A;  3OTN A;  3C5R A;  3AG1 E;  3FUE A;  5L8R J;  1EZV E;  2GGF A;  1P84 I;  3LCA A;  4FUL A;  1KOR A;  1MFT A;  5AEN A;  4WNE A;  5FWQ A;  2K9Y A;  3RL0 g;  3VMA A;  3FTX A;  2GUV A;  2KZT B;  4U0S A;  2Y4T A;  2V7Q H;  5AW1 B;  5CER B;  3KSQ A;  2M3B A;  3G2T A;  4A3T A;  2BF0 X;  2ZYA A;  2L9B A;  3CWB J;  3R4Y A;  3VLE A;  1U3C A;  5ANR A;  5ITZ F;  2DYR E;  3QWV A;  2JR8 A;  3PTZ A;  4HI9 A;  2WXI A;  4I17 A;  4CRW A;  2E75 D;  1EXJ A;  1IHB A;  4GPK A;  3L72 D;  3R9M A;  4L75 A;  2XPI A;  3JSV C;  3KS2 A;  3L74 D;  4F6R D;  1SQB J;  3N7N A;  2P9I G;  3L16 A;  3G71 P;  5GTI E;  4GTO A;  4RG9 A;  2KXP B;  2WMN A;  1NU1 G;  5GTH E;  2FFD A;  3C8V A;  2Y69 E;  2IPP A;  4V3I A;  4HNA D;  3KSL A;  2PRR A;  2MKV A;  3HRN A;  1SQQ K;  3VYI A;  2A06 D;  4IYP A;  2YQ8 A;  3P8C D;  4HVB A;  3PH0 A;  4RLY A;  1JY3 O;  4H13 B;  3L75 E;  2XS8 A;  2LSV A;  1OIP A;  1E8Y A;  4G24 A;  3RIB A;  3OXG A;  2YXR B;  1A02 F;  3D9I A;  5CCH C;  1GU4 A;  1BE3 G;  2Q7C A;  3OW2 O;  1U7J A;  2FYU J;  4JW1 A;  1Q2Z A;  3FH8 A;  2ZXE B;  2OGU A;  3H1J D;  4GZ6 A;  4NIK A;  1OVR A;  4Y99 C;  1N0Q A;  2V7Q J;  1YHQ P;  1HH0 A;  3LS8 A;  3TJP A;  3AE3 C;  3B71 A;  1KYO H;  3CK9 A;  5BW8 C;  3O48 A;  1H0A A;  1K05 A;  2P7J A;  2GRN B;  2KLV A;  1QVF O;  2WXK A;  3TWT A;  1E8Z A;  5CHE E;  1RHZ B;  2J49 A;  3FU3 A;  4JEU A;  5KBA A;  3U66 A;  3PZ1 A;  3RRM B;  4PS8 A;  4F7A A;  1KYO I;  3Q9N C;  4Y6W A;  3HVE B;  2KAT A;  4A1S A;  4NQ0 A;  1LTX A;  2NPS B;  1D8D A;  4HH2 A;  5CJ4 A;  2J4B A;  1JY3 P;  3V2P A;  2JAB A;  3EIQ C;  2B0O E;  4J8Y A;  5CMY A;  3L72 E;  1LTI C;  1OCZ E;  2N1T B;  3L74 E;  1PP9 D;  3DBS A;  3SY2 A;  3VMY A;  4Q96 A;  2XGS A;  1YTZ T;  2QIW A;  2QE7 H;  2L91 A;  4ILG A;  3HDX A;  1ZXG A;  2JO1 A;  1V55 E;  1TU3 F;  3L70 J;  3CWB E;  3CVX A;  1WRG A;  3AE7 C;  1FZG A;  2IOS A;  1AQT A;  1XTC C;  3UIO C;  3L35 A;  3A0H H;  4JEH A;  5DBK A;  3FUM A;  4HOR A;  5ENP D;  3ONL A;  4JHJ A;  3U59 A;  1JEK A;  2YKO A;  1IK7 A;  3Q15 A;  1SQB E;  5AJD A;  3U4T A;  1CZQ A;  1RE3 C;  4BY6 A;  4H7X A;  1N9A A;  4G23 A;  2F37 A;  4AUW A;  3RK3 D;  4IL6 E;  4YVO A;  5APV A;  3D3M A;  1M1J C;  2D2C C;  1S3J A;  3ASH A;  3ULQ A;  1UN9 A;  3G6E P;  3UXG A;  2Z5I A;  2YXQ B;  2AEF A;  4GA1 A;  3Q1M A;  3BAT A;  3QWP A;  3QJZ A;  4XKB A;  1W2B O;  1LT9 C;  3JCK C;  3AJI A;  3IEG A;  2A4Z A;  4NAC A;  2SPZ A;  2FYU E;  3GW4 A;  5B1A E;  3E30 A;  2RG8 A;  4YPC A;  1SQQ J;  2OEV A;  2WQH A;  3ABL E;  1KLX A;  3W67 A;  4UB6 E;  5KKZ C;  4KVM A;  1S4X A;  2KYV A;  3CK7 A;  1U3D A;  3B4S A;  3VN0 A;  3HE4 B;  4Y99 B;  1PP9 E;  2MYO A;  3SI5 A;  3FH5 A;  3SFY A;  4XE0 A;  1NKN A;  4GTS A;  5B5E H;  3MV2 B;  2WB2 A;  2ETB A;  3SWF A;  4N5Q A;  5KJ7 C;  3JYS A;  1K8A Q;  5JJT A;  2AXU A;  2YKP A;  3FU6 A;  4U3F D;  2POH A;  1GL2 C;  4LNU D;  1RZ4 A;  2BAS A;  4CT4 A;  3LW5 H;  1LWU C;  1JNM A;  1T3U A;  3ZXS A;  1S5L H;  1MX2 A;  3FFL A;  2FO1 E;  1L0L G;  3BCC J;  1HGZ A;  5C2Y A;  1EXI A;  4H13 D;  1NWQ A;  5LCW J;  4GU5 A;  2ZIS A;  1KFM A;  2B89 A;  1RF1 B;  1YJW P;  1PC2 A;  3SF4 A;  2HPC A;  1GK4 A;  2M3E A;  3B5N A;  3Q4A B;  4J8D A;  3VLD A;  3FTY A;  1UN8 A;  1VDY A;  2I2O A;  1USE A;  2EIN E;  3N71 A;  5BXO A;  3RK3 E;  4GA2 A;  3UT7 A;  3NBN B;  1FJP A;  3G9R A;  3IFM A;  4YXW H;  1BD8 A;  3D9L A;  1YIT P;  4WAF A;  1N0R A;  2AEM A;  2IZ0 A;  4HLL A;  5EYP F;  2XEE A;  1ZP0 C;  4DI3 A;  2FF4 A;  2IFM A;  2YMY A;  3IAO A;  2R44 A;  1N73 A;  4ZHB A;  4CEM A;  2NPS D;  3LW5 J;  4TXR A;  4UWF A;  4XKC A;  4UUC A;  4IFF A;  1BCC J;  1KQG B;  2XV5 A;  1JCQ A;  1RH5 B;  4A7P A;  3M0D C;  1TYQ G;  4U3F E;  2N1T D;  1VQO P;  1NVO A;  1NTM G;  3W68 A;  1KV4 A;  4AP2 A;  1M1J B;  2D2C B;  3FGA D;  2BCC J;  1OWO A;  4JF7 A;  2IX7 C;  1U7M A;  4XI9 A;  4XZ4 A;  1EZV G;  3QAR A;  3FUN A;  4HYT B;  1YYH A;  1LT9 B;  1X8Y A;  5KAI E;  1SQX K;  2AXZ A;  5AW4 B;  1SQQ E;  2M8R A;  1KB9 H;  3CGH A;  4NPE A;  3D9N A;  5JMN D;  3IV0 A;  3UPV A;  2W6B A;  5KKZ B;  2WTY A;  3ABK E;  2AEJ A;  3U1A A;  5TIS H;  1E8X A;  1BE3 J;  1VQ7 P;  3DSS A;  4XEI G;  3J5Q B;  5CEA A;  3HD7 A;  2Q3I A;  3ML9 A;  4FHJ A;  3L71 G;  1KB9 I;  3A0H E;  3HUS A;  1NTZ K;  4L1B A;  2LR2 A;  3EHQ A;  3H1L D;  2H89 C;  1GL2 B;  4XA4 A;  3HYM B;  1W2E A;  3B7T A;  5J90 A;  2HG5 D;  4LER A;  5LP0 A;  4HOU A;  3KAE A;  2ION A;  1LWU B;  3Q5R A;  4G8L A;  4B94 A;  1OFC X;  2WQ7 A;  4PUC A;  1NTK K;  2AWI A;  3V31 A;  2FBN A;  1E90 A;  3CLQ A;  1N86 A;  1YTZ I;  5CHX A;  2WXL A;  2OEW A;  4GA0 A;  4OVU A;  2JWD A;  3CC2 P;  3PVL A;  1IFI A;  1IKN D;  5CCH D;  2K88 A;  2NZ2 A;  3H1K G;  1JCC A;  3CD6 P;  3L75 G;  3S1K A;  4N78 E;  2YHE A;  3ZNG A;  2QC9 A;  1KIL C;  5ENO D;  2XDJ A;  1E7U A;  3KZI H;  4G25 A;  3FEX A;  4UWH A;  3AE5 C;  4U07 A;  3CVP A;  5CRV A;  5B5E E;  1ELR A;  4KXK B;  3NF1 A;  3CHR A;  2FXP A;  3B7S A;  5K5G B;  3H25 A;  3GHG A;  1JCS A;  3UT4 A;  1H0T A;  4BT8 A;  2V4L A;  1DEB A;  5KCM A;  1S63 A;  4K03 A;  3H32 A;  2IEJ A;  1M8O B;  2BTD A;  3AE8 C;  1AV1 A;  4NUR A;  3U3W A;  2OTJ P;  3UIP C;  1AA0 A;  1S5L E;  1J2J B;  3FDH A;  1X22 A;  3QWW A;  1H2V C;  1QBQ A;  2JP3 A;  4JPS A;  1KB9 D;  4NPD A;  3H1L E;  3MX3 A;  3R7R A;  2BCC E;  3KD7 A;  3RL0 C;  2FY8 A;  2P67 A;  1X0T A;  3P7K A;  1S0P A;  2DYS E;  2HOD B;  1MUU A;  5DJU B;  3D9M A;  1Z6T A;  2A06 G;  1HS6 A;  4EBA A;  1HBW A;  4DCK A;  2E76 C;  4DX1 A;  4FLB A;  4AY5 A;  5BV1 A;  4L74 A;  5BXU A;  2WZ7 A;  1SFC C;  3EHN A;  3L08 A;  3EHM A;  4WBA A;  1NHL A;  2PL2 A;  4GTM A;  1ZME C;  1G1I A;  5AW3 B;  3PRZ A;  2WQY C;  3TWW A;  3H1J G;  1OWN A;  3CVL A;  3L82 A;  2WXM A;  3ASN E;  1TNB A;  3SQV A;  4DPR A;  4PD4 H;  2DW3 A;  2DZN A;  1NAF A;  2KS1 A;  1JMM A;  4I1O B;  2D2C D;  4H44 C;  1T2K C;  3GLM A;  4KZC A;  4PD4 I;  4EZJ A;  2KNC B;  2AW6 A;  1FDO A;  3WUU A;  3VMZ A;  3RK2 C;  1EYH A;  1PL5 A;  2EIM E;  5AVV B;  1NAY A;  3FWN A;  4ACK A;  3PZD A;  4U63 A;  3CK8 A;  1L0L J;  3G2S A;  5CMW A;  2O01 J;  3MA5 A;  4U95 D;  1KIL B;  1SQX D;  4PH4 B;  1KB9 E;  4U04 A;  3MUD A;  3EQ2 A;  2C0X A;  4FJZ A;  4LGD E;  4WUY A;  5ENR D;  5E76 A;  1MKM A;  5KJ7 D;  4GAA A;  3AEE C;  4RQI A;  2JEE A;  4U7J A;  3AS4 A;  1LTT C;  1FVF A;  3C9I A;  3ZPJ A;  1GL2 D;  1LTB C;  2WPS A;  3V79 K;  3LVQ E;  3IR9 A;  1NTZ D;  2Z4E A;  1WDY A;  3TL5 A;  4UB8 H;  5FQ6 A;  1T3J A;  5FT9 A;  4JHK A;  3L6A A;  2KOG A;  3NB2 A;  5D2M C;  4YDY A;  3ULY A;  2VGX A;  4D6T G;  3ENE A;  4O1P A;  3ZU7 B;  4IRU A;  1NTK D;  4WWI A;  3CLJ A;  1MHQ A;  3IN6 A;  2XZR A;  1S64 A;  3I3N A;  4N3B A;  3RL0 B;  3L37 A;  3K9I A;  2ETA A;  2RFM A;  3LVR E;  3PEV B;  3FY4 A;  4GTQ A;  3O8Z A;  1BGY D;  4PS7 A;  2H6G A;  2V4H A;  1LTJ B;  3KZI E;  2GM4 A;  1OMI A;  1D8E A;  4RKU J;  1S5L X;  1KZU B;  4ME2 A;  2KB7 P;  1JY2 O;  1XGW A;  4I6E A;  2E76 B;  1RF0 C;  3GG2 A;  5EID A;  3UM0 A;  4C0M A;  1A02 J;  1SFC B;  3ASG A;  1SQX E;  1YIJ P;  3CX5 H;  2IBZ G;  3KYQ A;  1OUV A;  1TN7 A;  3DSV A;  3GZS A;  3V4Q A;  2F8Y A;  2QJP C;  5AW8 B;  4AVX A;  2X6K A;  2Q6Q A;  2A45 G;  1H88 A;  3EDT B;  4H44 B;  2MRI A;  1RW2 A;  1NTZ E;  2H8P D;  4JZY A;  3AG4 E;  4CGV A;  5M72 A;  1Y6I A;  3UT8 A;  4B8C B;  1NKZ B;  4RES B;  1ZW0 A;  2R05 A;  1FZC C;  4W7Z A;  2FUL A;  3AE4 C;  3H1H G;  4JA9 A;  4N3A A;  3RK2 B;  4E85 A;  4F53 A;  2KZJ A;  2VTB B;  3E1R A;  2QJK C;  3A3Y B;  1CW5 A;  4H0L C;  1NTK E;  1VQ9 P;  1Q86 Q;  1JY2 P;  3V2R A;  2LKM A;  4ASW A;  3ESL A;  1KT0 A;  3TGU D;  4N5C A;  2WPV B;  2KZT A;  2IFN A;  1KZO A;  4GZC A;  3H1I G;  3Q47 B;  5JHB A;  3SSU A;  1N54 A;  1FDM A;  1N7S C;  2DCP A;  4L9P A;  3OA7 A;  4JYB A;  5LCW C;  1HXI A;  5CRU A;  1MZC A;  3Q78 A;  2LXC B;  1HJ0 A;  3SBT B;  2YIU C;  1BI8 B;  3UM1 A;  1P84 H;  5ENN A;  2WXF A;  3D9J A;  3ZVV A;  1FU1 A;  3QH9 A;  2FFD C;  4E6H A;  4K5A B;  2CHW A;  3U1C A;  2PZI A;  3IKO B;  3B7R L;  4O60 A;  2UWJ E;  2VGY A;  4L2L A;  1DNP A;  4EHM A;  4KT0 J;  2X38 A;  3BRV B;  3B7U X;  4FC8 A;  3FUJ A;  2WIT A;  1YYC A;  5BV0 A;  2ZJS E;  4L7T A;  3AEA C;  2Q1K A;  1HVV A;  1X9V A;  3CX5 D;  4C7R A;  2WQ6 A;  1R5L A;  5APU A;  4YTP C;  3WU2 H;  3DXM G;  2CHZ A;  3TWX A;  1N4P A;  1L0N J;  4GYO A;  3EJN A;  3A0B H;  1E7V A;  1YA0 A;  4EZL A;  1XNF A;  3O4Z A;  1AFO A;  4LRZ A;  1K1B A;  5CJ0 A;  2QJY C;  3MZW B;  1BSH A;  2O3J A;  1UJK A;  4N39 A;  3UMV A;  3TG4 A;  4XFJ A;  3V2Q A;  5KNG A;  2VSO E;  1N4S A;  3C98 A;  4LEU A;  4UB8 E;  3JCU H;  4Y6C A;  3TGU E;  2OTK E;  5KLV K;  1HF8 A;  3CHQ A;  3RO3 A;  3SGH A;  3B7B A;  2JWA A;  4XE5 B;  4JD2 G;  4PDX A;  2I1J A;  1RE4 C;  1FOS E;  1IYG A;  2I9C A;  3HVE A;  3D70 A;  2PM6 A;  1TNY A;  3Q9U C;  3L73 J;  4JA7 A;  4FAD A;  3URZ A;  2NPS A;  1OWM A;  5AAR A;  5KWD A;  3KDP B;  4L2Y A;  1SVF A;  3NQP A;  3RL0 D;  1LTS C;  1DCQ A;  4N3C A;  3CWB D;  3L17 A;  4LNG A;  2WPQ A;  1Q82 Q;  3IF4 A;  4WND A;  4Y28 J;  2N1T A;  3C72 A;  1FZC B;  1T8Z A;  4YND A;  3JUI A;  4DZO A;  1TJC A;  2E76 D;  1SQB D;  3S7B A;  1Y8M A;  1PGO A;  1HF9 A;  3Q75 A;  4N3Y B;  3H6P A;  2XCC A;  5E79 E;  2WXP A;  1SFC D;  5CCG C;  4ZMD A;  3FWL A;  5C39 A;  2MOW A;  1KIL E;  1P84 D;  1GK6 A;  5KTB A;  3D6Z A;  2OYH C;  1O1T A;  1NOH A;  2JKV A;  3CX5 E;  2QEX P;  1N7S B;  1JUQ A;  1QGK B;  3G3Z A;  5APT A;  2Y4U A;  1TN6 A;  2ZYD A;  4JHR A;  3V2X A;  1NH4 A;  1PGJ A;  5AVY B;  2FYU D;  3SWY A;  4H44 D;  2H7H A;  2ZXX A;  3QAQ A;  4DX2 A;  1OCR E;  5BU8 B;  3DWL G;  2WMM A;  3OAK A;  2M63 A;  1BPO A;  1L5J A;  4ATG A;  4DX5 D;  2J58 A;  2BKK B;  2Q3E A;  2FFD B;  1TNZ A;  3WXX A;  1Z5S C;  1BDD A;  3RK2 D;  5KJN A;  5H2F H;  2VSX E;  3GF3 A;  4ZKP A;  1IK9 A;  3TG5 A;  1LTG C;  5FZQ A;  4PV1 C;  5FJY A;  3L54 A;  3DSW A;  4DUI A;  3C3O A;  4D6T J;  4GOE A;  1NP7 A;  2OVF A;  2QG4 A;  5DJT B;  4RJT A;  1SQV J;  2ZGD A;  5CCH A;  2P58 C;  2R5D A;  2NYJ A;  1L0N E;  3CC7 P;  4OYS A;  3FUD A;  1UIX A;  4KZ0 A;  1KQS O;  1X79 B;  2R5S A;  3SFZ A;  1YCS B;  3HE4 A;  2A45 I;  5CEC B;  3Q73 A;  2ZT9 C;  2WXN A;  2A5U A;  2FKW B;  3T97 B;  3LPZ A;  4FJY A;  3T9K A;  2QJY B;  5APX A;  3G2U A;  1NU1 K;  4AQR D;  5AN8 A;  1AWC B;  5CMZ A;  1OW7 A;  1LJ2 A;  2RMZ A;  4R7L A;  1VDF A;  1KPS B;  1P84 E;  2IZ1 A;  4C46 A;  1BDC A;  3L73 E;  2OQQ A;  1SQM A;  3B13 A;  3RSE G;  4DLO A;  1KYO D;  1KC8 Q;  2OYI C;  1SS1 A;  1NJI Q;  2KCV A;  3C1L A;  3KPE A;  5D0Q D;  1IZN B;  3KQG A;  3PUJ A;  3L70 D;  1NZN A;  1O1R A;  3ASO E;  3KHU A;  3TWR A;  4HRM B;  5KLV J;  3CXH I;  3S7J A;  1KTM A;  1RF1 A;  1TN8 A;  4JPZ B;  2WM9 A;  1JO5 A;  3B5N C;  3PLN A;  3D9K A;  1L2P A;  2ZVO B;  4XIF A;  5JA4 D;  5CED B;  5BU5 A;  5AQ9 A;  2HLO A;  4EDF A;  3RRN B;  3WU2 E;  1LP1 B;  2WXO A;  4G2V A;  2FEZ A;  1LGH B;  5EX0 A;  2XEH A;  4LLH A;  4AYC A;  3A0B E;  4R4L A;  1L4A C;  3ABV C;  3F5H A;  2O1J A;  1LD8 A;  3PZ4 A;  3H1H J;  4Q69 A;  1ELK A;  2PNN A;  4BTB A;  3CL3 D;  2WXJ A;  1NL4 A;  2OYH B;  2M5A B;  2XQ0 A;  3MGN A;  3JCU E;  2WSC H;  2EIK E;  3RAU A;  4W9R A;  1BSN A;  1SQP G;  3H1I J;  4A55 A;  3BRT B;  1SVX A;  3PEU B;  1YMP A;  1URQ C;  1OVU A;  5FIO A;  4K5B A;  4KJM A;  3RKV A;  1X5B A;  1ZV8 A;  1SQQ D;  3AU4 A;  4WB4 A;  1ZB1 A;  5APW A;  1HZ4 A;  1OXJ A;  2CK3 H;  4ZKU A;  1NTZ G;  2KK7 A;  3LKU A;  3D9P A;  3FUI A;  3AEG C;  1UJJ A;  5LFA A;  1M1J A;  5A6C A;  3M9H A;  3QDN A;  4I1L A;  3ASD A;  2QVA A;  5EN5 D;  3MD0 A;  3CST A;  4K35 A;  4GPM A;  1ZRT E;  1KYO E;  2LUH A;  1O5M A;  1SQV E;  5JJ7 A;  1S1C X;  1N52 A;  1LT9 A;  3ZRH A;  3L70 E;  3X2Q E;  3BEE A;  3OXF A;  1PV3 A;  2L0T B;  5KAF H;  4ANW A;  2B87 B;  5BVZ A;  3OXL A;  1G3N B;  2KC7 A;  4YDO A;  3BCC D;  1N7S D;  1E5W A;  2E42 A;  2IJG X;  1IFN A;  3Q5P A;  1DC2 A;  4BX9 A;  1BGY G;  2NC9 A;  2ZT9 B;  4BX8 A;  4F1P A;  1E96 B;  3B8E B;  3MHV A;  3I56 P;  2WSC J;  2HM8 A;  1KN7 A;  1HG5 A;  3HUS C;  3M9B A;  5KJ7 A;  1N95 A;  1TEZ A;  4N78 D;  1S9K E;  1N7L A;  1PIX A;  2XU6 A;  3AE6 C;  2XPZ A;  4K5C A;  1GL2 A;  4DLQ A;  3I4G A;  2RN0 A;  3HXD A;  3J5P A;  4A63 B;  1LWU A;  4N2S A;  1HH8 A;  1NO4 A;  2OYI B;  1NU1 J;  1PPJ G;  2J59 M;  2KSJ A;  3FHE A;  4IN3 B;  3TWV A;  2HYZ A;  4I1A A;  5KLV E;  4AIF A;  2ZVN B;  2UWJ G;  2L5G B;  2I8D A;  4GB9 A;  3DRA A;  3SD5 A;  3NTN A;  4YDE A;  2K9J B;  3S9O A;  2KP8 A;  4Z1M H;  2PP6 A;  5IY5 E;  2KM4 A;  1BI7 B;  4IL6 X;  1BCC D;  4BER A;  1GD2 E;  4IOI H;  3EIJ A;  3DXK G;  1GW4 A;  2RD0 A;  1IQR A;  2HO1 A;  1L4A B;  1T6A A;  2PGD A;  1M7L A;  1OZH A;  3SHF A;  3MJW A;  3CQC B;  1M1K Q;  2BCC D;  4C7N A;  1MJ0 A;  2J4D A;  4KVO A;  2MJZ A;  3UIN C;  3CVW A;  3ZUV B;  1DCE A;  3UM2 A;  4DRX E;  2H88 C;  3CVU A;  5T3R A;  1AVO A;  2YO2 A;  1L0L K;  4ANX A;  3BCC E;  1IO4 A;  2C2L A;  5AQA A;  1N11 A;  5BPP A;  3TYY A;  1URQ B;  1WAO 1;  1VQ6 P;  4CDN A;  2HFE D;  2XHE A;  1QNF A;  2VRS A;  2X6J A;  2QZA A;  1KT1 A;  1JB0 J;  3M0D A;  1OWA A;  1MV8 A;  4BWR A;  5EIB E;  5EDS A;  1BE3 D;  3EFG A;  3TNU B;  1USD A;  3CCU P;  4J0U A;  2ITA A;  4TXQ A;  5APS A;  2IF4 A;  3UQ3 A;  5AQ7 A;  3W9G A;  1QQE A;  2IQC A;  2HOD A;  2AXV A;  3O6Q B;  2ZGG A;  1H89 A;  2I6H A;  4B86 A;  1TNO A;  1Z3X A;  5CCG D;  3ONK A;  3DPD A;  1HFA A;  4EBA G;  1H2T C;  4A3V A;  4GZ3 A;  3P1U A;  4TRQ A;  3PHL A;  3F89 A;  3GYZ A;  2P9L G;  4DX7 D;  3M0A A;  2R2L A;  2XEV A;  5EIL A;  3PP5 A;  1FZF A;  3CEQ A;  2K37 A;  3LYA A;  4C48 B;  4HOS A;  1JMB A;  4FHK A;  3BG0 B;  1BCC E;  4ILI A;  4J8S A;  4QFV A;  4YVQ C;  4BES A;  1XTG B;  2W6J H;  3D6Y A;  5HKP A;  2FXO A;  1SLQ A;  3Q79 A;  2H43 A;  3E34 A;  3HIZ A;  4FU3 A;  2WSS H;  3L72 G;  3JC2 2;  2XS1 A;  4GMR A;  3HXC A;  2X3M A;  3L74 G;  1NU1 E;  5HS0 A;  1INZ A;  1JPL A;  4BSZ B;  3MEK A;  2KNC A;  1IFD A;  4C0E A;  3UI2 A;  2O01 H;  1SZA A;  2KIK A;  2PQN A;  4MLP A;  1SA4 A;  4HBD A;  3R2P A;  3SZ7 A;  1EDJ A;  4ACL A;  1RQU A;  4UWK A;  5AJL A;  1PFI A;  3MUD C;  1BE3 E;  3CWB G;  5KAF E;  3ZYK A;  2ZT9 D;  3AS5 A;  3MKR A;  4O1O A;  1OXZ A;  2WXR A;  1DD4 A;  3HE5 A;  3IHY A;  1K9M Q;  2L6B A;  3MKQ B;  1UW4 B;  4J8F A;  3KEA A;  2FO7 A;  1JTH B;  1SQB G;  2XNX A;  2IU1 A;  3DST A;  3HXE A;  2KUB A;  2QRX A;  3AEF C;  2OYO A;  3CMA P;  1WY6 A;  4XX5 A;  3MGB A;  1A17 A;  1J1E C;  3VLF A;  1OX3 A;  3CCV P;  3WMM 0;  1FJK A;  1VQK P;  1TR4 A;  3FU5 A;  3R9A B;  4ATZ D;  3KEZ A;  3GMA A;  3I5P A;  2LSU A;  3Q5M A;  2R3S A;  1EQ7 A;  1AQ5 A;  1SQP J;  2JJL A;  4BRY B;  5HRY A;  2FYU G;  4ZNC A;  3S7D A;  2ZYG A;  2OND A;  5LOZ A;  4CGW A;  2J9Q A;  3F6Q A;  4M3L A;  2ILR A;  5TIS E;  1PP9 G;  2V4H C;  1L4A D;  3QB2 A;  1LTJ A;  2OAR A;  3APC A;  5KJM A;  3NOG D;  3TAX A;  3B95 A;  1GZL A;  4DX6 D;  2E43 A;  1V54 E;  3FX0 A;  4CZ2 D;  2N9B A;  1YQ4 C;  1VQM P;  2HR2 A;  2P1J A;  1HE8 A;  1G2C A;  2IYO A;  4J8E A;  1EZV I;  1SFC A;  1VQL P;  4GMJ A;  1URQ D;  5G05 J;  3CCJ P;  3NZU A;  1L0L D;  2C0L A;  1FZB A;  2JLB A;  1J1D C;  1UG3 A;  3ZIM A;  1PY1 A;  4JVS A;  1FT1 A;  1Q2N A;  2R03 A;  2O01 N;  1L0N K;  1EF1 C;  1O1S A;  4EIJ A;  4C9B B;  1K8K G;  4JB8 P;  2J5U A;  4H7Y A;  3AE2 C;  2DIW A;  4NRH B;  1Y9B A;  3ASF A;  1NTM J;  4WY4 C;  1ELW A;  1W3B A;  4G8K A;  3VTP C;  3MV3 B;  1H8A A;  4PD4 D;  3PNT B;  1HG2 A;  1B89 A;  2PQR A;  2A5E A;  2H6H A;  5EKQ D;  1FZA A;  3PE4 A;  1GDT A;  2WPV A;  4CDR A;  4HS2 A;  2CG2 A;  2B88 A;  2YHC A;  1CI6 B;  2WT7 B;  4HFG A;  4J7W A;  1NI1 A;  1R8E A;  3V5B A;  4HRN A;  3G2W A;  4TXP A;  3UUX A;  2CPS A;  3T8M A;  3MCX A;  4AOF A;  3QC1 A;  3I5C A;  3L71 J;  1EDU A;  2J08 A;  3HTK B;  2P9U G;  1OWP A;  2FXM A;  4CPG A;  3CSF A;  4U3F G;  1VQ8 P;  4HXI A;  2VSN A;  3EUV A;  1SZ9 A;  2C0M A;  2BED A;  3RJV A;  5EFW B;  3SFX A;  3BUA A;  2J8S D;  1J1E B;  4JQ0 D;  3ZKJ A;  4G1T A;  2WVR A;  2RKL A;  4IFM A;  4KHX A;  5AVT B;  1PAQ A;  2YNQ A;  4HRL A;  5AVW B;  4GYY A;  2Z5H A;  1L0L E;  3GW6 A;  3LY8 A;  1QYM A;  1CSB A;  1SQQ G;  3FTZ A;  3LIE A;  3E1I A;  4WWP A;  4Z68 A;  2MHK A;  3H1K J;  3CKB A;  2X6F A;  3L75 J;  4I6G A;  3LDZ A;  4RVB A;  4CT0 A;  3FH7 A;  3DEP A;  2RFA A;  2QM8 A;  4N2Q A;  4GTP A;  4TV3 A;  1BU9 A;  5FIN A;  1AJY A;  3UM3 A;  4HJG H;  3L36 A;  1OW6 A;  4PD4 E;  1MYO A;  3BG1 B;  2AVP A;  4UWG A;  2UY1 B;  1OWL A;  3ZEF A;  5BNW A;  3E37 A;  5AW9 B;  1GMJ A;  5B66 H;  4TLF A;  1JY2 N;  2QM7 A;  3TXN A;  3SO8 A;  4APF A;  1SQV K;  5AVQ B;  3EFF K;  3VTY A;  4XI0 A;  4HB5 A;  4NPF X;  1J1D B;  5KLI C;  5JHA A;  2PAJ A;  5HQ8 A;  3PS6 A;  1FT2 A;  3TXM A;  5ENT D;  3TWS A;  1AVY A;  4OAV B;  1QEX A;  4KT6 B;  1H19 A;  3PH0 C;  2VQ2 A;  2C9L Y;  1KIL D;  1ZR2 A;  4W80 A;  1K04 A;  4GYW A;  4OVN F;  1QL1 A;  3CME P;  5AVZ B;  1P5Q A;  2XGM A;  3LY7 A;  4HB1 A;  1FPP A;  1Y47 A;  4U0U A;  3L72 J;  1JCD A;  2ETC A;  5G55 A;  4WY4 B;  4OVV A;  1FZC A;  3L74 J;  4ZFH A;  3JXJ A;  4DOJ A;  2HR3 A;  1EC5 A;  4OWF A;  3E32 A;  4JXT A;  4ABN A;  1HO8 A;  2Y9Z A;  2L6J A;  2QYU A;  1IFJ A;  5C1D A;  4L76 A;  3D71 A;  1FAV A;  3P2B A;  2ZXW E;  4UB6 H;  3NOC D;  1DEE G;  1WT6 A;  1X81 A;  1MQS A;  3ULE G;  3TDK A;  3ZHE B;  3A7O A;  2B6C A;  3AU5 A;  2NXP A;  3S4R A;  1WG0 A;  1BCC G;  1N7S A;  1Z56 A;  4DI4 A;  3L71 E;  2QJP B;  1OVV A;  3CHP A;  3H1J J;  1MZ9 A;  2LXB A;  3H1L G;  1L0N D;  2JEK A;  2BCC G;  2WVI A;  1PZQ A;  2FBW C;  2C0W A;  4U0Z A;  4O6F A;  3T5X A;  4BSX A;  4BWN A;  4LG6 A;  4GTT A;  3HRA A;  3AS8 A;  5HI7 A;  3LJ3 A;  2WSF H;  3OAW A;  3U64 A;  4KYO B;  3APF A;  2Y0C A;  3A2A A;  2WXG A;  1JWF A;  2QJK B;  3KXD A;  3APD A;  3QOU A;  5B1B E;  2XRZ A;  4H0L B;  5A23 A;  2KLU A;  2KBX A;  3H1K E;  5FZR A;  1EPU A;  5ARG A;  2BEQ D;  3FUL A;  3FTU A;  1WMK A;  2V5F A;  3L73 D;  2OCC E;  3WUV A;  2EIJ E;  3TWQ A;  5A7D B;  1KD1 Q;  1GW6 A;  2KI7 B;  4EYY Q;  5APQ A;  3RBZ A;  1FOS F;  4I9C A;  1Z3Y A;  1PP9 J;  2CPB A;  4JYC A;  3T97 A;  4URK A;  5ANL A;  5G04 J;  3L22 A;  5AYW D;  3NXS A;  3Q5S A;  1M90 Q;  3BVH A;  2GRR B;  4AJW A;  3GF7 A;  2YIU B;  4KMO A;  1T2K D;  1JCR A;  3RO2 A;  4UI9 J;  2KZI A;  4G11 A;  4Q94 A;  2H6I A;  1NFI E;  1RE4 A;  2PM7 A;  4GZD A;  2QFC A;  2EQX A;  5KLI B;  4GT1 A;  3RU0 A;  2O1K A;  3Q7F A;  4BEP A;  2WSF J;  4BFR A;  2AXT H;  2A45 H;  2R5B A;  3DSU A;  1RF1 C;  4FLH A;  4DK5 A;  2IBZ I;  2F0Y A;  4JC8 A;  1K3Z D;  2BKG A;  1EDL A;  4WVZ A;  1IXV A;  2VSY A;  4UQX A;  4RG6 A;  1JY3 N;  2R3C A;  2R59 A;  3D9O A;  3MIW A;  1LP1 A;  1RY3 A;  2KCL A;  4PJ0 H;  3AEB C;  3QNK A;  5KAI H;  2A06 E;  3MZL B;  1YI2 P;  2DWZ A;  3P8C E;  3C3Q A;  3S7F A;  3QKY A;  5CCG A;  1MFZ A;  3E4B A;  4WNG A;  3VOP A;  3CCR P;  3QK0 A;  4GTR A;  4UQY A;  2LAI A;  3ABM E;  4TUM A;  2OYH A;  3CXH H;  2M5A A;  2Q5U A;  4HLE A;  4D6T D;  2CFU A;  5B66 E;  1YQ3 C;  3UX4 A;  3ZYM A;  4RSY A;  1ZRT D;  3CHO A;  3H1J E;  1SQV D;  2Y0B G;  2XEN A;  3PZ3 A;  3PDN A;  4I2Z A;  3CHS A;  5G2N A;  2LNI A;  1QX8 A;  3ZDM A;  1H6K A;  1LNQ A;  1YJN P;  2H6F A;  1YJ9 P;  3LEW A;  4GTV A;  1D7M A;  4WY4 D;  4U3F J;  1N4R A;  3EU9 A;  4UWL A;  2B9B A;  3JUE A;  2OTL P;  2P2C P;  3PNL B;  4JL0 A;  4I1M A;  2JDI H;  2YKQ A;  1S9K D;  1EDI A;  3UKR G;  3AED C;  1Y8A A;  2HE0 A;  2WSE H;  2R02 A;  2FYN C;  1ZR4 A;  2XZD G;  1HJB A;  2P58 A;  2WPR A;  2Q9I A;  2LAH A;  2YNY A;  4LCT A;  1U2V G;  2B87 A;  1SQX G;  3T8K A;  2IBZ D;  5APY A;  3CC4 P;  5B3S E;  5KLV D;  1N73 C;  2G3A A;  2LXM A;  4I9E A;  4X8Q A;  4N6J A;  1K1A A;  4D10 C;  3CCM P;  4AEZ C;  1VPC A;  3ISM C;  1RE3 A;  3VP9 A;  5CBN A;  2X6H A;  3CIA A;  1LD7 A;  2W90 A;  2DBA A;  3L4F A;  4ANU A;  5AQB A;  4EI2 A;  3FUF A;  1KZP A;  5JJ6 A;  1H2U A;  2W6A A;  3H1H D;  1S72 P;  4D6T E;  2BUG A;  4H0L D;  4PV1 B;  2OYI A;  2LXL A;  2XKM A;  1YBK A;  4OH8 B;  1NTK G;  4I6M C;  3K5B A;  3GZ2 A;  5H7P A;  2K9J A;  1QVG O;  3FWV A;  3DEO A;  3MP7 B;  2F8X K;  3H1I D;  3CXH D;  2WSE J;  5FQ4 A;  2C9N Y;  5G05 C;  3UTM A;  1VQ5 P;  2GRM A;  1HU3 A;  1G1J A;  4GDO A;  3IHV A;  3HD7 C;  3EU5 A;  4GZ5 A;  3CCQ P;  1L4A A;  4FA6 A;  1PGP A;  1HUC A;  4TUU A;  4ILH B;  1FE6 A;  4LSZ E;  2QA4 P;  4HOQ A;  1S70 B;  2EIL E;  4AM9 A;  1HGV A;  4OAU C;  1VL2 A;  2IBZ E;  2GUS A;  4IUL A;  4HKZ H;  2N9Y B;  5H2F E;  4L73 A;  3OJA B;  3FUK A;  1URQ A;  2CG3 A;  2P9S G;  1S2E A;  2NSZ A;  3FUH A;  3LY9 A;  3CCS P;  4QQI A;  4MS6 A;  5FQ8 A;  3AE1 C;  2HPC B;  1IC2 A;  1N2D C;  2AXT E;  3B5N B;  3LJN A;  5EYL A;  2E74 C;  5FTP A;  3TNU A;  4APO A;  2VGE A;  3E7K A;  1OW8 A;  3TF5 A;  2M0B A;  3H1L J;  2W83 C;  3PRJ A;  5AVS B;  3R7Q A;  2E5Y A;  4F1S A;  4EOT A;  3FTS A;  2P9P G;  3H1H E;  3O6Q A;  4EZK A;  4R4M A;  2V0P A;  1NYH A;  4PJ0 E;  4DT0 A;  2IFU A;  3CHM A;  2GRQ B;  3D9H A;  3V4W A;  2FYN B;  1OCO E;  2YO3 A;  3PE3 A;  5BT1 A;  3GHG C;  4P29 A;  3NZS A;  2Y1L E;  3FU0 A;  1JM0 A;  1NU1 D;  1ZLL A;  1UOH A;  1GW3 A;  2ZU6 B;  3TGU G;  1LTA C;  1DIP A;  4HI8 A;  1SQP K;  4OGQ C;  3H1I E;  3CXH E;  3DPY A;  1N73 B;  3TK1 A;  3U9W A;  1ZU2 A;  4EQF A;  2FYZ A;  1VF5 C;  5AW2 B;  3MYV A;  4LNB A;  5BUZ A;  1A5E A;  4GOF A;  2V8S E;  3HXF A;  3EWK A;  5ARF A;  3P8M C;  1GU5 A;  2E0I A;  3LXU X;  2YMK A;  5AVX B;  4GOD A;  2P2U A;  4AY6 A;  4IFD K;  4GML A;  4J6I A;  1KFN A;  3HG0 D;  2ZFC A;  2Y3A A;  4WWO A;  3V2N A;  1NA3 A;  4YXD C;  3AG3 E;  1SW6 A;  2PFX A;  2GRL A;  3ZYL A;  5D66 A;  3L9T A;  4DJA A;  3M9Q A;  2WXH A;  4FP7 A;  3SFE C;  1SA5 A;  2VYI A;  1M56 D;  4U96 D;  2ZAE B;  4I2W A;  3HD7 B;  1HTL C;  3FXE A;  5DIZ A;  2Y9Y A;  1IQU A;  3HUS B;  3MKQ A;  1VQ4 P;  1ZOY C;  1E8W A;  1QL2 A;  3FP3 A;  3AG2 E;  1E79 H;  1NTM K;  1JOC A;  1JTH A;  4L23 A;  4C7N B;  1FZE A;  5TJH A;  3V2O A;  2E75 C;  1H6P A;  1IHG A;  4MBG A;  4HOT A;  2E2E A;  3Q49 B;  5T4Y A;  5KJL A;  4LC1 A;  1Q81 Q;  3FXD A;  4PV1 D;  1OT8 A;  3ZYQ A;  4BTA A;  3I55 P;  5EX3 A;  3NMD A;  1TJF A;  3P32 A;  2IDB A;  4HQD A;  4CCA A;  1RQV A;  1OY3 D;  2OV8 A;  3SNX A;  3CKC A;  2RH0 A;  4GIF A;  3VMX A;  4QMA A;  3S2A A;  5AW5 B;  4BRY A;  1U57 A;  2E74 B;  3IBE A;  2GW1 A;  1KIL A;  2IOL A;  1L0N G;  1SP4 A;  3FTV A;  4I7Z C;  4BXL A;  3E33 A;  2IY0 C;  2CHX A;  3CVN A;  1LTJ C;  5M1B A;  5AVU B;  2QSI A;  2I1K A;  3GHG B;  1H0T B;  4O9B A;  4BET A;  2XGO A;  5ENQ D;  3ZFW A;  1PGQ A;  1VQN P;  1NA0 A;  3SBS A;  4ANV A;  3H32 B;  3CI9 A;  3CQG B;  4OGQ B;  4EEC A;  2WMO A;  1W5C E;  3CR3 A;  4KBQ A;  2K1A A;  2L0I A;  4CDM A;  3L73 G;  1DX7 A;  1SQX J;  1VF5 B;  3RK6 A;  5CCL A;  1FDI A;  3Q2Y A;  4U8V D;  3B5N D;  3SFD C;  3M91 A;  2OVB A;  5J08 A;  3QWO C;  4DJG A;  2W8Z A;  1TNU A;  3BAS A;  5AW6 B;  2DVW A; 
#chains in the Genus database with same CATH homology
 4HB5 A;  4NPF X;  4NPE A;  4ASV A;  5AN8 A;  4OAV B;  5ENT D;  5JMN D;  3RGU A;  3TWS A;  1AWC B;  1LT1 A;  3J5Q B;  5CEA A;  2DZO A;  1BDC A;  4HB1 A;  1SS1 A;  1Y47 A;  2LR2 A;  2ETC A;  5KNH D;  3EHQ A;  4ZFH A;  3JXJ A;  3TWR A;  2HR3 A;  4HRM B;  1EC5 A;  4G8L A;  4B93 B;  5JA4 D;  3V31 A;  5CED B;  3V30 A;  5AQ9 A;  1BLX B;  3EHR A;  2KS1 B;  3NOC D;  1LP1 B;  2JWD A;  1DEE G;  1IKN D;  2XEH A;  3S1K A;  1WG0 A;  1FC2 C;  4YDW A;  3ZNG A;  2QC9 A;  5ENO D;  2PNN A;  1OVV A;  2DVW A;  2M5A B;  4CYM D;  2LXB A;  5K5G B;  1SVX A;  4LG6 A;  1YMP A;  3HRA A;  1OVU A;  1H0T A;  5FIO A;  4K5B A;  4KJM A;  2KBX A;  1AP7 A;  4JBZ A;  2QVA A;  5EN5 D;  4K35 A;  2QYJ A;  4GPM A;  3TWQ A;  2KI7 B;  4EYY Q;  2KXP C;  4NPD A;  1X0T A;  2B87 B;  1G3N B;  2XZT G;  5DJU B;  1DC2 A;  3AAA C;  1MX6 A;  2KZI A;  4F1P A;  3MHV A;  1NFI E;  4DX1 A;  4MN4 C;  5BXU A;  4K5C A;  4BEP A;  3IXE A;  3TWW A;  1K3Z D;  2BKG A;  1EDL A;  3J5P A;  4A63 B;  1IXV A;  2V5Q C;  3TWV A;  2DZN A;  5AAO A;  2I8D A;  1LP1 A;  4K3A A;  3JXI A;  3TWU A;  2DWZ A;  2AJA A;  1BI7 B;  5CBO A;  4BER A;  1D9S A;  4TUM A;  4IOI H;  2M5A A;  1MX4 A;  3W9F A;  2K3R A;  4U95 D;  4U8Y D;  2Y0B G;  2XEN A;  1MJ0 A;  5ENS D;  1EDK A;  3C5R A;  3ZUV B;  5ENR D;  4DRX E;  3ZDM A;  1MFT A;  5AQA A;  1N11 A;  3EU9 A;  3V79 K;  3JUE A;  1WDY A;  5CER B;  2P2C P;  5EIB E;  1EDI A;  2HE0 A;  4YDY A;  5ITZ F;  2XZD G;  4O1P A;  4HI9 A;  5AQ7 A;  2P58 A;  3W9G A;  3ZU7 B;  4WWI A;  1IHB A;  2B87 A;  3T8K A;  2ZGG A;  4F6R D;  1K1A A;  4HNA D;  2ETA A;  2RFM A;  5CBN A;  4DX7 D;  5EIL A;  3PH0 A;  4RLY A;  4C48 B;  5AQB A;  1JMB A;  4QFV A;  4BES A;  5HKP A;  1U7J A;  5EID A;  4NIK A;  1OVR A;  1N0Q A;  4GMR A;  5HS0 A;  3TWT A;  3DEO A;  4BSZ B;  2F8X K;  2F8Y A;  5KBA A;  3UI2 A;  3UTM A;  2KIK A;  3Q9N C;  4HBD A;  1EDJ A;  1ZW0 A;  4LSZ E;  4O1O A;  2KZJ A;  1S70 B;  2JAB A;  2B0O E;  4J8Y A;  2L6B A;  4OAU C;  4ASW A;  4HKZ H;  3KEA A;  2KUB A;  2QRX A;  4QQI A;  3LJN A;  5EYL A;  2VGE A;  1ZXG A;  1TR4 A;  2LXC B;  2M0B A;  4ATZ D;  1BI8 B;  5HRY A;  3D9H A;  4ZNC A;  4K5A B;  5ENP D;  2Y1L E;  1JM0 A;  1UOH A;  4O60 A;  2UWJ E;  3F6Q A;  2V4H C;  4HI8 A;  2F37 A;  3NOG D;  3B95 A;  4DX6 D;  1A5E A;  4CZ2 D;  1S3J A;  4GOF A;  2Q1K A;  3UXG A;  3TWX A;  3AJI A;  2SPZ A;  1K1B A;  4GOD A;  3MZW B;  1Q2N A;  3HG0 D;  5KNG A;  2OTK E;  2MYO A;  4JB8 P;  3B7B A;  1SW6 A;  2ETB A;  4N5Q A;  5D66 A;  3Q9U C;  4G8K A;  4LNU D;  5AAR A;  4U96 D;  5KWD A;  2ZAE B;  1DCQ A;  3FXE A;  2A5E A;  1MX2 A;  2FO1 E;  3V2O A;  2B89 A;  2B88 A;  4J7W A;  1OT8 A;  4HRN A;  3FXD A;  4ZMD A;  5BXO A;  5C39 A;  4HQD A;  3NBN B;  4CPG A;  1OY3 D;  5EFW B;  1BD8 A;  2J8S D;  3ZKJ A;  2RKL A;  1N0R A;  3V2X A;  4HRL A;  4HLL A;  5EYP F;  2XEE A;  4DX2 A;  4BXL A;  2WMM A;  1QYM A;  2R44 A;  4DX5 D;  2BKK B;  4ZHB A;  1BDD A;  4Z68 A;  1H0T B;  4BET A;  4UUC A;  5ENQ D;  3DEP A;  4DUI A;  2RFA A;  4GOE A;  1NVO A;  1BU9 A;  5DJT B;  5FIN A;  2ZGD A;  4HJG H;  1MYO A;  2NYJ A;  4U8V D;  1U7M A;  1YCS B;  3QWO C;  5CEC B;  1YYH A;  3SO8 A;  3T9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...