5CBOA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords mbp3-16,Immunoglobulin G-binding protein A
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Synthetic construct
total genus 55
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cboA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cboA01
2KZIA 2SPZA 2LXBA 1DC2A 4O1PA 1BD8A 2RFMA 2KZJA 4GODA 3EHRA 5EILA 3IXEA 3D9HA 4KJMA 1EDJA 3B7BA 1OT8A 3TWVA 3ZKJA 2KS1B 3MHVA 4J8YA 4U8YD 2XEHA 1WG0A 4HRMB 5FINA 2OTKE 2XENA 3UTMA 4LG6A 3V2XA 2ZAEB 5ENOD 2V4HC 3W9GA 4WWIA 4GOEA 1OVUA 2KXPC 2DVWA 3ZUVB 4DX6D 3FXDA 5ENRD 5ENTD 1U7MA 2DWZA 5BXOA 3JUEA 3ZNGA 1Y47A 4J7WA 2HR3A 5D66A 5ENPD 1MJ0A 4UUCA 1SS1A 4HRLA 2NYJA 3ZDMA 2M5AA 5HRYA 4DX7D 5KWDA 4K5BA 4HB5A 5FIOA 2UWJE 1UOHA 1MX2A 3LJNA 5DJUB 3T9KA 4ZHBA 4F6RD 1N0QA 2A5EA 2P58A 4DX1A 2JABA 2P2CP 5CEAA 2K3RA 3EU9A 2KBXA 5AQBA 1U7JA 3JXIA 4BXLA 4DX5D 3QWOC 2XZDG 2M5AB 4CPGA 4HRNA 1FC2C 5KNHD 2PNNA 1OVRA 1H0TA 2JWDA 1WDYA 4NIKA 4CZ2D 3TWUA 4LNUD 2DZNA 2QC9A 5KBAA 4HB1A 4K35A 3TWTA 2XZTG 3B95A 1MYOA 1AP7A 2F8XK 5EN5D 1SVXA 1NFIE 2FO1E 2KUBA 3KEAA 4HBDA 4TUMA 1D9SA 1IXVA 4HJGH 1BDCA 2ETBA 5CECB 2WMMA 1MX6A 4O1OA 5HS0A 4JB8P 3NOGD 3Q9NC 4ATZD 1JMBA 1OY3D 4GOFA 1X0TA 1H0TB 3TWSA 1A5EA 1Q2NA 3V2OA 3J5PA 4BERA 4U8VD 3V31A 1EDIA 2B88A 4N5QA 5AARA 4GPMA 3V79K 5EIDA 4BETA 3UI2A 2BKGA 1K1BA 5KNGA 4JBZA 2ZGGA 1LP1A 2B89A 3TWQA 1S3JA 3FXEA 4C48B 4B93B 1G3NB 4ASVA 4ZMDA 4DUIA 2RKLA 2AJAA 4BESA 4U96D 4BSZB 1IKND 4HI8A 5JA4D 3AJIA 2BKKB 2Y1LE 4HNAD 1EC5A 3Q9UC 4U95D 4DRXE 3V30A 4LSZE 5JMND 1EDKA 2I8DA 5K5GB 5AN8A 4NPFX 3T8KA 3NOCD 1LP1B 1BU9A 2J8SD 1MFTA 3C5RA 2L6BA 4QQIA 2LR2A 4F1PA 4K5CA 3MZWB 3TWWA 4OAUC 2VGEA 3AAAC 3S1KA 1N11A 1K1AA 4G8KA 5EFWB 2XEEA 5C39A 1ZXGA 5AQ9A 2QYJA 3NBNB 2B0OE 4GMRA 1K3ZD 4BEPA 1NVOA 4IOIH 3JXJA 5EYLA 4K5AB 3TWRA 5HKPA 4MN4C 2LXCB 2ETAA 3RGUA 1S70B 2V5QC 4HKZH 5DJTB 3J5QB 4ASWA 2QRXA 1ZW0A 2KIKA 1BI8B 1IHBA 2Y0BG 4QFVA 5EIBE 4ZNCA 3F6QA 4EYYQ 4Z68A 5BXUA 1TR4A 4HQDA 5ITZF 3EHQA 4O60A 4RLYA 3HRAA 5CBNA 2HE0A 1YYHA 4DX2A 5ENQD 3SO8A 3DEPA 5EYPF 4A63B 1YCSB 1YMPA 3TWXA 2B87A 1LT1A 5AQ7A 1OVVA 4YDWA 2ETCA 3PH0A 5CEDB 5CERB 5CBOA 1MX4A 2KI7B 1JM0A 1DEEG 1AWCB 1N0RA 2MYOA 1BLXB 4K3AA 2QVAA 2F37A 1QYMA 4ZFHA 2M0BA 1BDDA 5AQAA 2ZGDA 2F8YA 3HG0D 4HLLA 3W9FA 3UXGA 1DCQA 4CYMD 1EDLA 2DZOA 2RFAA 2R44A 4OAVB 5AAOA 1SW6A 3ZU7B 4G8LA 2B87B 4NPDA 5ENSD 2Q1KA 1BI7B 3DEOA 4YDYA 4NPEA 4HI9A
chains in the Genus database with same CATH superfamily
2KZIA 3ML9A 2FI7A 2Y3AA 1LTGC 3OXFA 4EZKA 3SWFA 1SQPE 4FP7A 2N9BA 1NTME 4JHJA 1FZCB 1HZ4A 3MV3B 4B8CB 4DJAA 5CRVA 3UKRG 3CXHI 2H6GA 3L70E 1LTJC 5AW2B 3APCA 3L22A 4BFRA 1ZU2A 3UM3A 4GZ5A 1XNFA 4U8YD 2YNYA 1WG0A 4HRMB 4EOTA 5FINA 3CK9A 1N73C 4AYCA 3G6EP 3KXDA 3FUDA 3H1ID 2Q9IA 1MV8A 1KZOA 3RK3C 1K05A 3Q15A 1NA3A 3GF7A 3G2UA 3DXMG 4QMAA 1L0ND 3HYMB 2OEVA 3H1HD 3V2PA 1R8EA 3I56P 2P9LG 3I3NA 4GOEA 2EIME 3QAQA 5A23A 1JCQA 1N73B 2KXPC 4LGDE 3LIDA 3OW2O 2DVWA 3GZ2A 3RK3B 3ASDA 2KCLA 4GTTA 5KLVK 2JJLA 4YDEA 4WY4A 1V54E 1U7MA 2WPVA 3JSVC 3P1UA 2Q3IA 3GMAA 5AVVB 4DI3A 1YQ3C 4PV1D 4XFJA 2KXPB 3B13A 3ZIMA 1N7LA 5IY5E 2WSFJ 1PP9E 2H43A 3ZNGA 3WG7E 1V55E 3P8MC 1USDA 1SQXJ 3MA5A 2RMZA 2LXLA 3JUIA 1VDYA 1SS1A 2CPSA 1HF9A 3R4YA 2XNDH 3RBZA 4HRLA 4C9BB 3ZDMA 1FS0E 1UIXA 2M5AA 5HRYA 3B5NA 1DD4A 4EQFA 4YPCA 4K5BA 3QWPA 3CHOA 1Q82Q 1CSBA 2UWJE 2OTJP 1MX2A 1UN9A 1KYOE 2Y4UA 2IF4A 1VQNP 2FYUG 1URQD 2BTDA 1NTZG 5TISE 1RY3A 3KPEA 4ZHBA 2P67A 4AM9A 1N0QA 2FKWB 2XCBA 3CX5D 2OOEA 2P58A 1NKZB 3G9RA 5J90A 2KCVA 3MV2B 1KB9D 5BV0A 3HDXA 4WNEA 2ZYAA 1B89A 4JVSA 5CEAA 1L4AD 4HH2A 4IN3B 2Y0CA 1TJCA 1UN8A 2KBXA 1G2CB 1QEXA 5GTIH 1U2VG 4CDRA 3IN6A 3JXIA 4BXLA 1LTBC 4FU3A 3NZSA 5BT1A 4KMOA 2OEWA 2D2CD 2IBZI 2XZDG 2O1KA 4GTQA 1LNQA 2X6FA 4I7ZC 3HTKA 3FH8A 1H6KA 1X22A 5AW5B 2P9NG 1TJFA 4XX5A 1AQTA 3UIOC 2AXTE 2ZISA 1HVVA 3L72G 1IQRA 1FDIA 2OVBA 2EINE 4OYSA 1RW2A 2QC9A 3D9OA 5KBAA 4I7ZB 2NPSD 4K35A 3Q75A 2FY8A 3FWLA 3QDNA 4TRQA 1MYOA 2KNCA 2F8XK 1MKMA 5EN5D 2FBWC 3TF5A 4DPRA 1KORA 1D9SA 4GMLA 5GTHE 3U64A 1VQPP 3CPWO 2ETBA 2OV8A 1ZV8A 5KAIE 3ONLA 4KT6B 3D9NA 4O6FA 4IL6X 2WMMA 3TDKA 3EQ2A 4R4LA 1N4SA 3CVWA 4K0RA 2ZT9C 4JB8P 3T8MA 3E33A 4U3FJ 3Q49B 4AIFA 3E4BA 3HE5A 1Z3YA 3RRUA 3L73J 2O01H 5LP0A 4GOFA 4A3VA 2QJYC 3HVEB 1H0TB 5FQ6A 1A5EA 1QNFA 3CCQP 2ZT9B 3EDTB 5D0QD 5HQ8A 3LIEA 4BERA 3T97B 4D6TE 1R5SA 2R3SA 1LTAC 1BE3J 3AG4E 3CWBE 2QJYB 3D3MA 1HX8A 2B88A 1SQPK 4GPMA 1LGHB 3V79K 1NJIQ 3MIWA 1NTMK 2IFUA 4BETA 3QNKA 2BKGA 4UB8E 3TGUJ 1JY3N 2YINA 3AEGC 3EJNA 3ONKA 4HXIA 2W90A 3V5BA 3FWNA 3ML8A 2OVFA 1QBQA 4JYCA 4EZJA 1JNMA 2LAHA 1T2KC 3WU2E 4PH4B 2LKMA 1ELWA 1SA4A 2AXVA 2K37A 1SQBJ 3AE7C 4C48B 2HR2A 2JEKA 3ESKA 3PS6A 1G3NB 1OZHA 4BWNA 3WXXA 3EIQC 2XDJA 2E5TA 3CSFA 3LVQE 4DUIA 1S5LE 3RU0A 2RKLA 2AEJA 2I1KA 1DH3A 3ZVVA 2IO2C 4U7EB 3AE2C 4U96D 4GCOA 4BESA 3TGOA 3C9IA 2NPSA 5D2MC 3UUXA 2KLUA 3Q5SA 3IEGA 2ZXEB 3M9HA 1EQ7A 2OYOA 2Y1LE 4HNAD 2ZXWE 2O01J 2GA1A 2XZRA 3RBXA 2Y9ZA 2LXMA 3AS5A 5AENA 1OMIA 4U95D 3TG5A 5KLIC 3RK2C 2I8DA 2GM4A 1EF1C 2PGDA 2IQCA 5AN8A 1M8OB 2Z5IA 1H2VC 5J08A 2J58A 4OGQD 2ZYDA 1NL4A 3Q7FA 3O48A 2XPYA 3DSWA 2J8SD 4JZYA 1SQVE 2C0MA 1SQPG 3RK2B 5KLIB 3RO2A 3FGAD 1NTMG 3HUSC 2LR2A 4PD4H 1T6AA 3TWWA 4I6EA 1BGYJ 4R4MA 4C7RA 2VGEA 1D8DA 2O1JA 5CHXA 3E7KA 5H2FE 1N11A 5APWA 3KSQA 2HODB 3L08A 2NC9A 1SZAA 4B0ZA 2QM8A 1IFDA 2QM7A 2ZVNB 1KQLA 1OWAA 3HD7D 2VJ8A 3HUSB 1JUQA 2G8YA 5EFWB 1P84H 2FYNC 2CHXA 1LTIC 5KLVD 5AQ9A 3U4TA 5LFAA 2FXPA 2WXJA 3Q2YA 5FTPA 2WXLA 4YTPC 4CT0A 1ZBPA 4UQYA 4RKUJ 4K5AB 2AW6A 3PEUB 2LSVA 2FYNB 3HXDA 1BPOA 3L72D 1IK7A 4HLEA 5CCMA 2KP8A 2PP6A 1J1DC 1HGZA 1X9VA 3LY9A 3V4QA 2CK3H 1FZFA 4C7NB 4HKZH 3ISMC 3LDZA 2IX7C 3L17A 4IULA 4ASWA 3H1IJ 3HE4A 1H0AA 2NRGA 4H0LD 2E74B 3C1LA 4N39A 1J1DB 4PS7A 1L0NJ 3L74G 3C3RA 4ZKPA 3H1HJ 4PJ0H 3RK3E 3CVQA 3Q5RA 2K1AA 1TR4A 4GTSA 2E43A 2BF0X 1W5CE 1AA0A 2IO3C 1GD2E 3HRAA 2OQQA 5B66H 4B8AA 3K9IA 1N54A 3PEVB 3UIPC 3IBEA 1RE3C 4R7LA 1ZMEC 2UWJG 3EHMA 4U0ZA 1LT1A 5KTBA 4H7YA 1TNOA 2J9QA 2X6KA 3JQ0A 4YDWA 3VYIA 2ETCA 3AG1E 1X79B 3BQOA 3PH0A 4JL0A 3FU6A 5CEDB 3RRNB 4N6JA 5CCGD 3HD7A 1NI1A 1H88A 5ANRA 3CXHE 2IONA 3FP3A 1NU1E 2HO1A 3M06A 1IO4A 2XEVA 2E76D 4MRUA 1HUCA 1R5LA 5AVXB 1FZEA 4WWNA 2FYUE 4PD4I 5AQAA 1EZVI 1NTZE 2ZGDA 3CGHA 3G2WA 4N78D 2Y4TA 4LLHA 2WB2A 2M63A 2H6HA 3HRNA 2I6HA 1TNYA 1YI2P 3FU0A 4TLFA 1NA0A 1UIIA 3SFEC 2J08A 4HLLA 3CLQA 4GZ3A 3UXGA 1JCCA 2KS1A 2WSEH 1DCQA 2DIWA 3PRZA 5AJLA 3RKVA 2CHZA 1P84I 2R44A 2G3AA 1VQ7P 5KJ7D 1SW6A 2FF4A 4G8LA 4BRYA 2XGOA 3PRJA 2A45G 1AV1A 3AE6C 1BI7B 3KEZA 4CEMA 4OVNF 2IFMA 2K88A 2WXRA 5BNWA 4YDYA 3GZ1A 3VP8A 5B5EH 3Q5PA 1ZB1A 5T4YA 3IHVA 1VQKP 5CRUA 3MGNA 5KJKA 3LYAA 3L13A 2IJGX 1KFNA 2K9YA 2KC7A 3II6A 3S7BA 4LEUA 3V2RA 2XRYA 1T3UA 2WXFA 1SQPD 1CW5A 1BD8A 2A5UA 2MKVA 3D70A 2XPZA 3CQGB 3UM0A 1NTMD 3VLFA 5APVA 2JDIH 1RE4C 1TNUA 2LUHA 4JF7A 3D9HA 3PE4A 1N7SD 5APYA 5B1BE 3RK6A 1HS6A 3L70D 5AJDA 2GRPB 4EPZA 2BCCE 3ASOE 3MHVA 4J8YA 2WXIA 4UWHA 3T5VA 2YKQA 3L9TA 3NF1A 1OIPA 3TNUA 1Q81Q 4EIJA 1IJDB 4WUYA 3P8CD 4A7PA 2XENA 2MOWA 3Q78A 3L35A 1PV3A 3FUJA 4F3VA 2ONDA 4ILGA 4D6TG 1VQ8P 5CCGA 3CWBG 4GCNA 4ILIA 1SQVK 1EZVG 1W2BO 3MYVA 2V4HC 2R05A 2XS1A 1ELKA 4AXHA 4WWIA 3CCJP 4DLQA 1KQFB 3IKOB 1TEZA 1GL2D 3M0DC 3PVLA 3LPZA 2DYSE 4PV1C 4L9PA 3S7FA 1EPUA 1RQVA 4PS8A 2JR8A 3L6AA 1PIXA 3IV0A 4FA6A 3FXDA 1KQSO 1MZCA 4GT1A 3CL3D 1UW4B 3CVNA 1M1JA 1RHZB 2R3CA 3ZFWA 2YXRB 1NAFA 5BXOA 4PV1B 3NQPA 4IL6H 4ILHB 3SWKA 5APQA 1Y47A 3APDA 3UPVA 5KJ7A 2HR3A 1YJ9P 1TNBA 1CI6A 1VQ9P 4G25A 2IBZE 3CCMP 1PP9D 5ENPD 5CCHC 5AVSB 5E75A 2KSJA 1M90Q 3O4ZA 4IFDK 2NYJA 1URQC 2XGMA 5KWDA 3UT8A 4N5CA 4HB5A 2IDBA 3ZXSA 1WMKA 1UOHA 2R5DA 1VQ6P 1WY6A 2KATA 4XZ4A 2FFDC 1KV4A 1YA0A 2W6AA 1ZRTE 3FUIA 1URQB 2W6BA 2VSYA 1KYOD 1FCHA 4F6RD 3U59A 3JCUH 4A3TA 1GK4A 2J4DA 4L23A 3H1KE 1L4AC 4WY4D 2I9CA 3FTWA 1M7LA 1N7SA 3FFLA 3GLMA 2WPSA 2FFDB 5CJ0A 1FDMA 4AV7A 3FH5A 3ZYQA 2D2CC 4M3LA 2JABA 4GTPA 3KDPB 4MLPA 3SHFA 2P2CP 3BUAA 3A3YB 1L4AB 4AY5A 1N4RA 4J6IA 3D9LA 1NH4A 1KD1Q 3CIAA 5H7PA 3B5ND 1Z6TA 4HRNA 2D2CB 1K8AQ 4WBAA 4FHKA 5KNHD 1GL2A 2NPSC 1LTXA 1GK6A 1HBWA 1U57A 3FTSA 3H1JG 2XU6A 3DSSA 5C1DA 2E2EA 2WSFH 1YYCA 2JWDA 1WDYA 2ZJSE 2OYHA 4NIKA 4CZ2D 3CVPA 4UI9K 1S5LX 2FBNA 3OAKA 1QL1A 2IOLA 2N1TD 2R03A 2L5GB 3AU5A 2OTLP 2XZTG 3B95A 1NU1K 3EFGA 2PM6A 5EX0A 2ZIRA 2X38A 5KLVJ 3OTNA 2R2LA 1SVXA 3CHQA 2XV5A 3LY7A 1Q7YQ 4TV3A 3VMYA 1U3DA 2L0TB 2KUBA 4XKBA 1IFJA 3OAWA 5JJTA 2WTYA 1IXVA 4YXWH 2FYUK 1BDCA 2F0YA 1NTZK 3KS2A 3ZPJA 1JTHB 5AVRB 1KQGB 1LTJB 2QE7H 3L75G 5CECB 4GDOA 2H6FA 3TXNA 3IR9A 2RH0A 4DJGA 1RF1C 2A06G 1MX6A 2J07A 4O1OA 3ZHEB 1LWUA 3L72J 4JEUA 4U3FE 3NOGD 3Q9NC 1EDUA 4ATZD 3AE1C 2KZTA 2WT7A 3CMEP 4AJWA 3NTNA 5GTIE 4K03A 5BU8B 1RF1B 4WNDA 5APUA 2K9JA 4GTOA 2ZVOB 3A0BH 3OJAB 5BV1A 3J5PA 3E32A 1VDFA 3ENEA 3GHGC 1NKNA 3L74E 3UINC 4N2SA 2YHEA 1GDTA 2DBAA 4N5QA 4XI0A 4D6TD 5EIDA 1FJPA 3CWBD 3D9MA 2H6IA 3UI2A 2LO6A 1VQ5P 1D7MA 3E37A 2OYIC 2YNQA 4XIFA 3Q4AB 5AYWD 4CGVA 2ZGGA 3GHGB 4APOA 1FBMA 3KZIH 1LP1A 2GUVA 1GU4A 1S3JA 2E75D 1QVGO 3CEQA 3BCCG 1NU1G 4H13D 1JY2N 3M91A 3E1RA 1H2TC 2OYIB 4ANXA 3NFQA 4ASVA 3RIBA 3AE4C 3A0HH 4B89A 1SFCA 3B7SA 2WMOA 4FJYA 3BG1B 1OFCX 3Q3DA 5G04J 4BTAA 2N1TA 5KJNA 4HI8A 4KXKB 3CCRP 3AJIA 2BKKB 4I2ZA 2O3JA 3VTPC 2FXOA 1EC5A 2GROB 1HTLC 5G05J 1PGOA 2UY1A 3SGHA 3UM2A 3DSTA 4W9RA 4OGQC 3MUDC 3V30A 3BG0B 3LY8A 3VMAA 3FUHA 5EKQD 1KZUB 3FTZA 1EDKA 1NOHA 4JA9A 4AY6A 4RJTA 3D9PA 1IK9A 2P2UA 3LKUA 4WNGA 5CHEE 5CMYA 1PL5A 2MRIA 2IEJA 2XPIA 2AXCA 3T8KA 3SBSA 1LT9C 4AVXA 2OARA 4J8EA 4OGQB 1MQSA 2WXGA 1BU9A 1FVHA 1MFTA 1A02J 2W8ZA 1H8AA 4GYWA 4GZCA 1SQVD 3P32A 3FU3A 3G2SA 1LT9B 5FZQA 3K5BA 2R17C 3S1KA 2R32A 4UB6H 3ZRHA 3M0AA 3GYZA 2WSCJ 2AXUA 3B7RL 4G8KA 3UM1A 2OCCE 4L2YA 3B71A 2IOSA 2BCCG 3JQ1A 2M3BA 3VLDA 1SQQE 2P9KG 3CVUA 2QYJA 4Z1MH 4URKA 4BEPA 3AECC 1SQPJ 3NZUA 5KAFH 3IAOA 1QGKB 3P7KA 4GAAA 2L9BA 4EECA 3TWRA 3S9OA 5T8IA 2WQ6A 3NB2A 3L70J 3SF4A 4FC8A 4H0LC 3CI9A 3CC2P 3JCKC 2PQNA 4L75A 1VF5D 2P9IG 3ASFA 4OH8B 5DJTB 2KCKA 3J5QB 3R7QA 3VP9A 2QRXA 1ZW0A 1NHLA 2J49A 1S2EA 1FJKA 3AE9C 1BI8B 3H1HE 4H0LB 2V8SE 4QFVA 3QH9A 2AEFA 1IFNA 4PD4E 3FTUA 2RN0A 1EZVE 5CCLA 3LS8A 4KVMA 1SQXG 1SLQA 1E7UA 3BEEA 3MJWA 4HQDA 1YJWP 1KT1A 2IBZG 3CCLP 3A5TA 5ITZF 3RK3D 1IFIA 4CDNA 1U3CA 3V2NA 5B3SE 1KLXA 3FHEA 1RF0A 1S72P 3ZYLA 1YYHA 2WITA 1OCCE 2VSNA 1P84E 1QL2A 1IHGA 4MBGA 3UKUG 4DX2A 1HJ0A 3PHLA 1KILC 2NSZA 3PE3A 3SO8A 3ZXPA 1X8YA 2M3EA 3G2TA 3I4RB 5G04C 2PZIA 1YMPA 1PP9J 1PPJE 5CCGC 3FX0A 1ELRA 4G24A 5AQ7A 1KILB 1T3JA 5FQ7A 3FUMA 4GYYA 5G05C 1LD8A 3H1KG 2V7QJ 1YQ4C 4E6HA 1HFAA 4WVZA 4EDFA 4JA7A 4H44D 3VTXA 1DEEG 3L16A 3IHYA 5ARGA 4KBQA 1G1IA 1OX3A 2HYZA 3ABME 1QYMA 1FZCA 2RG8A 1FOSF 2WXHA 1M1JC 1YIJP 1KTMA 3TSIA 4C0MA 1TYQG 2DW3A 2ZFCA 3CXHD 3O6QB 2WPQA 4W80A 3TL5A 3H1LJ 5A7DB 4PJ0E 2Y0DA 2B9BA 1NTKE 4AP2A 2FYUD 3URZA 1NTZD 4BX9A 1M1JB 2YKOA 4CYMD 2R5BA 3E1IA 1WT6A 1OXZA 5B66E 1HG2A 3CD6P 3PZDA 4OAVB 3ZU7B 3U1AA 3TAXA 2LNIA 4GTVA 2B87B 3FTYA 1E96B 2L6JA 1BCCE 1FDOA 3MCXA 5JHAA 1HU3A 1VPCA 5ENSD 3D9KA 3DEOA 1IZNB 3RL0g 4I17A 3DBSA 3R7RA 4FLBA 2FEZA 3M9QA 1DIPA 3H25A 4APFA 4BSXA 5KJMA 2WXOA 1N73A 1GW4A 2SPZA 4JD2G 3MKQA 3WUUA 4UWGA 3DWLG 2IPPA 3H1JE 2Q7CA 1JY3O 1DC2A 1AQ5A 4BX8A 2EIJE 1BSHA 4TXPA 3SFDC 1QVFO 2KZJA 4M7CA 4GODA 4U3FG 3AEFC 2PAJA 1L0LE 3EFFK 2XGSA 3CCEP 3IXEA 2V0PA 5AW7B 4L76A 3B7BA 3LCAA 3TWVA 4HS2A 3H32A 3U66A 3VMXA 4D10C 2XEHA 1FT2A 3L71E 2IZ1A 1NGMB 2BCCD 2OTKE 4WNFA 3FDHA 4LG6A 3V2XA 3L75E 1OWNA 4LUNU 1DVPA 2ZAEB 2A06E 4RSYA 4N3AA 1N4PA 3CX5H 3FTVA 2YO2A 4JHRA 3W9GA 1KFMA 3SY2A 2PL2A 1J2JB 4W7ZA 4NQ0A 1OVUA 2QJPC 3KHUA 2CHWA 3AE5C 1KB9H 3V4WA 3I4GA 4GA0A 5B5EE 1IYGA 4GTMA 5ENRD 3MP7B 5ENTD 2X6JA 3AS4A 4I2LC 1H6OA 2DWZA 3UQ3A 2QJPB 3ASHA 2IYPA 1K04A 3PNTB 3JUEA 1SQQK 4D6TJ 3T5XA 3CWBJ 2YMYA 2QSIA 1HG5A 1LF8A 1M57D 3TK1A 2J5UA 1G2CA 2YMKA 4UUCA 4RO0A 3RO3A 2IBZD 4J0UA 4Y99C 1E7VA 1FOSE 2YO3A 2L91A 4DX7D 3LW5J 5APTA 1FZAA 4LRZA 4M3OA 3W68A 3BCCE 1Z3XA 3B7TA 3H6PA 1Q2ZA 3EU5A 5FIOA 1YTZI 4WY4C 1E8WA 3LJNA 4Y99B 1AFOA 3HXEA 3FH7A 3T9KA 3ZYMA 3GF3A 2KYVA 1KN7A 3RL0D 2EIKE 2A5EA 1ZRTD 1ZP0C 1OUVA 4WY4B 3SFXA 4U7JA 2WPVB 2HPCA 3ZN3A 5FQ4A 4DX1A 3H1KD 5KJLA 1BGYG 1TU3F 4HYTB 3GZSA 4XKCA 4B86A 4CT4A 3B5NC 2ITAA 2K3RA 3EU9A 5AQBA 4IL6E 1N9AA 3ZYKA 4G2VA 5JJ7A 3D9JA 4G26A 4DX5D 1FZGA 1E8YA 4EI2A 3QWOC 2M5AB 4CPGA 4RG6A 3B5NB 1SQQG 1OWOA 2H89C 2WWWA 1H0TA 3MX3A 4ME2A 5EX3A 4IRUA 1SQVJ 5AVUB 2HLOA 2XQ0A 3EWKA 5E79H 4LC1A 4Y6WA 1KT0A 3TWUA 2P58C 1S9KE 2DZNA 2WXKA 2VGYA 3MGBA 4FULA 1FT1A 3T97A 2C9LY 5T3RA 2JEEA 1GZLA 4KHXA 4PUCA 4I1LA 4I6GA 2BASA 4LCTA 1ZOYC 3D9IA 3CX5I 2GUSA 5CJ4A 3PNLB 1SP4A 1TN6A 3D6YA 2C0LA 2VTBA 3JCUE 3BU8A 4HBDA 4TUMA 3UT4A 3PUJA 4HJGH 1KB9I 3MZLB 3H1HG 1NTKK 1PZQA 5HS0A 2XCCA 2FYZA 2P7JA 1GW3A 4GPKA 2R5SA 4DI4A 3AG3E 3RJVA 1S64A 3SSUA 3ASGA 3HTKB 1OY3D 4CCAA 3LJ3A 1X0TA 3FTXA 2WZ7A 4B94A 1OWMA 1K9MQ 4I6JA 3ZGQA 3TWSA 2IZ0A 3FUEA 4BT8A 2E74D 3DPDA 4I1MA 3UT7A 3V2OA 3U9WA 2NZ2A 4I1OB 2CPBA 4WWPA 3PZ2A 4U04A 3BRTB 3U1CA 3QWWA 4AEZC 3G71P 4YXDC 2KNCB 1PPJG 1X5BA 2E75C 1SQXE 3L74D 3GW6A 4FLHA 1S1CX 1JO5A 2VSXE 3AU4A 5KNGA 2KB7P 1NYHA 4H13C 1Y8AA 3G2VA 3APFA 3BATA 1L0LK 4DT0A 3TYYA 3EHNA 4GZDA 3OXLA 3TWQA 1WM5A 5D0OD 1A17A 3TXMA 4EHMA 3FXEA 3UX4A 1MFZA 4Q96A 4I9EA 4O9BA 3FU5A 1KILE 4B93B 4GA1A 4H13B 1N94A 5FQ8A 3HXBA 3HE5B 4ZMDA 4WWOA 1H6PA 2AJAA 1OWLA 5M1BA 1JUNA 3OA7A 4RVBA 3R9AB 5G55A 3CK7A 3CC7P 4I2WA 2HODA 5BPPA 1NTKG 2P1JA 4UI9J 5JA4D 1WRGA 2V4LA 5G2NA 1DD3A 4FHJA 3HUSA 3MD0A 3FWVA 5LCWJ 2WM9A 3O8ZA 2PM7A 3FULA 3A0BE 3FUKA 5LOZA 4LNBA 4DRXE 5KKZC 4XI9A 1BCCG 5JMND 1E8ZA 3S2AA 1XGWA 3CMAP 5K5GB 3C98A 1Y8MA 1LTSC 2FYUJ 1NTZJ 3NOCD 4C46A 3ABLE 3PDNA 5KKZB 2VQ2A 4E85A 1KPSB 2C0WA 5FZSA 4C7NA 2KLVA 2XS8A 2J59M 2L6BA 3CHPA 3KZIE 4Y28J 3D71A 3AE8C 1SA5A 4EBAG 3CVXA 3V2QA 2KOGA 5JJ6A 1QZ2A 4OAUC 1SFCD 1L0LG 5AVQB 1K1AA 1EYHA 2NPSB 4NURA 3PP5A 2WXQA 2WMNA 3FUFA 3A0HE 2Q7FA 1YJNP 4TXQA 3N71A 1INZA 2XEEA 2CG2A 1ZXGA 2QIWA 1Z56A 3L71G 2B0OE 1K3ZD 3AEAC 2EQXA 1NVOA 1SQQD 2XNXA 1VF5C 5KCMA 3JXJA 5EYLA 1VQMP 4JYBA 4OVUA 3QARA 5HKPA 4WB4A 3JC22 2JO1A 4U8HA 3L73E 4CDMA 4U07A 4XEIG 2PQRA 4A1SA 2PFXA 1SQMA 2WVIA 4UQXA 2ZU6B 3P8CE 1VF5B 5AW9B 3CHRA 3RAUA 2BCCJ 3G4SP 2YKPA 3MKRA 1RE3A 4ABNA 2KIKA 3L82A 2Y0BG 4DLOA 1BE3E 3R2PA 1NP7A 2O01N 4ZNCA 3NAWA 5TJHA 3JYSA 4L1BA 4N3BA 2XRZA 5AVZB 3V6IA 3S4RA 3CCVP 3TGUE 4UB6E 4PD4D 3VN0A 3MKQB 3GG2A 1EZVD 3Q47B 2WQHA 1KC8Q 3HIZA 2I1JA 4ANWA 1JEKA 3CSTA 2J09A 4X8QA 3C3OA 3CLJA 1E8XA 1Y6IA 4JXTA 4YNDA 1SQBE 2YHCA 3DEPA 5EYPF 3KYQA 4UWFA 1PGQA 1P84D 2WSCH 2X3MA 2VSOE 3FY4A 1D8EA 4A63B 1YBKA 5KAFE 1QLED 3AEDC 3SQVA 4UI9C 1ZN5A 1N8RQ 1OXJA 4H44C 2VYIA 3H32B 2IYOA 3KD7A 5LCWC 2Y0EA 1OVVA 1DX7A 2LAIA 3B8EB 1XTCC 3Q5MA 1PPJD 3B4SA 2LSUA 4TT3H 3HE4B 1RH5B 4GMJA 2L0IA 1IC2A 1JCDA 1HO8A 5CERB 5CBOA 1K8KG 1JM0A 4GIFA 1OW7A 4H44B 4W7YA 1N0RA 2MYOA 5FJYA 4I6MC 5CCHD 4JC8A 3SZ7A 3I5CA 4G1TA 2KSEA 3H1LE 4KYOB 3QJZA 5A6CA 1BDDA 1FZBA 4RG9A 4ACKA 1GU5A 4ANVA 1AVYA 2P9PG 4HOTA 1Q90D 3F5HA 2C2LA 3USSA 4J8SA 5E76A 4I9CA 2BEDA 3W9FA 4ACLA 3H1KJ 1W3BA 1MHQA 1NTKD 1SQXK 2DZOA 3PH0C 2RFAA 1FAVA 3SD5A 1BGYE 2KM4A 1RE4A 2E5YA 4HORA 3PTZA 3HD7C 1HXIA 2WXPA 1O1SA 4FJZA 3BVHA 2Q1KA 1Q86Q 1RZ4A 3CK8A 4RESB 1JCRA 2N9YB 3QWVA 1BCCD 5KLVG 4NPEA 3CCUP 3NMDA 2NXPA 5AW0B 4HI9A 4HOQA 1EXIA 3CKBA 3E30A 3HD7B 4IFFA 1NAYA 1GTWA 1E5WA 2LXBA 2V4HA 2WPRA 4O1PA 4ANUA 1NTMJ 1MUUA 5ANLA 2RFMA 3H1JD 2V5FA 3ABVC 3L4FA 3M0DA 3EHRA 5EILA 4J8DA 1LTTC 2VGXA 3TG4A 4DCKA 1DCEA 4KJMA 3CCSP 1JY2P 1QX8A 2V7QH 1EDJA 4UWKA 1UJJA 1JY2O 1L0LD 1OT8A 4MKTA 3A2AA 2HPCB 3ZKJA 3ULEG 2KS1B 2GGFA 4N3CA 3N4XA 2YQ8A 3H1IE 2CFZA 3L37A 4G11A 4AQRD 1JCSA 4BRYB 4IYPA 1PAQA 3UTMA 1L0NE 1KYOH 3L71D 1DEBA 4PS3A 5ENOD 1E79H 4NACA 5TISH 3E34A 3L75D 5CCHA 4CRWA 2W27A 3R9MA 1KMIZ 1L5JA 1P5QA 2A06D 4YVQC 3WUTA 2H7HA 4TXRA 4A55A 4F53A 2Y9YA 1URQA 4J8FA 2Q5UA 1S0PA 3AEEC 3ZUVB 1EXJA 4DX6D 4LERA 1OW6A 1ZR4A 1TN7A 3HXFA 2FULA 3AEBC 3Q79A 2FFDA 3QK0A 4JEHA 2VRSA 2QYUA 4P29A 4F7AA 4J7WA 3L74J 1GMJA 3ASNE 3ESLA 1L4AA 4HOSA 3F89A 5D66A 2VTBB 1MJ0A 1NZNA 2WQYC 1ZLLA 4N2QA 3TNUB 1LJ2A 1YTZT 2XHEA 2E76C 2AXTH 4DZOA 2WXNA 3RL0C 2A45H 2AVPA 5AVYB 2AXZA 1USEA 3FEXA 3BCCD 5DJUB 3U3WA 3DSVA 2JWAA 2E76B 1NU1D 1K73Q 1H89A 2GRLA 1M56D 3CX5E 2QFCA 3OXGA 4EBAA 4YVOA 5KJ7C 1UJKA 3RL0B 3ULYA 1PGPA 5GTHH 3SBTB 5KAIH 1KB9E 4L7TA 4U0SA 4U0UA 4KT0J 3CR3A 2HG5D 2POHA 3B7UX 5CMWA 3UIAA 2MJZA 1H2UA 4BT9A 1N4QA 3BRVB 1JTHA 1NO4A 1LTJA 1N52A 1CI6B 1IFPA 2QA4P 1PFIA 5ARFA 3PREA 1SQBK 4HFGA 3ZHEA 2GRNB 2XKMA 4ATGA 4OWFA 1U7JA 4GYOA 5BVZA 1O1RA 1FC2C 3L36A 2PNNA 1OVRA 2MHKA 2RD0A 1RF1A 1E90A 1JY3P 1N7SC 3LXUX 1VQOP 3GW4A 4FADA 4LNUD 3VLEA 5AW1B 2Z4EA 4F1SA 3L70G 3C8VA 4HB1A 4UB8H 2R59A 3A7OA 3L73G 1KYOI 3TWTA 1S9KD 1OWPA 1AP7A 3DXKG 3LW5H 3LEWA 1N7SB 3C3QA 1NFIE 4TUUA 3M9BA 3DPYA 4HVBA 3I5PA 1VQLP 2FO1E 4UQZA 2J4BA 3WU2H 4L2LA 3WMM0 2DYRE 3KEAA 3VMZA 1SQQJ 2OGUA 3GHGA 5AW3B 1HF8A 3PJSK 1GL2C 1BE3G 1ZR2A 1YITP 3WUVA 3MEKA 4EZLA 1S5LH 2OYHC 3CKCA 2E74C 3KQGA 2GRQB 2OYIA 4JW1A 2C9NY 5B1AE 1JWGA 3TGUG 3NXSA 2BEQD 1JMBA 2R02A 1SVFA 1L2PA 1GL2B 2CFUA 2ZYGA 5AVTB 3DSUA 2YIUC 2OYHB 2ZT9D 3P2BA 4WAFA 1Q2NA 3PZ1A 1HH8A 1N2DC 1SQBG 4L74A 2WSSH 1AJYA 2A4ZA 1FE6A 5FT9A 1OCOE 2WQ7A 3S7DA 3RRMB 4U8VD 5E79E 3ZEFA 1PP9G 3V31A 4Q94A 1EDIA 5AARA 3AS8A 4A1GA 2A45I 3X2QE 2YIUB 1LWUC 4NRHB 2HFED 1DNPA 2CG3A 1K1BA 5AW4B 4JBZA 1FU1A 1TNZA 3HXCA 1GW6A 1SQXD 2JKVA 5ENNA 3ITKA 2B89A 2X6HA 3EUVA 3MUDA 2C0XA 1JB0J 1LWUB 4XE0A 4GKGA 1LD7A 5H2FH 3H1LG 2KZTB 2WT7B 2H88C 2QEXP 4YDOA 4Q69A 2GRRB 1LT9A 1KILD 3CVYA 1T2KD 1L0NK 2P9UG 1BSNA 3BASA 4BTBA 4BSZB 2K9JB 2I2OA 1IKND 4AOFA 1JWFA 2HYNA 3CHSA 3KAEA 1M1KQ 1UG3A 2HM8A 3Q7AA 4KZ0A 5EDSA 5AVWB 3Q9UC 1OCRE 2IY0C 3QB2A 1JMMA 4LSZE 3QOUA 3D6ZA 1FPPA 2M8RA 2WXMA 3L54A 1IFMA 5DIZA 1S4XA 3W67A 4Y6CA 4L73A 5FZRA 4NPFX 1WAO1 1JPLA 1H19A 5BW8C 3VTYA 3EIJA 5BUZA 1VQ4P 1LP1B 4GZ6A 1SFCC 2DCPA 1NTKJ 4XA4A 2N1TC 4N3YB 3RK2D 3HVEA 1HWTC 3C5RA 2BUGA 1YHQP 2H8PD 4QQIA 1QQEA 4GU5A 4F1PA 4K5CA 3MZWB 2E0IA 5AW6B 1A02F 5C2YA 2QG4A 4JPZB 5AW8B 3AAAC 3CHMA 1O1TA 5BU5A 2QZAA 1BCCJ 1SFCB 4BY6A 3CVVA 3PZ3A 3LVRE 2N1TB 5KLVE 3Q73A 2Q3EA 5C39A 3H1IG 1S63A 2UY1B 4UWLA 3NBNB 4GMRA 2JLBA 3RSEG 2BEZF 1L0NG 4IOIH 3H1JJ 1HE8A 3L72E 4JPSA 3SFYA 1RQUA 2Q6QA 1J1EC 3SI5A 3S7JA 3ABKE 4MN4C 2QJKC 2LXCB 1L0LJ 3PLNA 4U3FD 2ETAA 1Z5SC 3RGUA 2FXMA 3MTUE 3CVLA 1S70B 3L73D 2V5QC 1KILA 4G23A 3SWYA 1IQUA 3CC4P 3ULQA 4I1AA 4GTRA 3CXHH 1J1EB 4IFMA 3CQCB 3L71J 2GRMA 2QJKB 1IHBA 5EIBE 4AUWA 2WSEJ 2PRRA 3L75J 1HGVA 3F6QA 3TJPA 1XTGB 1G1JA 1N86A 3I55P 2EILE 4EYYQ 1BE3D 1HH0A 3Q1MA 4Z68A 5BXUA 2X6IA 3O6QA 2YXQB 3EHQA 4O60A 4RLYA 1JOCA 2ZXXA 3TGUD 5CBNA 2HE0A 2W83C 1OCZE 4KVOA 5ENQD 1OW8A 2P10A 4CGWA 1TN8A 2E75B 5HI7A 3G3ZA 4JQ0D 2VGXB 1SQBD 1VL2A 2IFNA 1YCSB 3HHMA 2JP3A 1FVFA 2B6CA 1PGJA 3KSLA 3TWXA 2B87A 2KK7A 1X81A 2WVRA 3DRAA 1PC2A 3VOPA 2IU1A 2P9SG 2GW1A 5M72A 3QC1A 5DBKA 1O5MA 1PY1A 3PZ4A 4DK5A 1CZQA 1MX4A 2KI7B 1RF0C 3C72A 4GB9A 1AWCB 3FUNA 4LNGA 4C0EA 1BLXB 4K3AA 2QVAA 4DOJA 5FWQA 3CV0A 2F37A 3BCCJ 5AIJA 4OVVA 4ZFHA 1HJBA 2M0BA 3AE3C 4N78E 1MZ9A 1NU1J 2QY7A 4U63A 5APXA 3ZW3A 4PDXA 4V3IA 1W2EA 3UMVA 3H1LD 2AEMA 3AG2E 2RKKA 4RQIA 2E42A 1SZ9A 1KZPA 4GA2A 1SQVG 2F8YA 2Y69E 1AVOA 1Y9BA 3N7NA 3HG0D 3QKYA 5L8RJ 4JHKA 4MS6A 1N95A 1EDLA 2W6JH 3PUKA 4XE5B 4H7XA 4HOUA 5JHBA 2ILRA 1NWQA 2Z5HA 3IFMA 4KZCA 5AAOA 3SNXA 4NPDA 1T8ZA 2AWIA 2FO7A 5LX8A 1BGYD 5APSA 1FZCC 4ZKUA 3DSXA 3FEYA 5CMZA 3IF4A 3SFZA 4BWRA 4I43A
chains in the Genus database with same CATH topology
2KZIA 2SPZA 2LXBA 1DC2A 4O1PA 1BD8A 2RFMA 2KZJA 4GODA 3EHRA 5EILA 3IXEA 3D9HA 4KJMA 1EDJA 3B7BA 1OT8A 3TWVA 3ZKJA 2KS1B 3MHVA 4J8YA 4U8YD 2XEHA 1WG0A 4HRMB 5FINA 2OTKE 2XENA 3UTMA 4LG6A 3V2XA 2ZAEB 5ENOD 2V4HC 3W9GA 4WWIA 4GOEA 1OVUA 2KXPC 2DVWA 3ZUVB 4DX6D 3FXDA 5ENRD 5ENTD 1U7MA 2DWZA 5BXOA 3JUEA 3ZNGA 1Y47A 4J7WA 2HR3A 5D66A 5ENPD 1MJ0A 4UUCA 1SS1A 4HRLA 2NYJA 3ZDMA 2M5AA 5HRYA 4DX7D 5KWDA 4K5BA 4HB5A 5FIOA 2UWJE 1UOHA 1MX2A 3LJNA 5DJUB 3T9KA 4ZHBA 4F6RD 1N0QA 2A5EA 2P58A 4DX1A 2JABA 2P2CP 5CEAA 2K3RA 3EU9A 2KBXA 5AQBA 1U7JA 3JXIA 4BXLA 4DX5D 3QWOC 2XZDG 2M5AB 4CPGA 4HRNA 1FC2C 5KNHD 2PNNA 1OVRA 1H0TA 2JWDA 1WDYA 4NIKA 4CZ2D 3TWUA 4LNUD 2DZNA 2QC9A 5KBAA 4HB1A 4K35A 3TWTA 2XZTG 3B95A 1MYOA 1AP7A 2F8XK 5EN5D 1SVXA 1NFIE 2FO1E 2KUBA 3KEAA 4HBDA 4TUMA 1D9SA 1IXVA 4HJGH 1BDCA 2ETBA 5CECB 2WMMA 1MX6A 4O1OA 5HS0A 4JB8P 3NOGD 3Q9NC 4ATZD 1JMBA 1OY3D 4GOFA 1X0TA 1H0TB 3TWSA 1A5EA 1Q2NA 3V2OA 3J5PA 4BERA 4U8VD 3V31A 1EDIA 2B88A 4N5QA 5AARA 4GPMA 3V79K 5EIDA 4BETA 3UI2A 2BKGA 1K1BA 5KNGA 4JBZA 2ZGGA 1LP1A 2B89A 3TWQA 1S3JA 3FXEA 4C48B 4B93B 1G3NB 4ASVA 4ZMDA 4DUIA 2RKLA 2AJAA 4BESA 4U96D 4BSZB 1IKND 4HI8A 5JA4D 3AJIA 2BKKB 2Y1LE 4HNAD 1EC5A 3Q9UC 4U95D 4DRXE 3V30A 4LSZE 5JMND 1EDKA 2I8DA 5K5GB 5AN8A 4NPFX 3T8KA 3NOCD 1LP1B 1BU9A 2J8SD 1MFTA 3C5RA 2L6BA 4QQIA 2LR2A 4F1PA 4K5CA 3MZWB 3TWWA 4OAUC 2VGEA 3AAAC 3S1KA 1N11A 1K1AA 4G8KA 5EFWB 2XEEA 5C39A 1ZXGA 5AQ9A 2QYJA 3NBNB 2B0OE 4GMRA 1K3ZD 4BEPA 1NVOA 4IOIH 3JXJA 5EYLA 4K5AB 3TWRA 5HKPA 4MN4C 2LXCB 2ETAA 3RGUA 1S70B 2V5QC 4HKZH 5DJTB 3J5QB 4ASWA 2QRXA 1ZW0A 2KIKA 1BI8B 1IHBA 2Y0BG 4QFVA 5EIBE 4ZNCA 3F6QA 4EYYQ 4Z68A 5BXUA 1TR4A 4HQDA 5ITZF 3EHQA 4O60A 4RLYA 3HRAA 5CBNA 2HE0A 1YYHA 4DX2A 5ENQD 3SO8A 3DEPA 5EYPF 4A63B 1YCSB 1YMPA 3TWXA 2B87A 1LT1A 5AQ7A 1OVVA 4YDWA 2ETCA 3PH0A 5CEDB 5CERB 5CBOA 1MX4A 2KI7B 1JM0A 1DEEG 1AWCB 1N0RA 2MYOA 1BLXB 4K3AA 2QVAA 2F37A 1QYMA 4ZFHA 2M0BA 1BDDA 5AQAA 2ZGDA 2F8YA 3HG0D 4HLLA 3W9FA 3UXGA 1DCQA 4CYMD 1EDLA 2DZOA 2RFAA 2R44A 4OAVB 5AAOA 1SW6A 3ZU7B 4G8LA 2B87B 4NPDA 5ENSD 2Q1KA 1BI7B 3DEOA 4YDYA 4NPEA 4HI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZI A;  2SPZ A;  2LXB A;  1DC2 A;  4O1P A;  1BD8 A;  2RFM A;  2KZJ A;  4GOD A;  3EHR A;  5EIL A;  3IXE A;  3D9H A;  4KJM A;  1EDJ A;  3B7B A;  1OT8 A;  3TWV A;  3ZKJ A;  2KS1 B;  3MHV A;  4J8Y A;  4U8Y D;  2XEH A;  1WG0 A;  4HRM B;  5FIN A;  2OTK E;  2XEN A;  3UTM A;  4LG6 A;  3V2X A;  2ZAE B;  5ENO D;  2V4H C;  3W9G A;  4WWI A;  4GOE A;  1OVU A;  2KXP C;  2DVW A;  3ZUV B;  4DX6 D;  3FXD A;  5ENR D;  5ENT D;  1U7M A;  2DWZ A;  5BXO A;  3JUE A;  3ZNG A;  1Y47 A;  4J7W A;  2HR3 A;  5D66 A;  5ENP D;  1MJ0 A;  4UUC A;  1SS1 A;  4HRL A;  2NYJ A;  3ZDM A;  2M5A A;  5HRY A;  4DX7 D;  5KWD A;  4K5B A;  4HB5 A;  5FIO A;  2UWJ E;  1UOH A;  1MX2 A;  3LJN A;  5DJU B;  3T9K A;  4ZHB A;  4F6R D;  1N0Q A;  2A5E A;  2P58 A;  4DX1 A;  2JAB A;  2P2C P;  5CEA A;  2K3R A;  3EU9 A;  2KBX A;  5AQB A;  1U7J A;  3JXI A;  4BXL A;  4DX5 D;  3QWO C;  2XZD G;  2M5A B;  4CPG A;  4HRN A;  1FC2 C;  5KNH D;  2PNN A;  1OVR A;  1H0T A;  2JWD A;  1WDY A;  4NIK A;  4CZ2 D;  3TWU A;  4LNU D;  2DZN A;  2QC9 A;  5KBA A;  4HB1 A;  4K35 A;  3TWT A;  2XZT G;  3B95 A;  1MYO A;  1AP7 A;  2F8X K;  5EN5 D;  1SVX A;  1NFI E;  2FO1 E;  2KUB A;  3KEA A;  4HBD A;  4TUM A;  1D9S A;  1IXV A;  4HJG H;  1BDC A;  2ETB A;  5CEC B;  2WMM A;  1MX6 A;  4O1O A;  5HS0 A;  4JB8 P;  3NOG D;  3Q9N C;  4ATZ D;  1JMB A;  1OY3 D;  4GOF A;  1X0T A;  1H0T B;  3TWS A;  1A5E A;  1Q2N A;  3V2O A;  3J5P A;  4BER A;  4U8V D;  3V31 A;  1EDI A;  2B88 A;  4N5Q A;  5AAR A;  4GPM A;  3V79 K;  5EID A;  4BET A;  3UI2 A;  2BKG A;  1K1B A;  5KNG A;  4JBZ A;  2ZGG A;  1LP1 A;  2B89 A;  3TWQ A;  1S3J A;  3FXE A;  4C48 B;  4B93 B;  1G3N B;  4ASV A;  4ZMD A;  4DUI A;  2RKL A;  2AJA A;  4BES A;  4U96 D;  4BSZ B;  1IKN D;  4HI8 A;  5JA4 D;  3AJI A;  2BKK B;  2Y1L E;  4HNA D;  1EC5 A;  3Q9U C;  4U95 D;  4DRX E;  3V30 A;  4LSZ E;  5JMN D;  1EDK A;  2I8D A;  5K5G B;  5AN8 A;  4NPF X;  3T8K A;  3NOC D;  1LP1 B;  1BU9 A;  2J8S D;  1MFT A;  3C5R A;  2L6B A;  4QQI A;  2LR2 A;  4F1P A;  4K5C A;  3MZW B;  3TWW A;  4OAU C;  2VGE A;  3AAA C;  3S1K A;  1N11 A;  1K1A A;  4G8K A;  5EFW B;  2XEE A;  5C39 A;  1ZXG A;  5AQ9 A;  2QYJ A;  3NBN B;  2B0O E;  4GMR A;  1K3Z D;  4BEP A;  1NVO A;  4IOI H;  3JXJ A;  5EYL A;  4K5A B;  3TWR A;  5HKP A;  4MN4 C;  2LXC B;  2ETA A;  3RGU A;  1S70 B;  2V5Q C;  4HKZ H;  5DJT B;  3J5Q B;  4ASW A;  2QRX A;  1ZW0 A;  2KIK A;  1BI8 B;  1IHB A;  2Y0B G;  4QFV A;  5EIB E;  4ZNC A;  3F6Q A;  4EYY Q;  4Z68 A;  5BXU A;  1TR4 A;  4HQD A;  5ITZ F;  3EHQ A;  4O60 A;  4RLY A;  3HRA A;  5CBN A;  2HE0 A;  1YYH A;  4DX2 A;  5ENQ D;  3SO8 A;  3DEP A;  5EYP F;  4A63 B;  1YCS B;  1YMP A;  3TWX A;  2B87 A;  1LT1 A;  5AQ7 A;  1OVV A;  4YDW A;  2ETC A;  3PH0 A;  5CED B;  5CER B;  5CBO A;  1MX4 A;  2KI7 B;  1JM0 A;  1DEE G;  1AWC B;  1N0R A;  2MYO A;  1BLX B;  4K3A A;  2QVA A;  2F37 A;  1QYM A;  4ZFH A;  2M0B A;  1BDD A;  5AQA A;  2ZGD A;  2F8Y A;  3HG0 D;  4HLL A;  3W9F A;  3UXG A;  1DCQ A;  4CYM D;  1EDL A;  2DZO A;  2RFA A;  2R44 A;  4OAV B;  5AAO A;  1SW6 A;  3ZU7 B;  4G8L A;  2B87 B;  4NPD A;  5ENS D;  2Q1K A;  1BI7 B;  3DEO A;  4YDY A;  4NPE A;  4HI9 A; 
#chains in the Genus database with same CATH topology
 2KZI A;  3ML9 A;  2FI7 A;  2Y3A A;  1LTG C;  3OXF A;  4EZK A;  3SWF A;  1SQP E;  4FP7 A;  2N9B A;  1NTM E;  4JHJ A;  1FZC B;  1HZ4 A;  3MV3 B;  4B8C B;  4DJA A;  5CRV A;  3UKR G;  3CXH I;  2H6G A;  3L70 E;  1LTJ C;  5AW2 B;  3APC A;  3L22 A;  4BFR A;  1ZU2 A;  3UM3 A;  4GZ5 A;  1XNF A;  4U8Y D;  2YNY A;  1WG0 A;  4HRM B;  4EOT A;  5FIN A;  3CK9 A;  1N73 C;  4AYC A;  3G6E P;  3KXD A;  3FUD A;  3H1I D;  2Q9I A;  1MV8 A;  1KZO A;  3RK3 C;  1K05 A;  3Q15 A;  1NA3 A;  3GF7 A;  3G2U A;  3DXM G;  4QMA A;  1L0N D;  3HYM B;  2OEV A;  3H1H D;  3V2P A;  1R8E A;  3I56 P;  2P9L G;  3I3N A;  4GOE A;  2EIM E;  3QAQ A;  5A23 A;  1JCQ A;  1N73 B;  2KXP C;  4LGD E;  3LID A;  3OW2 O;  2DVW A;  3GZ2 A;  3RK3 B;  3ASD A;  2KCL A;  4GTT A;  5KLV K;  2JJL A;  4YDE A;  4WY4 A;  1V54 E;  1U7M A;  2WPV A;  3JSV C;  3P1U A;  2Q3I A;  3GMA A;  5AVV B;  4DI3 A;  1YQ3 C;  4PV1 D;  4XFJ A;  2KXP B;  3B13 A;  3ZIM A;  1N7L A;  5IY5 E;  2WSF J;  1PP9 E;  2H43 A;  3ZNG A;  3WG7 E;  1V55 E;  3P8M C;  1USD A;  1SQX J;  3MA5 A;  2RMZ A;  2LXL A;  3JUI A;  1VDY A;  1SS1 A;  2CPS A;  1HF9 A;  3R4Y A;  2XND H;  3RBZ A;  4HRL A;  4C9B B;  3ZDM A;  1FS0 E;  1UIX A;  2M5A A;  5HRY A;  3B5N A;  1DD4 A;  4EQF A;  4YPC A;  4K5B A;  3QWP A;  3CHO A;  1Q82 Q;  1CSB A;  2UWJ E;  2OTJ P;  1MX2 A;  1UN9 A;  1KYO E;  2Y4U A;  2IF4 A;  1VQN P;  2FYU G;  1URQ D;  2BTD A;  1NTZ G;  5TIS E;  1RY3 A;  3KPE A;  4ZHB A;  2P67 A;  4AM9 A;  1N0Q A;  2FKW B;  2XCB A;  3CX5 D;  2OOE A;  2P58 A;  1NKZ B;  3G9R A;  5J90 A;  2KCV A;  3MV2 B;  1KB9 D;  5BV0 A;  3HDX A;  4WNE A;  2ZYA A;  1B89 A;  4JVS A;  5CEA A;  1L4A D;  4HH2 A;  4IN3 B;  2Y0C A;  1TJC A;  1UN8 A;  2KBX A;  1G2C B;  1QEX A;  5GTI H;  1U2V G;  4CDR A;  3IN6 A;  3JXI A;  4BXL A;  1LTB C;  4FU3 A;  3NZS A;  5BT1 A;  4KMO A;  2OEW A;  2D2C D;  2IBZ I;  2XZD G;  2O1K A;  4GTQ A;  1LNQ A;  2X6F A;  4I7Z C;  3HTK A;  3FH8 A;  1H6K A;  1X22 A;  5AW5 B;  2P9N G;  1TJF A;  4XX5 A;  1AQT A;  3UIO C;  2AXT E;  2ZIS A;  1HVV A;  3L72 G;  1IQR A;  1FDI A;  2OVB A;  2EIN E;  4OYS A;  1RW2 A;  2QC9 A;  3D9O A;  5KBA A;  4I7Z B;  2NPS D;  4K35 A;  3Q75 A;  2FY8 A;  3FWL A;  3QDN A;  4TRQ A;  1MYO A;  2KNC A;  2F8X K;  1MKM A;  5EN5 D;  2FBW C;  3TF5 A;  4DPR A;  1KOR A;  1D9S A;  4GML A;  5GTH E;  3U64 A;  1VQP P;  3CPW O;  2ETB A;  2OV8 A;  1ZV8 A;  5KAI E;  3ONL A;  4KT6 B;  3D9N A;  4O6F A;  4IL6 X;  2WMM A;  3TDK A;  3EQ2 A;  4R4L A;  1N4S A;  3CVW A;  4K0R A;  2ZT9 C;  4JB8 P;  3T8M A;  3E33 A;  4U3F J;  3Q49 B;  4AIF A;  3E4B A;  3HE5 A;  1Z3Y A;  3RRU A;  3L73 J;  2O01 H;  5LP0 A;  4GOF A;  4A3V A;  2QJY C;  3HVE B;  1H0T B;  5FQ6 A;  1A5E A;  1QNF A;  3CCQ P;  2ZT9 B;  3EDT B;  5D0Q D;  5HQ8 A;  3LIE A;  4BER A;  3T97 B;  4D6T E;  1R5S A;  2R3S A;  1LTA C;  1BE3 J;  3AG4 E;  3CWB E;  2QJY B;  3D3M A;  1HX8 A;  2B88 A;  1SQP K;  4GPM A;  1LGH B;  3V79 K;  1NJI Q;  3MIW A;  1NTM K;  2IFU A;  4BET A;  3QNK A;  2BKG A;  4UB8 E;  3TGU J;  1JY3 N;  2YIN A;  3AEG C;  3EJN A;  3ONK A;  4HXI A;  2W90 A;  3V5B A;  3FWN A;  3ML8 A;  2OVF A;  1QBQ A;  4JYC A;  4EZJ A;  1JNM A;  2LAH A;  1T2K C;  3WU2 E;  4PH4 B;  2LKM A;  1ELW A;  1SA4 A;  2AXV A;  2K37 A;  1SQB J;  3AE7 C;  4C48 B;  2HR2 A;  2JEK A;  3ESK A;  3PS6 A;  1G3N B;  1OZH A;  4BWN A;  3WXX A;  3EIQ C;  2XDJ A;  2E5T A;  3CSF A;  3LVQ E;  4DUI A;  1S5L E;  3RU0 A;  2RKL A;  2AEJ A;  2I1K A;  1DH3 A;  3ZVV A;  2IO2 C;  4U7E B;  3AE2 C;  4U96 D;  4GCO A;  4BES A;  3TGO A;  3C9I A;  2NPS A;  5D2M C;  3UUX A;  2KLU A;  3Q5S A;  3IEG A;  2ZXE B;  3M9H A;  1EQ7 A;  2OYO A;  2Y1L E;  4HNA D;  2ZXW E;  2O01 J;  2GA1 A;  2XZR A;  3RBX A;  2Y9Z A;  2LXM A;  3AS5 A;  5AEN A;  1OMI A;  4U95 D;  3TG5 A;  5KLI C;  3RK2 C;  2I8D A;  2GM4 A;  1EF1 C;  2PGD A;  2IQC A;  5AN8 A;  1M8O B;  2Z5I A;  1H2V C;  5J08 A;  2J58 A;  4OGQ D;  2ZYD A;  1NL4 A;  3Q7F A;  3O48 A;  2XPY A;  3DSW A;  2J8S D;  4JZY A;  1SQV E;  2C0M A;  1SQP G;  3RK2 B;  5KLI B;  3RO2 A;  3FGA D;  1NTM G;  3HUS C;  2LR2 A;  4PD4 H;  1T6A A;  3TWW A;  4I6E A;  1BGY J;  4R4M A;  4C7R A;  2VGE A;  1D8D A;  2O1J A;  5CHX A;  3E7K A;  5H2F E;  1N11 A;  5APW A;  3KSQ A;  2HOD B;  3L08 A;  2NC9 A;  1SZA A;  4B0Z A;  2QM8 A;  1IFD A;  2QM7 A;  2ZVN B;  1KQL A;  1OWA A;  3HD7 D;  2VJ8 A;  3HUS B;  1JUQ A;  2G8Y A;  5EFW B;  1P84 H;  2FYN C;  2CHX A;  1LTI C;  5KLV D;  5AQ9 A;  3U4T A;  5LFA A;  2FXP A;  2WXJ A;  3Q2Y A;  5FTP A;  2WXL A;  4YTP C;  4CT0 A;  1ZBP A;  4UQY A;  4RKU J;  4K5A B;  2AW6 A;  3PEU B;  2LSV A;  2FYN B;  3HXD A;  1BPO A;  3L72 D;  1IK7 A;  4HLE A;  5CCM A;  2KP8 A;  2PP6 A;  1J1D C;  1HGZ A;  1X9V A;  3LY9 A;  3V4Q A;  2CK3 H;  1FZF A;  4C7N B;  4HKZ H;  3ISM C;  3LDZ A;  2IX7 C;  3L17 A;  4IUL A;  4ASW A;  3H1I J;  3HE4 A;  1H0A A;  2NRG A;  4H0L D;  2E74 B;  3C1L A;  4N39 A;  1J1D B;  4PS7 A;  1L0N J;  3L74 G;  3C3R A;  4ZKP A;  3H1H J;  4PJ0 H;  3RK3 E;  3CVQ A;  3Q5R A;  2K1A A;  1TR4 A;  4GTS A;  2E43 A;  2BF0 X;  1W5C E;  1AA0 A;  2IO3 C;  1GD2 E;  3HRA A;  2OQQ A;  5B66 H;  4B8A A;  3K9I A;  1N54 A;  3PEV B;  3UIP C;  3IBE A;  1RE3 C;  4R7L A;  1ZME C;  2UWJ G;  3EHM A;  4U0Z A;  1LT1 A;  5KTB A;  4H7Y A;  1TNO A;  2J9Q A;  2X6K A;  3JQ0 A;  4YDW A;  3VYI A;  2ETC A;  3AG1 E;  1X79 B;  3BQO A;  3PH0 A;  4JL0 A;  3FU6 A;  5CED B;  3RRN B;  4N6J A;  5CCG D;  3HD7 A;  1NI1 A;  1H88 A;  5ANR A;  3CXH E;  2ION A;  3FP3 A;  1NU1 E;  2HO1 A;  3M06 A;  1IO4 A;  2XEV A;  2E76 D;  4MRU A;  1HUC A;  1R5L A;  5AVX B;  1FZE A;  4WWN A;  2FYU E;  4PD4 I;  5AQA A;  1EZV I;  1NTZ E;  2ZGD A;  3CGH A;  3G2W A;  4N78 D;  2Y4T A;  4LLH A;  2WB2 A;  2M63 A;  2H6H A;  3HRN A;  2I6H A;  1TNY A;  1YI2 P;  3FU0 A;  4TLF A;  1NA0 A;  1UII A;  3SFE C;  2J08 A;  4HLL A;  3CLQ A;  4GZ3 A;  3UXG A;  1JCC A;  2KS1 A;  2WSE H;  1DCQ A;  2DIW A;  3PRZ A;  5AJL A;  3RKV A;  2CHZ A;  1P84 I;  2R44 A;  2G3A A;  1VQ7 P;  5KJ7 D;  1SW6 A;  2FF4 A;  4G8L A;  4BRY A;  2XGO A;  3PRJ A;  2A45 G;  1AV1 A;  3AE6 C;  1BI7 B;  3KEZ A;  4CEM A;  4OVN F;  2IFM A;  2K88 A;  2WXR A;  5BNW A;  4YDY A;  3GZ1 A;  3VP8 A;  5B5E H;  3Q5P A;  1ZB1 A;  5T4Y A;  3IHV A;  1VQK P;  5CRU A;  3MGN A;  5KJK A;  3LYA A;  3L13 A;  2IJG X;  1KFN A;  2K9Y A;  2KC7 A;  3II6 A;  3S7B A;  4LEU A;  3V2R A;  2XRY A;  1T3U A;  2WXF A;  1SQP D;  1CW5 A;  1BD8 A;  2A5U A;  2MKV A;  3D70 A;  2XPZ A;  3CQG B;  3UM0 A;  1NTM D;  3VLF A;  5APV A;  2JDI H;  1RE4 C;  1TNU A;  2LUH A;  4JF7 A;  3D9H A;  3PE4 A;  1N7S D;  5APY A;  5B1B E;  3RK6 A;  1HS6 A;  3L70 D;  5AJD A;  2GRP B;  4EPZ A;  2BCC E;  3ASO E;  3MHV A;  4J8Y A;  2WXI A;  4UWH A;  3T5V A;  2YKQ A;  3L9T A;  3NF1 A;  1OIP A;  3TNU A;  1Q81 Q;  4EIJ A;  1IJD B;  4WUY A;  3P8C D;  4A7P A;  2XEN A;  2MOW A;  3Q78 A;  3L35 A;  1PV3 A;  3FUJ A;  4F3V A;  2OND A;  4ILG A;  4D6T G;  1VQ8 P;  5CCG A;  3CWB G;  4GCN A;  4ILI A;  1SQV K;  1EZV G;  1W2B O;  3MYV A;  2V4H C;  2R05 A;  2XS1 A;  1ELK A;  4AXH A;  4WWI A;  3CCJ P;  4DLQ A;  1KQF B;  3IKO B;  1TEZ A;  1GL2 D;  3M0D C;  3PVL A;  3LPZ A;  2DYS E;  4PV1 C;  4L9P A;  3S7F A;  1EPU A;  1RQV A;  4PS8 A;  2JR8 A;  3L6A A;  1PIX A;  3IV0 A;  4FA6 A;  3FXD A;  1KQS O;  1MZC A;  4GT1 A;  3CL3 D;  1UW4 B;  3CVN A;  1M1J A;  1RHZ B;  2R3C A;  3ZFW A;  2YXR B;  1NAF A;  5BXO A;  4PV1 B;  3NQP A;  4IL6 H;  4ILH B;  3SWK A;  5APQ A;  1Y47 A;  3APD A;  3UPV A;  5KJ7 A;  2HR3 A;  1YJ9 P;  1TNB A;  1CI6 A;  1VQ9 P;  4G25 A;  2IBZ E;  3CCM P;  1PP9 D;  5ENP D;  5CCH C;  5AVS B;  5E75 A;  2KSJ A;  1M90 Q;  3O4Z A;  4IFD K;  2NYJ A;  1URQ C;  2XGM A;  5KWD A;  3UT8 A;  4N5C A;  4HB5 A;  2IDB A;  3ZXS A;  1WMK A;  1UOH A;  2R5D A;  1VQ6 P;  1WY6 A;  2KAT A;  4XZ4 A;  2FFD C;  1KV4 A;  1YA0 A;  2W6A A;  1ZRT E;  3FUI A;  1URQ B;  2W6B A;  2VSY A;  1KYO D;  1FCH A;  4F6R D;  3U59 A;  3JCU H;  4A3T A;  1GK4 A;  2J4D A;  4L23 A;  3H1K E;  1L4A C;  4WY4 D;  2I9C A;  3FTW A;  1M7L A;  1N7S A;  3FFL A;  3GLM A;  2WPS A;  2FFD B;  5CJ0 A;  1FDM A;  4AV7 A;  3FH5 A;  3ZYQ A;  2D2C C;  4M3L A;  2JAB A;  4GTP A;  3KDP B;  4MLP A;  3SHF A;  2P2C P;  3BUA A;  3A3Y B;  1L4A B;  4AY5 A;  1N4R A;  4J6I A;  3D9L A;  1NH4 A;  1KD1 Q;  3CIA A;  5H7P A;  3B5N D;  1Z6T A;  4HRN A;  2D2C B;  1K8A Q;  4WBA A;  4FHK A;  5KNH D;  1GL2 A;  2NPS C;  1LTX A;  1GK6 A;  1HBW A;  1U57 A;  3FTS A;  3H1J G;  2XU6 A;  3DSS A;  5C1D A;  2E2E A;  2WSF H;  1YYC A;  2JWD A;  1WDY A;  2ZJS E;  2OYH A;  4NIK A;  4CZ2 D;  3CVP A;  4UI9 K;  1S5L X;  2FBN A;  3OAK A;  1QL1 A;  2IOL A;  2N1T D;  2R03 A;  2L5G B;  3AU5 A;  2OTL P;  2XZT G;  3B95 A;  1NU1 K;  3EFG A;  2PM6 A;  5EX0 A;  2ZIR A;  2X38 A;  5KLV J;  3OTN A;  2R2L A;  1SVX A;  3CHQ A;  2XV5 A;  3LY7 A;  1Q7Y Q;  4TV3 A;  3VMY A;  1U3D A;  2L0T B;  2KUB A;  4XKB A;  1IFJ A;  3OAW A;  5JJT A;  2WTY A;  1IXV A;  4YXW H;  2FYU K;  1BDC A;  2F0Y A;  1NTZ K;  3KS2 A;  3ZPJ A;  1JTH B;  5AVR B;  1KQG B;  1LTJ B;  2QE7 H;  3L75 G;  5CEC B;  4GDO A;  2H6F A;  3TXN A;  3IR9 A;  2RH0 A;  4DJG A;  1RF1 C;  2A06 G;  1MX6 A;  2J07 A;  4O1O A;  3ZHE B;  1LWU A;  3L72 J;  4JEU A;  4U3F E;  3NOG D;  3Q9N C;  1EDU A;  4ATZ D;  3AE1 C;  2KZT A;  2WT7 A;  3CME P;  4AJW A;  3NTN A;  5GTI E;  4K03 A;  5BU8 B;  1RF1 B;  4WND A;  5APU A;  2K9J A;  4GTO A;  2ZVO B;  3A0B H;  3OJA B;  5BV1 A;  3J5P A;  3E32 A;  1VDF A;  3ENE A;  3GHG C;  1NKN A;  3L74 E;  3UIN C;  4N2S A;  2YHE A;  1GDT A;  2DBA A;  4N5Q A;  4XI0 A;  4D6T D;  5EID A;  1FJP A;  3CWB D;  3D9M A;  2H6I A;  3UI2 A;  2LO6 A;  1VQ5 P;  1D7M A;  3E37 A;  2OYI C;  2YNQ A;  4XIF A;  3Q4A B;  5AYW D;  4CGV A;  2ZGG A;  3GHG B;  4APO A;  1FBM A;  3KZI H;  1LP1 A;  2GUV A;  1GU4 A;  1S3J A;  2E75 D;  1QVG O;  3CEQ A;  3BCC G;  1NU1 G;  4H13 D;  1JY2 N;  3M91 A;  3E1R A;  1H2T C;  2OYI B;  4ANX A;  3NFQ A;  4ASV A;  3RIB A;  3AE4 C;  3A0H H;  4B89 A;  1SFC A;  3B7S A;  2WMO A;  4FJY A;  3BG1 B;  1OFC X;  3Q3D A;  5G04 J;  4BTA A;  2N1T A;  5KJN A;  4HI8 A;  4KXK B;  3CCR P;  3AJI A;  2BKK B;  4I2Z A;  2O3J A;  3VTP C;  2FXO A;  1EC5 A;  2GRO B;  1HTL C;  5G05 J;  1PGO A;  2UY1 A;  3SGH A;  3UM2 A;  3DST A;  4W9R A;  4OGQ C;  3MUD C;  3V30 A;  3BG0 B;  3LY8 A;  3VMA A;  3FUH A;  5EKQ D;  1KZU B;  3FTZ A;  1EDK A;  1NOH A;  4JA9 A;  4AY6 A;  4RJT A;  3D9P A;  1IK9 A;  2P2U A;  3LKU A;  4WNG A;  5CHE E;  5CMY A;  1PL5 A;  2MRI A;  2IEJ A;  2XPI A;  2AXC A;  3T8K A;  3SBS A;  1LT9 C;  4AVX A;  2OAR A;  4J8E A;  4OGQ B;  1MQS A;  2WXG A;  1BU9 A;  1FVH A;  1MFT A;  1A02 J;  2W8Z A;  1H8A A;  4GYW A;  4GZC A;  1SQV D;  3P32 A;  3FU3 A;  3G2S A;  1LT9 B;  5FZQ A;  3K5B A;  2R17 C;  3S1K A;  2R32 A;  4UB6 H;  3ZRH A;  3M0A A;  3GYZ A;  2WSC J;  2AXU A;  3B7R L;  4G8K A;  3UM1 A;  2OCC E;  4L2Y A;  3B71 A;  2IOS A;  2BCC G;  3JQ1 A;  2M3B A;  3VLD A;  1SQQ E;  2P9K G;  3CVU A;  2QYJ A;  4Z1M H;  4URK A;  4BEP A;  3AEC C;  1SQP J;  3NZU A;  5KAF H;  3IAO A;  1QGK B;  3P7K A;  4GAA A;  2L9B A;  4EEC A;  3TWR A;  3S9O A;  5T8I A;  2WQ6 A;  3NB2 A;  3L70 J;  3SF4 A;  4FC8 A;  4H0L C;  3CI9 A;  3CC2 P;  3JCK C;  2PQN A;  4L75 A;  1VF5 D;  2P9I G;  3ASF A;  4OH8 B;  5DJT B;  2KCK A;  3J5Q B;  3R7Q A;  3VP9 A;  2QRX A;  1ZW0 A;  1NHL A;  2J49 A;  1S2E A;  1FJK A;  3AE9 C;  1BI8 B;  3H1H E;  4H0L B;  2V8S E;  4QFV A;  3QH9 A;  2AEF A;  1IFN A;  4PD4 E;  3FTU A;  2RN0 A;  1EZV E;  5CCL A;  3LS8 A;  4KVM A;  1SQX G;  1SLQ A;  1E7U A;  3BEE A;  3MJW A;  4HQD A;  1YJW P;  1KT1 A;  2IBZ G;  3CCL P;  3A5T A;  5ITZ F;  3RK3 D;  1IFI A;  4CDN A;  1U3C A;  3V2N A;  5B3S E;  1KLX A;  3FHE A;  1RF0 A;  1S72 P;  3ZYL A;  1YYH A;  2WIT A;  1OCC E;  2VSN A;  1P84 E;  1QL2 A;  1IHG A;  4MBG A;  3UKU G;  4DX2 A;  1HJ0 A;  3PHL A;  1KIL C;  2NSZ A;  3PE3 A;  3SO8 A;  3ZXP A;  1X8Y A;  2M3E A;  3G2T A;  3I4R B;  5G04 C;  2PZI A;  1YMP A;  1PP9 J;  1PPJ E;  5CCG C;  3FX0 A;  1ELR A;  4G24 A;  5AQ7 A;  1KIL B;  1T3J A;  5FQ7 A;  3FUM A;  4GYY A;  5G05 C;  1LD8 A;  3H1K G;  2V7Q J;  1YQ4 C;  4E6H A;  1HFA A;  4WVZ A;  4EDF A;  4JA7 A;  4H44 D;  3VTX A;  1DEE G;  3L16 A;  3IHY A;  5ARG A;  4KBQ A;  1G1I A;  1OX3 A;  2HYZ A;  3ABM E;  1QYM A;  1FZC A;  2RG8 A;  1FOS F;  2WXH A;  1M1J C;  1YIJ P;  1KTM A;  3TSI A;  4C0M A;  1TYQ G;  2DW3 A;  2ZFC A;  3CXH D;  3O6Q B;  2WPQ A;  4W80 A;  3TL5 A;  3H1L J;  5A7D B;  4PJ0 E;  2Y0D A;  2B9B A;  1NTK E;  4AP2 A;  2FYU D;  3URZ A;  1NTZ D;  4BX9 A;  1M1J B;  2YKO A;  4CYM D;  2R5B A;  3E1I A;  1WT6 A;  1OXZ A;  5B66 E;  1HG2 A;  3CD6 P;  3PZD A;  4OAV B;  3ZU7 B;  3U1A A;  3TAX A;  2LNI A;  4GTV A;  2B87 B;  3FTY A;  1E96 B;  2L6J A;  1BCC E;  1FDO A;  3MCX A;  5JHA A;  1HU3 A;  1VPC A;  5ENS D;  3D9K A;  3DEO A;  1IZN B;  3RL0 g;  4I17 A;  3DBS A;  3R7R A;  4FLB A;  2FEZ A;  3M9Q A;  1DIP A;  3H25 A;  4APF A;  4BSX A;  5KJM A;  2WXO A;  1N73 A;  1GW4 A;  2SPZ A;  4JD2 G;  3MKQ A;  3WUU A;  4UWG A;  3DWL G;  2IPP A;  3H1J E;  2Q7C A;  1JY3 O;  1DC2 A;  1AQ5 A;  4BX8 A;  2EIJ E;  1BSH A;  4TXP A;  3SFD C;  1QVF O;  2KZJ A;  4M7C A;  4GOD A;  4U3F G;  3AEF C;  2PAJ A;  1L0L E;  3EFF K;  2XGS A;  3CCE P;  3IXE A;  2V0P A;  5AW7 B;  4L76 A;  3B7B A;  3LCA A;  3TWV A;  4HS2 A;  3H32 A;  3U66 A;  3VMX A;  4D10 C;  2XEH A;  1FT2 A;  3L71 E;  2IZ1 A;  1NGM B;  2BCC D;  2OTK E;  4WNF A;  3FDH A;  4LG6 A;  3V2X A;  3L75 E;  1OWN A;  4LUN U;  1DVP A;  2ZAE B;  2A06 E;  4RSY A;  4N3A A;  1N4P A;  3CX5 H;  3FTV A;  2YO2 A;  4JHR A;  3W9G A;  1KFM A;  3SY2 A;  2PL2 A;  1J2J B;  4W7Z A;  4NQ0 A;  1OVU A;  2QJP C;  3KHU A;  2CHW A;  3AE5 C;  1KB9 H;  3V4W A;  3I4G A;  4GA0 A;  5B5E E;  1IYG A;  4GTM A;  5ENR D;  3MP7 B;  5ENT D;  2X6J A;  3AS4 A;  4I2L C;  1H6O A;  2DWZ A;  3UQ3 A;  2QJP B;  3ASH A;  2IYP A;  1K04 A;  3PNT B;  3JUE A;  1SQQ K;  4D6T J;  3T5X A;  3CWB J;  2YMY A;  2QSI A;  1HG5 A;  1LF8 A;  1M57 D;  3TK1 A;  2J5U A;  1G2C A;  2YMK A;  4UUC A;  4RO0 A;  3RO3 A;  2IBZ D;  4J0U A;  4Y99 C;  1E7V A;  1FOS E;  2YO3 A;  2L91 A;  4DX7 D;  3LW5 J;  5APT A;  1FZA A;  4LRZ A;  4M3O A;  3W68 A;  3BCC E;  1Z3X A;  3B7T A;  3H6P A;  1Q2Z A;  3EU5 A;  5FIO A;  1YTZ I;  4WY4 C;  1E8W A;  3LJN A;  4Y99 B;  1AFO A;  3HXE A;  3FH7 A;  3T9K A;  3ZYM A;  3GF3 A;  2KYV A;  1KN7 A;  3RL0 D;  2EIK E;  2A5E A;  1ZRT D;  1ZP0 C;  1OUV A;  4WY4 B;  3SFX A;  4U7J A;  2WPV B;  2HPC A;  3ZN3 A;  5FQ4 A;  4DX1 A;  3H1K D;  5KJL A;  1BGY G;  1TU3 F;  4HYT B;  3GZS A;  4XKC A;  4B86 A;  4CT4 A;  3B5N C;  2ITA A;  2K3R A;  3EU9 A;  5AQB A;  4IL6 E;  1N9A A;  3ZYK A;  4G2V A;  5JJ7 A;  3D9J A;  4G26 A;  4DX5 D;  1FZG A;  1E8Y A;  4EI2 A;  3QWO C;  2M5A B;  4CPG A;  4RG6 A;  3B5N B;  1SQQ G;  1OWO A;  2H89 C;  2WWW A;  1H0T A;  3MX3 A;  4ME2 A;  5EX3 A;  4IRU A;  1SQV J;  5AVU B;  2HLO A;  2XQ0 A;  3EWK A;  5E79 H;  4LC1 A;  4Y6W A;  1KT0 A;  3TWU A;  2P58 C;  1S9K E;  2DZN A;  2WXK A;  2VGY A;  3MGB A;  4FUL A;  1FT1 A;  3T97 A;  2C9L Y;  5T3R A;  2JEE A;  1GZL A;  4KHX A;  4PUC A;  4I1L A;  4I6G A;  2BAS A;  4LCT A;  1ZOY C;  3D9I A;  3CX5 I;  2GUS A;  5CJ4 A;  3PNL B;  1SP4 A;  1TN6 A;  3D6Y A;  2C0L A;  2VTB A;  3JCU E;  3BU8 A;  4HBD A;  4TUM A;  3UT4 A;  3PUJ A;  4HJG H;  1KB9 I;  3MZL B;  3H1H G;  1NTK K;  1PZQ A;  5HS0 A;  2XCC A;  2FYZ A;  2P7J A;  1GW3 A;  4GPK A;  2R5S A;  4DI4 A;  3AG3 E;  3RJV A;  1S64 A;  3SSU A;  3ASG A;  3HTK B;  1OY3 D;  4CCA A;  3LJ3 A;  1X0T A;  3FTX A;  2WZ7 A;  4B94 A;  1OWM A;  1K9M Q;  4I6J A;  3ZGQ A;  3TWS A;  2IZ0 A;  3FUE A;  4BT8 A;  2E74 D;  3DPD A;  4I1M A;  3UT7 A;  3V2O A;  3U9W A;  2NZ2 A;  4I1O B;  2CPB A;  4WWP A;  3PZ2 A;  4U04 A;  3BRT B;  3U1C A;  3QWW A;  4AEZ C;  3G71 P;  4YXD C;  2KNC B;  1PPJ G;  1X5B A;  2E75 C;  1SQX E;  3L74 D;  3GW6 A;  4FLH A;  1S1C X;  1JO5 A;  2VSX E;  3AU4 A;  5KNG A;  2KB7 P;  1NYH A;  4H13 C;  1Y8A A;  3G2V A;  3APF A;  3BAT A;  1L0L K;  4DT0 A;  3TYY A;  3EHN A;  4GZD A;  3OXL A;  3TWQ A;  1WM5 A;  5D0O D;  1A17 A;  3TXM A;  4EHM A;  3FXE A;  3UX4 A;  1MFZ A;  4Q96 A;  4I9E A;  4O9B A;  3FU5 A;  1KIL E;  4B93 B;  4GA1 A;  4H13 B;  1N94 A;  5FQ8 A;  3HXB A;  3HE5 B;  4ZMD A;  4WWO A;  1H6P A;  2AJA A;  1OWL A;  5M1B A;  1JUN A;  3OA7 A;  4RVB A;  3R9A B;  5G55 A;  3CK7 A;  3CC7 P;  4I2W A;  2HOD A;  5BPP A;  1NTK G;  2P1J A;  4UI9 J;  5JA4 D;  1WRG A;  2V4L A;  5G2N A;  1DD3 A;  4FHJ A;  3HUS A;  3MD0 A;  3FWV A;  5LCW J;  2WM9 A;  3O8Z A;  2PM7 A;  3FUL A;  3A0B E;  3FUK A;  5LOZ A;  4LNB A;  4DRX E;  5KKZ C;  4XI9 A;  1BCC G;  5JMN D;  1E8Z A;  3S2A A;  1XGW A;  3CMA P;  5K5G B;  3C98 A;  1Y8M A;  1LTS C;  2FYU J;  1NTZ J;  3NOC D;  4C46 A;  3ABL E;  3PDN A;  5KKZ B;  2VQ2 A;  4E85 A;  1KPS B;  2C0W A;  5FZS A;  4C7N A;  2KLV A;  2XS8 A;  2J59 M;  2L6B A;  3CHP A;  3KZI E;  4Y28 J;  3D71 A;  3AE8 C;  1SA5 A;  4EBA G;  3CVX A;  3V2Q A;  2KOG A;  5JJ6 A;  1QZ2 A;  4OAU C;  1SFC D;  1L0L G;  5AVQ B;  1K1A A;  1EYH A;  2NPS B;  4NUR A;  3PP5 A;  2WXQ A;  2WMN A;  3FUF A;  3A0H E;  2Q7F A;  1YJN P;  4TXQ A;  3N71 A;  1INZ A;  2XEE A;  2CG2 A;  1ZXG A;  2QIW A;  1Z56 A;  3L71 G;  2B0O E;  1K3Z D;  3AEA C;  2EQX A;  1NVO A;  1SQQ D;  2XNX A;  1VF5 C;  5KCM A;  3JXJ A;  5EYL A;  1VQM P;  4JYB A;  4OVU A;  3QAR A;  5HKP A;  4WB4 A;  3JC2 2;  2JO1 A;  4U8H A;  3L73 E;  4CDM A;  4U07 A;  4XEI G;  2PQR A;  4A1S A;  2PFX A;  1SQM A;  2WVI A;  4UQX A;  2ZU6 B;  3P8C E;  1VF5 B;  5AW9 B;  3CHR A;  3RAU A;  2BCC J;  3G4S P;  2YKP A;  3MKR A;  1RE3 A;  4ABN A;  2KIK A;  3L82 A;  2Y0B G;  4DLO A;  1BE3 E;  3R2P A;  1NP7 A;  2O01 N;  4ZNC A;  3NAW A;  5TJH A;  3JYS A;  4L1B A;  4N3B A;  2XRZ A;  5AVZ B;  3V6I A;  3S4R A;  3CCV P;  3TGU E;  4UB6 E;  4PD4 D;  3VN0 A;  3MKQ B;  3GG2 A;  1EZV D;  3Q47 B;  2WQH A;  1KC8 Q;  3HIZ A;  2I1J A;  4ANW A;  1JEK A;  3CST A;  2J09 A;  4X8Q A;  3C3O A;  3CLJ A;  1E8X A;  1Y6I A;  4JXT A;  4YND A;  1SQB E;  2YHC A;  3DEP A;  5EYP F;  3KYQ A;  4UWF A;  1PGQ A;  1P84 D;  2WSC H;  2X3M A;  2VSO E;  3FY4 A;  1D8E A;  4A63 B;  1YBK A;  5KAF E;  1QLE D;  3AED C;  3SQV A;  4UI9 C;  1ZN5 A;  1N8R Q;  1OXJ A;  4H44 C;  2VYI A;  3H32 B;  2IYO A;  3KD7 A;  5LCW C;  2Y0E A;  1OVV A;  1DX7 A;  2LAI A;  3B8E B;  1XTC C;  3Q5M A;  1PPJ D;  3B4S A;  2LSU A;  4TT3 H;  3HE4 B;  1RH5 B;  4GMJ A;  2L0I A;  1IC2 A;  1JCD A;  1HO8 A;  5CER B;  5CBO A;  1K8K G;  1JM0 A;  4GIF A;  1OW7 A;  4H44 B;  4W7Y A;  1N0R A;  2MYO A;  5FJY A;  4I6M C;  5CCH D;  4JC8 A;  3SZ7 A;  3I5C A;  4G1T A;  2KSE A;  3H1L E;  4KYO B;  3QJZ A;  5A6C A;  1BDD A;  1FZB A;  4RG9 A;  4ACK A;  1GU5 A;  4ANV A;  1AVY A;  2P9P G;  4HOT A;  1Q90 D;  3F5H A;  2C2L A;  3USS A;  4J8S A;  5E76 A;  4I9C A;  2BED A;  3W9F A;  4ACL A;  3H1K J;  1W3B A;  1MHQ A;  1NTK D;  1SQX K;  2DZO A;  3PH0 C;  2RFA A;  1FAV A;  3SD5 A;  1BGY E;  2KM4 A;  1RE4 A;  2E5Y A;  4HOR A;  3PTZ A;  3HD7 C;  1HXI A;  2WXP A;  1O1S A;  4FJZ A;  3BVH A;  2Q1K A;  1Q86 Q;  1RZ4 A;  3CK8 A;  4RES B;  1JCR A;  2N9Y B;  3QWV A;  1BCC D;  5KLV G;  4NPE A;  3CCU P;  3NMD A;  2NXP A;  5AW0 B;  4HI9 A;  4HOQ A;  1EXI A;  3CKB A;  3E30 A;  3HD7 B;  4IFF A;  1NAY A;  1GTW A;  1E5W A;  2LXB A;  2V4H A;  2WPR A;  4O1P A;  4ANU A;  1NTM J;  1MUU A;  5ANL A;  2RFM A;  3H1J D;  2V5F A;  3ABV C;  3L4F A;  3M0D A;  3EHR A;  5EIL A;  4J8D A;  1LTT C;  2VGX A;  3TG4 A;  4DCK A;  1DCE A;  4KJM A;  3CCS P;  1JY2 P;  1QX8 A;  2V7Q H;  1EDJ A;  4UWK A;  1UJJ A;  1JY2 O;  1L0L D;  1OT8 A;  4MKT A;  3A2A A;  2HPC B;  3ZKJ A;  3ULE G;  2KS1 B;  2GGF A;  4N3C A;  3N4X A;  2YQ8 A;  3H1I E;  2CFZ A;  3L37 A;  4G11 A;  4AQR D;  1JCS A;  4BRY B;  4IYP A;  1PAQ A;  3UTM A;  1L0N E;  1KYO H;  3L71 D;  1DEB A;  4PS3 A;  5ENO D;  1E79 H;  4NAC A;  5TIS H;  3E34 A;  3L75 D;  5CCH A;  4CRW A;  2W27 A;  3R9M A;  1KMI Z;  1L5J A;  1P5Q A;  2A06 D;  4YVQ C;  3WUT A;  2H7H A;  4TXR A;  4A55 A;  4F53 A;  2Y9Y A;  1URQ A;  4J8F A;  2Q5U A;  1S0P A;  3AEE C;  3ZUV B;  1EXJ A;  4DX6 D;  4LER A;  1OW6 A;  1ZR4 A;  1TN7 A;  3HXF A;  2FUL A;  3AEB C;  3Q79 A;  2FFD A;  3QK0 A;  4JEH A;  2VRS A;  2QYU A;  4P29 A;  4F7A A;  4J7W A;  3L74 J;  1GMJ A;  3ASN E;  3ESL A;  1L4A A;  4HOS A;  3F89 A;  5D66 A;  2VTB B;  1MJ0 A;  1NZN A;  2WQY C;  1ZLL A;  4N2Q A;  3TNU B;  1LJ2 A;  1YTZ T;  2XHE A;  2E76 C;  2AXT H;  4DZO A;  2WXN A;  3RL0 C;  2A45 H;  2AVP A;  5AVY B;  2AXZ A;  1USE A;  3FEX A;  3BCC D;  5DJU B;  3U3W A;  3DSV A;  2JWA A;  2E76 B;  1NU1 D;  1K73 Q;  1H89 A;  2GRL A;  1M56 D;  3CX5 E;  2QFC A;  3OXG A;  4EBA A;  4YVO A;  5KJ7 C;  1UJK A;  3RL0 B;  3ULY A;  1PGP A;  5GTH H;  3SBT B;  5KAI H;  1KB9 E;  4L7T A;  4U0S A;  4U0U A;  4KT0 J;  3CR3 A;  2HG5 D;  2POH A;  3B7U X;  5CMW A;  3UIA A;  2MJZ A;  1H2U A;  4BT9 A;  1N4Q A;  3BRV B;  1JTH A;  1NO4 A;  1LTJ A;  1N52 A;  1CI6 B;  1IFP A;  2QA4 P;  1PFI A;  5ARF A;  3PRE A;  1SQB K;  4HFG A;  3ZHE A;  2GRN B;  2XKM A;  4ATG A;  4OWF A;  1U7J A;  4GYO A;  5BVZ A;  1O1R A;  1FC2 C;  3L36 A;  2PNN A;  1OVR A;  2MHK A;  2RD0 A;  1RF1 A;  1E90 A;  1JY3 P;  1N7S C;  3LXU X;  1VQO P;  3GW4 A;  4FAD A;  4LNU D;  3VLE A;  5AW1 B;  2Z4E A;  4F1S A;  3L70 G;  3C8V A;  4HB1 A;  4UB8 H;  2R59 A;  3A7O A;  3L73 G;  1KYO I;  3TWT A;  1S9K D;  1OWP A;  1AP7 A;  3DXK G;  3LW5 H;  3LEW A;  1N7S B;  3C3Q A;  1NFI E;  4TUU A;  3M9B A;  3DPY A;  4HVB A;  3I5P A;  1VQL P;  2FO1 E;  4UQZ A;  2J4B A;  3WU2 H;  4L2L A;  3WMM 0;  2DYR E;  3KEA A;  3VMZ A;  1SQQ J;  2OGU A;  3GHG A;  5AW3 B;  1HF8 A;  3PJS K;  1GL2 C;  1BE3 G;  1ZR2 A;  1YIT P;  3WUV A;  3MEK A;  4EZL A;  1S5L H;  2OYH C;  3CKC A;  2E74 C;  3KQG A;  2GRQ B;  2OYI A;  4JW1 A;  2C9N Y;  5B1A E;  1JWG A;  3TGU G;  3NXS A;  2BEQ D;  1JMB A;  2R02 A;  1SVF A;  1L2P A;  1GL2 B;  2CFU A;  2ZYG A;  5AVT B;  3DSU A;  2YIU C;  2OYH B;  2ZT9 D;  3P2B A;  4WAF A;  1Q2N A;  3PZ1 A;  1HH8 A;  1N2D C;  1SQB G;  4L74 A;  2WSS H;  1AJY A;  2A4Z A;  1FE6 A;  5FT9 A;  1OCO E;  2WQ7 A;  3S7D A;  3RRM B;  4U8V D;  5E79 E;  3ZEF A;  1PP9 G;  3V31 A;  4Q94 A;  1EDI A;  5AAR A;  3AS8 A;  4A1G A;  2A45 I;  3X2Q E;  2YIU B;  1LWU C;  4NRH B;  2HFE D;  1DNP A;  2CG3 A;  1K1B A;  5AW4 B;  4JBZ A;  1FU1 A;  1TNZ A;  3HXC A;  1GW6 A;  1SQX D;  2JKV A;  5ENN A;  3ITK A;  2B89 A;  2X6H A;  3EUV A;  3MUD A;  2C0X A;  1JB0 J;  1LWU B;  4XE0 A;  4GKG A;  1LD7 A;  5H2F H;  3H1L G;  2KZT B;  2WT7 B;  2H88 C;  2QEX P;  4YDO A;  4Q69 A;  2GRR B;  1LT9 A;  1KIL D;  3CVY A;  1T2K D;  1L0N K;  2P9U G;  1BSN A;  3BAS A;  4BTB A;  4BSZ B;  2K9J B;  2I2O A;  1IKN D;  4AOF A;  1JWF A;  2HYN A;  3CHS A;  3KAE A;  1M1K Q;  1UG3 A;  2HM8 A;  3Q7A A;  4KZ0 A;  5EDS A;  5AVW B;  3Q9U C;  1OCR E;  2IY0 C;  3QB2 A;  1JMM A;  4LSZ E;  3QOU A;  3D6Z A;  1FPP A;  2M8R A;  2WXM A;  3L54 A;  1IFM A;  5DIZ A;  1S4X A;  3W67 A;  4Y6C A;  4L73 A;  5FZR A;  4NPF X;  1WAO 1;  1JPL A;  1H19 A;  5BW8 C;  3VTY A;  3EIJ A;  5BUZ A;  1VQ4 P;  1LP1 B;  4GZ6 A;  1SFC C;  2DCP A;  1NTK J;  4XA4 A;  2N1T C;  4N3Y B;  3RK2 D;  3HVE A;  1HWT C;  3C5R A;  2BUG A;  1YHQ P;  2H8P D;  4QQI A;  1QQE A;  4GU5 A;  4F1P A;  4K5C A;  3MZW B;  2E0I A;  5AW6 B;  1A02 F;  5C2Y A;  2QG4 A;  4JPZ B;  5AW8 B;  3AAA C;  3CHM A;  1O1T A;  5BU5 A;  2QZA A;  1BCC J;  1SFC B;  4BY6 A;  3CVV A;  3PZ3 A;  3LVR E;  2N1T B;  5KLV E;  3Q73 A;  2Q3E A;  5C39 A;  3H1I G;  1S63 A;  2UY1 B;  4UWL A;  3NBN B;  4GMR A;  2JLB A;  3RSE G;  2BEZ F;  1L0N G;  4IOI H;  3H1J J;  1HE8 A;  3L72 E;  4JPS A;  3SFY A;  1RQU A;  2Q6Q A;  1J1E C;  3SI5 A;  3S7J A;  3ABK E;  4MN4 C;  2QJK C;  2LXC B;  1L0L J;  3PLN A;  4U3F D;  2ETA A;  1Z5S C;  3RGU A;  2FXM A;  3MTU E;  3CVL A;  1S70 B;  3L73 D;  2V5Q C;  1KIL A;  4G23 A;  3SWY A;  1IQU A;  3CC4 P;  3ULQ A;  4I1A A;  4GTR A;  3CXH H;  1J1E B;  4IFM A;  3CQC B;  3L71 J;  2GRM A;  2QJK B;  1IHB A;  5EIB E;  4AUW A;  2WSE J;  2PRR A;  3L75 J;  1HGV A;  3F6Q A;  3TJP A;  1XTG B;  1G1J A;  1N86 A;  3I55 P;  2EIL E;  4EYY Q;  1BE3 D;  1HH0 A;  3Q1M A;  4Z68 A;  5BXU A;  2X6I A;  3O6Q A;  2YXQ B;  3EHQ A;  4O60 A;  4RLY A;  1JOC A;  2ZXX A;  3TGU D;  5CBN A;  2HE0 A;  2W83 C;  1OCZ E;  4KVO A;  5ENQ D;  1OW8 A;  2P10 A;  4CGW A;  1TN8 A;  2E75 B;  5HI7 A;  3G3Z A;  4JQ0 D;  2VGX B;  1SQB D;  1VL2 A;  2IFN A;  1YCS B;  3HHM A;  2JP3 A;  1FVF A;  2B6C A;  1PGJ A;  3KSL A;  3TWX A;  2B87 A;  2KK7 A;  1X81 A;  2WVR A;  3DRA A;  1PC2 A;  3VOP A;  2IU1 A;  2P9S G;  2GW1 A;  5M72 A;  3QC1 A;  5DBK A;  1O5M A;  1PY1 A;  3PZ4 A;  4DK5 A;  1CZQ A;  1MX4 A;  2KI7 B;  1RF0 C;  3C72 A;  4GB9 A;  1AWC B;  3FUN A;  4LNG A;  4C0E A;  1BLX B;  4K3A A;  2QVA A;  4DOJ A;  5FWQ A;  3CV0 A;  2F37 A;  3BCC J;  5AIJ A;  4OVV A;  4ZFH A;  1HJB A;  2M0B A;  3AE3 C;  4N78 E;  1MZ9 A;  1NU1 J;  2QY7 A;  4U63 A;  5APX A;  3ZW3 A;  4PDX A;  4V3I A;  1W2E A;  3UMV A;  3H1L D;  2AEM A;  3AG2 E;  2RKK A;  4RQI A;  2E42 A;  1SZ9 A;  1KZP A;  4GA2 A;  1SQV G;  2F8Y A;  2Y69 E;  1AVO A;  1Y9B A;  3N7N A;  3HG0 D;  3QKY A;  5L8R J;  4JHK A;  4MS6 A;  1N95 A;  1EDL A;  2W6J H;  3PUK A;  4XE5 B;  4H7X A;  4HOU A;  5JHB A;  2ILR A;  1NWQ A;  2Z5H A;  3IFM A;  4KZC A;  5AAO A;  3SNX A;  4NPD A;  1T8Z A;  2AWI A;  2FO7 A;  5LX8 A;  1BGY D;  5APS A;  1FZC C;  4ZKU A;  3DSX A;  3FEY A;  5CMZ A;  3IF4 A;  3SFZ A;  4BWR A;  4I43 A; 
#chains in the Genus database with same CATH homology
 2KZI A;  2SPZ A;  2LXB A;  1DC2 A;  4O1P A;  1BD8 A;  2RFM A;  2KZJ A;  4GOD A;  3EHR A;  5EIL A;  3IXE A;  3D9H A;  4KJM A;  1EDJ A;  3B7B A;  1OT8 A;  3TWV A;  3ZKJ A;  2KS1 B;  3MHV A;  4J8Y A;  4U8Y D;  2XEH A;  1WG0 A;  4HRM B;  5FIN A;  2OTK E;  2XEN A;  3UTM A;  4LG6 A;  3V2X A;  2ZAE B;  5ENO D;  2V4H C;  3W9G A;  4WWI A;  4GOE A;  1OVU A;  2KXP C;  2DVW A;  3ZUV B;  4DX6 D;  3FXD A;  5ENR D;  5ENT D;  1U7M A;  2DWZ A;  5BXO A;  3JUE A;  3ZNG A;  1Y47 A;  4J7W A;  2HR3 A;  5D66 A;  5ENP D;  1MJ0 A;  4UUC A;  1SS1 A;  4HRL A;  2NYJ A;  3ZDM A;  2M5A A;  5HRY A;  4DX7 D;  5KWD A;  4K5B A;  4HB5 A;  5FIO A;  2UWJ E;  1UOH A;  1MX2 A;  3LJN A;  5DJU B;  3T9K A;  4ZHB A;  4F6R D;  1N0Q A;  2A5E A;  2P58 A;  4DX1 A;  2JAB A;  2P2C P;  5CEA A;  2K3R A;  3EU9 A;  2KBX A;  5AQB A;  1U7J A;  3JXI A;  4BXL A;  4DX5 D;  3QWO C;  2XZD G;  2M5A B;  4CPG A;  4HRN A;  1FC2 C;  5KNH D;  2PNN A;  1OVR A;  1H0T A;  2JWD A;  1WDY A;  4NIK A;  4CZ2 D;  3TWU A;  4LNU D;  2DZN A;  2QC9 A;  5KBA A;  4HB1 A;  4K35 A;  3TWT A;  2XZT G;  3B95 A;  1MYO A;  1AP7 A;  2F8X K;  5EN5 D;  1SVX A;  1NFI E;  2FO1 E;  2KUB A;  3KEA A;  4HBD A;  4TUM A;  1D9S A;  1IXV A;  4HJG H;  1BDC A;  2ETB A;  5CEC B;  2WMM A;  1MX6 A;  4O1O A;  5HS0 A;  4JB8 P;  3NOG D;  3Q9N C;  4ATZ D;  1JMB A;  1OY3 D;  4GOF A;  1X0T A;  1H0T B;  3TWS A;  1A5E A;  1Q2N A;  3V2O A;  3J5P A;  4BER A;  4U8V D;  3V31 A;  1EDI A;  2B88 A;  4N5Q A;  5AAR A;  4GPM A;  3V79 K;  5EID A;  4BET A;  3UI2 A;  2BKG A;  1K1B A;  5KNG A;  4JBZ A;  2ZGG A;  1LP1 A;  2B89 A;  3TWQ A;  1S3J A;  3FXE A;  4C48 B;  4B93 B;  1G3N B;  4ASV A;  4ZMD A;  4DUI A;  2RKL A;  2AJA A;  4BES A;  4U96 D;  4BSZ B;  1IKN D;  4HI8 A;  5JA4 D;  3AJI A;  2BKK B;  2Y1L E;  4HNA D;  1EC5 A;  3Q9U C;  4U95 D;  4DRX E;  3V30 A;  4LSZ E;  5JMN D;  1EDK A;  2I8D A;  5K5G B;  5AN8 A;  4NPF X;  3T8K A;  3NOC D;  1LP1 B;  1BU9 A;  2J8S D;  1MFT A;  3C5R A;  2L6B A;  4QQI A;  2LR2 A;  4F1P A;  4K5C A;  3MZW B;  3TWW A;  4OAU C;  2VGE A;  3AAA C;  3S1K A;  1N11 A;  1K1A A;  4G8K A;  5EFW B;  2XEE A;  5C39 A;  1ZXG A;  5AQ9 A;  2QYJ A;  3NBN B;  2B0O E;  4GMR A;  1K3Z D;  4BEP A;  1NVO A;  4IOI H;  3JXJ A;  5EYL A;  4K5A B;  3TWR A;  5HKP A;  4MN4 C;  2LXC B;  2ETA A;  3RGU A;  1S70 B;  2V5Q C;  4HKZ H;  5DJT B;  3J5Q B;  4ASW A;  2QRX A;  1ZW0 A;  2KIK A;  1BI8 B;  1IHB A;  2Y0B G;  4QFV A;  5EIB E;  4ZNC A;  3F6Q A;  4EYY Q;  4Z68 A;  5BXU A;  1TR4 A;  4HQD A;  5ITZ F;  3EHQ A;  4O60 A;  4RLY A;  3HRA A;  5CBN A;  2HE0 A;  1YYH A;  4DX2 A;  5ENQ D;  3SO8 A;  3DEP A;  5EYP F;  4A63 B;  1YCS B;  1YMP A;  3TWX A;  2B87 A;  1LT1 A;  5AQ7 A;  1OVV A;  4YDW A;  2ETC A;  3PH0 A;  5CED B;  5CER B;  5CBO A;  1MX4 A;  2KI7 B;  1JM0 A;  1DEE G;  1AWC B;  1N0R A;  2MYO A;  1BLX B;  4K3A A;  2QVA A;  2F37 A;  1QYM A;  4ZFH A;  2M0B A;  1BDD A;  5AQA A;  2ZGD A;  2F8Y A;  3HG0 D;  4HLL A;  3W9F A;  3UXG A;  1DCQ A;  4CYM D;  1EDL A;  2DZO A;  2RFA A;  2R44 A;  4OAV B;  5AAO A;  1SW6 A;  3ZU7 B;  4G8L A;  2B87 B;  4NPD A;  5ENS D;  2Q1K A;  1BI7 B;  3DEO A;  4YDY A;  4NPE A;  4HI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...