5CBOA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
molecule keywords mbp3-16,Immunoglobulin G-binding protein A
total genus 55
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cboA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cboA01
5CBNA 3TWVA 3F6QA 4G8KA 5EYLA 5FIOA 2LXCB 5DJUB 1BDDA 2PNNA 3UXGA 4BEPA 4NPEA 4DRXE 3ZNGA 1N11A 2KXPC 3IXEA 2ETCA 3Q9UC 1LP1B 3J5PA 5EIBE 4DX7D 3S1KA 1BDCA 2SPZA 1EC5A 1BI8B 4HB5A 5ENRD 3EU9A 5BXUA 1K1AA 4UUCA 4GOEA 5ENQD 3AJIA 2KZJA 4BESA 4F6RD 4YDWA 4WWIA 2DVWA 2DZNA 4DUIA 4ASWA 1G3NB 2XENA 4J7WA 4N5QA 5ENOD 3TWTA 2KZIA 4HRNA 2KIKA 3NOGD 3V30A 4Z68A 2ZGGA 1Q2NA 1U7JA 3J5QB 2M0BA 4C48B 5CEDB 2OTKE 4GMRA 2A5EA 2F8XK 1U7MA 1BD8A 4K35A 1IHBA 1K1BA 4JB8P 4U8YD 1X0TA 1EDJA 3KEAA 1BLXB 2RFAA 2LXBA 3W9FA 1S3JA 5BXOA 3JXIA 4HI9A 2QRXA 4CZ2D 2L6BA 4QQIA 4CYMD 2M5AB 2B87B 2ZAEB 4OAVB 4HBDA 3V2OA 4ZHBA 3PH0A 2V4HC 2XZDG 2F8YA 3TWUA 2P58A 2UWJE 2QC9A 4B93B 1H0TA 5CERB 3FXEA 3TWSA 4DX2A 3V79K 4IOIH 2HE0A 5C39A 3V2XA 2JWDA 2AJAA 4K5CA 1BI7B 2WMMA 4HKZH 1YMPA 1OVRA 2DZOA 4TUMA 3UI2A 1DC2A 1WDYA 2XEEA 2RKLA 3T8KA 4DX5D 2KI7B 2NYJA 1EDIA 4BETA 5K5GB 1DEEG 4HB1A 5EFWB 3DEOA 3ZUVB 5AAOA 1JMBA 4U8VD 1EDKA 5JA4D 2Q1KA 1MFTA 4NIKA 3HG0D 4HRLA 3MZWB 4EYYQ 2BKKB 5CEAA 3DEPA 4U96D 2MYOA 2QYJA 1JM0A 1EDLA 2LR2A 3UTMA 1AP7A 4LNUD 5ITZF 3MHVA 4G8LA 4U95D 1QYMA 2RFMA 4ATZD 2KBXA 1LT1A 4QFVA 3EHQA 3FXDA 4HLLA 4O1OA 2QVAA 1OT8A 1UOHA 1OVUA 1SS1A 1MX6A 1S70B 2ETAA 4CPGA 1K3ZD 2BKGA 5ENSD 1LP1A 3T9KA 4ZFHA 4DX1A 3AAAC 4BERA 1MX2A 3B95A 4F1PA 4LG6A 5AN8A 5AQAA 5EN5D 3TWRA 4DX6D 4ZMDA 2FO1E 4OAUC 4HI8A 4RLYA 1A5EA 1DCQA 2I8DA 4O60A 5KBAA 3V31A 5D66A 4JBZA 5KNGA 3TWXA 3HRAA 3LJNA 2K3RA 4GODA 1IKND 4GPMA 5AQ9A 1MX4A 4O1PA 2ZGDA 2VGEA 2R44A 4BXLA 1H0TB 2ETBA 3TWWA 1NVOA 5HS0A 3ZKJA 2F37A 2JABA 4YDYA 1ZW0A 1N0QA 3W9GA 5CECB 3Q9NC 1BU9A 2B87A 2KUBA 4HRMB 4HQDA 4ZNCA 4K5BA 2J8SD 5EILA 3C5RA 4BSZB 2HR3A 4NPDA 2Y0BG 1AWCB 4MN4C 5FINA 3RGUA 3D9HA 1NFIE 1YYHA 5KWDA 2Y1LE 3NBNB 2P2CP 3QWOC 4HJGH 1SVXA 3JUEA 2KS1B 1ZXGA 1OY3D 2XEHA 3JXJA 4GOFA 5AQBA 5HRYA 5HKPA 5AQ7A 5ENTD 1IXVA 4A63B 5JMND 1SW6A 2XZTG 1OVVA 2B0OE 3B7BA 1TR4A 5DJTB 2B89A 4J8YA 5CBOA 5EYPF 3TWQA 3EHRA 1WG0A 2M5AA 3ZDMA 2B88A 4K5AB 1Y47A 5EIDA 1MYOA 1MJ0A 1YCSB 4LSZE 5ENPD 4NPFX 4KJMA 3ZU7B 2DWZA 3NOCD 4K3AA 4ASVA 5AARA 1FC2C 1N0RA 3SO8A 2V5QC 1D9SA 4HNAD 5KNHD
chains in the Genus database with same CATH superfamily
3FTVA 2VGXB 1J2JB 1KPSB 4ANWA 5DJUB 1KILD 5AVWB 4C0EA 1NTMD 1YQ4C 2KXPC 4EHMA 2N1TA 1LP1B 3EHNA 1L0LE 3A7OA 5CCGC 4HB5A 3PP5A 3LW5H 3B7RL 4V3IA 4UWLA 4M3OA 1SQBK 1DH3A 4GPKA 3D6YA 3TWUA 3FP3A 2PAJA 3W68A 5BV0A 2XPZA 3ITKA 2KS1A 1BCCD 1IQUA 3EIQC 1L4AA 2I2OA 4BTAA 4CEMA 2ZT9C 3D71A 2VSNA 1OCZE 3AG4E 1BGYD 2ZAEB 4YVQC 1TNBA 2ZIRA 2XZDG 2RD0A 3KQGA 1FJPA 2OEVA 1LWUA 1KTMA 3R9MA 1AQ5A 1V55E 4D6TE 5BU8B 3TNUB 1MZCA 1BGYG 3CLJA 3ABKE 5B1AE 4DT0A 2DZOA 4FHJA 3N4XA 4EZKA 3L71E 3B13A 1KYOD 3CWBD 3HVEA 1VQ7P 1OW8A 4NIKA 3SFEC 3QWVA 2Y9YA 1ELWA 3RK2D 1OXZA 4G2VA 1OMIA 2ZXEB 3TGUJ 5FZRA 4DJAA 3N71A 3LVRE 2Y4UA 4QMAA 3VLEA 3FUNA 5JJ6A 3P8MC 1VQ9P 1LD7A 4I1AA 1SQMA 2CK3H 4W7ZA 5AENA 4B86A 2FFDB 4C7NB 4EZJA 3M06A 3EFFK 1IFJA 4RLYA 1DCQA 2WXGA 1YJWP 1HJBA 1CI6B 2OEWA 3FUDA 4GPMA 1IKND 3L73E 3SSUA 1HWTC 3IAOA 1PPJG 1E7VA 1GW6A 5HS0A 2O3JA 2FY8A 4EPZA 1SP4A 1D8DA 4J6IA 5FWQA 5A23A 3CK8A 3CVVA 5C1DA 1BU9A 1OWAA 3SD5A 2VGXA 1BPOA 1OZHA 4A3VA 3QWOC 2P9PG 3JUEA 3TL5A 1ZXGA 3B5NB 4H0LC 3M91A 3QJZA 4PUCA 1JY3O 3TJPA 4BRYA 1U3CA 5JMND 3V5BA 1H2UA 5CBOA 3L08A 1YQ3C 4TXQA 4GIFA 3AEBC 1ZR4A 3KDPB 4TV3A 4FJYA 1YCSB 2KZTB 1NZNA 3SWYA 3PHLA 4ASVA 4RKUJ 3SO8A 1PFIA 1FZGA 2OYIB 3GZ2A 3H1IE 2WPVA 3CD6P 2R17C 5AIJA 4H7YA 1H88A 2CHWA 1ZR2A 1HH8A 4PJ0H 4D6TD 3L17A 1EC5A 4U3FD 1BI8B 2YO3A 3CVQA 3WU2E 3CHPA 3FDHA 1S72P 2A5UA 3C3QA 2WSCJ 2ONDA 3U4TA 3UKUG 4AXHA 2KIKA 4WY4D 1QGKB 4N3AA 3PUJA 3ASNE 4KVOA 4CT0A 4JYBA 3CWBJ 2POHA 2A5EA 2FBWC 1RE4A 4UB6E 4N78D 2OGUA 2ZVOB 3JXIA 1PGJA 1L4AD 4Y6CA 3CVUA 4HH2A 1N4SA 3ASDA 2P58A 3CVLA 2P9SG 3HUSC 1K8AQ 2NPSB 2ZJSE 3BCCD 3NF1A 3UT4A 1GW3A 3I5CA 2Q3IA 1O1TA 4XI0A 3L71J 1H0AA 1Z3YA 3ZUVB 3RL0D 4Y99B 2K9JA 3MEKA 4U8VD 1TNZA 4AEZC 1VQ4P 3ULQA 4I2WA 3HXDA 2QYJA 4A1GA 4DI3A 2VTBB 4LNUD 4G8LA 5CCHC 4LNBA 4E6HA 2XV5A 4HVBA 2P10A 3H1JD 1K3ZD 5APYA 5KKZB 4G11A 2QJPC 1TNOA 2IO3C 3FTZA 3CHRA 4KT0J 2X3MA 5A6CA 1PIXA 1SQXD 2JKVA 1OCRE 3R2PA 2R44A 2E76C 4EBAG 1N7SD 1RF0C 5CCMA 1ZRTE 1BGYE 1AWCB 3OA7A 1XNFA 5BUZA 2FYUE 3CCSP 1OCOE 2P2CP 2PGDA 4HJGH 3CHMA 3L70E 3NB2A 3E1RA 1S9KE 1IXVA 2ILRA 2R32A 5FQ4A 3LKUA 1GL2D 5CHXA 5T8IA 1PGQA 1GU4A 2MRIA 1QZ2A 4N78E 2N9YB 5AVVB 2Q7CA 5LX8A 4GDOA 2HODB 1LTIC 1BDDA 4MKTA 4DRXE 3FH8A 1N11A 3ZNGA 4GTOA 5CCGD 1L0LG 3O6QB 4KT6B 4DX7D 4BT9A 2WXQA 1K8KG 4UUCA 4AY5A 1HX8A 2J58A 3B4SA 5CCHD 4GZDA 1J1DB 3PRJA 2R3SA 2QFCA 3CGHA 3OAKA 3BG0B 3TGUG 3EIJA 4AOFA 1R5LA 3GYZA 3DPDA 5BVZA 4AIFA 2E43A 4U8YD 1E8YA 1FDMA 2K88A 2WXHA 2JJLA 1JB0J 4HBDA 4N6JA 1N7SA 2AXTE 5DIZA 3FULA 3HDXA 1NTME 3Q5PA 1XTGB 3TYYA 1OFCX 2MJZA 4TRQA 1DC2A 2Q5UA 2DIWA 4B94A 1SQXE 1Y8MA 2GW1A 3OXFA 4CDRA 3S4RA 3ZIMA 1GD2E 2J5UA 2VRSA 2EQXA 3RAUA 1L2PA 4N5CA 1GL2C 1IFPA 2MYOA 4JHRA 3H1IJ 2PQRA 2FYUD 3A3YB 1QYMA 3RRMB 3DSVA 1SFCC 3T9KA 2BKGA 1USEA 2FXPA 3FUKA 3APDA 4OGQD 1FVFA 1J1EB 4JEUA 3NTNA 1EDUA 4DCKA 5KNGA 1MX4A 4DZOA 3HUSB 2JEEA 3LEWA 4JA9A 4NQ0A 1YITP 5EILA 1PC2A 3PH0C 3VLDA 3WXXA 4BSZB 2WPQA 3FUFA 4FU3A 1IFMA 5KWDA 2OCCE 1INZA 4ILIA 4ANVA 4WB4A 1ZOYC 1JTHB 1DX7A 2BUGA 4CRWA 5H7PA 1U57A 5AYWD 4J8YA 2AXTH 1YJ9P 1TR4A 2JR8A 3AEAC 3EHRA 2ZYDA 1KB9I 3QWPA 2WWWA 3VP9A 4KVMA 5B3SE 1N0RA 2WXNA 1DVPA 3C3RA 4J0UA 4H7XA 4TXRA 5AVQB 4Q96A 4BEPA 2LXLA 3PZDA 3ZHEA 4L2YA 1L0LJ 2Z4EA 5BT1A 3L9TA 4GTSA 4GTVA 2Y9ZA 2XNDH 2YIUC 2YQ8A 1LTJC 3MUDA 4AV7A 2DCPA 2KZIA 3SI5A 1IK9A 3RL0B 3AG1E 1H19A 3QC1A 1IHGA 3CHSA 4GMRA 2F8XK 4U8HA 2IONA 3PTZA 4DOJA 3H1KJ 3TSIA 4XE0A 5AW8B 1IO4A 1NAYA 1S3JA 2M63A 2E74C 3VMYA 3Q7AA 2BCCJ 4L74A 1EXJA 2FO7A 2H6FA 3DXMG 4QQIA 4CZ2D 3CMEP 2F8YA 1VF5D 3SFDC 1PP9G 5KCMA 4EQFA 3K5BA 1QVFO 1FVHA 1PL5A 3L54A 3DPYA 2AEJA 3V2PA 4GA2A 4PV1C 4OVNF 3ABLE 5LCWJ 1DEEG 5BV1A 3ZXSA 4C46A 3UQ3A 2A06E 3T97A 4U0SA 4PDXA 2GUSA 2Z5IA 4XI9A 2RFMA 2YNQA 2E75C 1LTXA 4HOUA 4UWKA 2QVAA 5G2NA 2ETAA 1MX6A 5EX0A 4JPZB 2P2UA 2XPYA 1KFNA 1QX8A 3MTUE 2YMKA 1QQEA 1R5SA 1JCSA 4OAUC 1FBMA 1LTGC 3TWXA 1FAVA 2QE7H 4ME2A 3S7DA 5AQ9A 5KLIB 4O1PA 4HOTA 4RJTA 1KQLA 4UQZA 2P9NG 3KHUA 3LIEA 4A7PA 2J8SD 4NPDA 5B1BE 4MLPA 1HF9A 4J8EA 2OTJP 1NKNA 5M1BA 4PV1D 3JXJA 5GTHE 3AEEC 5HKPA 3AEGC 2W8ZA 3U64A 1TU3F 3H1JJ 1VQLP 3GZSA 3IV0A 1SQBJ 2B89A 4WUYA 3CQGB 2KLVA 5JHAA 3VMZA 3CMAP 2CFUA 2E75D 4NPFX 1SFCB 3L74J 1OIPA 4WBAA 4ZKPA 4KMOA 2WSEJ 4U63A 3RK3C 2N1TD 3M9BA 5ANRA 3RSEG 3FHEA 2PNNA 4BY6A 2L6JA 2LNIA 2IFNA 4HFGA 3EU9A 4GOEA 1BCCE 3AJIA 2WXMA 1HTLC 4PJ0E 1GU5A 1E90A 2IPPA 2QJKB 4DUIA 3TWTA 3I5PA 2X6IA 4BX8A 1S9KD 4YDOA 1U7JA 2IY0C 2M0BA 2XRYA 2OTKE 2W90A 4G25A 4AP2A 3RBXA 3W9FA 1BLXB 1HGZA 2LAHA 1HH0A 4EZLA 3KPEA 2RG8A 1MKMA 1XGWA 3FXEA 5E79H 2R3CA 1JCDA 3E4BA 3VTYA 3V2RA 5C39A 4WAFA 3ENEA 1SQXJ 4AUWA 1JY2O 4RO0A 2YHCA 3L22A 3L16A 4TUMA 3RK3D 3PRZA 2BASA 3HE5A 3SFXA 3ASHA 5K5GB 4GAAA 3U3WA 2HM8A 3TXMA 1HFAA 2HFED 5KAIH 1SQPD 1MFTA 3CK7A 2BEQD 3HD7C 3L75G 5LP0A 2KBXA 3KZIE 4O1OA 2H8PD 1E96B 2N1TC 3QKYA 5TISE 2OYHB 4ZFHA 3CX5H 2R05A 1SA4A 1QVGO 4HI8A 2D2CC 3TG4A 3AE9C 1SQPJ 3WUTA 4BFRA 3R9AB 1RE4C 3AG3E 3FUEA 1SQBD 3ZKJA 4W7YA 3MIWA 4YDYA 3KSQA 2C2LA 4I17A 2ZU6B 2NC9A 5FT9A 2KP8A 5LOZA 1OUVA 2Y3AA 5FINA 3CL3D 1NTKG 1RY3A 3L36A 3NMDA 1JY2N 5AQ7A 2X6FA 1BSHA 4H0LD 4MBGA 3CC7P 5B66E 3CCRP 3CV0A 5G04C 1QL1A 3UT7A 2Q6QA 2V4LA 3GG2A 1Q7YQ 1PAQA 3BRTB 3OTNA 3ZDMA 2RN0A 4UB6H 1NWQA 1LD8A 1MYOA 2B9BA 3AU5A 5AVUB 3DSTA 3CPWO 1SQVK 5KNHD 4U3FG 1AJYA 2YNYA 4EIJA 5EYLA 3CVYA 2KB7P 1KYOH 2D2CD 1BE3G 1PV3A 2OYHA 3J5PA 4Y28J 3BCCE 1OWNA 2SPZA 4CDMA 3VMAA 3BEEA 4URKA 5ENQD 1SQXK 4UB8H 2ZYGA 1UN9A 3UX4A 2WPVB 4N3BA 2DVWA 2IBZG 3ONKA 1DCEA 2GRRB 4L1BA 4TT3H 2XENA 3IHVA 1RE3C 2H88C 3NZUA 5BPPA 1Q2NA 2K37A 1HZ4A 3U1AA 2XGSA 2RFAA 4HI9A 1IJDB 2OTLP 2HYNA 4Q94A 2A06G 2WTYA 3F5HA 1SLQA 1RQUA 2E42A 2HE0A 1RF1A 1KYOI 1EZVG 2JWDA 5APTA 1P84H 1OX3A 5TISH 3CCJP 3FTYA 1OVRA 1LT9B 3D70A 1K9MQ 2KI7B 1SQPK 5APSA 2DBAA 1D7MA 1KD1Q 4M7CA 1KB9E 1CI6A 5EKQD 3E34A 4JVSA 5ITZF 5KLVE 3AS4A 1PGOA 2PRRA 2ZVNB 3EHQA 4HLLA 1OT8A 2IU1A 1OVUA 2GRMA 3UINC 3PEVB 4ANXA 2IBZI 1X8YA 4XX5A 4AJWA 4FC8A 5AQAA 2IDBA 5E79E 2M8RA 2R5DA 1JWFA 4HYTB 1RE3A 4O60A 1OWLA 1NU1K 2VSOE 2GUVA 4GODA 4BXLA 3MKQB 4C9BB 2KZTA 1NA3A 1K05A 3T5XA 2K9JB 1YYCA 1Y9BA 2G8YA 3ASOE 3DXKG 3P1UA 5CHEE 1T3UA 4OWFA 4L75A 1YYHA 3CQCB 3Q5MA 1M57D 2L0IA 1JPLA 4XIFA 2V4HA 1N52A 5CMWA 4BWRA 1BCCJ 2FFDC 1NTMG 2IFUA 3DSUA 2QG4A 2XCCA 1KFMA 2WXFA 4LLHA 4G23A 1SQPE 3PZ3A 5GTIE 2NPSA 2MOWA 1T3JA 2V5QC 3CI9A 4HXIA 4FULA 2IX7C 5GTIH 2DW3A 2LXCB 1FZCC 2FFDA 4GMJA 3RU0A 5EDSA 4D10C 4TLFA 1E79H 5CCHA 3PZ1A 2IBZE 2Z5HA 3FX0A 2WM9A 3HE4A 5CCGA 3LDZA 4N2SA 1USDA 2KZJA 3DSWA 4LUNU 2DZNA 3GMAA 3Q1MA 4FADA 1HG5A 3CSFA 3G3ZA 5ENOD 2X6KA 5G04J 1L5JA 2OVFA 4WWNA 3OXGA 1FOSF 1FE6A 2DYRE 4MS6A 2H7HA 3H1KE 3KEAA 3RK3B 1EDJA 5BXOA 2ZT9B 5AJDA 4JEHA 2P58C 3ZGQA 3D9KA 1JCQA 1UW4B 4UQXA 4ATGA 2LSVA 2LUHA 2XKMA 1LWUC 5BU5A 3DRAA 1PY1A 4L76A 4JPSA 4FA6A 3EFGA 3UUXA 2LSUA 2BCCD 3WUVA 1JCCA 2C0XA 1ELKA 3FTXA 4EYYQ 1FZCA 1JM0A 3EHMA 1EDLA 3U66A 1H6KA 3CWBE 4PD4I 1ZN5A 1M90Q 1D8EA 3HYMB 2P9LG 1P84I 3L35A 3TGUE 4K03A 3VYIA 2KK7A 1IK7A 1YIJP 2HLOA 4WY4A 3VTPC 2WQYC 4XFJA 2HO1A 3UIAA 5FJYA 3QK0A 1VPCA 3CXHE 5IY5E 2KLUA 2IYPA 3JYSA 3FUJA 2EILE 1NO4A 2E75B 1YA0A 4W9RA 2ZGDA 2CPBA 1ZLLA 2N9BA 4CGVA 2VJ8A 1ZP0C 3Q9NC 4U3FJ 3G71P 4G1TA 3ZXPA 4IFFA 3CVNA 5CRUA 1NFIE 2HODA 1FS0E 5AVZB 4PV1B 3T97B 2XEHA 4OGQC 2ZT9D 3KZIH 4GOFA 1KV4A 3HE5B 3F89A 3H1JE 4EOTA 1OVVA 3EU5A 2NPSD 1NTZG 3Q47B 1WG0A 3MYVA 3L70G 4WWOA 3SQVA 2NXPA 4F3VA 2E76B 3PE4A 1MFZA 2ZYAA 2IYOA 2IBZD 2XRZA 4L2LA 3FY4A 3T5VA 5EX3A 3ULYA 4I2ZA 1G2CA 1MHQA 4CDNA 3L72E 3CCUP 1S63A 3GHGA 1KN7A 3RL0C 1TNYA 5KJMA 1W2BO 2ETCA 3IXEA 2CHZA 4WY4B 3PLNA 2LKMA 1LTJB 2R03A 2A45G 1L0ND 1RH5B 2J07A 3O8ZA 2XEVA 4JA7A 4IL6E 3PNLB 3HRNA 4N5QA 3NZSA 3ABVC 2E5YA 3HVEB 1IHBA 1HBWA 2Y0EA 2LXBA 3A0HH 3AEDC 2QRXA 2L6BA 5TJHA 4ZHBA 1VF5B 3PH0A 5CERB 5FTPA 2UWJE 3AE4C 4I6EA 4O6FA 1TN8A 4BRYB 3L4FA 3HIZA 4I43A 1OW7A 5AW0B 3CX5E 4ILHB 3ZRHA 3SBTB 1BI7B 4Q69A 3TAXA 4AQRD 4HS2A 3ZYLA 3UIOC 3Q78A 3B5ND 2GM4A 1L0LK 4LGDE 4YVOA 3Q15A 1S0PA 3R4YA 1HE8A 3ASFA 5KJNA 2LR2A 2UY1B 3JCUE 1WM5A 3G2TA 1JOCA 2O01J 2IJGX 1VF5C 4BWNA 5ANLA 3QARA 2KC7A 4F1PA 3QDNA 2WQ7A 1ZU2A 3WMM0 1NKZB 3L73D 3I56P 3CIAA 2L5GB 3MZLB 3BRVB 5AJLA 3TWRA 1A5EA 1QNFA 1Q86Q 3UPVA 2PM6A 3SWFA 3CCLP 3MUDC 2J49A 3HRAA 1S4XA 2AXZA 3GF3A 2ZISA 1KMIZ 5KJLA 1KB9D 2KUBA 4HRMB 3ZYKA 2IZ0A 4JC8A 4JD2G 1EZVE 1SVFA 4ACLA 3RGUA 1JMMA 5APQA 2R59A 3NBNB 1NHLA 1OWMA 3B5NC 3D6ZA 3PEUB 3S7BA 2E74B 2J9QA 3L74G 3JCUH 3CHQA 2KOGA 2PQNA 3B7TA 1CZQA 1M1JC 1AFOA 2M5AA 2JO1A 5CMZA 3KYQA 1IFNA 1Q82Q 1TN7A 3ZU7B 1X22A 3AE8C 2CFZA 1GK6A 4GYOA 3FU5A 2I6HA 1N4RA 3F6QA 4FHKA 1G1IA 2D2CB 1N54A 4U07A 4DI4A 5ARGA 3D9JA 2OYHC 1K1AA 1UJJA 2AXCA 2M3BA 1Q90D 2KNCB 3U1CA 4NURA 2O1JA 4YDWA 4GYWA 2JP3A 2MHKA 2FYNC 1N95A 2PP6A 1K73Q 1VQKP 1HVVA 2ZGGA 4C7NA 3HD7B 2QJYB 3Q2YA 4GZ6A 3VP8A 1K1BA 3FTWA 4IN3B 3PDNA 1FDIA 4APFA 1U2VG 4I6JA 4GT1A 3UM1A 3WUUA 2QY7A 3C9IA 2AVPA 3SFYA 3RO2A 1UIIA 3V79K 1N7SC 3V2XA 1P5QA 2WMMA 4HKZH 1E8ZA 3FH5A 1HJ0A 1FU1A 5KAFH 4GCNA 1L0LD 3UI2A 4DX5D 1O5MA 1N94A 5L8RJ 3UKRG 4RQIA 3CCEP 5EFWB 2XS8A 2YKQA 1URQC 1QLED 4WNDA 2JDIH 4I7ZB 4HRLA 1J1EC 3L72J 1VQNP 3FGAD 5CEAA 2Y69E 4WVZA 1Z56A 1H2TC 4KHXA 4ATZD 3BCCJ 5ARFA 4L9PA 1SFCA 3U59A 4J8SA 3H25A 1WRGA 3G9RA 4FJZA 2QJPB 3ESKA 4LG6A 5EN5D 3L37A 3EJNA 2LO6A 2VQ2A 1FZEA 1EZVD 3KSLA 4UQYA 2K3RA 1TNUA 3TWWA 5AVRB 2WSEH 1Y6IA 2ETBA 4FLHA 1T6AA 3ISMC 3L70D 2FXMA 3P8CD 3MD0A 3PS6A 2J08A 3L74D 2HR2A 2F0YA 3D9MA 3H6PA 3CEQA 3FWNA 3W67A 4I7ZC 1SVXA 1JY3N 2WMNA 5G55A 1NH4A 2E74D 1SQVE 4MRUA 1X5BA 4YTPC 5AW2B 1GTWA 5DJTB 2XGOA 2UWJG 5EIDA 2A4ZA 3G2WA 1MJ0A 3CHOA 3IEGA 4J8FA 1N7SB 5AARA 1BE3J 1FC2C 3O4ZA 1D9SA 5KLIC 2LAIA 1ZB1A 4IL6H 5CBNA 1NTMK 3TWVA 4GYYA 1BCCG 4LCTA 2V7QH 4GZ3A 1TJCA 4RESB 3Q9UC 5EIBE 2UY1A 5ENRD 2QJYC 5APWA 1NU1D 5BXUA 3IBEA 1SFCD 2FYNB 1H2VC 2P7JA 2KSJA 2WPRA 2XGMA 4IL6X 5AVXB 5M72A 1JCRA 3QAQA 4U7EB 5B5EH 1HXIA 2WPSA 2HYZA 4CYMD 4OAVB 1EPUA 3LS8A 2V4HC 4B93B 1NTZE 2B6CA 2QC9A 3P2BA 1H6PA 2P9IG 1SQVJ 1FZAA 5AW6B 1VQ5P 1M56D 1SQQD 1KC8Q 3WG7E 3CC4P 2RKLA 1M1JB 4B0ZA 3KS2A 1IFDA 4BETA 3C98A 1L4AB 2NSZA 2XZRA 3G6EP 2MKVA 1IQRA 3MZWB 3S9OA 1KZPA 3B5NA 3AU4A 3D9OA 4ILGA 3FUIA 3RBZA 3CXHH 3CVXA 3G2VA 3LY7A 2WMOA 1NL4A 4C0MA 2P67A 3AE3C 3I55P 3PNTB 2FYUK 3L82A 1N9AA 1GK4A 1SQVD 1A17A 3QB2A 1SS1A 1LP1A 3ZYMA 4BERA 3O6QA 3IFMA 4L73A 3FWVA 2I8DA 4Y99C 3RJVA 5D66A 3OJAB 1VDYA 1SZ9A 1LT9A 3CSTA 3II6A 3ZW3A 3JCKC 4PH4B 2GRPB 2VGEA 3ZHEB 3ESLA 3D9NA 3NFQA 4WNGA 4NRHB 2XPIA 4GB9A 2KSEA 1GMJA 3C5RA 2Y0BG 2YXQB 4RSYA 3CXHI 3MP7B 1KZUB 1GDTA 2P9KG 4AYCA 3ZFWA 1QL2A 1K04A 1M1JA 2NRGA 2E5TA 2RH0A 4A1SA 1KT0A 3B7BA 4L7TA 2JLBA 3NQPA 4APOA 2O1KA 4JZYA 4K5AB 1Y8AA 2LXMA 4IYPA 1JNMA 2OV8A 4CGWA 1CW5A 1NTZD 1WAO1 4I1LA 2K1AA 2J09A 1A02F 4I9CA 1LTTC 5C2YA 1NTKK 1IC2A 1N4PA 3E33A 3IKOB 4TXPA 1LGHB 3IF4A 1PGPA 2WVRA 3FU0A 5AW3B 1E8XA 3LYAA 5BW8C 1SQBG 3DSSA 3RK2B 3U9WA 1G3NB 3E1IA 2WT7B 5FQ7A 4DK5A 3TDKA 2WSSH 4C48B 5A7DB 3FTUA 2H43A 4GU5A 4LERA 4PS8A 1YTZI 1T2KD 3Q75A 3KXDA 1OCCE 3QWWA 5DBKA 3ZYQA 1SQPG 2QSIA 3RL0g 3Q7FA 3RIBA 1RW2A 3FWLA 2O01N 1KYOE 3H1LE 1VQPP 2IOSA 1YBKA 1OWOA 3LY9A 3L6AA 5D0OD 2QYUA 1FJKA 3CR3A 1PPJD 2C0WA 5AVSB 1UJKA 4D6TJ 3T8KA 2HG5D 2G3AA 2OYOA 1NU1J 1S5LX 2W6AA 4HB1A 3V2NA 2BEDA 3BQOA 1NYHA 4RG9A 1FT2A 2Q1KA 3LIDA 4OGQB 4F1SA 2C0MA 3A2AA 3DBSA 4EDFA 1P84D 3UTMA 4BTBA 3JSVC 3BVHA 4U95D 3R7QA 2PL2A 1NAFA 2C9LY 1SZAA 4XE5B 2KNCA 1HG2A 3AE5C 2IF4A 3C72A 2WQ6A 1NA0A 4DLQA 1DEBA 3FU6A 1MX2A 4M3LA 2H89C 3FUMA 1T2KC 5AN8A 4DX6D 5J08A 4JHJA 4ZMDA 1A02J 4PD4D 1H8AA 2ZXWE 1S5LE 4JBZA 4XZ4A 2KATA 5KLVG 4N2QA 1S5LH 1VDFA 1KILE 3HE4B 1Q81Q 4YXDC 3W9GA 3HXCA 2W6JH 1N0QA 5HQ8A 3H32A 4I6GA 3AE1C 5HI7A 3H1LG 2P9UG 3AS8A 1MQSA 1NTZJ 3AECC 4UWGA 4PD4H 2KS1B 3P7KA 1OWPA 5HRYA 3CCQP 1FOSE 1JUNA 4JYCA 3WU2H 5AW9B 3PUKA 2L91A 5CCLA 3GLMA 1MV8A 3GZ1A 3RK6A 2FBNA 4LSZE 1NTZK 1LWUB 2FKWB 4KJMA 1GL2A 2A06D 3NOCD 2OARA 4ANUA 2GRQB 3AE2C 1TN6A 3TG5A 3CK9A 3URZA 2IQCA 4JL0A 4R4MA 2QA4P 1AVYA 2X38A 5KKZC 1QEXA 3L75E 3OXLA 3VTXA 3JC22 3MX3A 5FQ6A 3VLFA 1VL2A 4AY6A 4R4LA 3HXBA 4U0UA 3NOGD 4I2LC 5G05C 3C1LA 3FEXA 3TXNA 1X0TA 2OVBA 3CX5D 1NP7A 2IFMA 4KZ0A 4XKCA 4I9EA 3SZ7A 1ZMEC 4UI9J 2YINA 1FZCB 3V2OA 1JTHA 3ML8A 3V6IA 4H44B 1VQMP 3EWKA 3X2QE 2FYUG 4UWHA 3VN0A 3D9IA 2XNXA 1H89A 1SQXG 2P1JA 2CPSA 1EQ7A 4TUUA 5D0QD 3APFA 1NU1E 1EDIA 2FEZA 2C0LA 1U3DA 5AAOA 1FZFA 2KM4A 5E76A 5JA4D 2WB2A 2EIJE 2ZXXA 1G1JA 2A45I 1ZV8A 3CKCA 4KXKB 4DLOA 4FLBA 3S7JA 2WT7A 2WSCH 3MA5A 3FXDA 3SGHA 1JWGA 1UOHA 3CKBA 3PE3A 1WT6A 3CWBG 1URQA 1X79B 3BU8A 1KT1A 1WY6A 3V4QA 4GA1A 3UMVA 1S2EA 2FO1E 3RRNB 4I1OB 1X9VA 3BCCG 3I4GA 1LTSC 2FULA 1L0NK 4HOSA 4ACKA 2L9BA 2YIUB 2WXPA 2YHEA 2JABA 3CC2P 4WNEA 2B87A 2RMZA 4NACA 1KORA 4U3FE 4ZNCA 1S64A 3H1LJ 1RF1B 3PJSK 3L75D 1NTKJ 4N3YB 4GTPA 2OQQA 1MUUA 2J4BA 1LNQA 4H0LB 1TJFA 2IO2C 4F53A 1YI2P 3O48A 4IFMA 3H1HG 3MCXA 2L0TB 3PZ2A 4Y6WA 2BCCE 3ASGA 2DWZA 3V4WA 1HUCA 1UG3A 5JHBA 3NXSA 2RKKA 1PZQA 4BSXA 5FIOA 3K9IA 2DYSE 3FUHA 4GTQA 3NAWA 3A5TA 3SF4A 3RK3E 3S1KA 3ONLA 4H13C 4OVUA 1V54E 2R5SA 3R7RA 1RHZB 4EI2A 4GTMA 4BESA 4FP7A 1NI1A 4IRUA 4ASWA 5AW4B 1NU1G 3V30A 3VMXA 3KD7A 4JQ0D 1SA5A 3J5QB 3LPZA 1VQ8P 2OYIA 5AW5B 1E5WA 2WZ7A 3GW4A 1BD8A 4JB8P 3C8VA 1GZLA 1PP9E 3Q5RA 5LCWC 2FYZA 2GGFA 3MJWA 1DD4A 3E30A 2BCCG 3BATA 3T8MA 3FH7A 3VOPA 3L72D 2JEKA 4G24A 1E7UA 3CX5I 3HD7A 5KLVJ 1GL2B 2XU6A 3BASA 3MKQA 1YMPA 2PFXA 5ENNA 1DIPA 3QNKA 3UM0A 3Q49B 4GTRA 1HGVA 4UWFA 3L73G 3RRUA 3UIPC 1BGYJ 2R5BA 1LTJA 3HG0D 2GA1A 3PVLA 3SNXA 2Y0CA 4WWPA 1JUQA 3L70J 1LT1A 2YMYA 2IZ1A 4QFVA 4PS7A 1RZ4A 4IFDK 2V8SE 2AWIA 3ABME 4H13B 2CHXA 3LCAA 1IZNB 2QZAA 3LW5J 3B95A 3H1LD 1FCHA 2GROB 2YKPA 3P8CE 1SQQJ 1URQD 3ZEFA 3PREA 4JXTA 4CCAA 3LJNA 1LF8A 2VSYA 4YNDA 2N1TB 5KJKA 5B5EE 1J1DC 1VQOP 3LXUX 3M0DA 2AXUA 3GF7A 4MN4C 1P84E 2FYUJ 1SQQK 3LJ3A 2Y1LE 2VYIA 4O9BA 1TEZA 4JHKA 2PZIA 3DSXA 3CLQA 5ENTD 1JY2P 1SW6A 1NTMJ 1O1SA 2WXIA 3HXFA 5EYPF 2R2LA 1MZ9A 1IFIA 3G2UA 1RF0A 2CG2A 3ULEG 5H2FE 1N73A 4WY4C 3H1KG 3IR9A 4YDEA 4B8CB 2AEMA 2X6HA 1BSNA 1KILB 4UB8E 2WXJA 4U0ZA 1L4AC 1Z5SC 2AXVA 1CSBA 2NZ2A 1N73C 3MGNA 1YTZT 2Y4TA 2Q3EA 4W80A 1R8EA 4WWIA 4UI9C 2V7QJ 2Y0DA 5CEDB 3RKVA 3CVPA 1W2EA 4G26A 2PM7A 2J59M 1FPPA 4KBQA 3EQ2A 3L74E 4DJGA 1LTBC 2M5AB 1KQGB 2EINE 1N2DC 5AW7B 1LTAC 3L13A 4DX2A 1FZBA 4IOIH 3M0AA 3AEFC 3TGOA 3G4SP 1EZVI 2E2EA 3H32B 4YXWH 1H6OA 1AV1A 1QBQA 1AA0A 1OXJA 3CVWA 3KEZA 3P32A 1NTKD 2NPSC 1M7LA 4XKBA 3H1HD 5AVYB 4UI9K 1W5CE 3MV2B 4AVXA 3JQ0A 2WXKA 5KAFE 1S70B 1EXIA 5ENSD 5FQ8A 4L23A 2FF4A 1ZBPA 5BNWA 2FXOA 2WQHA 1FT1A 3APCA 4P29A 3ZPJA 4C7RA 5KBAA 1HF8A 3H1HJ 3V31A 3FFLA 2E76D 2VSXE 4JF7A 1KB9H 2AEFA 1PP9J 1M8OB 3E7KA 3D9HA 4CT4A 2X6JA 3V2QA 1HO8A 1TYQG 3UXGA 2QIWA 1B89A 5AQBA 2OYIC 2R02A 2KYVA 3FEYA 1E8WA 4A63B 4U7JA 2WVIA 2XZTG 3L73J 3H1KD 3TNUA 2J4DA 1Y47A 4N39A 4A55A 5ENPD 2EIME 3A0HE 3SBSA 1EF1C 1O1RA 5APVA 3ZVVA 1N7LA 4LRZA 2QM7A 4G8KA 5KJ7D 2XQ0A 4GZ5A 4LNGA 1X81A 1UN8A 4GZCA 1URQB 5T3RA 4I6MC 4H13D 4ABNA 2OOEA 3TF5A 1Z3XA 4IULA 2EIKE 3UM2A 4F6RD 1BE3E 2XCBA 2YO2A 3B8EB 3GW6A 4Z68A 2BEZF 4E85A 3H1HE 2FI7A 2GRLA 2I9CA 3I3NA 4DX1A 4XEIG 4B89A 3TGUD 3H1JG 3SWKA 5FZSA 5CJ4A 2A45H 3B71A 3IN6A 3B7SA 3D9PA 4WNFA 5B66H 1H0TA 5GTHH 1GW4A 5AW1B 2ZFCA 3CCVP 3D3MA 4GTTA 3G2SA 4N3CA 1FDOA 3MGBA 3Q4AB 3M0DC 1WDYA 2XEEA 5KJ7C 1VQ6P 3M9QA 1DD3A 2HPCA 2WXOA 3DEOA 3AG2E 3E32A 1EDKA 2VGYA 2BKKB 2IOLA 3DEPA 1KLXA 4EBAA 3RK2C 3MHVA 4ZKUA 3PZ4A 1PP9D 3Q5SA 2XHEA 5AVTB 1JEKA 3UM3A 2W6BA 5KJ7A 2W27A 3H1IG 2AW6A 3AAAC 3D9LA 5KLVD 1SQBE 5CJ0A 1S1CX 5JJ7A 4OYSA 3UT8A 4F7AA 3OW2O 3BG1B 1LT9C 2O01H 3H1ID 1HS6A 2H6HA 2V0PA 3SFZA 1IYGA 1SQQE 3ZN3A 2C9NY 1NVOA 1RQVA 2WITA 1YHQP 2QM8A 3L72G 1N4QA 2F37A 3E37A 3JUIA 5KAIE 4Z1MH 3M9HA 4K5BA 2HR3A 4J8DA 3HTKA 2KXPB 4YPCA 4X8QA 3SHFA 3FTSA 2I1JA 3LY8A 4JW1A 2ITAA 3CCMP 2H6IA 4R7LA 1PPJE 4OVVA 3HD7D 2B0OE 3TWQA 4A3TA 2E0IA 2B88A 3QH9A 4H44C 3AS5A 3FU3A 1LJ2A 4RVBA 1L0NJ 2BF0X 3CXHD 3OAWA 1NGMB 1WMKA 1XTCC 2Q9IA 4K0RA 5H2FH 4NPEA 1SQQG 2VTBA 1BDCA 1Z6TA 5KTBA 4HLEA 3LVQE 4GKGA 4PD4E 2V5FA 5D2MC 4J7WA 1N8RQ 3HHMA 4HRNA 3Q73A 1OW6A 3GHGC 2H6GA 3B7UX 3AE6C 3HXEA 4BT8A 1U7MA 4KZCA 4K35A 4D6TG 3HTKB 5T4YA 1ELRA 2I1KA 2KCLA 2YKOA 2YXRB 5E75A 3KAEA 3MKRA 5CMYA 2B87B 4XA4A 1AQTA 1RF1C 1Q2ZA 1W3BA 1DNPA 4H44D 3TWSA 1YJNP 2JWAA 2WXLA 2AJAA 4K5CA 3AE7C 3HUSA 1KQSO 5APUA 5APXA 3C3OA 4B8AA 5J90A 4OH8B 5FZQA 1T8ZA 5LFAA 4GA0A 1NOHA 2KCVA 2NYJA 2WSFH 3RO3A 1ZRTD 3BUAA 1JMBA 3A0BH 2M3EA 1KILA 4U96D 4DPRA 3IHYA 2XDJA 3SY2A 2Q7FA 2IEJA 2K9YA 2KCKA 5JJTA 4BX9A 4I1MA 2CG3A 3DWLG 4AM9A 5KLVK 1JO5A 2QEXP 4CPGA 1N73B 1JY3P 1EYHA 3ML9A 1UIXA 2W83C 1L0NE 1BE3D 4LC1A 1KILC 3L75J 1M1KQ 3S2AA 1G2CB 3GHGB 2BTDA 2XS1A 4U04A 1NJIQ 1KZOA 1AP7A 3L71D 1H0TB 2WSFJ 3A0BE 1ZW0A 2GRNB 5CECB 3JQ1A 4HQDA 1NTKE 3Q79A 4GCOA 3L71G 1KQFB 4HOQA 3EUVA 3EDTB 4KYOB 4LEUA 3TK1A 1OY3D 2HPCB 5G05J 3MV3B 4HORA 3S7FA 4EECA 4RG6A 1SQVG 2QJKC 1AVOA 3N7NA 3USSA 3I4RB 4GMLA 3Q3DA 5CRVA 1N86A 2WXRA 4PS3A 1L0NG 4K3AA 1HU3A 4HNAD 3QOUA
chains in the Genus database with same CATH topology
5CBNA 3TWVA 3F6QA 4G8KA 5EYLA 5FIOA 2LXCB 5DJUB 1BDDA 2PNNA 3UXGA 4BEPA 4NPEA 4DRXE 3ZNGA 1N11A 2KXPC 3IXEA 2ETCA 3Q9UC 1LP1B 3J5PA 5EIBE 4DX7D 3S1KA 1BDCA 2SPZA 1EC5A 1BI8B 4HB5A 5ENRD 3EU9A 5BXUA 1K1AA 4UUCA 4GOEA 5ENQD 3AJIA 2KZJA 4BESA 4F6RD 4YDWA 4WWIA 2DVWA 2DZNA 4DUIA 4ASWA 1G3NB 2XENA 4J7WA 4N5QA 5ENOD 3TWTA 2KZIA 4HRNA 2KIKA 3NOGD 3V30A 4Z68A 2ZGGA 1Q2NA 1U7JA 3J5QB 2M0BA 4C48B 5CEDB 2OTKE 4GMRA 2A5EA 2F8XK 1U7MA 1BD8A 4K35A 1IHBA 1K1BA 4JB8P 4U8YD 1X0TA 1EDJA 3KEAA 1BLXB 2RFAA 2LXBA 3W9FA 1S3JA 5BXOA 3JXIA 4HI9A 2QRXA 4CZ2D 2L6BA 4QQIA 4CYMD 2M5AB 2B87B 2ZAEB 4OAVB 4HBDA 3V2OA 4ZHBA 3PH0A 2V4HC 2XZDG 2F8YA 3TWUA 2P58A 2UWJE 2QC9A 4B93B 1H0TA 5CERB 3FXEA 3TWSA 4DX2A 3V79K 4IOIH 2HE0A 5C39A 3V2XA 2JWDA 2AJAA 4K5CA 1BI7B 2WMMA 4HKZH 1YMPA 1OVRA 2DZOA 4TUMA 3UI2A 1DC2A 1WDYA 2XEEA 2RKLA 3T8KA 4DX5D 2KI7B 2NYJA 1EDIA 4BETA 5K5GB 1DEEG 4HB1A 5EFWB 3DEOA 3ZUVB 5AAOA 1JMBA 4U8VD 1EDKA 5JA4D 2Q1KA 1MFTA 4NIKA 3HG0D 4HRLA 3MZWB 4EYYQ 2BKKB 5CEAA 3DEPA 4U96D 2MYOA 2QYJA 1JM0A 1EDLA 2LR2A 3UTMA 1AP7A 4LNUD 5ITZF 3MHVA 4G8LA 4U95D 1QYMA 2RFMA 4ATZD 2KBXA 1LT1A 4QFVA 3EHQA 3FXDA 4HLLA 4O1OA 2QVAA 1OT8A 1UOHA 1OVUA 1SS1A 1MX6A 1S70B 2ETAA 4CPGA 1K3ZD 2BKGA 5ENSD 1LP1A 3T9KA 4ZFHA 4DX1A 3AAAC 4BERA 1MX2A 3B95A 4F1PA 4LG6A 5AN8A 5AQAA 5EN5D 3TWRA 4DX6D 4ZMDA 2FO1E 4OAUC 4HI8A 4RLYA 1A5EA 1DCQA 2I8DA 4O60A 5KBAA 3V31A 5D66A 4JBZA 5KNGA 3TWXA 3HRAA 3LJNA 2K3RA 4GODA 1IKND 4GPMA 5AQ9A 1MX4A 4O1PA 2ZGDA 2VGEA 2R44A 4BXLA 1H0TB 2ETBA 3TWWA 1NVOA 5HS0A 3ZKJA 2F37A 2JABA 4YDYA 1ZW0A 1N0QA 3W9GA 5CECB 3Q9NC 1BU9A 2B87A 2KUBA 4HRMB 4HQDA 4ZNCA 4K5BA 2J8SD 5EILA 3C5RA 4BSZB 2HR3A 4NPDA 2Y0BG 1AWCB 4MN4C 5FINA 3RGUA 3D9HA 1NFIE 1YYHA 5KWDA 2Y1LE 3NBNB 2P2CP 3QWOC 4HJGH 1SVXA 3JUEA 2KS1B 1ZXGA 1OY3D 2XEHA 3JXJA 4GOFA 5AQBA 5HRYA 5HKPA 5AQ7A 5ENTD 1IXVA 4A63B 5JMND 1SW6A 2XZTG 1OVVA 2B0OE 3B7BA 1TR4A 5DJTB 2B89A 4J8YA 5CBOA 5EYPF 3TWQA 3EHRA 1WG0A 2M5AA 3ZDMA 2B88A 4K5AB 1Y47A 5EIDA 1MYOA 1MJ0A 1YCSB 4LSZE 5ENPD 4NPFX 4KJMA 3ZU7B 2DWZA 3NOCD 4K3AA 4ASVA 5AARA 1FC2C 1N0RA 3SO8A 2V5QC 1D9SA 4HNAD 5KNHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBN A;  3TWV A;  3F6Q A;  4G8K A;  5EYL A;  5FIO A;  2LXC B;  5DJU B;  1BDD A;  2PNN A;  3UXG A;  4BEP A;  4NPE A;  4DRX E;  3ZNG A;  1N11 A;  2KXP C;  3IXE A;  2ETC A;  3Q9U C;  1LP1 B;  3J5P A;  5EIB E;  4DX7 D;  3S1K A;  1BDC A;  2SPZ A;  1EC5 A;  1BI8 B;  4HB5 A;  5ENR D;  3EU9 A;  5BXU A;  1K1A A;  4UUC A;  4GOE A;  5ENQ D;  3AJI A;  2KZJ A;  4BES A;  4F6R D;  4YDW A;  4WWI A;  2DVW A;  2DZN A;  4DUI A;  4ASW A;  1G3N B;  2XEN A;  4J7W A;  4N5Q A;  5ENO D;  3TWT A;  2KZI A;  4HRN A;  2KIK A;  3NOG D;  3V30 A;  4Z68 A;  2ZGG A;  1Q2N A;  1U7J A;  3J5Q B;  2M0B A;  4C48 B;  5CED B;  2OTK E;  4GMR A;  2A5E A;  2F8X K;  1U7M A;  1BD8 A;  4K35 A;  1IHB A;  1K1B A;  4JB8 P;  4U8Y D;  1X0T A;  1EDJ A;  3KEA A;  1BLX B;  2RFA A;  2LXB A;  3W9F A;  1S3J A;  5BXO A;  3JXI A;  4HI9 A;  2QRX A;  4CZ2 D;  2L6B A;  4QQI A;  4CYM D;  2M5A B;  2B87 B;  2ZAE B;  4OAV B;  4HBD A;  3V2O A;  4ZHB A;  3PH0 A;  2V4H C;  2XZD G;  2F8Y A;  3TWU A;  2P58 A;  2UWJ E;  2QC9 A;  4B93 B;  1H0T A;  5CER B;  3FXE A;  3TWS A;  4DX2 A;  3V79 K;  4IOI H;  2HE0 A;  5C39 A;  3V2X A;  2JWD A;  2AJA A;  4K5C A;  1BI7 B;  2WMM A;  4HKZ H;  1YMP A;  1OVR A;  2DZO A;  4TUM A;  3UI2 A;  1DC2 A;  1WDY A;  2XEE A;  2RKL A;  3T8K A;  4DX5 D;  2KI7 B;  2NYJ A;  1EDI A;  4BET A;  5K5G B;  1DEE G;  4HB1 A;  5EFW B;  3DEO A;  3ZUV B;  5AAO A;  1JMB A;  4U8V D;  1EDK A;  5JA4 D;  2Q1K A;  1MFT A;  4NIK A;  3HG0 D;  4HRL A;  3MZW B;  4EYY Q;  2BKK B;  5CEA A;  3DEP A;  4U96 D;  2MYO A;  2QYJ A;  1JM0 A;  1EDL A;  2LR2 A;  3UTM A;  1AP7 A;  4LNU D;  5ITZ F;  3MHV A;  4G8L A;  4U95 D;  1QYM A;  2RFM A;  4ATZ D;  2KBX A;  1LT1 A;  4QFV A;  3EHQ A;  3FXD A;  4HLL A;  4O1O A;  2QVA A;  1OT8 A;  1UOH A;  1OVU A;  1SS1 A;  1MX6 A;  1S70 B;  2ETA A;  4CPG A;  1K3Z D;  2BKG A;  5ENS D;  1LP1 A;  3T9K A;  4ZFH A;  4DX1 A;  3AAA C;  4BER A;  1MX2 A;  3B95 A;  4F1P A;  4LG6 A;  5AN8 A;  5AQA A;  5EN5 D;  3TWR A;  4DX6 D;  4ZMD A;  2FO1 E;  4OAU C;  4HI8 A;  4RLY A;  1A5E A;  1DCQ A;  2I8D A;  4O60 A;  5KBA A;  3V31 A;  5D66 A;  4JBZ A;  5KNG A;  3TWX A;  3HRA A;  3LJN A;  2K3R A;  4GOD A;  1IKN D;  4GPM A;  5AQ9 A;  1MX4 A;  4O1P A;  2ZGD A;  2VGE A;  2R44 A;  4BXL A;  1H0T B;  2ETB A;  3TWW A;  1NVO A;  5HS0 A;  3ZKJ A;  2F37 A;  2JAB A;  4YDY A;  1ZW0 A;  1N0Q A;  3W9G A;  5CEC B;  3Q9N C;  1BU9 A;  2B87 A;  2KUB A;  4HRM B;  4HQD A;  4ZNC A;  4K5B A;  2J8S D;  5EIL A;  3C5R A;  4BSZ B;  2HR3 A;  4NPD A;  2Y0B G;  1AWC B;  4MN4 C;  5FIN A;  3RGU A;  3D9H A;  1NFI E;  1YYH A;  5KWD A;  2Y1L E;  3NBN B;  2P2C P;  3QWO C;  4HJG H;  1SVX A;  3JUE A;  2KS1 B;  1ZXG A;  1OY3 D;  2XEH A;  3JXJ A;  4GOF A;  5AQB A;  5HRY A;  5HKP A;  5AQ7 A;  5ENT D;  1IXV A;  4A63 B;  5JMN D;  1SW6 A;  2XZT G;  1OVV A;  2B0O E;  3B7B A;  1TR4 A;  5DJT B;  2B89 A;  4J8Y A;  5CBO A;  5EYP F;  3TWQ A;  3EHR A;  1WG0 A;  2M5A A;  3ZDM A;  2B88 A;  4K5A B;  1Y47 A;  5EID A;  1MYO A;  1MJ0 A;  1YCS B;  4LSZ E;  5ENP D;  4NPF X;  4KJM A;  3ZU7 B;  2DWZ A;  3NOC D;  4K3A A;  4ASV A;  5AAR A;  1FC2 C;  1N0R A;  3SO8 A;  2V5Q C;  1D9S A;  4HNA D;  5KNH D; 
#chains in the Genus database with same CATH topology
 3FTV A;  2VGX B;  1J2J B;  1KPS B;  4ANW A;  5DJU B;  1KIL D;  5AVW B;  4C0E A;  1NTM D;  1YQ4 C;  2KXP C;  4EHM A;  2N1T A;  1LP1 B;  3EHN A;  1L0L E;  3A7O A;  5CCG C;  4HB5 A;  3PP5 A;  3LW5 H;  3B7R L;  4V3I A;  4UWL A;  4M3O A;  1SQB K;  1DH3 A;  4GPK A;  3D6Y A;  3TWU A;  3FP3 A;  2PAJ A;  3W68 A;  5BV0 A;  2XPZ A;  3ITK A;  2KS1 A;  1BCC D;  1IQU A;  3EIQ C;  1L4A A;  2I2O A;  4BTA A;  4CEM A;  2ZT9 C;  3D71 A;  2VSN A;  1OCZ E;  3AG4 E;  1BGY D;  2ZAE B;  4YVQ C;  1TNB A;  2ZIR A;  2XZD G;  2RD0 A;  3KQG A;  1FJP A;  2OEV A;  1LWU A;  1KTM A;  3R9M A;  1AQ5 A;  1V55 E;  4D6T E;  5BU8 B;  3TNU B;  1MZC A;  1BGY G;  3CLJ A;  3ABK E;  5B1A E;  4DT0 A;  2DZO A;  4FHJ A;  3N4X A;  4EZK A;  3L71 E;  3B13 A;  1KYO D;  3CWB D;  3HVE A;  1VQ7 P;  1OW8 A;  4NIK A;  3SFE C;  3QWV A;  2Y9Y A;  1ELW A;  3RK2 D;  1OXZ A;  4G2V A;  1OMI A;  2ZXE B;  3TGU J;  5FZR A;  4DJA A;  3N71 A;  3LVR E;  2Y4U A;  4QMA A;  3VLE A;  3FUN A;  5JJ6 A;  3P8M C;  1VQ9 P;  1LD7 A;  4I1A A;  1SQM A;  2CK3 H;  4W7Z A;  5AEN A;  4B86 A;  2FFD B;  4C7N B;  4EZJ A;  3M06 A;  3EFF K;  1IFJ A;  4RLY A;  1DCQ A;  2WXG A;  1YJW P;  1HJB A;  1CI6 B;  2OEW A;  3FUD A;  4GPM A;  1IKN D;  3L73 E;  3SSU A;  1HWT C;  3IAO A;  1PPJ G;  1E7V A;  1GW6 A;  5HS0 A;  2O3J A;  2FY8 A;  4EPZ A;  1SP4 A;  1D8D A;  4J6I A;  5FWQ A;  5A23 A;  3CK8 A;  3CVV A;  5C1D A;  1BU9 A;  1OWA A;  3SD5 A;  2VGX A;  1BPO A;  1OZH A;  4A3V A;  3QWO C;  2P9P G;  3JUE A;  3TL5 A;  1ZXG A;  3B5N B;  4H0L C;  3M91 A;  3QJZ A;  4PUC A;  1JY3 O;  3TJP A;  4BRY A;  1U3C A;  5JMN D;  3V5B A;  1H2U A;  5CBO A;  3L08 A;  1YQ3 C;  4TXQ A;  4GIF A;  3AEB C;  1ZR4 A;  3KDP B;  4TV3 A;  4FJY A;  1YCS B;  2KZT B;  1NZN A;  3SWY A;  3PHL A;  4ASV A;  4RKU J;  3SO8 A;  1PFI A;  1FZG A;  2OYI B;  3GZ2 A;  3H1I E;  2WPV A;  3CD6 P;  2R17 C;  5AIJ A;  4H7Y A;  1H88 A;  2CHW A;  1ZR2 A;  1HH8 A;  4PJ0 H;  4D6T D;  3L17 A;  1EC5 A;  4U3F D;  1BI8 B;  2YO3 A;  3CVQ A;  3WU2 E;  3CHP A;  3FDH A;  1S72 P;  2A5U A;  3C3Q A;  2WSC J;  2OND A;  3U4T A;  3UKU G;  4AXH A;  2KIK A;  4WY4 D;  1QGK B;  4N3A A;  3PUJ A;  3ASN E;  4KVO A;  4CT0 A;  4JYB A;  3CWB J;  2POH A;  2A5E A;  2FBW C;  1RE4 A;  4UB6 E;  4N78 D;  2OGU A;  2ZVO B;  3JXI A;  1PGJ A;  1L4A D;  4Y6C A;  3CVU A;  4HH2 A;  1N4S A;  3ASD A;  2P58 A;  3CVL A;  2P9S G;  3HUS C;  1K8A Q;  2NPS B;  2ZJS E;  3BCC D;  3NF1 A;  3UT4 A;  1GW3 A;  3I5C A;  2Q3I A;  1O1T A;  4XI0 A;  3L71 J;  1H0A A;  1Z3Y A;  3ZUV B;  3RL0 D;  4Y99 B;  2K9J A;  3MEK A;  4U8V D;  1TNZ A;  4AEZ C;  1VQ4 P;  3ULQ A;  4I2W A;  3HXD A;  2QYJ A;  4A1G A;  4DI3 A;  2VTB B;  4LNU D;  4G8L A;  5CCH C;  4LNB A;  4E6H A;  2XV5 A;  4HVB A;  2P10 A;  3H1J D;  1K3Z D;  5APY A;  5KKZ B;  4G11 A;  2QJP C;  1TNO A;  2IO3 C;  3FTZ A;  3CHR A;  4KT0 J;  2X3M A;  5A6C A;  1PIX A;  1SQX D;  2JKV A;  1OCR E;  3R2P A;  2R44 A;  2E76 C;  4EBA G;  1N7S D;  1RF0 C;  5CCM A;  1ZRT E;  1BGY E;  1AWC B;  3OA7 A;  1XNF A;  5BUZ A;  2FYU E;  3CCS P;  1OCO E;  2P2C P;  2PGD A;  4HJG H;  3CHM A;  3L70 E;  3NB2 A;  3E1R A;  1S9K E;  1IXV A;  2ILR A;  2R32 A;  5FQ4 A;  3LKU A;  1GL2 D;  5CHX A;  5T8I A;  1PGQ A;  1GU4 A;  2MRI A;  1QZ2 A;  4N78 E;  2N9Y B;  5AVV B;  2Q7C A;  5LX8 A;  4GDO A;  2HOD B;  1LTI C;  1BDD A;  4MKT A;  4DRX E;  3FH8 A;  1N11 A;  3ZNG A;  4GTO A;  5CCG D;  1L0L G;  3O6Q B;  4KT6 B;  4DX7 D;  4BT9 A;  2WXQ A;  1K8K G;  4UUC A;  4AY5 A;  1HX8 A;  2J58 A;  3B4S A;  5CCH D;  4GZD A;  1J1D B;  3PRJ A;  2R3S A;  2QFC A;  3CGH A;  3OAK A;  3BG0 B;  3TGU G;  3EIJ A;  4AOF A;  1R5L A;  3GYZ A;  3DPD A;  5BVZ A;  4AIF A;  2E43 A;  4U8Y D;  1E8Y A;  1FDM A;  2K88 A;  2WXH A;  2JJL A;  1JB0 J;  4HBD A;  4N6J A;  1N7S A;  2AXT E;  5DIZ A;  3FUL A;  3HDX A;  1NTM E;  3Q5P A;  1XTG B;  3TYY A;  1OFC X;  2MJZ A;  4TRQ A;  1DC2 A;  2Q5U A;  2DIW A;  4B94 A;  1SQX E;  1Y8M A;  2GW1 A;  3OXF A;  4CDR A;  3S4R A;  3ZIM A;  1GD2 E;  2J5U A;  2VRS A;  2EQX A;  3RAU A;  1L2P A;  4N5C A;  1GL2 C;  1IFP A;  2MYO A;  4JHR A;  3H1I J;  2PQR A;  2FYU D;  3A3Y B;  1QYM A;  3RRM B;  3DSV A;  1SFC C;  3T9K A;  2BKG A;  1USE A;  2FXP A;  3FUK A;  3APD A;  4OGQ D;  1FVF A;  1J1E B;  4JEU A;  3NTN A;  1EDU A;  4DCK A;  5KNG A;  1MX4 A;  4DZO A;  3HUS B;  2JEE A;  3LEW A;  4JA9 A;  4NQ0 A;  1YIT P;  5EIL A;  1PC2 A;  3PH0 C;  3VLD A;  3WXX A;  4BSZ B;  2WPQ A;  3FUF A;  4FU3 A;  1IFM A;  5KWD A;  2OCC E;  1INZ A;  4ILI A;  4ANV A;  4WB4 A;  1ZOY C;  1JTH B;  1DX7 A;  2BUG A;  4CRW A;  5H7P A;  1U57 A;  5AYW D;  4J8Y A;  2AXT H;  1YJ9 P;  1TR4 A;  2JR8 A;  3AEA C;  3EHR A;  2ZYD A;  1KB9 I;  3QWP A;  2WWW A;  3VP9 A;  4KVM A;  5B3S E;  1N0R A;  2WXN A;  1DVP A;  3C3R A;  4J0U A;  4H7X A;  4TXR A;  5AVQ B;  4Q96 A;  4BEP A;  2LXL A;  3PZD A;  3ZHE A;  4L2Y A;  1L0L J;  2Z4E A;  5BT1 A;  3L9T A;  4GTS A;  4GTV A;  2Y9Z A;  2XND H;  2YIU C;  2YQ8 A;  1LTJ C;  3MUD A;  4AV7 A;  2DCP A;  2KZI A;  3SI5 A;  1IK9 A;  3RL0 B;  3AG1 E;  1H19 A;  3QC1 A;  1IHG A;  3CHS A;  4GMR A;  2F8X K;  4U8H A;  2ION A;  3PTZ A;  4DOJ A;  3H1K J;  3TSI A;  4XE0 A;  5AW8 B;  1IO4 A;  1NAY A;  1S3J A;  2M63 A;  2E74 C;  3VMY A;  3Q7A A;  2BCC J;  4L74 A;  1EXJ A;  2FO7 A;  2H6F A;  3DXM G;  4QQI A;  4CZ2 D;  3CME P;  2F8Y A;  1VF5 D;  3SFD C;  1PP9 G;  5KCM A;  4EQF A;  3K5B A;  1QVF O;  1FVH A;  1PL5 A;  3L54 A;  3DPY A;  2AEJ A;  3V2P A;  4GA2 A;  4PV1 C;  4OVN F;  3ABL E;  5LCW J;  1DEE G;  5BV1 A;  3ZXS A;  4C46 A;  3UQ3 A;  2A06 E;  3T97 A;  4U0S A;  4PDX A;  2GUS A;  2Z5I A;  4XI9 A;  2RFM A;  2YNQ A;  2E75 C;  1LTX A;  4HOU A;  4UWK A;  2QVA A;  5G2N A;  2ETA A;  1MX6 A;  5EX0 A;  4JPZ B;  2P2U A;  2XPY A;  1KFN A;  1QX8 A;  3MTU E;  2YMK A;  1QQE A;  1R5S A;  1JCS A;  4OAU C;  1FBM A;  1LTG C;  3TWX A;  1FAV A;  2QE7 H;  4ME2 A;  3S7D A;  5AQ9 A;  5KLI B;  4O1P A;  4HOT A;  4RJT A;  1KQL A;  4UQZ A;  2P9N G;  3KHU A;  3LIE A;  4A7P A;  2J8S D;  4NPD A;  5B1B E;  4MLP A;  1HF9 A;  4J8E A;  2OTJ P;  1NKN A;  5M1B A;  4PV1 D;  3JXJ A;  5GTH E;  3AEE C;  5HKP A;  3AEG C;  2W8Z A;  3U64 A;  1TU3 F;  3H1J J;  1VQL P;  3GZS A;  3IV0 A;  1SQB J;  2B89 A;  4WUY A;  3CQG B;  2KLV A;  5JHA A;  3VMZ A;  3CMA P;  2CFU A;  2E75 D;  4NPF X;  1SFC B;  3L74 J;  1OIP A;  4WBA A;  4ZKP A;  4KMO A;  2WSE J;  4U63 A;  3RK3 C;  2N1T D;  3M9B A;  5ANR A;  3RSE G;  3FHE A;  2PNN A;  4BY6 A;  2L6J A;  2LNI A;  2IFN A;  4HFG A;  3EU9 A;  4GOE A;  1BCC E;  3AJI A;  2WXM A;  1HTL C;  4PJ0 E;  1GU5 A;  1E90 A;  2IPP A;  2QJK B;  4DUI A;  3TWT A;  3I5P A;  2X6I A;  4BX8 A;  1S9K D;  4YDO A;  1U7J A;  2IY0 C;  2M0B A;  2XRY A;  2OTK E;  2W90 A;  4G25 A;  4AP2 A;  3RBX A;  3W9F A;  1BLX B;  1HGZ A;  2LAH A;  1HH0 A;  4EZL A;  3KPE A;  2RG8 A;  1MKM A;  1XGW A;  3FXE A;  5E79 H;  2R3C A;  1JCD A;  3E4B A;  3VTY A;  3V2R A;  5C39 A;  4WAF A;  3ENE A;  1SQX J;  4AUW A;  1JY2 O;  4RO0 A;  2YHC A;  3L22 A;  3L16 A;  4TUM A;  3RK3 D;  3PRZ A;  2BAS A;  3HE5 A;  3SFX A;  3ASH A;  5K5G B;  4GAA A;  3U3W A;  2HM8 A;  3TXM A;  1HFA A;  2HFE D;  5KAI H;  1SQP D;  1MFT A;  3CK7 A;  2BEQ D;  3HD7 C;  3L75 G;  5LP0 A;  2KBX A;  3KZI E;  4O1O A;  2H8P D;  1E96 B;  2N1T C;  3QKY A;  5TIS E;  2OYH B;  4ZFH A;  3CX5 H;  2R05 A;  1SA4 A;  1QVG O;  4HI8 A;  2D2C C;  3TG4 A;  3AE9 C;  1SQP J;  3WUT A;  4BFR A;  3R9A B;  1RE4 C;  3AG3 E;  3FUE A;  1SQB D;  3ZKJ A;  4W7Y A;  3MIW A;  4YDY A;  3KSQ A;  2C2L A;  4I17 A;  2ZU6 B;  2NC9 A;  5FT9 A;  2KP8 A;  5LOZ A;  1OUV A;  2Y3A A;  5FIN A;  3CL3 D;  1NTK G;  1RY3 A;  3L36 A;  3NMD A;  1JY2 N;  5AQ7 A;  2X6F A;  1BSH A;  4H0L D;  4MBG A;  3CC7 P;  5B66 E;  3CCR P;  3CV0 A;  5G04 C;  1QL1 A;  3UT7 A;  2Q6Q A;  2V4L A;  3GG2 A;  1Q7Y Q;  1PAQ A;  3BRT B;  3OTN A;  3ZDM A;  2RN0 A;  4UB6 H;  1NWQ A;  1LD8 A;  1MYO A;  2B9B A;  3AU5 A;  5AVU B;  3DST A;  3CPW O;  1SQV K;  5KNH D;  4U3F G;  1AJY A;  2YNY A;  4EIJ A;  5EYL A;  3CVY A;  2KB7 P;  1KYO H;  2D2C D;  1BE3 G;  1PV3 A;  2OYH A;  3J5P A;  4Y28 J;  3BCC E;  1OWN A;  2SPZ A;  4CDM A;  3VMA A;  3BEE A;  4URK A;  5ENQ D;  1SQX K;  4UB8 H;  2ZYG A;  1UN9 A;  3UX4 A;  2WPV B;  4N3B A;  2DVW A;  2IBZ G;  3ONK A;  1DCE A;  2GRR B;  4L1B A;  4TT3 H;  2XEN A;  3IHV A;  1RE3 C;  2H88 C;  3NZU A;  5BPP A;  1Q2N A;  2K37 A;  1HZ4 A;  3U1A A;  2XGS A;  2RFA A;  4HI9 A;  1IJD B;  2OTL P;  2HYN A;  4Q94 A;  2A06 G;  2WTY A;  3F5H A;  1SLQ A;  1RQU A;  2E42 A;  2HE0 A;  1RF1 A;  1KYO I;  1EZV G;  2JWD A;  5APT A;  1P84 H;  1OX3 A;  5TIS H;  3CCJ P;  3FTY A;  1OVR A;  1LT9 B;  3D70 A;  1K9M Q;  2KI7 B;  1SQP K;  5APS A;  2DBA A;  1D7M A;  1KD1 Q;  4M7C A;  1KB9 E;  1CI6 A;  5EKQ D;  3E34 A;  4JVS A;  5ITZ F;  5KLV E;  3AS4 A;  1PGO A;  2PRR A;  2ZVN B;  3EHQ A;  4HLL A;  1OT8 A;  2IU1 A;  1OVU A;  2GRM A;  3UIN C;  3PEV B;  4ANX A;  2IBZ I;  1X8Y A;  4XX5 A;  4AJW A;  4FC8 A;  5AQA A;  2IDB A;  5E79 E;  2M8R A;  2R5D A;  1JWF A;  4HYT B;  1RE3 A;  4O60 A;  1OWL A;  1NU1 K;  2VSO E;  2GUV A;  4GOD A;  4BXL A;  3MKQ B;  4C9B B;  2KZT A;  1NA3 A;  1K05 A;  3T5X A;  2K9J B;  1YYC A;  1Y9B A;  2G8Y A;  3ASO E;  3DXK G;  3P1U A;  5CHE E;  1T3U A;  4OWF A;  4L75 A;  1YYH A;  3CQC B;  3Q5M A;  1M57 D;  2L0I A;  1JPL A;  4XIF A;  2V4H A;  1N52 A;  5CMW A;  4BWR A;  1BCC J;  2FFD C;  1NTM G;  2IFU A;  3DSU A;  2QG4 A;  2XCC A;  1KFM A;  2WXF A;  4LLH A;  4G23 A;  1SQP E;  3PZ3 A;  5GTI E;  2NPS A;  2MOW A;  1T3J A;  2V5Q C;  3CI9 A;  4HXI A;  4FUL A;  2IX7 C;  5GTI H;  2DW3 A;  2LXC B;  1FZC C;  2FFD A;  4GMJ A;  3RU0 A;  5EDS A;  4D10 C;  4TLF A;  1E79 H;  5CCH A;  3PZ1 A;  2IBZ E;  2Z5H A;  3FX0 A;  2WM9 A;  3HE4 A;  5CCG A;  3LDZ A;  4N2S A;  1USD A;  2KZJ A;  3DSW A;  4LUN U;  2DZN A;  3GMA A;  3Q1M A;  4FAD A;  1HG5 A;  3CSF A;  3G3Z A;  5ENO D;  2X6K A;  5G04 J;  1L5J A;  2OVF A;  4WWN A;  3OXG A;  1FOS F;  1FE6 A;  2DYR E;  4MS6 A;  2H7H A;  3H1K E;  3KEA A;  3RK3 B;  1EDJ A;  5BXO A;  2ZT9 B;  5AJD A;  4JEH A;  2P58 C;  3ZGQ A;  3D9K A;  1JCQ A;  1UW4 B;  4UQX A;  4ATG A;  2LSV A;  2LUH A;  2XKM A;  1LWU C;  5BU5 A;  3DRA A;  1PY1 A;  4L76 A;  4JPS A;  4FA6 A;  3EFG A;  3UUX A;  2LSU A;  2BCC D;  3WUV A;  1JCC A;  2C0X A;  1ELK A;  3FTX A;  4EYY Q;  1FZC A;  1JM0 A;  3EHM A;  1EDL A;  3U66 A;  1H6K A;  3CWB E;  4PD4 I;  1ZN5 A;  1M90 Q;  1D8E A;  3HYM B;  2P9L G;  1P84 I;  3L35 A;  3TGU E;  4K03 A;  3VYI A;  2KK7 A;  1IK7 A;  1YIJ P;  2HLO A;  4WY4 A;  3VTP C;  2WQY C;  4XFJ A;  2HO1 A;  3UIA A;  5FJY A;  3QK0 A;  1VPC A;  3CXH E;  5IY5 E;  2KLU A;  2IYP A;  3JYS A;  3FUJ A;  2EIL E;  1NO4 A;  2E75 B;  1YA0 A;  4W9R A;  2ZGD A;  2CPB A;  1ZLL A;  2N9B A;  4CGV A;  2VJ8 A;  1ZP0 C;  3Q9N C;  4U3F J;  3G71 P;  4G1T A;  3ZXP A;  4IFF A;  3CVN A;  5CRU A;  1NFI E;  2HOD A;  1FS0 E;  5AVZ B;  4PV1 B;  3T97 B;  2XEH A;  4OGQ C;  2ZT9 D;  3KZI H;  4GOF A;  1KV4 A;  3HE5 B;  3F89 A;  3H1J E;  4EOT A;  1OVV A;  3EU5 A;  2NPS D;  1NTZ G;  3Q47 B;  1WG0 A;  3MYV A;  3L70 G;  4WWO A;  3SQV A;  2NXP A;  4F3V A;  2E76 B;  3PE4 A;  1MFZ A;  2ZYA A;  2IYO A;  2IBZ D;  2XRZ A;  4L2L A;  3FY4 A;  3T5V A;  5EX3 A;  3ULY A;  4I2Z A;  1G2C A;  1MHQ A;  4CDN A;  3L72 E;  3CCU P;  1S63 A;  3GHG A;  1KN7 A;  3RL0 C;  1TNY A;  5KJM A;  1W2B O;  2ETC A;  3IXE A;  2CHZ A;  4WY4 B;  3PLN A;  2LKM A;  1LTJ B;  2R03 A;  2A45 G;  1L0N D;  1RH5 B;  2J07 A;  3O8Z A;  2XEV A;  4JA7 A;  4IL6 E;  3PNL B;  3HRN A;  4N5Q A;  3NZS A;  3ABV C;  2E5Y A;  3HVE B;  1IHB A;  1HBW A;  2Y0E A;  2LXB A;  3A0H H;  3AED C;  2QRX A;  2L6B A;  5TJH A;  4ZHB A;  1VF5 B;  3PH0 A;  5CER B;  5FTP A;  2UWJ E;  3AE4 C;  4I6E A;  4O6F A;  1TN8 A;  4BRY B;  3L4F A;  3HIZ A;  4I43 A;  1OW7 A;  5AW0 B;  3CX5 E;  4ILH B;  3ZRH A;  3SBT B;  1BI7 B;  4Q69 A;  3TAX A;  4AQR D;  4HS2 A;  3ZYL A;  3UIO C;  3Q78 A;  3B5N D;  2GM4 A;  1L0L K;  4LGD E;  4YVO A;  3Q15 A;  1S0P A;  3R4Y A;  1HE8 A;  3ASF A;  5KJN A;  2LR2 A;  2UY1 B;  3JCU E;  1WM5 A;  3G2T A;  1JOC A;  2O01 J;  2IJG X;  1VF5 C;  4BWN A;  5ANL A;  3QAR A;  2KC7 A;  4F1P A;  3QDN A;  2WQ7 A;  1ZU2 A;  3WMM 0;  1NKZ B;  3L73 D;  3I56 P;  3CIA A;  2L5G B;  3MZL B;  3BRV B;  5AJL A;  3TWR A;  1A5E A;  1QNF A;  1Q86 Q;  3UPV A;  2PM6 A;  3SWF A;  3CCL P;  3MUD C;  2J49 A;  3HRA A;  1S4X A;  2AXZ A;  3GF3 A;  2ZIS A;  1KMI Z;  5KJL A;  1KB9 D;  2KUB A;  4HRM B;  3ZYK A;  2IZ0 A;  4JC8 A;  4JD2 G;  1EZV E;  1SVF A;  4ACL A;  3RGU A;  1JMM A;  5APQ A;  2R59 A;  3NBN B;  1NHL A;  1OWM A;  3B5N C;  3D6Z A;  3PEU B;  3S7B A;  2E74 B;  2J9Q A;  3L74 G;  3JCU H;  3CHQ A;  2KOG A;  2PQN A;  3B7T A;  1CZQ A;  1M1J C;  1AFO A;  2M5A A;  2JO1 A;  5CMZ A;  3KYQ A;  1IFN A;  1Q82 Q;  1TN7 A;  3ZU7 B;  1X22 A;  3AE8 C;  2CFZ A;  1GK6 A;  4GYO A;  3FU5 A;  2I6H A;  1N4R A;  3F6Q A;  4FHK A;  1G1I A;  2D2C B;  1N54 A;  4U07 A;  4DI4 A;  5ARG A;  3D9J A;  2OYH C;  1K1A A;  1UJJ A;  2AXC A;  2M3B A;  1Q90 D;  2KNC B;  3U1C A;  4NUR A;  2O1J A;  4YDW A;  4GYW A;  2JP3 A;  2MHK A;  2FYN C;  1N95 A;  2PP6 A;  1K73 Q;  1VQK P;  1HVV A;  2ZGG A;  4C7N A;  3HD7 B;  2QJY B;  3Q2Y A;  4GZ6 A;  3VP8 A;  1K1B A;  3FTW A;  4IN3 B;  3PDN A;  1FDI A;  4APF A;  1U2V G;  4I6J A;  4GT1 A;  3UM1 A;  3WUU A;  2QY7 A;  3C9I A;  2AVP A;  3SFY A;  3RO2 A;  1UII A;  3V79 K;  1N7S C;  3V2X A;  1P5Q A;  2WMM A;  4HKZ H;  1E8Z A;  3FH5 A;  1HJ0 A;  1FU1 A;  5KAF H;  4GCN A;  1L0L D;  3UI2 A;  4DX5 D;  1O5M A;  1N94 A;  5L8R J;  3UKR G;  4RQI A;  3CCE P;  5EFW B;  2XS8 A;  2YKQ A;  1URQ C;  1QLE D;  4WND A;  2JDI H;  4I7Z B;  4HRL A;  1J1E C;  3L72 J;  1VQN P;  3FGA D;  5CEA A;  2Y69 E;  4WVZ A;  1Z56 A;  1H2T C;  4KHX A;  4ATZ D;  3BCC J;  5ARF A;  4L9P A;  1SFC A;  3U59 A;  4J8S A;  3H25 A;  1WRG A;  3G9R A;  4FJZ A;  2QJP B;  3ESK A;  4LG6 A;  5EN5 D;  3L37 A;  3EJN A;  2LO6 A;  2VQ2 A;  1FZE A;  1EZV D;  3KSL A;  4UQY A;  2K3R A;  1TNU A;  3TWW A;  5AVR B;  2WSE H;  1Y6I A;  2ETB A;  4FLH A;  1T6A A;  3ISM C;  3L70 D;  2FXM A;  3P8C D;  3MD0 A;  3PS6 A;  2J08 A;  3L74 D;  2HR2 A;  2F0Y A;  3D9M A;  3H6P A;  3CEQ A;  3FWN A;  3W67 A;  4I7Z C;  1SVX A;  1JY3 N;  2WMN A;  5G55 A;  1NH4 A;  2E74 D;  1SQV E;  4MRU A;  1X5B A;  4YTP C;  5AW2 B;  1GTW A;  5DJT B;  2XGO A;  2UWJ G;  5EID A;  2A4Z A;  3G2W A;  1MJ0 A;  3CHO A;  3IEG A;  4J8F A;  1N7S B;  5AAR A;  1BE3 J;  1FC2 C;  3O4Z A;  1D9S A;  5KLI C;  2LAI A;  1ZB1 A;  4IL6 H;  5CBN A;  1NTM K;  3TWV A;  4GYY A;  1BCC G;  4LCT A;  2V7Q H;  4GZ3 A;  1TJC A;  4RES B;  3Q9U C;  5EIB E;  2UY1 A;  5ENR D;  2QJY C;  5APW A;  1NU1 D;  5BXU A;  3IBE A;  1SFC D;  2FYN B;  1H2V C;  2P7J A;  2KSJ A;  2WPR A;  2XGM A;  4IL6 X;  5AVX B;  5M72 A;  1JCR A;  3QAQ A;  4U7E B;  5B5E H;  1HXI A;  2WPS A;  2HYZ A;  4CYM D;  4OAV B;  1EPU A;  3LS8 A;  2V4H C;  4B93 B;  1NTZ E;  2B6C A;  2QC9 A;  3P2B A;  1H6P A;  2P9I G;  1SQV J;  1FZA A;  5AW6 B;  1VQ5 P;  1M56 D;  1SQQ D;  1KC8 Q;  3WG7 E;  3CC4 P;  2RKL A;  1M1J B;  4B0Z A;  3KS2 A;  1IFD A;  4BET A;  3C98 A;  1L4A B;  2NSZ A;  2XZR A;  3G6E P;  2MKV A;  1IQR A;  3MZW B;  3S9O A;  1KZP A;  3B5N A;  3AU4 A;  3D9O A;  4ILG A;  3FUI A;  3RBZ A;  3CXH H;  3CVX A;  3G2V A;  3LY7 A;  2WMO A;  1NL4 A;  4C0M A;  2P67 A;  3AE3 C;  3I55 P;  3PNT B;  2FYU K;  3L82 A;  1N9A A;  1GK4 A;  1SQV D;  1A17 A;  3QB2 A;  1SS1 A;  1LP1 A;  3ZYM A;  4BER A;  3O6Q A;  3IFM A;  4L73 A;  3FWV A;  2I8D A;  4Y99 C;  3RJV A;  5D66 A;  3OJA B;  1VDY A;  1SZ9 A;  1LT9 A;  3CST A;  3II6 A;  3ZW3 A;  3JCK C;  4PH4 B;  2GRP B;  2VGE A;  3ZHE B;  3ESL A;  3D9N A;  3NFQ A;  4WNG A;  4NRH B;  2XPI A;  4GB9 A;  2KSE A;  1GMJ A;  3C5R A;  2Y0B G;  2YXQ B;  4RSY A;  3CXH I;  3MP7 B;  1KZU B;  1GDT A;  2P9K G;  4AYC A;  3ZFW A;  1QL2 A;  1K04 A;  1M1J A;  2NRG A;  2E5T A;  2RH0 A;  4A1S A;  1KT0 A;  3B7B A;  4L7T A;  2JLB A;  3NQP A;  4APO A;  2O1K A;  4JZY A;  4K5A B;  1Y8A A;  2LXM A;  4IYP A;  1JNM A;  2OV8 A;  4CGW A;  1CW5 A;  1NTZ D;  1WAO 1;  4I1L A;  2K1A A;  2J09 A;  1A02 F;  4I9C A;  1LTT C;  5C2Y A;  1NTK K;  1IC2 A;  1N4P A;  3E33 A;  3IKO B;  4TXP A;  1LGH B;  3IF4 A;  1PGP A;  2WVR A;  3FU0 A;  5AW3 B;  1E8X A;  3LYA A;  5BW8 C;  1SQB G;  3DSS A;  3RK2 B;  3U9W A;  1G3N B;  3E1I A;  2WT7 B;  5FQ7 A;  4DK5 A;  3TDK A;  2WSS H;  4C48 B;  5A7D B;  3FTU A;  2H43 A;  4GU5 A;  4LER A;  4PS8 A;  1YTZ I;  1T2K D;  3Q75 A;  3KXD A;  1OCC E;  3QWW A;  5DBK A;  3ZYQ A;  1SQP G;  2QSI A;  3RL0 g;  3Q7F A;  3RIB A;  1RW2 A;  3FWL A;  2O01 N;  1KYO E;  3H1L E;  1VQP P;  2IOS A;  1YBK A;  1OWO A;  3LY9 A;  3L6A A;  5D0O D;  2QYU A;  1FJK A;  3CR3 A;  1PPJ D;  2C0W A;  5AVS B;  1UJK A;  4D6T J;  3T8K A;  2HG5 D;  2G3A A;  2OYO A;  1NU1 J;  1S5L X;  2W6A A;  4HB1 A;  3V2N A;  2BED A;  3BQO A;  1NYH A;  4RG9 A;  1FT2 A;  2Q1K A;  3LID A;  4OGQ B;  4F1S A;  2C0M A;  3A2A A;  3DBS A;  4EDF A;  1P84 D;  3UTM A;  4BTB A;  3JSV C;  3BVH A;  4U95 D;  3R7Q A;  2PL2 A;  1NAF A;  2C9L Y;  1SZA A;  4XE5 B;  2KNC A;  1HG2 A;  3AE5 C;  2IF4 A;  3C72 A;  2WQ6 A;  1NA0 A;  4DLQ A;  1DEB A;  3FU6 A;  1MX2 A;  4M3L A;  2H89 C;  3FUM A;  1T2K C;  5AN8 A;  4DX6 D;  5J08 A;  4JHJ A;  4ZMD A;  1A02 J;  4PD4 D;  1H8A A;  2ZXW E;  1S5L E;  4JBZ A;  4XZ4 A;  2KAT A;  5KLV G;  4N2Q A;  1S5L H;  1VDF A;  1KIL E;  3HE4 B;  1Q81 Q;  4YXD C;  3W9G A;  3HXC A;  2W6J H;  1N0Q A;  5HQ8 A;  3H32 A;  4I6G A;  3AE1 C;  5HI7 A;  3H1L G;  2P9U G;  3AS8 A;  1MQS A;  1NTZ J;  3AEC C;  4UWG A;  4PD4 H;  2KS1 B;  3P7K A;  1OWP A;  5HRY A;  3CCQ P;  1FOS E;  1JUN A;  4JYC A;  3WU2 H;  5AW9 B;  3PUK A;  2L91 A;  5CCL A;  3GLM A;  1MV8 A;  3GZ1 A;  3RK6 A;  2FBN A;  4LSZ E;  1NTZ K;  1LWU B;  2FKW B;  4KJM A;  1GL2 A;  2A06 D;  3NOC D;  2OAR A;  4ANU A;  2GRQ B;  3AE2 C;  1TN6 A;  3TG5 A;  3CK9 A;  3URZ A;  2IQC A;  4JL0 A;  4R4M A;  2QA4 P;  1AVY A;  2X38 A;  5KKZ C;  1QEX A;  3L75 E;  3OXL A;  3VTX A;  3JC2 2;  3MX3 A;  5FQ6 A;  3VLF A;  1VL2 A;  4AY6 A;  4R4L A;  3HXB A;  4U0U A;  3NOG D;  4I2L C;  5G05 C;  3C1L A;  3FEX A;  3TXN A;  1X0T A;  2OVB A;  3CX5 D;  1NP7 A;  2IFM A;  4KZ0 A;  4XKC A;  4I9E A;  3SZ7 A;  1ZME C;  4UI9 J;  2YIN A;  1FZC B;  3V2O A;  1JTH A;  3ML8 A;  3V6I A;  4H44 B;  1VQM P;  3EWK A;  3X2Q E;  2FYU G;  4UWH A;  3VN0 A;  3D9I A;  2XNX A;  1H89 A;  1SQX G;  2P1J A;  2CPS A;  1EQ7 A;  4TUU A;  5D0Q D;  3APF A;  1NU1 E;  1EDI A;  2FEZ A;  2C0L A;  1U3D A;  5AAO A;  1FZF A;  2KM4 A;  5E76 A;  5JA4 D;  2WB2 A;  2EIJ E;  2ZXX A;  1G1J A;  2A45 I;  1ZV8 A;  3CKC A;  4KXK B;  4DLO A;  4FLB A;  3S7J A;  2WT7 A;  2WSC H;  3MA5 A;  3FXD A;  3SGH A;  1JWG A;  1UOH A;  3CKB A;  3PE3 A;  1WT6 A;  3CWB G;  1URQ A;  1X79 B;  3BU8 A;  1KT1 A;  1WY6 A;  3V4Q A;  4GA1 A;  3UMV A;  1S2E A;  2FO1 E;  3RRN B;  4I1O B;  1X9V A;  3BCC G;  3I4G A;  1LTS C;  2FUL A;  1L0N K;  4HOS A;  4ACK A;  2L9B A;  2YIU B;  2WXP A;  2YHE A;  2JAB A;  3CC2 P;  4WNE A;  2B87 A;  2RMZ A;  4NAC A;  1KOR A;  4U3F E;  4ZNC A;  1S64 A;  3H1L J;  1RF1 B;  3PJS K;  3L75 D;  1NTK J;  4N3Y B;  4GTP A;  2OQQ A;  1MUU A;  2J4B A;  1LNQ A;  4H0L B;  1TJF A;  2IO2 C;  4F53 A;  1YI2 P;  3O48 A;  4IFM A;  3H1H G;  3MCX A;  2L0T B;  3PZ2 A;  4Y6W A;  2BCC E;  3ASG A;  2DWZ A;  3V4W A;  1HUC A;  1UG3 A;  5JHB A;  3NXS A;  2RKK A;  1PZQ A;  4BSX A;  5FIO A;  3K9I A;  2DYS E;  3FUH A;  4GTQ A;  3NAW A;  3A5T A;  3SF4 A;  3RK3 E;  3S1K A;  3ONL A;  4H13 C;  4OVU A;  1V54 E;  2R5S A;  3R7R A;  1RHZ B;  4EI2 A;  4GTM A;  4BES A;  4FP7 A;  1NI1 A;  4IRU A;  4ASW A;  5AW4 B;  1NU1 G;  3V30 A;  3VMX A;  3KD7 A;  4JQ0 D;  1SA5 A;  3J5Q B;  3LPZ A;  1VQ8 P;  2OYI A;  5AW5 B;  1E5W A;  2WZ7 A;  3GW4 A;  1BD8 A;  4JB8 P;  3C8V A;  1GZL A;  1PP9 E;  3Q5R A;  5LCW C;  2FYZ A;  2GGF A;  3MJW A;  1DD4 A;  3E30 A;  2BCC G;  3BAT A;  3T8M A;  3FH7 A;  3VOP A;  3L72 D;  2JEK A;  4G24 A;  1E7U A;  3CX5 I;  3HD7 A;  5KLV J;  1GL2 B;  2XU6 A;  3BAS A;  3MKQ A;  1YMP A;  2PFX A;  5ENN A;  1DIP A;  3QNK A;  3UM0 A;  3Q49 B;  4GTR A;  1HGV A;  4UWF A;  3L73 G;  3RRU A;  3UIP C;  1BGY J;  2R5B A;  1LTJ A;  3HG0 D;  2GA1 A;  3PVL A;  3SNX A;  2Y0C A;  4WWP A;  1JUQ A;  3L70 J;  1LT1 A;  2YMY A;  2IZ1 A;  4QFV A;  4PS7 A;  1RZ4 A;  4IFD K;  2V8S E;  2AWI A;  3ABM E;  4H13 B;  2CHX A;  3LCA A;  1IZN B;  2QZA A;  3LW5 J;  3B95 A;  3H1L D;  1FCH A;  2GRO B;  2YKP A;  3P8C E;  1SQQ J;  1URQ D;  3ZEF A;  3PRE A;  4JXT A;  4CCA A;  3LJN A;  1LF8 A;  2VSY A;  4YND A;  2N1T B;  5KJK A;  5B5E E;  1J1D C;  1VQO P;  3LXU X;  3M0D A;  2AXU A;  3GF7 A;  4MN4 C;  1P84 E;  2FYU J;  1SQQ K;  3LJ3 A;  2Y1L E;  2VYI A;  4O9B A;  1TEZ A;  4JHK A;  2PZI A;  3DSX A;  3CLQ A;  5ENT D;  1JY2 P;  1SW6 A;  1NTM J;  1O1S A;  2WXI A;  3HXF A;  5EYP F;  2R2L A;  1MZ9 A;  1IFI A;  3G2U A;  1RF0 A;  2CG2 A;  3ULE G;  5H2F E;  1N73 A;  4WY4 C;  3H1K G;  3IR9 A;  4YDE A;  4B8C B;  2AEM A;  2X6H A;  1BSN A;  1KIL B;  4UB8 E;  2WXJ A;  4U0Z A;  1L4A C;  1Z5S C;  2AXV A;  1CSB A;  2NZ2 A;  1N73 C;  3MGN A;  1YTZ T;  2Y4T A;  2Q3E A;  4W80 A;  1R8E A;  4WWI A;  4UI9 C;  2V7Q J;  2Y0D A;  5CED B;  3RKV A;  3CVP A;  1W2E A;  4G26 A;  2PM7 A;  2J59 M;  1FPP A;  4KBQ A;  3EQ2 A;  3L74 E;  4DJG A;  1LTB C;  2M5A B;  1KQG B;  2EIN E;  1N2D C;  5AW7 B;  1LTA C;  3L13 A;  4DX2 A;  1FZB A;  4IOI H;  3M0A A;  3AEF C;  3TGO A;  3G4S P;  1EZV I;  2E2E A;  3H32 B;  4YXW H;  1H6O A;  1AV1 A;  1QBQ A;  1AA0 A;  1OXJ A;  3CVW A;  3KEZ A;  3P32 A;  1NTK D;  2NPS C;  1M7L A;  4XKB A;  3H1H D;  5AVY B;  4UI9 K;  1W5C E;  3MV2 B;  4AVX A;  3JQ0 A;  2WXK A;  5KAF E;  1S70 B;  1EXI A;  5ENS D;  5FQ8 A;  4L23 A;  2FF4 A;  1ZBP A;  5BNW A;  2FXO A;  2WQH A;  1FT1 A;  3APC A;  4P29 A;  3ZPJ A;  4C7R A;  5KBA A;  1HF8 A;  3H1H J;  3V31 A;  3FFL A;  2E76 D;  2VSX E;  4JF7 A;  1KB9 H;  2AEF A;  1PP9 J;  1M8O B;  3E7K A;  3D9H A;  4CT4 A;  2X6J A;  3V2Q A;  1HO8 A;  1TYQ G;  3UXG A;  2QIW A;  1B89 A;  5AQB A;  2OYI C;  2R02 A;  2KYV A;  3FEY A;  1E8W A;  4A63 B;  4U7J A;  2WVI A;  2XZT G;  3L73 J;  3H1K D;  3TNU A;  2J4D A;  1Y47 A;  4N39 A;  4A55 A;  5ENP D;  2EIM E;  3A0H E;  3SBS A;  1EF1 C;  1O1R A;  5APV A;  3ZVV A;  1N7L A;  4LRZ A;  2QM7 A;  4G8K A;  5KJ7 D;  2XQ0 A;  4GZ5 A;  4LNG A;  1X81 A;  1UN8 A;  4GZC A;  1URQ B;  5T3R A;  4I6M C;  4H13 D;  4ABN A;  2OOE A;  3TF5 A;  1Z3X A;  4IUL A;  2EIK E;  3UM2 A;  4F6R D;  1BE3 E;  2XCB A;  2YO2 A;  3B8E B;  3GW6 A;  4Z68 A;  2BEZ F;  4E85 A;  3H1H E;  2FI7 A;  2GRL A;  2I9C A;  3I3N A;  4DX1 A;  4XEI G;  4B89 A;  3TGU D;  3H1J G;  3SWK A;  5FZS A;  5CJ4 A;  2A45 H;  3B71 A;  3IN6 A;  3B7S A;  3D9P A;  4WNF A;  5B66 H;  1H0T A;  5GTH H;  1GW4 A;  5AW1 B;  2ZFC A;  3CCV P;  3D3M A;  4GTT A;  3G2S A;  4N3C A;  1FDO A;  3MGB A;  3Q4A B;  3M0D C;  1WDY A;  2XEE A;  5KJ7 C;  1VQ6 P;  3M9Q A;  1DD3 A;  2HPC A;  2WXO A;  3DEO A;  3AG2 E;  3E32 A;  1EDK A;  2VGY A;  2BKK B;  2IOL A;  3DEP A;  1KLX A;  4EBA A;  3RK2 C;  3MHV A;  4ZKU A;  3PZ4 A;  1PP9 D;  3Q5S A;  2XHE A;  5AVT B;  1JEK A;  3UM3 A;  2W6B A;  5KJ7 A;  2W27 A;  3H1I G;  2AW6 A;  3AAA C;  3D9L A;  5KLV D;  1SQB E;  5CJ0 A;  1S1C X;  5JJ7 A;  4OYS A;  3UT8 A;  4F7A A;  3OW2 O;  3BG1 B;  1LT9 C;  2O01 H;  3H1I D;  1HS6 A;  2H6H A;  2V0P A;  3SFZ A;  1IYG A;  1SQQ E;  3ZN3 A;  2C9N Y;  1NVO A;  1RQV A;  2WIT A;  1YHQ P;  2QM8 A;  3L72 G;  1N4Q A;  2F37 A;  3E37 A;  3JUI A;  5KAI E;  4Z1M H;  3M9H A;  4K5B A;  2HR3 A;  4J8D A;  3HTK A;  2KXP B;  4YPC A;  4X8Q A;  3SHF A;  3FTS A;  2I1J A;  3LY8 A;  4JW1 A;  2ITA A;  3CCM P;  2H6I A;  4R7L A;  1PPJ E;  4OVV A;  3HD7 D;  2B0O E;  3TWQ A;  4A3T A;  2E0I A;  2B88 A;  3QH9 A;  4H44 C;  3AS5 A;  3FU3 A;  1LJ2 A;  4RVB A;  1L0N J;  2BF0 X;  3CXH D;  3OAW A;  1NGM B;  1WMK A;  1XTC C;  2Q9I A;  4K0R A;  5H2F H;  4NPE A;  1SQQ G;  2VTB A;  1BDC A;  1Z6T A;  5KTB A;  4HLE A;  3LVQ E;  4GKG A;  4PD4 E;  2V5F A;  5D2M C;  4J7W A;  1N8R Q;  3HHM A;  4HRN A;  3Q73 A;  1OW6 A;  3GHG C;  2H6G A;  3B7U X;  3AE6 C;  3HXE A;  4BT8 A;  1U7M A;  4KZC A;  4K35 A;  4D6T G;  3HTK B;  5T4Y A;  1ELR A;  2I1K A;  2KCL A;  2YKO A;  2YXR B;  5E75 A;  3KAE A;  3MKR A;  5CMY A;  2B87 B;  4XA4 A;  1AQT A;  1RF1 C;  1Q2Z A;  1W3B A;  1DNP A;  4H44 D;  3TWS A;  1YJN P;  2JWA A;  2WXL A;  2AJA A;  4K5C A;  3AE7 C;  3HUS A;  1KQS O;  5APU A;  5APX A;  3C3O A;  4B8A A;  5J90 A;  4OH8 B;  5FZQ A;  1T8Z A;  5LFA A;  4GA0 A;  1NOH A;  2KCV A;  2NYJ A;  2WSF H;  3RO3 A;  1ZRT D;  3BUA A;  1JMB A;  3A0B H;  2M3E A;  1KIL A;  4U96 D;  4DPR A;  3IHY A;  2XDJ A;  3SY2 A;  2Q7F A;  2IEJ A;  2K9Y A;  2KCK A;  5JJT A;  4BX9 A;  4I1M A;  2CG3 A;  3DWL G;  4AM9 A;  5KLV K;  1JO5 A;  2QEX P;  4CPG A;  1N73 B;  1JY3 P;  1EYH A;  3ML9 A;  1UIX A;  2W83 C;  1L0N E;  1BE3 D;  4LC1 A;  1KIL C;  3L75 J;  1M1K Q;  3S2A A;  1G2C B;  3GHG B;  2BTD A;  2XS1 A;  4U04 A;  1NJI Q;  1KZO A;  1AP7 A;  3L71 D;  1H0T B;  2WSF J;  3A0B E;  1ZW0 A;  2GRN B;  5CEC B;  3JQ1 A;  4HQD A;  1NTK E;  3Q79 A;  4GCO A;  3L71 G;  1KQF B;  4HOQ A;  3EUV A;  3EDT B;  4KYO B;  4LEU A;  3TK1 A;  1OY3 D;  2HPC B;  5G05 J;  3MV3 B;  4HOR A;  3S7F A;  4EEC A;  4RG6 A;  1SQV G;  2QJK C;  1AVO A;  3N7N A;  3USS A;  3I4R B;  4GML A;  3Q3D A;  5CRV A;  1N86 A;  2WXR A;  4PS3 A;  1L0N G;  4K3A A;  1HU3 A;  4HNA D;  3QOU A; 
#chains in the Genus database with same CATH homology
 5CBN A;  3TWV A;  3F6Q A;  4G8K A;  5EYL A;  5FIO A;  2LXC B;  5DJU B;  1BDD A;  2PNN A;  3UXG A;  4BEP A;  4NPE A;  4DRX E;  3ZNG A;  1N11 A;  2KXP C;  3IXE A;  2ETC A;  3Q9U C;  1LP1 B;  3J5P A;  5EIB E;  4DX7 D;  3S1K A;  1BDC A;  2SPZ A;  1EC5 A;  1BI8 B;  4HB5 A;  5ENR D;  3EU9 A;  5BXU A;  1K1A A;  4UUC A;  4GOE A;  5ENQ D;  3AJI A;  2KZJ A;  4BES A;  4F6R D;  4YDW A;  4WWI A;  2DVW A;  2DZN A;  4DUI A;  4ASW A;  1G3N B;  2XEN A;  4J7W A;  4N5Q A;  5ENO D;  3TWT A;  2KZI A;  4HRN A;  2KIK A;  3NOG D;  3V30 A;  4Z68 A;  2ZGG A;  1Q2N A;  1U7J A;  3J5Q B;  2M0B A;  4C48 B;  5CED B;  2OTK E;  4GMR A;  2A5E A;  2F8X K;  1U7M A;  1BD8 A;  4K35 A;  1IHB A;  1K1B A;  4JB8 P;  4U8Y D;  1X0T A;  1EDJ A;  3KEA A;  1BLX B;  2RFA A;  2LXB A;  3W9F A;  1S3J A;  5BXO A;  3JXI A;  4HI9 A;  2QRX A;  4CZ2 D;  2L6B A;  4QQI A;  4CYM D;  2M5A B;  2B87 B;  2ZAE B;  4OAV B;  4HBD A;  3V2O A;  4ZHB A;  3PH0 A;  2V4H C;  2XZD G;  2F8Y A;  3TWU A;  2P58 A;  2UWJ E;  2QC9 A;  4B93 B;  1H0T A;  5CER B;  3FXE A;  3TWS A;  4DX2 A;  3V79 K;  4IOI H;  2HE0 A;  5C39 A;  3V2X A;  2JWD A;  2AJA A;  4K5C A;  1BI7 B;  2WMM A;  4HKZ H;  1YMP A;  1OVR A;  2DZO A;  4TUM A;  3UI2 A;  1DC2 A;  1WDY A;  2XEE A;  2RKL A;  3T8K A;  4DX5 D;  2KI7 B;  2NYJ A;  1EDI A;  4BET A;  5K5G B;  1DEE G;  4HB1 A;  5EFW B;  3DEO A;  3ZUV B;  5AAO A;  1JMB A;  4U8V D;  1EDK A;  5JA4 D;  2Q1K A;  1MFT A;  4NIK A;  3HG0 D;  4HRL A;  3MZW B;  4EYY Q;  2BKK B;  5CEA A;  3DEP A;  4U96 D;  2MYO A;  2QYJ A;  1JM0 A;  1EDL A;  2LR2 A;  3UTM A;  1AP7 A;  4LNU D;  5ITZ F;  3MHV A;  4G8L A;  4U95 D;  1QYM A;  2RFM A;  4ATZ D;  2KBX A;  1LT1 A;  4QFV A;  3EHQ A;  3FXD A;  4HLL A;  4O1O A;  2QVA A;  1OT8 A;  1UOH A;  1OVU A;  1SS1 A;  1MX6 A;  1S70 B;  2ETA A;  4CPG A;  1K3Z D;  2BKG A;  5ENS D;  1LP1 A;  3T9K A;  4ZFH A;  4DX1 A;  3AAA C;  4BER A;  1MX2 A;  3B95 A;  4F1P A;  4LG6 A;  5AN8 A;  5AQA A;  5EN5 D;  3TWR A;  4DX6 D;  4ZMD A;  2FO1 E;  4OAU C;  4HI8 A;  4RLY A;  1A5E A;  1DCQ A;  2I8D A;  4O60 A;  5KBA A;  3V31 A;  5D66 A;  4JBZ A;  5KNG A;  3TWX A;  3HRA A;  3LJN A;  2K3R A;  4GOD A;  1IKN D;  4GPM A;  5AQ9 A;  1MX4 A;  4O1P A;  2ZGD A;  2VGE A;  2R44 A;  4BXL A;  1H0T B;  2ETB A;  3TWW A;  1NVO A;  5HS0 A;  3ZKJ A;  2F37 A;  2JAB A;  4YDY A;  1ZW0 A;  1N0Q A;  3W9G A;  5CEC B;  3Q9N C;  1BU9 A;  2B87 A;  2KUB A;  4HRM B;  4HQD A;  4ZNC A;  4K5B A;  2J8S D;  5EIL A;  3C5R A;  4BSZ B;  2HR3 A;  4NPD A;  2Y0B G;  1AWC B;  4MN4 C;  5FIN A;  3RGU A;  3D9H A;  1NFI E;  1YYH A;  5KWD A;  2Y1L E;  3NBN B;  2P2C P;  3QWO C;  4HJG H;  1SVX A;  3JUE A;  2KS1 B;  1ZXG A;  1OY3 D;  2XEH A;  3JXJ A;  4GOF A;  5AQB A;  5HRY A;  5HKP A;  5AQ7 A;  5ENT D;  1IXV A;  4A63 B;  5JMN D;  1SW6 A;  2XZT G;  1OVV A;  2B0O E;  3B7B A;  1TR4 A;  5DJT B;  2B89 A;  4J8Y A;  5CBO A;  5EYP F;  3TWQ A;  3EHR A;  1WG0 A;  2M5A A;  3ZDM A;  2B88 A;  4K5A B;  1Y47 A;  5EID A;  1MYO A;  1MJ0 A;  1YCS B;  4LSZ E;  5ENP D;  4NPF X;  4KJM A;  3ZU7 B;  2DWZ A;  3NOC D;  4K3A A;  4ASV A;  5AAR A;  1FC2 C;  1N0R A;  3SO8 A;  2V5Q C;  1D9S A;  4HNA D;  5KNH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...