5CBOA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
176
structure length
176
Chain Sequence
b'SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbp3-16,Immunoglobulin G-binding protein A
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
total genus 55
structure length 176
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cboA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cboA01
2ETCA 4LNUD 5AQ9A 5ENTD 2F8YA 2V4HC 3TWQA 2KZIA 2BKKB 2DZNA 2PNNA 3JXIA 4HBDA 5CEDB 5AQBA 2VGEA 3SO8A 3ZUVB 3V79K 3TWRA 4HI9A 1DC2A 2JWDA 5EIDA 5FIOA 2RFAA 4CPGA 5AQ7A 2KZJA 4GODA 1MFTA 2QYJA 4J8YA 1EC5A 4B93B 1D9SA 3RGUA 4O60A 1SW6A 3JUEA 1NVOA 4U95D 4BEPA 2R44A 5EIBE 2BKGA 3D9HA 3TWTA 5CBOA 1N0RA 2XZDG 3V2XA 1BD8A 5CBNA 2WMMA 4DX5D 3IXEA 1U7MA 2ZAEB 4HJGH 4OAVB 5AN8A 4ATZD 4NPDA 2KS1B 4TUMA 4YDYA 2SPZA 1IXVA 3TWSA 1DCQA 2RFMA 2L6BA 1WG0A 2JABA 2HR3A 4NPFX 1U7JA 1MYOA 1S3JA 2OTKE 4ZMDA 3B7BA 4K5BA 1BI8B 2Y1LE 4GOEA 4HRMB 1UOHA 3TWVA 4MN4C 5EYLA 3FXDA 4JBZA 3ZNGA 1X0TA 2K3RA 1AP7A 1H0TA 2XZTG 2F37A 2J8SD 5EYPF 4HI8A 3TWXA 5EFWB 4U8VD 1K1BA 4DRXE 5D66A 4ZNCA 3DEOA 1ZXGA 2Y0BG 3TWUA 1A5EA 2KI7B 4IOIH 4ASVA 5HKPA 2ETBA 4N5QA 1OY3D 1QYMA 5CERB 4NIKA 3QWOC 4F6RD 2M5AA 5JMND 2UWJE 3S1KA 3JXJA 1DEEG 2KXPC 4ZFHA 1Q2NA 4HKZH 2LR2A 2DWZA 1BI7B 4NPEA 5BXOA 4CZ2D 5KNHD 1OT8A 5K5GB 2M0BA 3PH0A 1G3NB 4HNAD 4O1PA 3Q9NC 5FINA 2AJAA 3HRAA 3UXGA 3AAAC 3EU9A 3NOGD 5ENRD 5BXUA 1MX2A 3B95A 1WDYA 2LXCB 1LP1A 2FO1E 3F6QA 2B0OE 4YDWA 1EDLA 3ZU7B 2P58A 1YCSB 4WWIA 2LXBA 5DJTB 2HE0A 2B87A 3W9FA 4HRLA 2RKLA 3Q9UC 1MJ0A 5KWDA 4Z68A 1H0TB 3V30A 3ZKJA 5ENOD 4LSZE 4DX6D 4A63B 5CECB 5ENQD 1ZW0A 2DVWA 3TWWA 5ENSD 1BLXB 1SS1A 3J5QB 3NOCD 5EILA 4BERA 5AAOA 2P2CP 4HB5A 1JMBA 2M5AB 1YYHA 1SVXA 2F8XK 4QFVA 5KBAA 5C39A 2NYJA 2XEEA 5AARA 2Q1KA 5HRYA 3NBNB 2QRXA 4K5CA 3EHRA 4BESA 3J5PA 3T8KA 4G8KA 2KIKA 4CYMD 5ENPD 1YMPA 3W9GA 5KNGA 1IKND 2KUBA 4O1OA 4HB1A 3LJNA 4K3AA 1EDJA 4GMRA 4U96D 3MZWB 3KEAA 2B88A 2MYOA 1OVVA 1LT1A 4C48B 4G8LA 1LP1B 4ASWA 1N11A 4DX1A 4BXLA 5HS0A 3FXEA 1MX4A 1AWCB 2ETAA 4EYYQ 4HRNA 1JM0A 2B87B 1FC2C 2XENA 4GPMA 4K5AB 3T9KA 1OVUA 1S70B 2ZGGA 2I8DA 4J7WA 2KBXA 5DJUB 3DEPA 3MHVA 5AQAA 2A5EA 4DX7D 4JB8P 2ZGDA 1OVRA 3V31A 1MX6A 4BETA 1K1AA 4U8YD 1BDDA 3EHQA 3UI2A 1N0QA 5EN5D 4DUIA 4DX2A 4BSZB 4RLYA 1BDCA 3C5RA 5CEAA 3UTMA 2B89A 5JA4D 1BU9A 1TR4A 4F1PA 3ZDMA 2XEHA 1EDIA 1EDKA 1NFIE 4UUCA 1Y47A 4KJMA 2QVAA 3HG0D 4ZHBA 3AJIA 4HLLA 2V5QC 1K3ZD 4HQDA 4QQIA 2DZOA 1IHBA 4OAUC 4K35A 4LG6A 3V2OA 5ITZF 2QC9A 4GOFA
chains in the Genus database with same CATH superfamily
4N6JA 4YPCA 2G3AA 2P10A 2GRMA 2IONA 5CRUA 2F8YA 3H1LG 2YO3A 4U07A 2KZIA 2CK3H 2DZNA 3QJZA 1Z6TA 4TXPA 4I6GA 3PREA 2J08A 2QSIA 4HBDA 2E76B 2AXVA 2ZXEB 2DBAA 3SO8A 3L71G 1WY6A 3TWRA 4H0LD 4HI9A 1PPJD 3HE5B 1DC2A 2I2OA 1FZBA 3L73J 1PV3A 1FBMA 1INZA 2VGXB 3EQ2A 2WQYC 3N4XA 4W80A 1N7SA 1SQVJ 3M06A 5AVUB 5AQ7A 1OW6A 4DCKA 3UM1A 3AE5C 4XKBA 2QYJA 3A7OA 3CEQA 3FEXA 1LWUB 1FU1A 1ZB1A 3CV0A 3Q3DA 2O01J 1YHQP 1V54E 4B93B 1D9SA 3RGUA 1JCQA 1DNPA 4U95D 2P7JA 3AE7C 1KZOA 5KAIE 3CVWA 1LT9A 3VMZA 3CSFA 3KDPB 4I1AA 3QAQA 5ANLA 5CBOA 2YINA 4E6HA 1BD8A 1S72P 3IHVA 4LLHA 1NJIQ 2WMMA 4L2YA 2QYUA 4DX5D 1EZVD 4AQRD 2ZT9D 2Q3EA 1IYGA 5CCGD 2WSEH 1U2VG 3SY2A 3P8CE 1HJBA 2P9PG 5AN8A 3R7QA 4XEIG 5BPPA 1SFCD 1NU1E 3JUIA 3ZW3A 3H1ID 4NPDA 4I1OB 1L0NE 1OWMA 3LCAA 4TUMA 2A45G 2BEDA 2GM4A 2RG8A 4I2LC 2IO2C 1HJ0A 3HRNA 3Q5RA 4GTMA 5JJ7A 2L6BA 3C72A 2JDIH 1SQQK 1L5JA 2XRYA 4HOQA 3ONLA 1IQUA 4A3VA 4G26A 1U7JA 4ZKPA 5AJDA 1DD4A 2FXPA 3P1UA 4FJYA 3B7BA 3VTPC 2KC7A 3EIQC 2KB7P 3PZDA 3QWWA 2Q9IA 1S63A 1JWGA 3B7RL 1N73A 1UOHA 3MEKA 1PGOA 4MN4C 3OXLA 5EYLA 1PY1A 3DPDA 2YXRB 3FXDA 3BG0B 1EDUA 1OMIA 4CT0A 1FVHA 4IYPA 1SQBE 1M1JA 4UQXA 1KZUB 1PPJG 3SNXA 2UY1B 1FE6A 3AEFC 1TU3F 1JO5A 5FQ6A 1QNFA 3HUSA 3IN6A 2F37A 2KZTB 3C8VA 4RJTA 5B3SE 5EYPF 5GTHE 4HI8A 2R05A 3TWXA 4AVXA 3UMVA 3U3WA 1ZLLA 1K1BA 4N3CA 1NGMB 4GZ5A 1IO4A 2WXMA 5D66A 1GTWA 4PJ0H 4KBQA 3FUMA 3AE6C 2WTYA 1ZN5A 1A5EA 3L70D 3TNUA 2V4LA 1O1TA 3NF1A 4EBAA 4XZ4A 1OY3D 3H1LE 1NA3A 5CERB 4NIKA 3KXDA 2YNYA 3KSQA 5H2FE 3ZHEA 4EZLA 3ESLA 3L71E 1EXJA 3FUEA 3HXCA 3GHGC 2F0YA 3O4ZA 1EZVG 4ZFHA 3HXFA 4WVZA 4WNEA 4AOFA 4NURA 5LOZA 2A06D 2ZYGA 3D9KA 1YTZT 3ABLE 3JCUH 1CI6A 2WQ6A 5AVTB 5K5GB 5ARFA 4X8QA 5BU5A 3S7BA 2R32A 3H1IG 4WWPA 2WM9A 3KYQA 2B9BA 3S7FA 2NZ2A 4JW1A 2KOGA 4DLOA 1VQ6P 1TEZA 5FQ8A 3H1KJ 2LSVA 1KPSB 3EU9A 5AW6B 1SQQD 3GW4A 2ZISA 1GL2A 2H89C 1HFAA 2WQ7A 2QG4A 3BUAA 3TJPA 1Q7YQ 3M0DA 2DW3A 1WDYA 1TNBA 4KXKB 3ZFWA 3CMEP 1S1CX 3PUJA 2LXCB 4B0ZA 2BCCD 4ACKA 4ACLA 4UWLA 4YDWA 3S9OA 1KV4A 3LIEA 3II6A 1CW5A 1NO4A 3LJ3A 1EDLA 4JA7A 1AVYA 1FT2A 3TAXA 4A1SA 2G8YA 1GD2E 5FTPA 3ZPJA 1YIJP 2Q6QA 1YYCA 2MJZA 1A02J 5DJTB 3U9WA 3MUDC 4UI9K 3NZUA 4HH2A 1BGYD 2KXPB 4C9BB 3SFYA 4ANXA 3RO3A 1HWTC 1K73Q 3B8EB 4MBGA 2M3EA 1PL5A 3ITKA 1H88A 2I1KA 3PH0C 3HDXA 1R5LA 1WMKA 3L70G 1NTZK 4LSZE 5ENOD 2GUVA 1EQ7A 4DX6D 3UT4A 2E76C 4R4LA 3RBZA 2MOWA 1HTLC 3OA7A 4NACA 3TXMA 3KQGA 3W68A 5KKZB 2JR8A 3A0BE 1OUVA 1KLXA 2RH0A 2HG5D 1VDFA 1M90Q 2FKWB 4J0UA 3QH9A 1P5QA 1HS6A 1O1SA 2LSUA 1M56D 5KLIC 4HVBA 3AU4A 3HVEB 3USSA 4HS2A 5EILA 1PPJE 3OAWA 4WNGA 1MQSA 1NWQA 2P2CP 2WXFA 3PZ4A 1JEKA 1FVFA 2K9JB 4U3FD 3PZ2A 2A06G 3D9MA 4HOSA 1YYHA 3UM0A 2WT7A 3PLNA 3LVRE 4CEMA 3LY9A 2LXLA 3PE4A 3C3QA 4C0MA 3AU5A 4QFVA 3AG4E 1RF0C 4WBAA 4OWFA 5C39A 5KCMA 5AVYB 4L23A 3P8MC 3DSWA 5HRYA 2CFUA 2OYOA 3CXHI 1KILB 4K5CA 1Y6IA 1SQQG 2VYIA 3AG1E 3ESKA 4G8KA 4CYMD 5BT1A 5T8IA 4U04A 1RQVA 1HE8A 4JHJA 4F53A 1IKND 1L0NK 4LGDE 4O1OA 4IFFA 2KCVA 4GDOA 5T4YA 5JJTA 2E5YA 4OGQB 2H6IA 2PZIA 2J4DA 1VQKP 1EZVE 3MD0A 2AEJA 4B86A 2DYRE 2FFDA 5KJLA 2E74D 2NPSD 3CVNA 1YJNP 4HFGA 3FUDA 3FX0A 3JSVC 1WT6A 3H1IE 3MKRA 4A7PA 1RHZB 3F5HA 3B7TA 4N5CA 4YVOA 3O6QB 1NZNA 5B1BE 1BGYG 1IFPA 2IZ0A 3G3ZA 5B5EH 4ASWA 1VQ4P 3NFQA 3ZEFA 3FUFA 3C9IA 3CR3A 4EI2A 4U7JA 3QC1A 4PD4I 1SQBK 3H1HJ 1HUCA 1AWCB 4K0RA 2XGSA 3BRVB 1JM0A 1NTZD 3GLMA 5AW8B 1AVOA 2OV8A 2R59A 3HD7A 2OYIB 2KBXA 4GA0A 3ABVC 4Y6CA 3DEPA 3MHVA 3B5NA 3DXKG 1MFZA 1CZQA 1PP9D 2R3SA 4ABNA 3FH8A 1YI2P 1BE3J 3V31A 2JP3A 2N1TA 2WSCJ 3HHMA 4EQFA 4JA9A 3VLFA 4U3FG 3RSEG 3UI2A 1N0QA 2QJYB 1FZCB 1X81A 3L75J 1Q81Q 4TV3A 2QJKC 4PJ0E 1BCCJ 1FCHA 2GRNB 1L4AB 5GTIH 2WITA 1UG3A 2OEVA 4KZCA 4BSZB 2K88A 3PE3A 3C5RA 3TK1A 1GL2C 4OVUA 4AUWA 2W83C 3L70E 2R5SA 4JVSA 4GTOA 3BU8A 1ZU2A 3N7NA 1YQ3C 5AW7B 2Y9ZA 4UUCA 3HXEA 2XPYA 2AW6A 4H44B 4GKGA 2HODB 2IOLA 3NZSA 4ZHBA 3CI9A 3L36A 4Y99C 3TGUD 3ZXSA 1L2PA 3ZN3A 4HLLA 5AVVB 2E75B 3JCUE 2FO7A 1TN8A 2IPPA 4I9EA 2A06E 2IU1A 2ZJSE 1LF8A 4HXIA 4U8HA 2MKVA 4WWOA 2R5DA 2YIUB 3KZIH 1IHBA 1KILD 4K35A 3I3NA 3U66A 4GYOA 2ETCA 1UW4B 2WXNA 4LNUD 2XGOA 2AXCA 2N9YB 3X2QE 2KSEA 2HPCB 1HF8A 4CCAA 1FDIA 4LRZA 2BKKB 1SQQE 3D6ZA 1YA0A 2PNNA 1HVVA 5KLVJ 2V7QJ 3MA5A 4FP7A 4H7XA 1NTZG 2VGEA 1G2CB 3ZUVB 2K1AA 3IFMA 2XGMA 3Q4AB 4G11A 3CMAP 1YJWP 4FADA 1KD1Q 4H0LB 1LTJB 1Q90D 2MRIA 3QB2A 4DK5A 2BCCE 3NXSA 1U3CA 3R9AB 1O5MA 3SSUA 3UM3A 1W2EA 1SQPE 5FIOA 2RFAA 3SZ7A 3JCKC 1GZLA 3H1JJ 1MZ9A 4CPGA 1PP9G 1HH8A 4LERA 1URQA 1WRGA 2JKVA 3FHEA 3L72J 1MFTA 3RK2B 2IEJA 1N9AA 3HD7D 3DSVA 2XHEA 3CVUA 1BGYE 3FP3A 1SQVD 2OEWA 3D6YA 1N94A 1U3DA 4XA4A 4O60A 3JUEA 1Q2ZA 4ANUA 3S2AA 3CQGB 3MV2B 2C9NY 1NTME 1TYQG 1KN7A 5AVXB 4ILHB 3V2XA 2BF0X 2NXPA 4JYCA 5A7DB 5CBNA 3CXHD 1VL2A 5AVQB 2C0MA 4NQ0A 3MKQA 1U7MA 2ZAEB 4CDMA 4HJGH 2ZT9B 3WUTA 2DCPA 3CXHH 1HU3A 4OAVB 4CDRA 2LXMA 4TXRA 3EFGA 1VQPP 1Z5SC 2X6KA 4L9PA 3UIPC 3QOUA 3I56P 3DXMG 3MIWA 3P2BA 3PEUB 3TGUG 2QY7A 3HTKA 3PVLA 3FWLA 3IEGA 1IXVA 1DCQA 2X6FA 4U3FE 2KSJA 4J8FA 3TF5A 3FU0A 1WG0A 3H6PA 2JABA 1Q86Q 3EJNA 4YNDA 3Q78A 2P9KG 2IX7C 1SP4A 1OWLA 1T6AA 3AEAC 2LO6A 3IKOB 1MYOA 1ZV8A 1S3JA 3HE4B 4ZMDA 2IBZI 3PRJA 2FYNB 2J9QA 4ILGA 3AE8C 2IDBA 4K5BA 2Y1LE 4I7ZB 2DIWA 3FULA 3H32B 2IY0C 3GHGA 3VP8A 2YNQA 3VMAA 1NU1J 3TWVA 5L8RJ 3CCEP 1PC2A 1L0NJ 2C0XA 2GW1A 4JBZA 1X0TA 2K3RA 4PD4H 3FUHA 5CCMA 1PZQA 4WNDA 3V6IA 5KJ7D 4EPZA 4N2QA 1J1DB 1GU4A 2XZTG 3FH5A 3ZIMA 1H6OA 1E8WA 3APDA 1OFCX 4D6TD 2ZYDA 3HXBA 2Z5HA 1D7MA 5LCWC 1S9KD 3ASGA 1IHGA 1S2EA 4DI3A 3AE9C 5EFWB 3S4RA 4U8VD 2WPRA 4EHMA 1IZNB 1VQ9P 2X6IA 1GU5A 3CWBJ 1P84I 1NL4A 1PGJA 2OARA 2JEEA 2KCLA 1SQVG 1BPOA 1N7SB 2YKQA 5BV1A 3VMXA 4PS8A 1ZR2A 3R7RA 1N8RQ 2I6HA 4AY6A 4GB9A 1O1RA 2AEMA 2Y0EA 1JNMA 2JWAA 2I9CA 3BASA 2EIKE 1NTZE 4PDXA 2QM8A 4XI0A 3S1KA 3WU2H 5CRVA 1HXIA 1DEEG 2FI7A 3MUDA 2LR2A 2DWZA 3AE1C 3IAOA 3SGHA 1KC8Q 5LCWJ 3RK2D 2GRPB 1LT9B 1MUUA 2E0IA 4N3BA 5KNHD 1OT8A 1JCRA 1SQXJ 1PP9E 4FLHA 2ZVOB 5BNWA 3PH0A 4JXTA 4HNAD 2VTBA 1L4AC 3H1LJ 2J4BA 2VSXE 5AW2B 4LNBA 3Q9NC 5LP0A 4BRYA 2OYHC 5BW8C 4AJWA 3KSLA 3CVQA 5CJ4A 5GTIE 3ZYMA 1H89A 3NOGD 3UKUG 5G05C 5ENRD 1VF5C 1ELRA 3SFXA 1FZGA 4GCNA 4KMOA 2QJPC 2JLBA 3L71J 1H6KA 3VTXA 3D9OA 3HE5A 1LD8A 2KNCA 3Q49B 5KJNA 5APQA 4TUUA 1RH5B 1QBQA 4GPKA 1Z56A 3RL0D 1MV8A 4WY4C 4H44C 1T8ZA 3CPWO 3QNKA 3F6QA 2L9BA 3CIAA 5B1AE 4BX9A 2IZ1A 1ZMEC 5A23A 2BASA 2E75C 1PAQA 4A55A 2WZ7A 3L6AA 5CCHD 2L91A 4F7AA 5E76A 2LXBA 1AV1A 3Q47B 3A0HH 3JQ0A 3E7KA 3U4TA 3TGUE 1N73B 2HE0A 3L16A 1RF0A 4D6TG 1S5LH 4G25A 4HOTA 1URQC 2B87A 2RKLA 3KZIE 2FBWC 3ULYA 3CCUP 4JEHA 5G05J 1KFMA 2FF4A 2RD0A 5KWDA 3B7SA 2H7HA 3CK7A 1L0LK 1KILE 3CX5I 2CPBA 4RG9A 2WXKA 1NA0A 2WXJA 2WXOA 3CL3D 4I1LA 3ZKJA 3M9QA 3MV3B 1IJDB 3HUSB 1D8EA 3MZLB 1N7LA 1SQPK 4AIFA 1LTBC 2O1KA 4A63B 3L74D 1LGHB 2XCCA 1GW6A 3KAEA 3CGHA 4J8DA 3ASNE 4ANWA 5CECB 3RK3D 3BCCJ 1ZW0A 2HR2A 3LY7A 4H0LC 2POHA 2KLUA 1IFMA 1LTJC 1JUQA 1GMJA 1BLXB 3J5QB 1TN6A 2GRRB 3K5BA 4PV1D 4B8AA 3T5VA 4UQYA 2N9BA 1RF1C 4C7NA 3G2TA 1SVFA 1TJCA 4BERA 3AE2C 3SFDC 3U59A 1IQRA 4J8SA 1M8OB 2WPSA 2FULA 3LVQE 1VQ7P 1NTKD 2F8XK 2P58C 4JZYA 1EPUA 1NTMK 4H13C 3FU5A 3CCRP 3ZHEB 1N4RA 2Y3AA 1HF9A 5AW3B 2EIME 5CJ0A 2IO3C 4U7EB 2W27A 1N7SD 4GAAA 2XEEA 5AARA 2Q1KA 3QK0A 5G2NA 1SQMA 1FZEA 3EHRA 1H2TC 1SQVE 4BESA 5JHBA 1NYHA 2KIKA 1W5CE 3W9GA 2K37A 3GF7A 4DOJA 2J49A 4HB1A 3SWYA 4O6FA 3LJNA 2ZT9C 2KCKA 5CCGC 2KZTA 2IBZD 1GW4A 1VQ5P 3PHLA 3CHRA 2J07A 4HOUA 1N4QA 3CXHE 3PZ1A 2PQRA 1SFCC 3AEGC 3PZ3A 4ANVA 3PRZA 4DLQA 3T5XA 4GT1A 1FZAA 2FYZA 5APWA 2B88A 1N52A 2OCCE 2E74B 2NPSB 2H6HA 3L35A 2ILRA 2KLVA 1NH4A 2OTJP 2PM7A 4G8LA 3ZGQA 3WUUA 3I5PA 2CG3A 3RAUA 1Z3YA 4BXLA 5HS0A 2P67A 4L2LA 4U0UA 3E4BA 2D2CD 3Q7FA 3SWFA 2VRSA 3U64A 1L0LD 2WSEJ 4AM9A 3FTYA 2QEXP 1JY3O 3UIOC 4HRNA 3BATA 3AG2E 4UQZA 2XENA 4GPMA 1SQPD 1UIXA 1OVUA 1S70B 3AEEC 1P84H 5AW4B 3Q2YA 3Q5PA 1VDYA 3EDTB 3L74G 2L0IA 2E43A 2I8DA 2QZAA 2WSFH 1FOSE 4J6IA 5DJUB 1H19A 3H1IJ 5AQAA 5APVA 1JY2O 4PD4E 4ZKUA 3LXUX 4JB8P 3BQOA 4FLBA 1Y9BA 4I1MA 4EECA 3FY4A 2E42A 2P9UG 3T97A 2JJLA 2BEZF 3RL0g 3GG2A 4RVBA 4MS6A 3V2RA 5G55A 1BDDA 3AEBC 4D6TE 1BSHA 4DJAA 3FUKA 1S9KE 1QQEA 3UUXA 2WWWA 1NTKG 1ZR4A 1NTMD 5D0OD 3GZSA 2PQNA 1AJYA 5G04C 4MLPA 2WB2A 3HIZA 3I55P 3G6EP 3EU5A 2R3CA 4PS7A 3ULQA 4YVQC 3Q79A 1TR4A 3CD6P 2WSCH 5H7PA 2VSNA 5BVZA 2WT7B 4XE0A 3P7KA 1ZRTD 4I6JA 2QVAA 4G24A 4L7TA 5AVWB 3WU2E 3AJIA 1E5WA 4KZ0A 2IBZG 5CHXA 2CFZA 3DBSA 1LWUC 1KTMA 4GA2A 1X79B 2Y69E 5AVSB 2WVIA 4HQDA 3BVHA 3LW5J 1RE3C 1RE4C 1JY2N 3AS4A 2EQXA 3QWPA 3L70J 2CG2A 1FT1A 3RRNB 3CKBA 5G04J 3L37A 4KT0J 4M3OA 4GOFA 2JEKA 3RBXA 2O1JA 3CVVA 1FOSF 2FBNA 3L82A 5ENTD 2FFDB 2V4HC 2HLOA 3L22A 4IULA 2YQ8A 3EHNA 4AEZC 2WXQA 5APXA 3PS6A 4TXQA 1L0LG 1XTCC 3FTUA 3G2SA 3JXIA 2V5FA 1NOHA 3AE3C 1GL2D 3CX5D 4APOA 4QMAA 5CEDB 3L54A 2IOSA 2XEVA 4I9CA 1NI1A 5AQBA 3GZ1A 4W9RA 2BCCG 4GMLA 3V79K 2LKMA 1QZ2A 3CX5H 1SQPG 3H1KE 1TJFA 3Q15A 3CCLP 4GTTA 3V2NA 3ZVVA 3ASDA 4ILIA 1N54A 1N86A 5EIDA 4C46A 2ONDA 3DWLG 5FQ4A 5CMWA 4GYYA 4BX8A 4WAFA 4GODA 2VJ8A 1HX8A 4B8CB 3RU0A 4J8YA 1SQQJ 4N78D 3UPVA 3FH7A 3HD7B 4IL6H 3W67A 1IK7A 1TN7A 3SI5A 2QIWA 3B5NB 4RESB 2Q7FA 4OYSA 4M7CA 2QA4P 4TRQA 1G1JA 1NTMG 4XX5A 4BT8A 4CGWA 3CVXA 1SW6A 2XV5A 4RO0A 3CVLA 3TG5A 4BEPA 1IFIA 5AYWD 5EIBE 2P1JA 2BKGA 2J09A 1OXZA 2YMYA 3KEZA 4UWFA 1EF1C 3C3RA 1NKNA 3IXEA 3NMDA 4I6MC 3L74E 2KYVA 2FYUD 4YXWH 4EBAG 3RK3E 3O6QA 2OOEA 1T2KD 4ATZD 4JYBA 3CLQA 1E8ZA 1HZ4A 3I4GA 4AY5A 1BGYJ 4AYCA 2KS1B 4GCOA 1SQVK 1XGWA 2XQ0A 1MKMA 2SPZA 2IQCA 2B6CA 5C2YA 1SZ9A 3SHFA 3FEYA 3L4FA 4KYOB 3QARA 1NTKE 3EHMA 3E33A 3ASFA 1OW7A 1VPCA 3BEEA 2CHZA 3O8ZA 2OYIA 5TJHA 2ZVNB 1N4SA 2WXGA 4LCTA 4RQIA 4AV7A 2WMOA 1BI8B 4GOEA 3CLJA 1M7LA 4HRMB 3A5TA 4GZCA 3QKYA 1JTHA 2A5UA 3L17A 3Q7AA 1ELKA 3LDZA 4GMJA 1S5LX 3ZNGA 1AP7A 3CKCA 1X22A 2E74C 2IBZE 2NPSC 2WPVB 1H0TA 2X6HA 1KT1A 3OTNA 4BTAA 3OAKA 1HBWA 1H0AA 1L4AA 1S64A 5LX8A 5KAFH 2IYPA 1JCSA 4UB6H 2J8SD 2OYHA 4UI9C 2KATA 5JJ6A 4ZNCA 1ZXGA 1VQNP 2HO1A 2Y0BG 3TWUA 2RKKA 1NHLA 4IOIH 4ASVA 2ETBA 4N3AA 4N5QA 4WY4A 2P9NG 5FZSA 4D10C 1QYMA 3FTZA 1QEXA 2M5AA 1E96B 3BRTB 3UINC 1L0LE 3FDHA 1KB9I 3LPZA 1P84E 4N3YB 4Z1MH 1HH0A 5BU8B 3JXJA 2KXPC 1Q2NA 4L1BA 2YXQB 2FYUG 2YKOA 1OW8A 1MHQA 3EWKA 4NPEA 3RIBA 5BXOA 3MYVA 3ZYKA 3L73D 3GW6A 1TNYA 3S7DA 4CZ2D 4UI9J 4WWNA 2ZIRA 4GTSA 3TL5A 2M0BA 3B5ND 3GZ2A 5E75A 1LNQA 1JPLA 3AG3E 2HPCA 3C1LA 3ENEA 5FWQA 3R9MA 4U0SA 1VQLP 5FINA 4EZKA 2AJAA 2W6AA 3FU3A 4A1GA 3CHSA 2N1TD 3FTXA 5KKZC 2PM6A 3K9IA 1SQXD 1OZHA 1NTZJ 3SF4A 3UQ3A 1B89A 5FQ7A 3VP9A 1MX2A 1OCRE 3FTWA 1DH3A 1RZ4A 2GGFA 1PIXA 3P32A 1UJJA 1LTJA 1UIIA 4I17A 3HXDA 3T8MA 5J90A 3NTNA 3TG4A 2O01H 3RL0B 3M0AA 1QVFO 1RF1A 2HYNA 2YMKA 3H25A 1LP1A 4JEUA 1LTTC 2FO1E 5TISH 4JL0A 1PP9J 4YTPC 2WXLA 3MCXA 4Q69A 1ZRTE 1FZFA 3GF3A 1D8DA 2ZXWE 1AFOA 3ZU7B 2P58A 1YCSB 4WWIA 3ASOE 1HGZA 4HORA 2LAHA 2GRLA 3V5BA 3GHGB 4R4MA 1JY3P 4LC1A 4IFDK 1KILC 3W9FA 3CHMA 4XIFA 2MHKA 3PP5A 4JQ0D 2KM4A 3SBTB 4Z68A 3JC22 5AIJA 2QFCA 3V30A 4W7ZA 5ARGA 3IBEA 1JY2P 3QDNA 5CMYA 5CCGA 4KHXA 4OGQC 4PD4D 4PS3A 1PGQA 1VF5D 3A3YB 1EYHA 1SFCA 1S0PA 2IFUA 1CSBA 1KYOI 2H88C 3RK3B 3TGUJ 5HQ8A 3CX5E 4H7YA 5E79H 4HYTB 1M57D 4BWNA 4WY4D 2FEZA 4PV1B 3NOCD 4GTQA 4I2WA 2ZU6B 4DZOA 3BCCD 3M91A 4HB5A 5AW1B 4FULA 3E30A 3L73G 5B5EE 3VN0A 2PRRA 2OQQA 1GW3A 3GYZA 4O9BA 4MRUA 3ML8A 4PH4B 4EDFA 4OVVA 4BWRA 1HGVA 2Z4EA 1USDA 3IF4A 4IL6E 3UKRG 3H32A 4F1SA 2NYJA 1GK4A 3CHPA 1VQ8P 1URQD 3VOPA 4N78E 5AVRB 3LIDA 5ENNA 3CHQA 1SQBJ 3NBNB 1LTXA 2X3MA 3DSXA 3FUNA 1H2UA 3J5PA 1G1IA 1SQXG 2OYIC 1E8YA 1PGPA 5ENPD 1DIPA 2K9YA 3A2AA 4Y6WA 3L72E 1IFDA 3D9PA 2VTBB 1OX3A 4JC8A 4K3AA 4BRYB 5FT9A 1GK6A 3DSTA 1FJKA 3A0BH 1EDJA 4GMRA 1NTKK 1QX8A 2QJYC 3CCSP 1FZCC 1VQMP 2FYUE 3MZWB 1OWPA 3NB2A 3KEAA 4IRUA 1N2DC 2KNCB 1JCCA 4FU3A 2IF4A 1LT1A 2V8SE 2XNXA 3EFFK 2HYZA 5KLIB 3DSUA 5BUZA 4UB8H 3E34A 5AVZB 3D3MA 2XCBA 1N11A 2XKMA 4DX1A 2GA1A 4L73A 1K8AQ 1TNOA 2PFXA 4H13D 4JHKA 3FXEA 3ZXPA 4B94A 3CVPA 2D2CB 2VGXA 3H1KD 3FUIA 3VTYA 5EKQD 2ETAA 3F89A 3SFZA 2Y0DA 2XU6A 4CGVA 2B87B 2O3JA 2J59M 4R7LA 3CC4P 3I5CA 2YHCA 4L75A 2ZGGA 4CDNA 2Y0CA 1KQLA 1X9VA 1LWUA 3CCQP 1UN9A 5C1DA 5KJ7C 4F3VA 5AENA 2A5EA 2R17C 4GTRA 4DX7D 5D2MC 2ZGDA 2LNIA 1KB9D 2YIUC 4IL6X 1OVRA 1RE3A 1RE4A 3KS2A 4I43A 3R2PA 3UIAA 3FWVA 1KB9H 5KAFE 1YQ4C 5B66H 4UB6E 1MX6A 1K1AA 3BCCG 2BTDA 4UWHA 2NC9A 1FS0E 5BV0A 3ISMC 1M1JB 4HLEA 3FGAD 4KT6B 2FY8A 5CHEE 2V4HA 4GZ3A 2Y9YA 4RLYA 3JQ1A 4C7NB 5CEAA 3UTMA 1HG5A 5JA4D 5M72A 1BU9A 1SLQA 4JD2G 1Y8AA 1KMIZ 3B13A 3Q75A 1SA4A 2XEHA 1EDIA 5EX0A 1YITP 1KQGB 3RRUA 1NFIE 2L5GB 3TNUB 3V2PA 2BUGA 3CSTA 3G2UA 3RRMB 3CWBE 1Y47A 3D9NA 4KJMA 3CK8A 1QGKB 3SFEC 3HG0D 4BSXA 4EIJA 4D6TJ 2J5UA 3RK2C 5FZQA 3V2QA 1QL2A 2RN0A 4Q96A 1K3ZD 3O48A 4C7RA 3D71A 3AS8A 4QQIA 3L73E 4FA6A 1LJ2A 2DZOA 4OAUC 3IHYA 4LG6A 5J08A 4G23A 5ITZF 3OW2O 1CI6B 1X5BA 3CCVP 1AQTA 2XNDH 5CMZA 3PTZA 5AQ9A 4EOTA 5DIZA 4OH8B 3TWQA 2UY1A 3CHOA 3URZA 2QJKB 1W3BA 3RL0C 1SQXE 3LW5H 1IK9A 2YO2A 3H1KG 1JB0J 2E76D 3FTVA 5D0QD 1S4XA 3EUVA 1RQUA 1GL2B 1NAFA 2FXOA 2NRGA 3VLDA 2XDJA 2UWJG 3LS8A 3L08A 1OCCE 5TISE 1OWNA 4L74A 2JWDA 2WVRA 5CCHC 4UWGA 3UX4A 2J58A 5IY5E 1KYOD 1MZCA 3C98A 4B89A 2Q5UA 2KZJA 2LAIA 1KYOH 1R8EA 1OCOE 3FTSA 4Y99B 3BG1B 3I4RB 2FYNC 1ZBPA 5EX3A 1LTAC 4I7ZC 1EC5A 2A4ZA 3ABME 2ZYAA 1P84D 1NVOA 2IYOA 1LTSC 4KVOA 3T97B 4BY6A 2R44A 2M63A 4LUNU 4E85A 3QWVA 3D9HA 3TWTA 2HFED 1N0RA 2XZDG 3H1HD 1J1DC 3RK3C 5KLVK 3LKUA 2NPSA 1AA0A 3EIJA 2KP8A 4PV1C 4DPRA 3VMYA 3FU6A 3KD7A 2ITAA 4NRHB 3UT7A 1J2JB 5E79E 3G9RA 4TT3H 3HYMB 2ZFCA 1E7UA 4BT9A 2M8RA 3UM2A 4YDYA 2PGDA 2ZXXA 2XZRA 2W90A 1ZOYC 3TWSA 5JHAA 2L6JA 3BCCE 2Z5IA 2RFMA 1BE3D 1N7SC 3S7JA 3CVYA 1OIPA 2P9IG 4Q94A 3L9TA 2AXTH 1N4PA 5AW5B 3WXXA 4APFA 2C0WA 2HR3A 5APSA 4NPFX 3L75D 1UN8A 1J1EB 1BCCD 1NAYA 3L74J 2XS8A 2OTKE 3U1AA 1OCZE 1V55E 2FYUK 1N95A 1IFJA 3WUVA 4GZDA 3AE4C 4FHJA 1JY3N 1LT9C 2QE7H 4W7YA 1YJ9P 3WMM0 1IFNA 1JWFA 1USEA 4IFMA 3FWNA 2L0TB 1K04A 4M3LA 1KORA 3ONKA 1SZAA 3FFLA 3SQVA 1NTKJ 1EXIA 2PL2A 2WXHA 2VGYA 1OWOA 1DCEA 2JO1A 3N71A 1TNZA 2H43A 2H6FA 3Q1MA 4DRXE 1FDOA 3D9LA 2GUSA 3E1IA 4LNGA 4UB8E 5KTBA 3KHUA 3CCMP 5FZRA 3ZYLA 4ATGA 4DI4A 4DT0A 3Q5SA 3DEOA 2D2CC 3PUKA 2WPQA 2KI7B 4JHRA 2EILE 2HM8A 5HKPA 3HVEA 2O01N 3B7UX 3RO2A 4XI9A 2RMZA 4I2ZA 4JPZB 2R02A 1KZPA 2K9JA 1TNUA 3QWOC 4F6RD 4WNFA 1M1KQ 5JMND 2WXPA 1NU1K 2PP6A 3DPYA 3TYYA 3H1HG 4YXDC 5KLVD 1H6PA 2Q3IA 2UWJE 1N73C 4J8EA 2AXUA 2V7QH 4HKZH 3A0HE 1BI7B 1JOCA 1E79H 2C0LA 1KILA 1S5LE 1KB9E 4GYWA 4G2VA 1M1JC 5B66E 1AQ5A 1OXJA 1PFIA 1G3NB 3H1JD 2H6GA 5CCLA 1LTGC 3HUSC 4O1PA 2FXMA 3TGOA 3HRAA 1E8XA 2Q7CA 3L72D 1BE3G 3UXGA 2VQ2A 1L0LJ 3AAAC 3SBSA 5BXUA 2N1TB 1K9MQ 3AS5A 1JMMA 2OGUA 2YKPA 3IR9A 2BCCJ 3L75G 3V4QA 2WSFJ 3PNTB 1SQPJ 3D9IA 1BCCG 1YBKA 3M9BA 3B95A 4UWKA 3SD5A 3WG7E 4CRWA 3G2WA 3NAWA 1K8KG 2A45I 2XPZA 1K05A 3G71P 2EIJE 4EZJA 5APTA 2B0OE 5LFAA 4WUYA 3VYIA 5T3RA 1RY3A 3MX3A 3CC7P 3LY8A 3OXGA 2PAJA 1NTMJ 1NKZB 3PJSK 5APUA 1VQOP 2AWIA 4C0EA 1SQXK 4AP2A 5AJLA 1JTHB 4HRLA 5M1BA 3Q9UC 4N39A 1MJ0A 4JPSA 5A6CA 4N2SA 2OVFA 4XKCA 1FJPA 2E2EA 1OWAA 1FPPA 1H0TB 3PDNA 2C9LY 2AVPA 5KAIH 3DRAA 2OYHB 3OJAB 3RJVA 4FC8A 4LEUA 2CHWA 1VF5B 3P8CD 2XRZA 5ENQD 3M0DC 1FZCA 2P2UA 1KQSO 4U3FJ 2QJPB 2KS1A 5FJYA 4GIFA 2DVWA 4BTBA 2YHEA 4ME2A 3TWWA 5ENSD 1NU1D 3CC2P 1SS1A 4AXHA 3RK6A 2W6BA 4U63A 3G4SP 5KLVG 1L0ND 3G2VA 3MGNA 3NQPA 1FAVA 4WY4B 4RSYA 4P29A 1A02F 3KPEA 5AAOA 1JUNA 4GZ6A 3ABKE 3RKVA 1JMBA 2OTLP 2M5AB 1Q82Q 2IFNA 1SA5A 1SVXA 2WXIA 3U1CA 1KYOE 2WXRA 3TDKA 2GRQB 3LEWA 1U57A 3OXFA 2V0PA 5KBAA 4I6EA 2KK7A 3H1JG 2EINE 4GTVA 4GTPA 3ULEG 2HODA 2AEFA 3CWBD 1URQB 3L72G 1H2VC 1DVPA 2QRXA 2I1JA 1EZVI 3MTUE 1NP7A 2NSZA 5AW9B 3T8KA 3AEDC 1XTGB 3IV0A 1YMPA 5KNGA 2WPVA 3APCA 2KUBA 1DD3A 5KJ7A 2W8ZA 4WB4A 3Q5MA 1WAO1 3SWKA 4GU5A 3M9HA 1SQBD 3H1HE 4OGQD 1IC2A 5AW0B 2H8PD 1T2KC 1DX7A 2DYSE 4U96D 2P9LG 3ZYQA 2LUHA 2MYOA 3MJWA 5GTHH 1OVVA 3MKQB 4PUCA 4C48B 4RKUJ 1X8YA 3V4WA 3ZRHA 2Y4UA 2IFMA 3TXNA 3C3OA 3JYSA 1RF1B 3LYAA 1E90A 1KFNA 1W2BO 1LP1B 4FJZA 1G2CA 1J1EC 2AXTE 1E7VA 1Y8MA 3H1LD 1BE3E 1RW2A 2E5TA 3HTKB 2IJGX 4H13B 4DJGA 1MX4A 4FHKA 5ANRA 3L75E 3FUJA 5EDSA 4EYYQ 3PEVB 1BCCE 4U0ZA 3Q73A 3E1RA 1FC2C 3L71D 4K5AB 3T9KA 2FYUJ 2R03A 2W6JH 5H2FH 1T3JA 3VLEA 2XPIA 5APYA 4J7WA 1H8AA 3E32A 2R2LA 3MGBA 3CQCB 2X6JA 4CT4A 3D9JA 1NU1G 4KVMA 2CPSA 3D70A 1HO8A 1FDMA 4V3IA 1L0NG 4G1TA 3B4SA 1DEBA 2AXZA 4MKTA 2Y4TA 3AECC 4BETA 4U8YD 1Z3XA 1T3UA 1QLED 1SFCB 2FFDC 1LTIC 3EHQA 5EN5D 1BSNA 3R4YA 1JCDA 4GA1A 4DUIA 1L4AD 4DX2A 1A17A 2WQHA 1BDCA 3UT8A 4BFRA 2VSOE 3ML9A 4XE5B 4XFJA 4Y28J 1ELWA 2B89A 5KJKA 2R5BA 4IN3B 4A3TA 3CWBG 4YDOA 3MP7B 2GROB 4F1PA 1KT0A 3ZDMA 4L76A 2C2LA 1WM5A 1EDKA 5DBKA 4OVNF 3ASHA 5CCHA 4YDEA 4RG6A 1QL1A 4H44D 2OVBA 3L13A 1SQBG 3GMAA 2WSSH 3CK9A 3E37A 5KLVE 2XS1A 2M3BA 1R5SA 2BEQD 2E75D 1LD7A 1QVGO 5KJMA 2V5QC 3HD7C 3HE4A 3B5NC 4JF7A 4TLFA 1HG2A 3PNLB 4K03A 3TSIA 2A45H 1KQFB 2P9SG 2X38A 3B71A 2CHXA 1UJKA 3CCJP 1GDTA 1XNFA 5HI7A 4URKA 3APFA 2WMNA 2QM7A 3V2OA 2N1TC 2QC9A 2VSYA 3DSSA 1ZP0C 3H1JE 1YTZI
chains in the Genus database with same CATH topology
2ETCA 4LNUD 5AQ9A 5ENTD 2F8YA 2V4HC 3TWQA 2KZIA 2BKKB 2DZNA 2PNNA 3JXIA 4HBDA 5CEDB 5AQBA 2VGEA 3SO8A 3ZUVB 3V79K 3TWRA 4HI9A 1DC2A 2JWDA 5EIDA 5FIOA 2RFAA 4CPGA 5AQ7A 2KZJA 4GODA 1MFTA 2QYJA 4J8YA 1EC5A 4B93B 1D9SA 3RGUA 4O60A 1SW6A 3JUEA 1NVOA 4U95D 4BEPA 2R44A 5EIBE 2BKGA 3D9HA 3TWTA 5CBOA 1N0RA 2XZDG 3V2XA 1BD8A 5CBNA 2WMMA 4DX5D 3IXEA 1U7MA 2ZAEB 4HJGH 4OAVB 5AN8A 4ATZD 4NPDA 2KS1B 4TUMA 4YDYA 2SPZA 1IXVA 3TWSA 1DCQA 2RFMA 2L6BA 1WG0A 2JABA 2HR3A 4NPFX 1U7JA 1MYOA 1S3JA 2OTKE 4ZMDA 3B7BA 4K5BA 1BI8B 2Y1LE 4GOEA 4HRMB 1UOHA 3TWVA 4MN4C 5EYLA 3FXDA 4JBZA 3ZNGA 1X0TA 2K3RA 1AP7A 1H0TA 2XZTG 2F37A 2J8SD 5EYPF 4HI8A 3TWXA 5EFWB 4U8VD 1K1BA 4DRXE 5D66A 4ZNCA 3DEOA 1ZXGA 2Y0BG 3TWUA 1A5EA 2KI7B 4IOIH 4ASVA 5HKPA 2ETBA 4N5QA 1OY3D 1QYMA 5CERB 4NIKA 3QWOC 4F6RD 2M5AA 5JMND 2UWJE 3S1KA 3JXJA 1DEEG 2KXPC 4ZFHA 1Q2NA 4HKZH 2LR2A 2DWZA 1BI7B 4NPEA 5BXOA 4CZ2D 5KNHD 1OT8A 5K5GB 2M0BA 3PH0A 1G3NB 4HNAD 4O1PA 3Q9NC 5FINA 2AJAA 3HRAA 3UXGA 3AAAC 3EU9A 3NOGD 5ENRD 5BXUA 1MX2A 3B95A 1WDYA 2LXCB 1LP1A 2FO1E 3F6QA 2B0OE 4YDWA 1EDLA 3ZU7B 2P58A 1YCSB 4WWIA 2LXBA 5DJTB 2HE0A 2B87A 3W9FA 4HRLA 2RKLA 3Q9UC 1MJ0A 5KWDA 4Z68A 1H0TB 3V30A 3ZKJA 5ENOD 4LSZE 4DX6D 4A63B 5CECB 5ENQD 1ZW0A 2DVWA 3TWWA 5ENSD 1BLXB 1SS1A 3J5QB 3NOCD 5EILA 4BERA 5AAOA 2P2CP 4HB5A 1JMBA 2M5AB 1YYHA 1SVXA 2F8XK 4QFVA 5KBAA 5C39A 2NYJA 2XEEA 5AARA 2Q1KA 5HRYA 3NBNB 2QRXA 4K5CA 3EHRA 4BESA 3J5PA 3T8KA 4G8KA 2KIKA 4CYMD 5ENPD 1YMPA 3W9GA 5KNGA 1IKND 2KUBA 4O1OA 4HB1A 3LJNA 4K3AA 1EDJA 4GMRA 4U96D 3MZWB 3KEAA 2B88A 2MYOA 1OVVA 1LT1A 4C48B 4G8LA 1LP1B 4ASWA 1N11A 4DX1A 4BXLA 5HS0A 3FXEA 1MX4A 1AWCB 2ETAA 4EYYQ 4HRNA 1JM0A 2B87B 1FC2C 2XENA 4GPMA 4K5AB 3T9KA 1OVUA 1S70B 2ZGGA 2I8DA 4J7WA 2KBXA 5DJUB 3DEPA 3MHVA 5AQAA 2A5EA 4DX7D 4JB8P 2ZGDA 1OVRA 3V31A 1MX6A 4BETA 1K1AA 4U8YD 1BDDA 3EHQA 3UI2A 1N0QA 5EN5D 4DUIA 4DX2A 4BSZB 4RLYA 1BDCA 3C5RA 5CEAA 3UTMA 2B89A 5JA4D 1BU9A 1TR4A 4F1PA 3ZDMA 2XEHA 1EDIA 1EDKA 1NFIE 4UUCA 1Y47A 4KJMA 2QVAA 3HG0D 4ZHBA 3AJIA 4HLLA 2V5QC 1K3ZD 4HQDA 4QQIA 2DZOA 1IHBA 4OAUC 4K35A 4LG6A 3V2OA 5ITZF 2QC9A 4GOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETC A;  4LNU D;  5AQ9 A;  5ENT D;  2F8Y A;  2V4H C;  3TWQ A;  2KZI A;  2BKK B;  2DZN A;  2PNN A;  3JXI A;  4HBD A;  5CED B;  5AQB A;  2VGE A;  3SO8 A;  3ZUV B;  3V79 K;  3TWR A;  4HI9 A;  1DC2 A;  2JWD A;  5EID A;  5FIO A;  2RFA A;  4CPG A;  5AQ7 A;  2KZJ A;  4GOD A;  1MFT A;  2QYJ A;  4J8Y A;  1EC5 A;  4B93 B;  1D9S A;  3RGU A;  4O60 A;  1SW6 A;  3JUE A;  1NVO A;  4U95 D;  4BEP A;  2R44 A;  5EIB E;  2BKG A;  3D9H A;  3TWT A;  5CBO A;  1N0R A;  2XZD G;  3V2X A;  1BD8 A;  5CBN A;  2WMM A;  4DX5 D;  3IXE A;  1U7M A;  2ZAE B;  4HJG H;  4OAV B;  5AN8 A;  4ATZ D;  4NPD A;  2KS1 B;  4TUM A;  4YDY A;  2SPZ A;  1IXV A;  3TWS A;  1DCQ A;  2RFM A;  2L6B A;  1WG0 A;  2JAB A;  2HR3 A;  4NPF X;  1U7J A;  1MYO A;  1S3J A;  2OTK E;  4ZMD A;  3B7B A;  4K5B A;  1BI8 B;  2Y1L E;  4GOE A;  4HRM B;  1UOH A;  3TWV A;  4MN4 C;  5EYL A;  3FXD A;  4JBZ A;  3ZNG A;  1X0T A;  2K3R A;  1AP7 A;  1H0T A;  2XZT G;  2F37 A;  2J8S D;  5EYP F;  4HI8 A;  3TWX A;  5EFW B;  4U8V D;  1K1B A;  4DRX E;  5D66 A;  4ZNC A;  3DEO A;  1ZXG A;  2Y0B G;  3TWU A;  1A5E A;  2KI7 B;  4IOI H;  4ASV A;  5HKP A;  2ETB A;  4N5Q A;  1OY3 D;  1QYM A;  5CER B;  4NIK A;  3QWO C;  4F6R D;  2M5A A;  5JMN D;  2UWJ E;  3S1K A;  3JXJ A;  1DEE G;  2KXP C;  4ZFH A;  1Q2N A;  4HKZ H;  2LR2 A;  2DWZ A;  1BI7 B;  4NPE A;  5BXO A;  4CZ2 D;  5KNH D;  1OT8 A;  5K5G B;  2M0B A;  3PH0 A;  1G3N B;  4HNA D;  4O1P A;  3Q9N C;  5FIN A;  2AJA A;  3HRA A;  3UXG A;  3AAA C;  3EU9 A;  3NOG D;  5ENR D;  5BXU A;  1MX2 A;  3B95 A;  1WDY A;  2LXC B;  1LP1 A;  2FO1 E;  3F6Q A;  2B0O E;  4YDW A;  1EDL A;  3ZU7 B;  2P58 A;  1YCS B;  4WWI A;  2LXB A;  5DJT B;  2HE0 A;  2B87 A;  3W9F A;  4HRL A;  2RKL A;  3Q9U C;  1MJ0 A;  5KWD A;  4Z68 A;  1H0T B;  3V30 A;  3ZKJ A;  5ENO D;  4LSZ E;  4DX6 D;  4A63 B;  5CEC B;  5ENQ D;  1ZW0 A;  2DVW A;  3TWW A;  5ENS D;  1BLX B;  1SS1 A;  3J5Q B;  3NOC D;  5EIL A;  4BER A;  5AAO A;  2P2C P;  4HB5 A;  1JMB A;  2M5A B;  1YYH A;  1SVX A;  2F8X K;  4QFV A;  5KBA A;  5C39 A;  2NYJ A;  2XEE A;  5AAR A;  2Q1K A;  5HRY A;  3NBN B;  2QRX A;  4K5C A;  3EHR A;  4BES A;  3J5P A;  3T8K A;  4G8K A;  2KIK A;  4CYM D;  5ENP D;  1YMP A;  3W9G A;  5KNG A;  1IKN D;  2KUB A;  4O1O A;  4HB1 A;  3LJN A;  4K3A A;  1EDJ A;  4GMR A;  4U96 D;  3MZW B;  3KEA A;  2B88 A;  2MYO A;  1OVV A;  1LT1 A;  4C48 B;  4G8L A;  1LP1 B;  4ASW A;  1N11 A;  4DX1 A;  4BXL A;  5HS0 A;  3FXE A;  1MX4 A;  1AWC B;  2ETA A;  4EYY Q;  4HRN A;  1JM0 A;  2B87 B;  1FC2 C;  2XEN A;  4GPM A;  4K5A B;  3T9K A;  1OVU A;  1S70 B;  2ZGG A;  2I8D A;  4J7W A;  2KBX A;  5DJU B;  3DEP A;  3MHV A;  5AQA A;  2A5E A;  4DX7 D;  4JB8 P;  2ZGD A;  1OVR A;  3V31 A;  1MX6 A;  4BET A;  1K1A A;  4U8Y D;  1BDD A;  3EHQ A;  3UI2 A;  1N0Q A;  5EN5 D;  4DUI A;  4DX2 A;  4BSZ B;  4RLY A;  1BDC A;  3C5R A;  5CEA A;  3UTM A;  2B89 A;  5JA4 D;  1BU9 A;  1TR4 A;  4F1P A;  3ZDM A;  2XEH A;  1EDI A;  1EDK A;  1NFI E;  4UUC A;  1Y47 A;  4KJM A;  2QVA A;  3HG0 D;  4ZHB A;  3AJI A;  4HLL A;  2V5Q C;  1K3Z D;  4HQD A;  4QQI A;  2DZO A;  1IHB A;  4OAU C;  4K35 A;  4LG6 A;  3V2O A;  5ITZ F;  2QC9 A;  4GOF A; 
#chains in the Genus database with same CATH topology
 4N6J A;  4YPC A;  2G3A A;  2P10 A;  2GRM A;  2ION A;  5CRU A;  2F8Y A;  3H1L G;  2YO3 A;  4U07 A;  2KZI A;  2CK3 H;  2DZN A;  3QJZ A;  1Z6T A;  4TXP A;  4I6G A;  3PRE A;  2J08 A;  2QSI A;  4HBD A;  2E76 B;  2AXV A;  2ZXE B;  2DBA A;  3SO8 A;  3L71 G;  1WY6 A;  3TWR A;  4H0L D;  4HI9 A;  1PPJ D;  3HE5 B;  1DC2 A;  2I2O A;  1FZB A;  3L73 J;  1PV3 A;  1FBM A;  1INZ A;  2VGX B;  3EQ2 A;  2WQY C;  3N4X A;  4W80 A;  1N7S A;  1SQV J;  3M06 A;  5AVU B;  5AQ7 A;  1OW6 A;  4DCK A;  3UM1 A;  3AE5 C;  4XKB A;  2QYJ A;  3A7O A;  3CEQ A;  3FEX A;  1LWU B;  1FU1 A;  1ZB1 A;  3CV0 A;  3Q3D A;  2O01 J;  1YHQ P;  1V54 E;  4B93 B;  1D9S A;  3RGU A;  1JCQ A;  1DNP A;  4U95 D;  2P7J A;  3AE7 C;  1KZO A;  5KAI E;  3CVW A;  1LT9 A;  3VMZ A;  3CSF A;  3KDP B;  4I1A A;  3QAQ A;  5ANL A;  5CBO A;  2YIN A;  4E6H A;  1BD8 A;  1S72 P;  3IHV A;  4LLH A;  1NJI Q;  2WMM A;  4L2Y A;  2QYU A;  4DX5 D;  1EZV D;  4AQR D;  2ZT9 D;  2Q3E A;  1IYG A;  5CCG D;  2WSE H;  1U2V G;  3SY2 A;  3P8C E;  1HJB A;  2P9P G;  5AN8 A;  3R7Q A;  4XEI G;  5BPP A;  1SFC D;  1NU1 E;  3JUI A;  3ZW3 A;  3H1I D;  4NPD A;  4I1O B;  1L0N E;  1OWM A;  3LCA A;  4TUM A;  2A45 G;  2BED A;  2GM4 A;  2RG8 A;  4I2L C;  2IO2 C;  1HJ0 A;  3HRN A;  3Q5R A;  4GTM A;  5JJ7 A;  2L6B A;  3C72 A;  2JDI H;  1SQQ K;  1L5J A;  2XRY A;  4HOQ A;  3ONL A;  1IQU A;  4A3V A;  4G26 A;  1U7J A;  4ZKP A;  5AJD A;  1DD4 A;  2FXP A;  3P1U A;  4FJY A;  3B7B A;  3VTP C;  2KC7 A;  3EIQ C;  2KB7 P;  3PZD A;  3QWW A;  2Q9I A;  1S63 A;  1JWG A;  3B7R L;  1N73 A;  1UOH A;  3MEK A;  1PGO A;  4MN4 C;  3OXL A;  5EYL A;  1PY1 A;  3DPD A;  2YXR B;  3FXD A;  3BG0 B;  1EDU A;  1OMI A;  4CT0 A;  1FVH A;  4IYP A;  1SQB E;  1M1J A;  4UQX A;  1KZU B;  1PPJ G;  3SNX A;  2UY1 B;  1FE6 A;  3AEF C;  1TU3 F;  1JO5 A;  5FQ6 A;  1QNF A;  3HUS A;  3IN6 A;  2F37 A;  2KZT B;  3C8V A;  4RJT A;  5B3S E;  5EYP F;  5GTH E;  4HI8 A;  2R05 A;  3TWX A;  4AVX A;  3UMV A;  3U3W A;  1ZLL A;  1K1B A;  4N3C A;  1NGM B;  4GZ5 A;  1IO4 A;  2WXM A;  5D66 A;  1GTW A;  4PJ0 H;  4KBQ A;  3FUM A;  3AE6 C;  2WTY A;  1ZN5 A;  1A5E A;  3L70 D;  3TNU A;  2V4L A;  1O1T A;  3NF1 A;  4EBA A;  4XZ4 A;  1OY3 D;  3H1L E;  1NA3 A;  5CER B;  4NIK A;  3KXD A;  2YNY A;  3KSQ A;  5H2F E;  3ZHE A;  4EZL A;  3ESL A;  3L71 E;  1EXJ A;  3FUE A;  3HXC A;  3GHG C;  2F0Y A;  3O4Z A;  1EZV G;  4ZFH A;  3HXF A;  4WVZ A;  4WNE A;  4AOF A;  4NUR A;  5LOZ A;  2A06 D;  2ZYG A;  3D9K A;  1YTZ T;  3ABL E;  3JCU H;  1CI6 A;  2WQ6 A;  5AVT B;  5K5G B;  5ARF A;  4X8Q A;  5BU5 A;  3S7B A;  2R32 A;  3H1I G;  4WWP A;  2WM9 A;  3KYQ A;  2B9B A;  3S7F A;  2NZ2 A;  4JW1 A;  2KOG A;  4DLO A;  1VQ6 P;  1TEZ A;  5FQ8 A;  3H1K J;  2LSV A;  1KPS B;  3EU9 A;  5AW6 B;  1SQQ D;  3GW4 A;  2ZIS A;  1GL2 A;  2H89 C;  1HFA A;  2WQ7 A;  2QG4 A;  3BUA A;  3TJP A;  1Q7Y Q;  3M0D A;  2DW3 A;  1WDY A;  1TNB A;  4KXK B;  3ZFW A;  3CME P;  1S1C X;  3PUJ A;  2LXC B;  4B0Z A;  2BCC D;  4ACK A;  4ACL A;  4UWL A;  4YDW A;  3S9O A;  1KV4 A;  3LIE A;  3II6 A;  1CW5 A;  1NO4 A;  3LJ3 A;  1EDL A;  4JA7 A;  1AVY A;  1FT2 A;  3TAX A;  4A1S A;  2G8Y A;  1GD2 E;  5FTP A;  3ZPJ A;  1YIJ P;  2Q6Q A;  1YYC A;  2MJZ A;  1A02 J;  5DJT B;  3U9W A;  3MUD C;  4UI9 K;  3NZU A;  4HH2 A;  1BGY D;  2KXP B;  4C9B B;  3SFY A;  4ANX A;  3RO3 A;  1HWT C;  1K73 Q;  3B8E B;  4MBG A;  2M3E A;  1PL5 A;  3ITK A;  1H88 A;  2I1K A;  3PH0 C;  3HDX A;  1R5L A;  1WMK A;  3L70 G;  1NTZ K;  4LSZ E;  5ENO D;  2GUV A;  1EQ7 A;  4DX6 D;  3UT4 A;  2E76 C;  4R4L A;  3RBZ A;  2MOW A;  1HTL C;  3OA7 A;  4NAC A;  3TXM A;  3KQG A;  3W68 A;  5KKZ B;  2JR8 A;  3A0B E;  1OUV A;  1KLX A;  2RH0 A;  2HG5 D;  1VDF A;  1M90 Q;  2FKW B;  4J0U A;  3QH9 A;  1P5Q A;  1HS6 A;  1O1S A;  2LSU A;  1M56 D;  5KLI C;  4HVB A;  3AU4 A;  3HVE B;  3USS A;  4HS2 A;  5EIL A;  1PPJ E;  3OAW A;  4WNG A;  1MQS A;  1NWQ A;  2P2C P;  2WXF A;  3PZ4 A;  1JEK A;  1FVF A;  2K9J B;  4U3F D;  3PZ2 A;  2A06 G;  3D9M A;  4HOS A;  1YYH A;  3UM0 A;  2WT7 A;  3PLN A;  3LVR E;  4CEM A;  3LY9 A;  2LXL A;  3PE4 A;  3C3Q A;  4C0M A;  3AU5 A;  4QFV A;  3AG4 E;  1RF0 C;  4WBA A;  4OWF A;  5C39 A;  5KCM A;  5AVY B;  4L23 A;  3P8M C;  3DSW A;  5HRY A;  2CFU A;  2OYO A;  3CXH I;  1KIL B;  4K5C A;  1Y6I A;  1SQQ G;  2VYI A;  3AG1 E;  3ESK A;  4G8K A;  4CYM D;  5BT1 A;  5T8I A;  4U04 A;  1RQV A;  1HE8 A;  4JHJ A;  4F53 A;  1IKN D;  1L0N K;  4LGD E;  4O1O A;  4IFF A;  2KCV A;  4GDO A;  5T4Y A;  5JJT A;  2E5Y A;  4OGQ B;  2H6I A;  2PZI A;  2J4D A;  1VQK P;  1EZV E;  3MD0 A;  2AEJ A;  4B86 A;  2DYR E;  2FFD A;  5KJL A;  2E74 D;  2NPS D;  3CVN A;  1YJN P;  4HFG A;  3FUD A;  3FX0 A;  3JSV C;  1WT6 A;  3H1I E;  3MKR A;  4A7P A;  1RHZ B;  3F5H A;  3B7T A;  4N5C A;  4YVO A;  3O6Q B;  1NZN A;  5B1B E;  1BGY G;  1IFP A;  2IZ0 A;  3G3Z A;  5B5E H;  4ASW A;  1VQ4 P;  3NFQ A;  3ZEF A;  3FUF A;  3C9I A;  3CR3 A;  4EI2 A;  4U7J A;  3QC1 A;  4PD4 I;  1SQB K;  3H1H J;  1HUC A;  1AWC B;  4K0R A;  2XGS A;  3BRV B;  1JM0 A;  1NTZ D;  3GLM A;  5AW8 B;  1AVO A;  2OV8 A;  2R59 A;  3HD7 A;  2OYI B;  2KBX A;  4GA0 A;  3ABV C;  4Y6C A;  3DEP A;  3MHV A;  3B5N A;  3DXK G;  1MFZ A;  1CZQ A;  1PP9 D;  2R3S A;  4ABN A;  3FH8 A;  1YI2 P;  1BE3 J;  3V31 A;  2JP3 A;  2N1T A;  2WSC J;  3HHM A;  4EQF A;  4JA9 A;  3VLF A;  4U3F G;  3RSE G;  3UI2 A;  1N0Q A;  2QJY B;  1FZC B;  1X81 A;  3L75 J;  1Q81 Q;  4TV3 A;  2QJK C;  4PJ0 E;  1BCC J;  1FCH A;  2GRN B;  1L4A B;  5GTI H;  2WIT A;  1UG3 A;  2OEV A;  4KZC A;  4BSZ B;  2K88 A;  3PE3 A;  3C5R A;  3TK1 A;  1GL2 C;  4OVU A;  4AUW A;  2W83 C;  3L70 E;  2R5S A;  4JVS A;  4GTO A;  3BU8 A;  1ZU2 A;  3N7N A;  1YQ3 C;  5AW7 B;  2Y9Z A;  4UUC A;  3HXE A;  2XPY A;  2AW6 A;  4H44 B;  4GKG A;  2HOD B;  2IOL A;  3NZS A;  4ZHB A;  3CI9 A;  3L36 A;  4Y99 C;  3TGU D;  3ZXS A;  1L2P A;  3ZN3 A;  4HLL A;  5AVV B;  2E75 B;  3JCU E;  2FO7 A;  1TN8 A;  2IPP A;  4I9E A;  2A06 E;  2IU1 A;  2ZJS E;  1LF8 A;  4HXI A;  4U8H A;  2MKV A;  4WWO A;  2R5D A;  2YIU B;  3KZI H;  1IHB A;  1KIL D;  4K35 A;  3I3N A;  3U66 A;  4GYO A;  2ETC A;  1UW4 B;  2WXN A;  4LNU D;  2XGO A;  2AXC A;  2N9Y B;  3X2Q E;  2KSE A;  2HPC B;  1HF8 A;  4CCA A;  1FDI A;  4LRZ A;  2BKK B;  1SQQ E;  3D6Z A;  1YA0 A;  2PNN A;  1HVV A;  5KLV J;  2V7Q J;  3MA5 A;  4FP7 A;  4H7X A;  1NTZ G;  2VGE A;  1G2C B;  3ZUV B;  2K1A A;  3IFM A;  2XGM A;  3Q4A B;  4G11 A;  3CMA P;  1YJW P;  4FAD A;  1KD1 Q;  4H0L B;  1LTJ B;  1Q90 D;  2MRI A;  3QB2 A;  4DK5 A;  2BCC E;  3NXS A;  1U3C A;  3R9A B;  1O5M A;  3SSU A;  3UM3 A;  1W2E A;  1SQP E;  5FIO A;  2RFA A;  3SZ7 A;  3JCK C;  1GZL A;  3H1J J;  1MZ9 A;  4CPG A;  1PP9 G;  1HH8 A;  4LER A;  1URQ A;  1WRG A;  2JKV A;  3FHE A;  3L72 J;  1MFT A;  3RK2 B;  2IEJ A;  1N9A A;  3HD7 D;  3DSV A;  2XHE A;  3CVU A;  1BGY E;  3FP3 A;  1SQV D;  2OEW A;  3D6Y A;  1N94 A;  1U3D A;  4XA4 A;  4O60 A;  3JUE A;  1Q2Z A;  4ANU A;  3S2A A;  3CQG B;  3MV2 B;  2C9N Y;  1NTM E;  1TYQ G;  1KN7 A;  5AVX B;  4ILH B;  3V2X A;  2BF0 X;  2NXP A;  4JYC A;  5A7D B;  5CBN A;  3CXH D;  1VL2 A;  5AVQ B;  2C0M A;  4NQ0 A;  3MKQ A;  1U7M A;  2ZAE B;  4CDM A;  4HJG H;  2ZT9 B;  3WUT A;  2DCP A;  3CXH H;  1HU3 A;  4OAV B;  4CDR A;  2LXM A;  4TXR A;  3EFG A;  1VQP P;  1Z5S C;  2X6K A;  4L9P A;  3UIP C;  3QOU A;  3I56 P;  3DXM G;  3MIW A;  3P2B A;  3PEU B;  3TGU G;  2QY7 A;  3HTK A;  3PVL A;  3FWL A;  3IEG A;  1IXV A;  1DCQ A;  2X6F A;  4U3F E;  2KSJ A;  4J8F A;  3TF5 A;  3FU0 A;  1WG0 A;  3H6P A;  2JAB A;  1Q86 Q;  3EJN A;  4YND A;  3Q78 A;  2P9K G;  2IX7 C;  1SP4 A;  1OWL A;  1T6A A;  3AEA C;  2LO6 A;  3IKO B;  1MYO A;  1ZV8 A;  1S3J A;  3HE4 B;  4ZMD A;  2IBZ I;  3PRJ A;  2FYN B;  2J9Q A;  4ILG A;  3AE8 C;  2IDB A;  4K5B A;  2Y1L E;  4I7Z B;  2DIW A;  3FUL A;  3H32 B;  2IY0 C;  3GHG A;  3VP8 A;  2YNQ A;  3VMA A;  1NU1 J;  3TWV A;  5L8R J;  3CCE P;  1PC2 A;  1L0N J;  2C0X A;  2GW1 A;  4JBZ A;  1X0T A;  2K3R A;  4PD4 H;  3FUH A;  5CCM A;  1PZQ A;  4WND A;  3V6I A;  5KJ7 D;  4EPZ A;  4N2Q A;  1J1D B;  1GU4 A;  2XZT G;  3FH5 A;  3ZIM A;  1H6O A;  1E8W A;  3APD A;  1OFC X;  4D6T D;  2ZYD A;  3HXB A;  2Z5H A;  1D7M A;  5LCW C;  1S9K D;  3ASG A;  1IHG A;  1S2E A;  4DI3 A;  3AE9 C;  5EFW B;  3S4R A;  4U8V D;  2WPR A;  4EHM A;  1IZN B;  1VQ9 P;  2X6I A;  1GU5 A;  3CWB J;  1P84 I;  1NL4 A;  1PGJ A;  2OAR A;  2JEE A;  2KCL A;  1SQV G;  1BPO A;  1N7S B;  2YKQ A;  5BV1 A;  3VMX A;  4PS8 A;  1ZR2 A;  3R7R A;  1N8R Q;  2I6H A;  4AY6 A;  4GB9 A;  1O1R A;  2AEM A;  2Y0E A;  1JNM A;  2JWA A;  2I9C A;  3BAS A;  2EIK E;  1NTZ E;  4PDX A;  2QM8 A;  4XI0 A;  3S1K A;  3WU2 H;  5CRV A;  1HXI A;  1DEE G;  2FI7 A;  3MUD A;  2LR2 A;  2DWZ A;  3AE1 C;  3IAO A;  3SGH A;  1KC8 Q;  5LCW J;  3RK2 D;  2GRP B;  1LT9 B;  1MUU A;  2E0I A;  4N3B A;  5KNH D;  1OT8 A;  1JCR A;  1SQX J;  1PP9 E;  4FLH A;  2ZVO B;  5BNW A;  3PH0 A;  4JXT A;  4HNA D;  2VTB A;  1L4A C;  3H1L J;  2J4B A;  2VSX E;  5AW2 B;  4LNB A;  3Q9N C;  5LP0 A;  4BRY A;  2OYH C;  5BW8 C;  4AJW A;  3KSL A;  3CVQ A;  5CJ4 A;  5GTI E;  3ZYM A;  1H89 A;  3NOG D;  3UKU G;  5G05 C;  5ENR D;  1VF5 C;  1ELR A;  3SFX A;  1FZG A;  4GCN A;  4KMO A;  2QJP C;  2JLB A;  3L71 J;  1H6K A;  3VTX A;  3D9O A;  3HE5 A;  1LD8 A;  2KNC A;  3Q49 B;  5KJN A;  5APQ A;  4TUU A;  1RH5 B;  1QBQ A;  4GPK A;  1Z56 A;  3RL0 D;  1MV8 A;  4WY4 C;  4H44 C;  1T8Z A;  3CPW O;  3QNK A;  3F6Q A;  2L9B A;  3CIA A;  5B1A E;  4BX9 A;  2IZ1 A;  1ZME C;  5A23 A;  2BAS A;  2E75 C;  1PAQ A;  4A55 A;  2WZ7 A;  3L6A A;  5CCH D;  2L91 A;  4F7A A;  5E76 A;  2LXB A;  1AV1 A;  3Q47 B;  3A0H H;  3JQ0 A;  3E7K A;  3U4T A;  3TGU E;  1N73 B;  2HE0 A;  3L16 A;  1RF0 A;  4D6T G;  1S5L H;  4G25 A;  4HOT A;  1URQ C;  2B87 A;  2RKL A;  3KZI E;  2FBW C;  3ULY A;  3CCU P;  4JEH A;  5G05 J;  1KFM A;  2FF4 A;  2RD0 A;  5KWD A;  3B7S A;  2H7H A;  3CK7 A;  1L0L K;  1KIL E;  3CX5 I;  2CPB A;  4RG9 A;  2WXK A;  1NA0 A;  2WXJ A;  2WXO A;  3CL3 D;  4I1L A;  3ZKJ A;  3M9Q A;  3MV3 B;  1IJD B;  3HUS B;  1D8E A;  3MZL B;  1N7L A;  1SQP K;  4AIF A;  1LTB C;  2O1K A;  4A63 B;  3L74 D;  1LGH B;  2XCC A;  1GW6 A;  3KAE A;  3CGH A;  4J8D A;  3ASN E;  4ANW A;  5CEC B;  3RK3 D;  3BCC J;  1ZW0 A;  2HR2 A;  3LY7 A;  4H0L C;  2POH A;  2KLU A;  1IFM A;  1LTJ C;  1JUQ A;  1GMJ A;  1BLX B;  3J5Q B;  1TN6 A;  2GRR B;  3K5B A;  4PV1 D;  4B8A A;  3T5V A;  4UQY A;  2N9B A;  1RF1 C;  4C7N A;  3G2T A;  1SVF A;  1TJC A;  4BER A;  3AE2 C;  3SFD C;  3U59 A;  1IQR A;  4J8S A;  1M8O B;  2WPS A;  2FUL A;  3LVQ E;  1VQ7 P;  1NTK D;  2F8X K;  2P58 C;  4JZY A;  1EPU A;  1NTM K;  4H13 C;  3FU5 A;  3CCR P;  3ZHE B;  1N4R A;  2Y3A A;  1HF9 A;  5AW3 B;  2EIM E;  5CJ0 A;  2IO3 C;  4U7E B;  2W27 A;  1N7S D;  4GAA A;  2XEE A;  5AAR A;  2Q1K A;  3QK0 A;  5G2N A;  1SQM A;  1FZE A;  3EHR A;  1H2T C;  1SQV E;  4BES A;  5JHB A;  1NYH A;  2KIK A;  1W5C E;  3W9G A;  2K37 A;  3GF7 A;  4DOJ A;  2J49 A;  4HB1 A;  3SWY A;  4O6F A;  3LJN A;  2ZT9 C;  2KCK A;  5CCG C;  2KZT A;  2IBZ D;  1GW4 A;  1VQ5 P;  3PHL A;  3CHR A;  2J07 A;  4HOU A;  1N4Q A;  3CXH E;  3PZ1 A;  2PQR A;  1SFC C;  3AEG C;  3PZ3 A;  4ANV A;  3PRZ A;  4DLQ A;  3T5X A;  4GT1 A;  1FZA A;  2FYZ A;  5APW A;  2B88 A;  1N52 A;  2OCC E;  2E74 B;  2NPS B;  2H6H A;  3L35 A;  2ILR A;  2KLV A;  1NH4 A;  2OTJ P;  2PM7 A;  4G8L A;  3ZGQ A;  3WUU A;  3I5P A;  2CG3 A;  3RAU A;  1Z3Y A;  4BXL A;  5HS0 A;  2P67 A;  4L2L A;  4U0U A;  3E4B A;  2D2C D;  3Q7F A;  3SWF A;  2VRS A;  3U64 A;  1L0L D;  2WSE J;  4AM9 A;  3FTY A;  2QEX P;  1JY3 O;  3UIO C;  4HRN A;  3BAT A;  3AG2 E;  4UQZ A;  2XEN A;  4GPM A;  1SQP D;  1UIX A;  1OVU A;  1S70 B;  3AEE C;  1P84 H;  5AW4 B;  3Q2Y A;  3Q5P A;  1VDY A;  3EDT B;  3L74 G;  2L0I A;  2E43 A;  2I8D A;  2QZA A;  2WSF H;  1FOS E;  4J6I A;  5DJU B;  1H19 A;  3H1I J;  5AQA A;  5APV A;  1JY2 O;  4PD4 E;  4ZKU A;  3LXU X;  4JB8 P;  3BQO A;  4FLB A;  1Y9B A;  4I1M A;  4EEC A;  3FY4 A;  2E42 A;  2P9U G;  3T97 A;  2JJL A;  2BEZ F;  3RL0 g;  3GG2 A;  4RVB A;  4MS6 A;  3V2R A;  5G55 A;  1BDD A;  3AEB C;  4D6T E;  1BSH A;  4DJA A;  3FUK A;  1S9K E;  1QQE A;  3UUX A;  2WWW A;  1NTK G;  1ZR4 A;  1NTM D;  5D0O D;  3GZS A;  2PQN A;  1AJY A;  5G04 C;  4MLP A;  2WB2 A;  3HIZ A;  3I55 P;  3G6E P;  3EU5 A;  2R3C A;  4PS7 A;  3ULQ A;  4YVQ C;  3Q79 A;  1TR4 A;  3CD6 P;  2WSC H;  5H7P A;  2VSN A;  5BVZ A;  2WT7 B;  4XE0 A;  3P7K A;  1ZRT D;  4I6J A;  2QVA A;  4G24 A;  4L7T A;  5AVW B;  3WU2 E;  3AJI A;  1E5W A;  4KZ0 A;  2IBZ G;  5CHX A;  2CFZ A;  3DBS A;  1LWU C;  1KTM A;  4GA2 A;  1X79 B;  2Y69 E;  5AVS B;  2WVI A;  4HQD A;  3BVH A;  3LW5 J;  1RE3 C;  1RE4 C;  1JY2 N;  3AS4 A;  2EQX A;  3QWP A;  3L70 J;  2CG2 A;  1FT1 A;  3RRN B;  3CKB A;  5G04 J;  3L37 A;  4KT0 J;  4M3O A;  4GOF A;  2JEK A;  3RBX A;  2O1J A;  3CVV A;  1FOS F;  2FBN A;  3L82 A;  5ENT D;  2FFD B;  2V4H C;  2HLO A;  3L22 A;  4IUL A;  2YQ8 A;  3EHN A;  4AEZ C;  2WXQ A;  5APX A;  3PS6 A;  4TXQ A;  1L0L G;  1XTC C;  3FTU A;  3G2S A;  3JXI A;  2V5F A;  1NOH A;  3AE3 C;  1GL2 D;  3CX5 D;  4APO A;  4QMA A;  5CED B;  3L54 A;  2IOS A;  2XEV A;  4I9C A;  1NI1 A;  5AQB A;  3GZ1 A;  4W9R A;  2BCC G;  4GML A;  3V79 K;  2LKM A;  1QZ2 A;  3CX5 H;  1SQP G;  3H1K E;  1TJF A;  3Q15 A;  3CCL P;  4GTT A;  3V2N A;  3ZVV A;  3ASD A;  4ILI A;  1N54 A;  1N86 A;  5EID A;  4C46 A;  2OND A;  3DWL G;  5FQ4 A;  5CMW A;  4GYY A;  4BX8 A;  4WAF A;  4GOD A;  2VJ8 A;  1HX8 A;  4B8C B;  3RU0 A;  4J8Y A;  1SQQ J;  4N78 D;  3UPV A;  3FH7 A;  3HD7 B;  4IL6 H;  3W67 A;  1IK7 A;  1TN7 A;  3SI5 A;  2QIW A;  3B5N B;  4RES B;  2Q7F A;  4OYS A;  4M7C A;  2QA4 P;  4TRQ A;  1G1J A;  1NTM G;  4XX5 A;  4BT8 A;  4CGW A;  3CVX A;  1SW6 A;  2XV5 A;  4RO0 A;  3CVL A;  3TG5 A;  4BEP A;  1IFI A;  5AYW D;  5EIB E;  2P1J A;  2BKG A;  2J09 A;  1OXZ A;  2YMY A;  3KEZ A;  4UWF A;  1EF1 C;  3C3R A;  1NKN A;  3IXE A;  3NMD A;  4I6M C;  3L74 E;  2KYV A;  2FYU D;  4YXW H;  4EBA G;  3RK3 E;  3O6Q A;  2OOE A;  1T2K D;  4ATZ D;  4JYB A;  3CLQ A;  1E8Z A;  1HZ4 A;  3I4G A;  4AY5 A;  1BGY J;  4AYC A;  2KS1 B;  4GCO A;  1SQV K;  1XGW A;  2XQ0 A;  1MKM A;  2SPZ A;  2IQC A;  2B6C A;  5C2Y A;  1SZ9 A;  3SHF A;  3FEY A;  3L4F A;  4KYO B;  3QAR A;  1NTK E;  3EHM A;  3E33 A;  3ASF A;  1OW7 A;  1VPC A;  3BEE A;  2CHZ A;  3O8Z A;  2OYI A;  5TJH A;  2ZVN B;  1N4S A;  2WXG A;  4LCT A;  4RQI A;  4AV7 A;  2WMO A;  1BI8 B;  4GOE A;  3CLJ A;  1M7L A;  4HRM B;  3A5T A;  4GZC A;  3QKY A;  1JTH A;  2A5U A;  3L17 A;  3Q7A A;  1ELK A;  3LDZ A;  4GMJ A;  1S5L X;  3ZNG A;  1AP7 A;  3CKC A;  1X22 A;  2E74 C;  2IBZ E;  2NPS C;  2WPV B;  1H0T A;  2X6H A;  1KT1 A;  3OTN A;  4BTA A;  3OAK A;  1HBW A;  1H0A A;  1L4A A;  1S64 A;  5LX8 A;  5KAF H;  2IYP A;  1JCS A;  4UB6 H;  2J8S D;  2OYH A;  4UI9 C;  2KAT A;  5JJ6 A;  4ZNC A;  1ZXG A;  1VQN P;  2HO1 A;  2Y0B G;  3TWU A;  2RKK A;  1NHL A;  4IOI H;  4ASV A;  2ETB A;  4N3A A;  4N5Q A;  4WY4 A;  2P9N G;  5FZS A;  4D10 C;  1QYM A;  3FTZ A;  1QEX A;  2M5A A;  1E96 B;  3BRT B;  3UIN C;  1L0L E;  3FDH A;  1KB9 I;  3LPZ A;  1P84 E;  4N3Y B;  4Z1M H;  1HH0 A;  5BU8 B;  3JXJ A;  2KXP C;  1Q2N A;  4L1B A;  2YXQ B;  2FYU G;  2YKO A;  1OW8 A;  1MHQ A;  3EWK A;  4NPE A;  3RIB A;  5BXO A;  3MYV A;  3ZYK A;  3L73 D;  3GW6 A;  1TNY A;  3S7D A;  4CZ2 D;  4UI9 J;  4WWN A;  2ZIR A;  4GTS A;  3TL5 A;  2M0B A;  3B5N D;  3GZ2 A;  5E75 A;  1LNQ A;  1JPL A;  3AG3 E;  2HPC A;  3C1L A;  3ENE A;  5FWQ A;  3R9M A;  4U0S A;  1VQL P;  5FIN A;  4EZK A;  2AJA A;  2W6A A;  3FU3 A;  4A1G A;  3CHS A;  2N1T D;  3FTX A;  5KKZ C;  2PM6 A;  3K9I A;  1SQX D;  1OZH A;  1NTZ J;  3SF4 A;  3UQ3 A;  1B89 A;  5FQ7 A;  3VP9 A;  1MX2 A;  1OCR E;  3FTW A;  1DH3 A;  1RZ4 A;  2GGF A;  1PIX A;  3P32 A;  1UJJ A;  1LTJ A;  1UII A;  4I17 A;  3HXD A;  3T8M A;  5J90 A;  3NTN A;  3TG4 A;  2O01 H;  3RL0 B;  3M0A A;  1QVF O;  1RF1 A;  2HYN A;  2YMK A;  3H25 A;  1LP1 A;  4JEU A;  1LTT C;  2FO1 E;  5TIS H;  4JL0 A;  1PP9 J;  4YTP C;  2WXL A;  3MCX A;  4Q69 A;  1ZRT E;  1FZF A;  3GF3 A;  1D8D A;  2ZXW E;  1AFO A;  3ZU7 B;  2P58 A;  1YCS B;  4WWI A;  3ASO E;  1HGZ A;  4HOR A;  2LAH A;  2GRL A;  3V5B A;  3GHG B;  4R4M A;  1JY3 P;  4LC1 A;  4IFD K;  1KIL C;  3W9F A;  3CHM A;  4XIF A;  2MHK A;  3PP5 A;  4JQ0 D;  2KM4 A;  3SBT B;  4Z68 A;  3JC2 2;  5AIJ A;  2QFC A;  3V30 A;  4W7Z A;  5ARG A;  3IBE A;  1JY2 P;  3QDN A;  5CMY A;  5CCG A;  4KHX A;  4OGQ C;  4PD4 D;  4PS3 A;  1PGQ A;  1VF5 D;  3A3Y B;  1EYH A;  1SFC A;  1S0P A;  2IFU A;  1CSB A;  1KYO I;  2H88 C;  3RK3 B;  3TGU J;  5HQ8 A;  3CX5 E;  4H7Y A;  5E79 H;  4HYT B;  1M57 D;  4BWN A;  4WY4 D;  2FEZ A;  4PV1 B;  3NOC D;  4GTQ A;  4I2W A;  2ZU6 B;  4DZO A;  3BCC D;  3M91 A;  4HB5 A;  5AW1 B;  4FUL A;  3E30 A;  3L73 G;  5B5E E;  3VN0 A;  2PRR A;  2OQQ A;  1GW3 A;  3GYZ A;  4O9B A;  4MRU A;  3ML8 A;  4PH4 B;  4EDF A;  4OVV A;  4BWR A;  1HGV A;  2Z4E A;  1USD A;  3IF4 A;  4IL6 E;  3UKR G;  3H32 A;  4F1S A;  2NYJ A;  1GK4 A;  3CHP A;  1VQ8 P;  1URQ D;  3VOP A;  4N78 E;  5AVR B;  3LID A;  5ENN A;  3CHQ A;  1SQB J;  3NBN B;  1LTX A;  2X3M A;  3DSX A;  3FUN A;  1H2U A;  3J5P A;  1G1I A;  1SQX G;  2OYI C;  1E8Y A;  1PGP A;  5ENP D;  1DIP A;  2K9Y A;  3A2A A;  4Y6W A;  3L72 E;  1IFD A;  3D9P A;  2VTB B;  1OX3 A;  4JC8 A;  4K3A A;  4BRY B;  5FT9 A;  1GK6 A;  3DST A;  1FJK A;  3A0B H;  1EDJ A;  4GMR A;  1NTK K;  1QX8 A;  2QJY C;  3CCS P;  1FZC C;  1VQM P;  2FYU E;  3MZW B;  1OWP A;  3NB2 A;  3KEA A;  4IRU A;  1N2D C;  2KNC B;  1JCC A;  4FU3 A;  2IF4 A;  1LT1 A;  2V8S E;  2XNX A;  3EFF K;  2HYZ A;  5KLI B;  3DSU A;  5BUZ A;  4UB8 H;  3E34 A;  5AVZ B;  3D3M A;  2XCB A;  1N11 A;  2XKM A;  4DX1 A;  2GA1 A;  4L73 A;  1K8A Q;  1TNO A;  2PFX A;  4H13 D;  4JHK A;  3FXE A;  3ZXP A;  4B94 A;  3CVP A;  2D2C B;  2VGX A;  3H1K D;  3FUI A;  3VTY A;  5EKQ D;  2ETA A;  3F89 A;  3SFZ A;  2Y0D A;  2XU6 A;  4CGV A;  2B87 B;  2O3J A;  2J59 M;  4R7L A;  3CC4 P;  3I5C A;  2YHC A;  4L75 A;  2ZGG A;  4CDN A;  2Y0C A;  1KQL A;  1X9V A;  1LWU A;  3CCQ P;  1UN9 A;  5C1D A;  5KJ7 C;  4F3V A;  5AEN A;  2A5E A;  2R17 C;  4GTR A;  4DX7 D;  5D2M C;  2ZGD A;  2LNI A;  1KB9 D;  2YIU C;  4IL6 X;  1OVR A;  1RE3 A;  1RE4 A;  3KS2 A;  4I43 A;  3R2P A;  3UIA A;  3FWV A;  1KB9 H;  5KAF E;  1YQ4 C;  5B66 H;  4UB6 E;  1MX6 A;  1K1A A;  3BCC G;  2BTD A;  4UWH A;  2NC9 A;  1FS0 E;  5BV0 A;  3ISM C;  1M1J B;  4HLE A;  3FGA D;  4KT6 B;  2FY8 A;  5CHE E;  2V4H A;  4GZ3 A;  2Y9Y A;  4RLY A;  3JQ1 A;  4C7N B;  5CEA A;  3UTM A;  1HG5 A;  5JA4 D;  5M72 A;  1BU9 A;  1SLQ A;  4JD2 G;  1Y8A A;  1KMI Z;  3B13 A;  3Q75 A;  1SA4 A;  2XEH A;  1EDI A;  5EX0 A;  1YIT P;  1KQG B;  3RRU A;  1NFI E;  2L5G B;  3TNU B;  3V2P A;  2BUG A;  3CST A;  3G2U A;  3RRM B;  3CWB E;  1Y47 A;  3D9N A;  4KJM A;  3CK8 A;  1QGK B;  3SFE C;  3HG0 D;  4BSX A;  4EIJ A;  4D6T J;  2J5U A;  3RK2 C;  5FZQ A;  3V2Q A;  1QL2 A;  2RN0 A;  4Q96 A;  1K3Z D;  3O48 A;  4C7R A;  3D71 A;  3AS8 A;  4QQI A;  3L73 E;  4FA6 A;  1LJ2 A;  2DZO A;  4OAU C;  3IHY A;  4LG6 A;  5J08 A;  4G23 A;  5ITZ F;  3OW2 O;  1CI6 B;  1X5B A;  3CCV P;  1AQT A;  2XND H;  5CMZ A;  3PTZ A;  5AQ9 A;  4EOT A;  5DIZ A;  4OH8 B;  3TWQ A;  2UY1 A;  3CHO A;  3URZ A;  2QJK B;  1W3B A;  3RL0 C;  1SQX E;  3LW5 H;  1IK9 A;  2YO2 A;  3H1K G;  1JB0 J;  2E76 D;  3FTV A;  5D0Q D;  1S4X A;  3EUV A;  1RQU A;  1GL2 B;  1NAF A;  2FXO A;  2NRG A;  3VLD A;  2XDJ A;  2UWJ G;  3LS8 A;  3L08 A;  1OCC E;  5TIS E;  1OWN A;  4L74 A;  2JWD A;  2WVR A;  5CCH C;  4UWG A;  3UX4 A;  2J58 A;  5IY5 E;  1KYO D;  1MZC A;  3C98 A;  4B89 A;  2Q5U A;  2KZJ A;  2LAI A;  1KYO H;  1R8E A;  1OCO E;  3FTS A;  4Y99 B;  3BG1 B;  3I4R B;  2FYN C;  1ZBP A;  5EX3 A;  1LTA C;  4I7Z C;  1EC5 A;  2A4Z A;  3ABM E;  2ZYA A;  1P84 D;  1NVO A;  2IYO A;  1LTS C;  4KVO A;  3T97 B;  4BY6 A;  2R44 A;  2M63 A;  4LUN U;  4E85 A;  3QWV A;  3D9H A;  3TWT A;  2HFE D;  1N0R A;  2XZD G;  3H1H D;  1J1D C;  3RK3 C;  5KLV K;  3LKU A;  2NPS A;  1AA0 A;  3EIJ A;  2KP8 A;  4PV1 C;  4DPR A;  3VMY A;  3FU6 A;  3KD7 A;  2ITA A;  4NRH B;  3UT7 A;  1J2J B;  5E79 E;  3G9R A;  4TT3 H;  3HYM B;  2ZFC A;  1E7U A;  4BT9 A;  2M8R A;  3UM2 A;  4YDY A;  2PGD A;  2ZXX A;  2XZR A;  2W90 A;  1ZOY C;  3TWS A;  5JHA A;  2L6J A;  3BCC E;  2Z5I A;  2RFM A;  1BE3 D;  1N7S C;  3S7J A;  3CVY A;  1OIP A;  2P9I G;  4Q94 A;  3L9T A;  2AXT H;  1N4P A;  5AW5 B;  3WXX A;  4APF A;  2C0W A;  2HR3 A;  5APS A;  4NPF X;  3L75 D;  1UN8 A;  1J1E B;  1BCC D;  1NAY A;  3L74 J;  2XS8 A;  2OTK E;  3U1A A;  1OCZ E;  1V55 E;  2FYU K;  1N95 A;  1IFJ A;  3WUV A;  4GZD A;  3AE4 C;  4FHJ A;  1JY3 N;  1LT9 C;  2QE7 H;  4W7Y A;  1YJ9 P;  3WMM 0;  1IFN A;  1JWF A;  1USE A;  4IFM A;  3FWN A;  2L0T B;  1K04 A;  4M3L A;  1KOR A;  3ONK A;  1SZA A;  3FFL A;  3SQV A;  1NTK J;  1EXI A;  2PL2 A;  2WXH A;  2VGY A;  1OWO A;  1DCE A;  2JO1 A;  3N71 A;  1TNZ A;  2H43 A;  2H6F A;  3Q1M A;  4DRX E;  1FDO A;  3D9L A;  2GUS A;  3E1I A;  4LNG A;  4UB8 E;  5KTB A;  3KHU A;  3CCM P;  5FZR A;  3ZYL A;  4ATG A;  4DI4 A;  4DT0 A;  3Q5S A;  3DEO A;  2D2C C;  3PUK A;  2WPQ A;  2KI7 B;  4JHR A;  2EIL E;  2HM8 A;  5HKP A;  3HVE A;  2O01 N;  3B7U X;  3RO2 A;  4XI9 A;  2RMZ A;  4I2Z A;  4JPZ B;  2R02 A;  1KZP A;  2K9J A;  1TNU A;  3QWO C;  4F6R D;  4WNF A;  1M1K Q;  5JMN D;  2WXP A;  1NU1 K;  2PP6 A;  3DPY A;  3TYY A;  3H1H G;  4YXD C;  5KLV D;  1H6P A;  2Q3I A;  2UWJ E;  1N73 C;  4J8E A;  2AXU A;  2V7Q H;  4HKZ H;  3A0H E;  1BI7 B;  1JOC A;  1E79 H;  2C0L A;  1KIL A;  1S5L E;  1KB9 E;  4GYW A;  4G2V A;  1M1J C;  5B66 E;  1AQ5 A;  1OXJ A;  1PFI A;  1G3N B;  3H1J D;  2H6G A;  5CCL A;  1LTG C;  3HUS C;  4O1P A;  2FXM A;  3TGO A;  3HRA A;  1E8X A;  2Q7C A;  3L72 D;  1BE3 G;  3UXG A;  2VQ2 A;  1L0L J;  3AAA C;  3SBS A;  5BXU A;  2N1T B;  1K9M Q;  3AS5 A;  1JMM A;  2OGU A;  2YKP A;  3IR9 A;  2BCC J;  3L75 G;  3V4Q A;  2WSF J;  3PNT B;  1SQP J;  3D9I A;  1BCC G;  1YBK A;  3M9B A;  3B95 A;  4UWK A;  3SD5 A;  3WG7 E;  4CRW A;  3G2W A;  3NAW A;  1K8K G;  2A45 I;  2XPZ A;  1K05 A;  3G71 P;  2EIJ E;  4EZJ A;  5APT A;  2B0O E;  5LFA A;  4WUY A;  3VYI A;  5T3R A;  1RY3 A;  3MX3 A;  3CC7 P;  3LY8 A;  3OXG A;  2PAJ A;  1NTM J;  1NKZ B;  3PJS K;  5APU A;  1VQO P;  2AWI A;  4C0E A;  1SQX K;  4AP2 A;  5AJL A;  1JTH B;  4HRL A;  5M1B A;  3Q9U C;  4N39 A;  1MJ0 A;  4JPS A;  5A6C A;  4N2S A;  2OVF A;  4XKC A;  1FJP A;  2E2E A;  1OWA A;  1FPP A;  1H0T B;  3PDN A;  2C9L Y;  2AVP A;  5KAI H;  3DRA A;  2OYH B;  3OJA B;  3RJV A;  4FC8 A;  4LEU A;  2CHW A;  1VF5 B;  3P8C D;  2XRZ A;  5ENQ D;  3M0D C;  1FZC A;  2P2U A;  1KQS O;  4U3F J;  2QJP B;  2KS1 A;  5FJY A;  4GIF A;  2DVW A;  4BTB A;  2YHE A;  4ME2 A;  3TWW A;  5ENS D;  1NU1 D;  3CC2 P;  1SS1 A;  4AXH A;  3RK6 A;  2W6B A;  4U63 A;  3G4S P;  5KLV G;  1L0N D;  3G2V A;  3MGN A;  3NQP A;  1FAV A;  4WY4 B;  4RSY A;  4P29 A;  1A02 F;  3KPE A;  5AAO A;  1JUN A;  4GZ6 A;  3ABK E;  3RKV A;  1JMB A;  2OTL P;  2M5A B;  1Q82 Q;  2IFN A;  1SA5 A;  1SVX A;  2WXI A;  3U1C A;  1KYO E;  2WXR A;  3TDK A;  2GRQ B;  3LEW A;  1U57 A;  3OXF A;  2V0P A;  5KBA A;  4I6E A;  2KK7 A;  3H1J G;  2EIN E;  4GTV A;  4GTP A;  3ULE G;  2HOD A;  2AEF A;  3CWB D;  1URQ B;  3L72 G;  1H2V C;  1DVP A;  2QRX A;  2I1J A;  1EZV I;  3MTU E;  1NP7 A;  2NSZ A;  5AW9 B;  3T8K A;  3AED C;  1XTG B;  3IV0 A;  1YMP A;  5KNG A;  2WPV A;  3APC A;  2KUB A;  1DD3 A;  5KJ7 A;  2W8Z A;  4WB4 A;  3Q5M A;  1WAO 1;  3SWK A;  4GU5 A;  3M9H A;  1SQB D;  3H1H E;  4OGQ D;  1IC2 A;  5AW0 B;  2H8P D;  1T2K C;  1DX7 A;  2DYS E;  4U96 D;  2P9L G;  3ZYQ A;  2LUH A;  2MYO A;  3MJW A;  5GTH H;  1OVV A;  3MKQ B;  4PUC A;  4C48 B;  4RKU J;  1X8Y A;  3V4W A;  3ZRH A;  2Y4U A;  2IFM A;  3TXN A;  3C3O A;  3JYS A;  1RF1 B;  3LYA A;  1E90 A;  1KFN A;  1W2B O;  1LP1 B;  4FJZ A;  1G2C A;  1J1E C;  2AXT E;  1E7V A;  1Y8M A;  3H1L D;  1BE3 E;  1RW2 A;  2E5T A;  3HTK B;  2IJG X;  4H13 B;  4DJG A;  1MX4 A;  4FHK A;  5ANR A;  3L75 E;  3FUJ A;  5EDS A;  4EYY Q;  3PEV B;  1BCC E;  4U0Z A;  3Q73 A;  3E1R A;  1FC2 C;  3L71 D;  4K5A B;  3T9K A;  2FYU J;  2R03 A;  2W6J H;  5H2F H;  1T3J A;  3VLE A;  2XPI A;  5APY A;  4J7W A;  1H8A A;  3E32 A;  2R2L A;  3MGB A;  3CQC B;  2X6J A;  4CT4 A;  3D9J A;  1NU1 G;  4KVM A;  2CPS A;  3D70 A;  1HO8 A;  1FDM A;  4V3I A;  1L0N G;  4G1T A;  3B4S A;  1DEB A;  2AXZ A;  4MKT A;  2Y4T A;  3AEC C;  4BET A;  4U8Y D;  1Z3X A;  1T3U A;  1QLE D;  1SFC B;  2FFD C;  1LTI C;  3EHQ A;  5EN5 D;  1BSN A;  3R4Y A;  1JCD A;  4GA1 A;  4DUI A;  1L4A D;  4DX2 A;  1A17 A;  2WQH A;  1BDC A;  3UT8 A;  4BFR A;  2VSO E;  3ML9 A;  4XE5 B;  4XFJ A;  4Y28 J;  1ELW A;  2B89 A;  5KJK A;  2R5B A;  4IN3 B;  4A3T A;  3CWB G;  4YDO A;  3MP7 B;  2GRO B;  4F1P A;  1KT0 A;  3ZDM A;  4L76 A;  2C2L A;  1WM5 A;  1EDK A;  5DBK A;  4OVN F;  3ASH A;  5CCH A;  4YDE A;  4RG6 A;  1QL1 A;  4H44 D;  2OVB A;  3L13 A;  1SQB G;  3GMA A;  2WSS H;  3CK9 A;  3E37 A;  5KLV E;  2XS1 A;  2M3B A;  1R5S A;  2BEQ D;  2E75 D;  1LD7 A;  1QVG O;  5KJM A;  2V5Q C;  3HD7 C;  3HE4 A;  3B5N C;  4JF7 A;  4TLF A;  1HG2 A;  3PNL B;  4K03 A;  3TSI A;  2A45 H;  1KQF B;  2P9S G;  2X38 A;  3B71 A;  2CHX A;  1UJK A;  3CCJ P;  1GDT A;  1XNF A;  5HI7 A;  4URK A;  3APF A;  2WMN A;  2QM7 A;  3V2O A;  2N1T C;  2QC9 A;  2VSY A;  3DSS A;  1ZP0 C;  3H1J E;  1YTZ I; 
#chains in the Genus database with same CATH homology
 2ETC A;  4LNU D;  5AQ9 A;  5ENT D;  2F8Y A;  2V4H C;  3TWQ A;  2KZI A;  2BKK B;  2DZN A;  2PNN A;  3JXI A;  4HBD A;  5CED B;  5AQB A;  2VGE A;  3SO8 A;  3ZUV B;  3V79 K;  3TWR A;  4HI9 A;  1DC2 A;  2JWD A;  5EID A;  5FIO A;  2RFA A;  4CPG A;  5AQ7 A;  2KZJ A;  4GOD A;  1MFT A;  2QYJ A;  4J8Y A;  1EC5 A;  4B93 B;  1D9S A;  3RGU A;  4O60 A;  1SW6 A;  3JUE A;  1NVO A;  4U95 D;  4BEP A;  2R44 A;  5EIB E;  2BKG A;  3D9H A;  3TWT A;  5CBO A;  1N0R A;  2XZD G;  3V2X A;  1BD8 A;  5CBN A;  2WMM A;  4DX5 D;  3IXE A;  1U7M A;  2ZAE B;  4HJG H;  4OAV B;  5AN8 A;  4ATZ D;  4NPD A;  2KS1 B;  4TUM A;  4YDY A;  2SPZ A;  1IXV A;  3TWS A;  1DCQ A;  2RFM A;  2L6B A;  1WG0 A;  2JAB A;  2HR3 A;  4NPF X;  1U7J A;  1MYO A;  1S3J A;  2OTK E;  4ZMD A;  3B7B A;  4K5B A;  1BI8 B;  2Y1L E;  4GOE A;  4HRM B;  1UOH A;  3TWV A;  4MN4 C;  5EYL A;  3FXD A;  4JBZ A;  3ZNG A;  1X0T A;  2K3R A;  1AP7 A;  1H0T A;  2XZT G;  2F37 A;  2J8S D;  5EYP F;  4HI8 A;  3TWX A;  5EFW B;  4U8V D;  1K1B A;  4DRX E;  5D66 A;  4ZNC A;  3DEO A;  1ZXG A;  2Y0B G;  3TWU A;  1A5E A;  2KI7 B;  4IOI H;  4ASV A;  5HKP A;  2ETB A;  4N5Q A;  1OY3 D;  1QYM A;  5CER B;  4NIK A;  3QWO C;  4F6R D;  2M5A A;  5JMN D;  2UWJ E;  3S1K A;  3JXJ A;  1DEE G;  2KXP C;  4ZFH A;  1Q2N A;  4HKZ H;  2LR2 A;  2DWZ A;  1BI7 B;  4NPE A;  5BXO A;  4CZ2 D;  5KNH D;  1OT8 A;  5K5G B;  2M0B A;  3PH0 A;  1G3N B;  4HNA D;  4O1P A;  3Q9N C;  5FIN A;  2AJA A;  3HRA A;  3UXG A;  3AAA C;  3EU9 A;  3NOG D;  5ENR D;  5BXU A;  1MX2 A;  3B95 A;  1WDY A;  2LXC B;  1LP1 A;  2FO1 E;  3F6Q A;  2B0O E;  4YDW A;  1EDL A;  3ZU7 B;  2P58 A;  1YCS B;  4WWI A;  2LXB A;  5DJT B;  2HE0 A;  2B87 A;  3W9F A;  4HRL A;  2RKL A;  3Q9U C;  1MJ0 A;  5KWD A;  4Z68 A;  1H0T B;  3V30 A;  3ZKJ A;  5ENO D;  4LSZ E;  4DX6 D;  4A63 B;  5CEC B;  5ENQ D;  1ZW0 A;  2DVW A;  3TWW A;  5ENS D;  1BLX B;  1SS1 A;  3J5Q B;  3NOC D;  5EIL A;  4BER A;  5AAO A;  2P2C P;  4HB5 A;  1JMB A;  2M5A B;  1YYH A;  1SVX A;  2F8X K;  4QFV A;  5KBA A;  5C39 A;  2NYJ A;  2XEE A;  5AAR A;  2Q1K A;  5HRY A;  3NBN B;  2QRX A;  4K5C A;  3EHR A;  4BES A;  3J5P A;  3T8K A;  4G8K A;  2KIK A;  4CYM D;  5ENP D;  1YMP A;  3W9G A;  5KNG A;  1IKN D;  2KUB A;  4O1O A;  4HB1 A;  3LJN A;  4K3A A;  1EDJ A;  4GMR A;  4U96 D;  3MZW B;  3KEA A;  2B88 A;  2MYO A;  1OVV A;  1LT1 A;  4C48 B;  4G8L A;  1LP1 B;  4ASW A;  1N11 A;  4DX1 A;  4BXL A;  5HS0 A;  3FXE A;  1MX4 A;  1AWC B;  2ETA A;  4EYY Q;  4HRN A;  1JM0 A;  2B87 B;  1FC2 C;  2XEN A;  4GPM A;  4K5A B;  3T9K A;  1OVU A;  1S70 B;  2ZGG A;  2I8D A;  4J7W A;  2KBX A;  5DJU B;  3DEP A;  3MHV A;  5AQA A;  2A5E A;  4DX7 D;  4JB8 P;  2ZGD A;  1OVR A;  3V31 A;  1MX6 A;  4BET A;  1K1A A;  4U8Y D;  1BDD A;  3EHQ A;  3UI2 A;  1N0Q A;  5EN5 D;  4DUI A;  4DX2 A;  4BSZ B;  4RLY A;  1BDC A;  3C5R A;  5CEA A;  3UTM A;  2B89 A;  5JA4 D;  1BU9 A;  1TR4 A;  4F1P A;  3ZDM A;  2XEH A;  1EDI A;  1EDK A;  1NFI E;  4UUC A;  1Y47 A;  4KJM A;  2QVA A;  3HG0 D;  4ZHB A;  3AJI A;  4HLL A;  2V5Q C;  1K3Z D;  4HQD A;  4QQI A;  2DZO A;  1IHB A;  4OAU C;  4K35 A;  4LG6 A;  3V2O A;  5ITZ F;  2QC9 A;  4GOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...