3JUIA

Crystal structure of the c-terminal domain of human translation initiation factor eif2b epsilon subunit
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
176
structure length
174
Chain Sequence
GHHHHHHMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAGETILSWFSQRDDKGQQLRKNQQLQRFIQWLKEAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Translation initiation factor eIF-2B subunit epsilon
publication title Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B epsilon Subunit
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 64
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3juiA00
2VSOE 1H2VC 4B8AA 3D3MA 4B89A 2HM8A 3FEXA 2VSXE 1N54A 4JHJA 2IU1A 1UW4B 3JUIA 2IOSA 2ZU6B 2IOLA 2KZTB 1PAQA 3EIQC 1UG3A 1H6KA 4JHKA 4LUNU 2FULA 2I2OA 3FEYA 1N52A 1H2UA 5ANRA 2KZTA 4GMLA 4CT4A 2NSZA 4B8CB 4CEMA 1HU3A 3L6AA 2GGFA 1H2TC 2RG8A 4IULA 3RK6A 4C9BB 3EIJA 4GMJA 4CRWA 2IONA
chains in the Genus database with same CATH superfamily
1SQMA 4ACKA 4CGVA 3HHMA 1WG0A 4I9CA 2OVBA 2KZTB 2HR2A 3U3WA 4OVUA 4CDNA 5G2NA 3APCA 4DPRA 5D2MC 3FUDA 2X6KA 2Y3AA 1TNYA 3HVEB 2IQCA 5CEDB 1H6PA 3CSTA 3D9LA 3FFLA 1A5EA 2ZU6B 3SI5A 1FT2A 3PS6A 5JHAA 3QWPA 3S7BA 3WG7E 1MHQA 1FVHA 4B0ZA 4AY6A 4UQXA 2AXVA 1KT1A 3S7FA 3ZNGA 4KT6B 3DXKG 4Y6CA 3TXMA 3D9KA 3Q73A 3MJWA 1KLXA 5HQ8A 3W9FA 4N3AA 3QK0A 2Q7FA 1TYQG 4FJZA 3WXXA 3EU9A 5JMND 4BT9A 2XPZA 4C48B 1OWNA 3FUJA 1HFAA 4G11A 4GA2A 5EILA 3FULA 1XNFA 4CEMA 3PEUB 3D9OA 3QNKA 4DX1A 2I1KA 3KEAA 3Q79A 1XGWA 4J8EA 3FUEA 2X6IA 3ZU7B 3CVYA 5EX0A 4L23A 4A55A 2P9KG 1OUVA 1K8KG 3N71A 5KCMA 4DJAA 3CVPA 4I17A 5AJLA 3HDXA 3CQGB 3CHMA 4BEPA 2Y0BG 3QC1A 2J4BA 5G55A 5CCMA 3HIZA 3OAWA 1N4RA 4BFRA 3TJPA 2XEVA 4IN3B 1TJFA 2XEEA 5BV0A 5EKQD 3SBTB 3TL5A 2LAHA 3I5PA 3C3OA 3VLFA 3MGBA 4DRXE 4MS6A 4PDXA 5AN8A 5AQ7A 2FEZA 1E8XA 3GW4A 3T8KA 3ZYKA 3V31A 2UY1A 1HE8A 3EIJA 5J90A 3ZUVB 1OCOE 4CT0A 4GB9A 5FTPA 2X6JA 1SZAA 3ML9A 2C0LA 2WXMA 2XGMA 1TNUA 3Q49B 3ZKJA 3NF1A 1N52A 3UT4A 3OXGA 2XENA 2AJAA 3C5RA 2KBXA 3AU5A 5CBNA 2XGSA 4FULA 3ASGA 3E34A 4RG9A 3LPZA 3PZ3A 1H6KA 3CQCB 2IO3C 1H0AA 4XZ4A 4MRUA 4HOQA 4IYPA 3D9MA 5CCLA 3ULQA 3QOUA 3PE3A 4I9EA 3BUAA 1ZU2A 3ML8A 3Q47B 5KJLA 4MBGA 4QFVA 3QAQA 1QBQA 1JWFA 3D9JA 2XCBA 5HKPA 2YHEA 1N94A 3IEGA 2CHZA 2WQHA 1PC2A 5G05C 3CHQA 5JA4D 3KS2A 2JABA 3X2QE 4D10C 1OT8A 5FQ4A 1JPLA 5ARFA 2L6BA 1TNBA 3MYVA 4BWRA 2CG3A 3C3QA 3SFZA 1UJKA 2V8SE 2ZGGA 3CSFA 1NI1A 5D0OD 3FTVA 2DZOA 4L2YA 3TGOA 3UT8A 3AG4E 2QYUA 3Q75A 4HOTA 5AIJA 3VTXA 2GROB 4JPSA 2XCCA 3PUKA 4K0RA 4UQYA 3E32A 2YINA 5H7PA 3UM1A 2QYJA 2P9UG 2VGXB 5ENNA 2EQXA 4O1PA 3FTYA 5FZSA 3RK6A 2IO2C 4JZYA 1BD8A 3PNTB 2CFUA 3PZDA 2HM8A 3S2AA 3PREA 1AWCB 1L5JA 4L2LA 3CKCA 3EHRA 4O6FA 3OXLA 3UPVA 1O1SA 2KC7A 3Q7AA 3LXUX 4GTVA 4PS8A 1S70B 2LNIA 5KNHD 4WNEA 4ME2A 2L0IA 1LD8A 3K9IA 2LAIA 4GYOA 1NP7A 5C2YA 1S0PA 3FWVA 5G04C 4JC8A 4ANVA 3QB2A 4LSZE 5DBKA 3AG3E 4FADA 2BTDA 5KWDA 3DSUA 2IEJA 1DNPA 3ONLA 4YVQC 3T5VA 2E2EA 2XRYA 4BSXA 4I1AA 4GTTA 2LUHA 3S7JA 2OCCE 2WVIA 3LY7A 3TWTA 4I1OB 3RRMB 1N0RA 1NL4A 3ZIMA 4AM9A 3U66A 3CLJA 4U8HA 4N5CA 1Q2ZA 3PRZA 4XE0A 3UM2A 3T5XA 3AS4A 2GRPB 2RG8A 3PNLB 4G24A 3MA5A 1MYOA 3HRAA 2RD0A 2VTBA 5FQ6A 4FJYA 4LG6A 3CHPA 4BERA 5EYPF 2OEWA 3DSTA 4LNGA 1YYHA 2BEDA 2PQRA 3SY2A 1N4PA 5AQ9A 2XPYA 2NSZA 4J6IA 4WNGA 2WQ6A 2LSVA 3RO2A 2J49A 3UXGA 3CK7A 2EIKE 2I9CA 4EZJA 4ZHBA 3W9GA 4WWPA 2X3MA 1SZ9A 2F8YA 3CK8A 4XKCA 3V30A 1NA0A 2FF4A 5LFAA 4DLOA 2J9QA 3R9AB 4CDMA 4EPZA 4MLPA 2KZTA 4AV7A 4XI9A 3RO3A 5BV1A 2FI7A 3HVEA 1HG2A 2GRRB 2A5EA 3PEVB 3VLDA 4FU3A 3PH0C 4LEUA 1HU3A 2XZTG 3EJNA 2XRZA 4M7CA 4BESA 5FZRA 1TR4A 4TUUA 2WQ7A 4AY5A 4B89A 3TG4A 2KATA 2XS1A 4G23A 1IQRA 4FC8A 2ETBA 2WXPA 4GYYA 4EZKA 3FEYA 4HB5A 5B1BE 3ZRHA 3Q4AB 3L6AA 3E37A 1E8WA 2GW1A 3L22A 3QWWA 5FINA 2P9SG 2P9IG 3ABME 2IONA 4G2VA 4TXQA 1DVPA 2M63A 1OWLA 2VSXE 5BW8C 3UMVA 2GRQB 4LCTA 1WDYA 3BQOA 4GMLA 4DX5D 2WXQA 4TV3A 3NZSA 5ENSD 2FO1E 4NACA 1JCRA 3B7BA 5BT1A 4UQZA 1UJJA 1KZPA 3NOGD 1QQEA 1ELRA 3Q15A 5AYWD 4U63A 3CVWA 2AXZA 2DBAA 2WXJA 5ANRA 3ASFA 2R03A 4HVBA 1LD7A 4XI0A 4J8FA 2EIME 4GYWA 3FDHA 3SBSA 2KCLA 5KJKA 5HS0A 2NXPA 1MX6A 2VQ2A 4RG6A 4R7LA 2BUGA 3CGHA 3DXMG 4E85A 4UWGA 5BUZA 1HX8A 3G2WA 3R9MA 3DSXA 3FUMA 1D8EA 3CVQA 2OEVA 1UN9A 4RVBA 4U0SA 4UI9K 4BY6A 4J0UA 1IKND 4K5BA 5AQAA 1V55E 4GZDA 2VGYA 4B93B 4G8KA 2A4ZA 4GMRA 3SFYA 3AS5A 4CRWA 1INZA 3UM3A 5CERB 2LXLA 4M3OA 5B3SE 2AVPA 3B7SA 1N54A 1YA0A 4JHRA 3LKUA 4L1BA 4ILIA 4FHJA 3SO8A 2OV8A 4GTQA 5CBOA 2IJGX 2ONDA 3ABLE 3QWVA 4U95D 4PUCA 2X38A 4J8YA 3J5PA 4K5CA 4DX2A 4WNDA 4C0MA 3IKOB 5BXOA 3TWSA 2AW6A 1W3BA 1OCZE 3J5QB 3ZYLA 4LERA 5ENOD 2R02A 3UM0A 3KAEA 4KMOA 1ZB1A 4G1TA 3U4TA 2DYSE 3ASNE 3FU0A 1V54E 3SZ7A 3CK9A 5A7DB 3EUVA 5AJDA 4EBAA 3TWWA 1P5QA 4U8VD 1GW6A 3B7UX 1HS6A 3SQVA 4JXTA 4KVOA 1IYGA 4UI9C 4E6HA 4I6EA 4U8YD 1U2VG 3SNXA 2XS8A 2NYJA 2XHEA 3ZVVA 2ETAA 4GZCA 2FO7A 3MKQB 3TWRA 4GPKA 2J4DA 2WM9A 3NQPA 5EDSA 4JVSA 4APFA 3LJ3A 3LDZA 2VSYA 3LVRE 1OXJA 4H7YA 3G2UA 1KPSB 4HBDA 3CHRA 3CVLA 4YVOA 4JEHA 2QY7A 4F53A 3GYZA 1E7VA 3C98A 3AU4A 3UINC 3QKYA 4AIFA 1A17A 4HQDA 3ASOE 2WXNA 4APOA 2XQ0A 4Z68A 4NRHB 4FA6A 4N2QA 3D9HA 4CGWA 3FU3A 4O1OA 2VGXA 5LOZA 1B89A 4TXPA 4A3TA 4F1PA 3APFA 5G05J 3RKVA 1DCQA 1RW2A 1FT1A 5CRUA 4G26A 5EIBE 3SGHA 3JUIA 2UY1B 1E7UA 3QJZA 2L6JA 5IY5E 4KBQA 1O5MA 2WB2A 4GTMA 3VLEA 3Q5MA 1NFIE 1Z3YA 4JW1A 4AOFA 1H2VC 3NOCD 3T9KA 2H6IA 4EZLA 2WXOA 1U3DA 3FTSA 5J08A 2IOSA 2EILE 3JYSA 4C0EA 2ETCA 3MV2B 2KXPC 4OAUC 2GRNB 1BI7B 4PS7A 3TWVA 4HFGA 4J8SA 3RSEG 4NQ0A 3HG0D 4N2SA 3Q9NC 3DPYA 2LO6A 1TEZA 2EINE 3L08A 1BU9A 5D66A 1N4QA 3GZSA 1N95A 2PL2A 4AP2A 3D9PA 3PZ2A 4EECA 3RJVA 2R2LA 2HYZA 3DPDA 5KBAA 3BG0B 3JQ0A 3QARA 1HG5A 2VSOE 4XX5A 4I2ZA 4HXIA 1OCCE 4F6RD 2VSNA 5EN5D 3JUEA 4ZFHA 2X6HA 1TN7A 3ZYQA 4DX6D 1MZCA 2E0IA 4ANXA 4GMJA 2I6HA 2I1JA 4DUIA 4BETA 2YHCA 2WXGA 3FHEA 4A1SA 3LY9A 3KEZA 1E8ZA 1UOHA 3EHMA 3AG2E 3PZ4A 4YDOA 3B7TA 5JJ7A 4Y6WA 5G04J 1H19A 2AWIA 2YQ8A 1MQSA 3CVXA 3FTUA 4RLYA 1SVXA 3IHYA 3CVUA 5KNGA 1HH8A 1S63A 3EHQA 4N39A 1DC2A 3ZN3A 2WXKA 3FU6A 3EU5A 3LYAA 3ASDA 4ILHB 4HRLA 4V3IA 4ACLA 2P9LG 5EX3A 2F0YA 3UUXA 2XEHA 3ZHEA 4F1SA 3KD7A 4LUNU 4U96D 4MKTA 4YDEA 2HE0A 1X81A 5BXUA 4F7AA 4H7XA 2GRMA 2OVFA 4BTAA 4LNUD 2Y69E 2R59A 3ABKE 3PE4A 3LCAA 2X6FA 1JCSA 4EBAG 4W9RA 3DWLG 4KZ0A 2PNNA 5CHEE 4GZ3A 4IULA 1HZ4A 1HF8A 3EDTB 1OY3D 4NIKA 4GU5A 4HNAD 3BEEA 1EPUA 3MKRA 4DX7D 2LSUA 5KJMA 3DRAA 5CECB 5FWQA 5AARA 4Q69A 3RAUA 3SHFA 2ZIRA 4GAAA 3RIBA 3PDNA 4DI3A 4IRUA 3IHVA 2KCKA 1BLXB 3I3NA 1KZOA 3NZUA 1UN8A 2CHXA 3HYMB 2KM4A 3B13A 3C3RA 5KJNA 3TWXA 1EF1C 2WXFA 3IV0A 4L7TA 4YDYA 1BI8B 2C0MA 5FQ7A 2BF0X 5A23A 4KYOB 3L16A 1K1AA 2XZDG 1LTXA 1N9AA 3CEQA 2PZIA 1Y8MA 5CEAA 1TNZA 1DCEA 3DBSA 3L54A 3FH5A 5LP0A 5BPPA 1ZBPA 3FH8A 1UW4B 3ESKA 3UKRG 3FTXA 2QC9A 5BNWA 3PZ1A 2WXRA 3TWUA 1MX4A 4U04A 3GZ2A 3I4RB 4QQIA 3FUKA 3RU0A 4UWHA 3Q7FA 1D8DA 3S7DA 4JD2G 3DSVA 2JEKA 4ANWA 5JHBA 4GTOA 4X8QA 4PH4B 5FQ8A 4TUMA 1H2UA 5FIOA 4JA9A 3G2SA 4U0ZA 3CV0A 2F8XK 4A1GA 1Z3XA 4CCAA 2HO1A 5AQBA 2QZAA 3KSQA 3ZEFA 4Q94A 3R7RA 1IQUA 1K1BA 4BTBA 3IBEA 2H6HA 3AJIA 4UWLA 4JA7A 4O60A 2PM7A 4HI8A 1D9SA 3TG5A 3UTMA 1HO8A 3IXEA 4B94A 3HXFA 5ARGA 1N11A 3HXDA 1OCRE 3UI2A 2R05A 2VGEA 3O4ZA 3BU8A 3V2XA 2NC9A 3DEPA 3FTZA 1JUQA 3U64A 2XGOA 4C9BB 4FP7A 2V5QC 4AEZC 1RZ4A 2V4HC 3ASHA 1VDYA 3AS8A 2ILRA 3BG1B 3APDA 2XPIA 3MKQA 4TXRA 3L82A 4GTPA 1K3ZD 3TWQA 4KVMA 3ZPJA 4FLBA 1TNOA 2FBNA 4FLHA 4LRZA 2CG2A 4XKBA 1E90A 2JLBA 3FTWA 1HXIA 5CRVA 2ZXWE 3EIQC 4U0UA 3FUNA 3B95A 3LJNA 2V4LA 5AAOA 2Y1LE 4BX8A 2ZGDA 3V2OA 4YDWA 3GZ1A 2WPVA 2OOEA 3G2VA 3FP3A 3ZYMA 3PUJA 3FUFA 1N0QA 5E75A 4DK5A 2VYIA 4P29A 3UIPC 2P9PG 1O1TA 5ENPD 3OTNA 1JCQA 4G25A 3CHOA 4UI9J 1N4SA 2F37A 4UWFA 2Y4UA 3FEXA 5ENRD 4JHKA 1QZ2A 3AAAC 4WAFA 2KCVA 4JL0A 3SD5A 2EIJE 3SF4A 5T8IA 4WUYA 1G3NB 4ATGA 3LEWA 3JXIA 5CMWA 3EHNA 3DSWA 3JXJA 3ONKA 1EYHA 3V79K 1E96B 5ENTD 3ULEG 2WXIA 3OXFA 3L17A 5ENQD 1Z6TA 2H6FA 1OWMA 1TN8A 4I1MA 4OYSA 4TRQA 2L0TB 4EQFA 1YCSB 3QDNA 3ULYA 3RRUA 3R7QA 5HI7A 3AG1E 1LF8A 3ZW3A 2RFAA 3URZA 4J7WA 2B0OE 2P58C 4K03A 1TJCA 4HOSA 1SA4A 2DWZA 4GPMA 2WXHA 1EDUA 3DSSA 3KSLA 3O48A 4HI9A 4K5AB 1KT0A 2QFCA 4JEUA 1NA3A 2BKKB 4U7EB 5FZQA 4B8AA 4HLEA 2CHWA 1S64A 1MX2A 2IFUA 4BSZB 3CIAA 4JHJA 4HOUA 2RFMA 1WM5A 5JJTA 4I43A 5LX8A 4AXHA 2J07A 1WAO1 2YNQA 1H2TC 3B7RL 3FUHA 3L13A 3P2BA 3LVQE 2R17C 1H6OA 3UQ3A 4DI4A 3I4GA 4ABNA 2J09A 3DEOA 3ZGQA 4Q96A 1Y6IA 3ZXSA 2RKKA 4GCOA 2I2OA 3ZXPA 2V5FA 1OWPA 3Q78A 3ZFWA 3MV3B 4BT8A 4HRMB 4UWKA 4ANUA 2B6CA 3VTYA 1QYMA 4L9PA 4WNFA 5ANLA 4F3VA 3HXCA 2DIWA 3ISMC 5T3RA 2LXMA 3D3MA 5ITZF 1SA5A 3NBNB 4OVVA 4GA1A 2DYRE 1PAQA 2P2CP 1WY6A 4GZ6A 4N5QA 2R5SA 4B8CB 2AXUA 3G2TA 4HS2A 5E76A 5A6CA 2MHKA 2DZNA 4GZ5A 4FHKA 4OAVB 3E33A 2WXLA 1JWGA 2WMOA 1E8YA 3FU5A 4YNDA 4AJWA 2GGFA 1TN6A 3C72A 3MX3A 4XIFA 4ILGA 4CYMD 4GCNA 4LNBA 1O1RA 2P9NG 4GTSA 2H6GA 3D9IA 2A5UA 4I6GA 1Z5SC 4HORA 5EIDA 2PM6A 1IHBA 3PVLA 3Q9UC 2Y4TA 1YMPA 3MZLB 2ZISA 2CFZA 4A63B 3MCXA 3FH7A 1FCHA 2UWJG 4DLQA 5FJYA 2MOWA 3LY8A 1AP7A 1QNFA 2IU1A 4NURA 4N3CA 3HXBA 4KXKB 2L9BA 3SFXA 4G8LA 3TAXA 3TXNA 4AVXA 1ELWA 4GA0A 4HRNA 1BPOA 4URKA 1FVFA 2BKGA 2VJ8A 2IY0C 3P1UA 4I2WA 4UUCA 5AENA 1IXVA 1MJ0A 4A3VA 3T8MA 1FPPA 2DCPA 2GRLA 1SW6A 1ELKA 5LCWJ 3D9NA 5LCWC 3E4BA 5C1DA 1PY1A 3UX4A 3F6QA 1UG3A 2FULA 1IHGA 3CVNA 5HRYA 4XEIG 4WWOA 3FY4A 3NB2A 3RRNB 5FT9A 2V0PA 4CDRA 3CR3A 1X5BA 3CVVA 5T4YA 1U3CA 3JQ1A 4EHMA 5EYLA 4BX9A 3U9WA 1NZNA 2MYOA 4HLLA 4CT4A 2J08A 2J8SD 3NAWA 4RSYA 4GTRA 3ZHEB 3L9TA 3FUIA 3UKUG 3MEKA 5DIZA 5JJ6A 4ATZD 4JB8P 3LS8A 3CHSA 3UT7A 5CMYA 2C2LA 4I6JA 2VTBB 4N3BA 2DVWA 4PS3A 2MRIA 4KZCA 4U07A 3E30A 3UIOC 5B1AE 3JCKC 2IF4A 2PQNA 3HXEA 2IOLA 4WWNA 3ENEA 1OWOA 4RQIA 3ESLA 4J8DA 2WMNA 5D0QD 3CKBA 4CZ2D 5M72A
chains in the Genus database with same CATH topology
1SQMA 4ACKA 1H2VC 4AM9A 3ZIMA 3GZ1A 4CGVA 3U66A 3CLJA 3HHMA 2WPVA 4U8HA 2OOEA 4EZLA 2WXOA 3G2VA 1U3DA 3FP3A 3ZYMA 3FTSA 3PUJA 4N5CA 5J08A 3FUFA 2OVBA 4I9CA 2IOSA 5E75A 2KZTB 3PRZA 3JYSA 2HR2A 4XE0A 2VYIA 4DK5A 3U3WA 4C0EA 4OVUA 4P29A 3T5XA 5G2NA 4CDNA 3AS4A 3MV2B 3APCA 4PS7A 4DPRA 2RG8A 4HFGA 4J8SA 3PNLB 3FUDA 4G24A 4NQ0A 4N2SA 3MA5A 2X6KA 2Y3AA 2LO6A 2RD0A 3OTNA 5FQ6A 2VTBA 4G25A 3CHOA 4UI9J 4FJYA 3HVEB 1TEZA 2IQCA 3CHPA 3L08A 3CSTA 4UWFA 3D9LA 2Y4UA 3FEXA 3FFLA 3GZSA 2PQRA 2PL2A 2ZU6B 3SI5A 2XPYA 4JHKA 1QZ2A 4AP2A 3D9PA 3PS6A 4WAFA 4EECA 3RJVA 2KCVA 2NSZA 4J6IA 4WNGA 4JL0A 5JHAA 2WQ6A 2HYZA 3SD5A 3DPDA 2LSVA 3RO2A 2J49A 3BG0B 3QWPA 3JQ0A 3SF4A 5T8IA 4WUYA 3QARA 3S7BA 1MHQA 4ATGA 3CK7A 1FVHA 1HG5A 3LEWA 5CMWA 2VSOE 2I9CA 4B0ZA 4XX5A 3EHNA 4EZJA 4AY6A 4I2ZA 4UQXA 2AXVA 4WWPA 2X3MA 3ONKA 1KT1A 1SZ9A 3S7FA 1EYHA 3CK8A 4XKCA 4HXIA 1NA0A 4KT6B 1E96B 2FF4A 5LFAA 2WXIA 4Y6CA 2J9QA 3D9KA 3R9AB 3TXMA 4DLOA 3OXFA 3L17A 2VSNA 4CDMA 4EPZA 3MJWA 4MLPA 2KZTA 1KLXA 5HQ8A 1Z6TA 4AV7A 4N3AA 2X6HA 1OWMA 4XI9A 3ZYQA 4OYSA 4I1MA 4TRQA 3RO3A 2L0TB 4EQFA 3QK0A 2E0IA 2Q7FA 4ANXA 4GMJA 2I6HA 2I1JA 5BV1A 3QDNA 4FJZA 3WXXA 2YHCA 2FI7A 2WXGA 4BT9A 3RRUA 3R7QA 3FHEA 3HVEA 1HG2A 2XPZA 5HI7A 4A1SA 1OWNA 3LY9A 3FUJA 1HFAA 3PEVB 3VLDA 3KEZA 1LF8A 4FU3A 1E8ZA 3PH0C 4G11A 3ZW3A 4GA2A 3URZA 3EHMA 4LEUA 3FULA 1XNFA 2P58C 4CEMA 1HU3A 4K03A 1TJCA 4HOSA 3B7TA 5JJ7A 3PEUB 3EJNA 2XRZA 3D9OA 4Y6WA 5G04J 1H19A 2AWIA 3QNKA 2I1KA 5FZRA 2YQ8A 1MQSA 4TUUA 1XGWA 3CVXA 3FTUA 2WQ7A 4AY5A 4J8EA 4B89A 3TG4A 3FUEA 2KATA 2X6IA 3IHYA 3CVUA 4G23A 3CVYA 2WXHA 5EX0A 1EDUA 1HH8A 4L23A 1IQRA 4FC8A 2WXPA 4GYYA 4A55A 4EZKA 3FEYA 4N39A 3ZN3A 2WXKA 3FU6A 1OUVA 3ZRHA 3O48A 3Q4AB 3L6AA 3N71A 1KT0A 2QFCA 4JEUA 1E8WA 2GW1A 3L22A 1NA3A 3QWWA 5KCMA 3CVPA 4DJAA 4I17A 3LYAA 5AJLA 3ASDA 3HDXA 2IONA 5FZQA 4ILHB 3CQGB 3CHMA 4V3IA 4B8AA 4HLEA 4ACLA 2CHWA 3QC1A 4G2VA 2J4BA 5EX3A 1DVPA 2IFUA 2M63A 1OWLA 2VSXE 5G55A 3UUXA 3CIAA 5BW8C 3UMVA 4JHJA 3ZHEA 5CCMA 4F1SA 3HIZA 3OAWA 4HOUA 4LCTA 3KD7A 1WM5A 4LUNU 5JJTA 4I43A 5LX8A 4AXHA 4BFRA 3TJPA 2J07A 1WAO1 4MKTA 4GMLA 2XEVA 2WXQA 2YNQA 4IN3B 4TV3A 3NZSA 1TJFA 5BV0A 1H2TC 4H7XA 4F7AA 2GRMA 2OVFA 3B7RL 3FUHA 3L13A 4NACA 3P2BA 5EKQD 3LVQE 3SBTB 2R17C 5BT1A 3UQ3A 4DI4A 3I4GA 3TL5A 2LAHA 3I5PA 4UQZA 1UJJA 2J09A 4ABNA 4BTAA 3VLFA 1QQEA 2R59A 1ELRA 3ZGQA 3MGBA 3Q15A 3PE4A 3LCAA 4Q96A 4MS6A 2X6FA 4PDXA 5AYWD 1Y6IA 4U63A 3ZXSA 4EBAG 3CVWA 2AXZA 4W9RA 2FEZA 1E8XA 2DBAA 2I2OA 3GW4A 4GCOA 3ZYKA 2V5FA 2WXJA 5ANRA 3ASFA 4HVBA 2UY1A 1OWPA 3ZFWA 3MV3B 4XI0A 4UWKA 4KZ0A 4ANUA 4BT8A 5CHEE 4GZ3A 4J8FA 4IULA 4GYWA 1HE8A 3FDHA 1HZ4A 3EIJA 3VTYA 5J90A 1HF8A 4WNFA 3EDTB 3SBSA 4CT0A 5ANLA 4F3VA 2KCLA 4GB9A 5FTPA 2X6JA 2DIWA 1SZAA 4GU5A 5T3RA 3D3MA 3ML9A 5KJKA 2C0LA 3BEEA 1EPUA 2NXPA 2WXMA 3MKRA 2LSUA 4OVVA 4GA1A 2VQ2A 2XGMA 4RG6A 5KJMA 5FWQA 4R7LA 4Q69A 1PAQA 3Q49B 2BUGA 1WY6A 3CGHA 3NF1A 1N52A 4GZ6A 4E85A 4UWGA 5BUZA 1HX8A 3UT4A 3OXGA 2R5SA 3G2WA 4B8CB 2AXUA 3G2TA 3SHFA 4GAAA 3RIBA 3PDNA 4HS2A 4DI3A 5E76A 3FUMA 4IRUA 3AU5A 5A6CA 2MHKA 3IHVA 2XGSA 4FULA 3ASGA 2KCKA 4GZ5A 3CVQA 3I3NA 1UN9A 4FHKA 3NZUA 4RVBA 4U0SA 1UN8A 2CHXA 3HYMB 2KM4A 3B13A 3LPZA 4RG9A 4UI9K 5KJNA 1EF1C 1H6KA 3CQCB 2WXLA 2WXFA 4BY6A 4J0UA 1JWGA 2WMOA 3IV0A 1E8YA 4L7TA 3FU5A 1H0AA 4YNDA 2C0MA 4XZ4A 2BF0X 4GZDA 4HOQA 4MRUA 5FQ7A 4AJWA 2GGFA 2VGYA 4KYOB 5A23A 3L16A 3MX3A 4XIFA 4IYPA 2A4ZA 3D9MA 5CCLA 3AS5A 4CRWA 4ILGA 1INZA 3ULQA 3QOUA 4GCNA 3PE3A 3CEQA 4I9EA 2PZIA 1ZU2A 1Y8MA 3ML8A 3Q47B 4M3OA 3DBSA 3L54A 2AVPA 3FH5A 5LP0A 5BPPA 5KJLA 1ZBPA 3D9IA 2A5UA 3B7SA 1N54A 1YA0A 3FH8A 4JHRA 1UW4B 3ESKA 4I6GA 3LKUA 3FTXA 4HORA 4QFVA 4L1BA 3QAQA 5BNWA 2PM6A 1JWFA 3D9JA 4ILIA 2XCBA 3PVLA 2YHEA 3IEGA 4FHJA 2CHZA 2OV8A 2Y4TA 2IJGX 2ONDA 3QWVA 3MZLB 2WQHA 2WXRA 4PUCA 2X38A 2CFZA 1PC2A 5G05C 3MCXA 3FH7A 1FCHA 2UWJG 4U04A 3GZ2A 3I4RB 4DLQA 5FJYA 3FUKA 2MOWA 3RU0A 3LY8A 3CHQA 4WNDA 4C0MA 4UWHA 3KS2A 1QNFA 3S7DA 2IU1A 3IKOB 4D10C 4NURA 2JEKA 4ANWA 5FQ4A 1JPLA 4N3CA 5JHBA 4KXKB 2L9BA 5ARFA 2AW6A 1W3BA 3MYVA 4BWRA 3TAXA 2CG3A 3TXNA 3ZYLA 4LERA 4AVXA 3SFZA 1UJKA 2V8SE 3CSFA 1ELWA 4GA0A 3KAEA 1BPOA 4URKA 5D0OD 4KMOA 3FTVA 4PH4B 1FVFA 5FQ8A 4G1TA 4L2YA 3TGOA 3U4TA 3UT8A 3FU0A 2VJ8A 3P1UA 4I2WA 5AENA 3SZ7A 4HOTA 3CK9A 5A7DB 5AIJA 1H2UA 5AJDA 4EBAA 4JA9A 4A3VA 1P5QA 3VTXA 3T8MA 4JPSA 1GW6A 3G2SA 3B7UX 1HS6A 4U0ZA 2XCCA 3CV0A 4A1GA 4JXTA 4KVOA 1IYGA 1Z3XA 2DCPA 2HO1A 2GRLA 4CCAA 4UI9C 3PUKA 4E6HA 4I6EA 4K0RA 1ELKA 4UQYA 3ZEFA 4Q94A 5LCWJ 3D9NA 5LCWC 3E4BA 3R7RA 1PY1A 1IQUA 2XHEA 2YINA 3SNXA 3UX4A 4BTBA 5C1DA 3IBEA 3ZVVA 4UWLA 4JA7A 4GZCA 2FO7A 3MKQB 1UG3A 4GPKA 2PM7A 2FULA 2J4DA 2WM9A 1IHGA 2VGXB 5ENNA 3NQPA 2EQXA 3TG5A 5EDSA 3FTYA 5FZSA 3CVNA 3RK6A 4JZYA 4JVSA 4WWOA 3FY4A 4APFA 3LJ3A 3PNTB 3LDZA 2VSYA 3LVRE 2CFUA 3PZDA 3RRNB 5FT9A 2V0PA 4H7YA 4CDRA 3CR3A 1HO8A 1X5BA 4B94A 3CVVA 2HM8A 5ARGA 3S2AA 3G2UA 3PREA 5T4YA 1U3CA 3JQ1A 4BX9A 3CHRA 3CVLA 4YVOA 1L5JA 4JEHA 4L2LA 3U9WA 3CKCA 2QY7A 3O4ZA 4O6FA 1NZNA 4F53A 3GYZA 3C98A 1E7VA 3OXLA 4CT4A 2J08A 2NC9A 3AU4A 3FTZA 3UPVA 1JUQA 2KC7A 2XGOA 3QKYA 3LXUX 3U64A 4C9BB 4FP7A 5M72A 4PS8A 4AEZC 4AIFA 2LNIA 4RSYA 3ZHEB 1A17A 4WNEA 4ME2A 3ASHA 2L0IA 1VDYA 3FUIA 3MEKA 3K9IA 3AS8A 2LAIA 5DIZA 2WXNA 4GYOA 5JJ6A 2ILRA 4APOA 3BG1B 3APDA 1NP7A 2XPIA 2XQ0A 3LS8A 5C2YA 1S0PA 4NRHB 4FA6A 4N2QA 3CHSA 3UT7A 3MKQA 5CMYA 2C2LA 4I6JA 4CGWA 3FU3A 2VTBB 4N3BA 4PS3A 2MRIA 2VGXA 4KZCA 3FWVA 5G04C 5LOZA 1B89A 4JC8A 4U07A 4ANVA 3QB2A 4A3TA 5DBKA 4FADA 4KVMA 2BTDA 3APFA 3ZPJA 4FLBA 5G05J 3RKVA 3JCKC 2FBNA 4FLHA 4LRZA 4G26A 2CG2A 1DNPA 4XKBA 3ONLA 1E90A 3SGHA 2JLBA 3FTWA 1HXIA 2IF4A 2PQNA 3JUIA 2UY1B 2IOLA 3EIQC 4U0UA 3FUNA 1E7UA 3QJZA 4WWNA 3ENEA 4YVQC 2L6JA 3T5VA 2E2EA 2V4LA 2XRYA 1OWOA 4BSXA 4I1AA 3ESLA 4KBQA 3S7JA 2WB2A 4BX8A 4J8DA 2WVIA 2WMNA 3Q5MA 3VLEA 3LY7A 1Z3YA 4JW1A 4AOFA 5D0QD 4I1OB 3CKBA 3RRMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSO E;  1H2V C;  4B8A A;  3D3M A;  4B89 A;  2HM8 A;  3FEX A;  2VSX E;  1N54 A;  4JHJ A;  2IU1 A;  1UW4 B;  3JUI A;  2IOS A;  2ZU6 B;  2IOL A;  2KZT B;  1PAQ A;  3EIQ C;  1UG3 A;  1H6K A;  4JHK A;  4LUN U;  2FUL A;  2I2O A;  3FEY A;  1N52 A;  1H2U A;  5ANR A;  2KZT A;  4GML A;  4CT4 A;  2NSZ A;  4B8C B;  4CEM A;  1HU3 A;  3L6A A;  2GGF A;  1H2T C;  2RG8 A;  4IUL A;  3RK6 A;  4C9B B;  3EIJ A;  4GMJ A;  4CRW A;  2ION A; 
#chains in the Genus database with same CATH topology
 1SQM A;  4ACK A;  4CGV A;  3HHM A;  1WG0 A;  4I9C A;  2OVB A;  2KZT B;  2HR2 A;  3U3W A;  4OVU A;  4CDN A;  5G2N A;  3APC A;  4DPR A;  5D2M C;  3FUD A;  2X6K A;  2Y3A A;  1TNY A;  3HVE B;  2IQC A;  5CED B;  1H6P A;  3CST A;  3D9L A;  3FFL A;  1A5E A;  2ZU6 B;  3SI5 A;  1FT2 A;  3PS6 A;  5JHA A;  3QWP A;  3S7B A;  3WG7 E;  1MHQ A;  1FVH A;  4B0Z A;  4AY6 A;  4UQX A;  2AXV A;  1KT1 A;  3S7F A;  3ZNG A;  4KT6 B;  3DXK G;  4Y6C A;  3TXM A;  3D9K A;  3Q73 A;  3MJW A;  1KLX A;  5HQ8 A;  3W9F A;  4N3A A;  3QK0 A;  2Q7F A;  1TYQ G;  4FJZ A;  3WXX A;  3EU9 A;  5JMN D;  4BT9 A;  2XPZ A;  4C48 B;  1OWN A;  3FUJ A;  1HFA A;  4G11 A;  4GA2 A;  5EIL A;  3FUL A;  1XNF A;  4CEM A;  3PEU B;  3D9O A;  3QNK A;  4DX1 A;  2I1K A;  3KEA A;  3Q79 A;  1XGW A;  4J8E A;  3FUE A;  2X6I A;  3ZU7 B;  3CVY A;  5EX0 A;  4L23 A;  4A55 A;  2P9K G;  1OUV A;  1K8K G;  3N71 A;  5KCM A;  4DJA A;  3CVP A;  4I17 A;  5AJL A;  3HDX A;  3CQG B;  3CHM A;  4BEP A;  2Y0B G;  3QC1 A;  2J4B A;  5G55 A;  5CCM A;  3HIZ A;  3OAW A;  1N4R A;  4BFR A;  3TJP A;  2XEV A;  4IN3 B;  1TJF A;  2XEE A;  5BV0 A;  5EKQ D;  3SBT B;  3TL5 A;  2LAH A;  3I5P A;  3C3O A;  3VLF A;  3MGB A;  4DRX E;  4MS6 A;  4PDX A;  5AN8 A;  5AQ7 A;  2FEZ A;  1E8X A;  3GW4 A;  3T8K A;  3ZYK A;  3V31 A;  2UY1 A;  1HE8 A;  3EIJ A;  5J90 A;  3ZUV B;  1OCO E;  4CT0 A;  4GB9 A;  5FTP A;  2X6J A;  1SZA A;  3ML9 A;  2C0L A;  2WXM A;  2XGM A;  1TNU A;  3Q49 B;  3ZKJ A;  3NF1 A;  1N52 A;  3UT4 A;  3OXG A;  2XEN A;  2AJA A;  3C5R A;  2KBX A;  3AU5 A;  5CBN A;  2XGS A;  4FUL A;  3ASG A;  3E34 A;  4RG9 A;  3LPZ A;  3PZ3 A;  1H6K A;  3CQC B;  2IO3 C;  1H0A A;  4XZ4 A;  4MRU A;  4HOQ A;  4IYP A;  3D9M A;  5CCL A;  3ULQ A;  3QOU A;  3PE3 A;  4I9E A;  3BUA A;  1ZU2 A;  3ML8 A;  3Q47 B;  5KJL A;  4MBG A;  4QFV A;  3QAQ A;  1QBQ A;  1JWF A;  3D9J A;  2XCB A;  5HKP A;  2YHE A;  1N94 A;  3IEG A;  2CHZ A;  2WQH A;  1PC2 A;  5G05 C;  3CHQ A;  5JA4 D;  3KS2 A;  2JAB A;  3X2Q E;  4D10 C;  1OT8 A;  5FQ4 A;  1JPL A;  5ARF A;  2L6B A;  1TNB A;  3MYV A;  4BWR A;  2CG3 A;  3C3Q A;  3SFZ A;  1UJK A;  2V8S E;  2ZGG A;  3CSF A;  1NI1 A;  5D0O D;  3FTV A;  2DZO A;  4L2Y A;  3TGO A;  3UT8 A;  3AG4 E;  2QYU A;  3Q75 A;  4HOT A;  5AIJ A;  3VTX A;  2GRO B;  4JPS A;  2XCC A;  3PUK A;  4K0R A;  4UQY A;  3E32 A;  2YIN A;  5H7P A;  3UM1 A;  2QYJ A;  2P9U G;  2VGX B;  5ENN A;  2EQX A;  4O1P A;  3FTY A;  5FZS A;  3RK6 A;  2IO2 C;  4JZY A;  1BD8 A;  3PNT B;  2CFU A;  3PZD A;  2HM8 A;  3S2A A;  3PRE A;  1AWC B;  1L5J A;  4L2L A;  3CKC A;  3EHR A;  4O6F A;  3OXL A;  3UPV A;  1O1S A;  2KC7 A;  3Q7A A;  3LXU X;  4GTV A;  4PS8 A;  1S70 B;  2LNI A;  5KNH D;  4WNE A;  4ME2 A;  2L0I A;  1LD8 A;  3K9I A;  2LAI A;  4GYO A;  1NP7 A;  5C2Y A;  1S0P A;  3FWV A;  5G04 C;  4JC8 A;  4ANV A;  3QB2 A;  4LSZ E;  5DBK A;  3AG3 E;  4FAD A;  2BTD A;  5KWD A;  3DSU A;  2IEJ A;  1DNP A;  3ONL A;  4YVQ C;  3T5V A;  2E2E A;  2XRY A;  4BSX A;  4I1A A;  4GTT A;  2LUH A;  3S7J A;  2OCC E;  2WVI A;  3LY7 A;  3TWT A;  4I1O B;  3RRM B;  1N0R A;  1NL4 A;  3ZIM A;  4AM9 A;  3U66 A;  3CLJ A;  4U8H A;  4N5C A;  1Q2Z A;  3PRZ A;  4XE0 A;  3UM2 A;  3T5X A;  3AS4 A;  2GRP B;  2RG8 A;  3PNL B;  4G24 A;  3MA5 A;  1MYO A;  3HRA A;  2RD0 A;  2VTB A;  5FQ6 A;  4FJY A;  4LG6 A;  3CHP A;  4BER A;  5EYP F;  2OEW A;  3DST A;  4LNG A;  1YYH A;  2BED A;  2PQR A;  3SY2 A;  1N4P A;  5AQ9 A;  2XPY A;  2NSZ A;  4J6I A;  4WNG A;  2WQ6 A;  2LSV A;  3RO2 A;  2J49 A;  3UXG A;  3CK7 A;  2EIK E;  2I9C A;  4EZJ A;  4ZHB A;  3W9G A;  4WWP A;  2X3M A;  1SZ9 A;  2F8Y A;  3CK8 A;  4XKC A;  3V30 A;  1NA0 A;  2FF4 A;  5LFA A;  4DLO A;  2J9Q A;  3R9A B;  4CDM A;  4EPZ A;  4MLP A;  2KZT A;  4AV7 A;  4XI9 A;  3RO3 A;  5BV1 A;  2FI7 A;  3HVE A;  1HG2 A;  2GRR B;  2A5E A;  3PEV B;  3VLD A;  4FU3 A;  3PH0 C;  4LEU A;  1HU3 A;  2XZT G;  3EJN A;  2XRZ A;  4M7C A;  4BES A;  5FZR A;  1TR4 A;  4TUU A;  2WQ7 A;  4AY5 A;  4B89 A;  3TG4 A;  2KAT A;  2XS1 A;  4G23 A;  1IQR A;  4FC8 A;  2ETB A;  2WXP A;  4GYY A;  4EZK A;  3FEY A;  4HB5 A;  5B1B E;  3ZRH A;  3Q4A B;  3L6A A;  3E37 A;  1E8W A;  2GW1 A;  3L22 A;  3QWW A;  5FIN A;  2P9S G;  2P9I G;  3ABM E;  2ION A;  4G2V A;  4TXQ A;  1DVP A;  2M63 A;  1OWL A;  2VSX E;  5BW8 C;  3UMV A;  2GRQ B;  4LCT A;  1WDY A;  3BQO A;  4GML A;  4DX5 D;  2WXQ A;  4TV3 A;  3NZS A;  5ENS D;  2FO1 E;  4NAC A;  1JCR A;  3B7B A;  5BT1 A;  4UQZ A;  1UJJ A;  1KZP A;  3NOG D;  1QQE A;  1ELR A;  3Q15 A;  5AYW D;  4U63 A;  3CVW A;  2AXZ A;  2DBA A;  2WXJ A;  5ANR A;  3ASF A;  2R03 A;  4HVB A;  1LD7 A;  4XI0 A;  4J8F A;  2EIM E;  4GYW A;  3FDH A;  3SBS A;  2KCL A;  5KJK A;  5HS0 A;  2NXP A;  1MX6 A;  2VQ2 A;  4RG6 A;  4R7L A;  2BUG A;  3CGH A;  3DXM G;  4E85 A;  4UWG A;  5BUZ A;  1HX8 A;  3G2W A;  3R9M A;  3DSX A;  3FUM A;  1D8E A;  3CVQ A;  2OEV A;  1UN9 A;  4RVB A;  4U0S A;  4UI9 K;  4BY6 A;  4J0U A;  1IKN D;  4K5B A;  5AQA A;  1V55 E;  4GZD A;  2VGY A;  4B93 B;  4G8K A;  2A4Z A;  4GMR A;  3SFY A;  3AS5 A;  4CRW A;  1INZ A;  3UM3 A;  5CER B;  2LXL A;  4M3O A;  5B3S E;  2AVP A;  3B7S A;  1N54 A;  1YA0 A;  4JHR A;  3LKU A;  4L1B A;  4ILI A;  4FHJ A;  3SO8 A;  2OV8 A;  4GTQ A;  5CBO A;  2IJG X;  2OND A;  3ABL E;  3QWV A;  4U95 D;  4PUC A;  2X38 A;  4J8Y A;  3J5P A;  4K5C A;  4DX2 A;  4WND A;  4C0M A;  3IKO B;  5BXO A;  3TWS A;  2AW6 A;  1W3B A;  1OCZ E;  3J5Q B;  3ZYL A;  4LER A;  5ENO D;  2R02 A;  3UM0 A;  3KAE A;  4KMO A;  1ZB1 A;  4G1T A;  3U4T A;  2DYS E;  3ASN E;  3FU0 A;  1V54 E;  3SZ7 A;  3CK9 A;  5A7D B;  3EUV A;  5AJD A;  4EBA A;  3TWW A;  1P5Q A;  4U8V D;  1GW6 A;  3B7U X;  1HS6 A;  3SQV A;  4JXT A;  4KVO A;  1IYG A;  4UI9 C;  4E6H A;  4I6E A;  4U8Y D;  1U2V G;  3SNX A;  2XS8 A;  2NYJ A;  2XHE A;  3ZVV A;  2ETA A;  4GZC A;  2FO7 A;  3MKQ B;  3TWR A;  4GPK A;  2J4D A;  2WM9 A;  3NQP A;  5EDS A;  4JVS A;  4APF A;  3LJ3 A;  3LDZ A;  2VSY A;  3LVR E;  1OXJ A;  4H7Y A;  3G2U A;  1KPS B;  4HBD A;  3CHR A;  3CVL A;  4YVO A;  4JEH A;  2QY7 A;  4F53 A;  3GYZ A;  1E7V A;  3C98 A;  3AU4 A;  3UIN C;  3QKY A;  4AIF A;  1A17 A;  4HQD A;  3ASO E;  2WXN A;  4APO A;  2XQ0 A;  4Z68 A;  4NRH B;  4FA6 A;  4N2Q A;  3D9H A;  4CGW A;  3FU3 A;  4O1O A;  2VGX A;  5LOZ A;  1B89 A;  4TXP A;  4A3T A;  4F1P A;  3APF A;  5G05 J;  3RKV A;  1DCQ A;  1RW2 A;  1FT1 A;  5CRU A;  4G26 A;  5EIB E;  3SGH A;  3JUI A;  2UY1 B;  1E7U A;  3QJZ A;  2L6J A;  5IY5 E;  4KBQ A;  1O5M A;  2WB2 A;  4GTM A;  3VLE A;  3Q5M A;  1NFI E;  1Z3Y A;  4JW1 A;  4AOF A;  1H2V C;  3NOC D;  3T9K A;  2H6I A;  4EZL A;  2WXO A;  1U3D A;  3FTS A;  5J08 A;  2IOS A;  2EIL E;  3JYS A;  4C0E A;  2ETC A;  3MV2 B;  2KXP C;  4OAU C;  2GRN B;  1BI7 B;  4PS7 A;  3TWV A;  4HFG A;  4J8S A;  3RSE G;  4NQ0 A;  3HG0 D;  4N2S A;  3Q9N C;  3DPY A;  2LO6 A;  1TEZ A;  2EIN E;  3L08 A;  1BU9 A;  5D66 A;  1N4Q A;  3GZS A;  1N95 A;  2PL2 A;  4AP2 A;  3D9P A;  3PZ2 A;  4EEC A;  3RJV A;  2R2L A;  2HYZ A;  3DPD A;  5KBA A;  3BG0 B;  3JQ0 A;  3QAR A;  1HG5 A;  2VSO E;  4XX5 A;  4I2Z A;  4HXI A;  1OCC E;  4F6R D;  2VSN A;  5EN5 D;  3JUE A;  4ZFH A;  2X6H A;  1TN7 A;  3ZYQ A;  4DX6 D;  1MZC A;  2E0I A;  4ANX A;  4GMJ A;  2I6H A;  2I1J A;  4DUI A;  4BET A;  2YHC A;  2WXG A;  3FHE A;  4A1S A;  3LY9 A;  3KEZ A;  1E8Z A;  1UOH A;  3EHM A;  3AG2 E;  3PZ4 A;  4YDO A;  3B7T A;  5JJ7 A;  4Y6W A;  5G04 J;  1H19 A;  2AWI A;  2YQ8 A;  1MQS A;  3CVX A;  3FTU A;  4RLY A;  1SVX A;  3IHY A;  3CVU A;  5KNG A;  1HH8 A;  1S63 A;  3EHQ A;  4N39 A;  1DC2 A;  3ZN3 A;  2WXK A;  3FU6 A;  3EU5 A;  3LYA A;  3ASD A;  4ILH B;  4HRL A;  4V3I A;  4ACL A;  2P9L G;  5EX3 A;  2F0Y A;  3UUX A;  2XEH A;  3ZHE A;  4F1S A;  3KD7 A;  4LUN U;  4U96 D;  4MKT A;  4YDE A;  2HE0 A;  1X81 A;  5BXU A;  4F7A A;  4H7X A;  2GRM A;  2OVF A;  4BTA A;  4LNU D;  2Y69 E;  2R59 A;  3ABK E;  3PE4 A;  3LCA A;  2X6F A;  1JCS A;  4EBA G;  4W9R A;  3DWL G;  4KZ0 A;  2PNN A;  5CHE E;  4GZ3 A;  4IUL A;  1HZ4 A;  1HF8 A;  3EDT B;  1OY3 D;  4NIK A;  4GU5 A;  4HNA D;  3BEE A;  1EPU A;  3MKR A;  4DX7 D;  2LSU A;  5KJM A;  3DRA A;  5CEC B;  5FWQ A;  5AAR A;  4Q69 A;  3RAU A;  3SHF A;  2ZIR A;  4GAA A;  3RIB A;  3PDN A;  4DI3 A;  4IRU A;  3IHV A;  2KCK A;  1BLX B;  3I3N A;  1KZO A;  3NZU A;  1UN8 A;  2CHX A;  3HYM B;  2KM4 A;  3B13 A;  3C3R A;  5KJN A;  3TWX A;  1EF1 C;  2WXF A;  3IV0 A;  4L7T A;  4YDY A;  1BI8 B;  2C0M A;  5FQ7 A;  2BF0 X;  5A23 A;  4KYO B;  3L16 A;  1K1A A;  2XZD G;  1LTX A;  1N9A A;  3CEQ A;  2PZI A;  1Y8M A;  5CEA A;  1TNZ A;  1DCE A;  3DBS A;  3L54 A;  3FH5 A;  5LP0 A;  5BPP A;  1ZBP A;  3FH8 A;  1UW4 B;  3ESK A;  3UKR G;  3FTX A;  2QC9 A;  5BNW A;  3PZ1 A;  2WXR A;  3TWU A;  1MX4 A;  4U04 A;  3GZ2 A;  3I4R B;  4QQI A;  3FUK A;  3RU0 A;  4UWH A;  3Q7F A;  1D8D A;  3S7D A;  4JD2 G;  3DSV A;  2JEK A;  4ANW A;  5JHB A;  4GTO A;  4X8Q A;  4PH4 B;  5FQ8 A;  4TUM A;  1H2U A;  5FIO A;  4JA9 A;  3G2S A;  4U0Z A;  3CV0 A;  2F8X K;  4A1G A;  1Z3X A;  4CCA A;  2HO1 A;  5AQB A;  2QZA A;  3KSQ A;  3ZEF A;  4Q94 A;  3R7R A;  1IQU A;  1K1B A;  4BTB A;  3IBE A;  2H6H A;  3AJI A;  4UWL A;  4JA7 A;  4O60 A;  2PM7 A;  4HI8 A;  1D9S A;  3TG5 A;  3UTM A;  1HO8 A;  3IXE A;  4B94 A;  3HXF A;  5ARG A;  1N11 A;  3HXD A;  1OCR E;  3UI2 A;  2R05 A;  2VGE A;  3O4Z A;  3BU8 A;  3V2X A;  2NC9 A;  3DEP A;  3FTZ A;  1JUQ A;  3U64 A;  2XGO A;  4C9B B;  4FP7 A;  2V5Q C;  4AEZ C;  1RZ4 A;  2V4H C;  3ASH A;  1VDY A;  3AS8 A;  2ILR A;  3BG1 B;  3APD A;  2XPI A;  3MKQ A;  4TXR A;  3L82 A;  4GTP A;  1K3Z D;  3TWQ A;  4KVM A;  3ZPJ A;  4FLB A;  1TNO A;  2FBN A;  4FLH A;  4LRZ A;  2CG2 A;  4XKB A;  1E90 A;  2JLB A;  3FTW A;  1HXI A;  5CRV A;  2ZXW E;  3EIQ C;  4U0U A;  3FUN A;  3B95 A;  3LJN A;  2V4L A;  5AAO A;  2Y1L E;  4BX8 A;  2ZGD A;  3V2O A;  4YDW A;  3GZ1 A;  2WPV A;  2OOE A;  3G2V A;  3FP3 A;  3ZYM A;  3PUJ A;  3FUF A;  1N0Q A;  5E75 A;  4DK5 A;  2VYI A;  4P29 A;  3UIP C;  2P9P G;  1O1T A;  5ENP D;  3OTN A;  1JCQ A;  4G25 A;  3CHO A;  4UI9 J;  1N4S A;  2F37 A;  4UWF A;  2Y4U A;  3FEX A;  5ENR D;  4JHK A;  1QZ2 A;  3AAA C;  4WAF A;  2KCV A;  4JL0 A;  3SD5 A;  2EIJ E;  3SF4 A;  5T8I A;  4WUY A;  1G3N B;  4ATG A;  3LEW A;  3JXI A;  5CMW A;  3EHN A;  3DSW A;  3JXJ A;  3ONK A;  1EYH A;  3V79 K;  1E96 B;  5ENT D;  3ULE G;  2WXI A;  3OXF A;  3L17 A;  5ENQ D;  1Z6T A;  2H6F A;  1OWM A;  1TN8 A;  4I1M A;  4OYS A;  4TRQ A;  2L0T B;  4EQF A;  1YCS B;  3QDN A;  3ULY A;  3RRU A;  3R7Q A;  5HI7 A;  3AG1 E;  1LF8 A;  3ZW3 A;  2RFA A;  3URZ A;  4J7W A;  2B0O E;  2P58 C;  4K03 A;  1TJC A;  4HOS A;  1SA4 A;  2DWZ A;  4GPM A;  2WXH A;  1EDU A;  3DSS A;  3KSL A;  3O48 A;  4HI9 A;  4K5A B;  1KT0 A;  2QFC A;  4JEU A;  1NA3 A;  2BKK B;  4U7E B;  5FZQ A;  4B8A A;  4HLE A;  2CHW A;  1S64 A;  1MX2 A;  2IFU A;  4BSZ B;  3CIA A;  4JHJ A;  4HOU A;  2RFM A;  1WM5 A;  5JJT A;  4I43 A;  5LX8 A;  4AXH A;  2J07 A;  1WAO 1;  2YNQ A;  1H2T C;  3B7R L;  3FUH A;  3L13 A;  3P2B A;  3LVQ E;  2R17 C;  1H6O A;  3UQ3 A;  4DI4 A;  3I4G A;  4ABN A;  2J09 A;  3DEO A;  3ZGQ A;  4Q96 A;  1Y6I A;  3ZXS A;  2RKK A;  4GCO A;  2I2O A;  3ZXP A;  2V5F A;  1OWP A;  3Q78 A;  3ZFW A;  3MV3 B;  4BT8 A;  4HRM B;  4UWK A;  4ANU A;  2B6C A;  3VTY A;  1QYM A;  4L9P A;  4WNF A;  5ANL A;  4F3V A;  3HXC A;  2DIW A;  3ISM C;  5T3R A;  2LXM A;  3D3M A;  5ITZ F;  1SA5 A;  3NBN B;  4OVV A;  4GA1 A;  2DYR E;  1PAQ A;  2P2C P;  1WY6 A;  4GZ6 A;  4N5Q A;  2R5S A;  4B8C B;  2AXU A;  3G2T A;  4HS2 A;  5E76 A;  5A6C A;  2MHK A;  2DZN A;  4GZ5 A;  4FHK A;  4OAV B;  3E33 A;  2WXL A;  1JWG A;  2WMO A;  1E8Y A;  3FU5 A;  4YND A;  4AJW A;  2GGF A;  1TN6 A;  3C72 A;  3MX3 A;  4XIF A;  4ILG A;  4CYM D;  4GCN A;  4LNB A;  1O1R A;  2P9N G;  4GTS A;  2H6G A;  3D9I A;  2A5U A;  4I6G A;  1Z5S C;  4HOR A;  5EID A;  2PM6 A;  1IHB A;  3PVL A;  3Q9U C;  2Y4T A;  1YMP A;  3MZL B;  2ZIS A;  2CFZ A;  4A63 B;  3MCX A;  3FH7 A;  1FCH A;  2UWJ G;  4DLQ A;  5FJY A;  2MOW A;  3LY8 A;  1AP7 A;  1QNF A;  2IU1 A;  4NUR A;  4N3C A;  3HXB A;  4KXK B;  2L9B A;  3SFX A;  4G8L A;  3TAX A;  3TXN A;  4AVX A;  1ELW A;  4GA0 A;  4HRN A;  1BPO A;  4URK A;  1FVF A;  2BKG A;  2VJ8 A;  2IY0 C;  3P1U A;  4I2W A;  4UUC A;  5AEN A;  1IXV A;  1MJ0 A;  4A3V A;  3T8M A;  1FPP A;  2DCP A;  2GRL A;  1SW6 A;  1ELK A;  5LCW J;  3D9N A;  5LCW C;  3E4B A;  5C1D A;  1PY1 A;  3UX4 A;  3F6Q A;  1UG3 A;  2FUL A;  1IHG A;  3CVN A;  5HRY A;  4XEI G;  4WWO A;  3FY4 A;  3NB2 A;  3RRN B;  5FT9 A;  2V0P A;  4CDR A;  3CR3 A;  1X5B A;  3CVV A;  5T4Y A;  1U3C A;  3JQ1 A;  4EHM A;  5EYL A;  4BX9 A;  3U9W A;  1NZN A;  2MYO A;  4HLL A;  4CT4 A;  2J08 A;  2J8S D;  3NAW A;  4RSY A;  4GTR A;  3ZHE B;  3L9T A;  3FUI A;  3UKU G;  3MEK A;  5DIZ A;  5JJ6 A;  4ATZ D;  4JB8 P;  3LS8 A;  3CHS A;  3UT7 A;  5CMY A;  2C2L A;  4I6J A;  2VTB B;  4N3B A;  2DVW A;  4PS3 A;  2MRI A;  4KZC A;  4U07 A;  3E30 A;  3UIO C;  5B1A E;  3JCK C;  2IF4 A;  2PQN A;  3HXE A;  2IOL A;  4WWN A;  3ENE A;  1OWO A;  4RQI A;  3ESL A;  4J8D A;  2WMN A;  5D0Q D;  3CKB A;  4CZ2 D;  5M72 A; 
#chains in the Genus database with same CATH homology
 1SQM A;  4ACK A;  1H2V C;  4AM9 A;  3ZIM A;  3GZ1 A;  4CGV A;  3U66 A;  3CLJ A;  3HHM A;  2WPV A;  4U8H A;  2OOE A;  4EZL A;  2WXO A;  3G2V A;  1U3D A;  3FP3 A;  3ZYM A;  3FTS A;  3PUJ A;  4N5C A;  5J08 A;  3FUF A;  2OVB A;  4I9C A;  2IOS A;  5E75 A;  2KZT B;  3PRZ A;  3JYS A;  2HR2 A;  4XE0 A;  2VYI A;  4DK5 A;  3U3W A;  4C0E A;  4OVU A;  4P29 A;  3T5X A;  5G2N A;  4CDN A;  3AS4 A;  3MV2 B;  3APC A;  4PS7 A;  4DPR A;  2RG8 A;  4HFG A;  4J8S A;  3PNL B;  3FUD A;  4G24 A;  4NQ0 A;  4N2S A;  3MA5 A;  2X6K A;  2Y3A A;  2LO6 A;  2RD0 A;  3OTN A;  5FQ6 A;  2VTB A;  4G25 A;  3CHO A;  4UI9 J;  4FJY A;  3HVE B;  1TEZ A;  2IQC A;  3CHP A;  3L08 A;  3CST A;  4UWF A;  3D9L A;  2Y4U A;  3FEX A;  3FFL A;  3GZS A;  2PQR A;  2PL2 A;  2ZU6 B;  3SI5 A;  2XPY A;  4JHK A;  1QZ2 A;  4AP2 A;  3D9P A;  3PS6 A;  4WAF A;  4EEC A;  3RJV A;  2KCV A;  2NSZ A;  4J6I A;  4WNG A;  4JL0 A;  5JHA A;  2WQ6 A;  2HYZ A;  3SD5 A;  3DPD A;  2LSV A;  3RO2 A;  2J49 A;  3BG0 B;  3QWP A;  3JQ0 A;  3SF4 A;  5T8I A;  4WUY A;  3QAR A;  3S7B A;  1MHQ A;  4ATG A;  3CK7 A;  1FVH A;  1HG5 A;  3LEW A;  5CMW A;  2VSO E;  2I9C A;  4B0Z A;  4XX5 A;  3EHN A;  4EZJ A;  4AY6 A;  4I2Z A;  4UQX A;  2AXV A;  4WWP A;  2X3M A;  3ONK A;  1KT1 A;  1SZ9 A;  3S7F A;  1EYH A;  3CK8 A;  4XKC A;  4HXI A;  1NA0 A;  4KT6 B;  1E96 B;  2FF4 A;  5LFA A;  2WXI A;  4Y6C A;  2J9Q A;  3D9K A;  3R9A B;  3TXM A;  4DLO A;  3OXF A;  3L17 A;  2VSN A;  4CDM A;  4EPZ A;  3MJW A;  4MLP A;  2KZT A;  1KLX A;  5HQ8 A;  1Z6T A;  4AV7 A;  4N3A A;  2X6H A;  1OWM A;  4XI9 A;  3ZYQ A;  4OYS A;  4I1M A;  4TRQ A;  3RO3 A;  2L0T B;  4EQF A;  3QK0 A;  2E0I A;  2Q7F A;  4ANX A;  4GMJ A;  2I6H A;  2I1J A;  5BV1 A;  3QDN A;  4FJZ A;  3WXX A;  2YHC A;  2FI7 A;  2WXG A;  4BT9 A;  3RRU A;  3R7Q A;  3FHE A;  3HVE A;  1HG2 A;  2XPZ A;  5HI7 A;  4A1S A;  1OWN A;  3LY9 A;  3FUJ A;  1HFA A;  3PEV B;  3VLD A;  3KEZ A;  1LF8 A;  4FU3 A;  1E8Z A;  3PH0 C;  4G11 A;  3ZW3 A;  4GA2 A;  3URZ A;  3EHM A;  4LEU A;  3FUL A;  1XNF A;  2P58 C;  4CEM A;  1HU3 A;  4K03 A;  1TJC A;  4HOS A;  3B7T A;  5JJ7 A;  3PEU B;  3EJN A;  2XRZ A;  3D9O A;  4Y6W A;  5G04 J;  1H19 A;  2AWI A;  3QNK A;  2I1K A;  5FZR A;  2YQ8 A;  1MQS A;  4TUU A;  1XGW A;  3CVX A;  3FTU A;  2WQ7 A;  4AY5 A;  4J8E A;  4B89 A;  3TG4 A;  3FUE A;  2KAT A;  2X6I A;  3IHY A;  3CVU A;  4G23 A;  3CVY A;  2WXH A;  5EX0 A;  1EDU A;  1HH8 A;  4L23 A;  1IQR A;  4FC8 A;  2WXP A;  4GYY A;  4A55 A;  4EZK A;  3FEY A;  4N39 A;  3ZN3 A;  2WXK A;  3FU6 A;  1OUV A;  3ZRH A;  3O48 A;  3Q4A B;  3L6A A;  3N71 A;  1KT0 A;  2QFC A;  4JEU A;  1E8W A;  2GW1 A;  3L22 A;  1NA3 A;  3QWW A;  5KCM A;  3CVP A;  4DJA A;  4I17 A;  3LYA A;  5AJL A;  3ASD A;  3HDX A;  2ION A;  5FZQ A;  4ILH B;  3CQG B;  3CHM A;  4V3I A;  4B8A A;  4HLE A;  4ACL A;  2CHW A;  3QC1 A;  4G2V A;  2J4B A;  5EX3 A;  1DVP A;  2IFU A;  2M63 A;  1OWL A;  2VSX E;  5G55 A;  3UUX A;  3CIA A;  5BW8 C;  3UMV A;  4JHJ A;  3ZHE A;  5CCM A;  4F1S A;  3HIZ A;  3OAW A;  4HOU A;  4LCT A;  3KD7 A;  1WM5 A;  4LUN U;  5JJT A;  4I43 A;  5LX8 A;  4AXH A;  4BFR A;  3TJP A;  2J07 A;  1WAO 1;  4MKT A;  4GML A;  2XEV A;  2WXQ A;  2YNQ A;  4IN3 B;  4TV3 A;  3NZS A;  1TJF A;  5BV0 A;  1H2T C;  4H7X A;  4F7A A;  2GRM A;  2OVF A;  3B7R L;  3FUH A;  3L13 A;  4NAC A;  3P2B A;  5EKQ D;  3LVQ E;  3SBT B;  2R17 C;  5BT1 A;  3UQ3 A;  4DI4 A;  3I4G A;  3TL5 A;  2LAH A;  3I5P A;  4UQZ A;  1UJJ A;  2J09 A;  4ABN A;  4BTA A;  3VLF A;  1QQE A;  2R59 A;  1ELR A;  3ZGQ A;  3MGB A;  3Q15 A;  3PE4 A;  3LCA A;  4Q96 A;  4MS6 A;  2X6F A;  4PDX A;  5AYW D;  1Y6I A;  4U63 A;  3ZXS A;  4EBA G;  3CVW A;  2AXZ A;  4W9R A;  2FEZ A;  1E8X A;  2DBA A;  2I2O A;  3GW4 A;  4GCO A;  3ZYK A;  2V5F A;  2WXJ A;  5ANR A;  3ASF A;  4HVB A;  2UY1 A;  1OWP A;  3ZFW A;  3MV3 B;  4XI0 A;  4UWK A;  4KZ0 A;  4ANU A;  4BT8 A;  5CHE E;  4GZ3 A;  4J8F A;  4IUL A;  4GYW A;  1HE8 A;  3FDH A;  1HZ4 A;  3EIJ A;  3VTY A;  5J90 A;  1HF8 A;  4WNF A;  3EDT B;  3SBS A;  4CT0 A;  5ANL A;  4F3V A;  2KCL A;  4GB9 A;  5FTP A;  2X6J A;  2DIW A;  1SZA A;  4GU5 A;  5T3R A;  3D3M A;  3ML9 A;  5KJK A;  2C0L A;  3BEE A;  1EPU A;  2NXP A;  2WXM A;  3MKR A;  2LSU A;  4OVV A;  4GA1 A;  2VQ2 A;  2XGM A;  4RG6 A;  5KJM A;  5FWQ A;  4R7L A;  4Q69 A;  1PAQ A;  3Q49 B;  2BUG A;  1WY6 A;  3CGH A;  3NF1 A;  1N52 A;  4GZ6 A;  4E85 A;  4UWG A;  5BUZ A;  1HX8 A;  3UT4 A;  3OXG A;  2R5S A;  3G2W A;  4B8C B;  2AXU A;  3G2T A;  3SHF A;  4GAA A;  3RIB A;  3PDN A;  4HS2 A;  4DI3 A;  5E76 A;  3FUM A;  4IRU A;  3AU5 A;  5A6C A;  2MHK A;  3IHV A;  2XGS A;  4FUL A;  3ASG A;  2KCK A;  4GZ5 A;  3CVQ A;  3I3N A;  1UN9 A;  4FHK A;  3NZU A;  4RVB A;  4U0S A;  1UN8 A;  2CHX A;  3HYM B;  2KM4 A;  3B13 A;  3LPZ A;  4RG9 A;  4UI9 K;  5KJN A;  1EF1 C;  1H6K A;  3CQC B;  2WXL A;  2WXF A;  4BY6 A;  4J0U A;  1JWG A;  2WMO A;  3IV0 A;  1E8Y A;  4L7T A;  3FU5 A;  1H0A A;  4YND A;  2C0M A;  4XZ4 A;  2BF0 X;  4GZD A;  4HOQ A;  4MRU A;  5FQ7 A;  4AJW A;  2GGF A;  2VGY A;  4KYO B;  5A23 A;  3L16 A;  3MX3 A;  4XIF A;  4IYP A;  2A4Z A;  3D9M A;  5CCL A;  3AS5 A;  4CRW A;  4ILG A;  1INZ A;  3ULQ A;  3QOU A;  4GCN A;  3PE3 A;  3CEQ A;  4I9E A;  2PZI A;  1ZU2 A;  1Y8M A;  3ML8 A;  3Q47 B;  4M3O A;  3DBS A;  3L54 A;  2AVP A;  3FH5 A;  5LP0 A;  5BPP A;  5KJL A;  1ZBP A;  3D9I A;  2A5U A;  3B7S A;  1N54 A;  1YA0 A;  3FH8 A;  4JHR A;  1UW4 B;  3ESK A;  4I6G A;  3LKU A;  3FTX A;  4HOR A;  4QFV A;  4L1B A;  3QAQ A;  5BNW A;  2PM6 A;  1JWF A;  3D9J A;  4ILI A;  2XCB A;  3PVL A;  2YHE A;  3IEG A;  4FHJ A;  2CHZ A;  2OV8 A;  2Y4T A;  2IJG X;  2OND A;  3QWV A;  3MZL B;  2WQH A;  2WXR A;  4PUC A;  2X38 A;  2CFZ A;  1PC2 A;  5G05 C;  3MCX A;  3FH7 A;  1FCH A;  2UWJ G;  4U04 A;  3GZ2 A;  3I4R B;  4DLQ A;  5FJY A;  3FUK A;  2MOW A;  3RU0 A;  3LY8 A;  3CHQ A;  4WND A;  4C0M A;  4UWH A;  3KS2 A;  1QNF A;  3S7D A;  2IU1 A;  3IKO B;  4D10 C;  4NUR A;  2JEK A;  4ANW A;  5FQ4 A;  1JPL A;  4N3C A;  5JHB A;  4KXK B;  2L9B A;  5ARF A;  2AW6 A;  1W3B A;  3MYV A;  4BWR A;  3TAX A;  2CG3 A;  3TXN A;  3ZYL A;  4LER A;  4AVX A;  3SFZ A;  1UJK A;  2V8S E;  3CSF A;  1ELW A;  4GA0 A;  3KAE A;  1BPO A;  4URK A;  5D0O D;  4KMO A;  3FTV A;  4PH4 B;  1FVF A;  5FQ8 A;  4G1T A;  4L2Y A;  3TGO A;  3U4T A;  3UT8 A;  3FU0 A;  2VJ8 A;  3P1U A;  4I2W A;  5AEN A;  3SZ7 A;  4HOT A;  3CK9 A;  5A7D B;  5AIJ A;  1H2U A;  5AJD A;  4EBA A;  4JA9 A;  4A3V A;  1P5Q A;  3VTX A;  3T8M A;  4JPS A;  1GW6 A;  3G2S A;  3B7U X;  1HS6 A;  4U0Z A;  2XCC A;  3CV0 A;  4A1G A;  4JXT A;  4KVO A;  1IYG A;  1Z3X A;  2DCP A;  2HO1 A;  2GRL A;  4CCA A;  4UI9 C;  3PUK A;  4E6H A;  4I6E A;  4K0R A;  1ELK A;  4UQY A;  3ZEF A;  4Q94 A;  5LCW J;  3D9N A;  5LCW C;  3E4B A;  3R7R A;  1PY1 A;  1IQU A;  2XHE A;  2YIN A;  3SNX A;  3UX4 A;  4BTB A;  5C1D A;  3IBE A;  3ZVV A;  4UWL A;  4JA7 A;  4GZC A;  2FO7 A;  3MKQ B;  1UG3 A;  4GPK A;  2PM7 A;  2FUL A;  2J4D A;  2WM9 A;  1IHG A;  2VGX B;  5ENN A;  3NQP A;  2EQX A;  3TG5 A;  5EDS A;  3FTY A;  5FZS A;  3CVN A;  3RK6 A;  4JZY A;  4JVS A;  4WWO A;  3FY4 A;  4APF A;  3LJ3 A;  3PNT B;  3LDZ A;  2VSY A;  3LVR E;  2CFU A;  3PZD A;  3RRN B;  5FT9 A;  2V0P A;  4H7Y A;  4CDR A;  3CR3 A;  1HO8 A;  1X5B A;  4B94 A;  3CVV A;  2HM8 A;  5ARG A;  3S2A A;  3G2U A;  3PRE A;  5T4Y A;  1U3C A;  3JQ1 A;  4BX9 A;  3CHR A;  3CVL A;  4YVO A;  1L5J A;  4JEH A;  4L2L A;  3U9W A;  3CKC A;  2QY7 A;  3O4Z A;  4O6F A;  1NZN A;  4F53 A;  3GYZ A;  3C98 A;  1E7V A;  3OXL A;  4CT4 A;  2J08 A;  2NC9 A;  3AU4 A;  3FTZ A;  3UPV A;  1JUQ A;  2KC7 A;  2XGO A;  3QKY A;  3LXU X;  3U64 A;  4C9B B;  4FP7 A;  5M72 A;  4PS8 A;  4AEZ C;  4AIF A;  2LNI A;  4RSY A;  3ZHE B;  1A17 A;  4WNE A;  4ME2 A;  3ASH A;  2L0I A;  1VDY A;  3FUI A;  3MEK A;  3K9I A;  3AS8 A;  2LAI A;  5DIZ A;  2WXN A;  4GYO A;  5JJ6 A;  2ILR A;  4APO A;  3BG1 B;  3APD A;  1NP7 A;  2XPI A;  2XQ0 A;  3LS8 A;  5C2Y A;  1S0P A;  4NRH B;  4FA6 A;  4N2Q A;  3CHS A;  3UT7 A;  3MKQ A;  5CMY A;  2C2L A;  4I6J A;  4CGW A;  3FU3 A;  2VTB B;  4N3B A;  4PS3 A;  2MRI A;  2VGX A;  4KZC A;  3FWV A;  5G04 C;  5LOZ A;  1B89 A;  4JC8 A;  4U07 A;  4ANV A;  3QB2 A;  4A3T A;  5DBK A;  4FAD A;  4KVM A;  2BTD A;  3APF A;  3ZPJ A;  4FLB A;  5G05 J;  3RKV A;  3JCK C;  2FBN A;  4FLH A;  4LRZ A;  4G26 A;  2CG2 A;  1DNP A;  4XKB A;  3ONL A;  1E90 A;  3SGH A;  2JLB A;  3FTW A;  1HXI A;  2IF4 A;  2PQN A;  3JUI A;  2UY1 B;  2IOL A;  3EIQ C;  4U0U A;  3FUN A;  1E7U A;  3QJZ A;  4WWN A;  3ENE A;  4YVQ C;  2L6J A;  3T5V A;  2E2E A;  2V4L A;  2XRY A;  1OWO A;  4BSX A;  4I1A A;  3ESL A;  4KBQ A;  3S7J A;  2WB2 A;  4BX8 A;  4J8D A;  2WVI A;  2WMN A;  3Q5M A;  3VLE A;  3LY7 A;  1Z3Y A;  4JW1 A;  4AOF A;  5D0Q D;  4I1O B;  3CKB A;  3RRM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...