3JUIA

Crystal structure of the c-terminal domain of human translation initiation factor eif2b epsilon subunit
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
176
structure length
174
Chain Sequence
GHHHHHHMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAGETILSWFSQRDDKGQQLRKNQQLQRFIQWLKEAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B epsilon Subunit
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Translation initiation factor eIF-2B subunit epsilon
total genus 64
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3juiA00
3EIQC 4GMLA 1H2TC 4CRWA 4JHKA 2IOLA 2I2OA 2IONA 4GMJA 4B8CB 2KZTB 4C9BB 2HM8A 4B89A 3L6AA 2ZU6B 2IU1A 2NSZA 3JUIA 3FEXA 1N54A 2KZTA 1H2UA 2FULA 4IULA 3D3MA 4B8AA 4LUNU 3RK6A 2VSOE 3EIJA 1H6KA 1HU3A 1PAQA 2VSXE 2IOSA 5ANRA 1UG3A 4CT4A 2RG8A 1UW4B 2GGFA 1H2VC 3FEYA 4JHJA 4CEMA 1N52A
chains in the Genus database with same CATH superfamily
3CSFA 2IONA 5G04C 3NOGD 3HIZA 2QZAA 1UJJA 4N3CA 4L9PA 3ZPJA 3LS8A 4WNEA 4XI9A 1HU3A 4H7XA 5LP0A 1KT0A 4RG6A 3DWLG 4HQDA 5A23A 2UY1B 5G04J 3UTMA 4DJAA 3U9WA 2R17C 4AXHA 3FP3A 4I6EA 2GW1A 4JEHA 2DWZA 5AJLA 2FULA 3FUJA 3ML9A 2XGSA 4U0UA 4ABNA 3AG3E 3CVQA 3ZYKA 3TGOA 2XEEA 2DCPA 2VGYA 3GZ1A 4I1AA 3LPZA 2P9KG 4J0UA 3MKQA 1TNYA 4U8YD 1NI1A 3UT8A 3SO8A 4YVQC 3LDZA 2NYJA 3S7FA 4FJYA 2WVIA 4ATGA 3DSSA 1S64A 4GZ5A 3FTSA 4JHKA 5CMYA 5ENOD 3HXCA 2L6JA 4F1SA 3JCKC 3JQ0A 3ASGA 3EJNA 5E75A 2DVWA 4RVBA 2PZIA 3KEZA 3RK6A 4BX9A 2R05A 4W9RA 5KJKA 3EUVA 4ILHB 2EIME 1H6PA 1FVFA 4HRMB 2IO2C 3ZKJA 3CK8A 3CHMA 4OVUA 1S63A 3EDTB 5FZRA 2VGXB 2HO1A 1FT1A 2GROB 3UM1A 4GPKA 4ILIA 3G2VA 1OCRE 4V3IA 3CQCB 3EU9A 5ARGA 3R7RA 4UWFA 4IULA 1KPSB 4O6FA 3D9LA 4IYPA 2QFCA 4O1OA 4NRHB 3B7TA 5EYPF 1X5BA 3FUFA 1YCSB 3DPYA 3PNLB 1BI8B 3UQ3A 3HG0D 5BXOA 1HFAA 2C0LA 1PY1A 4GTTA 4PS3A 4N5CA 4C0EA 3CVVA 5AIJA 4OAVB 2I9CA 3T5VA 2VTBB 4H7YA 1TJCA 2ETBA 5ANRA 2RFAA 4LERA 3ZYQA 4WNFA 4AY6A 2AJAA 3CKCA 4IN3B 2XCBA 4DK5A 4G8LA 4K0RA 1IHGA 1FVHA 5T3RA 5CRUA 5BV1A 2XZDG 2EINE 4DUIA 3B13A 4GCNA 3PUKA 4TRQA 3QKYA 4XEIG 2E2EA 3ZIMA 4JXTA 1P5QA 4XX5A 3MCXA 3RRUA 2J08A 3FTXA 5G55A 4HLLA 3EIQC 3SNXA 3GZSA 4CGWA 4UQXA 3O4ZA 3FU6A 1BI7B 3AG4E 3L16A 2QYUA 4HS2A 2DYSE 4G24A 2MRIA 3OXLA 3QWVA 5ANLA 3OXGA 3EHQA 4WWNA 3CHOA 3FTYA 2I2OA 5CERB 3AS8A 5JHBA 4A1SA 2NXPA 1QNFA 5AAOA 3HDXA 3ZHEA 1NA3A 1D8EA 3FULA 4JW1A 3FTWA 2DZOA 2XPZA 1MHQA 2IFUA 3ULEG 1NA0A 2X6FA 4F53A 3D9PA 3V31A 1D8DA 4LNGA 4CCAA 1O1RA 1IXVA 4JA7A 3NB2A 2IO3C 3ASOE 3T8KA 3UKRG 4UI9J 4GZ3A 3MYVA 3ZW3A 4U96D 4CDNA 2C0MA 3BG0B 3ASDA 5ENQD 3FH5A 4DX7D 4XIFA 3I5PA 2HM8A 3U3WA 4ILGA 4J7WA 1LD8A 4AIFA 3ASHA 4I17A 1TYQG 3SY2A 5AYWD 5CEAA 3DSXA 2ILRA 4N3AA 2KATA 2XRYA 5EIDA 4EQFA 1ZBPA 3HHMA 3PREA 2LAIA 3T5XA 1E96B 1Y8MA 3CLJA 4LEUA 5FQ4A 2OV8A 3LVQE 5CCLA 3SHFA 5EIBE 1MYOA 3SZ7A 2R02A 3EHMA 3TWTA 3ZGQA 1JCQA 3TWVA 3SFZA 4UI9K 3ASNE 2IJGX 5AQ7A 2ZXWE 1JUQA 2YQ8A 1OWOA 2PM6A 4HOQA 3IEGA 4M7CA 2WXLA 2XRZA 4A63B 4BEPA 5JJTA 4DX6D 1HH8A 3S7BA 3AS5A 4Q69A 2LAHA 1UG3A 4CDRA 3T8MA 2H6FA 2FO7A 2XGMA 1MX6A 4L1BA 5AENA 1OT8A 3FUNA 3L17A 5LOZA 1H19A 4GYYA 5LCWC 4ANXA 4UWKA 5AQBA 5EYLA 2H6GA 4KT6B 2YNQA 2WQ7A 1Y6IA 4C0MA 4NACA 3JXIA 4GTSA 3ABLE 3TWUA 3TAXA 1HX8A 5KJLA 2PL2A 3AU5A 1OCCE 4F3VA 1L5JA 1LD7A 3UM3A 5DIZA 4GA1A 3CHPA 1DNPA 4QFVA 4WNGA 5BPPA 4U8HA 4N2QA 4DLOA 4F7AA 2OVFA 3LY8A 5D0QD 5KJMA 2V4HC 4P29A 2OEWA 1HG5A 1QZ2A 3FDHA 4JEUA 1EDUA 3URZA 3TWRA 3ONLA 2GGFA 4AP2A 2IEJA 4I9CA 5J90A 3OAWA 2GRPB 4HI9A 1NZNA 3WXXA 4BY6A 1INZA 2X6IA 4NQ0A 1HO8A 2KXPC 3DPDA 5FWQA 5T4YA 4FADA 4I6GA 3SBSA 4HNAD 4F6RD 4AM9A 4N3BA 5EKQD 4GTQA 1N4QA 5A7DB 4XKCA 3EHRA 4GTMA 4B93B 4EBAG 1K1BA 4KVMA 2CFUA 1WY6A 3S7JA 4JA9A 1QQEA 4AEZC 2A5EA 3BG1B 3B95A 2J4DA 5IY5E 3L82A 3CQGB 2P2CP 3MX3A 2F8XK 2LSVA 2LO6A 3J5PA 3KAEA 2BEDA 2VSXE 3L13A 4YDWA 3E4BA 4G1TA 4FJZA 2IQCA 2BUGA 1OCZE 4D10C 4GZDA 4EZJA 1JWFA 2LXMA 4EPZA 4R7LA 4LG6A 3Q9NC 1NFIE 3UPVA 4DX2A 2FBNA 3JXJA 4E6HA 4FP7A 1EF1C 1H0AA 5LFAA 1IHBA 4UQZA 1K3ZD 1SVXA 4LSZE 4F1PA 3OXFA 2WXPA 5M72A 2Y3AA 2A5UA 3R7QA 3ZYLA 3TL5A 2P9SG 4XKBA 2P9IG 4G23A 3TG4A 4I43A 3ZXPA 2WXQA 3PZ4A 4C48B 3IHYA 1JCRA 3Q47B 4J8YA 1HZ4A 1JWGA 3E37A 1KLXA 1YA0A 3DSVA 3MKQB 4MLPA 3D9NA 3RJVA 3FUEA 2OVBA 4BSXA 4YNDA 4U0SA 3E33A 4OAUC 5ENRD 3UMVA 2V0PA 5B1BE 4ANUA 4K03A 3HRAA 4GA0A 4QQIA 4NURA 5KJNA 5B3SE 1S0PA 5EX3A 3T9KA 3QB2A 1UW4B 2IF4A 3ZN3A 4A55A 3VLDA 4GA2A 3QAQA 2L6BA 4EHMA 3ZFWA 3FUKA 3UKUG 3Q5MA 2LUHA 3LXUX 2H6IA 3EIJA 4OYSA 5AJDA 3WG7E 5KNHD 1PAQA 3B7SA 2UWJG 2IOSA 2MYOA 3UT7A 1OUVA 3FY4A 3QK0A 1H2TC 4HI8A 4B8CB 3MV3B 3JUIA 4FA6A 3L9TA 3QOUA 2CG2A 4HORA 5FIOA 5HI7A 3D9JA 2PNNA 1BU9A 4MS6A 1JPLA 2EIKE 2VQ2A 5ENPD 3CVWA 3QDNA 3I4GA 1AP7A 3TWWA 2V8SE 3ESLA 3PRZA 2ETCA 3D9MA 4HOSA 4E85A 3FUHA 2Y0BG 3AJIA 3ULQA 4U7EB 5KNGA 4I2ZA 2NSZA 4Z68A 2BTDA 2J49A 5JJ7A 3G2WA 2ONDA 4UQYA 3APCA 5LX8A 3ZUVB 4PUCA 4BERA 1IQUA 1EPUA 4WUYA 2Y4UA 4GTVA 3ULYA 1OWLA 4GYOA 4CT0A 1MJ0A 4Q96A 2HR2A 1OWPA 1E90A 2J9QA 3UIOC 1V54E 3QC1A 3R9AB 3O48A 4UUCA 5BXUA 1N0RA 4ACLA 1Z5SC 2HE0A 4ZHBA 1IYGA 3V30A 3TXMA 2VSOE 4BT8A 4L2YA 3B7BA 1OWNA 3IHVA 5FINA 3D9OA 3FUIA 4GU5A 2DBAA 3LEWA 4XZ4A 3MKRA 3UT4A 4N5QA 4I6JA 4PH4B 3PVLA 4ANWA 4YVOA 3RU0A 2VSYA 3I4RB 4GB9A 4G8KA 4J8EA 4UWLA 5HRYA 2Q7FA 2XS8A 1KT1A 3K9IA 1U3DA 4JC8A 3DEOA 2WXJA 4EZLA 5KWDA 2FF4A 4AOFA 1TN6A 1Z3XA 3CHQA 4JL0A 3NOCD 1AWCB 4L2LA 1IQRA 2MHKA 4B0ZA 2AXVA 3G2TA 3CVPA 1VDYA 1N94A 5ENSD 3MEKA 4I1OB 1A5EA 4Y6WA 3V79K 3DBSA 1GW6A 4HVBA 2Y1LE 1HXIA 2WXHA 2J4BA 1DCQA 3CSTA 1TNUA 4CT4A 1BPOA 5FT9A 4TUMA 2JABA 4DX5D 3VLEA 1K8KG 1LTXA 2R5SA 2F0YA 3DXMG 3G2UA 5E76A 2LXLA 2WQ6A 2WPVA 3ABKE 2FI7A 3Q7FA 4LRZA 5EDSA 1MQSA 3B7UX 1JCSA 3ZHEB 5AQ9A 5DBKA 5C1DA 5BNWA 1W3BA 1N95A 4DI3A 4JPSA 5FJYA 1WG0A 1LF8A 2X6KA 2X3MA 4ZFHA 3ZU7B 5FTPA 3FEYA 2V5FA 4FHJA 3I3NA 5FZQA 4GMJA 1TNOA 4MBGA 2WQHA 3S7DA 4Y6CA 2CHWA 3F6QA 4APOA 5CHEE 3ZXSA 1U3CA 4A1GA 3ZRHA 4URKA 3ZEFA 3RIBA 1NL4A 1O1SA 2J07A 3CGHA 3FUDA 3C5RA 3L08A 1X81A 4HB5A 4I2WA 2RKKA 3QARA 1E7UA 4LUNU 3AU4A 3S2AA 2GRLA 2RG8A 2MOWA 3PNTB 3UINC 3KSLA 3X2QE 2EILE 5D66A 3D9IA 3PZDA 2WM9A 2VTBA 2VGEA 4L7TA 2JLBA 3CV0A 4J8DA 2WB2A 5KCMA 2KCLA 3ONKA 3HXEA 1DCEA 3D9HA 4DLQA 2YHCA 4YDOA 1UN9A 4N39A 4UWGA 3CKBA 4FLHA 4A3VA 1ELWA 2Y69E 3UIPC 4O1PA 1N9AA 4XI0A 4I9EA 1HE8A 2ZGDA 4EBAA 2P58C 4MRUA 3W9GA 3FH7A 2P9NG 3QNKA 3VTYA 3NF1A 1QYMA 2AXZA 3Q7AA 2VGXA 4HBDA 3TWQA 3J5QB 2IOLA 3LCAA 5HQ8A 3LJ3A 3V2XA 2QY7A 2XHEA 4APFA 3P1UA 1KZPA 5G05C 3UX4A 3VLFA 3ESKA 2PM7A 5CBNA 2X6HA 4KZ0A 3C72A 2FO1E 4WAFA 5EN5D 3PZ3A 3LY7A 3R9MA 1MX2A 5G05J 3LY9A 3CHSA 4LNBA 5B1AE 2GRQB 2OCCE 2I6HA 2XZTG 5ARFA 2AVPA 1H2VC 4BFRA 2YINA 1TR4A 3N71A 2B6CA 5AQAA 1N11A 5AARA 4BX8A 4TXPA 3C98A 2E0IA 1HS6A 3IKOB 2BF0X 3LKUA 3Q49B 5HKPA 2AXUA 3SGHA 3UI2A 3PE3A 4UWHA 1SZAA 4U0ZA 4DRXE 3FEXA 1N54A 2HYZA 3RO3A 2WXMA 3SFXA 3DXKG 3PDNA 4GTPA 2WXOA 4GZ6A 4EECA 3HXDA 1MX4A 3Q73A 1TJFA 3HVEB 3CVUA 3ML8A 4RQIA 1H6OA 1H2UA 1Q2ZA 1YMPA 5JMND 4I1MA 4EZKA 3BQOA 2VJ8A 2CG3A 2WXNA 3V2OA 3E34A 1RW2A 1A17A 4PS8A 4JHRA 3APDA 3CR3A 4G11A 2WXIA 4U95D 4JB8P 3D3MA 3BEEA 4PDXA 1S70B 4TXRA 1N4PA 2CFZA 4J6IA 4LNUD 4ME2A 3D9KA 5CMWA 2XPIA 3FFLA 3APFA 5JHAA 1TEZA 3MA5A 4HOUA 4ATZD 2YHEA 2IU1A 1UOHA 5A6CA 2JEKA 4WNDA 4K5BA 4B8AA 3FU3A 3FH8A 3PEUB 1TNZA 4GMRA 3RO2A 4AJWA 4CEMA 1B89A 3W9FA 2CHZA 4K5AB 4WWPA 3PH0C 3RSEG 3DEPA 4HLEA 5C2YA 2EQXA 3PE4A 1DVPA 2XPYA 1E8XA 1TN8A 3SFYA 3QJZA 3UM2A 2BKKB 3E32A 3ABME 2KZTB 5BUZA 2GRMA 3AG2E 4BWRA 5CCMA 3JUEA 1D9SA 4BETA 3FHEA 1WAO1 4AVXA 5CBOA 3FU5A 3C3RA 2R59A 3DRAA 3NZSA 2VSNA 3Q75A 5H7PA 2XEVA 4O60A 1HG2A 4BTAA 4TV3A 2LNIA 2WXKA 2L0IA 3C3OA 4G2VA 2RFMA 1SA4A 4U8VD 4PS7A 3TWSA 1MZCA 3CVLA 3GZ2A 3B7RL 5BT1A 4GAAA 1O1TA 3CK7A 5FQ8A 1UN8A 2R2LA 1ELRA 4TUUA 2X6JA 3CVNA 4AV7A 4ACKA 1RZ4A 1EYHA 5FQ7A 2XQ0A 2L9BA 3KS2A 4BTBA 1OCOE 4KZCA 3MZLB 3IV0A 4DPRA 3BUAA 2VYIA 4U63A 4HFGA 1DC2A 2V4LA 5D0OD 2F8YA 1TN7A 2XENA 5CECB 3LYAA 4HXIA 2B0OE 3TJPA 2A4ZA 4J8FA 3RRMB 5LCWJ 3AG1E 1HF8A 4DX1A 2H6HA 1SA5A 4FU3A 3ENEA 4L23A 4N2SA 1E8WA 2KCKA 4KYOB 4KMOA 4FULA 4CDMA 3TWXA 5G2NA 3NBNB 4M3OA 1KZOA 2P9UG 2KC7A 1ZB1A 3L6AA 3KSQA 4HRLA 4HOTA 4JVSA 3ZYMA 1UJKA 4GTRA 1IKND 4DI4A 3MGBA 3Q78A 4XE0A 3ZVVA 2P9LG 3UXGA 1Z3YA 3FU0A 2V5QC 4A3TA 3HXBA 3UM0A 1N4RA 4GYWA 3HXFA 2OEVA 5FQ6A 5CRVA 1N4SA 4G26A 3GYZA 4YDEA 3SD5A 2AWIA 3QWWA 3SBTB 2J8SD 3ZNGA 2KM4A 3MJWA 4RG9A 2GRRB 4BESA 1E8ZA 2WMNA 3G2SA 5JA4D 5CEDB 3IBEA 4TXQA 2DYRE 2ETAA 3SF4A 3ASFA 4JD2G 3FTZA 1TNBA 2R03A 2ZU6B 3NZUA 1K1AA 3CIAA 1E8YA 3C3QA 4CZ2D 4KVOA 5AN8A 1SQMA 3PUJA 4CYMD 5HS0A 2EIJE 3UUXA 3L22A 1O5MA 2M63A 4OVVA 4GZCA 4GPMA 2J09A 1U2VG 3U64A 3P2BA 4RLYA 3JQ1A 1NP7A 2L0TB 5T8IA 1FCHA 3FWVA 3TXNA 2XGOA 3FTVA 2ZGGA 5EX0A 1OY3D 1SW6A 4FHKA 2WMOA 2X38A 4CGVA 1BD8A 3Q15A 2PQRA 2XS1A 4LCTA 4B89A 5ITZF 3GW4A 3HYMB 1XNFA 3TG5A 3CK9A 1OXJA 5D2MC 3SI5A 3NQPA 5FZSA 3DSWA 4K5CA 4RSYA 2P9PG 1WM5A 2KBXA 1FPPA 3JYSA 4FLBA 2XCCA 3OTNA 3E30A 4C9BB 2UY1A 4YDYA 2KCVA 1WDYA 4FC8A 2GRNB 2IY0C 3PEVB 4WWOA 3PS6A 1H6KA 3CHRA 3DSTA 4GTOA 1XGWA 2ZISA 4MKTA 2Y4TA 4KXKB 3L54A 1SZ9A 1G3NB 4CRWA 3Q4AB 2FEZA 3VTXA 4UI9C 3LVRE 1Z6TA 5J08A 2RD0A 5JJ6A 3FUMA 3CEQA 4AY5A 5ENNA 2AW6A 3KEAA 1QBQA 4JHJA 1N0QA 2QYJA 1YYHA 3Q9UC 2LSUA 5BW8C 1V55E 2KZTA 4J8SA 4NIKA 3U66A 2XEHA 5BV0A 3CVYA 4U04A 3RAUA 3BU8A 3HVEA 1PC2A 2I1KA 3EU5A 4IRUA 4G25A 3DSUA 1E7VA 3Q79A 1BLXB 3ISMC 5EILA 4KBQA 2ZIRA 4GMLA 4GCOA 4ANVA 3U4TA 3PZ2A 2CHXA 3FTUA 3NAWA 4JZYA 5ENTD 3AS4A 5KBAA 3CVXA 2WXGA 4X8QA 4B94A 2BKGA 2DIWA 3PZ1A 4BSZB 3AAAC 1ELKA 1OWMA 4Q94A 2C2LA 3EHNA 1FT2A 3LJNA 2QC9A 3SQVA 1ZU2A 3MV2B 2NC9A 4BT9A 3QWPA 2DZNA 2WXRA 2WXFA 3RRNB 4U07A 2I1JA 3RKVA 3IXEA 2OOEA 3KD7A 4HRNA 2F37A 2PQNA 1N52A
chains in the Genus database with same CATH topology
2FF4A 4AOFA 3CSFA 2IONA 1Z3XA 3CHQA 5G04C 2KZTB 4JL0A 5BUZA 2GRMA 3HIZA 1HX8A 1UJJA 4N3CA 4BWRA 2PL2A 3AU5A 5KJLA 5CCMA 4L2LA 3ZPJA 3LS8A 4WNEA 1IQRA 4XI9A 3FHEA 1WAO1 4F3VA 1L5JA 4AVXA 1HU3A 2MHKA 3FU5A 4H7XA 5DIZA 5LP0A 4B0ZA 4GA1A 2AXVA 1KT0A 3CHPA 2R59A 4RG6A 1DNPA 3G2TA 4QFVA 3CVPA 4WNGA 5BPPA 3NZSA 1VDYA 4U8HA 2UY1B 5G04J 4DJAA 5A23A 4N2QA 4DLOA 2VSNA 3MEKA 3U9WA 4F7AA 2OVFA 2R17C 3LY8A 4I1OB 5D0QD 4AXHA 5KJMA 3FP3A 4I6EA 2XEVA 4Y6WA 2GW1A 1HG2A 3DBSA 4JEHA 4BTAA 4P29A 4TV3A 2LNIA 1GW6A 1HG5A 2WXKA 4HVBA 2L0IA 5AJLA 2FULA 1HXIA 2WXHA 1QZ2A 3FDHA 2J4BA 3FUJA 4JEUA 4G2VA 1EDUA 2XGSA 3ML9A 3CSTA 4U0UA 3URZA 4CT4A 1BPOA 3ONLA 2GGFA 4PS7A 4ABNA 4AP2A 3CVLA 3GZ2A 4I9CA 5FT9A 3B7RL 3CVQA 5J90A 3OAWA 3VLEA 3ZYKA 3TGOA 5BT1A 2DCPA 2R5SA 1NZNA 4GAAA 2VGYA 3CK7A 3GZ1A 5FQ8A 4I1AA 3LPZA 1UN8A 3WXXA 4J0UA 3G2UA 5E76A 1ELRA 3MKQA 4BY6A 2WPVA 2WQ6A 1INZA 4TUUA 3UT8A 2X6IA 4NQ0A 1HO8A 3DPDA 5FWQA 5T4YA 4FADA 4YVQC 3LDZA 2FI7A 4LRZA 3S7FA 2X6JA 3CVNA 4I6GA 4FJYA 2WVIA 3SBSA 4ATGA 4GZ5A 4AV7A 5EDSA 4ACKA 1MQSA 3B7UX 3FTSA 4JHKA 4N3BA 5CMYA 4AM9A 3ZHEB 1EYHA 5DBKA 5FQ7A 2XQ0A 2L9BA 3KS2A 2L6JA 5EKQD 3JCKC 1W3BA 4BTBA 3JQ0A 4F1SA 5BNWA 3ASGA 3EJNA 4DI3A 5E75A 4JPSA 5FJYA 5A7DB 4RVBA 2PZIA 3KEZA 4KZCA 4XKCA 3MZLB 3RK6A 3IV0A 4BX9A 4DPRA 1LF8A 2VYIA 2X6KA 4EBAG 4W9RA 4KVMA 5KJKA 2CFUA 4U63A 1WY6A 2X3MA 3S7JA 4HFGA 4ILHB 4JA9A 1QQEA 4AEZC 5FTPA 3FEYA 2V4LA 5D0OD 1FVFA 2V5FA 4FHJA 3BG1B 3I3NA 5FZQA 4GMJA 2WQHA 3LYAA 4HXIA 4Y6CA 3S7DA 2CHWA 2J4DA 3TJPA 2A4ZA 3CK8A 3CHMA 4APOA 4OVUA 5CHEE 3CQGB 4J8FA 3ZXSA 3MX3A 3EDTB 3RRMB 5LCWJ 1U3CA 1HF8A 2LSVA 5FZRA 2LO6A 3KAEA 4FU3A 3ENEA 3ZRHA 4L23A 2VGXB 2HO1A 4A1GA 3ZEFA 4URKA 2VSXE 4N2SA 1E8WA 2KCKA 3L13A 4KYOB 3RIBA 4KMOA 4FULA 3E4BA 4GPKA 4CDMA 4ILIA 3G2VA 4G1TA 4FJZA 2J07A 3CGHA 5G2NA 4M3OA 2IQCA 3FUDA 2BUGA 4V3IA 4D10C 4GZDA 3L08A 2KC7A 4EZJA 3CQCB 1JWFA 5ARGA 3R7RA 3L6AA 5C1DA 4EPZA 4UWFA 4I2WA 3QARA 4IULA 4O6FA 1E7UA 3D9LA 4R7LA 4HOTA 4IYPA 4JVSA 4LUNU 2QFCA 3ZYMA 1UJKA 2FBNA 3B7TA 4NRHB 3UPVA 1X5BA 3FUFA 3AU4A 4E6HA 3PNLB 3S2AA 4DI4A 2GRLA 3MGBA 2RG8A 4FP7A 2MOWA 3UQ3A 3PNTB 1EF1C 4XE0A 3ZVVA 1H0AA 1Z3YA 3FU0A 4A3TA 3D9IA 3PZDA 5LFAA 2WM9A 1HFAA 2C0LA 4GYWA 2VTBA 1PY1A 4L7TA 2JLBA 3CV0A 4PS3A 4UQZA 5FQ6A 4N5CA 4J8DA 4C0EA 5KCMA 2WB2A 2KCLA 3CVVA 3ONKA 4G26A 3OXFA 2WXPA 4DLQA 2YHCA 5AIJA 3GYZA 2I9CA 3SD5A 5M72A 1UN9A 2AWIA 3QWWA 3SBTB 4N39A 2Y3AA 3T5VA 2VTBB 4H7YA 1TJCA 2A5UA 4UWGA 2KM4A 3MJWA 3R7QA 4RG9A 3ZYLA 5ANRA 4LERA 3TL5A 3CKBA 4XKBA 3ZYQA 4WNFA 4AY6A 4FLHA 1E8ZA 3CKCA 4A3VA 2WMNA 3G2SA 4G23A 2XCBA 4IN3B 3TG4A 1ELWA 3IBEA 4K0RA 4I43A 4DK5A 1IHGA 1FVHA 3SF4A 5T3RA 5BV1A 3ASFA 4I9EA 4XI0A 2WXQA 1HE8A 3FTZA 2ZU6B 3B13A 3IHYA 3NZUA 3CIAA 4GCNA 2P58C 3Q47B 4EBAA 1E8YA 3PUKA 4MRUA 3QKYA 4TRQA 2E2EA 4KVOA 1HZ4A 1JWGA 1KLXA 1SQMA 1YA0A 3ZIMA 3PUJA 4JXTA 3MKQB 4MLPA 1P5QA 3D9NA 4XX5A 3RJVA 3FH7A 2OVBA 3FUEA 2J08A 3MCXA 3RRUA 3UUXA 4YNDA 4BSXA 3QNKA 3FTXA 3L22A 5G55A 4U0SA 3VTYA 3NF1A 3EIQC 2AXZA 3SNXA 2VGXA 3GZSA 2IOLA 4CGWA 4UQXA 3O4ZA 3FU6A 3UMVA 2V0PA 3LCAA 2M63A 4OVVA 4GZCA 4ANUA 2J09A 5HQ8A 3LJ3A 3U64A 4K03A 3P2BA 2QY7A 3JQ1A 2XHEA 4APFA 3L16A 1NP7A 3P1UA 4GA0A 2L0TB 5T8IA 4NURA 5G05C 3UX4A 4HS2A 3VLFA 4G24A 1S0PA 3ESKA 5EX3A 5KJNA 1FCHA 2MRIA 2PM7A 3FWVA 3QB2A 3TXNA 2XGOA 1UW4B 3OXLA 3FTVA 2IF4A 2X6HA 3QWVA 3ZN3A 4A55A 3VLDA 5EX0A 5ANLA 3OXGA 4KZ0A 4FHKA 2WMOA 2X38A 4CGVA 4WWNA 3CHOA 3FTYA 4GA2A 3QAQA 2I2OA 3CVYA 3AS8A 3Q15A 5JHBA 4A1SA 2NXPA 2PQRA 4WAFA 3ZFWA 3FUKA 4LCTA 4B89A 3LY7A 3GW4A 3HYMB 1QNFA 1XNFA 3Q5MA 5G05J 3TG5A 3LY9A 3CK9A 3CHSA 3HDXA 3LXUX 3ZHEA 3EIJA 3NQPA 3SI5A 1NA3A 5FZSA 4OYSA 5AJDA 1PAQA 2I6HA 3B7SA 2UWJG 2IOSA 4RSYA 3UT7A 5ARFA 1OUVA 2AVPA 1WM5A 1H2VC 3FULA 3FY4A 4BFRA 3JYSA 4FLBA 3QK0A 4JW1A 2YINA 3FTWA 3N71A 1H2TC 2XPZA 2XCCA 3OTNA 4B8CB 1MHQA 4C9BB 2UY1A 2IFUA 1NA0A 4BX8A 2KCVA 2X6FA 3MV3B 4F53A 3JUIA 3C98A 3D9PA 4FC8A 2E0IA 1HS6A 3PEVB 4WWOA 4CCAA 3PS6A 3IKOB 4JA7A 2BF0X 4FA6A 1H6KA 3LKUA 3CHRA 3QOUA 1XGWA 4UI9J 2CG2A 3Q49B 4GZ3A 2Y4TA 3MYVA 4KXKB 4MKTA 4HORA 5HI7A 3L54A 3D9JA 3ZW3A 2AXUA 4CDNA 1SZ9A 2C0MA 3BG0B 3SGHA 4CRWA 3ASDA 3FH5A 3PE3A 3Q4AB 1SZAA 4MS6A 2FEZA 4UWHA 4XIFA 3VTXA 1JPLA 3I5PA 2HM8A 2VQ2A 4U0ZA 3U3WA 4UI9C 3CVWA 3QDNA 3LVRE 1Z6TA 3I4GA 5J08A 3FEXA 1N54A 2HYZA 2RD0A 5JJ6A 3FUMA 3RO3A 2WXMA 4ILGA 3PDNA 2V8SE 2WXOA 4GZ6A 4EECA 3CEQA 4AY5A 3ESLA 3PRZA 5ENNA 4AIFA 3ASHA 2AW6A 4I17A 4JHJA 3D9MA 4HOSA 1TJFA 4E85A 3FUHA 3HVEB 3CVUA 5AYWD 2ILRA 4N3AA 2KATA 3ML8A 2LSUA 3ULQA 5BW8C 2XRYA 4I2ZA 2NSZA 2BTDA 2J49A 2KZTA 1H2UA 5JJ7A 4J8SA 3G2WA 2ONDA 4I1MA 4UQYA 4EZKA 5BV0A 3U66A 4U04A 1ZBPA 4EQFA 3APCA 3HVEA 2LAIA 1PC2A 3HHMA 3PREA 2I1KA 2VJ8A 4IRUA 2CG3A 2WXNA 3T5XA 4G25A 1E96B 5LX8A 1E7VA 4KBQA 4PUCA 1Y8MA 3CLJA 1A17A 4LEUA 1IQUA 4GMLA 4JHRA 4PS8A 5FQ4A 4GCOA 4ANVA 2OV8A 3LVQE 3APDA 1EPUA 5CCLA 3SHFA 3CR3A 4G11A 3U4TA 2WXIA 2Y4UA 4WUYA 3SZ7A 1OWLA 2CHXA 3EHMA 3FTUA 4GYOA 3ZGQA 3D3MA 4CT0A 3BEEA 4JZYA 4Q96A 3SFZA 4UI9K 2HR2A 2IJGX 4PDXA 1OWPA 2CFZA 4J6IA 3AS4A 1E90A 2J9QA 4ME2A 3CVXA 2WXGA 3QC1A 3R9AB 4B94A 1JUQA 3D9KA 2YQ8A 3O48A 5CMWA 1OWOA 2DIWA 2XPIA 3FFLA 2PM6A 3APFA 5JHAA 1TEZA 4HOQA 3MA5A 4ACLA 3IEGA 4HOUA 2WXLA 2YHEA 1IYGA 1ELKA 1OWMA 2IU1A 5A6CA 2XRZA 2JEKA 4Q94A 4WNDA 4B8AA 5JJTA 3TXMA 2VSOE 2C2LA 3EHNA 3FU3A 3FH8A 4L2YA 4BT8A 1OWNA 1HH8A 3PEUB 3S7BA 3AS5A 3IHVA 4Q69A 2LAHA 3D9OA 1UG3A 4CDRA 3T8MA 3FUIA 1ZU2A 4GU5A 3RO2A 4AJWA 2FO7A 3MV2B 2DBAA 2XGMA 4CEMA 2NC9A 4L1BA 5AENA 1B89A 3LEWA 4BT9A 4XZ4A 3MKRA 3FUNA 3UT4A 3L17A 3QWPA 5LOZA 1H19A 4I6JA 4PH4B 4GYYA 2CHZA 5LCWC 3PVLA 4ANWA 4YVOA 4WWPA 3RU0A 4ANXA 4UWKA 3PH0C 2VSYA 2WXRA 3I4RB 4HLEA 2WXFA 3RRNB 4GB9A 5C2YA 2EQXA 4KT6B 2YNQA 2WQ7A 4J8EA 1Y6IA 4UWLA 2Q7FA 3PE4A 4U07A 1DVPA 1KT1A 2I1JA 3K9IA 3RKVA 2XPYA 1E8XA 2OOEA 4NACA 4C0MA 3KD7A 1U3DA 4JC8A 2PQNA 2WXJA 3QJZA 4EZLA 3TAXA 1N52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIQ C;  4GML A;  1H2T C;  4CRW A;  4JHK A;  2IOL A;  2I2O A;  2ION A;  4GMJ A;  4B8C B;  2KZT B;  4C9B B;  2HM8 A;  4B89 A;  3L6A A;  2ZU6 B;  2IU1 A;  2NSZ A;  3JUI A;  3FEX A;  1N54 A;  2KZT A;  1H2U A;  2FUL A;  4IUL A;  3D3M A;  4B8A A;  4LUN U;  3RK6 A;  2VSO E;  3EIJ A;  1H6K A;  1HU3 A;  1PAQ A;  2VSX E;  2IOS A;  5ANR A;  1UG3 A;  4CT4 A;  2RG8 A;  1UW4 B;  2GGF A;  1H2V C;  3FEY A;  4JHJ A;  4CEM A;  1N52 A; 
#chains in the Genus database with same CATH topology
 3CSF A;  2ION A;  5G04 C;  3NOG D;  3HIZ A;  2QZA A;  1UJJ A;  4N3C A;  4L9P A;  3ZPJ A;  3LS8 A;  4WNE A;  4XI9 A;  1HU3 A;  4H7X A;  5LP0 A;  1KT0 A;  4RG6 A;  3DWL G;  4HQD A;  5A23 A;  2UY1 B;  5G04 J;  3UTM A;  4DJA A;  3U9W A;  2R17 C;  4AXH A;  3FP3 A;  4I6E A;  2GW1 A;  4JEH A;  2DWZ A;  5AJL A;  2FUL A;  3FUJ A;  3ML9 A;  2XGS A;  4U0U A;  4ABN A;  3AG3 E;  3CVQ A;  3ZYK A;  3TGO A;  2XEE A;  2DCP A;  2VGY A;  3GZ1 A;  4I1A A;  3LPZ A;  2P9K G;  4J0U A;  3MKQ A;  1TNY A;  4U8Y D;  1NI1 A;  3UT8 A;  3SO8 A;  4YVQ C;  3LDZ A;  2NYJ A;  3S7F A;  4FJY A;  2WVI A;  4ATG A;  3DSS A;  1S64 A;  4GZ5 A;  3FTS A;  4JHK A;  5CMY A;  5ENO D;  3HXC A;  2L6J A;  4F1S A;  3JCK C;  3JQ0 A;  3ASG A;  3EJN A;  5E75 A;  2DVW A;  4RVB A;  2PZI A;  3KEZ A;  3RK6 A;  4BX9 A;  2R05 A;  4W9R A;  5KJK A;  3EUV A;  4ILH B;  2EIM E;  1H6P A;  1FVF A;  4HRM B;  2IO2 C;  3ZKJ A;  3CK8 A;  3CHM A;  4OVU A;  1S63 A;  3EDT B;  5FZR A;  2VGX B;  2HO1 A;  1FT1 A;  2GRO B;  3UM1 A;  4GPK A;  4ILI A;  3G2V A;  1OCR E;  4V3I A;  3CQC B;  3EU9 A;  5ARG A;  3R7R A;  4UWF A;  4IUL A;  1KPS B;  4O6F A;  3D9L A;  4IYP A;  2QFC A;  4O1O A;  4NRH B;  3B7T A;  5EYP F;  1X5B A;  3FUF A;  1YCS B;  3DPY A;  3PNL B;  1BI8 B;  3UQ3 A;  3HG0 D;  5BXO A;  1HFA A;  2C0L A;  1PY1 A;  4GTT A;  4PS3 A;  4N5C A;  4C0E A;  3CVV A;  5AIJ A;  4OAV B;  2I9C A;  3T5V A;  2VTB B;  4H7Y A;  1TJC A;  2ETB A;  5ANR A;  2RFA A;  4LER A;  3ZYQ A;  4WNF A;  4AY6 A;  2AJA A;  3CKC A;  4IN3 B;  2XCB A;  4DK5 A;  4G8L A;  4K0R A;  1IHG A;  1FVH A;  5T3R A;  5CRU A;  5BV1 A;  2XZD G;  2EIN E;  4DUI A;  3B13 A;  4GCN A;  3PUK A;  4TRQ A;  3QKY A;  4XEI G;  2E2E A;  3ZIM A;  4JXT A;  1P5Q A;  4XX5 A;  3MCX A;  3RRU A;  2J08 A;  3FTX A;  5G55 A;  4HLL A;  3EIQ C;  3SNX A;  3GZS A;  4CGW A;  4UQX A;  3O4Z A;  3FU6 A;  1BI7 B;  3AG4 E;  3L16 A;  2QYU A;  4HS2 A;  2DYS E;  4G24 A;  2MRI A;  3OXL A;  3QWV A;  5ANL A;  3OXG A;  3EHQ A;  4WWN A;  3CHO A;  3FTY A;  2I2O A;  5CER B;  3AS8 A;  5JHB A;  4A1S A;  2NXP A;  1QNF A;  5AAO A;  3HDX A;  3ZHE A;  1NA3 A;  1D8E A;  3FUL A;  4JW1 A;  3FTW A;  2DZO A;  2XPZ A;  1MHQ A;  2IFU A;  3ULE G;  1NA0 A;  2X6F A;  4F53 A;  3D9P A;  3V31 A;  1D8D A;  4LNG A;  4CCA A;  1O1R A;  1IXV A;  4JA7 A;  3NB2 A;  2IO3 C;  3ASO E;  3T8K A;  3UKR G;  4UI9 J;  4GZ3 A;  3MYV A;  3ZW3 A;  4U96 D;  4CDN A;  2C0M A;  3BG0 B;  3ASD A;  5ENQ D;  3FH5 A;  4DX7 D;  4XIF A;  3I5P A;  2HM8 A;  3U3W A;  4ILG A;  4J7W A;  1LD8 A;  4AIF A;  3ASH A;  4I17 A;  1TYQ G;  3SY2 A;  5AYW D;  5CEA A;  3DSX A;  2ILR A;  4N3A A;  2KAT A;  2XRY A;  5EID A;  4EQF A;  1ZBP A;  3HHM A;  3PRE A;  2LAI A;  3T5X A;  1E96 B;  1Y8M A;  3CLJ A;  4LEU A;  5FQ4 A;  2OV8 A;  3LVQ E;  5CCL A;  3SHF A;  5EIB E;  1MYO A;  3SZ7 A;  2R02 A;  3EHM A;  3TWT A;  3ZGQ A;  1JCQ A;  3TWV A;  3SFZ A;  4UI9 K;  3ASN E;  2IJG X;  5AQ7 A;  2ZXW E;  1JUQ A;  2YQ8 A;  1OWO A;  2PM6 A;  4HOQ A;  3IEG A;  4M7C A;  2WXL A;  2XRZ A;  4A63 B;  4BEP A;  5JJT A;  4DX6 D;  1HH8 A;  3S7B A;  3AS5 A;  4Q69 A;  2LAH A;  1UG3 A;  4CDR A;  3T8M A;  2H6F A;  2FO7 A;  2XGM A;  1MX6 A;  4L1B A;  5AEN A;  1OT8 A;  3FUN A;  3L17 A;  5LOZ A;  1H19 A;  4GYY A;  5LCW C;  4ANX A;  4UWK A;  5AQB A;  5EYL A;  2H6G A;  4KT6 B;  2YNQ A;  2WQ7 A;  1Y6I A;  4C0M A;  4NAC A;  3JXI A;  4GTS A;  3ABL E;  3TWU A;  3TAX A;  1HX8 A;  5KJL A;  2PL2 A;  3AU5 A;  1OCC E;  4F3V A;  1L5J A;  1LD7 A;  3UM3 A;  5DIZ A;  4GA1 A;  3CHP A;  1DNP A;  4QFV A;  4WNG A;  5BPP A;  4U8H A;  4N2Q A;  4DLO A;  4F7A A;  2OVF A;  3LY8 A;  5D0Q D;  5KJM A;  2V4H C;  4P29 A;  2OEW A;  1HG5 A;  1QZ2 A;  3FDH A;  4JEU A;  1EDU A;  3URZ A;  3TWR A;  3ONL A;  2GGF A;  4AP2 A;  2IEJ A;  4I9C A;  5J90 A;  3OAW A;  2GRP B;  4HI9 A;  1NZN A;  3WXX A;  4BY6 A;  1INZ A;  2X6I A;  4NQ0 A;  1HO8 A;  2KXP C;  3DPD A;  5FWQ A;  5T4Y A;  4FAD A;  4I6G A;  3SBS A;  4HNA D;  4F6R D;  4AM9 A;  4N3B A;  5EKQ D;  4GTQ A;  1N4Q A;  5A7D B;  4XKC A;  3EHR A;  4GTM A;  4B93 B;  4EBA G;  1K1B A;  4KVM A;  2CFU A;  1WY6 A;  3S7J A;  4JA9 A;  1QQE A;  4AEZ C;  2A5E A;  3BG1 B;  3B95 A;  2J4D A;  5IY5 E;  3L82 A;  3CQG B;  2P2C P;  3MX3 A;  2F8X K;  2LSV A;  2LO6 A;  3J5P A;  3KAE A;  2BED A;  2VSX E;  3L13 A;  4YDW A;  3E4B A;  4G1T A;  4FJZ A;  2IQC A;  2BUG A;  1OCZ E;  4D10 C;  4GZD A;  4EZJ A;  1JWF A;  2LXM A;  4EPZ A;  4R7L A;  4LG6 A;  3Q9N C;  1NFI E;  3UPV A;  4DX2 A;  2FBN A;  3JXJ A;  4E6H A;  4FP7 A;  1EF1 C;  1H0A A;  5LFA A;  1IHB A;  4UQZ A;  1K3Z D;  1SVX A;  4LSZ E;  4F1P A;  3OXF A;  2WXP A;  5M72 A;  2Y3A A;  2A5U A;  3R7Q A;  3ZYL A;  3TL5 A;  2P9S G;  4XKB A;  2P9I G;  4G23 A;  3TG4 A;  4I43 A;  3ZXP A;  2WXQ A;  3PZ4 A;  4C48 B;  3IHY A;  1JCR A;  3Q47 B;  4J8Y A;  1HZ4 A;  1JWG A;  3E37 A;  1KLX A;  1YA0 A;  3DSV A;  3MKQ B;  4MLP A;  3D9N A;  3RJV A;  3FUE A;  2OVB A;  4BSX A;  4YND A;  4U0S A;  3E33 A;  4OAU C;  5ENR D;  3UMV A;  2V0P A;  5B1B E;  4ANU A;  4K03 A;  3HRA A;  4GA0 A;  4QQI A;  4NUR A;  5KJN A;  5B3S E;  1S0P A;  5EX3 A;  3T9K A;  3QB2 A;  1UW4 B;  2IF4 A;  3ZN3 A;  4A55 A;  3VLD A;  4GA2 A;  3QAQ A;  2L6B A;  4EHM A;  3ZFW A;  3FUK A;  3UKU G;  3Q5M A;  2LUH A;  3LXU X;  2H6I A;  3EIJ A;  4OYS A;  5AJD A;  3WG7 E;  5KNH D;  1PAQ A;  3B7S A;  2UWJ G;  2IOS A;  2MYO A;  3UT7 A;  1OUV A;  3FY4 A;  3QK0 A;  1H2T C;  4HI8 A;  4B8C B;  3MV3 B;  3JUI A;  4FA6 A;  3L9T A;  3QOU A;  2CG2 A;  4HOR A;  5FIO A;  5HI7 A;  3D9J A;  2PNN A;  1BU9 A;  4MS6 A;  1JPL A;  2EIK E;  2VQ2 A;  5ENP D;  3CVW A;  3QDN A;  3I4G A;  1AP7 A;  3TWW A;  2V8S E;  3ESL A;  3PRZ A;  2ETC A;  3D9M A;  4HOS A;  4E85 A;  3FUH A;  2Y0B G;  3AJI A;  3ULQ A;  4U7E B;  5KNG A;  4I2Z A;  2NSZ A;  4Z68 A;  2BTD A;  2J49 A;  5JJ7 A;  3G2W A;  2OND A;  4UQY A;  3APC A;  5LX8 A;  3ZUV B;  4PUC A;  4BER A;  1IQU A;  1EPU A;  4WUY A;  2Y4U A;  4GTV A;  3ULY A;  1OWL A;  4GYO A;  4CT0 A;  1MJ0 A;  4Q96 A;  2HR2 A;  1OWP A;  1E90 A;  2J9Q A;  3UIO C;  1V54 E;  3QC1 A;  3R9A B;  3O48 A;  4UUC A;  5BXU A;  1N0R A;  4ACL A;  1Z5S C;  2HE0 A;  4ZHB A;  1IYG A;  3V30 A;  3TXM A;  2VSO E;  4BT8 A;  4L2Y A;  3B7B A;  1OWN A;  3IHV A;  5FIN A;  3D9O A;  3FUI A;  4GU5 A;  2DBA A;  3LEW A;  4XZ4 A;  3MKR A;  3UT4 A;  4N5Q A;  4I6J A;  4PH4 B;  3PVL A;  4ANW A;  4YVO A;  3RU0 A;  2VSY A;  3I4R B;  4GB9 A;  4G8K A;  4J8E A;  4UWL A;  5HRY A;  2Q7F A;  2XS8 A;  1KT1 A;  3K9I A;  1U3D A;  4JC8 A;  3DEO A;  2WXJ A;  4EZL A;  5KWD A;  2FF4 A;  4AOF A;  1TN6 A;  1Z3X A;  3CHQ A;  4JL0 A;  3NOC D;  1AWC B;  4L2L A;  1IQR A;  2MHK A;  4B0Z A;  2AXV A;  3G2T A;  3CVP A;  1VDY A;  1N94 A;  5ENS D;  3MEK A;  4I1O B;  1A5E A;  4Y6W A;  3V79 K;  3DBS A;  1GW6 A;  4HVB A;  2Y1L E;  1HXI A;  2WXH A;  2J4B A;  1DCQ A;  3CST A;  1TNU A;  4CT4 A;  1BPO A;  5FT9 A;  4TUM A;  2JAB A;  4DX5 D;  3VLE A;  1K8K G;  1LTX A;  2R5S A;  2F0Y A;  3DXM G;  3G2U A;  5E76 A;  2LXL A;  2WQ6 A;  2WPV A;  3ABK E;  2FI7 A;  3Q7F A;  4LRZ A;  5EDS A;  1MQS A;  3B7U X;  1JCS A;  3ZHE B;  5AQ9 A;  5DBK A;  5C1D A;  5BNW A;  1W3B A;  1N95 A;  4DI3 A;  4JPS A;  5FJY A;  1WG0 A;  1LF8 A;  2X6K A;  2X3M A;  4ZFH A;  3ZU7 B;  5FTP A;  3FEY A;  2V5F A;  4FHJ A;  3I3N A;  5FZQ A;  4GMJ A;  1TNO A;  4MBG A;  2WQH A;  3S7D A;  4Y6C A;  2CHW A;  3F6Q A;  4APO A;  5CHE E;  3ZXS A;  1U3C A;  4A1G A;  3ZRH A;  4URK A;  3ZEF A;  3RIB A;  1NL4 A;  1O1S A;  2J07 A;  3CGH A;  3FUD A;  3C5R A;  3L08 A;  1X81 A;  4HB5 A;  4I2W A;  2RKK A;  3QAR A;  1E7U A;  4LUN U;  3AU4 A;  3S2A A;  2GRL A;  2RG8 A;  2MOW A;  3PNT B;  3UIN C;  3KSL A;  3X2Q E;  2EIL E;  5D66 A;  3D9I A;  3PZD A;  2WM9 A;  2VTB A;  2VGE A;  4L7T A;  2JLB A;  3CV0 A;  4J8D A;  2WB2 A;  5KCM A;  2KCL A;  3ONK A;  3HXE A;  1DCE A;  3D9H A;  4DLQ A;  2YHC A;  4YDO A;  1UN9 A;  4N39 A;  4UWG A;  3CKB A;  4FLH A;  4A3V A;  1ELW A;  2Y69 E;  3UIP C;  4O1P A;  1N9A A;  4XI0 A;  4I9E A;  1HE8 A;  2ZGD A;  4EBA A;  2P58 C;  4MRU A;  3W9G A;  3FH7 A;  2P9N G;  3QNK A;  3VTY A;  3NF1 A;  1QYM A;  2AXZ A;  3Q7A A;  2VGX A;  4HBD A;  3TWQ A;  3J5Q B;  2IOL A;  3LCA A;  5HQ8 A;  3LJ3 A;  3V2X A;  2QY7 A;  2XHE A;  4APF A;  3P1U A;  1KZP A;  5G05 C;  3UX4 A;  3VLF A;  3ESK A;  2PM7 A;  5CBN A;  2X6H A;  4KZ0 A;  3C72 A;  2FO1 E;  4WAF A;  5EN5 D;  3PZ3 A;  3LY7 A;  3R9M A;  1MX2 A;  5G05 J;  3LY9 A;  3CHS A;  4LNB A;  5B1A E;  2GRQ B;  2OCC E;  2I6H A;  2XZT G;  5ARF A;  2AVP A;  1H2V C;  4BFR A;  2YIN A;  1TR4 A;  3N71 A;  2B6C A;  5AQA A;  1N11 A;  5AAR A;  4BX8 A;  4TXP A;  3C98 A;  2E0I A;  1HS6 A;  3IKO B;  2BF0 X;  3LKU A;  3Q49 B;  5HKP A;  2AXU A;  3SGH A;  3UI2 A;  3PE3 A;  4UWH A;  1SZA A;  4U0Z A;  4DRX E;  3FEX A;  1N54 A;  2HYZ A;  3RO3 A;  2WXM A;  3SFX A;  3DXK G;  3PDN A;  4GTP A;  2WXO A;  4GZ6 A;  4EEC A;  3HXD A;  1MX4 A;  3Q73 A;  1TJF A;  3HVE B;  3CVU A;  3ML8 A;  4RQI A;  1H6O A;  1H2U A;  1Q2Z A;  1YMP A;  5JMN D;  4I1M A;  4EZK A;  3BQO A;  2VJ8 A;  2CG3 A;  2WXN A;  3V2O A;  3E34 A;  1RW2 A;  1A17 A;  4PS8 A;  4JHR A;  3APD A;  3CR3 A;  4G11 A;  2WXI A;  4U95 D;  4JB8 P;  3D3M A;  3BEE A;  4PDX A;  1S70 B;  4TXR A;  1N4P A;  2CFZ A;  4J6I A;  4LNU D;  4ME2 A;  3D9K A;  5CMW A;  2XPI A;  3FFL A;  3APF A;  5JHA A;  1TEZ A;  3MA5 A;  4HOU A;  4ATZ D;  2YHE A;  2IU1 A;  1UOH A;  5A6C A;  2JEK A;  4WND A;  4K5B A;  4B8A A;  3FU3 A;  3FH8 A;  3PEU B;  1TNZ A;  4GMR A;  3RO2 A;  4AJW A;  4CEM A;  1B89 A;  3W9F A;  2CHZ A;  4K5A B;  4WWP A;  3PH0 C;  3RSE G;  3DEP A;  4HLE A;  5C2Y A;  2EQX A;  3PE4 A;  1DVP A;  2XPY A;  1E8X A;  1TN8 A;  3SFY A;  3QJZ A;  3UM2 A;  2BKK B;  3E32 A;  3ABM E;  2KZT B;  5BUZ A;  2GRM A;  3AG2 E;  4BWR A;  5CCM A;  3JUE A;  1D9S A;  4BET A;  3FHE A;  1WAO 1;  4AVX A;  5CBO A;  3FU5 A;  3C3R A;  2R59 A;  3DRA A;  3NZS A;  2VSN A;  3Q75 A;  5H7P A;  2XEV A;  4O60 A;  1HG2 A;  4BTA A;  4TV3 A;  2LNI A;  2WXK A;  2L0I A;  3C3O A;  4G2V A;  2RFM A;  1SA4 A;  4U8V D;  4PS7 A;  3TWS A;  1MZC A;  3CVL A;  3GZ2 A;  3B7R L;  5BT1 A;  4GAA A;  1O1T A;  3CK7 A;  5FQ8 A;  1UN8 A;  2R2L A;  1ELR A;  4TUU A;  2X6J A;  3CVN A;  4AV7 A;  4ACK A;  1RZ4 A;  1EYH A;  5FQ7 A;  2XQ0 A;  2L9B A;  3KS2 A;  4BTB A;  1OCO E;  4KZC A;  3MZL B;  3IV0 A;  4DPR A;  3BUA A;  2VYI A;  4U63 A;  4HFG A;  1DC2 A;  2V4L A;  5D0O D;  2F8Y A;  1TN7 A;  2XEN A;  5CEC B;  3LYA A;  4HXI A;  2B0O E;  3TJP A;  2A4Z A;  4J8F A;  3RRM B;  5LCW J;  3AG1 E;  1HF8 A;  4DX1 A;  2H6H A;  1SA5 A;  4FU3 A;  3ENE A;  4L23 A;  4N2S A;  1E8W A;  2KCK A;  4KYO B;  4KMO A;  4FUL A;  4CDM A;  3TWX A;  5G2N A;  3NBN B;  4M3O A;  1KZO A;  2P9U G;  2KC7 A;  1ZB1 A;  3L6A A;  3KSQ A;  4HRL A;  4HOT A;  4JVS A;  3ZYM A;  1UJK A;  4GTR A;  1IKN D;  4DI4 A;  3MGB A;  3Q78 A;  4XE0 A;  3ZVV A;  2P9L G;  3UXG A;  1Z3Y A;  3FU0 A;  2V5Q C;  4A3T A;  3HXB A;  3UM0 A;  1N4R A;  4GYW A;  3HXF A;  2OEV A;  5FQ6 A;  5CRV A;  1N4S A;  4G26 A;  3GYZ A;  4YDE A;  3SD5 A;  2AWI A;  3QWW A;  3SBT B;  2J8S D;  3ZNG A;  2KM4 A;  3MJW A;  4RG9 A;  2GRR B;  4BES A;  1E8Z A;  2WMN A;  3G2S A;  5JA4 D;  5CED B;  3IBE A;  4TXQ A;  2DYR E;  2ETA A;  3SF4 A;  3ASF A;  4JD2 G;  3FTZ A;  1TNB A;  2R03 A;  2ZU6 B;  3NZU A;  1K1A A;  3CIA A;  1E8Y A;  3C3Q A;  4CZ2 D;  4KVO A;  5AN8 A;  1SQM A;  3PUJ A;  4CYM D;  5HS0 A;  2EIJ E;  3UUX A;  3L22 A;  1O5M A;  2M63 A;  4OVV A;  4GZC A;  4GPM A;  2J09 A;  1U2V G;  3U64 A;  3P2B A;  4RLY A;  3JQ1 A;  1NP7 A;  2L0T B;  5T8I A;  1FCH A;  3FWV A;  3TXN A;  2XGO A;  3FTV A;  2ZGG A;  5EX0 A;  1OY3 D;  1SW6 A;  4FHK A;  2WMO A;  2X38 A;  4CGV A;  1BD8 A;  3Q15 A;  2PQR A;  2XS1 A;  4LCT A;  4B89 A;  5ITZ F;  3GW4 A;  3HYM B;  1XNF A;  3TG5 A;  3CK9 A;  1OXJ A;  5D2M C;  3SI5 A;  3NQP A;  5FZS A;  3DSW A;  4K5C A;  4RSY A;  2P9P G;  1WM5 A;  2KBX A;  1FPP A;  3JYS A;  4FLB A;  2XCC A;  3OTN A;  3E30 A;  4C9B B;  2UY1 A;  4YDY A;  2KCV A;  1WDY A;  4FC8 A;  2GRN B;  2IY0 C;  3PEV B;  4WWO A;  3PS6 A;  1H6K A;  3CHR A;  3DST A;  4GTO A;  1XGW A;  2ZIS A;  4MKT A;  2Y4T A;  4KXK B;  3L54 A;  1SZ9 A;  1G3N B;  4CRW A;  3Q4A B;  2FEZ A;  3VTX A;  4UI9 C;  3LVR E;  1Z6T A;  5J08 A;  2RD0 A;  5JJ6 A;  3FUM A;  3CEQ A;  4AY5 A;  5ENN A;  2AW6 A;  3KEA A;  1QBQ A;  4JHJ A;  1N0Q A;  2QYJ A;  1YYH A;  3Q9U C;  2LSU A;  5BW8 C;  1V55 E;  2KZT A;  4J8S A;  4NIK A;  3U66 A;  2XEH A;  5BV0 A;  3CVY A;  4U04 A;  3RAU A;  3BU8 A;  3HVE A;  1PC2 A;  2I1K A;  3EU5 A;  4IRU A;  4G25 A;  3DSU A;  1E7V A;  3Q79 A;  1BLX B;  3ISM C;  5EIL A;  4KBQ A;  2ZIR A;  4GML A;  4GCO A;  4ANV A;  3U4T A;  3PZ2 A;  2CHX A;  3FTU A;  3NAW A;  4JZY A;  5ENT D;  3AS4 A;  5KBA A;  3CVX A;  2WXG A;  4X8Q A;  4B94 A;  2BKG A;  2DIW A;  3PZ1 A;  4BSZ B;  3AAA C;  1ELK A;  1OWM A;  4Q94 A;  2C2L A;  3EHN A;  1FT2 A;  3LJN A;  2QC9 A;  3SQV A;  1ZU2 A;  3MV2 B;  2NC9 A;  4BT9 A;  3QWP A;  2DZN A;  2WXR A;  2WXF A;  3RRN B;  4U07 A;  2I1J A;  3RKV A;  3IXE A;  2OOE A;  3KD7 A;  4HRN A;  2F37 A;  2PQN A;  1N52 A; 
#chains in the Genus database with same CATH homology
 2FF4 A;  4AOF A;  3CSF A;  2ION A;  1Z3X A;  3CHQ A;  5G04 C;  2KZT B;  4JL0 A;  5BUZ A;  2GRM A;  3HIZ A;  1HX8 A;  1UJJ A;  4N3C A;  4BWR A;  2PL2 A;  3AU5 A;  5KJL A;  5CCM A;  4L2L A;  3ZPJ A;  3LS8 A;  4WNE A;  1IQR A;  4XI9 A;  3FHE A;  1WAO 1;  4F3V A;  1L5J A;  4AVX A;  1HU3 A;  2MHK A;  3FU5 A;  4H7X A;  5DIZ A;  5LP0 A;  4B0Z A;  4GA1 A;  2AXV A;  1KT0 A;  3CHP A;  2R59 A;  4RG6 A;  1DNP A;  3G2T A;  4QFV A;  3CVP A;  4WNG A;  5BPP A;  3NZS A;  1VDY A;  4U8H A;  2UY1 B;  5G04 J;  4DJA A;  5A23 A;  4N2Q A;  4DLO A;  2VSN A;  3MEK A;  3U9W A;  4F7A A;  2OVF A;  2R17 C;  3LY8 A;  4I1O B;  5D0Q D;  4AXH A;  5KJM A;  3FP3 A;  4I6E A;  2XEV A;  4Y6W A;  2GW1 A;  1HG2 A;  3DBS A;  4JEH A;  4BTA A;  4P29 A;  4TV3 A;  2LNI A;  1GW6 A;  1HG5 A;  2WXK A;  4HVB A;  2L0I A;  5AJL A;  2FUL A;  1HXI A;  2WXH A;  1QZ2 A;  3FDH A;  2J4B A;  3FUJ A;  4JEU A;  4G2V A;  1EDU A;  2XGS A;  3ML9 A;  3CST A;  4U0U A;  3URZ A;  4CT4 A;  1BPO A;  3ONL A;  2GGF A;  4PS7 A;  4ABN A;  4AP2 A;  3CVL A;  3GZ2 A;  4I9C A;  5FT9 A;  3B7R L;  3CVQ A;  5J90 A;  3OAW A;  3VLE A;  3ZYK A;  3TGO A;  5BT1 A;  2DCP A;  2R5S A;  1NZN A;  4GAA A;  2VGY A;  3CK7 A;  3GZ1 A;  5FQ8 A;  4I1A A;  3LPZ A;  1UN8 A;  3WXX A;  4J0U A;  3G2U A;  5E76 A;  1ELR A;  3MKQ A;  4BY6 A;  2WPV A;  2WQ6 A;  1INZ A;  4TUU A;  3UT8 A;  2X6I A;  4NQ0 A;  1HO8 A;  3DPD A;  5FWQ A;  5T4Y A;  4FAD A;  4YVQ C;  3LDZ A;  2FI7 A;  4LRZ A;  3S7F A;  2X6J A;  3CVN A;  4I6G A;  4FJY A;  2WVI A;  3SBS A;  4ATG A;  4GZ5 A;  4AV7 A;  5EDS A;  4ACK A;  1MQS A;  3B7U X;  3FTS A;  4JHK A;  4N3B A;  5CMY A;  4AM9 A;  3ZHE B;  1EYH A;  5DBK A;  5FQ7 A;  2XQ0 A;  2L9B A;  3KS2 A;  2L6J A;  5EKQ D;  3JCK C;  1W3B A;  4BTB A;  3JQ0 A;  4F1S A;  5BNW A;  3ASG A;  3EJN A;  4DI3 A;  5E75 A;  4JPS A;  5FJY A;  5A7D B;  4RVB A;  2PZI A;  3KEZ A;  4KZC A;  4XKC A;  3MZL B;  3RK6 A;  3IV0 A;  4BX9 A;  4DPR A;  1LF8 A;  2VYI A;  2X6K A;  4EBA G;  4W9R A;  4KVM A;  5KJK A;  2CFU A;  4U63 A;  1WY6 A;  2X3M A;  3S7J A;  4HFG A;  4ILH B;  4JA9 A;  1QQE A;  4AEZ C;  5FTP A;  3FEY A;  2V4L A;  5D0O D;  1FVF A;  2V5F A;  4FHJ A;  3BG1 B;  3I3N A;  5FZQ A;  4GMJ A;  2WQH A;  3LYA A;  4HXI A;  4Y6C A;  3S7D A;  2CHW A;  2J4D A;  3TJP A;  2A4Z A;  3CK8 A;  3CHM A;  4APO A;  4OVU A;  5CHE E;  3CQG B;  4J8F A;  3ZXS A;  3MX3 A;  3EDT B;  3RRM B;  5LCW J;  1U3C A;  1HF8 A;  2LSV A;  5FZR A;  2LO6 A;  3KAE A;  4FU3 A;  3ENE A;  3ZRH A;  4L23 A;  2VGX B;  2HO1 A;  4A1G A;  3ZEF A;  4URK A;  2VSX E;  4N2S A;  1E8W A;  2KCK A;  3L13 A;  4KYO B;  3RIB A;  4KMO A;  4FUL A;  3E4B A;  4GPK A;  4CDM A;  4ILI A;  3G2V A;  4G1T A;  4FJZ A;  2J07 A;  3CGH A;  5G2N A;  4M3O A;  2IQC A;  3FUD A;  2BUG A;  4V3I A;  4D10 C;  4GZD A;  3L08 A;  2KC7 A;  4EZJ A;  3CQC B;  1JWF A;  5ARG A;  3R7R A;  3L6A A;  5C1D A;  4EPZ A;  4UWF A;  4I2W A;  3QAR A;  4IUL A;  4O6F A;  1E7U A;  3D9L A;  4R7L A;  4HOT A;  4IYP A;  4JVS A;  4LUN U;  2QFC A;  3ZYM A;  1UJK A;  2FBN A;  3B7T A;  4NRH B;  3UPV A;  1X5B A;  3FUF A;  3AU4 A;  4E6H A;  3PNL B;  3S2A A;  4DI4 A;  2GRL A;  3MGB A;  2RG8 A;  4FP7 A;  2MOW A;  3UQ3 A;  3PNT B;  1EF1 C;  4XE0 A;  3ZVV A;  1H0A A;  1Z3Y A;  3FU0 A;  4A3T A;  3D9I A;  3PZD A;  5LFA A;  2WM9 A;  1HFA A;  2C0L A;  4GYW A;  2VTB A;  1PY1 A;  4L7T A;  2JLB A;  3CV0 A;  4PS3 A;  4UQZ A;  5FQ6 A;  4N5C A;  4J8D A;  4C0E A;  5KCM A;  2WB2 A;  2KCL A;  3CVV A;  3ONK A;  4G26 A;  3OXF A;  2WXP A;  4DLQ A;  2YHC A;  5AIJ A;  3GYZ A;  2I9C A;  3SD5 A;  5M72 A;  1UN9 A;  2AWI A;  3QWW A;  3SBT B;  4N39 A;  2Y3A A;  3T5V A;  2VTB B;  4H7Y A;  1TJC A;  2A5U A;  4UWG A;  2KM4 A;  3MJW A;  3R7Q A;  4RG9 A;  3ZYL A;  5ANR A;  4LER A;  3TL5 A;  3CKB A;  4XKB A;  3ZYQ A;  4WNF A;  4AY6 A;  4FLH A;  1E8Z A;  3CKC A;  4A3V A;  2WMN A;  3G2S A;  4G23 A;  2XCB A;  4IN3 B;  3TG4 A;  1ELW A;  3IBE A;  4K0R A;  4I43 A;  4DK5 A;  1IHG A;  1FVH A;  3SF4 A;  5T3R A;  5BV1 A;  3ASF A;  4I9E A;  4XI0 A;  2WXQ A;  1HE8 A;  3FTZ A;  2ZU6 B;  3B13 A;  3IHY A;  3NZU A;  3CIA A;  4GCN A;  2P58 C;  3Q47 B;  4EBA A;  1E8Y A;  3PUK A;  4MRU A;  3QKY A;  4TRQ A;  2E2E A;  4KVO A;  1HZ4 A;  1JWG A;  1KLX A;  1SQM A;  1YA0 A;  3ZIM A;  3PUJ A;  4JXT A;  3MKQ B;  4MLP A;  1P5Q A;  3D9N A;  4XX5 A;  3RJV A;  3FH7 A;  2OVB A;  3FUE A;  2J08 A;  3MCX A;  3RRU A;  3UUX A;  4YND A;  4BSX A;  3QNK A;  3FTX A;  3L22 A;  5G55 A;  4U0S A;  3VTY A;  3NF1 A;  3EIQ C;  2AXZ A;  3SNX A;  2VGX A;  3GZS A;  2IOL A;  4CGW A;  4UQX A;  3O4Z A;  3FU6 A;  3UMV A;  2V0P A;  3LCA A;  2M63 A;  4OVV A;  4GZC A;  4ANU A;  2J09 A;  5HQ8 A;  3LJ3 A;  3U64 A;  4K03 A;  3P2B A;  2QY7 A;  3JQ1 A;  2XHE A;  4APF A;  3L16 A;  1NP7 A;  3P1U A;  4GA0 A;  2L0T B;  5T8I A;  4NUR A;  5G05 C;  3UX4 A;  4HS2 A;  3VLF A;  4G24 A;  1S0P A;  3ESK A;  5EX3 A;  5KJN A;  1FCH A;  2MRI A;  2PM7 A;  3FWV A;  3QB2 A;  3TXN A;  2XGO A;  1UW4 B;  3OXL A;  3FTV A;  2IF4 A;  2X6H A;  3QWV A;  3ZN3 A;  4A55 A;  3VLD A;  5EX0 A;  5ANL A;  3OXG A;  4KZ0 A;  4FHK A;  2WMO A;  2X38 A;  4CGV A;  4WWN A;  3CHO A;  3FTY A;  4GA2 A;  3QAQ A;  2I2O A;  3CVY A;  3AS8 A;  3Q15 A;  5JHB A;  4A1S A;  2NXP A;  2PQR A;  4WAF A;  3ZFW A;  3FUK A;  4LCT A;  4B89 A;  3LY7 A;  3GW4 A;  3HYM B;  1QNF A;  1XNF A;  3Q5M A;  5G05 J;  3TG5 A;  3LY9 A;  3CK9 A;  3CHS A;  3HDX A;  3LXU X;  3ZHE A;  3EIJ A;  3NQP A;  3SI5 A;  1NA3 A;  5FZS A;  4OYS A;  5AJD A;  1PAQ A;  2I6H A;  3B7S A;  2UWJ G;  2IOS A;  4RSY A;  3UT7 A;  5ARF A;  1OUV A;  2AVP A;  1WM5 A;  1H2V C;  3FUL A;  3FY4 A;  4BFR A;  3JYS A;  4FLB A;  3QK0 A;  4JW1 A;  2YIN A;  3FTW A;  3N71 A;  1H2T C;  2XPZ A;  2XCC A;  3OTN A;  4B8C B;  1MHQ A;  4C9B B;  2UY1 A;  2IFU A;  1NA0 A;  4BX8 A;  2KCV A;  2X6F A;  3MV3 B;  4F53 A;  3JUI A;  3C98 A;  3D9P A;  4FC8 A;  2E0I A;  1HS6 A;  3PEV B;  4WWO A;  4CCA A;  3PS6 A;  3IKO B;  4JA7 A;  2BF0 X;  4FA6 A;  1H6K A;  3LKU A;  3CHR A;  3QOU A;  1XGW A;  4UI9 J;  2CG2 A;  3Q49 B;  4GZ3 A;  2Y4T A;  3MYV A;  4KXK B;  4MKT A;  4HOR A;  5HI7 A;  3L54 A;  3D9J A;  3ZW3 A;  2AXU A;  4CDN A;  1SZ9 A;  2C0M A;  3BG0 B;  3SGH A;  4CRW A;  3ASD A;  3FH5 A;  3PE3 A;  3Q4A B;  1SZA A;  4MS6 A;  2FEZ A;  4UWH A;  4XIF A;  3VTX A;  1JPL A;  3I5P A;  2HM8 A;  2VQ2 A;  4U0Z A;  3U3W A;  4UI9 C;  3CVW A;  3QDN A;  3LVR E;  1Z6T A;  3I4G A;  5J08 A;  3FEX A;  1N54 A;  2HYZ A;  2RD0 A;  5JJ6 A;  3FUM A;  3RO3 A;  2WXM A;  4ILG A;  3PDN A;  2V8S E;  2WXO A;  4GZ6 A;  4EEC A;  3CEQ A;  4AY5 A;  3ESL A;  3PRZ A;  5ENN A;  4AIF A;  3ASH A;  2AW6 A;  4I17 A;  4JHJ A;  3D9M A;  4HOS A;  1TJF A;  4E85 A;  3FUH A;  3HVE B;  3CVU A;  5AYW D;  2ILR A;  4N3A A;  2KAT A;  3ML8 A;  2LSU A;  3ULQ A;  5BW8 C;  2XRY A;  4I2Z A;  2NSZ A;  2BTD A;  2J49 A;  2KZT A;  1H2U A;  5JJ7 A;  4J8S A;  3G2W A;  2OND A;  4I1M A;  4UQY A;  4EZK A;  5BV0 A;  3U66 A;  4U04 A;  1ZBP A;  4EQF A;  3APC A;  3HVE A;  2LAI A;  1PC2 A;  3HHM A;  3PRE A;  2I1K A;  2VJ8 A;  4IRU A;  2CG3 A;  2WXN A;  3T5X A;  4G25 A;  1E96 B;  5LX8 A;  1E7V A;  4KBQ A;  4PUC A;  1Y8M A;  3CLJ A;  1A17 A;  4LEU A;  1IQU A;  4GML A;  4JHR A;  4PS8 A;  5FQ4 A;  4GCO A;  4ANV A;  2OV8 A;  3LVQ E;  3APD A;  1EPU A;  5CCL A;  3SHF A;  3CR3 A;  4G11 A;  3U4T A;  2WXI A;  2Y4U A;  4WUY A;  3SZ7 A;  1OWL A;  2CHX A;  3EHM A;  3FTU A;  4GYO A;  3ZGQ A;  3D3M A;  4CT0 A;  3BEE A;  4JZY A;  4Q96 A;  3SFZ A;  4UI9 K;  2HR2 A;  2IJG X;  4PDX A;  1OWP A;  2CFZ A;  4J6I A;  3AS4 A;  1E90 A;  2J9Q A;  4ME2 A;  3CVX A;  2WXG A;  3QC1 A;  3R9A B;  4B94 A;  1JUQ A;  3D9K A;  2YQ8 A;  3O48 A;  5CMW A;  1OWO A;  2DIW A;  2XPI A;  3FFL A;  2PM6 A;  3APF A;  5JHA A;  1TEZ A;  4HOQ A;  3MA5 A;  4ACL A;  3IEG A;  4HOU A;  2WXL A;  2YHE A;  1IYG A;  1ELK A;  1OWM A;  2IU1 A;  5A6C A;  2XRZ A;  2JEK A;  4Q94 A;  4WND A;  4B8A A;  5JJT A;  3TXM A;  2VSO E;  2C2L A;  3EHN A;  3FU3 A;  3FH8 A;  4L2Y A;  4BT8 A;  1OWN A;  1HH8 A;  3PEU B;  3S7B A;  3AS5 A;  3IHV A;  4Q69 A;  2LAH A;  3D9O A;  1UG3 A;  4CDR A;  3T8M A;  3FUI A;  1ZU2 A;  4GU5 A;  3RO2 A;  4AJW A;  2FO7 A;  3MV2 B;  2DBA A;  2XGM A;  4CEM A;  2NC9 A;  4L1B A;  5AEN A;  1B89 A;  3LEW A;  4BT9 A;  4XZ4 A;  3MKR A;  3FUN A;  3UT4 A;  3L17 A;  3QWP A;  5LOZ A;  1H19 A;  4I6J A;  4PH4 B;  4GYY A;  2CHZ A;  5LCW C;  3PVL A;  4ANW A;  4YVO A;  4WWP A;  3RU0 A;  4ANX A;  4UWK A;  3PH0 C;  2VSY A;  2WXR A;  3I4R B;  4HLE A;  2WXF A;  3RRN B;  4GB9 A;  5C2Y A;  2EQX A;  4KT6 B;  2YNQ A;  2WQ7 A;  4J8E A;  1Y6I A;  4UWL A;  2Q7F A;  3PE4 A;  4U07 A;  1DVP A;  1KT1 A;  2I1J A;  3K9I A;  3RKV A;  2XPY A;  1E8X A;  2OOE A;  4NAC A;  4C0M A;  3KD7 A;  1U3D A;  4JC8 A;  2PQN A;  2WXJ A;  3QJZ A;  4EZL A;  3TAX A;  1N52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...