3JUIA

Crystal structure of the c-terminal domain of human translation initiation factor eif2b epsilon subunit
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
176
structure length
174
Chain Sequence
GHHHHHHMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAGETILSWFSQRDDKGQQLRKNQQLQRFIQWLKEAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B epsilon Subunit
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Translation initiation factor eIF-2B subunit epsilon
total genus 64
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3juiA00
2FULA 2KZTA 2KZTB 3EIJA 3RK6A 2NSZA 4B89A 1H6KA 1UW4B 4JHJA 2HM8A 4GMJA 4GMLA 2VSXE 4LUNU 1H2TC 1PAQA 2ZU6B 3EIQC 4CT4A 4C9BB 4CEMA 2IU1A 1UG3A 1HU3A 2VSOE 3JUIA 4CRWA 4IULA 3D3MA 3L6AA 2RG8A 4JHKA 3FEXA 2IOLA 2IONA 1N54A 5ANRA 1H2VC 1H2UA 2GGFA 2IOSA 3FEYA 4B8AA 4B8CB 1N52A 2I2OA
chains in the Genus database with same CATH superfamily
1MHQA 3TWUA 5AQ7A 4EECA 2UY1A 3CVLA 3VLDA 2E0IA 3DEOA 3Q78A 2KATA 4PH4B 3Q75A 2WB2A 3Q47B 4G23A 3RKVA 4HI9A 5C2YA 3PNTB 3RK6A 4GTTA 3SO8A 4UQZA 4CYMD 1UOHA 3EHMA 1OCOE 1N4RA 3ZUVB 4A55A 4I1OB 4GB9A 3ZEFA 1SA5A 1HG2A 1JCRA 2R2LA 3BG1B 1OCRE 2WMOA 2E2EA 2YNQA 2XCCA 3CHRA 4JZYA 2J49A 1FVFA 5AIJA 2FO1E 4MKTA 3RRUA 3JUIA 2AWIA 5M72A 2R17C 2IO2C 2HR2A 4G26A 4TXRA 3MKRA 2QFCA 2B0OE 4G2VA 1BI8B 4GA2A 4HB5A 3EHNA 1UN9A 3LKUA 4XKCA 3L6AA 2HYZA 4L2LA 3KSQA 3UM2A 4B8CB 4HOSA 2RFAA 2P9UG 3QDNA 2Y69E 3DSXA 5CMYA 5CERB 1HFAA 4N39A 3TGOA 3PH0C 3FUJA 1W3BA 5KJMA 3UIOC 3IHVA 4KMOA 3PZ3A 2X38A 4M7CA 4X8QA 3EUVA 5ANRA 2WXNA 1BI7B 4L2YA 4B93B 2Y3AA 3UIPC 4HLEA 4XKBA 2X3MA 1UW4B 1JCSA 2VGXB 4G24A 2WM9A 3ZYQA 4UQYA 3FTYA 4ILHB 4KZCA 3DSSA 5FQ8A 4CDRA 3APDA 4AXHA 4F1PA 3MV3B 5CCMA 2FBNA 4OVVA 4GMLA 1NI1A 4IRUA 3UXGA 2V8SE 3FWVA 4YVQC 2HE0A 3QWVA 3CK8A 1PC2A 1Z3XA 4DLOA 4YNDA 3Q73A 3ABME 4U0SA 5KJKA 2J08A 3E33A 4HRNA 3UX4A 3EIQC 3ENEA 5FINA 2WQ7A 1Y8MA 2CHZA 3AU4A 2Y0BG 5CRVA 5G04J 2FF4A 4J6IA 3ULYA 1GW6A 1Y6IA 4ZFHA 4AY5A 5CEDB 4FHKA 1E7VA 1YMPA 2EIJE 2VJ8A 4UI9C 4HORA 2RD0A 3B95A 5EX0A 4I6JA 4GTQA 4C0EA 3FU3A 3FEXA 3JQ1A 2PZIA 3UM0A 2J09A 3SFZA 3SI5A 3ZYKA 2FEZA 4ANVA 2VTBB 2KCVA 2H6GA 1INZA 2PL2A 4AJWA 3ABKE 3WXXA 5JJ7A 2P2CP 5D2MC 4F3VA 5AN8A 2HO1A 3O48A 2XQ0A 5HQ8A 2OEVA 4Y6CA 2L6BA 3D9KA 2DZOA 1H2VC 3L9TA 2XGMA 2GRLA 3U4TA 4HRMB 2I1KA 3HXEA 3MA5A 4GU5A 2A5UA 3SY2A 2AJAA 4UQXA 5FWQA 3DPYA 1LD8A 2UY1B 3E34A 4DX2A 3D9LA 2R5SA 3NQPA 5JJTA 5CECB 1JPLA 3J5QB 1A5EA 4CEMA 3ZRHA 1HF8A 3V2XA 4K03A 3PE3A 4BWRA 3ZN3A 1E8YA 4WNDA 1K1AA 2IOSA 5CEAA 2ETAA 2LAHA 4ANWA 4B89A 1OWOA 4I9EA 3IXEA 3NB2A 3R7RA 3RO3A 2X6KA 3ZU7B 2XHEA 4JA9A 4F6RD 5BXUA 1QNFA 3UUXA 1E96B 4UI9K 3L54A 2Q7FA 4U8VD 1SZAA 1KT0A 3CVNA 1IQUA 3TXNA 3B7UX 4LNBA 2LAIA 1WM5A 2IU1A 1N94A 1UG3A 3ZKJA 2Y1LE 1B89A 1EF1C 4RG9A 5E75A 2IEJA 3VTXA 3TJPA 3JCKC 1TNOA 1EPUA 3MCXA 4N5CA 1K8KG 1TN8A 3C3RA 4O60A 2R05A 1X81A 2OVBA 3N71A 4Y6WA 1JWGA 1LTXA 3JXJA 3PRZA 2WMNA 1PY1A 3LPZA 3PEUB 4ACKA 1JWFA 3ONLA 3CVYA 3G2VA 5LCWC 5ENTD 2CFZA 2XGSA 5EN5D 4HS2A 4WWPA 4XZ4A 3SNXA 4DX1A 3ISMC 1YCSB 3FH8A 3QB2A 5ANLA 2XPZA 1OWMA 4G1TA 4GZ5A 2ZXWE 4NRHB 3CHPA 3LEWA 3UTMA 1VDYA 3QWPA 2BKGA 2XPIA 3RIBA 3B7BA 3HYMB 1IXVA 4XE0A 4FP7A 4JEHA 2A4ZA 2X6FA 3ESKA 1HE8A 3NZSA 1IQRA 4JVSA 3FTXA 1HO8A 4FHJA 1D8DA 3D9OA 2J9QA 3L13A 4KZ0A 3OXLA 1SZ9A 5KJLA 2P9LG 3CKCA 2GW1A 4LUNU 2ZU6B 3KAEA 4DK5A 5DIZA 3UMVA 3FFLA 2CG3A 4JC8A 1EYHA 3PUKA 4ILIA 4U95D 3FTWA 2LXLA 3V2OA 1HX8A 2ZGDA 2WXMA 4GZ6A 3SD5A 4RG6A 1S0PA 4JHJA 3FTVA 3DXMG 3B13A 3MZLB 1HH8A 3TL5A 3CHOA 3CVPA 2ETBA 2V4HC 2YHCA 1QZ2A 2DYRE 4OAVB 2KM4A 4LSZE 3ASOE 3TWQA 4J8EA 1TJFA 2IQCA 2F8XK 2CHWA 4EPZA 4CDMA 3NBNB 4GTPA 2VSNA 3ZPJA 4WNEA 1TN7A 2LO6A 2C2LA 5ENSD 5BT1A 5A7DB 1ZBPA 2WXLA 3URZA 2WXPA 3Q9UC 4U8HA 2WXFA 2WXQA 1YA0A 3LYAA 3EIJA 4UWGA 2CHXA 4FU3A 3UM1A 3X2QE 4GZ3A 4DRXE 2AXZA 4LRZA 3MEKA 3LCAA 1KT1A 1NFIE 1JUQA 4GPMA 2LXMA 2I2OA 3TWXA 3CHMA 3G2SA 4HXIA 3L17A 3JQ0A 3PE4A 5CBOA 1HU3A 1OY3D 2XS8A 3ASHA 5FQ4A 3HVEA 3JUEA 4ANXA 3ZFWA 1TNUA 1N52A 4HNAD 4QQIA 4DJAA 3Q5MA 4C48B 1HS6A 1U3CA 3CK9A 5FQ7A 4E85A 3SF4A 3J5PA 4FLBA 3O4ZA 3UT8A 1V55E 4H7YA 2CFUA 4K5AB 4XIFA 1OCZE 2OVFA 2A5EA 4XEIG 1DVPA 4U0UA 4JPSA 4GTVA 2MRIA 2JEKA 3E32A 2F8YA 3FTSA 4K0RA 4Q94A 5KJNA 3D9HA 5ARGA 1ZU2A 2LSUA 3I3NA 3NOCD 3L22A 4YDOA 3FEYA 2EIME 4G8KA 4N3BA 3IHYA 2KZTB 4A3TA 2YHEA 3FUEA 1TN6A 1L5JA 3TWTA 3UT7A 3GZ2A 1FVHA 3MJWA 3ESLA 2AXVA 2MYOA 2PM7A 4JD2G 4TXQA 3EU5A 2WQ6A 4AOFA 3HXFA 5G05J 5BXOA 4TV3A 4GAAA 3ZNGA 2L9BA 2BUGA 2DBAA 5LP0A 1N4QA 4U0ZA 4I2ZA 2J4BA 1V54E 4NACA 4BT8A 1Z3YA 4MLPA 2XEEA 4XI0A 1OWNA 2B6CA 4N3AA 2F0YA 4WAFA 3LY7A 4HVBA 5BV0A 4YDEA 2VGEA 3CK7A 4EBAA 3FULA 3QNKA 4APOA 3FHEA 3RRMB 3FUKA 4G8LA 3OXFA 3HVEB 3QJZA 4J8SA 3U3WA 2WXGA 2XENA 3R9AB 1N54A 2V0PA 1Z5SC 1MYOA 3LXUX 4AY6A 2OOEA 3QOUA 3Q15A 3T5VA 3F6QA 3QC1A 5DBKA 3FUDA 4V3IA 4NURA 4GZCA 3AU5A 2I1JA 2XEHA 3PREA 2EIKE 5EYPF 2IY0C 2XPYA 4CT4A 1UN8A 1IHBA 2C0LA 5ENQD 4Q69A 1O1RA 4ANUA 3S7JA 5FQ6A 1WG0A 3W9GA 2V4LA 3PDNA 4Q96A 4YDWA 1RW2A 3G2WA 2XRYA 1K1BA 3HHMA 4DX7D 4J0UA 1H6KA 1E8WA 2PQRA 3APCA 1H2TC 3L16A 1DNPA 3VTYA 1BD8A 4IN3B 3PVLA 4UWKA 1TEZA 4HFGA 2P58C 5C1DA 2KXPC 1OWPA 2PQNA 4B8AA 1KZPA 1UJKA 2OV8A 3E4BA 2QC9A 1H6PA 4DX6D 1ZB1A 2VSYA 1OCCE 4LCTA 4E6HA 3EHRA 3CSFA 5LFAA 3PZ1A 4EZLA 4AP2A 3OXGA 3DSWA 4U7EB 2WXOA 1Q2ZA 3L82A 4JL0A 3LY8A 5G2NA 5B3SE 4CT0A 5AENA 4N3CA 5EKQD 2VTBA 4GMJA 3LVRE 3K9IA 1G3NB 1N4SA 2L0IA 3ZGQA 2KCKA 2QY7A 4JXTA 2C0MA 2IOLA 4WNFA 2WXKA 4GYWA 3PUJA 1WAO1 2FULA 3TWSA 1E8ZA 3HXCA 4BTBA 1BU9A 1ELRA 5FT9A 5H7PA 2IFUA 3PEVB 3EDTB 5HI7A 5EIDA 5G05C 3CEQA 4EQFA 2AVPA 4JHKA 1IHGA 3PS6A 4TRQA 1MZCA 2VQ2A 3HXBA 4BX8A 3CV0A 1AWCB 3AS5A 2KZTA 4A1SA 4R7LA 4WNGA 3PZ4A 1P5QA 2RKKA 1S64A 2X6HA 2H6IA 3CIAA 3FU6A 1MQSA 1AP7A 4UWLA 4I17A 1S70B 4LEUA 3KS2A 4J8DA 1TNYA 4NQ0A 2R59A 4CRWA 3HDXA 2R02A 5CCLA 3MKQB 1SA4A 4I6GA 1H2UA 2P9PG 3FUIA 3SZ7A 2ILRA 3KD7A 3SQVA 3G2UA 3DSUA 5BV1A 1Z6TA 1QQEA 4IYPA 5EIBE 3V31A 3ZHEA 2P9NG 3CGHA 4FC8A 5B1AE 3FY4A 4U04A 3UT4A 5FZSA 3RU0A 1S63A 2H6HA 3TAXA 4AVXA 3DSTA 4N2SA 3CQCB 3DBSA 3BQOA 3BU8A 1H6OA 3MYVA 2I6HA 1QBQA 4HI8A 1MX4A 3JXIA 4DUIA 1N95A 3I5PA 4K5BA 3RAUA 1NP7A 3T8KA 3T9KA 4P29A 4AV7A 4MRUA 1MJ0A 3AG4E 4GMRA 2EILE 4GTMA 2P9SG 3HIZA 4BEPA 3FU5A 3UQ3A 4I43A 3P2BA 3TWRA 4GPKA 4MBGA 3HG0D 3Q9NC 4JHRA 2R03A 4F1SA 4HOTA 2QZAA 2KBXA 2XZTG 2J07A 3PZDA 3HRAA 3U9WA 4BT9A 2AXUA 4TUMA 1KPSB 3AG1E 3UM3A 4HBDA 4U63A 2P9KG 4ATGA 1KZOA 2GROB 3ASGA 4K5CA 5HS0A 4J8FA 1X5BA 5T3RA 2IONA 3D9JA 4L7TA 1IKND 1WDYA 3FP3A 3UI2A 1A17A 4RQIA 4GYYA 2QYJA 5CRUA 1BLXB 3MX3A 2VYIA 2WXRA 1LF8A 2MHKA 3ZXSA 2ETCA 3AG3E 4HOUA 2V5FA 3IV0A 4BETA 4L9PA 3Q79A 2V5QC 4BSXA 1WY6A 2VGYA 5EX3A 2DZNA 3B7SA 3ZYMA 2XS1A 3TWWA 1H0AA 4GA0A 2HM8A 4C0MA 5EYLA 2WXIA 1SW6A 3MKQA 3C98A 5AQ9A 3UKUG 3Q49B 4I9CA 5FJYA 4KT6B 3C5RA 3NF1A 5ARFA 4CCAA 5J90A 2ZGGA 3AAAC 3P1UA 3I4GA 2XCBA 3D9PA 4DI3A 4AEZC 3CVXA 3SGHA 3ZXPA 3NOGD 3ZVVA 1E7UA 2L6JA 2OCCE 3PNLB 2ZIRA 4QFVA 1TJCA 1N9AA 3RJVA 1E8XA 3FUMA 3QWWA 5JA4D 2ONDA 4O1PA 3RRNB 2AW6A 1BPOA 2KC7A 5BPPA 3KEZA 1MX6A 5D0OD 4DPRA 2NC9A 4YDYA 3E30A 4EZKA 2FI7A 2P9IG 3HXDA 3CVVA 3FDHA 4O1OA 4GCNA 4JA7A 1TNBA 4ME2A 4G25A 4M3OA 3FUHA 3L08A 3GW4A 2CG2A 4GZDA 4RLYA 2XZDG 4AM9A 5AAOA 4BY6A 3FH5A 3D9NA 3DPDA 3U66A 4GA1A 4GTOA 5ENPD 4C9BB 4BFRA 5KNHD 5B1BE 2DCPA 2ZISA 3SFXA 3ASDA 5EDSA 4FULA 2BKKB 3QAQA 5BUZA 3LS8A 2M63A 4W9RA 3ABLE 5LOZA 1PAQA 5LX8A 2DWZA 5AARA 4OAUC 3RO2A 1LD7A 4WWNA 3LVQE 5AQBA 4L1BA 4WWOA 1HXIA 4I2WA 4OYSA 2NYJA 4LERA 2H6FA 4F53A 1OUVA 4ATZD 3FU0A 1N0QA 5J08A 2VGXA 2DYSE 5AJLA 3CVUA 2LUHA 5KBAA 1TNZA 2FO7A 3CQGB 5KNGA 3UINC 3Q7FA 3AS8A 4PS8A 3ML9A 4PS7A 2BEDA 4EZJA 5LCWJ 3DXKG 2GRRB 2GRMA 3JYSA 3G2TA 2MOWA 1DCEA 1E90A 3R9MA 3AJIA 1RZ4A 1HG5A 4UUCA 4U8YD 4GTSA 3LJ3A 3C3QA 4IULA 4N5QA 1DC2A 3MGBA 1O1SA 2LSVA 4LNUD 2UWJG 3UPVA 3V30A 3EU9A 4JEUA 4BERA 5AQAA 2EQXA 4JW1A 1MX2A 4BESA 4AIFA 3BEEA 3CVWA 1FT2A 5FTPA 1NA3A 3QK0A 2PM6A 4TUUA 3CR3A 5IY5E 1IYGA 5JHBA 4GTRA 1N11A 3MV2B 2J4DA 3ZIMA 4GCOA 3UKRG 3GZ1A 2IJGX 4HQDA 3Q7AA 5G04C 3D3MA 3B7RL 2YINA 4BX9A 2KCLA 3C72A 4RSYA 4J8YA 1ELWA 4FJYA 3I4RB 2YQ8A 3FUFA 5KCMA 3IBEA 4ACLA 3TG5A 5AJDA 4UI9J 3ULQA 2RG8A 3APFA 5G55A 3C3OA 3S7BA 2IO3C 1U2VG 4A63B 4U96D 4FADA 3E37A 3CKBA 4KVMA 2F37A 5D66A 4A3VA 4F7AA 4DX5D 3GZSA 4JB8P 1OWLA 4HRLA 4LNGA 2GRNB 1YYHA 1O5MA 3VLFA 2WPVA 2WXHA 1K3ZD 3SHFA 2VSXE 5A23A 5KWDA 4DI4A 5ENRD 2BF0X 4I1MA 5BW8C 1N4PA 4TXPA 4B0ZA 2EINE 3U64A 3V79K 4URKA 2IF4A 3CHSA 5ITZF 1EDUA 3CHQA 3ZYLA 2WXJA 4CDNA 1FT1A 1TYQG 5ENNA 3FUNA 4FA6A 3ASNE 3CSTA 4CGVA 3FTZA 3WG7E 2LNIA 3S2AA 2VSOE 2DIWA 5HKPA 4EHMA 2I9CA 2GGFA 3S7FA 2XRZA 4BSZB 4CGWA 5D0QD 3DRAA 2DVWA 3TG4A 1NL4A 4MS6A 4PS3A 4L23A 5CHEE 4D10C 5ENOD 3D9MA 4ZHBA 2WQHA 3LDZA 3OAWA 1H19A 3ASFA 1UJJA 1D8EA 2Y4UA 2XEVA 1NZNA 4PUCA 3FTUA 2GRPB 3B7TA 4ILGA 2X6IA 3BUAA 1QYMA 1KLXA 2OEWA 3TXMA 3SFYA 4CZ2D 3KEAA 5CMWA 3Q4AB 4KYOB 3OTNA 4XX5A 3ONKA 5EILA 2NSZA 1TR4A 3DWLG 5CBNA 4ABNA 2BTDA 4G11A 4LG6A 3LY9A 3R7QA 1FPPA 2JLBA 2JABA 2J8SD 3QARA 1FCHA 5HRYA 1NA0A 3NAWA 3ULEG 4I1AA 1XNFA 4H7XA 2L0TB 5JMND 2GRQB 4DLQA 3BG0B 1N0RA 5T4YA 1JCQA 3T5XA 4UWHA 1XGWA 1SVXA 5JHAA 4EBAG 1D9SA 3S7DA 2RFMA 3FH7A 4GYOA 4A1GA 2XGOA 3DEPA 4O6FA 3GYZA 1ELKA 2Y4TA 1OT8A 3AS4A 3TWVA 4KXKB 4OVUA 2NXPA 3SBTB 3D9IA 4APFA 4KBQA 2X6JA 3VLEA 4N2QA 4UWFA 1DCQA 3EJNA 5BNWA 3T8MA 4KVOA 4BTAA 5AYWD 4HLLA 3ZHEB 3IEGA 3IKOB 3AG2E 4YVOA 5FIOA 1OXJA 1SQMA 5T8IA 3RSEG 3W9FA 4HOQA 5E76A 1O1TA 3CVQA 5JJ6A 4J7WA 3KSLA 3NZUA 4I6EA 3CLJA 4FJZA 4U07A 3QKYA 4FLHA 3ML8A 3PZ2A 4B94A 4RVBA 2PNNA 2QYUA 3SBSA 3LJNA 5FZQA 1HZ4A 1U3DA 3EHQA 4WUYA 3ZW3A 4NIKA 3DSVA 4Z68A 2WVIA 5FZRA 4XI9A 4PDXA 5A6CA
chains in the Genus database with same CATH topology
1MHQA 3E4BA 2XPZA 1OWMA 5J08A 4EECA 2VGXA 2UY1A 3CVLA 4G1TA 4GZ5A 4NRHB 2E0IA 3VLDA 3CHPA 5AJLA 4PH4B 2KATA 3CVUA 3LEWA 2VSYA 1VDYA 2WB2A 3Q47B 4LCTA 4E6HA 2FO7A 3CQGB 3QWPA 3CSFA 4G23A 5LFAA 3RKVA 2XPIA 3RIBA 3AS8A 4PS8A 3ML9A 4PS7A 4EZLA 4AP2A 3OXGA 5C2YA 4EZJA 2WXOA 5LCWJ 3PNTB 4JL0A 3LY8A 5G2NA 2GRMA 3HYMB 3JYSA 3G2TA 2MOWA 3RK6A 4CT0A 4UQZA 5AENA 4N3CA 4XE0A 4FP7A 1E90A 5EKQD 2VTBA 4GMJA 3LVRE 3K9IA 4JEHA 2A4ZA 2X6FA 3EHMA 3ESKA 1HG5A 2L0IA 1HE8A 3ZGQA 4A55A 3NZSA 3LJ3A 4IULA 4I1OB 1IQRA 2KCKA 4GB9A 2QY7A 4JVSA 3FTXA 4JXTA 1HO8A 2C0MA 3MGBA 4FHJA 2IOLA 3D9OA 2J9QA 3L13A 4KZ0A 4WNFA 2WXKA 3OXLA 1HG2A 2LSVA 4GYWA 3PUJA 3BG1B 1WAO1 2WMOA 1SZ9A 2UWJG 2E2EA 2FULA 5KJLA 2YNQA 1E8ZA 4BTBA 3UPVA 2XCCA 4JEUA 3CKCA 3CHRA 2GW1A 1ELRA 4LUNU 5FT9A 4JZYA 2IFUA 2ZU6B 3KAEA 3PEVB 3EDTB 5DIZA 5HI7A 2J49A 4DK5A 3UMVA 1FVFA 2EQXA 4JW1A 5AIJA 4MKTA 3FFLA 5G05C 3CEQA 3RRUA 5ARGA 3BEEA 4AIFA 4EQFA 3CVWA 2CG3A 4JC8A 2AVPA 1EYHA 3JUIA 3PUKA 4ILIA 2AWIA 5FTPA 1NA3A 1IHGA 3QK0A 3PS6A 4JHKA 5M72A 3FTWA 2R17C 1HX8A 2PM6A 4TRQA 2VQ2A 4TUUA 2HR2A 3CR3A 4G26A 1IYGA 4BX8A 5JHBA 2WXMA 3CV0A 4GZ6A 3AS5A 2KZTA 3SD5A 4A1SA 3MKRA 2QFCA 4RG6A 4R7LA 1S0PA 3MV2B 4WNGA 2J4DA 4JHJA 3ZIMA 3FTVA 4G2VA 4GCOA 3B13A 3MZLB 1HH8A 3TL5A 3GZ1A 3CHOA 4GA2A 3CVPA 1P5QA 2IJGX 3EHNA 1UN9A 3LKUA 4XKCA 2YHCA 5G04C 1QZ2A 2X6HA 3D3MA 3L6AA 3B7RL 2HYZA 2KM4A 3CIAA 4L2LA 2YINA 4BX9A 2KCLA 4J8EA 3FU6A 4B8CB 1MQSA 4RSYA 1TJFA 4HOSA 3QDNA 2IQCA 2CHWA 1ELWA 4EPZA 4FJYA 3I4RB 4CDMA 2YQ8A 3FUFA 5CMYA 5KCMA 4UWLA 4I17A 1HFAA 2VSNA 3KS2A 4LEUA 3ZPJA 4WNEA 4N39A 3TGOA 2LO6A 2C2LA 3IBEA 3FUJA 3PH0C 4J8DA 1W3BA 4ACLA 3TG5A 5KJMA 5AJDA 4NQ0A 2R59A 3IHVA 4KMOA 4UI9J 5A7DB 4CRWA 5BT1A 1ZBPA 3HDXA 3ULQA 2RG8A 3APFA 2X38A 5CCLA 3MKQB 2WXLA 3URZA 2WXPA 4I6GA 1H2UA 5ANRA 2WXNA 3FUIA 5G55A 4L2YA 4U8HA 3S7BA 3SZ7A 2WXFA 2ILRA 3KD7A 2WXQA 2Y3AA 1YA0A 3G2UA 4HLEA 4XKBA 3LYAA 3EIJA 5BV1A 4UWGA 2X3MA 1UW4B 1Z6TA 2CHXA 4FADA 1QQEA 2VGXB 3CKBA 4KVMA 4IYPA 4FU3A 4G24A 2WM9A 4A3VA 3ZHEA 3ZYQA 4UQYA 4F7AA 4GZ3A 3CGHA 3FTYA 4FC8A 3GZSA 3FY4A 4ILHB 4KZCA 2AXZA 4LRZA 4U04A 5FZSA 3UT4A 3RU0A 5FQ8A 3MEKA 3LCAA 4CDRA 3APDA 1OWLA 1KT1A 1JUQA 3TAXA 4AXHA 3MV3B 4AVXA 2I2OA 3CHMA 3G2SA 4N2SA 3CQCB 2FBNA 3L17A 4HXIA 3VLFA 5CCMA 2WPVA 3DBSA 2WXHA 4OVVA 4GMLA 4IRUA 2VSXE 3SHFA 5A23A 3FH8A 4DI4A 2BF0X 2V8SE 3FWVA 3JQ0A 3MYVA 2I6HA 3PE4A 4YVQC 4I1MA 1HU3A 5BW8C 3QWVA 3ASHA 3CK8A 4B0ZA 3I5PA 1PC2A 1Z3XA 4DLOA 5FQ4A 3HVEA 4YNDA 1NP7A 3U64A 4URKA 2IF4A 3CHSA 1EDUA 3CHQA 4U0SA 4ANXA 5KJKA 3ZFWA 3ZYLA 4P29A 2J08A 1N52A 2WXJA 4AV7A 4CDNA 4MRUA 4DJAA 3Q5MA 4FA6A 5ENNA 3FUNA 3UX4A 1HS6A 1U3CA 3CSTA 3CK9A 3EIQC 3ENEA 3FTZA 4CGVA 3HIZA 3FU5A 5FQ7A 2LNIA 4I43A 3P2BA 3SF4A 3UQ3A 4E85A 2WQ7A 3S2AA 1Y8MA 4FLBA 4GPKA 3O4ZA 2VSOE 2DIWA 2CHZA 3UT8A 3AU4A 5G04J 2FF4A 4JHRA 4J6IA 2I9CA 1GW6A 4F1SA 4H7YA 4HOTA 2GGFA 2CFUA 3S7FA 2XRZA 1Y6IA 4AY5A 4XIFA 2OVFA 2J07A 1DVPA 4FHKA 1E7VA 4CGWA 5D0QD 3PZDA 4U0UA 3U9WA 2AXUA 4JPSA 3TG4A 4MS6A 2VJ8A 4BT9A 4PS3A 4UI9C 2MRIA 2JEKA 4L23A 2RD0A 4HORA 5EX0A 3FTSA 4I6JA 4U63A 5CHEE 4K0RA 4ATGA 4D10C 3D9MA 4C0EA 3ASGA 4Q94A 3FU3A 5KJNA 4J8FA 3FEXA 2WQHA 3LDZA 3JQ1A 1ZU2A 1X5BA 2LSUA 3I3NA 2IONA 3OAWA 3D9JA 2PZIA 3L22A 4L7TA 5T3RA 1H19A 3ASFA 3FEYA 3FP3A 2J09A 3SFZA 1UJJA 3SI5A 1A17A 2Y4UA 4N3BA 3ZYKA 2FEZA 3IHYA 2KZTB 4A3TA 4ANVA 4GYYA 2KCVA 2VTBB 2XEVA 1NZNA 1INZA 2YHEA 2PL2A 3FUEA 4AJWA 3MX3A 4PUCA 2VYIA 3WXXA 3FTUA 3B7TA 1L5JA 2WXRA 5JJ7A 1LF8A 2MHKA 4ILGA 3ZXSA 4F3VA 3UT7A 2X6IA 3GZ2A 1FVHA 1KLXA 2HO1A 3MJWA 3O48A 3ESLA 4HOUA 2XQ0A 2V5FA 5HQ8A 3IV0A 3TXMA 2AXVA 4Y6CA 4BSXA 3D9KA 2PM7A 1H2VC 5CMWA 1WY6A 2VGYA 3Q4AB 5EX3A 3B7SA 2XGMA 3ZYMA 4KYOB 3OTNA 4XX5A 3ONKA 1H0AA 2GRLA 3U4TA 2NSZA 4GA0A 2WQ6A 4AOFA 2HM8A 4ABNA 4C0MA 2I1KA 5G05J 2BTDA 4TV3A 4G11A 3MA5A 4GAAA 2WXIA 3MKQA 3C98A 2A5UA 3LY9A 4GU5A 3Q49B 4I9CA 3R7QA 2JLBA 2L9BA 5FJYA 4UQXA 5FWQA 4KT6B 3QARA 1FCHA 3NF1A 2BUGA 2DBAA 5ARFA 5LP0A 2UY1B 4U0ZA 4CCAA 1NA0A 5J90A 4I2ZA 3D9LA 2J4BA 2R5SA 3NQPA 5JJTA 4NACA 4BT8A 1Z3YA 4I1AA 3P1UA 1JPLA 4MLPA 4CEMA 1HF8A 1XNFA 3ZRHA 4H7XA 3I4GA 3PE3A 4K03A 4XI0A 2L0TB 1OWNA 2XCBA 3D9PA 4AEZC 4DI3A 4BWRA 3ZN3A 3CVXA 3SGHA 4N3AA 1E8YA 4DLQA 4WNDA 3ZVVA 4WAFA 1E7UA 2L6JA 3PNLB 3BG0B 3LY7A 4HVBA 2IOSA 4QFVA 5T4YA 5BV0A 3T5XA 3CK7A 4UWHA 1XGWA 4EBAA 3FULA 1TJCA 3RJVA 2LAHA 1E8XA 3FUMA 4ANWA 5JHAA 4EBAG 3QWWA 3QNKA 2ONDA 3S7DA 4APOA 4B89A 1OWOA 3FH7A 4I9EA 3RRNB 3FHEA 3RRMB 3R7RA 3FUKA 3RO3A 2AW6A 4GYOA 4A1GA 2XGOA 1BPOA 2KC7A 2X6KA 3OXFA 4O6FA 3GYZA 1ELKA 3HVEB 2Y4TA 3QJZA 3KEZA 4J8SA 5BPPA 2WXGA 3AS4A 3U3WA 2XHEA 4JA9A 5D0OD 4DPRA 3R9AB 2NC9A 4KXKB 4OVUA 4EZKA 1QNFA 2NXPA 3UUXA 1N54A 2V0PA 2FI7A 1E96B 4UI9K 3CVVA 3FDHA 3SBTB 3L54A 4GCNA 2Q7FA 3D9IA 4APFA 4KBQA 4AY6A 3LXUX 4JA7A 4ME2A 2OOEA 2X6JA 3QOUA 3Q15A 3VLEA 3T5VA 1SZAA 1KT0A 3CVNA 1IQUA 4G25A 4M3OA 4UWFA 4N2QA 3FUHA 3TXNA 3B7UX 3L08A 3EJNA 5BNWA 3GW4A 2CG2A 2LAIA 1WM5A 2IU1A 3T8MA 3QC1A 1UG3A 4GZDA 5DBKA 4AM9A 3FUDA 4KVOA 4V3IA 4NURA 4BTAA 3FH5A 3D9NA 1B89A 5AYWD 4BY6A 1EF1C 4GZCA 4RG9A 5E75A 3ZHEB 3AU5A 3IEGA 2I1JA 3PREA 3IKOB 3DPDA 4YVOA 3VTXA 3U66A 4GA1A 1SQMA 2XPYA 3ZEFA 4CT4A 3TJPA 3JCKC 1UN8A 5T8IA 4C9BB 1EPUA 2C0LA 3MCXA 4Q69A 4BFRA 4N5CA 4HOQA 5ANLA 4ANUA 5E76A 3S7JA 5FQ6A 2DCPA 3CVQA 5JJ6A 3NZUA 4I6EA 3ASDA 3CLJA 4FJZA 5EDSA 2OVBA 4U07A 3N71A 4FULA 2V4LA 3PDNA 4Q96A 4Y6WA 3QKYA 1JWGA 4FLHA 3QAQA 3ML8A 5BUZA 3G2WA 3LS8A 3PRZA 2XRYA 3HHMA 2M63A 2WMNA 4W9RA 1PY1A 4RVBA 4J0UA 4B94A 3LPZA 1H6KA 1E8WA 2PQRA 3APCA 5LOZA 3PEUB 3SBSA 1H2TC 1PAQA 3L16A 4ACKA 5FZQA 1JWFA 1HZ4A 1U3DA 1DNPA 3ONLA 4WUYA 3ZW3A 3CVYA 3G2VA 5LX8A 3VTYA 4IN3B 5LCWC 3RO2A 4WWNA 3PVLA 3LVQE 4UWKA 1TEZA 2WVIA 2CFZA 2XGSA 2P58C 4HFGA 4L1BA 5FZRA 4HS2A 4WWPA 5C1DA 4XZ4A 4XI9A 3SNXA 4WWOA 1HXIA 4I2WA 4OYSA 4PDXA 5A6CA 1OWPA 2PQNA 4LERA 4B8AA 4F53A 1OUVA 1UJKA 3QB2A 2OV8A 3FU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUL A;  2KZT A;  2KZT B;  3EIJ A;  3RK6 A;  2NSZ A;  4B89 A;  1H6K A;  1UW4 B;  4JHJ A;  2HM8 A;  4GMJ A;  4GML A;  2VSX E;  4LUN U;  1H2T C;  1PAQ A;  2ZU6 B;  3EIQ C;  4CT4 A;  4C9B B;  4CEM A;  2IU1 A;  1UG3 A;  1HU3 A;  2VSO E;  3JUI A;  4CRW A;  4IUL A;  3D3M A;  3L6A A;  2RG8 A;  4JHK A;  3FEX A;  2IOL A;  2ION A;  1N54 A;  5ANR A;  1H2V C;  1H2U A;  2GGF A;  2IOS A;  3FEY A;  4B8A A;  4B8C B;  1N52 A;  2I2O A; 
#chains in the Genus database with same CATH topology
 1MHQ A;  3TWU A;  5AQ7 A;  4EEC A;  2UY1 A;  3CVL A;  3VLD A;  2E0I A;  3DEO A;  3Q78 A;  2KAT A;  4PH4 B;  3Q75 A;  2WB2 A;  3Q47 B;  4G23 A;  3RKV A;  4HI9 A;  5C2Y A;  3PNT B;  3RK6 A;  4GTT A;  3SO8 A;  4UQZ A;  4CYM D;  1UOH A;  3EHM A;  1OCO E;  1N4R A;  3ZUV B;  4A55 A;  4I1O B;  4GB9 A;  3ZEF A;  1SA5 A;  1HG2 A;  1JCR A;  2R2L A;  3BG1 B;  1OCR E;  2WMO A;  2E2E A;  2YNQ A;  2XCC A;  3CHR A;  4JZY A;  2J49 A;  1FVF A;  5AIJ A;  2FO1 E;  4MKT A;  3RRU A;  3JUI A;  2AWI A;  5M72 A;  2R17 C;  2IO2 C;  2HR2 A;  4G26 A;  4TXR A;  3MKR A;  2QFC A;  2B0O E;  4G2V A;  1BI8 B;  4GA2 A;  4HB5 A;  3EHN A;  1UN9 A;  3LKU A;  4XKC A;  3L6A A;  2HYZ A;  4L2L A;  3KSQ A;  3UM2 A;  4B8C B;  4HOS A;  2RFA A;  2P9U G;  3QDN A;  2Y69 E;  3DSX A;  5CMY A;  5CER B;  1HFA A;  4N39 A;  3TGO A;  3PH0 C;  3FUJ A;  1W3B A;  5KJM A;  3UIO C;  3IHV A;  4KMO A;  3PZ3 A;  2X38 A;  4M7C A;  4X8Q A;  3EUV A;  5ANR A;  2WXN A;  1BI7 B;  4L2Y A;  4B93 B;  2Y3A A;  3UIP C;  4HLE A;  4XKB A;  2X3M A;  1UW4 B;  1JCS A;  2VGX B;  4G24 A;  2WM9 A;  3ZYQ A;  4UQY A;  3FTY A;  4ILH B;  4KZC A;  3DSS A;  5FQ8 A;  4CDR A;  3APD A;  4AXH A;  4F1P A;  3MV3 B;  5CCM A;  2FBN A;  4OVV A;  4GML A;  1NI1 A;  4IRU A;  3UXG A;  2V8S E;  3FWV A;  4YVQ C;  2HE0 A;  3QWV A;  3CK8 A;  1PC2 A;  1Z3X A;  4DLO A;  4YND A;  3Q73 A;  3ABM E;  4U0S A;  5KJK A;  2J08 A;  3E33 A;  4HRN A;  3UX4 A;  3EIQ C;  3ENE A;  5FIN A;  2WQ7 A;  1Y8M A;  2CHZ A;  3AU4 A;  2Y0B G;  5CRV A;  5G04 J;  2FF4 A;  4J6I A;  3ULY A;  1GW6 A;  1Y6I A;  4ZFH A;  4AY5 A;  5CED B;  4FHK A;  1E7V A;  1YMP A;  2EIJ E;  2VJ8 A;  4UI9 C;  4HOR A;  2RD0 A;  3B95 A;  5EX0 A;  4I6J A;  4GTQ A;  4C0E A;  3FU3 A;  3FEX A;  3JQ1 A;  2PZI A;  3UM0 A;  2J09 A;  3SFZ A;  3SI5 A;  3ZYK A;  2FEZ A;  4ANV A;  2VTB B;  2KCV A;  2H6G A;  1INZ A;  2PL2 A;  4AJW A;  3ABK E;  3WXX A;  5JJ7 A;  2P2C P;  5D2M C;  4F3V A;  5AN8 A;  2HO1 A;  3O48 A;  2XQ0 A;  5HQ8 A;  2OEV A;  4Y6C A;  2L6B A;  3D9K A;  2DZO A;  1H2V C;  3L9T A;  2XGM A;  2GRL A;  3U4T A;  4HRM B;  2I1K A;  3HXE A;  3MA5 A;  4GU5 A;  2A5U A;  3SY2 A;  2AJA A;  4UQX A;  5FWQ A;  3DPY A;  1LD8 A;  2UY1 B;  3E34 A;  4DX2 A;  3D9L A;  2R5S A;  3NQP A;  5JJT A;  5CEC B;  1JPL A;  3J5Q B;  1A5E A;  4CEM A;  3ZRH A;  1HF8 A;  3V2X A;  4K03 A;  3PE3 A;  4BWR A;  3ZN3 A;  1E8Y A;  4WND A;  1K1A A;  2IOS A;  5CEA A;  2ETA A;  2LAH A;  4ANW A;  4B89 A;  1OWO A;  4I9E A;  3IXE A;  3NB2 A;  3R7R A;  3RO3 A;  2X6K A;  3ZU7 B;  2XHE A;  4JA9 A;  4F6R D;  5BXU A;  1QNF A;  3UUX A;  1E96 B;  4UI9 K;  3L54 A;  2Q7F A;  4U8V D;  1SZA A;  1KT0 A;  3CVN A;  1IQU A;  3TXN A;  3B7U X;  4LNB A;  2LAI A;  1WM5 A;  2IU1 A;  1N94 A;  1UG3 A;  3ZKJ A;  2Y1L E;  1B89 A;  1EF1 C;  4RG9 A;  5E75 A;  2IEJ A;  3VTX A;  3TJP A;  3JCK C;  1TNO A;  1EPU A;  3MCX A;  4N5C A;  1K8K G;  1TN8 A;  3C3R A;  4O60 A;  2R05 A;  1X81 A;  2OVB A;  3N71 A;  4Y6W A;  1JWG A;  1LTX A;  3JXJ A;  3PRZ A;  2WMN A;  1PY1 A;  3LPZ A;  3PEU B;  4ACK A;  1JWF A;  3ONL A;  3CVY A;  3G2V A;  5LCW C;  5ENT D;  2CFZ A;  2XGS A;  5EN5 D;  4HS2 A;  4WWP A;  4XZ4 A;  3SNX A;  4DX1 A;  3ISM C;  1YCS B;  3FH8 A;  3QB2 A;  5ANL A;  2XPZ A;  1OWM A;  4G1T A;  4GZ5 A;  2ZXW E;  4NRH B;  3CHP A;  3LEW A;  3UTM A;  1VDY A;  3QWP A;  2BKG A;  2XPI A;  3RIB A;  3B7B A;  3HYM B;  1IXV A;  4XE0 A;  4FP7 A;  4JEH A;  2A4Z A;  2X6F A;  3ESK A;  1HE8 A;  3NZS A;  1IQR A;  4JVS A;  3FTX A;  1HO8 A;  4FHJ A;  1D8D A;  3D9O A;  2J9Q A;  3L13 A;  4KZ0 A;  3OXL A;  1SZ9 A;  5KJL A;  2P9L G;  3CKC A;  2GW1 A;  4LUN U;  2ZU6 B;  3KAE A;  4DK5 A;  5DIZ A;  3UMV A;  3FFL A;  2CG3 A;  4JC8 A;  1EYH A;  3PUK A;  4ILI A;  4U95 D;  3FTW A;  2LXL A;  3V2O A;  1HX8 A;  2ZGD A;  2WXM A;  4GZ6 A;  3SD5 A;  4RG6 A;  1S0P A;  4JHJ A;  3FTV A;  3DXM G;  3B13 A;  3MZL B;  1HH8 A;  3TL5 A;  3CHO A;  3CVP A;  2ETB A;  2V4H C;  2YHC A;  1QZ2 A;  2DYR E;  4OAV B;  2KM4 A;  4LSZ E;  3ASO E;  3TWQ A;  4J8E A;  1TJF A;  2IQC A;  2F8X K;  2CHW A;  4EPZ A;  4CDM A;  3NBN B;  4GTP A;  2VSN A;  3ZPJ A;  4WNE A;  1TN7 A;  2LO6 A;  2C2L A;  5ENS D;  5BT1 A;  5A7D B;  1ZBP A;  2WXL A;  3URZ A;  2WXP A;  3Q9U C;  4U8H A;  2WXF A;  2WXQ A;  1YA0 A;  3LYA A;  3EIJ A;  4UWG A;  2CHX A;  4FU3 A;  3UM1 A;  3X2Q E;  4GZ3 A;  4DRX E;  2AXZ A;  4LRZ A;  3MEK A;  3LCA A;  1KT1 A;  1NFI E;  1JUQ A;  4GPM A;  2LXM A;  2I2O A;  3TWX A;  3CHM A;  3G2S A;  4HXI A;  3L17 A;  3JQ0 A;  3PE4 A;  5CBO A;  1HU3 A;  1OY3 D;  2XS8 A;  3ASH A;  5FQ4 A;  3HVE A;  3JUE A;  4ANX A;  3ZFW A;  1TNU A;  1N52 A;  4HNA D;  4QQI A;  4DJA A;  3Q5M A;  4C48 B;  1HS6 A;  1U3C A;  3CK9 A;  5FQ7 A;  4E85 A;  3SF4 A;  3J5P A;  4FLB A;  3O4Z A;  3UT8 A;  1V55 E;  4H7Y A;  2CFU A;  4K5A B;  4XIF A;  1OCZ E;  2OVF A;  2A5E A;  4XEI G;  1DVP A;  4U0U A;  4JPS A;  4GTV A;  2MRI A;  2JEK A;  3E32 A;  2F8Y A;  3FTS A;  4K0R A;  4Q94 A;  5KJN A;  3D9H A;  5ARG A;  1ZU2 A;  2LSU A;  3I3N A;  3NOC D;  3L22 A;  4YDO A;  3FEY A;  2EIM E;  4G8K A;  4N3B A;  3IHY A;  2KZT B;  4A3T A;  2YHE A;  3FUE A;  1TN6 A;  1L5J A;  3TWT A;  3UT7 A;  3GZ2 A;  1FVH A;  3MJW A;  3ESL A;  2AXV A;  2MYO A;  2PM7 A;  4JD2 G;  4TXQ A;  3EU5 A;  2WQ6 A;  4AOF A;  3HXF A;  5G05 J;  5BXO A;  4TV3 A;  4GAA A;  3ZNG A;  2L9B A;  2BUG A;  2DBA A;  5LP0 A;  1N4Q A;  4U0Z A;  4I2Z A;  2J4B A;  1V54 E;  4NAC A;  4BT8 A;  1Z3Y A;  4MLP A;  2XEE A;  4XI0 A;  1OWN A;  2B6C A;  4N3A A;  2F0Y A;  4WAF A;  3LY7 A;  4HVB A;  5BV0 A;  4YDE A;  2VGE A;  3CK7 A;  4EBA A;  3FUL A;  3QNK A;  4APO A;  3FHE A;  3RRM B;  3FUK A;  4G8L A;  3OXF A;  3HVE B;  3QJZ A;  4J8S A;  3U3W A;  2WXG A;  2XEN A;  3R9A B;  1N54 A;  2V0P A;  1Z5S C;  1MYO A;  3LXU X;  4AY6 A;  2OOE A;  3QOU A;  3Q15 A;  3T5V A;  3F6Q A;  3QC1 A;  5DBK A;  3FUD A;  4V3I A;  4NUR A;  4GZC A;  3AU5 A;  2I1J A;  2XEH A;  3PRE A;  2EIK E;  5EYP F;  2IY0 C;  2XPY A;  4CT4 A;  1UN8 A;  1IHB A;  2C0L A;  5ENQ D;  4Q69 A;  1O1R A;  4ANU A;  3S7J A;  5FQ6 A;  1WG0 A;  3W9G A;  2V4L A;  3PDN A;  4Q96 A;  4YDW A;  1RW2 A;  3G2W A;  2XRY A;  1K1B A;  3HHM A;  4DX7 D;  4J0U A;  1H6K A;  1E8W A;  2PQR A;  3APC A;  1H2T C;  3L16 A;  1DNP A;  3VTY A;  1BD8 A;  4IN3 B;  3PVL A;  4UWK A;  1TEZ A;  4HFG A;  2P58 C;  5C1D A;  2KXP C;  1OWP A;  2PQN A;  4B8A A;  1KZP A;  1UJK A;  2OV8 A;  3E4B A;  2QC9 A;  1H6P A;  4DX6 D;  1ZB1 A;  2VSY A;  1OCC E;  4LCT A;  4E6H A;  3EHR A;  3CSF A;  5LFA A;  3PZ1 A;  4EZL A;  4AP2 A;  3OXG A;  3DSW A;  4U7E B;  2WXO A;  1Q2Z A;  3L82 A;  4JL0 A;  3LY8 A;  5G2N A;  5B3S E;  4CT0 A;  5AEN A;  4N3C A;  5EKQ D;  2VTB A;  4GMJ A;  3LVR E;  3K9I A;  1G3N B;  1N4S A;  2L0I A;  3ZGQ A;  2KCK A;  2QY7 A;  4JXT A;  2C0M A;  2IOL A;  4WNF A;  2WXK A;  4GYW A;  3PUJ A;  1WAO 1;  2FUL A;  3TWS A;  1E8Z A;  3HXC A;  4BTB A;  1BU9 A;  1ELR A;  5FT9 A;  5H7P A;  2IFU A;  3PEV B;  3EDT B;  5HI7 A;  5EID A;  5G05 C;  3CEQ A;  4EQF A;  2AVP A;  4JHK A;  1IHG A;  3PS6 A;  4TRQ A;  1MZC A;  2VQ2 A;  3HXB A;  4BX8 A;  3CV0 A;  1AWC B;  3AS5 A;  2KZT A;  4A1S A;  4R7L A;  4WNG A;  3PZ4 A;  1P5Q A;  2RKK A;  1S64 A;  2X6H A;  2H6I A;  3CIA A;  3FU6 A;  1MQS A;  1AP7 A;  4UWL A;  4I17 A;  1S70 B;  4LEU A;  3KS2 A;  4J8D A;  1TNY A;  4NQ0 A;  2R59 A;  4CRW A;  3HDX A;  2R02 A;  5CCL A;  3MKQ B;  1SA4 A;  4I6G A;  1H2U A;  2P9P G;  3FUI A;  3SZ7 A;  2ILR A;  3KD7 A;  3SQV A;  3G2U A;  3DSU A;  5BV1 A;  1Z6T A;  1QQE A;  4IYP A;  5EIB E;  3V31 A;  3ZHE A;  2P9N G;  3CGH A;  4FC8 A;  5B1A E;  3FY4 A;  4U04 A;  3UT4 A;  5FZS A;  3RU0 A;  1S63 A;  2H6H A;  3TAX A;  4AVX A;  3DST A;  4N2S A;  3CQC B;  3DBS A;  3BQO A;  3BU8 A;  1H6O A;  3MYV A;  2I6H A;  1QBQ A;  4HI8 A;  1MX4 A;  3JXI A;  4DUI A;  1N95 A;  3I5P A;  4K5B A;  3RAU A;  1NP7 A;  3T8K A;  3T9K A;  4P29 A;  4AV7 A;  4MRU A;  1MJ0 A;  3AG4 E;  4GMR A;  2EIL E;  4GTM A;  2P9S G;  3HIZ A;  4BEP A;  3FU5 A;  3UQ3 A;  4I43 A;  3P2B A;  3TWR A;  4GPK A;  4MBG A;  3HG0 D;  3Q9N C;  4JHR A;  2R03 A;  4F1S A;  4HOT A;  2QZA A;  2KBX A;  2XZT G;  2J07 A;  3PZD A;  3HRA A;  3U9W A;  4BT9 A;  2AXU A;  4TUM A;  1KPS B;  3AG1 E;  3UM3 A;  4HBD A;  4U63 A;  2P9K G;  4ATG A;  1KZO A;  2GRO B;  3ASG A;  4K5C A;  5HS0 A;  4J8F A;  1X5B A;  5T3R A;  2ION A;  3D9J A;  4L7T A;  1IKN D;  1WDY A;  3FP3 A;  3UI2 A;  1A17 A;  4RQI A;  4GYY A;  2QYJ A;  5CRU A;  1BLX B;  3MX3 A;  2VYI A;  2WXR A;  1LF8 A;  2MHK A;  3ZXS A;  2ETC A;  3AG3 E;  4HOU A;  2V5F A;  3IV0 A;  4BET A;  4L9P A;  3Q79 A;  2V5Q C;  4BSX A;  1WY6 A;  2VGY A;  5EX3 A;  2DZN A;  3B7S A;  3ZYM A;  2XS1 A;  3TWW A;  1H0A A;  4GA0 A;  2HM8 A;  4C0M A;  5EYL A;  2WXI A;  1SW6 A;  3MKQ A;  3C98 A;  5AQ9 A;  3UKU G;  3Q49 B;  4I9C A;  5FJY A;  4KT6 B;  3C5R A;  3NF1 A;  5ARF A;  4CCA A;  5J90 A;  2ZGG A;  3AAA C;  3P1U A;  3I4G A;  2XCB A;  3D9P A;  4DI3 A;  4AEZ C;  3CVX A;  3SGH A;  3ZXP A;  3NOG D;  3ZVV A;  1E7U A;  2L6J A;  2OCC E;  3PNL B;  2ZIR A;  4QFV A;  1TJC A;  1N9A A;  3RJV A;  1E8X A;  3FUM A;  3QWW A;  5JA4 D;  2OND A;  4O1P A;  3RRN B;  2AW6 A;  1BPO A;  2KC7 A;  5BPP A;  3KEZ A;  1MX6 A;  5D0O D;  4DPR A;  2NC9 A;  4YDY A;  3E30 A;  4EZK A;  2FI7 A;  2P9I G;  3HXD A;  3CVV A;  3FDH A;  4O1O A;  4GCN A;  4JA7 A;  1TNB A;  4ME2 A;  4G25 A;  4M3O A;  3FUH A;  3L08 A;  3GW4 A;  2CG2 A;  4GZD A;  4RLY A;  2XZD G;  4AM9 A;  5AAO A;  4BY6 A;  3FH5 A;  3D9N A;  3DPD A;  3U66 A;  4GA1 A;  4GTO A;  5ENP D;  4C9B B;  4BFR A;  5KNH D;  5B1B E;  2DCP A;  2ZIS A;  3SFX A;  3ASD A;  5EDS A;  4FUL A;  2BKK B;  3QAQ A;  5BUZ A;  3LS8 A;  2M63 A;  4W9R A;  3ABL E;  5LOZ A;  1PAQ A;  5LX8 A;  2DWZ A;  5AAR A;  4OAU C;  3RO2 A;  1LD7 A;  4WWN A;  3LVQ E;  5AQB A;  4L1B A;  4WWO A;  1HXI A;  4I2W A;  4OYS A;  2NYJ A;  4LER A;  2H6F A;  4F53 A;  1OUV A;  4ATZ D;  3FU0 A;  1N0Q A;  5J08 A;  2VGX A;  2DYS E;  5AJL A;  3CVU A;  2LUH A;  5KBA A;  1TNZ A;  2FO7 A;  3CQG B;  5KNG A;  3UIN C;  3Q7F A;  3AS8 A;  4PS8 A;  3ML9 A;  4PS7 A;  2BED A;  4EZJ A;  5LCW J;  3DXK G;  2GRR B;  2GRM A;  3JYS A;  3G2T A;  2MOW A;  1DCE A;  1E90 A;  3R9M A;  3AJI A;  1RZ4 A;  1HG5 A;  4UUC A;  4U8Y D;  4GTS A;  3LJ3 A;  3C3Q A;  4IUL A;  4N5Q A;  1DC2 A;  3MGB A;  1O1S A;  2LSV A;  4LNU D;  2UWJ G;  3UPV A;  3V30 A;  3EU9 A;  4JEU A;  4BER A;  5AQA A;  2EQX A;  4JW1 A;  1MX2 A;  4BES A;  4AIF A;  3BEE A;  3CVW A;  1FT2 A;  5FTP A;  1NA3 A;  3QK0 A;  2PM6 A;  4TUU A;  3CR3 A;  5IY5 E;  1IYG A;  5JHB A;  4GTR A;  1N11 A;  3MV2 B;  2J4D A;  3ZIM A;  4GCO A;  3UKR G;  3GZ1 A;  2IJG X;  4HQD A;  3Q7A A;  5G04 C;  3D3M A;  3B7R L;  2YIN A;  4BX9 A;  2KCL A;  3C72 A;  4RSY A;  4J8Y A;  1ELW A;  4FJY A;  3I4R B;  2YQ8 A;  3FUF A;  5KCM A;  3IBE A;  4ACL A;  3TG5 A;  5AJD A;  4UI9 J;  3ULQ A;  2RG8 A;  3APF A;  5G55 A;  3C3O A;  3S7B A;  2IO3 C;  1U2V G;  4A63 B;  4U96 D;  4FAD A;  3E37 A;  3CKB A;  4KVM A;  2F37 A;  5D66 A;  4A3V A;  4F7A A;  4DX5 D;  3GZS A;  4JB8 P;  1OWL A;  4HRL A;  4LNG A;  2GRN B;  1YYH A;  1O5M A;  3VLF A;  2WPV A;  2WXH A;  1K3Z D;  3SHF A;  2VSX E;  5A23 A;  5KWD A;  4DI4 A;  5ENR D;  2BF0 X;  4I1M A;  5BW8 C;  1N4P A;  4TXP A;  4B0Z A;  2EIN E;  3U64 A;  3V79 K;  4URK A;  2IF4 A;  3CHS A;  5ITZ F;  1EDU A;  3CHQ A;  3ZYL A;  2WXJ A;  4CDN A;  1FT1 A;  1TYQ G;  5ENN A;  3FUN A;  4FA6 A;  3ASN E;  3CST A;  4CGV A;  3FTZ A;  3WG7 E;  2LNI A;  3S2A A;  2VSO E;  2DIW A;  5HKP A;  4EHM A;  2I9C A;  2GGF A;  3S7F A;  2XRZ A;  4BSZ B;  4CGW A;  5D0Q D;  3DRA A;  2DVW A;  3TG4 A;  1NL4 A;  4MS6 A;  4PS3 A;  4L23 A;  5CHE E;  4D10 C;  5ENO D;  3D9M A;  4ZHB A;  2WQH A;  3LDZ A;  3OAW A;  1H19 A;  3ASF A;  1UJJ A;  1D8E A;  2Y4U A;  2XEV A;  1NZN A;  4PUC A;  3FTU A;  2GRP B;  3B7T A;  4ILG A;  2X6I A;  3BUA A;  1QYM A;  1KLX A;  2OEW A;  3TXM A;  3SFY A;  4CZ2 D;  3KEA A;  5CMW A;  3Q4A B;  4KYO B;  3OTN A;  4XX5 A;  3ONK A;  5EIL A;  2NSZ A;  1TR4 A;  3DWL G;  5CBN A;  4ABN A;  2BTD A;  4G11 A;  4LG6 A;  3LY9 A;  3R7Q A;  1FPP A;  2JLB A;  2JAB A;  2J8S D;  3QAR A;  1FCH A;  5HRY A;  1NA0 A;  3NAW A;  3ULE G;  4I1A A;  1XNF A;  4H7X A;  2L0T B;  5JMN D;  2GRQ B;  4DLQ A;  3BG0 B;  1N0R A;  5T4Y A;  1JCQ A;  3T5X A;  4UWH A;  1XGW A;  1SVX A;  5JHA A;  4EBA G;  1D9S A;  3S7D A;  2RFM A;  3FH7 A;  4GYO A;  4A1G A;  2XGO A;  3DEP A;  4O6F A;  3GYZ A;  1ELK A;  2Y4T A;  1OT8 A;  3AS4 A;  3TWV A;  4KXK B;  4OVU A;  2NXP A;  3SBT B;  3D9I A;  4APF A;  4KBQ A;  2X6J A;  3VLE A;  4N2Q A;  4UWF A;  1DCQ A;  3EJN A;  5BNW A;  3T8M A;  4KVO A;  4BTA A;  5AYW D;  4HLL A;  3ZHE B;  3IEG A;  3IKO B;  3AG2 E;  4YVO A;  5FIO A;  1OXJ A;  1SQM A;  5T8I A;  3RSE G;  3W9F A;  4HOQ A;  5E76 A;  1O1T A;  3CVQ A;  5JJ6 A;  4J7W A;  3KSL A;  3NZU A;  4I6E A;  3CLJ A;  4FJZ A;  4U07 A;  3QKY A;  4FLH A;  3ML8 A;  3PZ2 A;  4B94 A;  4RVB A;  2PNN A;  2QYU A;  3SBS A;  3LJN A;  5FZQ A;  1HZ4 A;  1U3D A;  3EHQ A;  4WUY A;  3ZW3 A;  4NIK A;  3DSV A;  4Z68 A;  2WVI A;  5FZR A;  4XI9 A;  4PDX A;  5A6C A; 
#chains in the Genus database with same CATH homology
 1MHQ A;  3E4B A;  2XPZ A;  1OWM A;  5J08 A;  4EEC A;  2VGX A;  2UY1 A;  3CVL A;  4G1T A;  4GZ5 A;  4NRH B;  2E0I A;  3VLD A;  3CHP A;  5AJL A;  4PH4 B;  2KAT A;  3CVU A;  3LEW A;  2VSY A;  1VDY A;  2WB2 A;  3Q47 B;  4LCT A;  4E6H A;  2FO7 A;  3CQG B;  3QWP A;  3CSF A;  4G23 A;  5LFA A;  3RKV A;  2XPI A;  3RIB A;  3AS8 A;  4PS8 A;  3ML9 A;  4PS7 A;  4EZL A;  4AP2 A;  3OXG A;  5C2Y A;  4EZJ A;  2WXO A;  5LCW J;  3PNT B;  4JL0 A;  3LY8 A;  5G2N A;  2GRM A;  3HYM B;  3JYS A;  3G2T A;  2MOW A;  3RK6 A;  4CT0 A;  4UQZ A;  5AEN A;  4N3C A;  4XE0 A;  4FP7 A;  1E90 A;  5EKQ D;  2VTB A;  4GMJ A;  3LVR E;  3K9I A;  4JEH A;  2A4Z A;  2X6F A;  3EHM A;  3ESK A;  1HG5 A;  2L0I A;  1HE8 A;  3ZGQ A;  4A55 A;  3NZS A;  3LJ3 A;  4IUL A;  4I1O B;  1IQR A;  2KCK A;  4GB9 A;  2QY7 A;  4JVS A;  3FTX A;  4JXT A;  1HO8 A;  2C0M A;  3MGB A;  4FHJ A;  2IOL A;  3D9O A;  2J9Q A;  3L13 A;  4KZ0 A;  4WNF A;  2WXK A;  3OXL A;  1HG2 A;  2LSV A;  4GYW A;  3PUJ A;  3BG1 B;  1WAO 1;  2WMO A;  1SZ9 A;  2UWJ G;  2E2E A;  2FUL A;  5KJL A;  2YNQ A;  1E8Z A;  4BTB A;  3UPV A;  2XCC A;  4JEU A;  3CKC A;  3CHR A;  2GW1 A;  1ELR A;  4LUN U;  5FT9 A;  4JZY A;  2IFU A;  2ZU6 B;  3KAE A;  3PEV B;  3EDT B;  5DIZ A;  5HI7 A;  2J49 A;  4DK5 A;  3UMV A;  1FVF A;  2EQX A;  4JW1 A;  5AIJ A;  4MKT A;  3FFL A;  5G05 C;  3CEQ A;  3RRU A;  5ARG A;  3BEE A;  4AIF A;  4EQF A;  3CVW A;  2CG3 A;  4JC8 A;  2AVP A;  1EYH A;  3JUI A;  3PUK A;  4ILI A;  2AWI A;  5FTP A;  1NA3 A;  1IHG A;  3QK0 A;  3PS6 A;  4JHK A;  5M72 A;  3FTW A;  2R17 C;  1HX8 A;  2PM6 A;  4TRQ A;  2VQ2 A;  4TUU A;  2HR2 A;  3CR3 A;  4G26 A;  1IYG A;  4BX8 A;  5JHB A;  2WXM A;  3CV0 A;  4GZ6 A;  3AS5 A;  2KZT A;  3SD5 A;  4A1S A;  3MKR A;  2QFC A;  4RG6 A;  4R7L A;  1S0P A;  3MV2 B;  4WNG A;  2J4D A;  4JHJ A;  3ZIM A;  3FTV A;  4G2V A;  4GCO A;  3B13 A;  3MZL B;  1HH8 A;  3TL5 A;  3GZ1 A;  3CHO A;  4GA2 A;  3CVP A;  1P5Q A;  2IJG X;  3EHN A;  1UN9 A;  3LKU A;  4XKC A;  2YHC A;  5G04 C;  1QZ2 A;  2X6H A;  3D3M A;  3L6A A;  3B7R L;  2HYZ A;  2KM4 A;  3CIA A;  4L2L A;  2YIN A;  4BX9 A;  2KCL A;  4J8E A;  3FU6 A;  4B8C B;  1MQS A;  4RSY A;  1TJF A;  4HOS A;  3QDN A;  2IQC A;  2CHW A;  1ELW A;  4EPZ A;  4FJY A;  3I4R B;  4CDM A;  2YQ8 A;  3FUF A;  5CMY A;  5KCM A;  4UWL A;  4I17 A;  1HFA A;  2VSN A;  3KS2 A;  4LEU A;  3ZPJ A;  4WNE A;  4N39 A;  3TGO A;  2LO6 A;  2C2L A;  3IBE A;  3FUJ A;  3PH0 C;  4J8D A;  1W3B A;  4ACL A;  3TG5 A;  5KJM A;  5AJD A;  4NQ0 A;  2R59 A;  3IHV A;  4KMO A;  4UI9 J;  5A7D B;  4CRW A;  5BT1 A;  1ZBP A;  3HDX A;  3ULQ A;  2RG8 A;  3APF A;  2X38 A;  5CCL A;  3MKQ B;  2WXL A;  3URZ A;  2WXP A;  4I6G A;  1H2U A;  5ANR A;  2WXN A;  3FUI A;  5G55 A;  4L2Y A;  4U8H A;  3S7B A;  3SZ7 A;  2WXF A;  2ILR A;  3KD7 A;  2WXQ A;  2Y3A A;  1YA0 A;  3G2U A;  4HLE A;  4XKB A;  3LYA A;  3EIJ A;  5BV1 A;  4UWG A;  2X3M A;  1UW4 B;  1Z6T A;  2CHX A;  4FAD A;  1QQE A;  2VGX B;  3CKB A;  4KVM A;  4IYP A;  4FU3 A;  4G24 A;  2WM9 A;  4A3V A;  3ZHE A;  3ZYQ A;  4UQY A;  4F7A A;  4GZ3 A;  3CGH A;  3FTY A;  4FC8 A;  3GZS A;  3FY4 A;  4ILH B;  4KZC A;  2AXZ A;  4LRZ A;  4U04 A;  5FZS A;  3UT4 A;  3RU0 A;  5FQ8 A;  3MEK A;  3LCA A;  4CDR A;  3APD A;  1OWL A;  1KT1 A;  1JUQ A;  3TAX A;  4AXH A;  3MV3 B;  4AVX A;  2I2O A;  3CHM A;  3G2S A;  4N2S A;  3CQC B;  2FBN A;  3L17 A;  4HXI A;  3VLF A;  5CCM A;  2WPV A;  3DBS A;  2WXH A;  4OVV A;  4GML A;  4IRU A;  2VSX E;  3SHF A;  5A23 A;  3FH8 A;  4DI4 A;  2BF0 X;  2V8S E;  3FWV A;  3JQ0 A;  3MYV A;  2I6H A;  3PE4 A;  4YVQ C;  4I1M A;  1HU3 A;  5BW8 C;  3QWV A;  3ASH A;  3CK8 A;  4B0Z A;  3I5P A;  1PC2 A;  1Z3X A;  4DLO A;  5FQ4 A;  3HVE A;  4YND A;  1NP7 A;  3U64 A;  4URK A;  2IF4 A;  3CHS A;  1EDU A;  3CHQ A;  4U0S A;  4ANX A;  5KJK A;  3ZFW A;  3ZYL A;  4P29 A;  2J08 A;  1N52 A;  2WXJ A;  4AV7 A;  4CDN A;  4MRU A;  4DJA A;  3Q5M A;  4FA6 A;  5ENN A;  3FUN A;  3UX4 A;  1HS6 A;  1U3C A;  3CST A;  3CK9 A;  3EIQ C;  3ENE A;  3FTZ A;  4CGV A;  3HIZ A;  3FU5 A;  5FQ7 A;  2LNI A;  4I43 A;  3P2B A;  3SF4 A;  3UQ3 A;  4E85 A;  2WQ7 A;  3S2A A;  1Y8M A;  4FLB A;  4GPK A;  3O4Z A;  2VSO E;  2DIW A;  2CHZ A;  3UT8 A;  3AU4 A;  5G04 J;  2FF4 A;  4JHR A;  4J6I A;  2I9C A;  1GW6 A;  4F1S A;  4H7Y A;  4HOT A;  2GGF A;  2CFU A;  3S7F A;  2XRZ A;  1Y6I A;  4AY5 A;  4XIF A;  2OVF A;  2J07 A;  1DVP A;  4FHK A;  1E7V A;  4CGW A;  5D0Q D;  3PZD A;  4U0U A;  3U9W A;  2AXU A;  4JPS A;  3TG4 A;  4MS6 A;  2VJ8 A;  4BT9 A;  4PS3 A;  4UI9 C;  2MRI A;  2JEK A;  4L23 A;  2RD0 A;  4HOR A;  5EX0 A;  3FTS A;  4I6J A;  4U63 A;  5CHE E;  4K0R A;  4ATG A;  4D10 C;  3D9M A;  4C0E A;  3ASG A;  4Q94 A;  3FU3 A;  5KJN A;  4J8F A;  3FEX A;  2WQH A;  3LDZ A;  3JQ1 A;  1ZU2 A;  1X5B A;  2LSU A;  3I3N A;  2ION A;  3OAW A;  3D9J A;  2PZI A;  3L22 A;  4L7T A;  5T3R A;  1H19 A;  3ASF A;  3FEY A;  3FP3 A;  2J09 A;  3SFZ A;  1UJJ A;  3SI5 A;  1A17 A;  2Y4U A;  4N3B A;  3ZYK A;  2FEZ A;  3IHY A;  2KZT B;  4A3T A;  4ANV A;  4GYY A;  2KCV A;  2VTB B;  2XEV A;  1NZN A;  1INZ A;  2YHE A;  2PL2 A;  3FUE A;  4AJW A;  3MX3 A;  4PUC A;  2VYI A;  3WXX A;  3FTU A;  3B7T A;  1L5J A;  2WXR A;  5JJ7 A;  1LF8 A;  2MHK A;  4ILG A;  3ZXS A;  4F3V A;  3UT7 A;  2X6I A;  3GZ2 A;  1FVH A;  1KLX A;  2HO1 A;  3MJW A;  3O48 A;  3ESL A;  4HOU A;  2XQ0 A;  2V5F A;  5HQ8 A;  3IV0 A;  3TXM A;  2AXV A;  4Y6C A;  4BSX A;  3D9K A;  2PM7 A;  1H2V C;  5CMW A;  1WY6 A;  2VGY A;  3Q4A B;  5EX3 A;  3B7S A;  2XGM A;  3ZYM A;  4KYO B;  3OTN A;  4XX5 A;  3ONK A;  1H0A A;  2GRL A;  3U4T A;  2NSZ A;  4GA0 A;  2WQ6 A;  4AOF A;  2HM8 A;  4ABN A;  4C0M A;  2I1K A;  5G05 J;  2BTD A;  4TV3 A;  4G11 A;  3MA5 A;  4GAA A;  2WXI A;  3MKQ A;  3C98 A;  2A5U A;  3LY9 A;  4GU5 A;  3Q49 B;  4I9C A;  3R7Q A;  2JLB A;  2L9B A;  5FJY A;  4UQX A;  5FWQ A;  4KT6 B;  3QAR A;  1FCH A;  3NF1 A;  2BUG A;  2DBA A;  5ARF A;  5LP0 A;  2UY1 B;  4U0Z A;  4CCA A;  1NA0 A;  5J90 A;  4I2Z A;  3D9L A;  2J4B A;  2R5S A;  3NQP A;  5JJT A;  4NAC A;  4BT8 A;  1Z3Y A;  4I1A A;  3P1U A;  1JPL A;  4MLP A;  4CEM A;  1HF8 A;  1XNF A;  3ZRH A;  4H7X A;  3I4G A;  3PE3 A;  4K03 A;  4XI0 A;  2L0T B;  1OWN A;  2XCB A;  3D9P A;  4AEZ C;  4DI3 A;  4BWR A;  3ZN3 A;  3CVX A;  3SGH A;  4N3A A;  1E8Y A;  4DLQ A;  4WND A;  3ZVV A;  4WAF A;  1E7U A;  2L6J A;  3PNL B;  3BG0 B;  3LY7 A;  4HVB A;  2IOS A;  4QFV A;  5T4Y A;  5BV0 A;  3T5X A;  3CK7 A;  4UWH A;  1XGW A;  4EBA A;  3FUL A;  1TJC A;  3RJV A;  2LAH A;  1E8X A;  3FUM A;  4ANW A;  5JHA A;  4EBA G;  3QWW A;  3QNK A;  2OND A;  3S7D A;  4APO A;  4B89 A;  1OWO A;  3FH7 A;  4I9E A;  3RRN B;  3FHE A;  3RRM B;  3R7R A;  3FUK A;  3RO3 A;  2AW6 A;  4GYO A;  4A1G A;  2XGO A;  1BPO A;  2KC7 A;  2X6K A;  3OXF A;  4O6F A;  3GYZ A;  1ELK A;  3HVE B;  2Y4T A;  3QJZ A;  3KEZ A;  4J8S A;  5BPP A;  2WXG A;  3AS4 A;  3U3W A;  2XHE A;  4JA9 A;  5D0O D;  4DPR A;  3R9A B;  2NC9 A;  4KXK B;  4OVU A;  4EZK A;  1QNF A;  2NXP A;  3UUX A;  1N54 A;  2V0P A;  2FI7 A;  1E96 B;  4UI9 K;  3CVV A;  3FDH A;  3SBT B;  3L54 A;  4GCN A;  2Q7F A;  3D9I A;  4APF A;  4KBQ A;  4AY6 A;  3LXU X;  4JA7 A;  4ME2 A;  2OOE A;  2X6J A;  3QOU A;  3Q15 A;  3VLE A;  3T5V A;  1SZA A;  1KT0 A;  3CVN A;  1IQU A;  4G25 A;  4M3O A;  4UWF A;  4N2Q A;  3FUH A;  3TXN A;  3B7U X;  3L08 A;  3EJN A;  5BNW A;  3GW4 A;  2CG2 A;  2LAI A;  1WM5 A;  2IU1 A;  3T8M A;  3QC1 A;  1UG3 A;  4GZD A;  5DBK A;  4AM9 A;  3FUD A;  4KVO A;  4V3I A;  4NUR A;  4BTA A;  3FH5 A;  3D9N A;  1B89 A;  5AYW D;  4BY6 A;  1EF1 C;  4GZC A;  4RG9 A;  5E75 A;  3ZHE B;  3AU5 A;  3IEG A;  2I1J A;  3PRE A;  3IKO B;  3DPD A;  4YVO A;  3VTX A;  3U66 A;  4GA1 A;  1SQM A;  2XPY A;  3ZEF A;  4CT4 A;  3TJP A;  3JCK C;  1UN8 A;  5T8I A;  4C9B B;  1EPU A;  2C0L A;  3MCX A;  4Q69 A;  4BFR A;  4N5C A;  4HOQ A;  5ANL A;  4ANU A;  5E76 A;  3S7J A;  5FQ6 A;  2DCP A;  3CVQ A;  5JJ6 A;  3NZU A;  4I6E A;  3ASD A;  3CLJ A;  4FJZ A;  5EDS A;  2OVB A;  4U07 A;  3N71 A;  4FUL A;  2V4L A;  3PDN A;  4Q96 A;  4Y6W A;  3QKY A;  1JWG A;  4FLH A;  3QAQ A;  3ML8 A;  5BUZ A;  3G2W A;  3LS8 A;  3PRZ A;  2XRY A;  3HHM A;  2M63 A;  2WMN A;  4W9R A;  1PY1 A;  4RVB A;  4J0U A;  4B94 A;  3LPZ A;  1H6K A;  1E8W A;  2PQR A;  3APC A;  5LOZ A;  3PEU B;  3SBS A;  1H2T C;  1PAQ A;  3L16 A;  4ACK A;  5FZQ A;  1JWF A;  1HZ4 A;  1U3D A;  1DNP A;  3ONL A;  4WUY A;  3ZW3 A;  3CVY A;  3G2V A;  5LX8 A;  3VTY A;  4IN3 B;  5LCW C;  3RO2 A;  4WWN A;  3PVL A;  3LVQ E;  4UWK A;  1TEZ A;  2WVI A;  2CFZ A;  2XGS A;  2P58 C;  4HFG A;  4L1B A;  5FZR A;  4HS2 A;  4WWP A;  5C1D A;  4XZ4 A;  4XI9 A;  3SNX A;  4WWO A;  1HXI A;  4I2W A;  4OYS A;  4PDX A;  5A6C A;  1OWP A;  2PQN A;  4LER A;  4B8A A;  4F53 A;  1OUV A;  1UJK A;  3QB2 A;  2OV8 A;  3FU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...