3EIQC

Crystal structure of pdcd4-eif4a
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
278
Chain Sequence
b'ETAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKDCVQARAALDKATVLLSMVWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic initiation factor 4A-I
publication title Structural basis for translational inhibition by the tumour suppressor Pdcd4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/antitumor protein
total genus 93
structure length 278
sequence length 290
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eiqC02
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eiqC01
2IU1A 3FEYA 3FEXA 4GMJA 3L6AA 2KZTB 4CT4A 2KZTA 4B8AA 4LUNU 1H2VC 5ANRA 1H2TC 3EIQC 2HM8A 3EIJA 4JHJA 4IULA 4B89A 2VSXE 2I2OA 1N54A 2RG8A 3D3MA 1N52A 1PAQA 4CRWA 4GMLA 2IONA 4JHKA 3JUIA 2IOLA 2ZU6B 1UW4B 1HU3A 1UG3A 3RK6A 4C9BB 1H2UA 2IOSA 2NSZA 4CEMA 2FULA 2GGFA 1H6KA 4B8CB 2VSOE
chains in the Genus database with same CATH superfamily
3NB2A 4LNGA 4OYSA 4QFVA 2WB2A 5BUZA 3HIZA 3UKRG 3AS5A 3UT8A 2YQ8A 2PZIA 3CQGB 4HORA 5EDSA 1TNBA 3P1UA 4JB8P 5ENPD 3QWPA 4WNEA 2CG3A 3C98A 3PNLB 2H6GA 1Y8MA 4IULA 3LEWA 3MGBA 4BSZB 2KCLA 3UIPC 2XZDG 3SGHA 5KJMA 1IQUA 3DSWA 3TG5A 4O60A 2DZNA 2FO1E 2BUGA 4L1BA 3VLDA 1Z6TA 1HE8A 5HS0A 3FTYA 2GRPB 1SZ9A 2XCBA 1IHGA 3UPVA 3PUJA 1BU9A 1DC2A 4GZCA 3L82A 1UJJA 4AXHA 3MKQA 4GPMA 1KT1A 4N5CA 5A6CA 1HX8A 1OY3D 3ABKE 3DEOA 3SY2A 3V31A 3LY9A 4GTMA 4PS7A 4BETA 4V3IA 1MHQA 4MLPA 4DX5D 2YNQA 3IEGA 2FBNA 1N0QA 3FUHA 4KZ0A 1O1TA 5M72A 5KCMA 5JHAA 1UN8A 2XQ0A 3CLJA 2WXJA 3LVRE 4HOTA 2GGFA 3BU8A 4Q69A 4KVOA 4M3OA 4BT9A 3V2XA 5G05J 5KJLA 1KT0A 2OCCE 5AJDA 5FQ7A 3PZDA 3PE3A 3JUIA 5JJ7A 2ZXWE 3AU5A 4EBAA 2EIKE 2PL2A 3Q78A 1YCSB 3CVNA 3NOCD 4GMJA 1UOHA 1QBQA 5KWDA 2PQNA 3TWRA 4IRUA 4UI9K 3B7UX 4GTRA 3G2UA 4F3VA 2F8YA 2CHXA 5EYPF 1XNFA 1U2VG 3U3WA 5AYWD 2J4DA 3JCKC 3R7RA 2X6HA 4KZCA 3FU3A 1E7UA 1JCQA 3UM2A 3U66A 4ME2A 1N9AA 3GZSA 3E37A 1OXJA 1N4PA 3FWVA 1TN8A 4E85A 1NFIE 1OWOA 4WUYA 2CG2A 4X8QA 3CQCB 2DZOA 1L5JA 4KVMA 5ENOD 3EUVA 2RD0A 5FT9A 4PS8A 4YDWA 1E96B 2YINA 2XS8A 3LVQE 3UQ3A 2DYSE 4GMLA 3OAWA 5KBAA 1V55E 4C0MA 3IHVA 1JWFA 2LSVA 2NYJA 3ABME 4RSYA 4ATZD 3BG0B 3SFYA 2EQXA 1MX4A 4I9CA 3O48A 4RG9A 3T8KA 1HG5A 3WXXA 3HXBA 2OVBA 1BLXB 3PEVB 1UG3A 1PY1A 4LNBA 1DCEA 1S64A 3SFXA 4HVBA 3LJNA 4NACA 2HO1A 1MX2A 3RIBA 3G2VA 1EPUA 4DX1A 3AG1E 1RZ4A 4JHJA 1HZ4A 2HE0A 2UY1B 3ASHA 2ILRA 2WVIA 3D9NA 2LAHA 3CR3A 1ELWA 1JCRA 1LF8A 3QKYA 2AVPA 1N11A 3ZW3A 4JEUA 3DSVA 5A7DB 1H0AA 5FZSA 5CBOA 5ENSD 5C1DA 3ULQA 4N39A 3CVWA 4YDOA 1QQEA 4DLOA 4AJWA 4HRNA 3CV0A 4TRQA 4A63B 3RRMB 3HYMB 4CT4A 3Q79A 5CECB 2H6IA 2I1JA 5H7PA 4CZ2D 4XE0A 3L22A 3OXFA 4L23A 5HI7A 1K1BA 2R05A 4JHKA 3B7SA 1OWNA 3ZIMA 1HFAA 3J5PA 3FUKA 3R7QA 2VSOE 5CMWA 1Z3XA 4HB5A 1X81A 3UM3A 5E75A 4UWFA 2WXMA 4U0ZA 4EZKA 5CRUA 3AS8A 4UQZA 1EYHA 3U9WA 3CSTA 1IKND 3QWWA 2NSZA 4ANXA 4KBQA 2KCVA 3TG4A 4GAAA 4L2YA 3QJZA 3HDXA 2J9QA 4B94A 1Z5SC 1TNYA 4J8SA 2MOWA 1TJFA 1N52A 3CKCA 3PZ3A 3ML9A 3EHRA 4EECA 3V30A 1ZU2A 3E30A 3WG7E 4TXPA 3G2SA 1W3BA 4JL0A 1QZ2A 3U4TA 4MBGA 4CYMD 4B8AA 2CFUA 3TWVA 4DJAA 2WXRA 2V4LA 4U96D 5B3SE 1OUVA 3LS8A 3I4RB 2HR2A 1N4QA 5FQ4A 2QYUA 3ZEFA 3BQOA 4FADA 3FH8A 4ILGA 3KSLA 4KXKB 1MZCA 3UT7A 4HOUA 1LD7A 2VSXE 2E0IA 2L6JA 4GTTA 4I43A 4F6RD 4ILIA 2ZGDA 4LG6A 4HLEA 1TJCA 4Q96A 4G1TA 4HQDA 4ZFHA 5LP0A 3NZUA 3L9TA 4OAVB 2V0PA 3D9PA 4UWKA 1KLXA 5J90A 3FU5A 2WXQA 2XEEA 4Z68A 1AWCB 2J08A 3RSEG 4B0ZA 5JJ6A 2Y1LE 4U7EB 4CCAA 4RLYA 2EIJE 2AW6A 5AIJA 3OXLA 2GRRB 2XRYA 4XZ4A 4BSXA 4FA6A 3MCXA 4G25A 4LRZA 4AP2A 3MKQB 3TJPA 3FTVA 3MA5A 3JQ0A 1JCSA 4P29A 1Y6IA 4I2WA 5ENNA 1O1RA 1H2VC 3OXGA 3UINC 1LTXA 5B1BE 3URZA 5CHEE 4G8KA 5G55A 3ZYKA 2L9BA 3TGOA 3UT4A 5ANLA 2Y3AA 4O6FA 3ZRHA 3DXKG 4ATGA 5G04C 3LDZA 3D9OA 4C0EA 1JPLA 4GYOA 3JXJA 3QARA 1MJ0A 2XGSA 3VTXA 4GTSA 2LO6A 3FTWA 4NQ0A 3ENEA 2ZIRA 4AM9A 3CGHA 2FULA 4J0UA 2RFMA 3ZHEA 3RRUA 1UN9A 1OCZE 3TWXA 4XEIG 3CVVA 5LCWC 2HM8A 3VLEA 2I9CA 3ZNGA 1IHBA 3TL5A 4BX8A 3F6QA 1JUQA 4APFA 4AY6A 2Y69E 4GZ3A 2CFZA 3AJIA 4BX9A 3KAEA 2KZTB 5FJYA 2V5FA 1A5EA 2ETAA 5AQ7A 3B7RL 4LCTA 5FINA 4L7TA 3FH7A 4DPRA 3UX4A 1SA5A 5CEAA 2IQCA 3R9MA 4RVBA 2GW1A 2BKGA 1E8YA 1ELRA 3ASNE 3SBTB 5JHBA 5DBKA 4XX5A 4J8DA 3ABLE 3FUIA 2QZAA 2LAIA 3ASOE 3C3QA 3ULYA 1SW6A 4BT8A 2IOSA 3KEAA 4B8CB 4G11A 4DX7D 4APOA 5ITZF 5CCLA 3MZLB 3FUMA 1FVHA 4YDEA 5JJTA 2JLBA 2ZISA 2WQ6A 3UI2A 3UIOC 4EPZA 1HXIA 3FUFA 3B13A 3FTSA 3FHEA 3B7TA 4M7CA 2IY0C 4UWGA 3NZSA 4FLHA 3D9IA 1P5QA 4G26A 3QAQA 2QYJA 4G24A 2UWJG 2J09A 3RU0A 4WNDA 3LYAA 3AG4E 2A4ZA 3RO3A 4J6IA 4HRMB 2HYZA 1E90A 2VGXA 1YYHA 4RG6A 3Q9NC 4U63A 4O1PA 5BV1A 5IY5E 2F37A 5EKQD 3Q4AB 2Y4TA 3I4GA 3Q7FA 3QDNA 4TXRA 4EZLA 3GW4A 2WQ7A 2XRZA 3DPYA 4BWRA 4C48B 3B95A 4UUCA 3L16A 4G8LA 2C0LA 5FTPA 2YHEA 4OAUC 1H6OA 2GROB 3RKVA 2WM9A 3KS2A 4JA7A 1YA0A 1E8WA 4I9EA 1WY6A 3D9KA 4I1MA 2R2LA 4H7XA 1V54E 4CGWA 4U8VD 3FU0A 3MX3A 4FULA 4G2VA 4U0SA 1X5BA 3TWUA 3JUEA 2R02A 5AN8A 3QWVA 4GB9A 2XEHA 1OT8A 4GZ5A 2QY7A 2B0OE 2DYRE 5AJLA 4PH4B 4KMOA 4W9RA 3PH0C 3PNTB 4C9BB 3Q73A 2IU1A 1E7VA 2IF4A 2Q7FA 3VTYA 4BTAA 3BG1B 2XENA 2CHZA 4DI4A 2OEVA 1YMPA 1WM5A 2WXHA 1NA0A 5T4YA 3PZ4A 5FIOA 4ZHBA 5FQ6A 3PS6A 4AY5A 3ZKJA 3FDHA 1GW6A 3CHQA 4N3AA 5FZRA 3EHMA 4D10C 5D0OD 3AG3E 3TXNA 2DWZA 4K5BA 3T8MA 4ACLA 4FJYA 1VDYA 3D9HA 3DXMG 2R03A 4NIKA 4AEZC 1DNPA 3APCA 5HQ8A 2AXVA 2VQ2A 3EJNA 3AAAC 4K5CA 4I2ZA 1K8KG 2P9UG 3E32A 3FTXA 4CRWA 2AXZA 2J4BA 3DSTA 4LSZE 1D8DA 4TUUA 2M63A 1HF8A 3ESLA 5B1AE 3DSXA 3C3RA 3S7BA 2RKKA 4GA2A 1S0PA 2X6KA 3DEPA 4YDYA 1HH8A 3L08A 3IBEA 3ZYQA 3FEXA 2C2LA 3ZYMA 1H19A 1HO8A 3ASDA 5D66A 3IHYA 3DSUA 3CVQA 5A23A 4IN3B 4ABNA 2YHCA 3DWLG 3FTUA 4HRLA 1E8XA 2BTDA 5LOZA 4AIFA 5ENQD 3SI5A 4HS2A 5HKPA 4HBDA 3E34A 2RFAA 3D9JA 4WWPA 1D9SA 2WXLA 2NC9A 3UKUG 3NBNB 2XPYA 4I1OB 3MJWA 4B93B 2A5EA 3HXDA 2XCCA 4CDMA 3MV2B 3I3NA 1QYMA 3P2BA 3PRZA 2EIME 3TWQA 2L6BA 3FUEA 3L54A 2XHEA 2IO2C 3ZYLA 4ANVA 3E4BA 2B6CA 1TNUA 4JXTA 1N94A 1TR4A 3PREA 2VSYA 2LSUA 5J08A 4UI9J 3CSFA 3PZ1A 4YNDA 3JYSA 3FFLA 4HOQA 3BEEA 2WXIA 1O1SA 1N4RA 2I1KA 2I6HA 3CHMA 3QC1A 2MHKA 2P58C 3Q7AA 1NZNA 2Y4UA 2P9IG 3QB2A 4NURA 2X6IA 3SBSA 2BF0X 2OV8A 4UQXA 2LNIA 2A5UA 2MRIA 5JA4D 3ZFWA 3SD5A 2OVFA 3ISMC 5JMND 5CRVA 4LUNU 4H7YA 1KPSB 2J49A 2V8SE 3TWTA 3L13A 4HFGA 4AV7A 5C2YA 3GZ2A 3LY7A 1H6PA 1OCCE 3PE4A 2GRNB 2IJGX 3MYVA 4GTOA 4PDXA 3APDA 4BY6A 1FPPA 4Y6WA 3LJ3A 3T5VA 2VSNA 3D9MA 5BT1A 3ZPJA 4WWOA 2XPIA 3EHNA 1TN6A 4XKCA 3ZXSA 1G3NB 2ZGGA 3UM0A 2WXKA 2VTBA 3X2QE 4JA9A 3NOGD 5AARA 4B89A 4LNUD 1NP7A 2P9SG 1KZPA 4MS6A 5G2NA 3QK0A 4WAFA 3Q49B 5FZQA 4U04A 3C5RA 3SQVA 1U3CA 2AXUA 3CK8A 4BERA 3ASFA 4FLBA 2F0YA 1H2TC 1TN7A 2GRLA 3V79K 3HXCA 5EX3A 1BI8B 4F1PA 3ZN3A 2VGXB 3B7BA 3CIAA 2ETCA 1H2UA 2PQRA 4A3VA 2QC9A 3L6AA 3QOUA 3FUJA 1EDUA 4I17A 2DBAA 4UQYA 5EIDA 3PUKA 3MKRA 2FO7A 1H6KA 1DVPA 2WXFA 5ARGA 2KXPC 4ANUA 3HRAA 4K0RA 3K9IA 4QQIA 4RQIA 1ZBPA 3KEZA 1LD8A 4CGVA 2QFCA 4GTQA 3ESKA 2WMOA 1UW4B 2P9NG 3Q5MA 4ACKA 2E2EA 4XI0A 4Y6CA 3CVXA 3KD7A 4JZYA 4AOFA 3L17A 3CVYA 4N2SA 4G23A 2KBXA 1HG2A 5BXUA 3LY8A 1TYQG 2CHWA 3UTMA 4PS3A 1FT2A 3OTNA 2WXNA 2XS1A 3ONLA 4I1AA 1A17A 5AQBA 1AP7A 3CK9A 2FF4A 1BPOA 4J7WA 4JD2G 3CVPA 2JEKA 3FP3A 4DUIA 3SFZA 5ENTD 3AG2E 1N4SA 1N0RA 3EHQA 4GTVA 1JWGA 4JW1A 4JEHA 4I6JA 2OEWA 5BNWA 2DCPA 4GTPA 3S7DA 2P9PG 4GA0A 2V5QC 3PDNA 1INZA 1ZB1A 4LERA 2WXOA 2F8XK 4J8YA 1OWMA 3UM1A 5T3RA 5KJNA 4AVXA 4ILHB 1K3ZD 3RAUA 4U8HA 3DRAA 3HVEA 5BW8C 3FULA 4PUCA 3MEKA 4TUMA 4GCNA 2P9KG 3S7FA 3ML8A 1MQSA 4OVVA 4F7AA 3BUAA 2C0MA 4HI8A 2VGYA 3IXEA 2KC7A 1NA3A 2PNNA 3T5XA 2V4HC 3SZ7A 3FH5A 3CHPA 4HI9A 3EU9A 4DK5A 2FEZA 3N71A 1RW2A 4GYYA 4UWHA 2IO3C 3DPDA 4A1GA 3ZVVA 3CHOA 3ZU7B 1HU3A 5EILA 5CBNA 1E8ZA 2Y0BG 2KZTA 4JHRA 5AAOA 3CHSA 3ZUVB 1WAO1 3NF1A 3ZGQA 4HXIA 2ZU6B 4DI3A 3HXFA 2ETBA 4DX6D 2FI7A 3FTZA 5EIBE 1OCRE 2XGOA 4HOSA 5D2MC 3HXEA 3RRNB 1Q2ZA 2X6FA 2ONDA 3LCAA 4YVOA 3G2TA 4GA1A 4IYPA 1WG0A 4WNGA 3VLFA 3FUNA 1XGWA 3I5PA 4TXQA 2EILE 4TV3A 4CT0A 3Q9UC 3Q75A 1KZOA 2JABA 3MV3B 3IV0A 4FHJA 5HRYA 4U95D 1IQRA 3LPZA 1PAQA 2WMNA 5EN5D 5G05C 3E33A 2AJAA 3SNXA 2VJ8A 4L2LA 2EINE 2L0IA 4GZDA 5DIZA 5BPPA 3R9AB 2IEJA 4DRXE 4UWLA 4FHKA 3FU6A 5FWQA 3ASGA 2MYOA 4BTBA 4K5AB 4KYOB 3TWWA 3ZXPA 4ANWA 5KJKA 1BD8A 3ONKA 3C3OA 4Q94A 2GRMA 4XI9A 3SHFA 3UXGA 2WXPA 4XKBA 4WNFA 3AU4A 1HS6A 2BEDA 4L9PA 4BFRA 3PEUB 5EYLA 4DLQA 5AQAA 2LUHA 4N2QA 2GRQB 4CDRA 3Q15A 4LEUA 3CVLA 3AS4A 2PM7A 1NI1A 4FC8A 3HHMA 1S70B 3PVLA 1TEZA 3PZ2A 4FP7A 4GZ6A 1WDYA 4EBAG 4KT6B 2IOLA 3APFA 2OOEA 3NAWA 4I6GA 2R5SA 3G2WA 1B89A 3EU5A 2WXGA 2DVWA 3CEQA 3DBSA 3O4ZA 2LXMA 2P9LG 5BV0A 2L0TB 3IKOB 4URKA 2RG8A 4N5QA 4A55A 4R7LA 5CERB 3D9LA 4A3TA 1FVFA 2VTBB 4F53A 3V2OA 3FY4A 1SVXA 4EHMA 4XIFA 3EIQC 1IYGA 4MRUA 1EF1C 2BKKB 5CEDB 4I6EA 1N54A 2XEVA 4GCOA 4J8EA 3HG0D 5AQ9A 3RK6A 3EDTB 3CKBA 4O1OA 3RO2A 3CVUA 4GPKA 5ANRA 1FCHA 1S63A 5CCMA 5ARFA 2PM6A 2KATA 2VYIA 1DCQA 5BXOA 1Z3YA 1ELKA 3Q47B 5E76A 1BI7B 2XGMA 3ZHEB 2J07A 3NQPA 3DSSA 2J8SD 2X6JA 5T8IA 2DIWA 4U07A 5G04J 3JQ1A 4GYWA 2UY1A 3TAXA 2AWIA 3SF4A 2VGEA 1TNOA 4EQFA 1SA4A 4F1SA 3GZ1A 3JXIA 1O5MA 4N3CA 5KNHD 2WPVA 4NRHB 3FUDA 3SO8A 2X38A 4FU3A 4WWNA 2R59A 1TNZA 2I2OA 1N95A 3UUXA 2NXPA 3S7JA 2H6FA 1MX6A 5LCWJ 3LKUA 3ULEG 4HLLA 2R17C 3FEYA 5EX0A 3U64A 5AENA 2IFUA 2LXLA 5LX8A 1OWPA 5KNGA 4HNAD 4DX2A 4U8YD 3CHRA 1U3DA 3TXMA 5LFAA 1MYOA 3LXUX 4U0UA 4OVUA 4GU5A 2P2CP 4K03A 1OCOE 2KCKA 1D8EA 2X3MA 4EZJA 1NL4A 4E6HA 4JVSA 2XPZA 4UI9C 3W9FA 3J5QB 1IXVA 2XZTG 3C72A 4MKTA 4A1SA 5CMYA 4CDNA 3CK7A 3W9GA 3S2AA 4BEPA 4GMRA 4J8FA 2KM4A 5D0QD 3D3MA 1K1AA 3HVEB 2IONA 1SZAA 4JC8A 3TWSA 4CEMA 1OWLA 4FJZA 3T9KA 3QNKA 1QNFA 4BESA 1SQMA 4JPSA 1FT1A 5ENRD 4N3BA 3GYZA 3EIJA 4YVQC 2WQHA 3RJVA 2H6HA 3UMVA 5FQ8A 3KSQA 1UJKA 1PC2A
chains in the Genus database with same CATH topology
3FH5A 4ILGA 4OYSA 4TUUA 2M63A 4QFVA 3CHPA 4KXKB 3UT7A 4DK5A 1HF8A 2WB2A 3ESLA 4HOUA 2FEZA 5BUZA 3N71A 2VSXE 3S7BA 2E0IA 2L6JA 4GYYA 4GA2A 3HIZA 4UWHA 1S0PA 3DPDA 4A1GA 3AS5A 2X6KA 3ZVVA 3CHOA 4I43A 3UT8A 4ILIA 2YQ8A 2PZIA 1HU3A 3CQGB 4HLEA 1TJCA 4Q96A 1HH8A 1E8ZA 3L08A 3IBEA 4HORA 4G1TA 5EDSA 3P1UA 3ZYQA 3FEXA 5LP0A 2C2LA 3NZUA 3ZYMA 3QWPA 1H19A 2CG3A 4WNEA 1HO8A 2KZTA 3ASDA 2V0PA 3C98A 3PNLB 3D9PA 4JHRA 4UWKA 1KLXA 1Y8MA 4IULA 3CHSA 5J90A 3FU5A 3IHYA 1WAO1 2WXQA 3CVQA 3LEWA 3MGBA 3NF1A 3ZGQA 5A23A 4IN3B 2KCLA 4ABNA 3SGHA 2YHCA 3FTUA 4HXIA 2ZU6B 5KJMA 1IQUA 1E8XA 4DI3A 2J08A 2BTDA 2FI7A 3FTZA 5LOZA 4AIFA 3SI5A 4HS2A 3TG5A 4B0ZA 5JJ6A 2XGOA 4CCAA 4HOSA 2AW6A 3D9JA 5AIJA 2BUGA 4WWPA 3OXLA 2WXLA 3RRNB 4L1BA 2X6FA 3VLDA 2ONDA 1Z6TA 1HE8A 2XRYA 4XZ4A 4BSXA 4FA6A 3FTYA 3LCAA 2NC9A 3MCXA 4YVOA 4G25A 1SZ9A 2XCBA 3G2TA 4GA1A 1IHGA 4IYPA 2XPYA 3UPVA 3PUJA 4I1OB 4LRZA 4WNGA 3MJWA 4AP2A 3VLFA 4GZCA 3MKQB 3FUNA 1UJJA 1XGWA 3TJPA 4AXHA 2XCCA 3FTVA 3I5PA 3MKQA 3MA5A 4CDMA 3JQ0A 4P29A 3MV2B 1Y6IA 3I3NA 4I2WA 5ENNA 1KT1A 4TV3A 3P2BA 4CT0A 3PRZA 1H2VC 4N5CA 5A6CA 1HX8A 3MV3B 3FUEA 3IV0A 3L54A 3OXGA 4FHJA 2XHEA 3URZA 5CHEE 1IQRA 3LPZA 1PAQA 5G55A 2WMNA 3ZYLA 4ANVA 3ZYKA 2L9BA 3E4BA 3LY9A 3TGOA 4JXTA 4PS7A 5G05C 3UT4A 5ANLA 2Y3AA 3SNXA 3PREA 4V3IA 2VJ8A 4O6FA 1MHQA 4L2LA 3ZRHA 2VSYA 4ATGA 2L0IA 4MLPA 5G04C 2YNQA 3IEGA 2FBNA 3LDZA 4GZDA 5DIZA 2LSUA 3D9OA 4UI9J 4C0EA 5J08A 3CSFA 1JPLA 3FUHA 4GYOA 3R9AB 4KZ0A 5BPPA 4YNDA 5M72A 3QARA 2XGSA 5KCMA 3VTXA 5JHAA 2LO6A 3JYSA 4UWLA 4FHKA 1UN8A 3FFLA 2XQ0A 3FU6A 3CLJA 4HOQA 3FTWA 4NQ0A 3ASGA 2WXJA 5FWQA 3ENEA 3LVRE 4BTBA 3BEEA 2WXIA 4AM9A 3CGHA 4HOTA 4KYOB 2FULA 4J0UA 2GGFA 4ANWA 4Q69A 5KJKA 4KVOA 3ZHEA 4M3OA 3RRUA 1UN9A 2I1KA 2I6HA 3ONKA 4BT9A 4Q94A 3CHMA 2GRMA 3QC1A 4XI9A 3SHFA 2MHKA 3CVVA 5G05J 2P58C 5LCWC 5KJLA 2WXPA 4XKBA 2HM8A 1KT0A 1NZNA 3AU4A 4WNFA 1HS6A 3VLEA 2I9CA 2Y4UA 4BFRA 3TL5A 4BX8A 3PEUB 5AJDA 5FQ7A 3QB2A 4NURA 2X6IA 3SBSA 3PZDA 3PE3A 1JUQA 2BF0X 2OV8A 3JUIA 4UQXA 4DLQA 4APFA 5JJ7A 4N2QA 3AU5A 2LNIA 4EBAA 2A5UA 4CDRA 4AY6A 2MRIA 3Q15A 2PL2A 2CFZA 4GZ3A 3ZFWA 4BX9A 4LEUA 3KAEA 3CVLA 3SD5A 2OVFA 3AS4A 3CVNA 4GMJA 2KZTB 2PM7A 5FJYA 2PQNA 4FC8A 4LUNU 4H7YA 2J49A 2V5FA 2V8SE 4IRUA 4UI9K 3HHMA 3B7UX 3PVLA 3G2UA 3L13A 1TEZA 4F3VA 4HFGA 4FP7A 3B7RL 4LCTA 4AV7A 4GZ6A 5C2YA 4L7TA 3FH7A 4KT6B 4DPRA 2CHXA 4EBAG 3UX4A 3GZ2A 2IOLA 3LY7A 3APFA 1XNFA 3U3WA 3PE4A 5AYWD 2IJGX 2IQCA 2J4DA 2OOEA 3JCKC 3MYVA 4RVBA 4PDXA 3APDA 4I6GA 4BY6A 2R5SA 3G2WA 2GW1A 3R7RA 2X6HA 4KZCA 1B89A 1ELRA 1E8YA 3FU3A 4Y6WA 3LJ3A 3SBTB 5JHBA 5DBKA 4XX5A 2WXGA 1E7UA 3T5VA 4J8DA 3FUIA 2VSNA 3CEQA 3D9MA 3DBSA 3O4ZA 5BT1A 2LAIA 5BV0A 3U66A 2L0TB 4ME2A 3IKOB 4URKA 3ZPJA 2RG8A 4WWOA 3GZSA 2XPIA 3EHNA 4XKCA 4BT8A 4A55A 3ZXSA 4R7LA 3FWVA 3D9LA 4E85A 4A3TA 2IOSA 1FVFA 4B8CB 1OWOA 4F53A 4WUYA 2CG2A 4G11A 2VTBB 3FY4A 4APOA 2WXKA 2VTBA 3CQCB 1L5JA 4KVMA 5CCLA 2RD0A 3MZLB 3FUMA 4JA9A 1FVHA 4XIFA 5FT9A 2JLBA 4PS8A 5JJTA 3EIQC 1E96B 1IYGA 4MRUA 1EF1C 4B89A 2WQ6A 2YINA 4I6EA 1N54A 3LVQE 3UQ3A 1NP7A 2XEVA 4GCOA 4MS6A 5G2NA 4J8EA 4EPZA 1HXIA 4GMLA 3FUFA 3QK0A 3B13A 4WAFA 3FTSA 3OAWA 3Q49B 3FHEA 3B7TA 5FZQA 4U04A 3RK6A 1U3CA 2AXUA 3CK8A 4C0MA 4UWGA 3NZSA 4FLHA 3EDTB 3D9IA 1P5QA 3ASFA 4G26A 3CKBA 3IHVA 3RO2A 3CVUA 3QAQA 1JWFA 2LSVA 4FLBA 4G24A 4GPKA 5ANRA 1FCHA 1H2TC 2UWJG 4RSYA 2GRLA 3BG0B 2EQXA 5CCMA 2J09A 2PM6A 5ARFA 4WNDA 3RU0A 3LYAA 5EX3A 2A4ZA 3RO3A 4I9CA 3O48A 4RG9A 3ZN3A 1HG5A 2KATA 4J6IA 2VGXB 2HYZA 2VYIA 2OVBA 3PEVB 3WXXA 3CIAA 1E90A 2VGXA 1Z3YA 1ELKA 3Q47B 1UG3A 5E76A 1PY1A 4RG6A 2XGMA 1H2UA 4U63A 2PQRA 4HVBA 3ZHEB 2J07A 4A3VA 4NACA 3NQPA 5BV1A 2HO1A 3L6AA 3QOUA 3FUJA 5EKQD 3Q4AB 2Y4TA 3I4GA 2X6JA 3RIBA 3G2VA 3QDNA 1EDUA 1EPUA 4JHJA 5T8IA 4EZLA 1HZ4A 3GW4A 4I17A 2WQ7A 2DBAA 2UY1B 2DIWA 4U07A 5G04J 3JQ1A 4UQYA 4GYWA 2UY1A 3TAXA 2XRZA 2AWIA 3ASHA 3SF4A 2ILRA 2WVIA 3PUKA 3D9NA 4BWRA 2LAHA 4EQFA 3CR3A 3MKRA 4F1SA 3L16A 3GZ1A 2FO7A 2C0LA 1H6KA 1ELWA 5FTPA 1DVPA 4N3CA 2YHEA 2WXFA 5ARGA 2WPVA 4NRHB 3FUDA 3RKVA 2X38A 4ANUA 4FU3A 4WWNA 2WM9A 4K0RA 3K9IA 3KS2A 1LF8A 2R59A 3QKYA 4JA7A 1YA0A 1E8WA 1ZBPA 4I9EA 2AVPA 3KEZA 2I2OA 3ZW3A 4CGVA 1WY6A 3D9KA 4I1MA 4JEUA 5A7DB 3UUXA 1H0AA 2NXPA 2QFCA 3S7JA 5FZSA 4H7XA 4CGWA 5C1DA 3ULQA 3ESKA 5LCWJ 2WMOA 3LKUA 4N39A 1UW4B 3FU0A 3CVWA 3MX3A 4FULA 1QQEA 4DLOA 3Q5MA 4G2VA 4U0SA 4ACKA 2E2EA 4AJWA 4XI0A 4Y6CA 1X5BA 3CVXA 3KD7A 4JZYA 2R17C 3FEYA 5EX0A 3CV0A 3U64A 4AOFA 5AENA 2IFUA 4TRQA 3L17A 3RRMB 3HYMB 3QWVA 4GB9A 4CT4A 5LX8A 1OWPA 3CVYA 2I1JA 4GZ5A 4N2SA 2QY7A 4XE0A 4G23A 3L22A 1HG2A 3OXFA 4L23A 5HI7A 5AJLA 4PH4B 4KMOA 4W9RA 3LY8A 3PH0C 3B7SA 1OWNA 2CHWA 3PNTB 4JHKA 4PS3A 3ZIMA 1HFAA 3CHRA 3OTNA 1U3DA 4C9BB 3TXMA 5LFAA 2WXNA 3ONLA 3FUKA 4I1AA 1A17A 3R7QA 2VSOE 2IU1A 5CMWA 1E7VA 1Z3XA 3LXUX 3CK9A 2FF4A 1BPOA 5E75A 4U0UA 2IF4A 4UWFA 2Q7FA 2WXMA 4OVUA 4U0ZA 4EZKA 4GU5A 3CVPA 2JEKA 3FP3A 3VTYA 4BTAA 3AS8A 3BG1B 4K03A 3SFZA 2KCKA 2X3MA 2CHZA 4DI4A 4UQZA 1EYHA 4EZJA 4E6HA 4JVSA 3U9WA 2XPZA 4UI9C 3CSTA 1JWGA 1WM5A 2WXHA 2NSZA 1NA0A 3QWWA 4JEHA 4JW1A 5T4YA 4I6JA 4ANXA 5BNWA 4KBQA 2DCPA 5FQ6A 2KCVA 3PS6A 3TG4A 4AY5A 3S7DA 4GAAA 4MKTA 4A1SA 4GA0A 5CMYA 4L2YA 4CDNA 3QJZA 3FDHA 3PDNA 1GW6A 2J9QA 3HDXA 3CK7A 4B94A 1INZA 3CHQA 4J8SA 2MOWA 4LERA 2WXOA 4N3AA 5FZRA 3S2AA 1OWMA 1TJFA 3EHMA 4J8FA 4D10C 2KM4A 5D0QD 5D0OD 3D3MA 5T3RA 5KJNA 1N52A 3CKCA 4AVXA 3TXNA 4ILHB 3HVEB 3ML9A 4U8HA 2IONA 3HVEA 3T8MA 4ACLA 5BW8C 4EECA 4FJYA 3FULA 1SZAA 4JC8A 1ZU2A 4PUCA 3MEKA 4CEMA 1VDYA 1OWLA 1W3BA 3G2SA 4JL0A 4FJZA 4GCNA 1QZ2A 3QNKA 1QNFA 3U4TA 1SQMA 3S7FA 4AEZC 4JPSA 3ML8A 4B8AA 1MQSA 4OVVA 2CFUA 4F7AA 1DNPA 3APCA 5HQ8A 4DJAA 2AXVA 4N3BA 2WXRA 2C0MA 2VQ2A 3GYZA 3EIJA 3EJNA 2VGYA 4YVQC 2V4LA 2WQHA 4I2ZA 3FTXA 2KC7A 4CRWA 2AXZA 3RJVA 1NA3A 3T5XA 1OUVA 2J4BA 3LS8A 3UMVA 3SZ7A 3I4RB 2HR2A 5FQ8A 5FQ4A 3ZEFA 1UJKA 1PC2A 4FADA 3FH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU1 A;  3FEY A;  3FEX A;  4GMJ A;  3L6A A;  2KZT B;  4CT4 A;  2KZT A;  4B8A A;  4LUN U;  1H2V C;  5ANR A;  1H2T C;  3EIQ C;  2HM8 A;  3EIJ A;  4JHJ A;  4IUL A;  4B89 A;  2VSX E;  2I2O A;  1N54 A;  2RG8 A;  3D3M A;  1N52 A;  1PAQ A;  4CRW A;  4GML A;  2ION A;  4JHK A;  3JUI A;  2IOL A;  2ZU6 B;  1UW4 B;  1HU3 A;  1UG3 A;  3RK6 A;  4C9B B;  1H2U A;  2IOS A;  2NSZ A;  4CEM A;  2FUL A;  2GGF A;  1H6K A;  4B8C B;  2VSO E; 
#chains in the Genus database with same CATH topology
 3NB2 A;  4LNG A;  4OYS A;  4QFV A;  2WB2 A;  5BUZ A;  3HIZ A;  3UKR G;  3AS5 A;  3UT8 A;  2YQ8 A;  2PZI A;  3CQG B;  4HOR A;  5EDS A;  1TNB A;  3P1U A;  4JB8 P;  5ENP D;  3QWP A;  4WNE A;  2CG3 A;  3C98 A;  3PNL B;  2H6G A;  1Y8M A;  4IUL A;  3LEW A;  3MGB A;  4BSZ B;  2KCL A;  3UIP C;  2XZD G;  3SGH A;  5KJM A;  1IQU A;  3DSW A;  3TG5 A;  4O60 A;  2DZN A;  2FO1 E;  2BUG A;  4L1B A;  3VLD A;  1Z6T A;  1HE8 A;  5HS0 A;  3FTY A;  2GRP B;  1SZ9 A;  2XCB A;  1IHG A;  3UPV A;  3PUJ A;  1BU9 A;  1DC2 A;  4GZC A;  3L82 A;  1UJJ A;  4AXH A;  3MKQ A;  4GPM A;  1KT1 A;  4N5C A;  5A6C A;  1HX8 A;  1OY3 D;  3ABK E;  3DEO A;  3SY2 A;  3V31 A;  3LY9 A;  4GTM A;  4PS7 A;  4BET A;  4V3I A;  1MHQ A;  4MLP A;  4DX5 D;  2YNQ A;  3IEG A;  2FBN A;  1N0Q A;  3FUH A;  4KZ0 A;  1O1T A;  5M72 A;  5KCM A;  5JHA A;  1UN8 A;  2XQ0 A;  3CLJ A;  2WXJ A;  3LVR E;  4HOT A;  2GGF A;  3BU8 A;  4Q69 A;  4KVO A;  4M3O A;  4BT9 A;  3V2X A;  5G05 J;  5KJL A;  1KT0 A;  2OCC E;  5AJD A;  5FQ7 A;  3PZD A;  3PE3 A;  3JUI A;  5JJ7 A;  2ZXW E;  3AU5 A;  4EBA A;  2EIK E;  2PL2 A;  3Q78 A;  1YCS B;  3CVN A;  3NOC D;  4GMJ A;  1UOH A;  1QBQ A;  5KWD A;  2PQN A;  3TWR A;  4IRU A;  4UI9 K;  3B7U X;  4GTR A;  3G2U A;  4F3V A;  2F8Y A;  2CHX A;  5EYP F;  1XNF A;  1U2V G;  3U3W A;  5AYW D;  2J4D A;  3JCK C;  3R7R A;  2X6H A;  4KZC A;  3FU3 A;  1E7U A;  1JCQ A;  3UM2 A;  3U66 A;  4ME2 A;  1N9A A;  3GZS A;  3E37 A;  1OXJ A;  1N4P A;  3FWV A;  1TN8 A;  4E85 A;  1NFI E;  1OWO A;  4WUY A;  2CG2 A;  4X8Q A;  3CQC B;  2DZO A;  1L5J A;  4KVM A;  5ENO D;  3EUV A;  2RD0 A;  5FT9 A;  4PS8 A;  4YDW A;  1E96 B;  2YIN A;  2XS8 A;  3LVQ E;  3UQ3 A;  2DYS E;  4GML A;  3OAW A;  5KBA A;  1V55 E;  4C0M A;  3IHV A;  1JWF A;  2LSV A;  2NYJ A;  3ABM E;  4RSY A;  4ATZ D;  3BG0 B;  3SFY A;  2EQX A;  1MX4 A;  4I9C A;  3O48 A;  4RG9 A;  3T8K A;  1HG5 A;  3WXX A;  3HXB A;  2OVB A;  1BLX B;  3PEV B;  1UG3 A;  1PY1 A;  4LNB A;  1DCE A;  1S64 A;  3SFX A;  4HVB A;  3LJN A;  4NAC A;  2HO1 A;  1MX2 A;  3RIB A;  3G2V A;  1EPU A;  4DX1 A;  3AG1 E;  1RZ4 A;  4JHJ A;  1HZ4 A;  2HE0 A;  2UY1 B;  3ASH A;  2ILR A;  2WVI A;  3D9N A;  2LAH A;  3CR3 A;  1ELW A;  1JCR A;  1LF8 A;  3QKY A;  2AVP A;  1N11 A;  3ZW3 A;  4JEU A;  3DSV A;  5A7D B;  1H0A A;  5FZS A;  5CBO A;  5ENS D;  5C1D A;  3ULQ A;  4N39 A;  3CVW A;  4YDO A;  1QQE A;  4DLO A;  4AJW A;  4HRN A;  3CV0 A;  4TRQ A;  4A63 B;  3RRM B;  3HYM B;  4CT4 A;  3Q79 A;  5CEC B;  2H6I A;  2I1J A;  5H7P A;  4CZ2 D;  4XE0 A;  3L22 A;  3OXF A;  4L23 A;  5HI7 A;  1K1B A;  2R05 A;  4JHK A;  3B7S A;  1OWN A;  3ZIM A;  1HFA A;  3J5P A;  3FUK A;  3R7Q A;  2VSO E;  5CMW A;  1Z3X A;  4HB5 A;  1X81 A;  3UM3 A;  5E75 A;  4UWF A;  2WXM A;  4U0Z A;  4EZK A;  5CRU A;  3AS8 A;  4UQZ A;  1EYH A;  3U9W A;  3CST A;  1IKN D;  3QWW A;  2NSZ A;  4ANX A;  4KBQ A;  2KCV A;  3TG4 A;  4GAA A;  4L2Y A;  3QJZ A;  3HDX A;  2J9Q A;  4B94 A;  1Z5S C;  1TNY A;  4J8S A;  2MOW A;  1TJF A;  1N52 A;  3CKC A;  3PZ3 A;  3ML9 A;  3EHR A;  4EEC A;  3V30 A;  1ZU2 A;  3E30 A;  3WG7 E;  4TXP A;  3G2S A;  1W3B A;  4JL0 A;  1QZ2 A;  3U4T A;  4MBG A;  4CYM D;  4B8A A;  2CFU A;  3TWV A;  4DJA A;  2WXR A;  2V4L A;  4U96 D;  5B3S E;  1OUV A;  3LS8 A;  3I4R B;  2HR2 A;  1N4Q A;  5FQ4 A;  2QYU A;  3ZEF A;  3BQO A;  4FAD A;  3FH8 A;  4ILG A;  3KSL A;  4KXK B;  1MZC A;  3UT7 A;  4HOU A;  1LD7 A;  2VSX E;  2E0I A;  2L6J A;  4GTT A;  4I43 A;  4F6R D;  4ILI A;  2ZGD A;  4LG6 A;  4HLE A;  1TJC A;  4Q96 A;  4G1T A;  4HQD A;  4ZFH A;  5LP0 A;  3NZU A;  3L9T A;  4OAV B;  2V0P A;  3D9P A;  4UWK A;  1KLX A;  5J90 A;  3FU5 A;  2WXQ A;  2XEE A;  4Z68 A;  1AWC B;  2J08 A;  3RSE G;  4B0Z A;  5JJ6 A;  2Y1L E;  4U7E B;  4CCA A;  4RLY A;  2EIJ E;  2AW6 A;  5AIJ A;  3OXL A;  2GRR B;  2XRY A;  4XZ4 A;  4BSX A;  4FA6 A;  3MCX A;  4G25 A;  4LRZ A;  4AP2 A;  3MKQ B;  3TJP A;  3FTV A;  3MA5 A;  3JQ0 A;  1JCS A;  4P29 A;  1Y6I A;  4I2W A;  5ENN A;  1O1R A;  1H2V C;  3OXG A;  3UIN C;  1LTX A;  5B1B E;  3URZ A;  5CHE E;  4G8K A;  5G55 A;  3ZYK A;  2L9B A;  3TGO A;  3UT4 A;  5ANL A;  2Y3A A;  4O6F A;  3ZRH A;  3DXK G;  4ATG A;  5G04 C;  3LDZ A;  3D9O A;  4C0E A;  1JPL A;  4GYO A;  3JXJ A;  3QAR A;  1MJ0 A;  2XGS A;  3VTX A;  4GTS A;  2LO6 A;  3FTW A;  4NQ0 A;  3ENE A;  2ZIR A;  4AM9 A;  3CGH A;  2FUL A;  4J0U A;  2RFM A;  3ZHE A;  3RRU A;  1UN9 A;  1OCZ E;  3TWX A;  4XEI G;  3CVV A;  5LCW C;  2HM8 A;  3VLE A;  2I9C A;  3ZNG A;  1IHB A;  3TL5 A;  4BX8 A;  3F6Q A;  1JUQ A;  4APF A;  4AY6 A;  2Y69 E;  4GZ3 A;  2CFZ A;  3AJI A;  4BX9 A;  3KAE A;  2KZT B;  5FJY A;  2V5F A;  1A5E A;  2ETA A;  5AQ7 A;  3B7R L;  4LCT A;  5FIN A;  4L7T A;  3FH7 A;  4DPR A;  3UX4 A;  1SA5 A;  5CEA A;  2IQC A;  3R9M A;  4RVB A;  2GW1 A;  2BKG A;  1E8Y A;  1ELR A;  3ASN E;  3SBT B;  5JHB A;  5DBK A;  4XX5 A;  4J8D A;  3ABL E;  3FUI A;  2QZA A;  2LAI A;  3ASO E;  3C3Q A;  3ULY A;  1SW6 A;  4BT8 A;  2IOS A;  3KEA A;  4B8C B;  4G11 A;  4DX7 D;  4APO A;  5ITZ F;  5CCL A;  3MZL B;  3FUM A;  1FVH A;  4YDE A;  5JJT A;  2JLB A;  2ZIS A;  2WQ6 A;  3UI2 A;  3UIO C;  4EPZ A;  1HXI A;  3FUF A;  3B13 A;  3FTS A;  3FHE A;  3B7T A;  4M7C A;  2IY0 C;  4UWG A;  3NZS A;  4FLH A;  3D9I A;  1P5Q A;  4G26 A;  3QAQ A;  2QYJ A;  4G24 A;  2UWJ G;  2J09 A;  3RU0 A;  4WND A;  3LYA A;  3AG4 E;  2A4Z A;  3RO3 A;  4J6I A;  4HRM B;  2HYZ A;  1E90 A;  2VGX A;  1YYH A;  4RG6 A;  3Q9N C;  4U63 A;  4O1P A;  5BV1 A;  5IY5 E;  2F37 A;  5EKQ D;  3Q4A B;  2Y4T A;  3I4G A;  3Q7F A;  3QDN A;  4TXR A;  4EZL A;  3GW4 A;  2WQ7 A;  2XRZ A;  3DPY A;  4BWR A;  4C48 B;  3B95 A;  4UUC A;  3L16 A;  4G8L A;  2C0L A;  5FTP A;  2YHE A;  4OAU C;  1H6O A;  2GRO B;  3RKV A;  2WM9 A;  3KS2 A;  4JA7 A;  1YA0 A;  1E8W A;  4I9E A;  1WY6 A;  3D9K A;  4I1M A;  2R2L A;  4H7X A;  1V54 E;  4CGW A;  4U8V D;  3FU0 A;  3MX3 A;  4FUL A;  4G2V A;  4U0S A;  1X5B A;  3TWU A;  3JUE A;  2R02 A;  5AN8 A;  3QWV A;  4GB9 A;  2XEH A;  1OT8 A;  4GZ5 A;  2QY7 A;  2B0O E;  2DYR E;  5AJL A;  4PH4 B;  4KMO A;  4W9R A;  3PH0 C;  3PNT B;  4C9B B;  3Q73 A;  2IU1 A;  1E7V A;  2IF4 A;  2Q7F A;  3VTY A;  4BTA A;  3BG1 B;  2XEN A;  2CHZ A;  4DI4 A;  2OEV A;  1YMP A;  1WM5 A;  2WXH A;  1NA0 A;  5T4Y A;  3PZ4 A;  5FIO A;  4ZHB A;  5FQ6 A;  3PS6 A;  4AY5 A;  3ZKJ A;  3FDH A;  1GW6 A;  3CHQ A;  4N3A A;  5FZR A;  3EHM A;  4D10 C;  5D0O D;  3AG3 E;  3TXN A;  2DWZ A;  4K5B A;  3T8M A;  4ACL A;  4FJY A;  1VDY A;  3D9H A;  3DXM G;  2R03 A;  4NIK A;  4AEZ C;  1DNP A;  3APC A;  5HQ8 A;  2AXV A;  2VQ2 A;  3EJN A;  3AAA C;  4K5C A;  4I2Z A;  1K8K G;  2P9U G;  3E32 A;  3FTX A;  4CRW A;  2AXZ A;  2J4B A;  3DST A;  4LSZ E;  1D8D A;  4TUU A;  2M63 A;  1HF8 A;  3ESL A;  5B1A E;  3DSX A;  3C3R A;  3S7B A;  2RKK A;  4GA2 A;  1S0P A;  2X6K A;  3DEP A;  4YDY A;  1HH8 A;  3L08 A;  3IBE A;  3ZYQ A;  3FEX A;  2C2L A;  3ZYM A;  1H19 A;  1HO8 A;  3ASD A;  5D66 A;  3IHY A;  3DSU A;  3CVQ A;  5A23 A;  4IN3 B;  4ABN A;  2YHC A;  3DWL G;  3FTU A;  4HRL A;  1E8X A;  2BTD A;  5LOZ A;  4AIF A;  5ENQ D;  3SI5 A;  4HS2 A;  5HKP A;  4HBD A;  3E34 A;  2RFA A;  3D9J A;  4WWP A;  1D9S A;  2WXL A;  2NC9 A;  3UKU G;  3NBN B;  2XPY A;  4I1O B;  3MJW A;  4B93 B;  2A5E A;  3HXD A;  2XCC A;  4CDM A;  3MV2 B;  3I3N A;  1QYM A;  3P2B A;  3PRZ A;  2EIM E;  3TWQ A;  2L6B A;  3FUE A;  3L54 A;  2XHE A;  2IO2 C;  3ZYL A;  4ANV A;  3E4B A;  2B6C A;  1TNU A;  4JXT A;  1N94 A;  1TR4 A;  3PRE A;  2VSY A;  2LSU A;  5J08 A;  4UI9 J;  3CSF A;  3PZ1 A;  4YND A;  3JYS A;  3FFL A;  4HOQ A;  3BEE A;  2WXI A;  1O1S A;  1N4R A;  2I1K A;  2I6H A;  3CHM A;  3QC1 A;  2MHK A;  2P58 C;  3Q7A A;  1NZN A;  2Y4U A;  2P9I G;  3QB2 A;  4NUR A;  2X6I A;  3SBS A;  2BF0 X;  2OV8 A;  4UQX A;  2LNI A;  2A5U A;  2MRI A;  5JA4 D;  3ZFW A;  3SD5 A;  2OVF A;  3ISM C;  5JMN D;  5CRV A;  4LUN U;  4H7Y A;  1KPS B;  2J49 A;  2V8S E;  3TWT A;  3L13 A;  4HFG A;  4AV7 A;  5C2Y A;  3GZ2 A;  3LY7 A;  1H6P A;  1OCC E;  3PE4 A;  2GRN B;  2IJG X;  3MYV A;  4GTO A;  4PDX A;  3APD A;  4BY6 A;  1FPP A;  4Y6W A;  3LJ3 A;  3T5V A;  2VSN A;  3D9M A;  5BT1 A;  3ZPJ A;  4WWO A;  2XPI A;  3EHN A;  1TN6 A;  4XKC A;  3ZXS A;  1G3N B;  2ZGG A;  3UM0 A;  2WXK A;  2VTB A;  3X2Q E;  4JA9 A;  3NOG D;  5AAR A;  4B89 A;  4LNU D;  1NP7 A;  2P9S G;  1KZP A;  4MS6 A;  5G2N A;  3QK0 A;  4WAF A;  3Q49 B;  5FZQ A;  4U04 A;  3C5R A;  3SQV A;  1U3C A;  2AXU A;  3CK8 A;  4BER A;  3ASF A;  4FLB A;  2F0Y A;  1H2T C;  1TN7 A;  2GRL A;  3V79 K;  3HXC A;  5EX3 A;  1BI8 B;  4F1P A;  3ZN3 A;  2VGX B;  3B7B A;  3CIA A;  2ETC A;  1H2U A;  2PQR A;  4A3V A;  2QC9 A;  3L6A A;  3QOU A;  3FUJ A;  1EDU A;  4I17 A;  2DBA A;  4UQY A;  5EID A;  3PUK A;  3MKR A;  2FO7 A;  1H6K A;  1DVP A;  2WXF A;  5ARG A;  2KXP C;  4ANU A;  3HRA A;  4K0R A;  3K9I A;  4QQI A;  4RQI A;  1ZBP A;  3KEZ A;  1LD8 A;  4CGV A;  2QFC A;  4GTQ A;  3ESK A;  2WMO A;  1UW4 B;  2P9N G;  3Q5M A;  4ACK A;  2E2E A;  4XI0 A;  4Y6C A;  3CVX A;  3KD7 A;  4JZY A;  4AOF A;  3L17 A;  3CVY A;  4N2S A;  4G23 A;  2KBX A;  1HG2 A;  5BXU A;  3LY8 A;  1TYQ G;  2CHW A;  3UTM A;  4PS3 A;  1FT2 A;  3OTN A;  2WXN A;  2XS1 A;  3ONL A;  4I1A A;  1A17 A;  5AQB A;  1AP7 A;  3CK9 A;  2FF4 A;  1BPO A;  4J7W A;  4JD2 G;  3CVP A;  2JEK A;  3FP3 A;  4DUI A;  3SFZ A;  5ENT D;  3AG2 E;  1N4S A;  1N0R A;  3EHQ A;  4GTV A;  1JWG A;  4JW1 A;  4JEH A;  4I6J A;  2OEW A;  5BNW A;  2DCP A;  4GTP A;  3S7D A;  2P9P G;  4GA0 A;  2V5Q C;  3PDN A;  1INZ A;  1ZB1 A;  4LER A;  2WXO A;  2F8X K;  4J8Y A;  1OWM A;  3UM1 A;  5T3R A;  5KJN A;  4AVX A;  4ILH B;  1K3Z D;  3RAU A;  4U8H A;  3DRA A;  3HVE A;  5BW8 C;  3FUL A;  4PUC A;  3MEK A;  4TUM A;  4GCN A;  2P9K G;  3S7F A;  3ML8 A;  1MQS A;  4OVV A;  4F7A A;  3BUA A;  2C0M A;  4HI8 A;  2VGY A;  3IXE A;  2KC7 A;  1NA3 A;  2PNN A;  3T5X A;  2V4H C;  3SZ7 A;  3FH5 A;  3CHP A;  4HI9 A;  3EU9 A;  4DK5 A;  2FEZ A;  3N71 A;  1RW2 A;  4GYY A;  4UWH A;  2IO3 C;  3DPD A;  4A1G A;  3ZVV A;  3CHO A;  3ZU7 B;  1HU3 A;  5EIL A;  5CBN A;  1E8Z A;  2Y0B G;  2KZT A;  4JHR A;  5AAO A;  3CHS A;  3ZUV B;  1WAO 1;  3NF1 A;  3ZGQ A;  4HXI A;  2ZU6 B;  4DI3 A;  3HXF A;  2ETB A;  4DX6 D;  2FI7 A;  3FTZ A;  5EIB E;  1OCR E;  2XGO A;  4HOS A;  5D2M C;  3HXE A;  3RRN B;  1Q2Z A;  2X6F A;  2OND A;  3LCA A;  4YVO A;  3G2T A;  4GA1 A;  4IYP A;  1WG0 A;  4WNG A;  3VLF A;  3FUN A;  1XGW A;  3I5P A;  4TXQ A;  2EIL E;  4TV3 A;  4CT0 A;  3Q9U C;  3Q75 A;  1KZO A;  2JAB A;  3MV3 B;  3IV0 A;  4FHJ A;  5HRY A;  4U95 D;  1IQR A;  3LPZ A;  1PAQ A;  2WMN A;  5EN5 D;  5G05 C;  3E33 A;  2AJA A;  3SNX A;  2VJ8 A;  4L2L A;  2EIN E;  2L0I A;  4GZD A;  5DIZ A;  5BPP A;  3R9A B;  2IEJ A;  4DRX E;  4UWL A;  4FHK A;  3FU6 A;  5FWQ A;  3ASG A;  2MYO A;  4BTB A;  4K5A B;  4KYO B;  3TWW A;  3ZXP A;  4ANW A;  5KJK A;  1BD8 A;  3ONK A;  3C3O A;  4Q94 A;  2GRM A;  4XI9 A;  3SHF A;  3UXG A;  2WXP A;  4XKB A;  4WNF A;  3AU4 A;  1HS6 A;  2BED A;  4L9P A;  4BFR A;  3PEU B;  5EYL A;  4DLQ A;  5AQA A;  2LUH A;  4N2Q A;  2GRQ B;  4CDR A;  3Q15 A;  4LEU A;  3CVL A;  3AS4 A;  2PM7 A;  1NI1 A;  4FC8 A;  3HHM A;  1S70 B;  3PVL A;  1TEZ A;  3PZ2 A;  4FP7 A;  4GZ6 A;  1WDY A;  4EBA G;  4KT6 B;  2IOL A;  3APF A;  2OOE A;  3NAW A;  4I6G A;  2R5S A;  3G2W A;  1B89 A;  3EU5 A;  2WXG A;  2DVW A;  3CEQ A;  3DBS A;  3O4Z A;  2LXM A;  2P9L G;  5BV0 A;  2L0T B;  3IKO B;  4URK A;  2RG8 A;  4N5Q A;  4A55 A;  4R7L A;  5CER B;  3D9L A;  4A3T A;  1FVF A;  2VTB B;  4F53 A;  3V2O A;  3FY4 A;  1SVX A;  4EHM A;  4XIF A;  3EIQ C;  1IYG A;  4MRU A;  1EF1 C;  2BKK B;  5CED B;  4I6E A;  1N54 A;  2XEV A;  4GCO A;  4J8E A;  3HG0 D;  5AQ9 A;  3RK6 A;  3EDT B;  3CKB A;  4O1O A;  3RO2 A;  3CVU A;  4GPK A;  5ANR A;  1FCH A;  1S63 A;  5CCM A;  5ARF A;  2PM6 A;  2KAT A;  2VYI A;  1DCQ A;  5BXO A;  1Z3Y A;  1ELK A;  3Q47 B;  5E76 A;  1BI7 B;  2XGM A;  3ZHE B;  2J07 A;  3NQP A;  3DSS A;  2J8S D;  2X6J A;  5T8I A;  2DIW A;  4U07 A;  5G04 J;  3JQ1 A;  4GYW A;  2UY1 A;  3TAX A;  2AWI A;  3SF4 A;  2VGE A;  1TNO A;  4EQF A;  1SA4 A;  4F1S A;  3GZ1 A;  3JXI A;  1O5M A;  4N3C A;  5KNH D;  2WPV A;  4NRH B;  3FUD A;  3SO8 A;  2X38 A;  4FU3 A;  4WWN A;  2R59 A;  1TNZ A;  2I2O A;  1N95 A;  3UUX A;  2NXP A;  3S7J A;  2H6F A;  1MX6 A;  5LCW J;  3LKU A;  3ULE G;  4HLL A;  2R17 C;  3FEY A;  5EX0 A;  3U64 A;  5AEN A;  2IFU A;  2LXL A;  5LX8 A;  1OWP A;  5KNG A;  4HNA D;  4DX2 A;  4U8Y D;  3CHR A;  1U3D A;  3TXM A;  5LFA A;  1MYO A;  3LXU X;  4U0U A;  4OVU A;  4GU5 A;  2P2C P;  4K03 A;  1OCO E;  2KCK A;  1D8E A;  2X3M A;  4EZJ A;  1NL4 A;  4E6H A;  4JVS A;  2XPZ A;  4UI9 C;  3W9F A;  3J5Q B;  1IXV A;  2XZT G;  3C72 A;  4MKT A;  4A1S A;  5CMY A;  4CDN A;  3CK7 A;  3W9G A;  3S2A A;  4BEP A;  4GMR A;  4J8F A;  2KM4 A;  5D0Q D;  3D3M A;  1K1A A;  3HVE B;  2ION A;  1SZA A;  4JC8 A;  3TWS A;  4CEM A;  1OWL A;  4FJZ A;  3T9K A;  3QNK A;  1QNF A;  4BES A;  1SQM A;  4JPS A;  1FT1 A;  5ENR D;  4N3B A;  3GYZ A;  3EIJ A;  4YVQ C;  2WQH A;  3RJV A;  2H6H A;  3UMV A;  5FQ8 A;  3KSQ A;  1UJK A;  1PC2 A; 
#chains in the Genus database with same CATH homology
 3FH5 A;  4ILG A;  4OYS A;  4TUU A;  2M63 A;  4QFV A;  3CHP A;  4KXK B;  3UT7 A;  4DK5 A;  1HF8 A;  2WB2 A;  3ESL A;  4HOU A;  2FEZ A;  5BUZ A;  3N71 A;  2VSX E;  3S7B A;  2E0I A;  2L6J A;  4GYY A;  4GA2 A;  3HIZ A;  4UWH A;  1S0P A;  3DPD A;  4A1G A;  3AS5 A;  2X6K A;  3ZVV A;  3CHO A;  4I43 A;  3UT8 A;  4ILI A;  2YQ8 A;  2PZI A;  1HU3 A;  3CQG B;  4HLE A;  1TJC A;  4Q96 A;  1HH8 A;  1E8Z A;  3L08 A;  3IBE A;  4HOR A;  4G1T A;  5EDS A;  3P1U A;  3ZYQ A;  3FEX A;  5LP0 A;  2C2L A;  3NZU A;  3ZYM A;  3QWP A;  1H19 A;  2CG3 A;  4WNE A;  1HO8 A;  2KZT A;  3ASD A;  2V0P A;  3C98 A;  3PNL B;  3D9P A;  4JHR A;  4UWK A;  1KLX A;  1Y8M A;  4IUL A;  3CHS A;  5J90 A;  3FU5 A;  3IHY A;  1WAO 1;  2WXQ A;  3CVQ A;  3LEW A;  3MGB A;  3NF1 A;  3ZGQ A;  5A23 A;  4IN3 B;  2KCL A;  4ABN A;  3SGH A;  2YHC A;  3FTU A;  4HXI A;  2ZU6 B;  5KJM A;  1IQU A;  1E8X A;  4DI3 A;  2J08 A;  2BTD A;  2FI7 A;  3FTZ A;  5LOZ A;  4AIF A;  3SI5 A;  4HS2 A;  3TG5 A;  4B0Z A;  5JJ6 A;  2XGO A;  4CCA A;  4HOS A;  2AW6 A;  3D9J A;  5AIJ A;  2BUG A;  4WWP A;  3OXL A;  2WXL A;  3RRN B;  4L1B A;  2X6F A;  3VLD A;  2OND A;  1Z6T A;  1HE8 A;  2XRY A;  4XZ4 A;  4BSX A;  4FA6 A;  3FTY A;  3LCA A;  2NC9 A;  3MCX A;  4YVO A;  4G25 A;  1SZ9 A;  2XCB A;  3G2T A;  4GA1 A;  1IHG A;  4IYP A;  2XPY A;  3UPV A;  3PUJ A;  4I1O B;  4LRZ A;  4WNG A;  3MJW A;  4AP2 A;  3VLF A;  4GZC A;  3MKQ B;  3FUN A;  1UJJ A;  1XGW A;  3TJP A;  4AXH A;  2XCC A;  3FTV A;  3I5P A;  3MKQ A;  3MA5 A;  4CDM A;  3JQ0 A;  4P29 A;  3MV2 B;  1Y6I A;  3I3N A;  4I2W A;  5ENN A;  1KT1 A;  4TV3 A;  3P2B A;  4CT0 A;  3PRZ A;  1H2V C;  4N5C A;  5A6C A;  1HX8 A;  3MV3 B;  3FUE A;  3IV0 A;  3L54 A;  3OXG A;  4FHJ A;  2XHE A;  3URZ A;  5CHE E;  1IQR A;  3LPZ A;  1PAQ A;  5G55 A;  2WMN A;  3ZYL A;  4ANV A;  3ZYK A;  2L9B A;  3E4B A;  3LY9 A;  3TGO A;  4JXT A;  4PS7 A;  5G05 C;  3UT4 A;  5ANL A;  2Y3A A;  3SNX A;  3PRE A;  4V3I A;  2VJ8 A;  4O6F A;  1MHQ A;  4L2L A;  3ZRH A;  2VSY A;  4ATG A;  2L0I A;  4MLP A;  5G04 C;  2YNQ A;  3IEG A;  2FBN A;  3LDZ A;  4GZD A;  5DIZ A;  2LSU A;  3D9O A;  4UI9 J;  4C0E A;  5J08 A;  3CSF A;  1JPL A;  3FUH A;  4GYO A;  3R9A B;  4KZ0 A;  5BPP A;  4YND A;  5M72 A;  3QAR A;  2XGS A;  5KCM A;  3VTX A;  5JHA A;  2LO6 A;  3JYS A;  4UWL A;  4FHK A;  1UN8 A;  3FFL A;  2XQ0 A;  3FU6 A;  3CLJ A;  4HOQ A;  3FTW A;  4NQ0 A;  3ASG A;  2WXJ A;  5FWQ A;  3ENE A;  3LVR E;  4BTB A;  3BEE A;  2WXI A;  4AM9 A;  3CGH A;  4HOT A;  4KYO B;  2FUL A;  4J0U A;  2GGF A;  4ANW A;  4Q69 A;  5KJK A;  4KVO A;  3ZHE A;  4M3O A;  3RRU A;  1UN9 A;  2I1K A;  2I6H A;  3ONK A;  4BT9 A;  4Q94 A;  3CHM A;  2GRM A;  3QC1 A;  4XI9 A;  3SHF A;  2MHK A;  3CVV A;  5G05 J;  2P58 C;  5LCW C;  5KJL A;  2WXP A;  4XKB A;  2HM8 A;  1KT0 A;  1NZN A;  3AU4 A;  4WNF A;  1HS6 A;  3VLE A;  2I9C A;  2Y4U A;  4BFR A;  3TL5 A;  4BX8 A;  3PEU B;  5AJD A;  5FQ7 A;  3QB2 A;  4NUR A;  2X6I A;  3SBS A;  3PZD A;  3PE3 A;  1JUQ A;  2BF0 X;  2OV8 A;  3JUI A;  4UQX A;  4DLQ A;  4APF A;  5JJ7 A;  4N2Q A;  3AU5 A;  2LNI A;  4EBA A;  2A5U A;  4CDR A;  4AY6 A;  2MRI A;  3Q15 A;  2PL2 A;  2CFZ A;  4GZ3 A;  3ZFW A;  4BX9 A;  4LEU A;  3KAE A;  3CVL A;  3SD5 A;  2OVF A;  3AS4 A;  3CVN A;  4GMJ A;  2KZT B;  2PM7 A;  5FJY A;  2PQN A;  4FC8 A;  4LUN U;  4H7Y A;  2J49 A;  2V5F A;  2V8S E;  4IRU A;  4UI9 K;  3HHM A;  3B7U X;  3PVL A;  3G2U A;  3L13 A;  1TEZ A;  4F3V A;  4HFG A;  4FP7 A;  3B7R L;  4LCT A;  4AV7 A;  4GZ6 A;  5C2Y A;  4L7T A;  3FH7 A;  4KT6 B;  4DPR A;  2CHX A;  4EBA G;  3UX4 A;  3GZ2 A;  2IOL A;  3LY7 A;  3APF A;  1XNF A;  3U3W A;  3PE4 A;  5AYW D;  2IJG X;  2IQC A;  2J4D A;  2OOE A;  3JCK C;  3MYV A;  4RVB A;  4PDX A;  3APD A;  4I6G A;  4BY6 A;  2R5S A;  3G2W A;  2GW1 A;  3R7R A;  2X6H A;  4KZC A;  1B89 A;  1ELR A;  1E8Y A;  3FU3 A;  4Y6W A;  3LJ3 A;  3SBT B;  5JHB A;  5DBK A;  4XX5 A;  2WXG A;  1E7U A;  3T5V A;  4J8D A;  3FUI A;  2VSN A;  3CEQ A;  3D9M A;  3DBS A;  3O4Z A;  5BT1 A;  2LAI A;  5BV0 A;  3U66 A;  2L0T B;  4ME2 A;  3IKO B;  4URK A;  3ZPJ A;  2RG8 A;  4WWO A;  3GZS A;  2XPI A;  3EHN A;  4XKC A;  4BT8 A;  4A55 A;  3ZXS A;  4R7L A;  3FWV A;  3D9L A;  4E85 A;  4A3T A;  2IOS A;  1FVF A;  4B8C B;  1OWO A;  4F53 A;  4WUY A;  2CG2 A;  4G11 A;  2VTB B;  3FY4 A;  4APO A;  2WXK A;  2VTB A;  3CQC B;  1L5J A;  4KVM A;  5CCL A;  2RD0 A;  3MZL B;  3FUM A;  4JA9 A;  1FVH A;  4XIF A;  5FT9 A;  2JLB A;  4PS8 A;  5JJT A;  3EIQ C;  1E96 B;  1IYG A;  4MRU A;  1EF1 C;  4B89 A;  2WQ6 A;  2YIN A;  4I6E A;  1N54 A;  3LVQ E;  3UQ3 A;  1NP7 A;  2XEV A;  4GCO A;  4MS6 A;  5G2N A;  4J8E A;  4EPZ A;  1HXI A;  4GML A;  3FUF A;  3QK0 A;  3B13 A;  4WAF A;  3FTS A;  3OAW A;  3Q49 B;  3FHE A;  3B7T A;  5FZQ A;  4U04 A;  3RK6 A;  1U3C A;  2AXU A;  3CK8 A;  4C0M A;  4UWG A;  3NZS A;  4FLH A;  3EDT B;  3D9I A;  1P5Q A;  3ASF A;  4G26 A;  3CKB A;  3IHV A;  3RO2 A;  3CVU A;  3QAQ A;  1JWF A;  2LSV A;  4FLB A;  4G24 A;  4GPK A;  5ANR A;  1FCH A;  1H2T C;  2UWJ G;  4RSY A;  2GRL A;  3BG0 B;  2EQX A;  5CCM A;  2J09 A;  2PM6 A;  5ARF A;  4WND A;  3RU0 A;  3LYA A;  5EX3 A;  2A4Z A;  3RO3 A;  4I9C A;  3O48 A;  4RG9 A;  3ZN3 A;  1HG5 A;  2KAT A;  4J6I A;  2VGX B;  2HYZ A;  2VYI A;  2OVB A;  3PEV B;  3WXX A;  3CIA A;  1E90 A;  2VGX A;  1Z3Y A;  1ELK A;  3Q47 B;  1UG3 A;  5E76 A;  1PY1 A;  4RG6 A;  2XGM A;  1H2U A;  4U63 A;  2PQR A;  4HVB A;  3ZHE B;  2J07 A;  4A3V A;  4NAC A;  3NQP A;  5BV1 A;  2HO1 A;  3L6A A;  3QOU A;  3FUJ A;  5EKQ D;  3Q4A B;  2Y4T A;  3I4G A;  2X6J A;  3RIB A;  3G2V A;  3QDN A;  1EDU A;  1EPU A;  4JHJ A;  5T8I A;  4EZL A;  1HZ4 A;  3GW4 A;  4I17 A;  2WQ7 A;  2DBA A;  2UY1 B;  2DIW A;  4U07 A;  5G04 J;  3JQ1 A;  4UQY A;  4GYW A;  2UY1 A;  3TAX A;  2XRZ A;  2AWI A;  3ASH A;  3SF4 A;  2ILR A;  2WVI A;  3PUK A;  3D9N A;  4BWR A;  2LAH A;  4EQF A;  3CR3 A;  3MKR A;  4F1S A;  3L16 A;  3GZ1 A;  2FO7 A;  2C0L A;  1H6K A;  1ELW A;  5FTP A;  1DVP A;  4N3C A;  2YHE A;  2WXF A;  5ARG A;  2WPV A;  4NRH B;  3FUD A;  3RKV A;  2X38 A;  4ANU A;  4FU3 A;  4WWN A;  2WM9 A;  4K0R A;  3K9I A;  3KS2 A;  1LF8 A;  2R59 A;  3QKY A;  4JA7 A;  1YA0 A;  1E8W A;  1ZBP A;  4I9E A;  2AVP A;  3KEZ A;  2I2O A;  3ZW3 A;  4CGV A;  1WY6 A;  3D9K A;  4I1M A;  4JEU A;  5A7D B;  3UUX A;  1H0A A;  2NXP A;  2QFC A;  3S7J A;  5FZS A;  4H7X A;  4CGW A;  5C1D A;  3ULQ A;  3ESK A;  5LCW J;  2WMO A;  3LKU A;  4N39 A;  1UW4 B;  3FU0 A;  3CVW A;  3MX3 A;  4FUL A;  1QQE A;  4DLO A;  3Q5M A;  4G2V A;  4U0S A;  4ACK A;  2E2E A;  4AJW A;  4XI0 A;  4Y6C A;  1X5B A;  3CVX A;  3KD7 A;  4JZY A;  2R17 C;  3FEY A;  5EX0 A;  3CV0 A;  3U64 A;  4AOF A;  5AEN A;  2IFU A;  4TRQ A;  3L17 A;  3RRM B;  3HYM B;  3QWV A;  4GB9 A;  4CT4 A;  5LX8 A;  1OWP A;  3CVY A;  2I1J A;  4GZ5 A;  4N2S A;  2QY7 A;  4XE0 A;  4G23 A;  3L22 A;  1HG2 A;  3OXF A;  4L23 A;  5HI7 A;  5AJL A;  4PH4 B;  4KMO A;  4W9R A;  3LY8 A;  3PH0 C;  3B7S A;  1OWN A;  2CHW A;  3PNT B;  4JHK A;  4PS3 A;  3ZIM A;  1HFA A;  3CHR A;  3OTN A;  1U3D A;  4C9B B;  3TXM A;  5LFA A;  2WXN A;  3ONL A;  3FUK A;  4I1A A;  1A17 A;  3R7Q A;  2VSO E;  2IU1 A;  5CMW A;  1E7V A;  1Z3X A;  3LXU X;  3CK9 A;  2FF4 A;  1BPO A;  5E75 A;  4U0U A;  2IF4 A;  4UWF A;  2Q7F A;  2WXM A;  4OVU A;  4U0Z A;  4EZK A;  4GU5 A;  3CVP A;  2JEK A;  3FP3 A;  3VTY A;  4BTA A;  3AS8 A;  3BG1 B;  4K03 A;  3SFZ A;  2KCK A;  2X3M A;  2CHZ A;  4DI4 A;  4UQZ A;  1EYH A;  4EZJ A;  4E6H A;  4JVS A;  3U9W A;  2XPZ A;  4UI9 C;  3CST A;  1JWG A;  1WM5 A;  2WXH A;  2NSZ A;  1NA0 A;  3QWW A;  4JEH A;  4JW1 A;  5T4Y A;  4I6J A;  4ANX A;  5BNW A;  4KBQ A;  2DCP A;  5FQ6 A;  2KCV A;  3PS6 A;  3TG4 A;  4AY5 A;  3S7D A;  4GAA A;  4MKT A;  4A1S A;  4GA0 A;  5CMY A;  4L2Y A;  4CDN A;  3QJZ A;  3FDH A;  3PDN A;  1GW6 A;  2J9Q A;  3HDX A;  3CK7 A;  4B94 A;  1INZ A;  3CHQ A;  4J8S A;  2MOW A;  4LER A;  2WXO A;  4N3A A;  5FZR A;  3S2A A;  1OWM A;  1TJF A;  3EHM A;  4J8F A;  4D10 C;  2KM4 A;  5D0Q D;  5D0O D;  3D3M A;  5T3R A;  5KJN A;  1N52 A;  3CKC A;  4AVX A;  3TXN A;  4ILH B;  3HVE B;  3ML9 A;  4U8H A;  2ION A;  3HVE A;  3T8M A;  4ACL A;  5BW8 C;  4EEC A;  4FJY A;  3FUL A;  1SZA A;  4JC8 A;  1ZU2 A;  4PUC A;  3MEK A;  4CEM A;  1VDY A;  1OWL A;  1W3B A;  3G2S A;  4JL0 A;  4FJZ A;  4GCN A;  1QZ2 A;  3QNK A;  1QNF A;  3U4T A;  1SQM A;  3S7F A;  4AEZ C;  4JPS A;  3ML8 A;  4B8A A;  1MQS A;  4OVV A;  2CFU A;  4F7A A;  1DNP A;  3APC A;  5HQ8 A;  4DJA A;  2AXV A;  4N3B A;  2WXR A;  2C0M A;  2VQ2 A;  3GYZ A;  3EIJ A;  3EJN A;  2VGY A;  4YVQ C;  2V4L A;  2WQH A;  4I2Z A;  3FTX A;  2KC7 A;  4CRW A;  2AXZ A;  3RJV A;  1NA3 A;  3T5X A;  1OUV A;  2J4B A;  3LS8 A;  3UMV A;  3SZ7 A;  3I4R B;  2HR2 A;  5FQ8 A;  5FQ4 A;  3ZEF A;  1UJK A;  1PC2 A;  4FAD A;  3FH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...