3EIQC

Crystal structure of pdcd4-eif4a
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
278
Chain Sequence
ETAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKDCVQARAALDKATVLLSMVWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic initiation factor 4A-I
publication title Structural basis for translational inhibition by the tumour suppressor Pdcd4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/antitumor protein
total genus 93
structure length 278
sequence length 290
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eiqC02
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eiqC01
3D3MA 2KZTB 4B8CB 4JHKA 4CRWA 4B8AA 1H2VC 4JHJA 4CT4A 4CEMA 4B89A 2VSOE 1PAQA 2IOLA 3EIJA 2GGFA 1H6KA 5ANRA 1HU3A 4LUNU 2IONA 1UW4B 4C9BB 2VSXE 4IULA 3FEYA 2HM8A 1UG3A 2RG8A 3EIQC 2IU1A 2ZU6B 1H2UA 1N52A 2NSZA 3L6AA 2KZTA 2I2OA 1H2TC 1N54A 4GMJA 3JUIA 3RK6A 2IOSA 3FEXA 4GMLA 2FULA
chains in the Genus database with same CATH superfamily
3CVLA 2ETCA 5EN5D 1HE8A 1Z6TA 5CMYA 1OCOE 1GW6A 2WXIA 3QK0A 1OWOA 2NSZA 3U4TA 5A6CA 2HYZA 3FTSA 4JB8P 1JWFA 2XZDG 3T9KA 2YQ8A 2I9CA 4N2SA 4GPKA 5E76A 2LUHA 4JVSA 2X38A 1S0PA 4GPMA 3S7FA 1JCRA 3AS5A 2UY1A 1TR4A 3DRAA 2H6IA 2ONDA 3QWPA 4G8KA 1TYQG 2RG8A 4GTSA 3LDZA 2L6BA 5D66A 3TXNA 4EPZA 2R59A 4BEPA 2LNIA 1TJCA 3MKQB 2X6KA 5M72A 3DEPA 1BU9A 3BG1B 2EIME 3R9MA 1MYOA 3EIJA 4G1TA 5C1DA 4UWLA 2J09A 3S2AA 3ASFA 1HG5A 3FU5A 1H2TC 3BUAA 4TRQA 4GTMA 4KZ0A 5BPPA 3L22A 5ENOD 3FUIA 4AY5A 3EU5A 1OT8A 2WM9A 2VQ2A 3EDTB 2X6IA 3VTYA 4BETA 2WMOA 1OCRE 2XS1A 5ITZF 5FQ8A 3NF1A 1HF8A 5J08A 4FP7A 1H6OA 3CK7A 5CERB 1JCSA 4YDOA 2VSYA 4WUYA 5ARFA 1OCZE 4HORA 1B89A 3FDHA 5C2YA 2ETAA 3LCAA 3CVUA 4FHKA 3FTXA 3UXGA 2VTBB 4J8FA 5FWQA 4KMOA 1YYHA 2AXVA 2E2EA 2XRYA 3ZYQA 2IF4A 3PZ4A 2LXMA 4CGWA 2BUGA 3FUKA 3ASGA 1YMPA 5G04J 3DSVA 4UI9C 1OWLA 2R02A 4HOSA 4HRLA 5FZSA 3NZUA 3CHSA 2OCCE 2Y3AA 3RSEG 3ZEFA 4L7TA 3BQOA 5BT1A 2BEDA 4FJYA 5ENQD 3CHQA 4H7XA 4CRWA 4GB9A 3L08A 5AQ9A 5JMND 3FTWA 4OVVA 4DI3A 1UJJA 2VSNA 2QY7A 3FH8A 1E8WA 4K5BA 2LAIA 3ZYMA 3AG4E 3UKRG 3L17A 2IO2C 4TXQA 5AAOA 3MA5A 3PZ3A 2KBXA 3HXEA 3FU3A 4RVBA 2CFZA 1KT1A 3EHRA 5KJKA 1Z3YA 4PS8A 4FLHA 3D9HA 2IQCA 1K1AA 3RKVA 5BUZA 2WQ6A 4GZ5A 1NL4A 3UPVA 4EZKA 2EINE 2WXQA 2EILE 3UM1A 4ANVA 3RO2A 3FTUA 4CDMA 4NACA 3FUNA 1G3NB 2OEVA 3ZN3A 4LSZE 3GYZA 1N52A 2WVIA 2P9KG 3D9IA 4K5CA 3L13A 3FEXA 2KZTB 2DBAA 5KWDA 4HLEA 5T3RA 4PS7A 3CGHA 4GTPA 5B1BE 1BLXB 3FUEA 4OYSA 3JXIA 3DSWA 5KJLA 1S63A 1KLXA 3ENEA 2KC7A 4J0UA 1FVHA 2P9IG 3UT7A 4MLPA 3KD7A 3PEUB 3FUJA 1OWPA 3TL5A 4GTRA 2XGSA 3BU8A 3MYVA 4UQYA 3EJNA 4AEZC 3CVWA 3SFXA 4CGVA 3FU0A 1MJ0A 4WWPA 2CG3A 2HO1A 3I5PA 4XEIG 5HQ8A 4YVQC 4A3TA 1ZU2A 3ZW3A 1FT1A 3QNKA 5JJ6A 2GRQB 4O1OA 2P9SG 1OY3D 2AXZA 4YNDA 5FTPA 3PZDA 2J4BA 3SQVA 4GZCA 1N4RA 5CRVA 3HHMA 1HFAA 1FVFA 3ZHEB 3Q49B 1LD7A 3CK8A 4U7EB 3E37A 4XZ4A 3MV2B 4GTVA 4EHMA 4ANWA 3RAUA 3N71A 3Q79A 1BI7B 4NIKA 3CVVA 1TJFA 3V79K 2C2LA 3URZA 1FT2A 4DLOA 4WNFA 4LEUA 4JL0A 2AJAA 1N95A 5LFAA 4N5CA 3ULQA 1L5JA 3D9PA 3IXEA 4L23A 3DWLG 2R05A 4ILIA 4EQFA 2FBNA 2XCCA 1RZ4A 3HVEA 2FULA 1UN8A 1IQRA 3B7RL 4HI8A 4DPRA 2P2CP 3CQCB 5LX8A 3SF4A 4DX2A 3LVRE 1UN9A 4U96D 1LD8A 4C48B 3RJVA 3O4ZA 2I1KA 3Q4AB 4G8LA 4DRXE 2JABA 4L2LA 3TWSA 3MCXA 4APFA 1TN7A 1IYGA 3QWWA 4HLLA 4N5QA 4U0SA 2X3MA 3RRNB 5CECB 5EDSA 1XNFA 1RW2A 3NOCD 2R03A 1JPLA 5EX3A 1OXJA 4HOUA 4L1BA 4QQIA 1FPPA 1W3BA 4JHKA 3UTMA 2XRZA 3C3RA 5LCWC 5CHEE 2XS8A 5ANRA 2KXPC 1LTXA 2WMNA 1AP7A 4ILGA 4WNDA 4ILHB 3PZ1A 4AIFA 3ZXSA 2I6HA 1WG0A 2XZTG 3CQGB 1BPOA 3B7BA 4JZYA 1DCQA 4BX8A 2XPIA 4HQDA 3UIOC 3OXGA 1SA4A 4KVOA 4ANUA 3TXMA 3DXMG 1MQSA 4C0MA 2DZNA 4GYWA 3W9FA 4LNUD 2M63A 4IULA 2UY1B 4LNBA 4N2QA 5KCMA 4ANXA 2AVPA 3AG1E 3ZPJA 2GROB 4A55A 2ZXWE 3ESKA 5CBNA 4GYOA 3CR3A 4FU3A 1DCEA 2KCKA 2KCLA 1D8EA 2VSXE 4ZFHA 2WXJA 1AWCB 3D9JA 5CEDB 4V3IA 3PRZA 4A1SA 4JEUA 3FFLA 5CRUA 5JHAA 2GW1A 1JWGA 3L54A 3PDNA 3HG0D 4GA0A 3B95A 3PVLA 3Q73A 2FF4A 1ELRA 3GZSA 3O48A 2VGXA 1ELKA 4FHJA 3C98A 2ETBA 1H19A 3FH7A 2DYSE 3QKYA 2L9BA 5KJNA 3JCKC 1K3ZD 4DX7D 3SZ7A 4I6JA 4JXTA 3CVYA 3P2BA 1X5BA 2GRPB 2RFAA 3J5QB 2QC9A 1DVPA 2LSUA 4XI9A 4Y6CA 4HOTA 2QYJA 3LS8A 2CHXA 4NQ0A 1QQEA 3PS6A 3QC1A 2MOWA 3VLFA 1E8YA 4I2WA 4PH4B 4OVUA 4UQXA 3KSLA 4JHJA 5ENTD 4I1OB 4AVXA 3E33A 1K1BA 4JC8A 3R9AB 5CBOA 2J8SD 2LAHA 1N54A 4I17A 5A7DB 2GRMA 3AU5A 5EIDA 4U8VD 3MZLB 4HRMB 1JCQA 3D9KA 4PDXA 3G2WA 3W9GA 5FQ4A 4DX5D 4A1GA 3QWVA 2I1JA 2J4DA 3PNTB 4I2ZA 3PREA 5ENNA 3IKOB 3ZNGA 5BNWA 4J7WA 5AJLA 2V4LA 4BSZB 4K5AB 4MBGA 3KEZA 4BTAA 3CVNA 3MGBA 5IY5E 1E96B 2WXRA 3FHEA 2J08A 3CHMA 4N3CA 2Y4TA 2CG2A 2L0TB 3CKBA 4IYPA 1EF1C 5KBAA 4KT6B 4OAVB 4BX9A 3C72A 2C0LA 2Q7FA 4HB5A 5HRYA 3Q78A 4JA7A 2P9NG 1DNPA 3ZGQA 2ILRA 1SZAA 2MYOA 2P9UG 2X6JA 2XPZA 5G2NA 1PY1A 3FTVA 1TEZA 1E7UA 2XPYA 4ACKA 3D3MA 4U8HA 4N3BA 1IXVA 3F6QA 3UIPC 3ISMC 4TUMA 4W9RA 3QARA 1Y8MA 3BEEA 4URKA 4DUIA 3B7SA 3X2QE 2RD0A 3ASNE 4WWOA 4I43A 3G2SA 5FINA 1ELWA 1HS6A 2IJGX 1H6KA 4YDEA 3NZSA 1IKND 4HOQA 3HDXA 3G2UA 3T8KA 3UM2A 3TGOA 3CLJA 1P5QA 4GMJA 1OWNA 4DJAA 3ZU7B 1E8ZA 1MZCA 3PE4A 4GZ3A 3PUJA 4G2VA 1ZBPA 1O1SA 1NP7A 3D9LA 2GRRB 4B94A 3Q75A 3FEYA 2FO7A 3JYSA 4BTBA 2WXFA 1NI1A 4J8DA 3RK6A 3IBEA 3DPDA 1EDUA 3IEGA 3U66A 2DVWA 2NYJA 4A63B 4UWGA 1N4PA 4UWKA 5B1AE 2WPVA 3GZ1A 5G55A 2PZIA 2AWIA 2VSOE 2YHEA 1OUVA 3FUMA 5EYPF 3PH0C 2XHEA 1UG3A 3ZVVA 4K03A 3MX3A 4BT8A 3ZFWA 2R5SA 1H0AA 3AU4A 4BESA 3HVEB 4UI9J 5FT9A 4I1AA 3TG4A 2NXPA 3IHVA 5J90A 3LY7A 4AXHA 3NBNB 2JLBA 1N0QA 4NURA 4YDYA 3HXDA 2P58C 3SY2A 3APDA 4RG6A 1NA0A 3JXJA 1TNBA 1N11A 2WXLA 3EHQA 4GTQA 4GAAA 2JEKA 5KNHD 2B6CA 2FI7A 3B7TA 1H2VC 2J07A 4HS2A 2A5EA 5ENPD 2XQ0A 2V5FA 3K9IA 4XI0A 4HI9A 3B13A 4IRUA 2QFCA 4ATGA 3FTYA 4AY6A 4EZJA 2PNNA 4G23A 4EECA 4OAUC 1QZ2A 2OV8A 1VDYA 4AOFA 4GTOA 2F37A 2R17C 1KPSB 3UI2A 3ULEG 3GZ2A 4G11A 5AIJA 3S7DA 5AQAA 3R7QA 2BKKB 3TAXA 2CHWA 4HFGA 2A4ZA 2QZAA 3ABLE 4FADA 3PZ2A 3FUHA 3AS8A 2Y69E 1WDYA 1SQMA 1EYHA 4WNEA 3ULYA 3CKCA 1IQUA 1IHBA 1Z3XA 5EX0A 3KSQA 3DXKG 1WM5A 2CHZA 5G05C 3T8MA 2IONA 4B93B 1E8XA 1FCHA 3OTNA 3RRMB 1D9SA 4PUCA 2XGOA 3KEAA 1MHQA 2WB2A 2VGEA 4F1PA 3FU6A 2Y0BG 2KCVA 4O60A 2V8SE 3DSUA 3SI5A 3EU9A 2HM8A 5EYLA 3R7RA 3EIQC 3QAQA 2VGXB 3QJZA 4HVBA 2XCBA 5ARGA 4PS3A 4UI9K 3JQ1A 2P9LG 3KAEA 3DPYA 4CT4A 3QOUA 5BV1A 4UWHA 4DX6D 3SO8A 2VJ8A 5D0OD 4F6RD 5FQ6A 3E32A 4LCTA 3ABKE 2FO1E 3OXLA 2Y1LE 3IV0A 1TNZA 1WAO1 3FWVA 4B0ZA 4FULA 4B8AA 4MRUA 3UT4A 4FA6A 1U3DA 3P1UA 2OVFA 4J8EA 3HRAA 3LY8A 2Y4UA 3AG3E 3TWWA 3OXFA 3Q9UC 2GRNB 3V2XA 4DLQA 2FEZA 4U0ZA 1INZA 3CSTA 4B8CB 4F53A 2WQ7A 5H7PA 1N0RA 2QYUA 3SHFA 2H6GA 4LG6A 4UQZA 4KVMA 3L6AA 3HYMB 4J6IA 4GCNA 3PEVB 4Q69A 4GZDA 4F3VA 3S7BA 3FUFA 1JUQA 2V4HC 3QDNA 4GCOA 3ZUVB 1DC2A 4DK5A 4I9EA 2BTDA 4U04A 1QNFA 1N94A 4YVOA 3APCA 3DBSA 4UUCA 3CHPA 1K8KG 3ESLA 4QFVA 4U95D 3DSSA 2GGFA 3ML8A 4HNAD 3BG0B 5FIOA 5G04C 3TJPA 1N4SA 1MX2A 4CCAA 3FY4A 3QB2A 4XKBA 5JJTA 1KT0A 3V31A 3DEOA 5EKQD 5BXOA 1SA5A 3LKUA 2AW6A 3KS2A 4ATZD 3LY9A 3PNLB 5EIBE 4KBQA 3E4BA 4O6FA 5HKPA 1S70B 4XE0A 4CDRA 2DIWA 5LCWJ 5FZQA 1V55E 3WXXA 2KATA 2F8XK 4I6GA 1A17A 1XGWA 3E34A 4G26A 5HS0A 4WAFA 2GRLA 1OCCE 2DZOA 3TWXA 2IY0C 1NFIE 3G2TA 4AM9A 2WQHA 3NAWA 5LOZA 4U0UA 1O5MA 4HBDA 3CVXA 3U64A 3UX4A 3EHMA 3SGHA 2VGYA 4CZ2D 3ZYLA 4F1SA 4LUNU 4JA9A 2RKKA 1YA0A 3ONLA 3JUEA 4E85A 3Q5MA 4BFRA 1X81A 4LERA 3NQPA 3AG2E 2VYIA 3UMVA 2F8YA 1MX4A 4APOA 2ZIRA 2XENA 2KM4A 2WXOA 5CCLA 4I9CA 3Q7AA 5FQ7A 4XKCA 4X8QA 3ASOE 5CMWA 3MKRA 3FTZA 3ZYKA 3MJWA 4N39A 2P9PG 2MHKA 2BF0X 2RFMA 1HX8A 3ZKJA 2X6FA 3L16A 2XEVA 2A5UA 1SVXA 5FZRA 5AJDA 3TG5A 2IFUA 4BT9A 5AENA 1BI8B 4C9BB 1MX6A 3UKUG 4I6EA 3MKQA 1Q2ZA 3OAWA 3EHNA 5B3SE 4LNGA 3VLEA 4Q96A 5JHBA 1KZPA 3PE3A 4E6HA 3TWVA 5D0QD 3TWUA 5BV0A 2V0PA 3CIAA 4FJZA 2AXUA 3NB2A 2X6HA 2ZU6B 1H2UA 3CHOA 4FLBA 4TUUA 1HH8A 4J8YA 4JD2G 2IOSA 2YHCA 2OEWA 3ML9A 3SD5A 3TWQA 1V54E 4MS6A 5T4YA 3APFA 3LEWA 3LJNA 3T5VA 1OWMA 5LP0A 3CHRA 3SBTB 3IHYA 4NRHB 3JUIA 2H6FA 4JHRA 4O1PA 1QYMA 1E90A 2BKGA 5AYWD 2VTBA 4R7LA 2R2LA 1S64A 4KZCA 4WWNA 3CSFA 4ME2A 4WNGA 4DI4A 5KJMA 3SFYA 5HI7A 2EQXA 2NC9A 2IO3C 4GYYA 4FC8A 4EBAG 4ABNA 3FH5A 3CK9A 4RQIA 2PM6A 4Z68A 2LO6A 5AN8A 4GU5A 4XX5A 4L9PA 3ASHA 4TV3A 4RLYA 3Q9NC 3TWTA 1E7VA 2UWJG 3CVPA 4KYOB 3AS4A 3RIBA 3AJIA 3DSTA 3FP3A 3I3NA 4J8SA 3UT8A 2XEEA 3J5PA 3SBSA 3RRUA 3L82A 3V30A 5CCMA 3C3QA 3ASDA 3JQ0A 3ONKA 1WY6A 2I2OA 5AQ7A 4LRZA 2PM7A 3U3WA 3CV0A 3FULA 2YINA 3U9WA 3D9NA 4F7AA 1PAQA 4XIFA 5ANLA 4Q94A 2YNQA 4M7CA 3D9OA 3CEQA 3V2OA 4ACLA 4DX1A 3S7JA 2DYRE 2C0MA 2IU1A 5EILA 3I4RB 5ENRD 4BWRA 4JEHA 4BERA 2OOEA 3VTXA 4GA2A 4AV7A 5BXUA 4BY6A 1IHGA 1U3CA 3LVQE 3C3OA 2WXNA 1HXIA 2KZTA 5KNGA 4A3VA 2L6JA 4HXIA 4C0EA 4GMLA 1N9AA 4H7YA 3PUKA 3FUDA 4AJWA 2J49A 4RG9A 2MRIA 3HXBA 3ZRHA 2DCPA 1EPUA 3CVQA 1N4QA 5E75A 2H6HA 4I1MA 3UM3A 4AP2A 2WXGA 2IEJA 2V5QC 4ZHBA 3Q47B 4N3AA 4G24A 4JW1A 3SFZA 2LSVA 2ZGDA 3HXCA 3ZIMA 4D10C 2B0OE 1TNUA 4YDWA 2ZGGA 3WG7E 2WXHA 1TNOA 2PQNA 1LF8A 4HRNA 1QBQA 4TXRA 4JPSA 1TN8A 1SW6A 1SZ9A 1Z5SC 5JJ7A 1UW4B 3GW4A 3SNXA 3C5RA 1HG2A 2F0YA 5DBKA 4L2YA 1UJKA 5BW8C 3UQ3A 3G2VA 3I4GA 4IN3B 1YCSB 4U07A 3DSXA 5ENSD 1PC2A 3NOGD 4RSYA 3MEKA 4P29A 3B7UX 5AQBA 1H6PA 3HIZA 1A5EA 1HU3A 1D8DA 4KXKB 3LJ3A 2EIJE 4GMRA 3ZHEA 3VLDA 2EIKE 3L9TA 4GA1A 4CYMD 3RU0A 2XGMA 4U8YD 2HE0A 3Q7FA 4MKTA 4GZ6A 4CDNA 2PL2A 3TWRA 3LYAA 2ZISA 3E30A 5A23A 1NA3A 2LXLA 4TXPA 4BSXA 4CEMA 4B89A 3ZXPA 5FJYA 2WXKA 1TNYA 1ZB1A 4K0RA 3HXFA 4G25A 1KZOA 2WXPA 4UWFA 4U63A 2XEHA 1Y6IA 5T8IA 5DIZA 5JA4D 3UM0A 3UINC 3LXUX 2IOLA 3AAAC 2WXMA 3MV3B 2L0IA 1O1TA 2E0IA 2J9QA 3D9MA 4EZLA 5D2MC 1HZ4A 3UUXA 1TN6A 3LPZA 4Y6WA 2PQRA 1U2VG 4CT0A 4EBAA 1O1RA 5G05J 2DWZA 5AARA 2OVBA 3ABME 3RO3A 1HO8A 5CEAA 4GTTA 2CFUA 3Q15A 3EUVA 3T5XA 4M3OA 1UOHA 1NZNA 1BD8A 2HR2A
chains in the Genus database with same CATH topology
1HX8A 2X6FA 3L16A 4L2LA 3CVLA 3HVEB 2XEVA 4UI9J 3MCXA 2A5UA 5FT9A 4APFA 4I1AA 5FZRA 1IYGA 3TG4A 2NXPA 5AJDA 3QWWA 3TG5A 2IFUA 4BT9A 1HE8A 1Z6TA 3IHVA 5CMYA 5AENA 5J90A 3LY7A 4AXHA 1GW6A 2WXIA 2JLBA 4U0SA 4C9BB 2X3MA 3QK0A 4NURA 3RRNB 4I6EA 2P58C 3MKQA 5EDSA 1OWOA 3APDA 1XNFA 2NSZA 3U4TA 4RG6A 5A6CA 2HYZA 3FTSA 1NA0A 2WXLA 3EHNA 3OAWA 1JWFA 4GAAA 3VLEA 4Q96A 2JEKA 2YQ8A 1JPLA 3PE3A 5EX3A 5JHBA 4HOUA 2I9CA 4E6HA 4N2SA 4GPKA 4L1BA 5E76A 2FI7A 5D0QD 3B7TA 1W3BA 4JHKA 2X38A 4JVSA 5BV0A 2XRZA 1S0PA 1H2VC 3S7FA 2J07A 4HS2A 2V0PA 5LCWC 3CIAA 3AS5A 2UY1A 5CHEE 2XQ0A 2ONDA 5ANRA 3QWPA 4FJZA 2V5FA 3K9IA 2AXUA 2WMNA 2RG8A 2X6HA 2ZU6B 3LDZA 1H2UA 4XI0A 4ILGA 4WNDA 4ILHB 3TXNA 3CHOA 4EPZA 4AIFA 4FLBA 2R59A 3B13A 2LNIA 1HH8A 1TJCA 4IRUA 2QFCA 4TUUA 3MKQB 2IOSA 2YHCA 4ATGA 3FTYA 3ZXSA 4AY6A 2I6HA 4EZJA 4G23A 2X6KA 5M72A 4EECA 3CQGB 1BPOA 4JZYA 1QZ2A 4BX8A 2OV8A 3ML9A 2XPIA 1VDYA 3SD5A 3BG1B 4MS6A 4AOFA 3OXGA 5T4YA 3APFA 2R17C 3LEWA 4KVOA 3EIJA 4ANUA 3TXMA 3T5VA 1OWMA 4G1TA 1MQSA 3GZ2A 4C0MA 4G11A 4GYWA 5C1DA 2M63A 4IULA 5AIJA 4UWLA 2UY1B 2J09A 3S2AA 3ASFA 1HG5A 3FU5A 3S7DA 5LP0A 4N2QA 3R7QA 3CHRA 1H2TC 3SBTB 3IHYA 4NRHB 5KCMA 4TRQA 3JUIA 4JHRA 3TAXA 4ANXA 4KZ0A 2AVPA 1E90A 2CHWA 4HFGA 5AYWD 2A4ZA 3ZPJA 4A55A 5BPPA 2VTBA 3ESKA 4GYOA 4R7LA 3CR3A 4KZCA 3L22A 4WWNA 3CSFA 4ME2A 4FADA 3FUHA 4FU3A 3FUIA 4AY5A 2KCKA 4WNGA 3AS8A 2WM9A 4DI4A 2KCLA 1SQMA 2VQ2A 2VSXE 1EYHA 3EDTB 2X6IA 4WNEA 3VTYA 5KJMA 2WMOA 2WXJA 3CKCA 5FQ8A 3D9JA 1IQUA 1Z3XA 5HI7A 2EQXA 4V3IA 5EX0A 3PRZA 4A1SA 4JEUA 3NF1A 2NC9A 3FFLA 1HF8A 5J08A 4GYYA 5JHAA 4FP7A 3CK7A 2GW1A 1JWGA 3L54A 2VSYA 4FC8A 4EBAG 4WUYA 5ARFA 4HORA 3PDNA 1B89A 3FDHA 4ABNA 5C2YA 1WM5A 3FH5A 3LCAA 3CK9A 4GA0A 2CHZA 3PVLA 2FF4A 5G05C 3CVUA 4FHKA 3FTXA 2VTBB 1ELRA 3GZSA 2PM6A 4J8FA 3O48A 2VGXA 2LO6A 5FWQA 3T8MA 2IONA 4KMOA 1ELKA 4GU5A 4FHJA 4XX5A 1E8XA 1FCHA 2AXVA 3OTNA 3C98A 3RRMB 4PUCA 2E2EA 2XRYA 1H19A 3ASHA 3FH7A 4TV3A 3ZYQA 2XGOA 1MHQA 2IF4A 1E7VA 2WB2A 2UWJG 3CVPA 4KYOB 4CGWA 3AS4A 3QKYA 3RIBA 2BUGA 2L9BA 3FP3A 3FUKA 3FU6A 3I3NA 4J8SA 3UT8A 5KJNA 3JCKC 3SBSA 3ASGA 5G04J 3RRUA 2KCVA 4UI9C 2V8SE 1OWLA 5CCMA 3ASDA 3JQ0A 3ONKA 3SI5A 3SZ7A 4HOSA 2HM8A 3R7RA 5FZSA 3EIQC 1WY6A 3NZUA 3CHSA 3QAQA 2Y3AA 2VGXB 2I2OA 4I6JA 3ZEFA 4L7TA 3QJZA 5BT1A 4JXTA 4LRZA 2PM7A 3CVYA 4HVBA 3U3WA 2XCBA 3CV0A 3P2BA 4FJYA 5ARGA 3FULA 2YINA 3CHQA 4PS3A 4UI9K 1X5BA 3JQ1A 3U9WA 3KAEA 4H7XA 3D9NA 4CRWA 4F7AA 4GB9A 4CT4A 3L08A 3QOUA 5BV1A 1DVPA 1PAQA 4UWHA 2LSUA 4XI9A 4XIFA 5ANLA 4Q94A 2YNQA 3FTWA 4Y6CA 2VJ8A 5D0OD 4HOTA 3LS8A 2CHXA 3D9OA 3CEQA 4ACLA 4NQ0A 4OVVA 5FQ6A 4LCTA 3S7JA 4DI3A 1UJJA 2C0MA 1QQEA 2IU1A 2VSNA 3I4RB 3PS6A 4BWRA 2QY7A 3FH8A 4JEHA 3QC1A 1E8WA 2MOWA 3OXLA 2LAIA 3ZYMA 3L17A 3VLFA 3IV0A 1E8YA 1H0AA 4I2WA 4PH4B 4OVUA 4UQXA 1WAO1 3MA5A 3FWVA 4B0ZA 2OOEA 4FULA 3VTXA 3FU3A 4B8AA 4JHJA 4MRUA 3UT4A 4RVBA 4FA6A 2CFZA 4GA2A 4AV7A 1U3DA 4I1OB 1KT1A 3P1UA 2OVFA 4J8EA 5KJKA 4AVXA 4BY6A 1Z3YA 1IHGA 1U3CA 3LVQE 3LY8A 4PS8A 4FLHA 2Y4UA 2WXNA 4JC8A 3R9AB 1HXIA 2KZTA 2LAHA 2IQCA 3OXFA 3RKVA 1N54A 4A3VA 2L6JA 4I17A 5A7DB 2GRMA 4HXIA 4C0EA 3AU5A 4GMLA 4DLQA 2FEZA 2HR2A 5BUZA 2WQ6A 4GZ5A 4H7YA 3MZLB 4U0ZA 3UPVA 1INZA 3D9KA 4PDXA 3CSTA 3G2WA 5FQ4A 4B8CB 4A1GA 4F53A 4EZKA 3QWVA 2WQ7A 2WXQA 3PUKA 4ANVA 2I1JA 3FUDA 4AJWA 3RO2A 2J49A 3FTUA 2J4DA 4RG9A 4CDMA 3SHFA 3PNTB 4I2ZA 3PREA 5ENNA 4NACA 3IKOB 3FUNA 2MRIA 4UQZA 3ZRHA 4KVMA 3ZN3A 5BNWA 2DCPA 3GYZA 1EPUA 1N52A 3L6AA 3CVQA 2WVIA 3HYMB 4J6IA 5AJLA 2V4LA 4GCNA 3D9IA 3PEVB 3KEZA 4BTAA 3L13A 3CVNA 3FEXA 5E75A 2KZTB 4I1MA 3MGBA 2DBAA 4AP2A 2WXGA 4Q69A 1E96B 4HLEA 2WXRA 3Q47B 5T3RA 3FHEA 2J08A 3CHMA 4N3AA 4PS7A 4G24A 4JW1A 3CGHA 4GZDA 4N3CA 4F3VA 2Y4TA 3FUEA 3S7BA 3SFZA 3FUFA 1JUQA 4OYSA 2CG2A 2L0TB 2LSVA 3QDNA 3CKBA 3ZIMA 4D10C 4GCOA 4IYPA 1EF1C 4DK5A 4I9EA 2BTDA 4U04A 4KT6B 4BX9A 5KJLA 1QNFA 4YVOA 2C0LA 2Q7FA 1KLXA 3ENEA 3APCA 3DBSA 2WXHA 2KC7A 3CHPA 4J0UA 2PQNA 1LF8A 1FVHA 3ESLA 3UT7A 4MLPA 4JPSA 4JA7A 3KD7A 3PEUB 4QFVA 2GGFA 1SZ9A 3ML8A 3BG0B 3TJPA 5G04C 1DNPA 3ZGQA 3FUJA 2ILRA 5JJ7A 1SZAA 1UW4B 1OWPA 2X6JA 2XPZA 3GW4A 4CCAA 3SNXA 3FY4A 3TL5A 5G2NA 3QB2A 4XKBA 5JJTA 1HG2A 1PY1A 2XGSA 4L2YA 3FTVA 5DBKA 1KT0A 1UJKA 1TEZA 3MYVA 4UQYA 1E7UA 5BW8C 3UQ3A 3EJNA 3G2VA 3I4GA 4IN3B 5EKQD 2XPYA 4ACKA 4U07A 4AEZC 3D3MA 3CVWA 1PC2A 4RSYA 4U8HA 3MEKA 4P29A 3LKUA 3B7UX 4CGVA 3FU0A 4N3BA 2AW6A 3KS2A 4W9RA 3HIZA 3LY9A 3PNLB 4WWPA 3QARA 1HU3A 1Y8MA 4KBQA 2CG3A 4KXKB 3BEEA 4URKA 2HO1A 3E4BA 4O6FA 3B7SA 3I5PA 3LJ3A 2RD0A 3ZHEA 3VLDA 5HQ8A 4YVQC 4A3TA 4XE0A 1ZU2A 4WWOA 3ZW3A 4CDRA 3QNKA 2DIWA 4I43A 5LCWJ 5FZQA 3WXXA 2KATA 3G2SA 1A17A 4GA1A 4I6GA 1XGWA 5JJ6A 2XGMA 3RU0A 4G26A 4WAFA 1ELWA 1HS6A 2IJGX 2GRLA 1H6KA 2AXZA 4MKTA 4YNDA 4GZ6A 5FTPA 3NZSA 3PZDA 4CDNA 4HOQA 3HDXA 3G2UA 2PL2A 2J4BA 4GZCA 3TGOA 3LYAA 3CLJA 1P5QA 3G2TA 4GMJA 4AM9A 2WQHA 1OWNA 5A23A 4DJAA 3HHMA 1HFAA 1NA3A 1FVFA 3ZHEB 1E8ZA 5LOZA 3PE4A 4U0UA 4BSXA 3Q49B 3CVXA 4GZ3A 3U64A 3PUJA 3CK8A 3UX4A 3EHMA 3SGHA 4G2VA 4B89A 4CEMA 4XZ4A 3MV2B 2VGYA 1ZBPA 5FJYA 4ANWA 1NP7A 3ZYLA 3D9LA 3N71A 4B94A 2WXKA 4F1SA 3CVVA 4LUNU 4K0RA 1TJFA 4JA9A 3FEYA 1YA0A 2FO7A 3JYSA 4G25A 4BTBA 2C2LA 2WXFA 2WXPA 3ONLA 4UWFA 3URZA 4E85A 3Q5MA 4BFRA 4U63A 4DLOA 4J8DA 3RK6A 3IBEA 4WNFA 3DPDA 4LEUA 1Y6IA 1EDUA 4JL0A 5T8IA 4LERA 5DIZA 3IEGA 3NQPA 5LFAA 3U66A 4N5CA 2VYIA 3LXUX 3Q4AB 1L5JA 2IOLA 3ULQA 3D9PA 3UMVA 2WXMA 3MV3B 2L0IA 2E0IA 4UWGA 4APOA 2J9QA 4L23A 4UWKA 2WPVA 3D9MA 3GZ1A 5G55A 2KM4A 2WXOA 5CCLA 4ILIA 4EQFA 2FBNA 2XCCA 4EZLA 1HZ4A 3UUXA 3HVEA 3LPZA 4Y6WA 2FULA 1UN8A 2PQRA 4CT0A 4EBAA 1IQRA 3B7RL 2PZIA 4I9CA 2AWIA 5G05J 5FQ7A 4XKCA 5CMWA 2VSOE 2YHEA 1OUVA 3FTZA 2OVBA 3FUMA 3MKRA 3CQCB 4DPRA 3RO3A 3ZYKA 3MJWA 5LX8A 1HO8A 3PH0C 2CFUA 4N39A 3SF4A 2XHEA 3Q15A 3LVRE 2MHKA 1UG3A 3T5XA 1UN9A 3ZVVA 4M3OA 4K03A 3MX3A 1NZNA 2BF0X 3RJVA 3O4ZA 4BT8A 2I1KA 3ZFWA 2R5SA 3AU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3M A;  2KZT B;  4B8C B;  4JHK A;  4CRW A;  4B8A A;  1H2V C;  4JHJ A;  4CT4 A;  4CEM A;  4B89 A;  2VSO E;  1PAQ A;  2IOL A;  3EIJ A;  2GGF A;  1H6K A;  5ANR A;  1HU3 A;  4LUN U;  2ION A;  1UW4 B;  4C9B B;  2VSX E;  4IUL A;  3FEY A;  2HM8 A;  1UG3 A;  2RG8 A;  3EIQ C;  2IU1 A;  2ZU6 B;  1H2U A;  1N52 A;  2NSZ A;  3L6A A;  2KZT A;  2I2O A;  1H2T C;  1N54 A;  4GMJ A;  3JUI A;  3RK6 A;  2IOS A;  3FEX A;  4GML A;  2FUL A; 
#chains in the Genus database with same CATH topology
 3CVL A;  2ETC A;  5EN5 D;  1HE8 A;  1Z6T A;  5CMY A;  1OCO E;  1GW6 A;  2WXI A;  3QK0 A;  1OWO A;  2NSZ A;  3U4T A;  5A6C A;  2HYZ A;  3FTS A;  4JB8 P;  1JWF A;  2XZD G;  3T9K A;  2YQ8 A;  2I9C A;  4N2S A;  4GPK A;  5E76 A;  2LUH A;  4JVS A;  2X38 A;  1S0P A;  4GPM A;  3S7F A;  1JCR A;  3AS5 A;  2UY1 A;  1TR4 A;  3DRA A;  2H6I A;  2OND A;  3QWP A;  4G8K A;  1TYQ G;  2RG8 A;  4GTS A;  3LDZ A;  2L6B A;  5D66 A;  3TXN A;  4EPZ A;  2R59 A;  4BEP A;  2LNI A;  1TJC A;  3MKQ B;  2X6K A;  5M72 A;  3DEP A;  1BU9 A;  3BG1 B;  2EIM E;  3R9M A;  1MYO A;  3EIJ A;  4G1T A;  5C1D A;  4UWL A;  2J09 A;  3S2A A;  3ASF A;  1HG5 A;  3FU5 A;  1H2T C;  3BUA A;  4TRQ A;  4GTM A;  4KZ0 A;  5BPP A;  3L22 A;  5ENO D;  3FUI A;  4AY5 A;  3EU5 A;  1OT8 A;  2WM9 A;  2VQ2 A;  3EDT B;  2X6I A;  3VTY A;  4BET A;  2WMO A;  1OCR E;  2XS1 A;  5ITZ F;  5FQ8 A;  3NF1 A;  1HF8 A;  5J08 A;  4FP7 A;  1H6O A;  3CK7 A;  5CER B;  1JCS A;  4YDO A;  2VSY A;  4WUY A;  5ARF A;  1OCZ E;  4HOR A;  1B89 A;  3FDH A;  5C2Y A;  2ETA A;  3LCA A;  3CVU A;  4FHK A;  3FTX A;  3UXG A;  2VTB B;  4J8F A;  5FWQ A;  4KMO A;  1YYH A;  2AXV A;  2E2E A;  2XRY A;  3ZYQ A;  2IF4 A;  3PZ4 A;  2LXM A;  4CGW A;  2BUG A;  3FUK A;  3ASG A;  1YMP A;  5G04 J;  3DSV A;  4UI9 C;  1OWL A;  2R02 A;  4HOS A;  4HRL A;  5FZS A;  3NZU A;  3CHS A;  2OCC E;  2Y3A A;  3RSE G;  3ZEF A;  4L7T A;  3BQO A;  5BT1 A;  2BED A;  4FJY A;  5ENQ D;  3CHQ A;  4H7X A;  4CRW A;  4GB9 A;  3L08 A;  5AQ9 A;  5JMN D;  3FTW A;  4OVV A;  4DI3 A;  1UJJ A;  2VSN A;  2QY7 A;  3FH8 A;  1E8W A;  4K5B A;  2LAI A;  3ZYM A;  3AG4 E;  3UKR G;  3L17 A;  2IO2 C;  4TXQ A;  5AAO A;  3MA5 A;  3PZ3 A;  2KBX A;  3HXE A;  3FU3 A;  4RVB A;  2CFZ A;  1KT1 A;  3EHR A;  5KJK A;  1Z3Y A;  4PS8 A;  4FLH A;  3D9H A;  2IQC A;  1K1A A;  3RKV A;  5BUZ A;  2WQ6 A;  4GZ5 A;  1NL4 A;  3UPV A;  4EZK A;  2EIN E;  2WXQ A;  2EIL E;  3UM1 A;  4ANV A;  3RO2 A;  3FTU A;  4CDM A;  4NAC A;  3FUN A;  1G3N B;  2OEV A;  3ZN3 A;  4LSZ E;  3GYZ A;  1N52 A;  2WVI A;  2P9K G;  3D9I A;  4K5C A;  3L13 A;  3FEX A;  2KZT B;  2DBA A;  5KWD A;  4HLE A;  5T3R A;  4PS7 A;  3CGH A;  4GTP A;  5B1B E;  1BLX B;  3FUE A;  4OYS A;  3JXI A;  3DSW A;  5KJL A;  1S63 A;  1KLX A;  3ENE A;  2KC7 A;  4J0U A;  1FVH A;  2P9I G;  3UT7 A;  4MLP A;  3KD7 A;  3PEU B;  3FUJ A;  1OWP A;  3TL5 A;  4GTR A;  2XGS A;  3BU8 A;  3MYV A;  4UQY A;  3EJN A;  4AEZ C;  3CVW A;  3SFX A;  4CGV A;  3FU0 A;  1MJ0 A;  4WWP A;  2CG3 A;  2HO1 A;  3I5P A;  4XEI G;  5HQ8 A;  4YVQ C;  4A3T A;  1ZU2 A;  3ZW3 A;  1FT1 A;  3QNK A;  5JJ6 A;  2GRQ B;  4O1O A;  2P9S G;  1OY3 D;  2AXZ A;  4YND A;  5FTP A;  3PZD A;  2J4B A;  3SQV A;  4GZC A;  1N4R A;  5CRV A;  3HHM A;  1HFA A;  1FVF A;  3ZHE B;  3Q49 B;  1LD7 A;  3CK8 A;  4U7E B;  3E37 A;  4XZ4 A;  3MV2 B;  4GTV A;  4EHM A;  4ANW A;  3RAU A;  3N71 A;  3Q79 A;  1BI7 B;  4NIK A;  3CVV A;  1TJF A;  3V79 K;  2C2L A;  3URZ A;  1FT2 A;  4DLO A;  4WNF A;  4LEU A;  4JL0 A;  2AJA A;  1N95 A;  5LFA A;  4N5C A;  3ULQ A;  1L5J A;  3D9P A;  3IXE A;  4L23 A;  3DWL G;  2R05 A;  4ILI A;  4EQF A;  2FBN A;  2XCC A;  1RZ4 A;  3HVE A;  2FUL A;  1UN8 A;  1IQR A;  3B7R L;  4HI8 A;  4DPR A;  2P2C P;  3CQC B;  5LX8 A;  3SF4 A;  4DX2 A;  3LVR E;  1UN9 A;  4U96 D;  1LD8 A;  4C48 B;  3RJV A;  3O4Z A;  2I1K A;  3Q4A B;  4G8L A;  4DRX E;  2JAB A;  4L2L A;  3TWS A;  3MCX A;  4APF A;  1TN7 A;  1IYG A;  3QWW A;  4HLL A;  4N5Q A;  4U0S A;  2X3M A;  3RRN B;  5CEC B;  5EDS A;  1XNF A;  1RW2 A;  3NOC D;  2R03 A;  1JPL A;  5EX3 A;  1OXJ A;  4HOU A;  4L1B A;  4QQI A;  1FPP A;  1W3B A;  4JHK A;  3UTM A;  2XRZ A;  3C3R A;  5LCW C;  5CHE E;  2XS8 A;  5ANR A;  2KXP C;  1LTX A;  2WMN A;  1AP7 A;  4ILG A;  4WND A;  4ILH B;  3PZ1 A;  4AIF A;  3ZXS A;  2I6H A;  1WG0 A;  2XZT G;  3CQG B;  1BPO A;  3B7B A;  4JZY A;  1DCQ A;  4BX8 A;  2XPI A;  4HQD A;  3UIO C;  3OXG A;  1SA4 A;  4KVO A;  4ANU A;  3TXM A;  3DXM G;  1MQS A;  4C0M A;  2DZN A;  4GYW A;  3W9F A;  4LNU D;  2M63 A;  4IUL A;  2UY1 B;  4LNB A;  4N2Q A;  5KCM A;  4ANX A;  2AVP A;  3AG1 E;  3ZPJ A;  2GRO B;  4A55 A;  2ZXW E;  3ESK A;  5CBN A;  4GYO A;  3CR3 A;  4FU3 A;  1DCE A;  2KCK A;  2KCL A;  1D8E A;  2VSX E;  4ZFH A;  2WXJ A;  1AWC B;  3D9J A;  5CED B;  4V3I A;  3PRZ A;  4A1S A;  4JEU A;  3FFL A;  5CRU A;  5JHA A;  2GW1 A;  1JWG A;  3L54 A;  3PDN A;  3HG0 D;  4GA0 A;  3B95 A;  3PVL A;  3Q73 A;  2FF4 A;  1ELR A;  3GZS A;  3O48 A;  2VGX A;  1ELK A;  4FHJ A;  3C98 A;  2ETB A;  1H19 A;  3FH7 A;  2DYS E;  3QKY A;  2L9B A;  5KJN A;  3JCK C;  1K3Z D;  4DX7 D;  3SZ7 A;  4I6J A;  4JXT A;  3CVY A;  3P2B A;  1X5B A;  2GRP B;  2RFA A;  3J5Q B;  2QC9 A;  1DVP A;  2LSU A;  4XI9 A;  4Y6C A;  4HOT A;  2QYJ A;  3LS8 A;  2CHX A;  4NQ0 A;  1QQE A;  3PS6 A;  3QC1 A;  2MOW A;  3VLF A;  1E8Y A;  4I2W A;  4PH4 B;  4OVU A;  4UQX A;  3KSL A;  4JHJ A;  5ENT D;  4I1O B;  4AVX A;  3E33 A;  1K1B A;  4JC8 A;  3R9A B;  5CBO A;  2J8S D;  2LAH A;  1N54 A;  4I17 A;  5A7D B;  2GRM A;  3AU5 A;  5EID A;  4U8V D;  3MZL B;  4HRM B;  1JCQ A;  3D9K A;  4PDX A;  3G2W A;  3W9G A;  5FQ4 A;  4DX5 D;  4A1G A;  3QWV A;  2I1J A;  2J4D A;  3PNT B;  4I2Z A;  3PRE A;  5ENN A;  3IKO B;  3ZNG A;  5BNW A;  4J7W A;  5AJL A;  2V4L A;  4BSZ B;  4K5A B;  4MBG A;  3KEZ A;  4BTA A;  3CVN A;  3MGB A;  5IY5 E;  1E96 B;  2WXR A;  3FHE A;  2J08 A;  3CHM A;  4N3C A;  2Y4T A;  2CG2 A;  2L0T B;  3CKB A;  4IYP A;  1EF1 C;  5KBA A;  4KT6 B;  4OAV B;  4BX9 A;  3C72 A;  2C0L A;  2Q7F A;  4HB5 A;  5HRY A;  3Q78 A;  4JA7 A;  2P9N G;  1DNP A;  3ZGQ A;  2ILR A;  1SZA A;  2MYO A;  2P9U G;  2X6J A;  2XPZ A;  5G2N A;  1PY1 A;  3FTV A;  1TEZ A;  1E7U A;  2XPY A;  4ACK A;  3D3M A;  4U8H A;  4N3B A;  1IXV A;  3F6Q A;  3UIP C;  3ISM C;  4TUM A;  4W9R A;  3QAR A;  1Y8M A;  3BEE A;  4URK A;  4DUI A;  3B7S A;  3X2Q E;  2RD0 A;  3ASN E;  4WWO A;  4I43 A;  3G2S A;  5FIN A;  1ELW A;  1HS6 A;  2IJG X;  1H6K A;  4YDE A;  3NZS A;  1IKN D;  4HOQ A;  3HDX A;  3G2U A;  3T8K A;  3UM2 A;  3TGO A;  3CLJ A;  1P5Q A;  4GMJ A;  1OWN A;  4DJA A;  3ZU7 B;  1E8Z A;  1MZC A;  3PE4 A;  4GZ3 A;  3PUJ A;  4G2V A;  1ZBP A;  1O1S A;  1NP7 A;  3D9L A;  2GRR B;  4B94 A;  3Q75 A;  3FEY A;  2FO7 A;  3JYS A;  4BTB A;  2WXF A;  1NI1 A;  4J8D A;  3RK6 A;  3IBE A;  3DPD A;  1EDU A;  3IEG A;  3U66 A;  2DVW A;  2NYJ A;  4A63 B;  4UWG A;  1N4P A;  4UWK A;  5B1A E;  2WPV A;  3GZ1 A;  5G55 A;  2PZI A;  2AWI A;  2VSO E;  2YHE A;  1OUV A;  3FUM A;  5EYP F;  3PH0 C;  2XHE A;  1UG3 A;  3ZVV A;  4K03 A;  3MX3 A;  4BT8 A;  3ZFW A;  2R5S A;  1H0A A;  3AU4 A;  4BES A;  3HVE B;  4UI9 J;  5FT9 A;  4I1A A;  3TG4 A;  2NXP A;  3IHV A;  5J90 A;  3LY7 A;  4AXH A;  3NBN B;  2JLB A;  1N0Q A;  4NUR A;  4YDY A;  3HXD A;  2P58 C;  3SY2 A;  3APD A;  4RG6 A;  1NA0 A;  3JXJ A;  1TNB A;  1N11 A;  2WXL A;  3EHQ A;  4GTQ A;  4GAA A;  2JEK A;  5KNH D;  2B6C A;  2FI7 A;  3B7T A;  1H2V C;  2J07 A;  4HS2 A;  2A5E A;  5ENP D;  2XQ0 A;  2V5F A;  3K9I A;  4XI0 A;  4HI9 A;  3B13 A;  4IRU A;  2QFC A;  4ATG A;  3FTY A;  4AY6 A;  4EZJ A;  2PNN A;  4G23 A;  4EEC A;  4OAU C;  1QZ2 A;  2OV8 A;  1VDY A;  4AOF A;  4GTO A;  2F37 A;  2R17 C;  1KPS B;  3UI2 A;  3ULE G;  3GZ2 A;  4G11 A;  5AIJ A;  3S7D A;  5AQA A;  3R7Q A;  2BKK B;  3TAX A;  2CHW A;  4HFG A;  2A4Z A;  2QZA A;  3ABL E;  4FAD A;  3PZ2 A;  3FUH A;  3AS8 A;  2Y69 E;  1WDY A;  1SQM A;  1EYH A;  4WNE A;  3ULY A;  3CKC A;  1IQU A;  1IHB A;  1Z3X A;  5EX0 A;  3KSQ A;  3DXK G;  1WM5 A;  2CHZ A;  5G05 C;  3T8M A;  2ION A;  4B93 B;  1E8X A;  1FCH A;  3OTN A;  3RRM B;  1D9S A;  4PUC A;  2XGO A;  3KEA A;  1MHQ A;  2WB2 A;  2VGE A;  4F1P A;  3FU6 A;  2Y0B G;  2KCV A;  4O60 A;  2V8S E;  3DSU A;  3SI5 A;  3EU9 A;  2HM8 A;  5EYL A;  3R7R A;  3EIQ C;  3QAQ A;  2VGX B;  3QJZ A;  4HVB A;  2XCB A;  5ARG A;  4PS3 A;  4UI9 K;  3JQ1 A;  2P9L G;  3KAE A;  3DPY A;  4CT4 A;  3QOU A;  5BV1 A;  4UWH A;  4DX6 D;  3SO8 A;  2VJ8 A;  5D0O D;  4F6R D;  5FQ6 A;  3E32 A;  4LCT A;  3ABK E;  2FO1 E;  3OXL A;  2Y1L E;  3IV0 A;  1TNZ A;  1WAO 1;  3FWV A;  4B0Z A;  4FUL A;  4B8A A;  4MRU A;  3UT4 A;  4FA6 A;  1U3D A;  3P1U A;  2OVF A;  4J8E A;  3HRA A;  3LY8 A;  2Y4U A;  3AG3 E;  3TWW A;  3OXF A;  3Q9U C;  2GRN B;  3V2X A;  4DLQ A;  2FEZ A;  4U0Z A;  1INZ A;  3CST A;  4B8C B;  4F53 A;  2WQ7 A;  5H7P A;  1N0R A;  2QYU A;  3SHF A;  2H6G A;  4LG6 A;  4UQZ A;  4KVM A;  3L6A A;  3HYM B;  4J6I A;  4GCN A;  3PEV B;  4Q69 A;  4GZD A;  4F3V A;  3S7B A;  3FUF A;  1JUQ A;  2V4H C;  3QDN A;  4GCO A;  3ZUV B;  1DC2 A;  4DK5 A;  4I9E A;  2BTD A;  4U04 A;  1QNF A;  1N94 A;  4YVO A;  3APC A;  3DBS A;  4UUC A;  3CHP A;  1K8K G;  3ESL A;  4QFV A;  4U95 D;  3DSS A;  2GGF A;  3ML8 A;  4HNA D;  3BG0 B;  5FIO A;  5G04 C;  3TJP A;  1N4S A;  1MX2 A;  4CCA A;  3FY4 A;  3QB2 A;  4XKB A;  5JJT A;  1KT0 A;  3V31 A;  3DEO A;  5EKQ D;  5BXO A;  1SA5 A;  3LKU A;  2AW6 A;  3KS2 A;  4ATZ D;  3LY9 A;  3PNL B;  5EIB E;  4KBQ A;  3E4B A;  4O6F A;  5HKP A;  1S70 B;  4XE0 A;  4CDR A;  2DIW A;  5LCW J;  5FZQ A;  1V55 E;  3WXX A;  2KAT A;  2F8X K;  4I6G A;  1A17 A;  1XGW A;  3E34 A;  4G26 A;  5HS0 A;  4WAF A;  2GRL A;  1OCC E;  2DZO A;  3TWX A;  2IY0 C;  1NFI E;  3G2T A;  4AM9 A;  2WQH A;  3NAW A;  5LOZ A;  4U0U A;  1O5M A;  4HBD A;  3CVX A;  3U64 A;  3UX4 A;  3EHM A;  3SGH A;  2VGY A;  4CZ2 D;  3ZYL A;  4F1S A;  4LUN U;  4JA9 A;  2RKK A;  1YA0 A;  3ONL A;  3JUE A;  4E85 A;  3Q5M A;  4BFR A;  1X81 A;  4LER A;  3NQP A;  3AG2 E;  2VYI A;  3UMV A;  2F8Y A;  1MX4 A;  4APO A;  2ZIR A;  2XEN A;  2KM4 A;  2WXO A;  5CCL A;  4I9C A;  3Q7A A;  5FQ7 A;  4XKC A;  4X8Q A;  3ASO E;  5CMW A;  3MKR A;  3FTZ A;  3ZYK A;  3MJW A;  4N39 A;  2P9P G;  2MHK A;  2BF0 X;  2RFM A;  1HX8 A;  3ZKJ A;  2X6F A;  3L16 A;  2XEV A;  2A5U A;  1SVX A;  5FZR A;  5AJD A;  3TG5 A;  2IFU A;  4BT9 A;  5AEN A;  1BI8 B;  4C9B B;  1MX6 A;  3UKU G;  4I6E A;  3MKQ A;  1Q2Z A;  3OAW A;  3EHN A;  5B3S E;  4LNG A;  3VLE A;  4Q96 A;  5JHB A;  1KZP A;  3PE3 A;  4E6H A;  3TWV A;  5D0Q D;  3TWU A;  5BV0 A;  2V0P A;  3CIA A;  4FJZ A;  2AXU A;  3NB2 A;  2X6H A;  2ZU6 B;  1H2U A;  3CHO A;  4FLB A;  4TUU A;  1HH8 A;  4J8Y A;  4JD2 G;  2IOS A;  2YHC A;  2OEW A;  3ML9 A;  3SD5 A;  3TWQ A;  1V54 E;  4MS6 A;  5T4Y A;  3APF A;  3LEW A;  3LJN A;  3T5V A;  1OWM A;  5LP0 A;  3CHR A;  3SBT B;  3IHY A;  4NRH B;  3JUI A;  2H6F A;  4JHR A;  4O1P A;  1QYM A;  1E90 A;  2BKG A;  5AYW D;  2VTB A;  4R7L A;  2R2L A;  1S64 A;  4KZC A;  4WWN A;  3CSF A;  4ME2 A;  4WNG A;  4DI4 A;  5KJM A;  3SFY A;  5HI7 A;  2EQX A;  2NC9 A;  2IO3 C;  4GYY A;  4FC8 A;  4EBA G;  4ABN A;  3FH5 A;  3CK9 A;  4RQI A;  2PM6 A;  4Z68 A;  2LO6 A;  5AN8 A;  4GU5 A;  4XX5 A;  4L9P A;  3ASH A;  4TV3 A;  4RLY A;  3Q9N C;  3TWT A;  1E7V A;  2UWJ G;  3CVP A;  4KYO B;  3AS4 A;  3RIB A;  3AJI A;  3DST A;  3FP3 A;  3I3N A;  4J8S A;  3UT8 A;  2XEE A;  3J5P A;  3SBS A;  3RRU A;  3L82 A;  3V30 A;  5CCM A;  3C3Q A;  3ASD A;  3JQ0 A;  3ONK A;  1WY6 A;  2I2O A;  5AQ7 A;  4LRZ A;  2PM7 A;  3U3W A;  3CV0 A;  3FUL A;  2YIN A;  3U9W A;  3D9N A;  4F7A A;  1PAQ A;  4XIF A;  5ANL A;  4Q94 A;  2YNQ A;  4M7C A;  3D9O A;  3CEQ A;  3V2O A;  4ACL A;  4DX1 A;  3S7J A;  2DYR E;  2C0M A;  2IU1 A;  5EIL A;  3I4R B;  5ENR D;  4BWR A;  4JEH A;  4BER A;  2OOE A;  3VTX A;  4GA2 A;  4AV7 A;  5BXU A;  4BY6 A;  1IHG A;  1U3C A;  3LVQ E;  3C3O A;  2WXN A;  1HXI A;  2KZT A;  5KNG A;  4A3V A;  2L6J A;  4HXI A;  4C0E A;  4GML A;  1N9A A;  4H7Y A;  3PUK A;  3FUD A;  4AJW A;  2J49 A;  4RG9 A;  2MRI A;  3HXB A;  3ZRH A;  2DCP A;  1EPU A;  3CVQ A;  1N4Q A;  5E75 A;  2H6H A;  4I1M A;  3UM3 A;  4AP2 A;  2WXG A;  2IEJ A;  2V5Q C;  4ZHB A;  3Q47 B;  4N3A A;  4G24 A;  4JW1 A;  3SFZ A;  2LSV A;  2ZGD A;  3HXC A;  3ZIM A;  4D10 C;  2B0O E;  1TNU A;  4YDW A;  2ZGG A;  3WG7 E;  2WXH A;  1TNO A;  2PQN A;  1LF8 A;  4HRN A;  1QBQ A;  4TXR A;  4JPS A;  1TN8 A;  1SW6 A;  1SZ9 A;  1Z5S C;  5JJ7 A;  1UW4 B;  3GW4 A;  3SNX A;  3C5R A;  1HG2 A;  2F0Y A;  5DBK A;  4L2Y A;  1UJK A;  5BW8 C;  3UQ3 A;  3G2V A;  3I4G A;  4IN3 B;  1YCS B;  4U07 A;  3DSX A;  5ENS D;  1PC2 A;  3NOG D;  4RSY A;  3MEK A;  4P29 A;  3B7U X;  5AQB A;  1H6P A;  3HIZ A;  1A5E A;  1HU3 A;  1D8D A;  4KXK B;  3LJ3 A;  2EIJ E;  4GMR A;  3ZHE A;  3VLD A;  2EIK E;  3L9T A;  4GA1 A;  4CYM D;  3RU0 A;  2XGM A;  4U8Y D;  2HE0 A;  3Q7F A;  4MKT A;  4GZ6 A;  4CDN A;  2PL2 A;  3TWR A;  3LYA A;  2ZIS A;  3E30 A;  5A23 A;  1NA3 A;  2LXL A;  4TXP A;  4BSX A;  4CEM A;  4B89 A;  3ZXP A;  5FJY A;  2WXK A;  1TNY A;  1ZB1 A;  4K0R A;  3HXF A;  4G25 A;  1KZO A;  2WXP A;  4UWF A;  4U63 A;  2XEH A;  1Y6I A;  5T8I A;  5DIZ A;  5JA4 D;  3UM0 A;  3UIN C;  3LXU X;  2IOL A;  3AAA C;  2WXM A;  3MV3 B;  2L0I A;  1O1T A;  2E0I A;  2J9Q A;  3D9M A;  4EZL A;  5D2M C;  1HZ4 A;  3UUX A;  1TN6 A;  3LPZ A;  4Y6W A;  2PQR A;  1U2V G;  4CT0 A;  4EBA A;  1O1R A;  5G05 J;  2DWZ A;  5AAR A;  2OVB A;  3ABM E;  3RO3 A;  1HO8 A;  5CEA A;  4GTT A;  2CFU A;  3Q15 A;  3EUV A;  3T5X A;  4M3O A;  1UOH A;  1NZN A;  1BD8 A;  2HR2 A; 
#chains in the Genus database with same CATH homology
 1HX8 A;  2X6F A;  3L16 A;  4L2L A;  3CVL A;  3HVE B;  2XEV A;  4UI9 J;  3MCX A;  2A5U A;  5FT9 A;  4APF A;  4I1A A;  5FZR A;  1IYG A;  3TG4 A;  2NXP A;  5AJD A;  3QWW A;  3TG5 A;  2IFU A;  4BT9 A;  1HE8 A;  1Z6T A;  3IHV A;  5CMY A;  5AEN A;  5J90 A;  3LY7 A;  4AXH A;  1GW6 A;  2WXI A;  2JLB A;  4U0S A;  4C9B B;  2X3M A;  3QK0 A;  4NUR A;  3RRN B;  4I6E A;  2P58 C;  3MKQ A;  5EDS A;  1OWO A;  3APD A;  1XNF A;  2NSZ A;  3U4T A;  4RG6 A;  5A6C A;  2HYZ A;  3FTS A;  1NA0 A;  2WXL A;  3EHN A;  3OAW A;  1JWF A;  4GAA A;  3VLE A;  4Q96 A;  2JEK A;  2YQ8 A;  1JPL A;  3PE3 A;  5EX3 A;  5JHB A;  4HOU A;  2I9C A;  4E6H A;  4N2S A;  4GPK A;  4L1B A;  5E76 A;  2FI7 A;  5D0Q D;  3B7T A;  1W3B A;  4JHK A;  2X38 A;  4JVS A;  5BV0 A;  2XRZ A;  1S0P A;  1H2V C;  3S7F A;  2J07 A;  4HS2 A;  2V0P A;  5LCW C;  3CIA A;  3AS5 A;  2UY1 A;  5CHE E;  2XQ0 A;  2OND A;  5ANR A;  3QWP A;  4FJZ A;  2V5F A;  3K9I A;  2AXU A;  2WMN A;  2RG8 A;  2X6H A;  2ZU6 B;  3LDZ A;  1H2U A;  4XI0 A;  4ILG A;  4WND A;  4ILH B;  3TXN A;  3CHO A;  4EPZ A;  4AIF A;  4FLB A;  2R59 A;  3B13 A;  2LNI A;  1HH8 A;  1TJC A;  4IRU A;  2QFC A;  4TUU A;  3MKQ B;  2IOS A;  2YHC A;  4ATG A;  3FTY A;  3ZXS A;  4AY6 A;  2I6H A;  4EZJ A;  4G23 A;  2X6K A;  5M72 A;  4EEC A;  3CQG B;  1BPO A;  4JZY A;  1QZ2 A;  4BX8 A;  2OV8 A;  3ML9 A;  2XPI A;  1VDY A;  3SD5 A;  3BG1 B;  4MS6 A;  4AOF A;  3OXG A;  5T4Y A;  3APF A;  2R17 C;  3LEW A;  4KVO A;  3EIJ A;  4ANU A;  3TXM A;  3T5V A;  1OWM A;  4G1T A;  1MQS A;  3GZ2 A;  4C0M A;  4G11 A;  4GYW A;  5C1D A;  2M63 A;  4IUL A;  5AIJ A;  4UWL A;  2UY1 B;  2J09 A;  3S2A A;  3ASF A;  1HG5 A;  3FU5 A;  3S7D A;  5LP0 A;  4N2Q A;  3R7Q A;  3CHR A;  1H2T C;  3SBT B;  3IHY A;  4NRH B;  5KCM A;  4TRQ A;  3JUI A;  4JHR A;  3TAX A;  4ANX A;  4KZ0 A;  2AVP A;  1E90 A;  2CHW A;  4HFG A;  5AYW D;  2A4Z A;  3ZPJ A;  4A55 A;  5BPP A;  2VTB A;  3ESK A;  4GYO A;  4R7L A;  3CR3 A;  4KZC A;  3L22 A;  4WWN A;  3CSF A;  4ME2 A;  4FAD A;  3FUH A;  4FU3 A;  3FUI A;  4AY5 A;  2KCK A;  4WNG A;  3AS8 A;  2WM9 A;  4DI4 A;  2KCL A;  1SQM A;  2VQ2 A;  2VSX E;  1EYH A;  3EDT B;  2X6I A;  4WNE A;  3VTY A;  5KJM A;  2WMO A;  2WXJ A;  3CKC A;  5FQ8 A;  3D9J A;  1IQU A;  1Z3X A;  5HI7 A;  2EQX A;  4V3I A;  5EX0 A;  3PRZ A;  4A1S A;  4JEU A;  3NF1 A;  2NC9 A;  3FFL A;  1HF8 A;  5J08 A;  4GYY A;  5JHA A;  4FP7 A;  3CK7 A;  2GW1 A;  1JWG A;  3L54 A;  2VSY A;  4FC8 A;  4EBA G;  4WUY A;  5ARF A;  4HOR A;  3PDN A;  1B89 A;  3FDH A;  4ABN A;  5C2Y A;  1WM5 A;  3FH5 A;  3LCA A;  3CK9 A;  4GA0 A;  2CHZ A;  3PVL A;  2FF4 A;  5G05 C;  3CVU A;  4FHK A;  3FTX A;  2VTB B;  1ELR A;  3GZS A;  2PM6 A;  4J8F A;  3O48 A;  2VGX A;  2LO6 A;  5FWQ A;  3T8M A;  2ION A;  4KMO A;  1ELK A;  4GU5 A;  4FHJ A;  4XX5 A;  1E8X A;  1FCH A;  2AXV A;  3OTN A;  3C98 A;  3RRM B;  4PUC A;  2E2E A;  2XRY A;  1H19 A;  3ASH A;  3FH7 A;  4TV3 A;  3ZYQ A;  2XGO A;  1MHQ A;  2IF4 A;  1E7V A;  2WB2 A;  2UWJ G;  3CVP A;  4KYO B;  4CGW A;  3AS4 A;  3QKY A;  3RIB A;  2BUG A;  2L9B A;  3FP3 A;  3FUK A;  3FU6 A;  3I3N A;  4J8S A;  3UT8 A;  5KJN A;  3JCK C;  3SBS A;  3ASG A;  5G04 J;  3RRU A;  2KCV A;  4UI9 C;  2V8S E;  1OWL A;  5CCM A;  3ASD A;  3JQ0 A;  3ONK A;  3SI5 A;  3SZ7 A;  4HOS A;  2HM8 A;  3R7R A;  5FZS A;  3EIQ C;  1WY6 A;  3NZU A;  3CHS A;  3QAQ A;  2Y3A A;  2VGX B;  2I2O A;  4I6J A;  3ZEF A;  4L7T A;  3QJZ A;  5BT1 A;  4JXT A;  4LRZ A;  2PM7 A;  3CVY A;  4HVB A;  3U3W A;  2XCB A;  3CV0 A;  3P2B A;  4FJY A;  5ARG A;  3FUL A;  2YIN A;  3CHQ A;  4PS3 A;  4UI9 K;  1X5B A;  3JQ1 A;  3U9W A;  3KAE A;  4H7X A;  3D9N A;  4CRW A;  4F7A A;  4GB9 A;  4CT4 A;  3L08 A;  3QOU A;  5BV1 A;  1DVP A;  1PAQ A;  4UWH A;  2LSU A;  4XI9 A;  4XIF A;  5ANL A;  4Q94 A;  2YNQ A;  3FTW A;  4Y6C A;  2VJ8 A;  5D0O D;  4HOT A;  3LS8 A;  2CHX A;  3D9O A;  3CEQ A;  4ACL A;  4NQ0 A;  4OVV A;  5FQ6 A;  4LCT A;  3S7J A;  4DI3 A;  1UJJ A;  2C0M A;  1QQE A;  2IU1 A;  2VSN A;  3I4R B;  3PS6 A;  4BWR A;  2QY7 A;  3FH8 A;  4JEH A;  3QC1 A;  1E8W A;  2MOW A;  3OXL A;  2LAI A;  3ZYM A;  3L17 A;  3VLF A;  3IV0 A;  1E8Y A;  1H0A A;  4I2W A;  4PH4 B;  4OVU A;  4UQX A;  1WAO 1;  3MA5 A;  3FWV A;  4B0Z A;  2OOE A;  4FUL A;  3VTX A;  3FU3 A;  4B8A A;  4JHJ A;  4MRU A;  3UT4 A;  4RVB A;  4FA6 A;  2CFZ A;  4GA2 A;  4AV7 A;  1U3D A;  4I1O B;  1KT1 A;  3P1U A;  2OVF A;  4J8E A;  5KJK A;  4AVX A;  4BY6 A;  1Z3Y A;  1IHG A;  1U3C A;  3LVQ E;  3LY8 A;  4PS8 A;  4FLH A;  2Y4U A;  2WXN A;  4JC8 A;  3R9A B;  1HXI A;  2KZT A;  2LAH A;  2IQC A;  3OXF A;  3RKV A;  1N54 A;  4A3V A;  2L6J A;  4I17 A;  5A7D B;  2GRM A;  4HXI A;  4C0E A;  3AU5 A;  4GML A;  4DLQ A;  2FEZ A;  2HR2 A;  5BUZ A;  2WQ6 A;  4GZ5 A;  4H7Y A;  3MZL B;  4U0Z A;  3UPV A;  1INZ A;  3D9K A;  4PDX A;  3CST A;  3G2W A;  5FQ4 A;  4B8C B;  4A1G A;  4F53 A;  4EZK A;  3QWV A;  2WQ7 A;  2WXQ A;  3PUK A;  4ANV A;  2I1J A;  3FUD A;  4AJW A;  3RO2 A;  2J49 A;  3FTU A;  2J4D A;  4RG9 A;  4CDM A;  3SHF A;  3PNT B;  4I2Z A;  3PRE A;  5ENN A;  4NAC A;  3IKO B;  3FUN A;  2MRI A;  4UQZ A;  3ZRH A;  4KVM A;  3ZN3 A;  5BNW A;  2DCP A;  3GYZ A;  1EPU A;  1N52 A;  3L6A A;  3CVQ A;  2WVI A;  3HYM B;  4J6I A;  5AJL A;  2V4L A;  4GCN A;  3D9I A;  3PEV B;  3KEZ A;  4BTA A;  3L13 A;  3CVN A;  3FEX A;  5E75 A;  2KZT B;  4I1M A;  3MGB A;  2DBA A;  4AP2 A;  2WXG A;  4Q69 A;  1E96 B;  4HLE A;  2WXR A;  3Q47 B;  5T3R A;  3FHE A;  2J08 A;  3CHM A;  4N3A A;  4PS7 A;  4G24 A;  4JW1 A;  3CGH A;  4GZD A;  4N3C A;  4F3V A;  2Y4T A;  3FUE A;  3S7B A;  3SFZ A;  3FUF A;  1JUQ A;  4OYS A;  2CG2 A;  2L0T B;  2LSV A;  3QDN A;  3CKB A;  3ZIM A;  4D10 C;  4GCO A;  4IYP A;  1EF1 C;  4DK5 A;  4I9E A;  2BTD A;  4U04 A;  4KT6 B;  4BX9 A;  5KJL A;  1QNF A;  4YVO A;  2C0L A;  2Q7F A;  1KLX A;  3ENE A;  3APC A;  3DBS A;  2WXH A;  2KC7 A;  3CHP A;  4J0U A;  2PQN A;  1LF8 A;  1FVH A;  3ESL A;  3UT7 A;  4MLP A;  4JPS A;  4JA7 A;  3KD7 A;  3PEU B;  4QFV A;  2GGF A;  1SZ9 A;  3ML8 A;  3BG0 B;  3TJP A;  5G04 C;  1DNP A;  3ZGQ A;  3FUJ A;  2ILR A;  5JJ7 A;  1SZA A;  1UW4 B;  1OWP A;  2X6J A;  2XPZ A;  3GW4 A;  4CCA A;  3SNX A;  3FY4 A;  3TL5 A;  5G2N A;  3QB2 A;  4XKB A;  5JJT A;  1HG2 A;  1PY1 A;  2XGS A;  4L2Y A;  3FTV A;  5DBK A;  1KT0 A;  1UJK A;  1TEZ A;  3MYV A;  4UQY A;  1E7U A;  5BW8 C;  3UQ3 A;  3EJN A;  3G2V A;  3I4G A;  4IN3 B;  5EKQ D;  2XPY A;  4ACK A;  4U07 A;  4AEZ C;  3D3M A;  3CVW A;  1PC2 A;  4RSY A;  4U8H A;  3MEK A;  4P29 A;  3LKU A;  3B7U X;  4CGV A;  3FU0 A;  4N3B A;  2AW6 A;  3KS2 A;  4W9R A;  3HIZ A;  3LY9 A;  3PNL B;  4WWP A;  3QAR A;  1HU3 A;  1Y8M A;  4KBQ A;  2CG3 A;  4KXK B;  3BEE A;  4URK A;  2HO1 A;  3E4B A;  4O6F A;  3B7S A;  3I5P A;  3LJ3 A;  2RD0 A;  3ZHE A;  3VLD A;  5HQ8 A;  4YVQ C;  4A3T A;  4XE0 A;  1ZU2 A;  4WWO A;  3ZW3 A;  4CDR A;  3QNK A;  2DIW A;  4I43 A;  5LCW J;  5FZQ A;  3WXX A;  2KAT A;  3G2S A;  1A17 A;  4GA1 A;  4I6G A;  1XGW A;  5JJ6 A;  2XGM A;  3RU0 A;  4G26 A;  4WAF A;  1ELW A;  1HS6 A;  2IJG X;  2GRL A;  1H6K A;  2AXZ A;  4MKT A;  4YND A;  4GZ6 A;  5FTP A;  3NZS A;  3PZD A;  4CDN A;  4HOQ A;  3HDX A;  3G2U A;  2PL2 A;  2J4B A;  4GZC A;  3TGO A;  3LYA A;  3CLJ A;  1P5Q A;  3G2T A;  4GMJ A;  4AM9 A;  2WQH A;  1OWN A;  5A23 A;  4DJA A;  3HHM A;  1HFA A;  1NA3 A;  1FVF A;  3ZHE B;  1E8Z A;  5LOZ A;  3PE4 A;  4U0U A;  4BSX A;  3Q49 B;  3CVX A;  4GZ3 A;  3U64 A;  3PUJ A;  3CK8 A;  3UX4 A;  3EHM A;  3SGH A;  4G2V A;  4B89 A;  4CEM A;  4XZ4 A;  3MV2 B;  2VGY A;  1ZBP A;  5FJY A;  4ANW A;  1NP7 A;  3ZYL A;  3D9L A;  3N71 A;  4B94 A;  2WXK A;  4F1S A;  3CVV A;  4LUN U;  4K0R A;  1TJF A;  4JA9 A;  3FEY A;  1YA0 A;  2FO7 A;  3JYS A;  4G25 A;  4BTB A;  2C2L A;  2WXF A;  2WXP A;  3ONL A;  4UWF A;  3URZ A;  4E85 A;  3Q5M A;  4BFR A;  4U63 A;  4DLO A;  4J8D A;  3RK6 A;  3IBE A;  4WNF A;  3DPD A;  4LEU A;  1Y6I A;  1EDU A;  4JL0 A;  5T8I A;  4LER A;  5DIZ A;  3IEG A;  3NQP A;  5LFA A;  3U66 A;  4N5C A;  2VYI A;  3LXU X;  3Q4A B;  1L5J A;  2IOL A;  3ULQ A;  3D9P A;  3UMV A;  2WXM A;  3MV3 B;  2L0I A;  2E0I A;  4UWG A;  4APO A;  2J9Q A;  4L23 A;  4UWK A;  2WPV A;  3D9M A;  3GZ1 A;  5G55 A;  2KM4 A;  2WXO A;  5CCL A;  4ILI A;  4EQF A;  2FBN A;  2XCC A;  4EZL A;  1HZ4 A;  3UUX A;  3HVE A;  3LPZ A;  4Y6W A;  2FUL A;  1UN8 A;  2PQR A;  4CT0 A;  4EBA A;  1IQR A;  3B7R L;  2PZI A;  4I9C A;  2AWI A;  5G05 J;  5FQ7 A;  4XKC A;  5CMW A;  2VSO E;  2YHE A;  1OUV A;  3FTZ A;  2OVB A;  3FUM A;  3MKR A;  3CQC B;  4DPR A;  3RO3 A;  3ZYK A;  3MJW A;  5LX8 A;  1HO8 A;  3PH0 C;  2CFU A;  4N39 A;  3SF4 A;  2XHE A;  3Q15 A;  3LVR E;  2MHK A;  1UG3 A;  3T5X A;  1UN9 A;  3ZVV A;  4M3O A;  4K03 A;  3MX3 A;  1NZN A;  2BF0 X;  3RJV A;  3O4Z A;  4BT8 A;  2I1K A;  3ZFW A;  2R5S A;  3AU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...