3EIQC

Crystal structure of pdcd4-eif4a
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
278
Chain Sequence
ETAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKDCVQARAALDKATVLLSMVWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antitumor protein
molecule keywords Eukaryotic initiation factor 4A-I
publication title Structural basis for translational inhibition by the tumour suppressor Pdcd4
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 278
sequence length 290
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eiqC02
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eiqC01
1H2TC 3EIJA 3FEYA 1H6KA 2ZU6B 3FEXA 4GMLA 1HU3A 1H2UA 1UW4B 2KZTA 3RK6A 1PAQA 4CT4A 2RG8A 1N52A 2IONA 3L6AA 2NSZA 4IULA 4CEMA 2KZTB 4GMJA 4JHKA 4B89A 2GGFA 2FULA 4JHJA 4CRWA 2IOLA 3EIQC 2IOSA 1N54A 1H2VC 2VSXE 5ANRA 1UG3A 2VSOE 4B8CB 2HM8A 4C9BB 2I2OA 3D3MA 2IU1A 4B8AA 4LUNU 3JUIA
chains in the Genus database with same CATH superfamily
4F1PA 3B7TA 3D9OA 4XE0A 4UQXA 2EIJE 2LUHA 3DSSA 3O4ZA 2DYSE 4IULA 4GB9A 1AWCB 3Q7FA 2YHCA 5ITZF 1TYQG 4LSZE 3RO3A 3QWPA 3U64A 3OAWA 5FINA 5KJLA 4NRHB 3FUIA 5BV0A 3ABKE 5H7PA 3QB2A 2J4DA 5KJKA 4BY6A 2ZXWE 3QWWA 1FVFA 1KZPA 3BEEA 3PZ4A 4KBQA 5A7DB 4C0EA 1HG5A 3HXEA 1YMPA 3MKQA 4AP2A 4F1SA 1O1RA 5AIJA 1HO8A 3P2BA 3RRMB 3U66A 1ELKA 2QYUA 4ANVA 3JUEA 5CCLA 2KC7A 4FHKA 2P58C 4TV3A 1OWOA 3V2XA 3IEGA 4YDYA 4XIFA 1OWPA 2ETCA 2WXLA 4Y6CA 3D9JA 3JQ1A 3EHQA 4OVVA 2JABA 2OV8A 4K03A 4L7TA 4Q96A 4L9PA 2L6JA 5BUZA 1TNBA 4FC8A 5HI7A 4CGWA 4LRZA 3DSVA 3J5QB 4TXRA 1IQRA 1K1AA 3EHRA 4G11A 3OXGA 3EIJA 3FEYA 2J9QA 3E34A 4B93B 4DX5D 1Z3XA 1WM5A 3ASGA 1JCQA 2B6CA 5AENA 1HX8A 3TG4A 3B7RL 4RVBA 1IKND 1DC2A 2X3MA 4FADA 3ENEA 1PY1A 5AN8A 4KT6B 1H6PA 3FUFA 5HRYA 4GTRA 5AYWD 3PEVB 2PM6A 2YQ8A 1U3CA 4UWGA 4BSZB 4H7XA 4XEIG 1B89A 4YVQC 3ZKJA 2WXKA 1FVHA 1HH8A 3MA5A 2XZDG 4KMOA 2KM4A 1H6KA 3FTYA 2F37A 4UWHA 1N52A 3TG5A 2EIKE 1LTXA 3TWSA 3PUJA 3DSUA 3NOGD 4JA9A 1WY6A 2Y69E 4CDRA 3TWQA 2Y3AA 3CVVA 4UQZA 4F6RD 3PNLB 1UJJA 4L2YA 1HG2A 4DX1A 4WNGA 4WWOA 3HXFA 4HS2A 3LJ3A 5HQ8A 3OTNA 5ENQD 1MYOA 1SW6A 4UQYA 3BG0B 3U4TA 4ILIA 1TJFA 3DBSA 2MRIA 5JJ7A 4BESA 4HI8A 5HS0A 3FUEA 5CHEE 4AM9A 4AIFA 3S7DA 2WXMA 2OVBA 3GW4A 3AS5A 5CECB 1FCHA 3LCAA 4G2VA 1IQUA 3PZ2A 1TR4A 1K3ZD 5KCMA 3D9LA 3ZYLA 1H0AA 4B89A 3QARA 3R7RA 5FQ6A 4M7CA 4CGVA 1UOHA 1MX4A 2EIME 4KXKB 4FP7A 2YNQA 2XGMA 3G2VA 3ULEG 1D9SA 5AQ7A 3ZYQA 2MHKA 5G04J 2WMOA 3EDTB 3EHMA 3QAQA 3SY2A 3CGHA 4HRLA 3URZA 4U8VD 4A1GA 2XEVA 1Q2ZA 2MOWA 4JZYA 1LD7A 4W9RA 5KNGA 3ZYKA 1OCCE 1BLXB 2J08A 3AG2E 3MV2B 1W3BA 4I17A 2J8SD 2IOLA 3MZLB 4XZ4A 4AJWA 1DCEA 2DYRE 4N3BA 3APDA 5LCWJ 1WG0A 3VLFA 2YINA 1FT2A 3ESKA 5CMWA 1DVPA 5CMYA 3E37A 1Y8MA 5EX0A 1Y6IA 5D2MC 4PS3A 3LY8A 3I5PA 2DZNA 1TNYA 4EZJA 3L13A 5EYLA 5DIZA 5A23A 2VTBA 1OWLA 1YYHA 1EPUA 4C48B 3AJIA 3CHQA 5ENOD 1MJ0A 1NP7A 2P9LG 3HVEA 4J0UA 3L9TA 4FLBA 4GTMA 4EBAG 2ZISA 1E8WA 2IY0C 3UTMA 2EQXA 3Q73A 3UX4A 4J8YA 4J7WA 4I2WA 5ENSD 3L16A 3E33A 4CZ2D 1TNOA 4NACA 4BERA 1ELWA 3DSXA 2VJ8A 1N4SA 4HVBA 3PE3A 4BT9A 2GRNB 2LAHA 2BKKB 3LJNA 3FUDA 1E8ZA 3V31A 3FDHA 2HE0A 4JHRA 5KWDA 4RG6A 1EF1C 4AV7A 3PNTB 5FQ7A 1BU9A 4AOFA 4U8YD 4TRQA 3LXUX 4BTAA 1QBQA 3T8KA 3UKRG 1SZAA 2L0TB 2X6IA 5AQBA 2FBNA 4U96D 3WXXA 1OCRE 1WDYA 3FUJA 2IEJA 1HZ4A 3SD5A 1NA3A 5LP0A 4R7LA 2VGXB 4FU3A 4AY6A 2I1JA 1KLXA 2WXFA 3BUAA 1N0QA 1UN9A 3FTVA 3D9PA 3RO2A 3ZHEB 2IO2C 3TWVA 2V5QC 1N94A 2FF4A 1TN8A 2QY7A 2R59A 3MCXA 4HRNA 2PZIA 3SO8A 3CVUA 4I1MA 2HO1A 2CG2A 3Q49B 3QOUA 4IYPA 4YNDA 2ZIRA 3CVQA 4G8KA 1E8YA 2R5SA 1MHQA 3UT7A 2WXPA 3NF1A 3P1UA 2GRPB 2BEDA 3UPVA 5G55A 3FH5A 3HXCA 4FJYA 1A17A 3MV3B 4DX2A 1S64A 2I1KA 4BETA 5JJTA 3SFYA 4KVOA 1UG3A 2OCCE 3B7SA 2I2OA 5CBNA 3PUKA 4AEZC 3SBSA 3VLEA 1OXJA 2JLBA 4Z68A 2XRYA 2F0YA 3RJVA 2AW6A 3ZXPA 3HRAA 4HFGA 3ZN3A 4MBGA 4B94A 4JW1A 4WNEA 4GTSA 1RW2A 2CFZA 3G2TA 4LNGA 3TGOA 2ZU6B 2XQ0A 4ANXA 3CEQA 1X5BA 1EYHA 1TN7A 3C98A 3TWWA 4C0MA 3UM1A 4APOA 2Y1LE 1UN8A 2DIWA 2YHEA 3U9WA 2WQ6A 3CQCB 1ELRA 1LD8A 2Y0BG 2VQ2A 3D9HA 3EU5A 3JXIA 4HXIA 3PS6A 2GRQB 3FU5A 2J4BA 2XENA 3D9NA 4ATGA 2KCKA 4KYOB 4G8LA 2WB2A 4GCOA 2FEZA 3FUNA 3NB2A 3FTUA 1N4PA 3LEWA 3K9IA 3CVNA 5KJNA 4HLEA 5JHAA 4V3IA 3SBTB 4N2QA 4UI9C 1HS6A 1K8KG 1TEZA 2XS8A 3FH8A 3W9GA 2DBAA 3IKOB 4ACKA 4FHJA 2CHXA 3DPDA 3CHMA 3JCKC 3HXBA 1HXIA 4LEUA 3QNKA 3KEAA 1WAO1 2BF0X 4DJAA 3AS8A 5EIBE 3CSTA 5FQ8A 1Z3YA 2KBXA 2PL2A 5ENNA 2IU1A 3CHPA 3RU0A 3GYZA 2WXHA 2XGSA 3ZPJA 4N39A 2WXIA 3CVLA 3VLDA 5CBOA 3X2QE 4G1TA 3TWTA 4U63A 4J8SA 1E90A 4OAVB 3Q4AB 4O6FA 1MQSA 3MKRA 1HFAA 1OCOE 3LS8A 4UWFA 5BT1A 2CHZA 5BXOA 1GW6A 3CHRA 4GZCA 2WQHA 3HXDA 2WXNA 4DLQA 3ZIMA 4AY5A 4ILGA 3KSLA 3MX3A 3QKYA 1ZBPA 1UJKA 1E7UA 2B0OE 4M3OA 1XGWA 3R9MA 4J8EA 3B7UX 4NIKA 2P9NG 3CK9A 4I2ZA 2NYJA 2E0IA 4Y6WA 3SFZA 4OVUA 4I9EA 3IBEA 3PZDA 4PS7A 4B8CB 3PDNA 4IRUA 3ML8A 4ANWA 3RAUA 5G2NA 3PVLA 3G2UA 4HOTA 2VGEA 4CEMA 3CQGB 3FTSA 4PH4B 2XGOA 3SQVA 1S63A 4RG9A 4GTTA 4B8AA 2X6HA 1ZB1A 2UY1A 3ASFA 3LDZA 2ETBA 3CK8A 4ME2A 1JCRA 3E30A 4GMJA 3ZHEA 1KT1A 5FQ4A 5G05C 4PDXA 1SVXA 1E96B 2I6HA 4HOSA 3S7BA 4A63B 2WM9A 2KXPC 4NURA 3CVPA 4CDNA 3LKUA 5AJLA 4GMLA 4U95D 3NQPA 4O60A 3V30A 3SF4A 1U3DA 2KZTB 2EINE 3ONLA 5C1DA 3PRZA 3NOCD 1O1TA 2GRMA 5D0OD 3Q9UC 2XRZA 3ASOE 3TXNA 1N95A 4DI4A 4PS8A 5EKQD 3CVWA 2GRLA 3NAWA 3ZEFA 3QK0A 4HQDA 3TAXA 3NZSA 3CIAA 5J08A 3Q9NC 4OAUC 3DEOA 4GA0A 1N4QA 2GRRB 4GZ6A 3Q79A 3CVXA 1N54A 3DRAA 3FWVA 3T9KA 4I1OB 4LUNU 4K5CA 3DWLG 4GTQA 4NQ0A 4XI9A 2X6KA 3Q15A 2FI7A 1A5EA 4JEHA 3UM2A 2V4LA 3ZUVB 5EIDA 5ENPD 2X6FA 2F8XK 3Q78A 3MKQB 3KEZA 3AG4E 5ENRD 3APFA 3T5VA 3UUXA 3C3QA 3ZVVA 2OEWA 2P9SG 5FZSA 5FTPA 5LX8A 2KCVA 1YCSB 2XEEA 4WAFA 3RRUA 2XCCA 3FU0A 3OXFA 2OOEA 4I6GA 3AS4A 3UXGA 4Q94A 1SZ9A 4LERA 4B0ZA 5EDSA 2C0MA 3RKVA 4F3VA 4JB8P 2OVFA 2J09A 4WUYA 4G25A 5CERB 4DLOA 5KNHD 3L17A 4GZ5A 4U0ZA 4X8QA 3ZGQA 3AG1E 4F53A 2DCPA 5J90A 2E2EA 4L2LA 4URKA 2LO6A 1JWFA 3Q47B 1OCZE 1SA5A 3PZ3A 4P29A 1KT0A 4HI9A 2ONDA 3AG3E 3W9FA 2IO3C 1OWNA 4FA6A 1YA0A 3D9IA 4F7AA 4WNFA 3G2SA 4K0RA 4U04A 4J8FA 3S2AA 2VSYA 2AVPA 2PM7A 5FT9A 2RKKA 3ZFWA 3HG0D 1H19A 5EILA 3S7JA 3EIQC 5AAOA 3T8MA 4WWNA 3SI5A 3UM3A 2R17C 4XI0A 1H2TC 3TJPA 4DX7D 4O1OA 3FY4A 1P5QA 4YVOA 3RK6A 4JXTA 3MYVA 4DPRA 2L0IA 3B95A 5EN5D 5CCMA 4UI9K 4UI9J 2GW1A 3APCA 1IHGA 3KSQA 3HYMB 4E85A 4H7YA 5HKPA 2XEHA 4FLHA 4JL0A 3CKBA 5BPPA 2WVIA 5JA4D 4GPMA 2NC9A 4GA1A 1NZNA 5DBKA 4DUIA 4QQIA 4N3CA 3ASDA 2AJAA 3JUIA 3CR3A 3AAAC 3E32A 2MYOA 2J49A 1D8DA 3FP3A 3I4RB 3DEPA 2IF4A 3FTWA 2R03A 3PREA 4G26A 5CRVA 1OY3D 4HOUA 4U8HA 5BW8C 2LAIA 4EHMA 2XPZA 1K1BA 2WXJA 2JEKA 3SZ7A 2IONA 3UINC 1N11A 1O5MA 2GGFA 3CHOA 1JCSA 2M63A 4U0UA 4MS6A 4C9BB 3C5RA 1ZU2A 1Z6TA 4UWKA 2CFUA 3C72A 5JJ6A 3LY7A 2KZTA 5B1BE 1NFIE 3QWVA 3ZRHA 4GU5A 2BKGA 2FULA 3ABLE 3FUMA 3L08A 3ZU7B 1MX2A 3Q5MA 2KATA 4EBAA 3FULA 3LVQE 5A6CA 3L22A 2CG3A 4BX9A 4WWPA 1E8XA 3D9KA 4DRXE 4ATZD 3AU5A 2BTDA 4FULA 3CHSA 2QYJA 5FIOA 5BNWA 1PAQA 2I9CA 3L6AA 4BFRA 2V8SE 2ETAA 4A3VA 4BSXA 1JWGA 3CSFA 5D66A 2ILRA 4O1PA 2VSXE 4ILHB 3G2WA 3EUVA 3ESLA 4ANUA 3GZ1A 2Y4UA 1NI1A 2L9BA 4XX5A 3Q75A 3CK7A 2X6JA 4GZDA 2VTBB 3IV0A 2WXGA 3DPYA 3VTYA 4UUCA 4CCAA 3KD7A 2DVWA 2RD0A 5G05J 1QNFA 2LXLA 1QZ2A 3FU6A 1G3NB 4E6HA 1BI8B 3HVEB 5FJYA 2HYZA 3DSWA 4L23A 1V54E 4GYOA 3SNXA 2J07A 2XHEA 3C3OA 3R9AB 3CVYA 4YDOA 5C2YA 5B3SE 5KJMA 5CRUA 3E4BA 5AARA 2IQCA 4WNDA 1H2UA 3BG1B 4I1AA 3PEUB 3HHMA 3KAEA 2UWJG 3NBNB 5BXUA 2WXOA 3SGHA 3FTXA 2ZGGA 5ANRA 2WPVA 2HM8A 1AP7A 4OYSA 4N5CA 3LPZA 1Z5SC 3PH0C 4ACLA 1INZA 2A5UA 5M72A 3IHYA 3C3RA 4RLYA 3FEXA 5JMND 1MZCA 3LY9A 3RIBA 3WG7E 4DK5A 2Y4TA 3O48A 4JD2G 3MGBA 1H2VC 3ABME 2PQNA 3EU9A 2F8YA 2KCLA 3ONKA 2C0LA 2RFMA 1JUQA 3QC1A 5T8IA 2AXUA 3HIZA 2VSOE 2A5EA 2P9IG 2PNNA 2H6IA 1TNZA 3BQOA 2HR2A 5E76A 2R05A 3EJNA 3Q7AA 5ANLA 2NXPA 2DWZA 5T3RA 5IY5E 2VSNA 4EPZA 3UM0A 3SHFA 4MKTA 3VTXA 3OXLA 2GROB 2QFCA 2R2LA 4ABNA 3B13A 1JPLA 4RSYA 4APFA 3ML9A 4JVSA 3HDXA 2VGXA 1HU3A 1D8EA 4CT4A 5ARGA 1H6OA 4GTOA 4XKBA 2IFUA 5KBAA 1TNUA 3J5PA 5FZQA 4CRWA 3BU8A 2P9KG 2AXVA 3TWRA 4UWLA 3AU4A 2WQ7A 4JPSA 2P9UG 4I6JA 3RSEG 4EECA 2QZAA 3R7QA 3DXKG 2IJGX 3DXMG 4TUMA 3TWXA 4GTVA 1OWMA 4GYWA 3FUHA 1OT8A 2WMNA 4G24A 1XNFA 3V2OA 4PUCA 3EHNA 5AJDA 4GTPA 2AWIA 3RRNB 2RG8A 4I6EA 4CDMA 5JHBA 4HNAD 4HLLA 2EILE 2LSVA 4A3TA 4KZCA 2VGYA 3LYAA 3S7FA 3FU3A 3MEKA 3L54A 3ISMC 1L5JA 1BPOA 3FFLA 1RZ4A 3CLJA 1HE8A 2R02A 4ZFHA 5T4YA 2XCBA 1TN6A 4JHJA 4TUUA 2P9PG 4MRUA 4L1BA 3QJZA 4IN3B 2Q7FA 4EZKA 1KZOA 4GAAA 2XZTG 4ZHBA 5LOZA 2LSUA 2FO1E 3CKCA 4GCNA 4FJZA 2L6BA 4K5AB 3F6QA 4EQFA 2PQRA 5ARFA 4BTBA 2CHWA 4KVMA 2XS1A 1SQMA 3CV0A 2V4HC 3PE4A 4LNUD 3N71A 4J8DA 3QDNA 4K5BA 1U2VG 2BUGA 1NA0A 4J6IA 2WXRA 4LNBA 3FH7A 3LVRE 2H6HA 1QYMA 4U0SA 2VYIA 5FWQA 3UIPC 4QFVA 4CYMD 1KPSB 3ASHA 4LCTA 4I43A 1VDYA 4Q69A 3KS2A 4TXQA 4U7EB 3B7BA 1DCQA 4D10C 4N2SA 4JEUA 2LNIA 4HRMB 4AVXA 3NZUA 3MJWA 3ZNGA 4EZLA 2XPYA 2H6GA 4U07A 3GZ2A 4MLPA 3T5XA 1FT1A 2OEVA 2RFAA 2ZGDA 3FHEA 3IXEA 1V55E 3UT4A 3UIOC 4JC8A 5BV1A 5LFAA 3ZXSA 3JQ0A 5ENTD 4GYYA 4N3AA 3FUKA 5FZRA 1N9AA 1S70B 1FPPA 1UW4B 1SA4A 3JXJA 5B1AE 2C2LA 3D9MA 3UI2A 3ZYMA 4GMRA 4YDEA 4HOQA 3FTZA 1S0PA 3U3WA 2XPIA 4CT0A 3ASNE 1PC2A 4HBDA 2H6FA 3TL5A 5CEAA 4A1SA 4A55A 1NL4A 5G04C 1E7VA 4HB5A 3TXMA 5AQAA 5AQ9A 3DSTA 4I9CA 5EX3A 2P2CP 4G23A 4TXPA 2A4ZA 1OUVA 2UY1B 1IXVA 3ULYA 2NSZA 1N0RA 1O1SA 1TJCA 5EYPF 1MX6A 2IOSA 4BX8A 5LCWC 3PZ1A 1N4RA 3UMVA 1HF8A 2V5FA 1QQEA 2LXMA 3SFXA 4XKCA 3UQ3A 4BWRA 2AXZA 4JHKA 3GZSA 3UKUG 4AXHA 1BD8A 2QC9A 3ZW3A 1IHBA 4HORA 4GA2A 3D3MA 3IHVA 2WXQA 1EDUA 5D0QD 1DNPA 3JYSA 4DI3A 4GPKA 2V0PA 3ULQA 1BI7B 3UT8A 4YDWA 2FO7A 4N5QA 1LF8A 3I3NA 4BEPA 3I4GA 2DZOA 4JA7A 4RQIA 3L82A 4LG6A 3V79K 5E75A 4BT8A 4GZ3A 1IYGA 4DX6D 5CEDB 1X81A 2X38A 4KZ0A 3TWUA
chains in the Genus database with same CATH topology
4NQ0A 4AOFA 4XI9A 2X6KA 3B7TA 2KCLA 3D9OA 3Q15A 3ONKA 2FI7A 4XE0A 4UQXA 2C0LA 4TRQA 3LXUX 4BTAA 3O4ZA 1SZAA 4IULA 2L0TB 4JEHA 4GB9A 2X6IA 2V4LA 1JUQA 2FBNA 2YHCA 3QC1A 3WXXA 5T8IA 2AXUA 3HIZA 3RO3A 2X6FA 3FUJA 2VSOE 3QWPA 3U64A 3OAWA 1HZ4A 3SD5A 5KJLA 4NRHB 1NA3A 3FUIA 5BV0A 3MKQB 2HR2A 5E76A 3QB2A 2J4DA 5KJKA 4BY6A 5LP0A 3EJNA 4R7LA 5ANLA 2VGXB 4FU3A 4AY6A 3KEZA 2NXPA 3QWWA 5T3RA 1FVFA 2I1JA 2VSNA 4EPZA 1KLXA 3APFA 3BEEA 2WXFA 3T5VA 4KBQA 1UN9A 3FTVA 5A7DB 3UUXA 3D9PA 3RO2A 3SHFA 4MKTA 3VTXA 3ZHEB 3OXLA 4C0EA 1HG5A 2QFCA 4ABNA 3ZVVA 3B13A 5FZSA 3MKQA 1JPLA 5FTPA 4RSYA 4AP2A 4APFA 4F1SA 5LX8A 2KCVA 2FF4A 3ML9A 4JVSA 4WAFA 2QY7A 2R59A 5AIJA 3HDXA 3MCXA 1HO8A 3RRUA 3P2BA 3RRMB 2PZIA 2VGXA 2XCCA 3FU0A 3CVUA 4I1MA 3OXFA 3U66A 2OOEA 1ELKA 4I6GA 3AS4A 1HU3A 4ANVA 2HO1A 1SZ9A 2CG2A 4Q94A 3Q49B 4CT4A 3QOUA 4LERA 4IYPA 4YNDA 5ARGA 5CCLA 2KC7A 3CVQA 4FHKA 4XKBA 2IFUA 4B0ZA 1E8YA 5EDSA 2C0MA 2R5SA 5FZQA 4CRWA 2P58C 1MHQA 2AXVA 3UT7A 4TV3A 2WXPA 1OWOA 3NF1A 3RKVA 4F3VA 4UWLA 3P1UA 3IEGA 3AU4A 2OVFA 2J09A 4XIFA 3UPVA 4WUYA 1OWPA 2WQ7A 4JPSA 5G55A 2WXLA 4Y6CA 4I6JA 3FH5A 4EECA 4G25A 3R7QA 3D9JA 3JQ1A 4OVVA 4DLOA 2IJGX 3L17A 2OV8A 4FJYA 4K03A 4GZ5A 1A17A 4L7TA 3MV3B 4Q96A 4U0ZA 3ZGQA 2L6JA 5BUZA 4F53A 2I1KA 1OWMA 2DCPA 4FC8A 4GYWA 5J90A 2E2EA 5JJTA 3FUHA 5HI7A 4CGWA 4L2LA 4KVOA 2LO6A 2WMNA 1JWFA 3Q47B 4LRZA 4URKA 4G24A 1XNFA 4P29A 4PUCA 1KT0A 3EHNA 1UG3A 5AJDA 1IQRA 3B7SA 2I2OA 4G11A 2ONDA 3OXGA 3EIJA 3FEYA 3PUKA 2AWIA 2J9QA 3RRNB 4AEZC 1Z3XA 1WM5A 2RG8A 3ASGA 3SBSA 3VLEA 4I6EA 1OWNA 4CDMA 4FA6A 1YA0A 2JLBA 5JHBA 5AENA 1HX8A 2XRYA 3RJVA 3TG4A 3B7RL 2LSVA 3D9IA 2AW6A 4RVBA 4A3TA 4KZCA 4HFGA 2X3MA 4F7AA 3ZN3A 2VGYA 3ENEA 3LYAA 4FADA 4B94A 4JW1A 4WNFA 4WNEA 1PY1A 3S7FA 4KT6B 3G2SA 3FUFA 3FU3A 2CFZA 4K0RA 3MEKA 3L54A 3G2TA 5AYWD 4U04A 3PEVB 2PM6A 4J8FA 1L5JA 2YQ8A 3S2AA 1BPOA 1U3CA 3TGOA 2VSYA 2ZU6B 4UWGA 2XQ0A 3FFLA 4ANXA 2AVPA 3CLJA 3CEQA 4H7XA 1HE8A 1X5BA 1EYHA 2PM7A 5FT9A 5T4YA 3C98A 4C0MA 3ZFWA 2XCBA 1H19A 1B89A 4APOA 4JHJA 3S7JA 1UN8A 4TUUA 4YVQC 2DIWA 2YHEA 3EIQC 4MRUA 3U9WA 2WQ6A 2WXKA 3CQCB 3T8MA 1ELRA 4WWNA 4L1BA 1FVHA 3QJZA 3SI5A 4IN3B 2Q7FA 1HH8A 4EZKA 3MA5A 4GAAA 2R17C 2VQ2A 4KMOA 5LOZA 2LSUA 4XI0A 1H2TC 3TJPA 2KM4A 3CKCA 1H6KA 4GCNA 4HXIA 4FJZA 3FTYA 3PS6A 3FY4A 1P5QA 4YVOA 3RK6A 4EQFA 4JXTA 3FU5A 3MYVA 4UWHA 2J4BA 2PQRA 1N52A 3TG5A 3D9NA 5ARFA 4BTBA 4DPRA 2L0IA 4ATGA 2CHWA 2KCKA 4KVMA 3PUJA 5CCMA 1SQMA 3CV0A 4JA9A 4KYOB 3PE4A 4UI9K 4GCOA 2WB2A 2FEZA 3FUNA 4UI9J 2GW1A 3APCA 3FTUA 1IHGA 1WY6A 3LEWA 3N71A 3HYMB 4E85A 4J8DA 4CDRA 3QDNA 2Y3AA 3K9IA 4H7YA 3CVNA 5KJNA 4HLEA 3CVVA 4UQZA 2BUGA 5JHAA 1NA0A 4J6IA 2WXRA 4V3IA 3PNLB 1UJJA 4FLHA 4JL0A 4L2YA 3CKBA 5BPPA 3FH7A 1HG2A 2WVIA 3SBTB 4N2QA 4UI9C 1HS6A 4WNGA 3LVRE 4WWOA 2NC9A 4HS2A 1TEZA 4U0SA 3FH8A 4GA1A 1NZNA 3LJ3A 5HQ8A 5DBKA 3OTNA 2DBAA 3IKOB 4ACKA 4FHJA 4UQYA 3BG0B 2VYIA 5FWQA 4N3CA 2CHXA 3ASDA 4QFVA 3JUIA 3DPDA 3CHMA 3JCKC 3ASHA 4LCTA 1HXIA 3U4TA 4LEUA 3QNKA 4ILIA 3CR3A 4I43A 1VDYA 1TJFA 4Q69A 3KS2A 3DBSA 1WAO1 2BF0X 2MRIA 4DJAA 3AS8A 4D10C 5JJ7A 2J49A 4N2SA 4JEUA 2LNIA 4AVXA 3FUEA 3NZUA 5CHEE 3FP3A 4AM9A 3I4RB 3MJWA 3CSTA 5FQ8A 1Z3YA 4AIFA 2IF4A 3S7DA 3FTWA 2WXMA 3PREA 4EZLA 2OVBA 3GW4A 5G04J 4G26A 3AS5A 2XPYA 2PL2A 4HOUA 5ENNA 4U8HA 2IU1A 4U07A 1FCHA 3LCAA 3CHPA 2LAIA 3GYZA 5BW8C 3RU0A 3GZ2A 2WXHA 4G2VA 4MLPA 3T5XA 2XGSA 3ZPJA 2XPZA 1IQUA 2WXJA 2JEKA 3SZ7A 3FHEA 2IONA 4N39A 3UT4A 5KCMA 3D9LA 2WXIA 3CVLA 3VLDA 3ZYLA 1H0AA 4B89A 4JC8A 2GGFA 4G1TA 3CHOA 4U63A 5BV1A 4J8SA 5LFAA 1E90A 3QARA 3ZXSA 2M63A 3JQ0A 3R7RA 5FQ6A 3Q4AB 4O6FA 1MQSA 4U0UA 4GYYA 3MKRA 4N3AA 3FUKA 4MS6A 1HFAA 5FZRA 4C9BB 1ZU2A 3LS8A 4CGVA 1Z6TA 4UWKA 2CFUA 4UWFA 5JJ6A 3LY7A 5BT1A 1UW4B 2KZTA 2CHZA 4KXKB 1GW6A 2C2LA 3D9MA 4FP7A 2YNQA 3CHRA 3QWVA 3ZRHA 4GU5A 3ZYMA 2FULA 4GZCA 3FUMA 3L08A 2XGMA 3G2VA 2WQHA 3Q5MA 4HOQA 2KATA 3FTZA 2WXNA 1S0PA 3FULA 4DLQA 4EBAA 3ZIMA 3LVQE 5A6CA 3ZYQA 3L22A 4AY5A 2CG3A 4ILGA 4BX9A 3MX3A 3QKYA 1E8XA 2MHKA 4WWPA 3U3WA 1ZBPA 1UJKA 2WMOA 2XPIA 3D9KA 1E7UA 3CGHA 3EDTB 3EHMA 3QAQA 4M3OA 3URZA 1XGWA 1PC2A 4CT0A 3AU5A 4A1GA 2BTDA 4FULA 4J8EA 3B7UX 3CHSA 3TL5A 5BNWA 2XEVA 1PAQA 4A1SA 2MOWA 3CK9A 2I9CA 4JZYA 4A55A 3L6AA 4W9RA 4BFRA 2V8SE 4I2ZA 3ZYKA 4A3VA 2J08A 5G04C 3MV2B 1E7VA 1W3BA 4I17A 2E0IA 2IOLA 4Y6WA 3TXMA 4BSXA 1JWGA 3CSFA 3MZLB 2ILRA 4XZ4A 3SFZA 2VSXE 4OVUA 4I9EA 3IBEA 3PZDA 4ILHB 4PS7A 4AJWA 4B8CB 3PDNA 4IRUA 4I9CA 3ML8A 4N3BA 5EX3A 4G23A 3G2WA 4ANWA 2A4ZA 3ESLA 1OUVA 5G2NA 3APDA 5LCWJ 4ANUA 3GZ1A 2Y4UA 2UY1B 3PVLA 3VLFA 2L9BA 3G2UA 4XX5A 2NSZA 4HOTA 3CK7A 4CEMA 2X6JA 3CQGB 4GZDA 2YINA 3FTSA 4PH4B 2XGOA 2VTBB 1TJCA 3IV0A 2WXGA 3ESKA 2IOSA 4BX8A 5CMWA 1DVPA 5CMYA 3VTYA 5LCWC 4RG9A 4CCAA 3KD7A 2RD0A 1Y8MA 5G05J 4B8AA 5EX0A 1Y6IA 2X6HA 3UMVA 1QNFA 1HF8A 2V5FA 4PS3A 3LY8A 2UY1A 1QZ2A 3FU6A 1QQEA 4E6HA 3I5PA 3ASFA 3LDZA 4XKCA 4EZJA 3HVEB 5FJYA 3CK8A 3L13A 3UQ3A 4ME2A 4BWRA 2AXZA 5DIZA 2HYZA 5A23A 2VTBA 4GMJA 1OWLA 4JHKA 4L23A 3ZHEA 1EPUA 1KT1A 5FQ4A 5G05C 3GZSA 4GYOA 4AXHA 3CHQA 4PDXA 3SNXA 2J07A 2XHEA 3ZW3A 1E96B 1NP7A 2I6HA 3R9AB 3S7BA 3CVYA 4HOSA 5C2YA 4HORA 4GA2A 5KJMA 3D3MA 3IHVA 2WM9A 2WXQA 4NURA 3E4BA 3HVEA 2IQCA 4J0UA 3CVPA 4CDNA 3LKUA 1EDUA 5D0QD 4WNDA 5AJLA 1DNPA 4FLBA 4GMLA 1H2UA 3BG1B 4I1AA 4EBAG 3NQPA 1E8WA 3JYSA 3PEUB 3SF4A 3HHMA 1U3DA 4DI3A 4GPKA 2EQXA 2V0PA 3ULQA 2KZTB 3KAEA 3UX4A 3UT8A 4I2WA 2UWJG 3ONLA 3L16A 5C1DA 2FO7A 2WXOA 3SGHA 3FTXA 3PRZA 5ANRA 1LF8A 2WPVA 4NACA 1ELWA 2HM8A 2GRMA 4OYSA 3I3NA 4N5CA 5D0OD 3LPZA 2VJ8A 3PH0C 3I4GA 4ACLA 2XRZA 1INZA 3TXNA 4JA7A 4HVBA 2A5UA 5M72A 3IHYA 3PE3A 3FEXA 4BT9A 3LY9A 2LAHA 3RIBA 3FUDA 4DI4A 4PS8A 5EKQD 3CVWA 2GRLA 1E8ZA 3QK0A 3ZEFA 3TAXA 5E75A 3NZSA 3CIAA 3FDHA 4DK5A 5J08A 4GA0A 4BT8A 4JHRA 2Y4TA 3O48A 4RG6A 1EF1C 4GZ6A 4AV7A 3PNTB 3CVXA 1N54A 3MGBA 4GZ3A 3FWVA 1H2VC 1IYGA 5FQ7A 2PQNA 4I1OB 4LUNU 2X38A 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2T C;  3EIJ A;  3FEY A;  1H6K A;  2ZU6 B;  3FEX A;  4GML A;  1HU3 A;  1H2U A;  1UW4 B;  2KZT A;  3RK6 A;  1PAQ A;  4CT4 A;  2RG8 A;  1N52 A;  2ION A;  3L6A A;  2NSZ A;  4IUL A;  4CEM A;  2KZT B;  4GMJ A;  4JHK A;  4B89 A;  2GGF A;  2FUL A;  4JHJ A;  4CRW A;  2IOL A;  3EIQ C;  2IOS A;  1N54 A;  1H2V C;  2VSX E;  5ANR A;  1UG3 A;  2VSO E;  4B8C B;  2HM8 A;  4C9B B;  2I2O A;  3D3M A;  2IU1 A;  4B8A A;  4LUN U;  3JUI A; 
#chains in the Genus database with same CATH topology
 4F1P A;  3B7T A;  3D9O A;  4XE0 A;  4UQX A;  2EIJ E;  2LUH A;  3DSS A;  3O4Z A;  2DYS E;  4IUL A;  4GB9 A;  1AWC B;  3Q7F A;  2YHC A;  5ITZ F;  1TYQ G;  4LSZ E;  3RO3 A;  3QWP A;  3U64 A;  3OAW A;  5FIN A;  5KJL A;  4NRH B;  3FUI A;  5BV0 A;  3ABK E;  5H7P A;  3QB2 A;  2J4D A;  5KJK A;  4BY6 A;  2ZXW E;  3QWW A;  1FVF A;  1KZP A;  3BEE A;  3PZ4 A;  4KBQ A;  5A7D B;  4C0E A;  1HG5 A;  3HXE A;  1YMP A;  3MKQ A;  4AP2 A;  4F1S A;  1O1R A;  5AIJ A;  1HO8 A;  3P2B A;  3RRM B;  3U66 A;  1ELK A;  2QYU A;  4ANV A;  3JUE A;  5CCL A;  2KC7 A;  4FHK A;  2P58 C;  4TV3 A;  1OWO A;  3V2X A;  3IEG A;  4YDY A;  4XIF A;  1OWP A;  2ETC A;  2WXL A;  4Y6C A;  3D9J A;  3JQ1 A;  3EHQ A;  4OVV A;  2JAB A;  2OV8 A;  4K03 A;  4L7T A;  4Q96 A;  4L9P A;  2L6J A;  5BUZ A;  1TNB A;  4FC8 A;  5HI7 A;  4CGW A;  4LRZ A;  3DSV A;  3J5Q B;  4TXR A;  1IQR A;  1K1A A;  3EHR A;  4G11 A;  3OXG A;  3EIJ A;  3FEY A;  2J9Q A;  3E34 A;  4B93 B;  4DX5 D;  1Z3X A;  1WM5 A;  3ASG A;  1JCQ A;  2B6C A;  5AEN A;  1HX8 A;  3TG4 A;  3B7R L;  4RVB A;  1IKN D;  1DC2 A;  2X3M A;  4FAD A;  3ENE A;  1PY1 A;  5AN8 A;  4KT6 B;  1H6P A;  3FUF A;  5HRY A;  4GTR A;  5AYW D;  3PEV B;  2PM6 A;  2YQ8 A;  1U3C A;  4UWG A;  4BSZ B;  4H7X A;  4XEI G;  1B89 A;  4YVQ C;  3ZKJ A;  2WXK A;  1FVH A;  1HH8 A;  3MA5 A;  2XZD G;  4KMO A;  2KM4 A;  1H6K A;  3FTY A;  2F37 A;  4UWH A;  1N52 A;  3TG5 A;  2EIK E;  1LTX A;  3TWS A;  3PUJ A;  3DSU A;  3NOG D;  4JA9 A;  1WY6 A;  2Y69 E;  4CDR A;  3TWQ A;  2Y3A A;  3CVV A;  4UQZ A;  4F6R D;  3PNL B;  1UJJ A;  4L2Y A;  1HG2 A;  4DX1 A;  4WNG A;  4WWO A;  3HXF A;  4HS2 A;  3LJ3 A;  5HQ8 A;  3OTN A;  5ENQ D;  1MYO A;  1SW6 A;  4UQY A;  3BG0 B;  3U4T A;  4ILI A;  1TJF A;  3DBS A;  2MRI A;  5JJ7 A;  4BES A;  4HI8 A;  5HS0 A;  3FUE A;  5CHE E;  4AM9 A;  4AIF A;  3S7D A;  2WXM A;  2OVB A;  3GW4 A;  3AS5 A;  5CEC B;  1FCH A;  3LCA A;  4G2V A;  1IQU A;  3PZ2 A;  1TR4 A;  1K3Z D;  5KCM A;  3D9L A;  3ZYL A;  1H0A A;  4B89 A;  3QAR A;  3R7R A;  5FQ6 A;  4M7C A;  4CGV A;  1UOH A;  1MX4 A;  2EIM E;  4KXK B;  4FP7 A;  2YNQ A;  2XGM A;  3G2V A;  3ULE G;  1D9S A;  5AQ7 A;  3ZYQ A;  2MHK A;  5G04 J;  2WMO A;  3EDT B;  3EHM A;  3QAQ A;  3SY2 A;  3CGH A;  4HRL A;  3URZ A;  4U8V D;  4A1G A;  2XEV A;  1Q2Z A;  2MOW A;  4JZY A;  1LD7 A;  4W9R A;  5KNG A;  3ZYK A;  1OCC E;  1BLX B;  2J08 A;  3AG2 E;  3MV2 B;  1W3B A;  4I17 A;  2J8S D;  2IOL A;  3MZL B;  4XZ4 A;  4AJW A;  1DCE A;  2DYR E;  4N3B A;  3APD A;  5LCW J;  1WG0 A;  3VLF A;  2YIN A;  1FT2 A;  3ESK A;  5CMW A;  1DVP A;  5CMY A;  3E37 A;  1Y8M A;  5EX0 A;  1Y6I A;  5D2M C;  4PS3 A;  3LY8 A;  3I5P A;  2DZN A;  1TNY A;  4EZJ A;  3L13 A;  5EYL A;  5DIZ A;  5A23 A;  2VTB A;  1OWL A;  1YYH A;  1EPU A;  4C48 B;  3AJI A;  3CHQ A;  5ENO D;  1MJ0 A;  1NP7 A;  2P9L G;  3HVE A;  4J0U A;  3L9T A;  4FLB A;  4GTM A;  4EBA G;  2ZIS A;  1E8W A;  2IY0 C;  3UTM A;  2EQX A;  3Q73 A;  3UX4 A;  4J8Y A;  4J7W A;  4I2W A;  5ENS D;  3L16 A;  3E33 A;  4CZ2 D;  1TNO A;  4NAC A;  4BER A;  1ELW A;  3DSX A;  2VJ8 A;  1N4S A;  4HVB A;  3PE3 A;  4BT9 A;  2GRN B;  2LAH A;  2BKK B;  3LJN A;  3FUD A;  1E8Z A;  3V31 A;  3FDH A;  2HE0 A;  4JHR A;  5KWD A;  4RG6 A;  1EF1 C;  4AV7 A;  3PNT B;  5FQ7 A;  1BU9 A;  4AOF A;  4U8Y D;  4TRQ A;  3LXU X;  4BTA A;  1QBQ A;  3T8K A;  3UKR G;  1SZA A;  2L0T B;  2X6I A;  5AQB A;  2FBN A;  4U96 D;  3WXX A;  1OCR E;  1WDY A;  3FUJ A;  2IEJ A;  1HZ4 A;  3SD5 A;  1NA3 A;  5LP0 A;  4R7L A;  2VGX B;  4FU3 A;  4AY6 A;  2I1J A;  1KLX A;  2WXF A;  3BUA A;  1N0Q A;  1UN9 A;  3FTV A;  3D9P A;  3RO2 A;  3ZHE B;  2IO2 C;  3TWV A;  2V5Q C;  1N94 A;  2FF4 A;  1TN8 A;  2QY7 A;  2R59 A;  3MCX A;  4HRN A;  2PZI A;  3SO8 A;  3CVU A;  4I1M A;  2HO1 A;  2CG2 A;  3Q49 B;  3QOU A;  4IYP A;  4YND A;  2ZIR A;  3CVQ A;  4G8K A;  1E8Y A;  2R5S A;  1MHQ A;  3UT7 A;  2WXP A;  3NF1 A;  3P1U A;  2GRP B;  2BED A;  3UPV A;  5G55 A;  3FH5 A;  3HXC A;  4FJY A;  1A17 A;  3MV3 B;  4DX2 A;  1S64 A;  2I1K A;  4BET A;  5JJT A;  3SFY A;  4KVO A;  1UG3 A;  2OCC E;  3B7S A;  2I2O A;  5CBN A;  3PUK A;  4AEZ C;  3SBS A;  3VLE A;  1OXJ A;  2JLB A;  4Z68 A;  2XRY A;  2F0Y A;  3RJV A;  2AW6 A;  3ZXP A;  3HRA A;  4HFG A;  3ZN3 A;  4MBG A;  4B94 A;  4JW1 A;  4WNE A;  4GTS A;  1RW2 A;  2CFZ A;  3G2T A;  4LNG A;  3TGO A;  2ZU6 B;  2XQ0 A;  4ANX A;  3CEQ A;  1X5B A;  1EYH A;  1TN7 A;  3C98 A;  3TWW A;  4C0M A;  3UM1 A;  4APO A;  2Y1L E;  1UN8 A;  2DIW A;  2YHE A;  3U9W A;  2WQ6 A;  3CQC B;  1ELR A;  1LD8 A;  2Y0B G;  2VQ2 A;  3D9H A;  3EU5 A;  3JXI A;  4HXI A;  3PS6 A;  2GRQ B;  3FU5 A;  2J4B A;  2XEN A;  3D9N A;  4ATG A;  2KCK A;  4KYO B;  4G8L A;  2WB2 A;  4GCO A;  2FEZ A;  3FUN A;  3NB2 A;  3FTU A;  1N4P A;  3LEW A;  3K9I A;  3CVN A;  5KJN A;  4HLE A;  5JHA A;  4V3I A;  3SBT B;  4N2Q A;  4UI9 C;  1HS6 A;  1K8K G;  1TEZ A;  2XS8 A;  3FH8 A;  3W9G A;  2DBA A;  3IKO B;  4ACK A;  4FHJ A;  2CHX A;  3DPD A;  3CHM A;  3JCK C;  3HXB A;  1HXI A;  4LEU A;  3QNK A;  3KEA A;  1WAO 1;  2BF0 X;  4DJA A;  3AS8 A;  5EIB E;  3CST A;  5FQ8 A;  1Z3Y A;  2KBX A;  2PL2 A;  5ENN A;  2IU1 A;  3CHP A;  3RU0 A;  3GYZ A;  2WXH A;  2XGS A;  3ZPJ A;  4N39 A;  2WXI A;  3CVL A;  3VLD A;  5CBO A;  3X2Q E;  4G1T A;  3TWT A;  4U63 A;  4J8S A;  1E90 A;  4OAV B;  3Q4A B;  4O6F A;  1MQS A;  3MKR A;  1HFA A;  1OCO E;  3LS8 A;  4UWF A;  5BT1 A;  2CHZ A;  5BXO A;  1GW6 A;  3CHR A;  4GZC A;  2WQH A;  3HXD A;  2WXN A;  4DLQ A;  3ZIM A;  4AY5 A;  4ILG A;  3KSL A;  3MX3 A;  3QKY A;  1ZBP A;  1UJK A;  1E7U A;  2B0O E;  4M3O A;  1XGW A;  3R9M A;  4J8E A;  3B7U X;  4NIK A;  2P9N G;  3CK9 A;  4I2Z A;  2NYJ A;  2E0I A;  4Y6W A;  3SFZ A;  4OVU A;  4I9E A;  3IBE A;  3PZD A;  4PS7 A;  4B8C B;  3PDN A;  4IRU A;  3ML8 A;  4ANW A;  3RAU A;  5G2N A;  3PVL A;  3G2U A;  4HOT A;  2VGE A;  4CEM A;  3CQG B;  3FTS A;  4PH4 B;  2XGO A;  3SQV A;  1S63 A;  4RG9 A;  4GTT A;  4B8A A;  2X6H A;  1ZB1 A;  2UY1 A;  3ASF A;  3LDZ A;  2ETB A;  3CK8 A;  4ME2 A;  1JCR A;  3E30 A;  4GMJ A;  3ZHE A;  1KT1 A;  5FQ4 A;  5G05 C;  4PDX A;  1SVX A;  1E96 B;  2I6H A;  4HOS A;  3S7B A;  4A63 B;  2WM9 A;  2KXP C;  4NUR A;  3CVP A;  4CDN A;  3LKU A;  5AJL A;  4GML A;  4U95 D;  3NQP A;  4O60 A;  3V30 A;  3SF4 A;  1U3D A;  2KZT B;  2EIN E;  3ONL A;  5C1D A;  3PRZ A;  3NOC D;  1O1T A;  2GRM A;  5D0O D;  3Q9U C;  2XRZ A;  3ASO E;  3TXN A;  1N95 A;  4DI4 A;  4PS8 A;  5EKQ D;  3CVW A;  2GRL A;  3NAW A;  3ZEF A;  3QK0 A;  4HQD A;  3TAX A;  3NZS A;  3CIA A;  5J08 A;  3Q9N C;  4OAU C;  3DEO A;  4GA0 A;  1N4Q A;  2GRR B;  4GZ6 A;  3Q79 A;  3CVX A;  1N54 A;  3DRA A;  3FWV A;  3T9K A;  4I1O B;  4LUN U;  4K5C A;  3DWL G;  4GTQ A;  4NQ0 A;  4XI9 A;  2X6K A;  3Q15 A;  2FI7 A;  1A5E A;  4JEH A;  3UM2 A;  2V4L A;  3ZUV B;  5EID A;  5ENP D;  2X6F A;  2F8X K;  3Q78 A;  3MKQ B;  3KEZ A;  3AG4 E;  5ENR D;  3APF A;  3T5V A;  3UUX A;  3C3Q A;  3ZVV A;  2OEW A;  2P9S G;  5FZS A;  5FTP A;  5LX8 A;  2KCV A;  1YCS B;  2XEE A;  4WAF A;  3RRU A;  2XCC A;  3FU0 A;  3OXF A;  2OOE A;  4I6G A;  3AS4 A;  3UXG A;  4Q94 A;  1SZ9 A;  4LER A;  4B0Z A;  5EDS A;  2C0M A;  3RKV A;  4F3V A;  4JB8 P;  2OVF A;  2J09 A;  4WUY A;  4G25 A;  5CER B;  4DLO A;  5KNH D;  3L17 A;  4GZ5 A;  4U0Z A;  4X8Q A;  3ZGQ A;  3AG1 E;  4F53 A;  2DCP A;  5J90 A;  2E2E A;  4L2L A;  4URK A;  2LO6 A;  1JWF A;  3Q47 B;  1OCZ E;  1SA5 A;  3PZ3 A;  4P29 A;  1KT0 A;  4HI9 A;  2OND A;  3AG3 E;  3W9F A;  2IO3 C;  1OWN A;  4FA6 A;  1YA0 A;  3D9I A;  4F7A A;  4WNF A;  3G2S A;  4K0R A;  4U04 A;  4J8F A;  3S2A A;  2VSY A;  2AVP A;  2PM7 A;  5FT9 A;  2RKK A;  3ZFW A;  3HG0 D;  1H19 A;  5EIL A;  3S7J A;  3EIQ C;  5AAO A;  3T8M A;  4WWN A;  3SI5 A;  3UM3 A;  2R17 C;  4XI0 A;  1H2T C;  3TJP A;  4DX7 D;  4O1O A;  3FY4 A;  1P5Q A;  4YVO A;  3RK6 A;  4JXT A;  3MYV A;  4DPR A;  2L0I A;  3B95 A;  5EN5 D;  5CCM A;  4UI9 K;  4UI9 J;  2GW1 A;  3APC A;  1IHG A;  3KSQ A;  3HYM B;  4E85 A;  4H7Y A;  5HKP A;  2XEH A;  4FLH A;  4JL0 A;  3CKB A;  5BPP A;  2WVI A;  5JA4 D;  4GPM A;  2NC9 A;  4GA1 A;  1NZN A;  5DBK A;  4DUI A;  4QQI A;  4N3C A;  3ASD A;  2AJA A;  3JUI A;  3CR3 A;  3AAA C;  3E32 A;  2MYO A;  2J49 A;  1D8D A;  3FP3 A;  3I4R B;  3DEP A;  2IF4 A;  3FTW A;  2R03 A;  3PRE A;  4G26 A;  5CRV A;  1OY3 D;  4HOU A;  4U8H A;  5BW8 C;  2LAI A;  4EHM A;  2XPZ A;  1K1B A;  2WXJ A;  2JEK A;  3SZ7 A;  2ION A;  3UIN C;  1N11 A;  1O5M A;  2GGF A;  3CHO A;  1JCS A;  2M63 A;  4U0U A;  4MS6 A;  4C9B B;  3C5R A;  1ZU2 A;  1Z6T A;  4UWK A;  2CFU A;  3C72 A;  5JJ6 A;  3LY7 A;  2KZT A;  5B1B E;  1NFI E;  3QWV A;  3ZRH A;  4GU5 A;  2BKG A;  2FUL A;  3ABL E;  3FUM A;  3L08 A;  3ZU7 B;  1MX2 A;  3Q5M A;  2KAT A;  4EBA A;  3FUL A;  3LVQ E;  5A6C A;  3L22 A;  2CG3 A;  4BX9 A;  4WWP A;  1E8X A;  3D9K A;  4DRX E;  4ATZ D;  3AU5 A;  2BTD A;  4FUL A;  3CHS A;  2QYJ A;  5FIO A;  5BNW A;  1PAQ A;  2I9C A;  3L6A A;  4BFR A;  2V8S E;  2ETA A;  4A3V A;  4BSX A;  1JWG A;  3CSF A;  5D66 A;  2ILR A;  4O1P A;  2VSX E;  4ILH B;  3G2W A;  3EUV A;  3ESL A;  4ANU A;  3GZ1 A;  2Y4U A;  1NI1 A;  2L9B A;  4XX5 A;  3Q75 A;  3CK7 A;  2X6J A;  4GZD A;  2VTB B;  3IV0 A;  2WXG A;  3DPY A;  3VTY A;  4UUC A;  4CCA A;  3KD7 A;  2DVW A;  2RD0 A;  5G05 J;  1QNF A;  2LXL A;  1QZ2 A;  3FU6 A;  1G3N B;  4E6H A;  1BI8 B;  3HVE B;  5FJY A;  2HYZ A;  3DSW A;  4L23 A;  1V54 E;  4GYO A;  3SNX A;  2J07 A;  2XHE A;  3C3O A;  3R9A B;  3CVY A;  4YDO A;  5C2Y A;  5B3S E;  5KJM A;  5CRU A;  3E4B A;  5AAR A;  2IQC A;  4WND A;  1H2U A;  3BG1 B;  4I1A A;  3PEU B;  3HHM A;  3KAE A;  2UWJ G;  3NBN B;  5BXU A;  2WXO A;  3SGH A;  3FTX A;  2ZGG A;  5ANR A;  2WPV A;  2HM8 A;  1AP7 A;  4OYS A;  4N5C A;  3LPZ A;  1Z5S C;  3PH0 C;  4ACL A;  1INZ A;  2A5U A;  5M72 A;  3IHY A;  3C3R A;  4RLY A;  3FEX A;  5JMN D;  1MZC A;  3LY9 A;  3RIB A;  3WG7 E;  4DK5 A;  2Y4T A;  3O48 A;  4JD2 G;  3MGB A;  1H2V C;  3ABM E;  2PQN A;  3EU9 A;  2F8Y A;  2KCL A;  3ONK A;  2C0L A;  2RFM A;  1JUQ A;  3QC1 A;  5T8I A;  2AXU A;  3HIZ A;  2VSO E;  2A5E A;  2P9I G;  2PNN A;  2H6I A;  1TNZ A;  3BQO A;  2HR2 A;  5E76 A;  2R05 A;  3EJN A;  3Q7A A;  5ANL A;  2NXP A;  2DWZ A;  5T3R A;  5IY5 E;  2VSN A;  4EPZ A;  3UM0 A;  3SHF A;  4MKT A;  3VTX A;  3OXL A;  2GRO B;  2QFC A;  2R2L A;  4ABN A;  3B13 A;  1JPL A;  4RSY A;  4APF A;  3ML9 A;  4JVS A;  3HDX A;  2VGX A;  1HU3 A;  1D8E A;  4CT4 A;  5ARG A;  1H6O A;  4GTO A;  4XKB A;  2IFU A;  5KBA A;  1TNU A;  3J5P A;  5FZQ A;  4CRW A;  3BU8 A;  2P9K G;  2AXV A;  3TWR A;  4UWL A;  3AU4 A;  2WQ7 A;  4JPS A;  2P9U G;  4I6J A;  3RSE G;  4EEC A;  2QZA A;  3R7Q A;  3DXK G;  2IJG X;  3DXM G;  4TUM A;  3TWX A;  4GTV A;  1OWM A;  4GYW A;  3FUH A;  1OT8 A;  2WMN A;  4G24 A;  1XNF A;  3V2O A;  4PUC A;  3EHN A;  5AJD A;  4GTP A;  2AWI A;  3RRN B;  2RG8 A;  4I6E A;  4CDM A;  5JHB A;  4HNA D;  4HLL A;  2EIL E;  2LSV A;  4A3T A;  4KZC A;  2VGY A;  3LYA A;  3S7F A;  3FU3 A;  3MEK A;  3L54 A;  3ISM C;  1L5J A;  1BPO A;  3FFL A;  1RZ4 A;  3CLJ A;  1HE8 A;  2R02 A;  4ZFH A;  5T4Y A;  2XCB A;  1TN6 A;  4JHJ A;  4TUU A;  2P9P G;  4MRU A;  4L1B A;  3QJZ A;  4IN3 B;  2Q7F A;  4EZK A;  1KZO A;  4GAA A;  2XZT G;  4ZHB A;  5LOZ A;  2LSU A;  2FO1 E;  3CKC A;  4GCN A;  4FJZ A;  2L6B A;  4K5A B;  3F6Q A;  4EQF A;  2PQR A;  5ARF A;  4BTB A;  2CHW A;  4KVM A;  2XS1 A;  1SQM A;  3CV0 A;  2V4H C;  3PE4 A;  4LNU D;  3N71 A;  4J8D A;  3QDN A;  4K5B A;  1U2V G;  2BUG A;  1NA0 A;  4J6I A;  2WXR A;  4LNB A;  3FH7 A;  3LVR E;  2H6H A;  1QYM A;  4U0S A;  2VYI A;  5FWQ A;  3UIP C;  4QFV A;  4CYM D;  1KPS B;  3ASH A;  4LCT A;  4I43 A;  1VDY A;  4Q69 A;  3KS2 A;  4TXQ A;  4U7E B;  3B7B A;  1DCQ A;  4D10 C;  4N2S A;  4JEU A;  2LNI A;  4HRM B;  4AVX A;  3NZU A;  3MJW A;  3ZNG A;  4EZL A;  2XPY A;  2H6G A;  4U07 A;  3GZ2 A;  4MLP A;  3T5X A;  1FT1 A;  2OEV A;  2RFA A;  2ZGD A;  3FHE A;  3IXE A;  1V55 E;  3UT4 A;  3UIO C;  4JC8 A;  5BV1 A;  5LFA A;  3ZXS A;  3JQ0 A;  5ENT D;  4GYY A;  4N3A A;  3FUK A;  5FZR A;  1N9A A;  1S70 B;  1FPP A;  1UW4 B;  1SA4 A;  3JXJ A;  5B1A E;  2C2L A;  3D9M A;  3UI2 A;  3ZYM A;  4GMR A;  4YDE A;  4HOQ A;  3FTZ A;  1S0P A;  3U3W A;  2XPI A;  4CT0 A;  3ASN E;  1PC2 A;  4HBD A;  2H6F A;  3TL5 A;  5CEA A;  4A1S A;  4A55 A;  1NL4 A;  5G04 C;  1E7V A;  4HB5 A;  3TXM A;  5AQA A;  5AQ9 A;  3DST A;  4I9C A;  5EX3 A;  2P2C P;  4G23 A;  4TXP A;  2A4Z A;  1OUV A;  2UY1 B;  1IXV A;  3ULY A;  2NSZ A;  1N0R A;  1O1S A;  1TJC A;  5EYP F;  1MX6 A;  2IOS A;  4BX8 A;  5LCW C;  3PZ1 A;  1N4R A;  3UMV A;  1HF8 A;  2V5F A;  1QQE A;  2LXM A;  3SFX A;  4XKC A;  3UQ3 A;  4BWR A;  2AXZ A;  4JHK A;  3GZS A;  3UKU G;  4AXH A;  1BD8 A;  2QC9 A;  3ZW3 A;  1IHB A;  4HOR A;  4GA2 A;  3D3M A;  3IHV A;  2WXQ A;  1EDU A;  5D0Q D;  1DNP A;  3JYS A;  4DI3 A;  4GPK A;  2V0P A;  3ULQ A;  1BI7 B;  3UT8 A;  4YDW A;  2FO7 A;  4N5Q A;  1LF8 A;  3I3N A;  4BEP A;  3I4G A;  2DZO A;  4JA7 A;  4RQI A;  3L82 A;  4LG6 A;  3V79 K;  5E75 A;  4BT8 A;  4GZ3 A;  1IYG A;  4DX6 D;  5CED B;  1X81 A;  2X38 A;  4KZ0 A;  3TWU A; 
#chains in the Genus database with same CATH homology
 4NQ0 A;  4AOF A;  4XI9 A;  2X6K A;  3B7T A;  2KCL A;  3D9O A;  3Q15 A;  3ONK A;  2FI7 A;  4XE0 A;  4UQX A;  2C0L A;  4TRQ A;  3LXU X;  4BTA A;  3O4Z A;  1SZA A;  4IUL A;  2L0T B;  4JEH A;  4GB9 A;  2X6I A;  2V4L A;  1JUQ A;  2FBN A;  2YHC A;  3QC1 A;  3WXX A;  5T8I A;  2AXU A;  3HIZ A;  3RO3 A;  2X6F A;  3FUJ A;  2VSO E;  3QWP A;  3U64 A;  3OAW A;  1HZ4 A;  3SD5 A;  5KJL A;  4NRH B;  1NA3 A;  3FUI A;  5BV0 A;  3MKQ B;  2HR2 A;  5E76 A;  3QB2 A;  2J4D A;  5KJK A;  4BY6 A;  5LP0 A;  3EJN A;  4R7L A;  5ANL A;  2VGX B;  4FU3 A;  4AY6 A;  3KEZ A;  2NXP A;  3QWW A;  5T3R A;  1FVF A;  2I1J A;  2VSN A;  4EPZ A;  1KLX A;  3APF A;  3BEE A;  2WXF A;  3T5V A;  4KBQ A;  1UN9 A;  3FTV A;  5A7D B;  3UUX A;  3D9P A;  3RO2 A;  3SHF A;  4MKT A;  3VTX A;  3ZHE B;  3OXL A;  4C0E A;  1HG5 A;  2QFC A;  4ABN A;  3ZVV A;  3B13 A;  5FZS A;  3MKQ A;  1JPL A;  5FTP A;  4RSY A;  4AP2 A;  4APF A;  4F1S A;  5LX8 A;  2KCV A;  2FF4 A;  3ML9 A;  4JVS A;  4WAF A;  2QY7 A;  2R59 A;  5AIJ A;  3HDX A;  3MCX A;  1HO8 A;  3RRU A;  3P2B A;  3RRM B;  2PZI A;  2VGX A;  2XCC A;  3FU0 A;  3CVU A;  4I1M A;  3OXF A;  3U66 A;  2OOE A;  1ELK A;  4I6G A;  3AS4 A;  1HU3 A;  4ANV A;  2HO1 A;  1SZ9 A;  2CG2 A;  4Q94 A;  3Q49 B;  4CT4 A;  3QOU A;  4LER A;  4IYP A;  4YND A;  5ARG A;  5CCL A;  2KC7 A;  3CVQ A;  4FHK A;  4XKB A;  2IFU A;  4B0Z A;  1E8Y A;  5EDS A;  2C0M A;  2R5S A;  5FZQ A;  4CRW A;  2P58 C;  1MHQ A;  2AXV A;  3UT7 A;  4TV3 A;  2WXP A;  1OWO A;  3NF1 A;  3RKV A;  4F3V A;  4UWL A;  3P1U A;  3IEG A;  3AU4 A;  2OVF A;  2J09 A;  4XIF A;  3UPV A;  4WUY A;  1OWP A;  2WQ7 A;  4JPS A;  5G55 A;  2WXL A;  4Y6C A;  4I6J A;  3FH5 A;  4EEC A;  4G25 A;  3R7Q A;  3D9J A;  3JQ1 A;  4OVV A;  4DLO A;  2IJG X;  3L17 A;  2OV8 A;  4FJY A;  4K03 A;  4GZ5 A;  1A17 A;  4L7T A;  3MV3 B;  4Q96 A;  4U0Z A;  3ZGQ A;  2L6J A;  5BUZ A;  4F53 A;  2I1K A;  1OWM A;  2DCP A;  4FC8 A;  4GYW A;  5J90 A;  2E2E A;  5JJT A;  3FUH A;  5HI7 A;  4CGW A;  4L2L A;  4KVO A;  2LO6 A;  2WMN A;  1JWF A;  3Q47 B;  4LRZ A;  4URK A;  4G24 A;  1XNF A;  4P29 A;  4PUC A;  1KT0 A;  3EHN A;  1UG3 A;  5AJD A;  1IQR A;  3B7S A;  2I2O A;  4G11 A;  2OND A;  3OXG A;  3EIJ A;  3FEY A;  3PUK A;  2AWI A;  2J9Q A;  3RRN B;  4AEZ C;  1Z3X A;  1WM5 A;  2RG8 A;  3ASG A;  3SBS A;  3VLE A;  4I6E A;  1OWN A;  4CDM A;  4FA6 A;  1YA0 A;  2JLB A;  5JHB A;  5AEN A;  1HX8 A;  2XRY A;  3RJV A;  3TG4 A;  3B7R L;  2LSV A;  3D9I A;  2AW6 A;  4RVB A;  4A3T A;  4KZC A;  4HFG A;  2X3M A;  4F7A A;  3ZN3 A;  2VGY A;  3ENE A;  3LYA A;  4FAD A;  4B94 A;  4JW1 A;  4WNF A;  4WNE A;  1PY1 A;  3S7F A;  4KT6 B;  3G2S A;  3FUF A;  3FU3 A;  2CFZ A;  4K0R A;  3MEK A;  3L54 A;  3G2T A;  5AYW D;  4U04 A;  3PEV B;  2PM6 A;  4J8F A;  1L5J A;  2YQ8 A;  3S2A A;  1BPO A;  1U3C A;  3TGO A;  2VSY A;  2ZU6 B;  4UWG A;  2XQ0 A;  3FFL A;  4ANX A;  2AVP A;  3CLJ A;  3CEQ A;  4H7X A;  1HE8 A;  1X5B A;  1EYH A;  2PM7 A;  5FT9 A;  5T4Y A;  3C98 A;  4C0M A;  3ZFW A;  2XCB A;  1H19 A;  1B89 A;  4APO A;  4JHJ A;  3S7J A;  1UN8 A;  4TUU A;  4YVQ C;  2DIW A;  2YHE A;  3EIQ C;  4MRU A;  3U9W A;  2WQ6 A;  2WXK A;  3CQC B;  3T8M A;  1ELR A;  4WWN A;  4L1B A;  1FVH A;  3QJZ A;  3SI5 A;  4IN3 B;  2Q7F A;  1HH8 A;  4EZK A;  3MA5 A;  4GAA A;  2R17 C;  2VQ2 A;  4KMO A;  5LOZ A;  2LSU A;  4XI0 A;  1H2T C;  3TJP A;  2KM4 A;  3CKC A;  1H6K A;  4GCN A;  4HXI A;  4FJZ A;  3FTY A;  3PS6 A;  3FY4 A;  1P5Q A;  4YVO A;  3RK6 A;  4EQF A;  4JXT A;  3FU5 A;  3MYV A;  4UWH A;  2J4B A;  2PQR A;  1N52 A;  3TG5 A;  3D9N A;  5ARF A;  4BTB A;  4DPR A;  2L0I A;  4ATG A;  2CHW A;  2KCK A;  4KVM A;  3PUJ A;  5CCM A;  1SQM A;  3CV0 A;  4JA9 A;  4KYO B;  3PE4 A;  4UI9 K;  4GCO A;  2WB2 A;  2FEZ A;  3FUN A;  4UI9 J;  2GW1 A;  3APC A;  3FTU A;  1IHG A;  1WY6 A;  3LEW A;  3N71 A;  3HYM B;  4E85 A;  4J8D A;  4CDR A;  3QDN A;  2Y3A A;  3K9I A;  4H7Y A;  3CVN A;  5KJN A;  4HLE A;  3CVV A;  4UQZ A;  2BUG A;  5JHA A;  1NA0 A;  4J6I A;  2WXR A;  4V3I A;  3PNL B;  1UJJ A;  4FLH A;  4JL0 A;  4L2Y A;  3CKB A;  5BPP A;  3FH7 A;  1HG2 A;  2WVI A;  3SBT B;  4N2Q A;  4UI9 C;  1HS6 A;  4WNG A;  3LVR E;  4WWO A;  2NC9 A;  4HS2 A;  1TEZ A;  4U0S A;  3FH8 A;  4GA1 A;  1NZN A;  3LJ3 A;  5HQ8 A;  5DBK A;  3OTN A;  2DBA A;  3IKO B;  4ACK A;  4FHJ A;  4UQY A;  3BG0 B;  2VYI A;  5FWQ A;  4N3C A;  2CHX A;  3ASD A;  4QFV A;  3JUI A;  3DPD A;  3CHM A;  3JCK C;  3ASH A;  4LCT A;  1HXI A;  3U4T A;  4LEU A;  3QNK A;  4ILI A;  3CR3 A;  4I43 A;  1VDY A;  1TJF A;  4Q69 A;  3KS2 A;  3DBS A;  1WAO 1;  2BF0 X;  2MRI A;  4DJA A;  3AS8 A;  4D10 C;  5JJ7 A;  2J49 A;  4N2S A;  4JEU A;  2LNI A;  4AVX A;  3FUE A;  3NZU A;  5CHE E;  3FP3 A;  4AM9 A;  3I4R B;  3MJW A;  3CST A;  5FQ8 A;  1Z3Y A;  4AIF A;  2IF4 A;  3S7D A;  3FTW A;  2WXM A;  3PRE A;  4EZL A;  2OVB A;  3GW4 A;  5G04 J;  4G26 A;  3AS5 A;  2XPY A;  2PL2 A;  4HOU A;  5ENN A;  4U8H A;  2IU1 A;  4U07 A;  1FCH A;  3LCA A;  3CHP A;  2LAI A;  3GYZ A;  5BW8 C;  3RU0 A;  3GZ2 A;  2WXH A;  4G2V A;  4MLP A;  3T5X A;  2XGS A;  3ZPJ A;  2XPZ A;  1IQU A;  2WXJ A;  2JEK A;  3SZ7 A;  3FHE A;  2ION A;  4N39 A;  3UT4 A;  5KCM A;  3D9L A;  2WXI A;  3CVL A;  3VLD A;  3ZYL A;  1H0A A;  4B89 A;  4JC8 A;  2GGF A;  4G1T A;  3CHO A;  4U63 A;  5BV1 A;  4J8S A;  5LFA A;  1E90 A;  3QAR A;  3ZXS A;  2M63 A;  3JQ0 A;  3R7R A;  5FQ6 A;  3Q4A B;  4O6F A;  1MQS A;  4U0U A;  4GYY A;  3MKR A;  4N3A A;  3FUK A;  4MS6 A;  1HFA A;  5FZR A;  4C9B B;  1ZU2 A;  3LS8 A;  4CGV A;  1Z6T A;  4UWK A;  2CFU A;  4UWF A;  5JJ6 A;  3LY7 A;  5BT1 A;  1UW4 B;  2KZT A;  2CHZ A;  4KXK B;  1GW6 A;  2C2L A;  3D9M A;  4FP7 A;  2YNQ A;  3CHR A;  3QWV A;  3ZRH A;  4GU5 A;  3ZYM A;  2FUL A;  4GZC A;  3FUM A;  3L08 A;  2XGM A;  3G2V A;  2WQH A;  3Q5M A;  4HOQ A;  2KAT A;  3FTZ A;  2WXN A;  1S0P A;  3FUL A;  4DLQ A;  4EBA A;  3ZIM A;  3LVQ E;  5A6C A;  3ZYQ A;  3L22 A;  4AY5 A;  2CG3 A;  4ILG A;  4BX9 A;  3MX3 A;  3QKY A;  1E8X A;  2MHK A;  4WWP A;  3U3W A;  1ZBP A;  1UJK A;  2WMO A;  2XPI A;  3D9K A;  1E7U A;  3CGH A;  3EDT B;  3EHM A;  3QAQ A;  4M3O A;  3URZ A;  1XGW A;  1PC2 A;  4CT0 A;  3AU5 A;  4A1G A;  2BTD A;  4FUL A;  4J8E A;  3B7U X;  3CHS A;  3TL5 A;  5BNW A;  2XEV A;  1PAQ A;  4A1S A;  2MOW A;  3CK9 A;  2I9C A;  4JZY A;  4A55 A;  3L6A A;  4W9R A;  4BFR A;  2V8S E;  4I2Z A;  3ZYK A;  4A3V A;  2J08 A;  5G04 C;  3MV2 B;  1E7V A;  1W3B A;  4I17 A;  2E0I A;  2IOL A;  4Y6W A;  3TXM A;  4BSX A;  1JWG A;  3CSF A;  3MZL B;  2ILR A;  4XZ4 A;  3SFZ A;  2VSX E;  4OVU A;  4I9E A;  3IBE A;  3PZD A;  4ILH B;  4PS7 A;  4AJW A;  4B8C B;  3PDN A;  4IRU A;  4I9C A;  3ML8 A;  4N3B A;  5EX3 A;  4G23 A;  3G2W A;  4ANW A;  2A4Z A;  3ESL A;  1OUV A;  5G2N A;  3APD A;  5LCW J;  4ANU A;  3GZ1 A;  2Y4U A;  2UY1 B;  3PVL A;  3VLF A;  2L9B A;  3G2U A;  4XX5 A;  2NSZ A;  4HOT A;  3CK7 A;  4CEM A;  2X6J A;  3CQG B;  4GZD A;  2YIN A;  3FTS A;  4PH4 B;  2XGO A;  2VTB B;  1TJC A;  3IV0 A;  2WXG A;  3ESK A;  2IOS A;  4BX8 A;  5CMW A;  1DVP A;  5CMY A;  3VTY A;  5LCW C;  4RG9 A;  4CCA A;  3KD7 A;  2RD0 A;  1Y8M A;  5G05 J;  4B8A A;  5EX0 A;  1Y6I A;  2X6H A;  3UMV A;  1QNF A;  1HF8 A;  2V5F A;  4PS3 A;  3LY8 A;  2UY1 A;  1QZ2 A;  3FU6 A;  1QQE A;  4E6H A;  3I5P A;  3ASF A;  3LDZ A;  4XKC A;  4EZJ A;  3HVE B;  5FJY A;  3CK8 A;  3L13 A;  3UQ3 A;  4ME2 A;  4BWR A;  2AXZ A;  5DIZ A;  2HYZ A;  5A23 A;  2VTB A;  4GMJ A;  1OWL A;  4JHK A;  4L23 A;  3ZHE A;  1EPU A;  1KT1 A;  5FQ4 A;  5G05 C;  3GZS A;  4GYO A;  4AXH A;  3CHQ A;  4PDX A;  3SNX A;  2J07 A;  2XHE A;  3ZW3 A;  1E96 B;  1NP7 A;  2I6H A;  3R9A B;  3S7B A;  3CVY A;  4HOS A;  5C2Y A;  4HOR A;  4GA2 A;  5KJM A;  3D3M A;  3IHV A;  2WM9 A;  2WXQ A;  4NUR A;  3E4B A;  3HVE A;  2IQC A;  4J0U A;  3CVP A;  4CDN A;  3LKU A;  1EDU A;  5D0Q D;  4WND A;  5AJL A;  1DNP A;  4FLB A;  4GML A;  1H2U A;  3BG1 B;  4I1A A;  4EBA G;  3NQP A;  1E8W A;  3JYS A;  3PEU B;  3SF4 A;  3HHM A;  1U3D A;  4DI3 A;  4GPK A;  2EQX A;  2V0P A;  3ULQ A;  2KZT B;  3KAE A;  3UX4 A;  3UT8 A;  4I2W A;  2UWJ G;  3ONL A;  3L16 A;  5C1D A;  2FO7 A;  2WXO A;  3SGH A;  3FTX A;  3PRZ A;  5ANR A;  1LF8 A;  2WPV A;  4NAC A;  1ELW A;  2HM8 A;  2GRM A;  4OYS A;  3I3N A;  4N5C A;  5D0O D;  3LPZ A;  2VJ8 A;  3PH0 C;  3I4G A;  4ACL A;  2XRZ A;  1INZ A;  3TXN A;  4JA7 A;  4HVB A;  2A5U A;  5M72 A;  3IHY A;  3PE3 A;  3FEX A;  4BT9 A;  3LY9 A;  2LAH A;  3RIB A;  3FUD A;  4DI4 A;  4PS8 A;  5EKQ D;  3CVW A;  2GRL A;  1E8Z A;  3QK0 A;  3ZEF A;  3TAX A;  5E75 A;  3NZS A;  3CIA A;  3FDH A;  4DK5 A;  5J08 A;  4GA0 A;  4BT8 A;  4JHR A;  2Y4T A;  3O48 A;  4RG6 A;  1EF1 C;  4GZ6 A;  4AV7 A;  3PNT B;  3CVX A;  1N54 A;  3MGB A;  4GZ3 A;  3FWV A;  1H2V C;  1IYG A;  5FQ7 A;  2PQN A;  4I1O B;  4LUN U;  2X38 A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...