2KCLA

Solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
EDPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetratricopeptide repeat domain protein
publication title Solution NMR structure of tetratricopeptide repeat domain protein SrU_0103 from Salinibacter ruber, Northeast Structural Genomics Consortium (NESG) Target SrR115C
rcsb
source organism Salinibacter ruber
molecule tags Structural genomics, unknown function
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kclA00
4N39A 3S7BA 1IHGA 3CVLA 4GPKA 4BTAA 3GW4A 3ASGA 4G23A 2XGOA 3LKUA 4GCNA 5KJLA 5CHEE 2VGYA 2LNIA 1OUVA 2VSNA 4O6FA 3S7FA 4RG9A 4HORA 3RO2A 5JJTA 3TGOA 4AY6A 4Y6WA 4F3VA 5BT1A 3Q49B 3AS4A 2XCCA 5FZRA 3N71A 2PQNA 1HZ4A 3FP3A 3GZ2A 4ABNA 4WNGA 4AY5A 3SZ7A 4G2VA 1B89A 3LY7A 4YNDA 5BW8C 3UUXA 4GZ6A 4U0UA 2HR2A 5D0OD 1NZNA 4I2ZA 2J9QA 2IF4A 5FZQA 4HOTA 5CCLA 1TJCA 4GCOA 2P58C 4AM9A 4KBQA 4KYOB 2UWJG 2VSYA 2I6HA 4A1SA 3GYZA 5M72A 4N2SA 1WAO1 3PE4A 1ZU2A 1KT1A 1QZ2A 2FF4A 1NA3A 2XGMA 5BNWA 5DIZA 3AS8A 3ASHA 3FFLA 2YHCA 4HOQA 4W9RA 5EKQD 3URZA 3ASFA 2DBAA 5G05C 5FTPA 3SF4A 3MA5A 4RG6A 4GA2A 5JJ7A 2Y4UA 3OXFA 4UQYA 3TG5A 5G04C 4WNDA 5ARGA 4GZ3A 4HOUA 5JJ6A 2VQ2A 2XEVA 4XI9A 2UY1B 2FBNA 3QDNA 4UQZA 3QWWA 4WNFA 2VGXB 3EDTB 4LEUA 4U0ZA 3CK8A 2R5SA 2VGXA 2KCLA 4G24A 3ZPJA 3TAXA 1KT0A 1A17A 2AVPA 3RO3A 2HO1A 2V5FA 4BT8A 3RU0A 4B94A 2KC7A 4J8FA 5FT9A 4JL0A 1NA0A 4N3AA 1QQEA 3CKCA 2PZIA 5LCWJ 3IEGA 3LPZA 2XGSA 3UQ3A 2FEZA 2Y4TA 3Q15A 3GZ1A 3VTXA 2C2LA 3MV2B 3S7JA 4GA1A 4JA9A 2L6JA 3ZFWA 5HQ8A 4YVQC 4JA7A 5ARFA 4I9CA 1HXIA 2PL2A 3LYAA 3MKRA 4WUYA 4U0SA 4KXKB 2KCVA 4IN3B 1KLXA 2GW1A 3ZGQA 3QKYA 3KS2A 3CEQA 3U4TA 2KCKA 3LCAA 3CKBA 4N5CA 4J8DA 3BEEA 3Q47B 2C0MA 2VYIA 4GA0A 4I1AA 3HYMB 4YVOA 4GYOA 4BTBA 4XIFA 3QOUA 4HOSA 3CVQA 3CVPA 1PC2A 2FI7A 2MHKA 3Q4AB 4CGWA 5KJNA 5DBKA 2WPVA 2YQ8A 2UY1A 5EX0A 4N3CA 2XPIA 1E96B 5KJMA 3RJVA 2OOEA 4G25A 4J8EA 4GYYA 2NC9A 4GYWA 3OXGA 4H7YA 2IFUA 4JHRA 4APOA 4U07A 3MEKA 3UPVA 4UI9C 2QFCA 5D0QD 3MV3B 1HH8A 4WNEA 3O48A 3ZN3A 3JYSA 3RIBA 5FZSA 4GZ5A 3ESKA 3QWVA 4NQ0A 4I9EA 4G26A 3RKVA 3PE3A 2WQHA 2C0LA 2FO7A 2JLBA 4CDRA 3FWVA 5AYWD 3LY8A 4G1TA 1WM5A 3TG4A 3NF1A 3CK7A 3ZHEB 2KATA 4NRHB 3ZHEA 4UI9K 3S7DA 4BT9A 3KAEA 3U3WA 3E4BA 3WXXA 5KJKA 2LSVA 1W3BA 3QWPA 5G05J 5LCWC 5HI7A 4EQFA 1ZBPA 1YA0A 2LSUA 3PDNA 1ELWA 1XNFA 4N2QA 2HYZA 2XCBA 2E2EA 4J0UA 5G04J 4Y6CA 3CV0A 2ONDA 4I2WA 4CGVA 4I17A 5A6CA 2PQRA 3LY9A 3KD7A 3ULQA 4ME2A 1FCHA 2Q7FA 5A7DB 3ASDA 4BWRA 5C1DA 5CCMA 5EX3A 3OXLA 3K9IA 2BUGA 3Q5MA 1ELRA 3R9AB 3CVNA 1Y8MA 4UI9J 3VTYA 4XI0A 4U04A 4UQXA 1P5QA 4N3BA 3CK9A 4H7XA 3AS5A 5FJYA 1IYGA 4AIFA
chains in the Genus database with same CATH superfamily
1IHGA 3KEZA 1UJJA 3HRAA 5FQ6A 1S63A 4BTAA 3Q79A 5B1AE 3GW4A 3ASGA 5KNGA 5CBNA 4GCNA 5CHEE 4MKTA 4RG9A 2HM8A 3V2OA 3GZSA 4F7AA 4AXHA 4Y6WA 2P9KG 3FHEA 3AS4A 3PEUB 4CCAA 4FLHA 2PQNA 2WXLA 5FQ7A 2Y69E 4AY5A 2NSZA 3SZ7A 4G2VA 4ATGA 3Q75A 2QY7A 3D9HA 3UUXA 2IU1A 3SO8A 1IQUA 1NZNA 4K5BA 4FJYA 3JCKC 4K5CA 3SFYA 2J9QA 2X6IA 1SA5A 4HOTA 5CCLA 2WQ6A 5AN8A 1QNFA 4KBQA 3I4RB 2EIKE 4KYOB 4ILHB 2UWJG 2VGEA 4OAUC 4A1SA 3GYZA 1K1AA 2R02A 1TN8A 3PE4A 3T8MA 2LUHA 2CFZA 1NA3A 3EIJA 3LS8A 4B8CB 1YYHA 4DI3A 2WXJA 4O1OA 5BNWA 4TXPA 3W9FA 4G11A 3FFLA 1N4QA 4HFGA 4B89A 4HOQA 3ULYA 1IKND 3UM3A 3FU0A 3L22A 4EBAA 3NBNB 2WXFA 3D9NA 5G05C 4CEMA 3RAUA 4URKA 3MA5A 3PNLB 4RG6A 4GA2A 3TG5A 1H0AA 4GZ3A 1YCSB 4HOUA 2LXLA 3AJIA 3SQVA 3Q78A 1OWOA 4JB8P 3EDTB 4LEUA 4C0EA 2KXPC 3CK8A 2R5SA 3CGHA 4GZDA 2J08A 3PZ4A 3CVXA 3B7UX 4N5QA 2J4BA 3TWSA 4ACLA 2V8SE 4BEPA 3NB2A 1H6PA 3C3QA 3DPYA 1TR4A 2DCPA 4FHKA 3V31A 5FT9A 3TWVA 5B3SE 5AAOA 2CFUA 1NA0A 1HX8A 3CVWA 4FP7A 4FA6A 3FTZA 4U63A 4E85A 3CKCA 3IEGA 3LPZA 1OCOE 3UQ3A 2ZU6B 2XS1A 5BV0A 4J8SA 2C2LA 3DSWA 3MV2B 3S7JA 2XRYA 3TXMA 2L6JA 3EJNA 5ARFA 3MKRA 2DVWA 1N4RA 4GTSA 3C5RA 3B7SA 4HS2A 4LCTA 5EYLA 4DK5A 1BPOA 4UWLA 2MRIA 2JABA 2F8YA 2IOSA 4Z68A 4TUUA 2IY0C 3NQPA 3DSVA 4CRWA 3KS2A 3U4TA 3V30A 1HFAA 3AG2E 1H2UA 1HS6A 2RD0A 3LCAA 4YDWA 2X6KA 3QARA 1MX6A 4FJZA 4GTOA 2C0MA 5E76A 4FHJA 4QFVA 1OWMA 3PZ1A 3QB2A 1SVXA 4ZHBA 3I4GA 2IQCA 1UJKA 1O1SA 3B7RL 3JQ0A 3QOUA 4HOSA 4AEZC 4O1PA 4V3IA 3X2QE 3MZLB 1E90A 3CVPA 2VTBB 2FI7A 5LX8A 3MJWA 4ILGA 1OCZE 2WXNA 4AOFA 4U96D 2XPIA 3AG3E 4P29A 5AJLA 2ZXWE 1O1TA 3W9GA 1EDUA 4J8EA 1E7VA 4GTTA 2BKKB 4WWNA 1OWLA 1UG3A 3D9KA 5T8IA 1OXJA 3MV3B 1BU9A 4WNEA 2A4ZA 3O48A 3DSTA 4OVUA 5FZSA 3DEOA 3FTVA 4GZ5A 1VDYA 2V0PA 3PE3A 2WQHA 2C0LA 3LXUX 3OTNA 3FWVA 4XX5A 2A5UA 5D66A 3CIAA 1TNZA 3HXEA 3UM1A 4NRHB 3L54A 4IYPA 1MX4A 5KJKA 4U8HA 3E33A 2YNQA 3TWQA 5HI7A 1ZBPA 5ENQD 4N2QA 3ONLA 4J0UA 3CR3A 4Y6CA 2WXHA 2ONDA 2XZTG 4YDEA 3L9TA 1Z6TA 4I17A 2XEEA 4JC8A 3DRAA 3PNTB 4AJWA 4BERA 5A7DB 1U3DA 1E8XA 1PAQA 2I1JA 5CCMA 5EX3A 4F1SA 3EHQA 1OCCE 2LAHA 3AAAC 1LD8A 4XZ4A 3R9AB 4JEHA 2WMNA 1Y8MA 4UI9J 5EYPF 3MKQA 3QK0A 2XEHA 3ABKE 3ULEG 4MS6A 4H7XA 1K8KG 3AS5A 4MBGA 5EDSA 4LNGA 3CHPA 2B0OE 1IYGA 4M3OA 3ZW3A 3ASOE 4TXRA 3UIPC 2IO2C 4GMJA 2R2LA 3CVLA 2AXUA 2DZNA 1NP7A 2KBXA 3MCXA 3ASNE 4MLPA 2LNIA 2VSNA 1Q2ZA 3C3OA 3VLFA 3SHFA 1TYQG 3P1UA 1HE8A 4GMRA 3EU9A 2OEVA 4J7WA 1E8ZA 5CEAA 2XCCA 1HZ4A 4EZJA 4DLQA 3DSUA 3LVQE 5B1BE 4DX2A 2Y3AA 3Q7AA 3LY7A 5BW8C 4HI9A 4U0UA 4UUCA 2HR2A 5AIJA 3NZSA 4RVBA 1TJCA 2GRPB 4KZ0A 4NURA 3CVUA 1TNYA 2P58C 3ZUVB 4AM9A 4D10C 3FEYA 3CQGB 5FQ4A 2RFMA 3EUVA 4RQIA 4N2SA 2DIWA 3C98A 1KT1A 4K5AB 1TNBA 2FF4A 2XGMA 1FT2A 3Q9UC 2RKKA 4C48B 1UW4B 1EF1C 3ZRHA 4KMOA 1RZ4A 5EKQD 4AVXA 4L2YA 3HXBA 1OWNA 3ASFA 3L17A 4KZCA 3T9KA 5LP0A 5C2YA 3SF4A 3UM0A 5JJ7A 5BUZA 3OXFA 4BETA 4DX5D 5FINA 4WNDA 3RK6A 2IOLA 4FU3A 2VQ2A 4XI9A 3QDNA 2WXMA 4RLYA 1OY3D 3QWWA 1AWCB 4A3TA 2XHEA 1N94A 4HXIA 4GZCA 4ZFHA 5CERB 2VGXA 1DNPA 2KCLA 5KCMA 1LTXA 4G24A 4ANUA 3FDHA 5CECB 1A17A 2DWZA 3SBSA 3ZYKA 4A3VA 1SW6A 4HRMB 3RO3A 1N0QA 2MYOA 2KC7A 4GMLA 2H6GA 4F1PA 1SA4A 3VLEA 1JPLA 4GPMA 3PS6A 5KBAA 2WXOA 2LO6A 2PZIA 5LCWJ 2EILE 5CMWA 4BSXA 3ML8A 1KZOA 3MX3A 2Y4TA 4M7CA 3BU8A 5ITZF 5G55A 2EIME 4LUNU 3BUAA 3V79K 3U9WA 3ZFWA 3D3MA 2XENA 1X5BA 1FVHA 2Y1LE 2IJGX 4JA7A 1HXIA 3LYAA 2WVIA 2OCCE 4WUYA 2PM6A 4ANVA 4GTRA 4KXKB 3FUJA 2IO3C 4CDNA 2KCVA 4JW1A 4WAFA 2WXKA 3QNKA 3D9JA 3NAWA 3R9MA 3VLDA 2CHWA 4TUMA 3CEQA 2KM4A 1H2VC 1HG2A 3CLJA 3KSLA 3LVRE 3G2TA 3SY2A 2J4DA 2X6FA 4HLEA 1MX2A 3G2WA 3ZIMA 2R17C 3HXFA 4CZ2D 4L9PA 4I1AA 4GYOA 1UOHA 4WWOA 3G2SA 5AQBA 2H6FA 3D9MA 2YQ8A 4FC8A 5EX0A 3S2AA 1N4PA 4TXQA 1D8DA 3IV0A 3FU6A 3APCA 3RJVA 2KZTB 2OOEA 3IXEA 5FIOA 1OWPA 3L6AA 4GYYA 4GYWA 4K03A 3OXGA 4H7YA 2IFUA 4JHRA 3UPVA 4I43A 3FH7A 4HBDA 4I6JA 2AW6A 2QFCA 3JQ1A 1HH8A 3ZKJA 3SD5A 3JUIA 1H6KA 3CHQA 1D9SA 4TRQA 4DJAA 3DSSA 2GRQB 5CRUA 1N95A 3ESKA 3QWVA 4I9EA 4A1GA 2ILRA 3RKVA 2EIJE 2YINA 1N0RA 3BG1B 4CDRA 4OAVB 2ZISA 4G1TA 1TEZA 5AENA 3UINC 2ETBA 3TG4A 1ZB1A 3NF1A 3ZHEB 2GROB 4HQDA 2YHEA 5J90A 4FULA 2PNNA 1Z3XA 3IHVA 4BT9A 4OYSA 3B13A 1W3BA 3KSQA 2CHZA 2CG3A 1FVFA 3E30A 2F8XK 4LG6A 2XCBA 1N54A 3UI2A 3KEAA 2E2EA 3SFZA 1MQSA 5G04J 2P9PG 3JXIA 3FEXA 5A6CA 2PQRA 4L7TA 3ASDA 2R05A 4I6GA 5C1DA 5KWDA 4HVBA 4B8AA 3PREA 1NI1A 5CEDB 3FUFA 3Q5MA 4OVVA 4Q69A 1SQMA 1KZPA 3VTYA 5BV1A 2L6BA 4XI0A 5AQ9A 2QC9A 4RSYA 3ZXPA 3UT7A 5FJYA 2M63A 4JXTA 3LJ3A 1MHQA 4AIFA 4PS7A 1QYMA 3EHRA 5EN5D 1HG5A 2WXQA 4G23A 1E7UA 3FUEA 5KJLA 1N11A 2ZGDA 3DWLG 3S7FA 3RO2A 2FULA 3UKRG 1WG0A 3FH8A 3JUEA 2V4HC 2WXPA 4EZLA 4F3VA 3CHRA 3FUHA 2QYUA 4AP2A 4YDYA 2VJ8A 3N71A 5FZRA 2FO1E 3RRUA 4E6HA 3FP3A 2EQXA 3GZ2A 3C3RA 4ABNA 2NXPA 4WNGA 3FH5A 4ILIA 2A5EA 3I5PA 5ENOD 1TN6A 1IQRA 4U8VD 1N9AA 3T8KA 4GZ6A 3APDA 4UWKA 5D0OD 4BX9A 5FZQA 4WWPA 3TWRA 1OT8A 1G3NB 2VSYA 3MGBA 3WG7E 4JD2G 1U2VG 1WAO1 2BEDA 5DIZA 3ISMC 3U66A 3ASHA 1TNUA 1S0PA 4W9RA 1DCEA 3PEVB 3URZA 4JPSA 2WB2A 4DX1A 5FTPA 5BXUA 3SBTB 2OEWA 4AV7A 2L9BA 4XE0A 2WXIA 2Y4UA 4UQYA 2BF0X 3L08A 5ARGA 3ONKA 4Q94A 5JJ6A 4GTMA 2XZDG 2AXZA 2E0IA 4WNFA 2L0IA 1ELKA 2P9LG 3E32A 3TAXA 4B93B 2V4LA 1RW2A 2ZGGA 1JUQA 2H6HA 5AQ7A 3PH0C 1K3ZD 4EZKA 2V5FA 4GAAA 4MRUA 2XQ0A 4DRXE 3L16A 4L23A 5AARA 4A55A 1QQEA 4FADA 1KPSB 4GTQA 1JCQA 3L82A 2XGSA 2FEZA 4HI8A 5ENRD 3GZ1A 2J8SD 3VTXA 4EHMA 1Z5SC 4CYMD 4YVQC 5CBOA 4I9CA 3ZNGA 1PY1A 4XEIG 3G2UA 3I3NA 2GRRB 4DUIA 4LSZE 3NOGD 3CHMA 3PRZA 4IN3B 5ANRA 4DPRA 1KLXA 2GW1A 3ZGQA 3DBSA 4LNBA 1MZCA 2KCKA 3FUDA 2J49A 2IONA 5BXOA 1IXVA 4N5CA 2Y0BG 3V2XA 4APFA 4U8YD 3HYMB 2WXRA 4DX6D 1XGWA 3EHMA 3D9PA 3ABLE 4BSZB 4XIFA 4B0ZA 1JCSA 3JXJA 3CVQA 5ENPD 3P2BA 1PC2A 3FUKA 2BKGA 3HVEA 5DBKA 2WPVA 3ZVVA 2UY1A 1O1RA 4EBAG 4N3CA 1E96B 4NACA 3Q7FA 3RSEG 5KJMA 3TL5A 1YMPA 4ANWA 2DZOA 1OCRE 3OAWA 4DX7D 2J07A 3MEKA 3PVLA 2AJAA 1S70B 1BI8B 5D0QD 3FY4A 4PDXA 3HHMA 3DXKG 4XKCA 3UIOC 3UXGA 3T5VA 5J08A 3ZN3A 3JYSA 3RIBA 2B6CA 4NQ0A 2R03A 4HRLA 3SFXA 4C9BB 3LJNA 3LY8A 2V5QC 3UT4A 3ZXSA 4K0RA 2XPYA 1WM5A 5FWQA 4C0MA 4Q96A 3FUNA 5E75A 3CK7A 1E8WA 2KATA 1JCRA 1E8YA 3E37A 3RRNB 4LRZA 4UI9K 3U3WA 3KAEA 3FUIA 4UWFA 3WXXA 2WM9A 3QWPA 5G05J 5LCWC 3MYVA 3PDNA 3HG0D 1ELWA 4KVMA 2HYZA 3APFA 3ZEFA 5LFAA 2X6JA 3ZYQA 3CV0A 4CGVA 3LY9A 3KD7A 3ULQA 2ETCA 2X6HA 4PS8A 2X3MA 3CQCB 2DYSE 2R59A 4LNUD 2P2CP 4YDOA 5A23A 3MKQB 4I1MA 4I6EA 3L13A 2ZIRA 2EINE 4U04A 4UQXA 4GB9A 1P5QA 5EILA 4N3BA 3CK9A 4DI4A 1HU3A 1SZAA 3TJPA 1N4SA 4BX8A 3EHNA 2L0TB 4N39A 3FTWA 3S7BA 3DEPA 2H6IA 3ZYMA 3ZYLA 3CHSA 4GPKA 3PZ2A 4UWGA 2XGOA 3LKUA 3F6QA 2VGYA 1OUVA 4O6FA 4HORA 5JJTA 2J09A 3LDZA 4GTVA 3EU5A 3FULA 1BLXB 5JHBA 3TGOA 4AY6A 3B7BA 5BT1A 3D9IA 3J5QB 2RFAA 3Q49B 1NL4A 2X38A 3TWWA 2VSOE 4PH4B 4HNAD 2P9IG 2RG8A 3AG4E 3UKUG 3NZUA 1B89A 2WMOA 4YNDA 4HRNA 3PUKA 4LERA 2I1KA 1S64A 4I2ZA 3BG0B 4GTPA 4A63B 2IF4A 1A5EA 4TV3A 4GCOA 4BESA 4F53A 1UN8A 4EPZA 4HB5A 1O5MA 4BFRA 2I6HA 2HE0A 5M72A 4CDMA 1N52A 3FTSA 1ZU2A 1QZ2A 3CVYA 1SZ9A 4IRUA 2ETAA 2WQ7A 1INZA 4J6IA 3AS8A 3HDXA 2YHCA 2F37A 1L5JA 1MYOA 5D2MC 3PZDA 4HLLA 4I1OB 2OV8A 3RRMB 3UMVA 2DBAA 3C72A 3UT8A 2OVBA 1EPUA 5KNHD 3R7QA 5G04C 2GRNB 1NFIE 3HVEB 2XEVA 2WXGA 2UY1B 2FBNA 3FU5A 4UQZA 3UX4A 1AP7A 1H6OA 4R7LA 2VGXB 4U0ZA 3SGHA 1HF8A 1WDYA 3ML9A 4X8QA 3E34A 3ZPJA 1KT0A 4EECA 3QC1A 2AVPA 5G2NA 2HO1A 3DPDA 3TXNA 3RU0A 4B94A 4BT8A 4J8FA 5ENSD 3DXMG 5ENTD 2XS8A 4ACKA 4JL0A 3TWXA 2DYRE 2P9NG 3ABME 3NOCD 4N3AA 1EYHA 5CMYA 3B95A 5AJDA 1WY6A 2VSXE 5EIDA 5AQAA 3HXCA 2BTDA 3Q15A 3FTYA 3Q9NC 4GA1A 4JA9A 2JEKA 5HQ8A 3FU3A 3QJZA 4ANXA 3FTXA 4GU5A 5FQ8A 2XPZA 3B7TA 5EIBE 2PL2A 1BI7B 1U3CA 4PUCA 4NIKA 4U0SA 4J8YA 2XRZA 2P9SG 1Y6IA 4CT0A 3TWUA 3SI5A 1QBQA 3DSXA 1UN9A 5HKPA 3QKYA 4KT6B 3IKOB 2GRMA 3FUMA 4U95D 3CKBA 1BD8A 3D9LA 3AU4A 3PUJA 2F0YA 4J8DA 1FPPA 3BEEA 5JMND 3Q47B 2LAIA 2VYIA 3CSFA 4GA0A 4QQIA 4YVOA 4BTBA 3CVVA 2AWIA 3T5XA 1FT1A 3CSTA 1DCQA 3ZU7B 5HRYA 4CT4A 4ATZD 2MHKA 3Q4AB 4CGWA 5BPPA 5KJNA 5CRVA 4JHJA 2PM7A 1LF8A 3ESLA 3IHYA 1H2TC 2MOWA 3R7RA 4G25A 2QZAA 4XKBA 4G8KA 1IHBA 2KZTA 2NC9A 1V54E 1TNOA 3UM2A 4APOA 4U07A 3AG1E 2AXVA 1X81A 4UI9C 4U7EB 3G2VA 1JWFA 3J5PA 3CHOA 2NYJA 4F6RD 4PS3A 5T4YA 4G26A 5ENNA 5H7PA 2LXMA 2FO7A 2JLBA 4FLBA 5AYWD 3HIZA 4JHKA 2IEJA 4JZYA 4BY6A 3TWTA 5LOZA 1H19A 3AU5A 5IY5E 3ENEA 1JWGA 3ZHEA 3Q73A 4O60A 3S7DA 3E4BA 2LSVA 1K1BA 1DC2A 1GW6A 3O4ZA 4DLOA 4EQFA 1YA0A 2LSUA 3FTUA 4L1BA 1XNFA 3BQOA 5ANLA 4L2LA 1V55E 2GGFA 3LEWA 4IULA 4I2WA 3PZ3A 3U64A 4UWHA 1TJFA 2CHXA 4JEUA 3HXDA 2P9UG 5HS0A 3SNXA 1Z3YA 4ME2A 1FCHA 1LD7A 2Q7FA 4BWRA 5JHAA 1DVPA 1HO8A 1MJ0A 3OXLA 1D8EA 3K9IA 3EIQC 5T3RA 2VTBA 2I9CA 2BUGA 1ELRA 3CVNA 2OVFA 4JVSA 2I2OA 2QYJA 4G8LA 2CG2A 3IBEA 3D9OA 3QAQA 4KVOA 5JA4D 3UTMA 2GRLA 1TN7A
chains in the Genus database with same CATH topology
4PS7A 3EHNA 2L0TB 4N39A 3FTWA 3S7BA 1IHGA 4GMJA 3CVLA 3KEZA 1UJJA 2AXUA 1HG5A 3ZYMA 5FQ6A 3ZYLA 3CHSA 4GPKA 1NP7A 4BTAA 3GW4A 3ASGA 2WXQA 3MCXA 4G23A 4UWGA 2XGOA 1E7UA 3FUEA 3LKUA 4GCNA 4MLPA 5CHEE 5KJLA 2VGYA 2LNIA 4MKTA 1OUVA 2VSNA 4O6FA 3S7FA 4RG9A 4HORA 2HM8A 3RO2A 5JJTA 3VLFA 2J09A 2FULA 3LDZA 3GZSA 4F7AA 3FULA 3SHFA 3P1UA 1HE8A 3FH8A 5JHBA 3TGOA 4AXHA 2WXPA 4EZLA 4AY6A 4Y6WA 4F3VA 3CHRA 3FUHA 5BT1A 1E8ZA 3D9IA 3FHEA 3Q49B 3AS4A 4AP2A 2XCCA 3PEUB 4CCAA 2VJ8A 2X38A 3N71A 5FZRA 4FLHA 2PQNA 1HZ4A 2VSOE 2WXLA 5FQ7A 4EZJA 3RRUA 4PH4B 4DLQA 4E6HA 3FP3A 2EQXA 2RG8A 3LVQE 3GZ2A 4ABNA 2NXPA 4WNGA 4AY5A 3FH5A 2Y3AA 4ILIA 2NSZA 3SZ7A 3NZUA 4G2VA 1B89A 3I5PA 4ATGA 1IQRA 2WMOA 3LY7A 4YNDA 5BW8C 3PUKA 2QY7A 4LERA 3UUXA 2IU1A 4GZ6A 4U0UA 1IQUA 2HR2A 3APDA 4UWKA 5AIJA 2I1KA 5D0OD 1NZNA 3NZSA 3BG0B 4FJYA 4I2ZA 4BX9A 3JCKC 2J9QA 2IF4A 4RVBA 2X6IA 5FZQA 4HOTA 4TV3A 5CCLA 2WQ6A 4WWPA 1TJCA 1QNFA 4KZ0A 4NURA 4GCOA 3CVUA 2P58C 4AM9A 4KBQA 3I4RB 4D10C 4KYOB 4ILHB 4F53A 3FEYA 2UWJG 1UN8A 3CQGB 4EPZA 5FQ4A 2VSYA 3MGBA 4BFRA 2I6HA 4A1SA 3GYZA 5M72A 4CDMA 4N2SA 2DIWA 1N52A 3C98A 1WAO1 3FTSA 3PE4A 3T8MA 1ZU2A 1KT1A 2CFZA 1QZ2A 2FF4A 1NA3A 3EIJA 2XGMA 3LS8A 4B8CB 4DI3A 2WXJA 5BNWA 5DIZA 1SZ9A 3CVYA 4IRUA 3U66A 2WQ7A 1INZA 4J6IA 3AS8A 3ASHA 4G11A 3FFLA 4HFGA 1UW4B 4B89A 3HDXA 2YHCA 1EF1C 4HOQA 1S0PA 3ZRHA 4W9RA 4KMOA 3PEVB 5EKQD 1L5JA 3URZA 4AVXA 4L2YA 3FU0A 3PZDA 4I1OB 4JPSA 1OWNA 3ASFA 2OV8A 3L17A 3L22A 4KZCA 3RRMB 4EBAA 2WB2A 3UMVA 2DBAA 2WXFA 3D9NA 5G05C 4CEMA 5LP0A 5FTPA 3UT8A 2OVBA 3SBTB 4AV7A 5C2YA 3SF4A 3MA5A 4URKA 1EPUA 3PNLB 4RG6A 4GA2A 5JJ7A 2L9BA 4XE0A 2WXIA 2Y4UA 3OXFA 5BUZA 4UQYA 3R7QA 3TG5A 5G04C 2BF0X 4WNDA 3RK6A 1H0AA 3L08A 5ARGA 2IOLA 3HVEB 4GZ3A 4HOUA 4FU3A 3ONKA 4Q94A 5JJ6A 2VQ2A 2WXGA 2XEVA 4XI9A 1OWOA 2UY1B 2FBNA 3QDNA 2WXMA 3FU5A 4UQZA 3UX4A 2AXZA 3QWWA 4A3TA 2E0IA 2XHEA 4WNFA 2L0IA 4HXIA 4R7LA 2VGXB 3EDTB 4GZCA 4LEUA 4U0ZA 1ELKA 4C0EA 3CK8A 3SGHA 1HF8A 2VGXA 3CGHA 1DNPA 2KCLA 2R5SA 4GZDA 2J08A 5KCMA 3ML9A 3CVXA 4G24A 4ANUA 3ZPJA 3B7UX 3TAXA 1KT0A 3FDHA 2J4BA 4EECA 1A17A 3SBSA 3ZYKA 4A3VA 4ACLA 2V4LA 2V8SE 1JUQA 3QC1A 2AVPA 3RO3A 5G2NA 2HO1A 3PH0C 4EZKA 3DPDA 3TXNA 2V5FA 3RU0A 2DCPA 4GAAA 4MRUA 2KC7A 2XQ0A 4GMLA 4J8FA 4FHKA 4B94A 5FT9A 3L16A 4ACKA 4JL0A 3VLEA 2CFUA 1NA0A 1HX8A 4L23A 3CVWA 4FP7A 4N3AA 1EYHA 1JPLA 5CMYA 4A55A 4FA6A 1QQEA 5AJDA 3PS6A 1WY6A 3FTZA 2VSXE 4U63A 2WXOA 4E85A 4FADA 2LO6A 2PZIA 3CKCA 5LCWJ 5CMWA 3IEGA 4BSXA 3ML8A 3LPZA 2XGSA 3UQ3A 2FEZA 3MX3A 2ZU6B 2Y4TA 2BTDA 3Q15A 5BV0A 3FTYA 3GZ1A 4J8SA 3VTXA 2C2LA 5G55A 3MV2B 3S7JA 2XRYA 4GA1A 4LUNU 3TXMA 4JA9A 3U9WA 2L6JA 3ZFWA 2JEKA 5HQ8A 3FU3A 3D3MA 4YVQC 1X5BA 3EJNA 1FVHA 4JA7A 2IJGX 3QJZA 3FTXA 4GU5A 5ARFA 5FQ8A 4ANXA 4I9CA 2XPZA 1HXIA 3B7TA 2PL2A 3LYAA 2WVIA 3MKRA 4WUYA 1U3CA 4PUCA 1PY1A 4U0SA 2PM6A 3G2UA 4ANVA 3B7SA 4HS2A 2XRZA 4LCTA 4KXKB 3FUJA 3I3NA 4CDNA 2KCVA 4DK5A 4JW1A 1BPOA 4UWLA 3CHMA 4WAFA 2MRIA 3PRZA 4IN3B 1Y6IA 2WXKA 4CT0A 3QNKA 3D9JA 3SI5A 5ANRA 4DPRA 2IOSA 1UN9A 1KLXA 4TUUA 2GW1A 3NQPA 3ZGQA 3VLDA 3DBSA 4CRWA 2CHWA 3QKYA 3KS2A 3CEQA 2KM4A 3U4TA 1H2VC 2KCKA 1HFAA 4KT6B 1HG2A 3CLJA 3IKOB 3FUDA 2J49A 2GRMA 1H2UA 1HS6A 2RD0A 3G2TA 3LVRE 3LCAA 2IONA 3FUMA 3CKBA 2X6KA 3D9LA 3LJ3A 3AU4A 3QARA 3PUJA 2J4DA 2X6FA 4N5CA 4FJZA 4J8DA 4HLEA 3BEEA 3G2WA 3Q47B 2C0MA 2R17C 5E76A 4FHJA 2LAIA 1OWMA 3QB2A 4QFVA 3ZIMA 4APFA 2VYIA 3CSFA 4GA0A 4I1AA 3HYMB 2WXRA 4YVOA 1XGWA 3EHMA 1UJKA 2IQCA 3I4GA 3D9PA 4GYOA 4BTBA 2AWIA 3T5XA 3CVVA 3B7RL 3JQ0A 4XIFA 4B0ZA 3CSTA 3QOUA 4WWOA 3G2SA 4HOSA 4AEZC 4BT8A 4CT4A 4V3IA 3CVQA 3MZLB 1E90A 3CVPA 3P2BA 1PC2A 2FI7A 2VTBB 5LX8A 2MHKA 3FUKA 3MJWA 3Q4AB 4ILGA 3D9MA 4CGWA 5BPPA 5KJNA 2WXNA 4JHJA 3HVEA 5DBKA 2WPVA 3ZVVA 2YQ8A 4FC8A 2UY1A 2PM7A 1LF8A 5EX0A 4AOFA 4EBAG 4N3CA 3S2AA 2XPIA 1E96B 3ESLA 4NACA 5KJMA 3IV0A 3FU6A 3TL5A 4P29A 3IHYA 5AJLA 3APCA 3RJVA 4ANWA 1H2TC 2KZTB 2MOWA 2OOEA 3R7RA 1OWPA 1EDUA 3OAWA 4G25A 4J8EA 4XKBA 3L6AA 4GYYA 1E7VA 2KZTA 2NC9A 4GYWA 4K03A 3OXGA 4H7YA 2IFUA 4JHRA 4WWNA 4APOA 1OWLA 4U07A 2J07A 2AXVA 3MEKA 4I43A 3PVLA 1UG3A 3FH7A 3UPVA 4I6JA 3D9KA 2AW6A 4UI9C 5T8IA 2QFCA 3G2VA 5D0QD 1JWFA 3FY4A 3MV3B 4PDXA 3JQ1A 1HH8A 3CHOA 4WNEA 3HHMA 3SD5A 2A4ZA 4XKCA 3JUIA 3O48A 1H6KA 3CHQA 4OVUA 4TRQA 4DJAA 5J08A 3ZN3A 3JYSA 3RIBA 5FZSA 3T5VA 4PS3A 3FTVA 4GZ5A 3ESKA 3QWVA 4NQ0A 4I9EA 1VDYA 2V0PA 4G26A 5T4YA 4A1GA 2ILRA 3RKVA 3PE3A 2WQHA 2YINA 5ENNA 2C0LA 3BG1B 2FO7A 2JLBA 4CDRA 4C9BB 3LXUX 3OTNA 3FWVA 4FLBA 5AYWD 3HIZA 3LY8A 4JHKA 4XX5A 3UT4A 3ZXSA 4K0RA 4G1TA 2XPYA 4JZYA 1WM5A 5AENA 2A5UA 5FWQA 4BY6A 1TEZA 4C0MA 4Q96A 3CIAA 5LOZA 3TG4A 3FUNA 3NF1A 5E75A 3CK7A 1H19A 3ZHEB 3AU5A 2YHEA 5J90A 1E8WA 2KATA 4NRHB 3L54A 4FULA 3ENEA 1Z3XA 1E8YA 1JWGA 3ZHEA 3RRNB 4LRZA 3IHVA 4UI9K 4IYPA 3S7DA 4BT9A 3KAEA 3U3WA 3FUIA 3E4BA 4UWFA 3WXXA 2WM9A 4OYSA 5KJKA 4U8HA 2LSVA 3B13A 1W3BA 2YNQA 1GW6A 2CHZA 3QWPA 3O4ZA 5G05J 5LCWC 2CG3A 5HI7A 4DLOA 4EQFA 1ZBPA 1FVFA 1YA0A 2LSUA 3FTUA 3MYVA 3PDNA 1ELWA 1XNFA 4KVMA 4L1BA 4N2QA 2HYZA 1N54A 2XCBA 3APFA 3ONLA 5ANLA 2E2EA 3ZEFA 5LFAA 2X6JA 4L2LA 3SFZA 4J0UA 3CR3A 1MQSA 5G04J 4Y6CA 3ZYQA 2GGFA 3CV0A 2WXHA 2ONDA 3LEWA 4IULA 4I2WA 4CGVA 3U64A 4UWHA 1Z6TA 4I17A 3FEXA 1TJFA 2CHXA 4JEUA 4JC8A 5A6CA 3PNTB 3SNXA 2PQRA 4AJWA 3LY9A 3KD7A 4L7TA 3ULQA 1Z3YA 4ME2A 1FCHA 2Q7FA 5A7DB 3ASDA 4BWRA 1U3DA 1E8XA 4I6GA 5C1DA 1DVPA 2X6HA 1PAQA 5JHAA 1HO8A 2I1JA 5CCMA 4PS8A 5EX3A 2X3MA 4F1SA 3CQCB 4HVBA 3OXLA 4B8AA 2R59A 3PREA 3K9IA 3EIQC 5T3RA 2VTBA 2LAHA 2I9CA 2BUGA 3FUFA 4XZ4A 5A23A 3MKQB 1ELRA 3Q5MA 4JEHA 3R9AB 3CVNA 4I1MA 4OVVA 4Q69A 2WMNA 1SQMA 2OVFA 4JVSA 1Y8MA 4I6EA 4UI9J 3VTYA 2I2OA 3MKQA 3L13A 3QK0A 5BV1A 4XI0A 2CG2A 4U04A 4UQXA 3IBEA 4RSYA 3UT7A 3D9OA 4GB9A 1P5QA 4MS6A 4N3BA 3CK9A 4H7XA 3AS5A 3QAQA 5FJYA 4DI4A 1HU3A 1SZAA 4KVOA 5EDSA 2GRLA 3CHPA 3TJPA 2M63A 1IYGA 4M3OA 3ZW3A 4JXTA 1MHQA 4BX8A 4AIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N39 A;  3S7B A;  1IHG A;  3CVL A;  4GPK A;  4BTA A;  3GW4 A;  3ASG A;  4G23 A;  2XGO A;  3LKU A;  4GCN A;  5KJL A;  5CHE E;  2VGY A;  2LNI A;  1OUV A;  2VSN A;  4O6F A;  3S7F A;  4RG9 A;  4HOR A;  3RO2 A;  5JJT A;  3TGO A;  4AY6 A;  4Y6W A;  4F3V A;  5BT1 A;  3Q49 B;  3AS4 A;  2XCC A;  5FZR A;  3N71 A;  2PQN A;  1HZ4 A;  3FP3 A;  3GZ2 A;  4ABN A;  4WNG A;  4AY5 A;  3SZ7 A;  4G2V A;  1B89 A;  3LY7 A;  4YND A;  5BW8 C;  3UUX A;  4GZ6 A;  4U0U A;  2HR2 A;  5D0O D;  1NZN A;  4I2Z A;  2J9Q A;  2IF4 A;  5FZQ A;  4HOT A;  5CCL A;  1TJC A;  4GCO A;  2P58 C;  4AM9 A;  4KBQ A;  4KYO B;  2UWJ G;  2VSY A;  2I6H A;  4A1S A;  3GYZ A;  5M72 A;  4N2S A;  1WAO 1;  3PE4 A;  1ZU2 A;  1KT1 A;  1QZ2 A;  2FF4 A;  1NA3 A;  2XGM A;  5BNW A;  5DIZ A;  3AS8 A;  3ASH A;  3FFL A;  2YHC A;  4HOQ A;  4W9R A;  5EKQ D;  3URZ A;  3ASF A;  2DBA A;  5G05 C;  5FTP A;  3SF4 A;  3MA5 A;  4RG6 A;  4GA2 A;  5JJ7 A;  2Y4U A;  3OXF A;  4UQY A;  3TG5 A;  5G04 C;  4WND A;  5ARG A;  4GZ3 A;  4HOU A;  5JJ6 A;  2VQ2 A;  2XEV A;  4XI9 A;  2UY1 B;  2FBN A;  3QDN A;  4UQZ A;  3QWW A;  4WNF A;  2VGX B;  3EDT B;  4LEU A;  4U0Z A;  3CK8 A;  2R5S A;  2VGX A;  2KCL A;  4G24 A;  3ZPJ A;  3TAX A;  1KT0 A;  1A17 A;  2AVP A;  3RO3 A;  2HO1 A;  2V5F A;  4BT8 A;  3RU0 A;  4B94 A;  2KC7 A;  4J8F A;  5FT9 A;  4JL0 A;  1NA0 A;  4N3A A;  1QQE A;  3CKC A;  2PZI A;  5LCW J;  3IEG A;  3LPZ A;  2XGS A;  3UQ3 A;  2FEZ A;  2Y4T A;  3Q15 A;  3GZ1 A;  3VTX A;  2C2L A;  3MV2 B;  3S7J A;  4GA1 A;  4JA9 A;  2L6J A;  3ZFW A;  5HQ8 A;  4YVQ C;  4JA7 A;  5ARF A;  4I9C A;  1HXI A;  2PL2 A;  3LYA A;  3MKR A;  4WUY A;  4U0S A;  4KXK B;  2KCV A;  4IN3 B;  1KLX A;  2GW1 A;  3ZGQ A;  3QKY A;  3KS2 A;  3CEQ A;  3U4T A;  2KCK A;  3LCA A;  3CKB A;  4N5C A;  4J8D A;  3BEE A;  3Q47 B;  2C0M A;  2VYI A;  4GA0 A;  4I1A A;  3HYM B;  4YVO A;  4GYO A;  4BTB A;  4XIF A;  3QOU A;  4HOS A;  3CVQ A;  3CVP A;  1PC2 A;  2FI7 A;  2MHK A;  3Q4A B;  4CGW A;  5KJN A;  5DBK A;  2WPV A;  2YQ8 A;  2UY1 A;  5EX0 A;  4N3C A;  2XPI A;  1E96 B;  5KJM A;  3RJV A;  2OOE A;  4G25 A;  4J8E A;  4GYY A;  2NC9 A;  4GYW A;  3OXG A;  4H7Y A;  2IFU A;  4JHR A;  4APO A;  4U07 A;  3MEK A;  3UPV A;  4UI9 C;  2QFC A;  5D0Q D;  3MV3 B;  1HH8 A;  4WNE A;  3O48 A;  3ZN3 A;  3JYS A;  3RIB A;  5FZS A;  4GZ5 A;  3ESK A;  3QWV A;  4NQ0 A;  4I9E A;  4G26 A;  3RKV A;  3PE3 A;  2WQH A;  2C0L A;  2FO7 A;  2JLB A;  4CDR A;  3FWV A;  5AYW D;  3LY8 A;  4G1T A;  1WM5 A;  3TG4 A;  3NF1 A;  3CK7 A;  3ZHE B;  2KAT A;  4NRH B;  3ZHE A;  4UI9 K;  3S7D A;  4BT9 A;  3KAE A;  3U3W A;  3E4B A;  3WXX A;  5KJK A;  2LSV A;  1W3B A;  3QWP A;  5G05 J;  5LCW C;  5HI7 A;  4EQF A;  1ZBP A;  1YA0 A;  2LSU A;  3PDN A;  1ELW A;  1XNF A;  4N2Q A;  2HYZ A;  2XCB A;  2E2E A;  4J0U A;  5G04 J;  4Y6C A;  3CV0 A;  2OND A;  4I2W A;  4CGV A;  4I17 A;  5A6C A;  2PQR A;  3LY9 A;  3KD7 A;  3ULQ A;  4ME2 A;  1FCH A;  2Q7F A;  5A7D B;  3ASD A;  4BWR A;  5C1D A;  5CCM A;  5EX3 A;  3OXL A;  3K9I A;  2BUG A;  3Q5M A;  1ELR A;  3R9A B;  3CVN A;  1Y8M A;  4UI9 J;  3VTY A;  4XI0 A;  4U04 A;  4UQX A;  1P5Q A;  4N3B A;  3CK9 A;  4H7X A;  3AS5 A;  5FJY A;  1IYG A;  4AIF A; 
#chains in the Genus database with same CATH topology
 1IHG A;  3KEZ A;  1UJJ A;  3HRA A;  5FQ6 A;  1S63 A;  4BTA A;  3Q79 A;  5B1A E;  3GW4 A;  3ASG A;  5KNG A;  5CBN A;  4GCN A;  5CHE E;  4MKT A;  4RG9 A;  2HM8 A;  3V2O A;  3GZS A;  4F7A A;  4AXH A;  4Y6W A;  2P9K G;  3FHE A;  3AS4 A;  3PEU B;  4CCA A;  4FLH A;  2PQN A;  2WXL A;  5FQ7 A;  2Y69 E;  4AY5 A;  2NSZ A;  3SZ7 A;  4G2V A;  4ATG A;  3Q75 A;  2QY7 A;  3D9H A;  3UUX A;  2IU1 A;  3SO8 A;  1IQU A;  1NZN A;  4K5B A;  4FJY A;  3JCK C;  4K5C A;  3SFY A;  2J9Q A;  2X6I A;  1SA5 A;  4HOT A;  5CCL A;  2WQ6 A;  5AN8 A;  1QNF A;  4KBQ A;  3I4R B;  2EIK E;  4KYO B;  4ILH B;  2UWJ G;  2VGE A;  4OAU C;  4A1S A;  3GYZ A;  1K1A A;  2R02 A;  1TN8 A;  3PE4 A;  3T8M A;  2LUH A;  2CFZ A;  1NA3 A;  3EIJ A;  3LS8 A;  4B8C B;  1YYH A;  4DI3 A;  2WXJ A;  4O1O A;  5BNW A;  4TXP A;  3W9F A;  4G11 A;  3FFL A;  1N4Q A;  4HFG A;  4B89 A;  4HOQ A;  3ULY A;  1IKN D;  3UM3 A;  3FU0 A;  3L22 A;  4EBA A;  3NBN B;  2WXF A;  3D9N A;  5G05 C;  4CEM A;  3RAU A;  4URK A;  3MA5 A;  3PNL B;  4RG6 A;  4GA2 A;  3TG5 A;  1H0A A;  4GZ3 A;  1YCS B;  4HOU A;  2LXL A;  3AJI A;  3SQV A;  3Q78 A;  1OWO A;  4JB8 P;  3EDT B;  4LEU A;  4C0E A;  2KXP C;  3CK8 A;  2R5S A;  3CGH A;  4GZD A;  2J08 A;  3PZ4 A;  3CVX A;  3B7U X;  4N5Q A;  2J4B A;  3TWS A;  4ACL A;  2V8S E;  4BEP A;  3NB2 A;  1H6P A;  3C3Q A;  3DPY A;  1TR4 A;  2DCP A;  4FHK A;  3V31 A;  5FT9 A;  3TWV A;  5B3S E;  5AAO A;  2CFU A;  1NA0 A;  1HX8 A;  3CVW A;  4FP7 A;  4FA6 A;  3FTZ A;  4U63 A;  4E85 A;  3CKC A;  3IEG A;  3LPZ A;  1OCO E;  3UQ3 A;  2ZU6 B;  2XS1 A;  5BV0 A;  4J8S A;  2C2L A;  3DSW A;  3MV2 B;  3S7J A;  2XRY A;  3TXM A;  2L6J A;  3EJN A;  5ARF A;  3MKR A;  2DVW A;  1N4R A;  4GTS A;  3C5R A;  3B7S A;  4HS2 A;  4LCT A;  5EYL A;  4DK5 A;  1BPO A;  4UWL A;  2MRI A;  2JAB A;  2F8Y A;  2IOS A;  4Z68 A;  4TUU A;  2IY0 C;  3NQP A;  3DSV A;  4CRW A;  3KS2 A;  3U4T A;  3V30 A;  1HFA A;  3AG2 E;  1H2U A;  1HS6 A;  2RD0 A;  3LCA A;  4YDW A;  2X6K A;  3QAR A;  1MX6 A;  4FJZ A;  4GTO A;  2C0M A;  5E76 A;  4FHJ A;  4QFV A;  1OWM A;  3PZ1 A;  3QB2 A;  1SVX A;  4ZHB A;  3I4G A;  2IQC A;  1UJK A;  1O1S A;  3B7R L;  3JQ0 A;  3QOU A;  4HOS A;  4AEZ C;  4O1P A;  4V3I A;  3X2Q E;  3MZL B;  1E90 A;  3CVP A;  2VTB B;  2FI7 A;  5LX8 A;  3MJW A;  4ILG A;  1OCZ E;  2WXN A;  4AOF A;  4U96 D;  2XPI A;  3AG3 E;  4P29 A;  5AJL A;  2ZXW E;  1O1T A;  3W9G A;  1EDU A;  4J8E A;  1E7V A;  4GTT A;  2BKK B;  4WWN A;  1OWL A;  1UG3 A;  3D9K A;  5T8I A;  1OXJ A;  3MV3 B;  1BU9 A;  4WNE A;  2A4Z A;  3O48 A;  3DST A;  4OVU A;  5FZS A;  3DEO A;  3FTV A;  4GZ5 A;  1VDY A;  2V0P A;  3PE3 A;  2WQH A;  2C0L A;  3LXU X;  3OTN A;  3FWV A;  4XX5 A;  2A5U A;  5D66 A;  3CIA A;  1TNZ A;  3HXE A;  3UM1 A;  4NRH B;  3L54 A;  4IYP A;  1MX4 A;  5KJK A;  4U8H A;  3E33 A;  2YNQ A;  3TWQ A;  5HI7 A;  1ZBP A;  5ENQ D;  4N2Q A;  3ONL A;  4J0U A;  3CR3 A;  4Y6C A;  2WXH A;  2OND A;  2XZT G;  4YDE A;  3L9T A;  1Z6T A;  4I17 A;  2XEE A;  4JC8 A;  3DRA A;  3PNT B;  4AJW A;  4BER A;  5A7D B;  1U3D A;  1E8X A;  1PAQ A;  2I1J A;  5CCM A;  5EX3 A;  4F1S A;  3EHQ A;  1OCC E;  2LAH A;  3AAA C;  1LD8 A;  4XZ4 A;  3R9A B;  4JEH A;  2WMN A;  1Y8M A;  4UI9 J;  5EYP F;  3MKQ A;  3QK0 A;  2XEH A;  3ABK E;  3ULE G;  4MS6 A;  4H7X A;  1K8K G;  3AS5 A;  4MBG A;  5EDS A;  4LNG A;  3CHP A;  2B0O E;  1IYG A;  4M3O A;  3ZW3 A;  3ASO E;  4TXR A;  3UIP C;  2IO2 C;  4GMJ A;  2R2L A;  3CVL A;  2AXU A;  2DZN A;  1NP7 A;  2KBX A;  3MCX A;  3ASN E;  4MLP A;  2LNI A;  2VSN A;  1Q2Z A;  3C3O A;  3VLF A;  3SHF A;  1TYQ G;  3P1U A;  1HE8 A;  4GMR A;  3EU9 A;  2OEV A;  4J7W A;  1E8Z A;  5CEA A;  2XCC A;  1HZ4 A;  4EZJ A;  4DLQ A;  3DSU A;  3LVQ E;  5B1B E;  4DX2 A;  2Y3A A;  3Q7A A;  3LY7 A;  5BW8 C;  4HI9 A;  4U0U A;  4UUC A;  2HR2 A;  5AIJ A;  3NZS A;  4RVB A;  1TJC A;  2GRP B;  4KZ0 A;  4NUR A;  3CVU A;  1TNY A;  2P58 C;  3ZUV B;  4AM9 A;  4D10 C;  3FEY A;  3CQG B;  5FQ4 A;  2RFM A;  3EUV A;  4RQI A;  4N2S A;  2DIW A;  3C98 A;  1KT1 A;  4K5A B;  1TNB A;  2FF4 A;  2XGM A;  1FT2 A;  3Q9U C;  2RKK A;  4C48 B;  1UW4 B;  1EF1 C;  3ZRH A;  4KMO A;  1RZ4 A;  5EKQ D;  4AVX A;  4L2Y A;  3HXB A;  1OWN A;  3ASF A;  3L17 A;  4KZC A;  3T9K A;  5LP0 A;  5C2Y A;  3SF4 A;  3UM0 A;  5JJ7 A;  5BUZ A;  3OXF A;  4BET A;  4DX5 D;  5FIN A;  4WND A;  3RK6 A;  2IOL A;  4FU3 A;  2VQ2 A;  4XI9 A;  3QDN A;  2WXM A;  4RLY A;  1OY3 D;  3QWW A;  1AWC B;  4A3T A;  2XHE A;  1N94 A;  4HXI A;  4GZC A;  4ZFH A;  5CER B;  2VGX A;  1DNP A;  2KCL A;  5KCM A;  1LTX A;  4G24 A;  4ANU A;  3FDH A;  5CEC B;  1A17 A;  2DWZ A;  3SBS A;  3ZYK A;  4A3V A;  1SW6 A;  4HRM B;  3RO3 A;  1N0Q A;  2MYO A;  2KC7 A;  4GML A;  2H6G A;  4F1P A;  1SA4 A;  3VLE A;  1JPL A;  4GPM A;  3PS6 A;  5KBA A;  2WXO A;  2LO6 A;  2PZI A;  5LCW J;  2EIL E;  5CMW A;  4BSX A;  3ML8 A;  1KZO A;  3MX3 A;  2Y4T A;  4M7C A;  3BU8 A;  5ITZ F;  5G55 A;  2EIM E;  4LUN U;  3BUA A;  3V79 K;  3U9W A;  3ZFW A;  3D3M A;  2XEN A;  1X5B A;  1FVH A;  2Y1L E;  2IJG X;  4JA7 A;  1HXI A;  3LYA A;  2WVI A;  2OCC E;  4WUY A;  2PM6 A;  4ANV A;  4GTR A;  4KXK B;  3FUJ A;  2IO3 C;  4CDN A;  2KCV A;  4JW1 A;  4WAF A;  2WXK A;  3QNK A;  3D9J A;  3NAW A;  3R9M A;  3VLD A;  2CHW A;  4TUM A;  3CEQ A;  2KM4 A;  1H2V C;  1HG2 A;  3CLJ A;  3KSL A;  3LVR E;  3G2T A;  3SY2 A;  2J4D A;  2X6F A;  4HLE A;  1MX2 A;  3G2W A;  3ZIM A;  2R17 C;  3HXF A;  4CZ2 D;  4L9P A;  4I1A A;  4GYO A;  1UOH A;  4WWO A;  3G2S A;  5AQB A;  2H6F A;  3D9M A;  2YQ8 A;  4FC8 A;  5EX0 A;  3S2A A;  1N4P A;  4TXQ A;  1D8D A;  3IV0 A;  3FU6 A;  3APC A;  3RJV A;  2KZT B;  2OOE A;  3IXE A;  5FIO A;  1OWP A;  3L6A A;  4GYY A;  4GYW A;  4K03 A;  3OXG A;  4H7Y A;  2IFU A;  4JHR A;  3UPV A;  4I43 A;  3FH7 A;  4HBD A;  4I6J A;  2AW6 A;  2QFC A;  3JQ1 A;  1HH8 A;  3ZKJ A;  3SD5 A;  3JUI A;  1H6K A;  3CHQ A;  1D9S A;  4TRQ A;  4DJA A;  3DSS A;  2GRQ B;  5CRU A;  1N95 A;  3ESK A;  3QWV A;  4I9E A;  4A1G A;  2ILR A;  3RKV A;  2EIJ E;  2YIN A;  1N0R A;  3BG1 B;  4CDR A;  4OAV B;  2ZIS A;  4G1T A;  1TEZ A;  5AEN A;  3UIN C;  2ETB A;  3TG4 A;  1ZB1 A;  3NF1 A;  3ZHE B;  2GRO B;  4HQD A;  2YHE A;  5J90 A;  4FUL A;  2PNN A;  1Z3X A;  3IHV A;  4BT9 A;  4OYS A;  3B13 A;  1W3B A;  3KSQ A;  2CHZ A;  2CG3 A;  1FVF A;  3E30 A;  2F8X K;  4LG6 A;  2XCB A;  1N54 A;  3UI2 A;  3KEA A;  2E2E A;  3SFZ A;  1MQS A;  5G04 J;  2P9P G;  3JXI A;  3FEX A;  5A6C A;  2PQR A;  4L7T A;  3ASD A;  2R05 A;  4I6G A;  5C1D A;  5KWD A;  4HVB A;  4B8A A;  3PRE A;  1NI1 A;  5CED B;  3FUF A;  3Q5M A;  4OVV A;  4Q69 A;  1SQM A;  1KZP A;  3VTY A;  5BV1 A;  2L6B A;  4XI0 A;  5AQ9 A;  2QC9 A;  4RSY A;  3ZXP A;  3UT7 A;  5FJY A;  2M63 A;  4JXT A;  3LJ3 A;  1MHQ A;  4AIF A;  4PS7 A;  1QYM A;  3EHR A;  5EN5 D;  1HG5 A;  2WXQ A;  4G23 A;  1E7U A;  3FUE A;  5KJL A;  1N11 A;  2ZGD A;  3DWL G;  3S7F A;  3RO2 A;  2FUL A;  3UKR G;  1WG0 A;  3FH8 A;  3JUE A;  2V4H C;  2WXP A;  4EZL A;  4F3V A;  3CHR A;  3FUH A;  2QYU A;  4AP2 A;  4YDY A;  2VJ8 A;  3N71 A;  5FZR A;  2FO1 E;  3RRU A;  4E6H A;  3FP3 A;  2EQX A;  3GZ2 A;  3C3R A;  4ABN A;  2NXP A;  4WNG A;  3FH5 A;  4ILI A;  2A5E A;  3I5P A;  5ENO D;  1TN6 A;  1IQR A;  4U8V D;  1N9A A;  3T8K A;  4GZ6 A;  3APD A;  4UWK A;  5D0O D;  4BX9 A;  5FZQ A;  4WWP A;  3TWR A;  1OT8 A;  1G3N B;  2VSY A;  3MGB A;  3WG7 E;  4JD2 G;  1U2V G;  1WAO 1;  2BED A;  5DIZ A;  3ISM C;  3U66 A;  3ASH A;  1TNU A;  1S0P A;  4W9R A;  1DCE A;  3PEV B;  3URZ A;  4JPS A;  2WB2 A;  4DX1 A;  5FTP A;  5BXU A;  3SBT B;  2OEW A;  4AV7 A;  2L9B A;  4XE0 A;  2WXI A;  2Y4U A;  4UQY A;  2BF0 X;  3L08 A;  5ARG A;  3ONK A;  4Q94 A;  5JJ6 A;  4GTM A;  2XZD G;  2AXZ A;  2E0I A;  4WNF A;  2L0I A;  1ELK A;  2P9L G;  3E32 A;  3TAX A;  4B93 B;  2V4L A;  1RW2 A;  2ZGG A;  1JUQ A;  2H6H A;  5AQ7 A;  3PH0 C;  1K3Z D;  4EZK A;  2V5F A;  4GAA A;  4MRU A;  2XQ0 A;  4DRX E;  3L16 A;  4L23 A;  5AAR A;  4A55 A;  1QQE A;  4FAD A;  1KPS B;  4GTQ A;  1JCQ A;  3L82 A;  2XGS A;  2FEZ A;  4HI8 A;  5ENR D;  3GZ1 A;  2J8S D;  3VTX A;  4EHM A;  1Z5S C;  4CYM D;  4YVQ C;  5CBO A;  4I9C A;  3ZNG A;  1PY1 A;  4XEI G;  3G2U A;  3I3N A;  2GRR B;  4DUI A;  4LSZ E;  3NOG D;  3CHM A;  3PRZ A;  4IN3 B;  5ANR A;  4DPR A;  1KLX A;  2GW1 A;  3ZGQ A;  3DBS A;  4LNB A;  1MZC A;  2KCK A;  3FUD A;  2J49 A;  2ION A;  5BXO A;  1IXV A;  4N5C A;  2Y0B G;  3V2X A;  4APF A;  4U8Y D;  3HYM B;  2WXR A;  4DX6 D;  1XGW A;  3EHM A;  3D9P A;  3ABL E;  4BSZ B;  4XIF A;  4B0Z A;  1JCS A;  3JXJ A;  3CVQ A;  5ENP D;  3P2B A;  1PC2 A;  3FUK A;  2BKG A;  3HVE A;  5DBK A;  2WPV A;  3ZVV A;  2UY1 A;  1O1R A;  4EBA G;  4N3C A;  1E96 B;  4NAC A;  3Q7F A;  3RSE G;  5KJM A;  3TL5 A;  1YMP A;  4ANW A;  2DZO A;  1OCR E;  3OAW A;  4DX7 D;  2J07 A;  3MEK A;  3PVL A;  2AJA A;  1S70 B;  1BI8 B;  5D0Q D;  3FY4 A;  4PDX A;  3HHM A;  3DXK G;  4XKC A;  3UIO C;  3UXG A;  3T5V A;  5J08 A;  3ZN3 A;  3JYS A;  3RIB A;  2B6C A;  4NQ0 A;  2R03 A;  4HRL A;  3SFX A;  4C9B B;  3LJN A;  3LY8 A;  2V5Q C;  3UT4 A;  3ZXS A;  4K0R A;  2XPY A;  1WM5 A;  5FWQ A;  4C0M A;  4Q96 A;  3FUN A;  5E75 A;  3CK7 A;  1E8W A;  2KAT A;  1JCR A;  1E8Y A;  3E37 A;  3RRN B;  4LRZ A;  4UI9 K;  3U3W A;  3KAE A;  3FUI A;  4UWF A;  3WXX A;  2WM9 A;  3QWP A;  5G05 J;  5LCW C;  3MYV A;  3PDN A;  3HG0 D;  1ELW A;  4KVM A;  2HYZ A;  3APF A;  3ZEF A;  5LFA A;  2X6J A;  3ZYQ A;  3CV0 A;  4CGV A;  3LY9 A;  3KD7 A;  3ULQ A;  2ETC A;  2X6H A;  4PS8 A;  2X3M A;  3CQC B;  2DYS E;  2R59 A;  4LNU D;  2P2C P;  4YDO A;  5A23 A;  3MKQ B;  4I1M A;  4I6E A;  3L13 A;  2ZIR A;  2EIN E;  4U04 A;  4UQX A;  4GB9 A;  1P5Q A;  5EIL A;  4N3B A;  3CK9 A;  4DI4 A;  1HU3 A;  1SZA A;  3TJP A;  1N4S A;  4BX8 A;  3EHN A;  2L0T B;  4N39 A;  3FTW A;  3S7B A;  3DEP A;  2H6I A;  3ZYM A;  3ZYL A;  3CHS A;  4GPK A;  3PZ2 A;  4UWG A;  2XGO A;  3LKU A;  3F6Q A;  2VGY A;  1OUV A;  4O6F A;  4HOR A;  5JJT A;  2J09 A;  3LDZ A;  4GTV A;  3EU5 A;  3FUL A;  1BLX B;  5JHB A;  3TGO A;  4AY6 A;  3B7B A;  5BT1 A;  3D9I A;  3J5Q B;  2RFA A;  3Q49 B;  1NL4 A;  2X38 A;  3TWW A;  2VSO E;  4PH4 B;  4HNA D;  2P9I G;  2RG8 A;  3AG4 E;  3UKU G;  3NZU A;  1B89 A;  2WMO A;  4YND A;  4HRN A;  3PUK A;  4LER A;  2I1K A;  1S64 A;  4I2Z A;  3BG0 B;  4GTP A;  4A63 B;  2IF4 A;  1A5E A;  4TV3 A;  4GCO A;  4BES A;  4F53 A;  1UN8 A;  4EPZ A;  4HB5 A;  1O5M A;  4BFR A;  2I6H A;  2HE0 A;  5M72 A;  4CDM A;  1N52 A;  3FTS A;  1ZU2 A;  1QZ2 A;  3CVY A;  1SZ9 A;  4IRU A;  2ETA A;  2WQ7 A;  1INZ A;  4J6I A;  3AS8 A;  3HDX A;  2YHC A;  2F37 A;  1L5J A;  1MYO A;  5D2M C;  3PZD A;  4HLL A;  4I1O B;  2OV8 A;  3RRM B;  3UMV A;  2DBA A;  3C72 A;  3UT8 A;  2OVB A;  1EPU A;  5KNH D;  3R7Q A;  5G04 C;  2GRN B;  1NFI E;  3HVE B;  2XEV A;  2WXG A;  2UY1 B;  2FBN A;  3FU5 A;  4UQZ A;  3UX4 A;  1AP7 A;  1H6O A;  4R7L A;  2VGX B;  4U0Z A;  3SGH A;  1HF8 A;  1WDY A;  3ML9 A;  4X8Q A;  3E34 A;  3ZPJ A;  1KT0 A;  4EEC A;  3QC1 A;  2AVP A;  5G2N A;  2HO1 A;  3DPD A;  3TXN A;  3RU0 A;  4B94 A;  4BT8 A;  4J8F A;  5ENS D;  3DXM G;  5ENT D;  2XS8 A;  4ACK A;  4JL0 A;  3TWX A;  2DYR E;  2P9N G;  3ABM E;  3NOC D;  4N3A A;  1EYH A;  5CMY A;  3B95 A;  5AJD A;  1WY6 A;  2VSX E;  5EID A;  5AQA A;  3HXC A;  2BTD A;  3Q15 A;  3FTY A;  3Q9N C;  4GA1 A;  4JA9 A;  2JEK A;  5HQ8 A;  3FU3 A;  3QJZ A;  4ANX A;  3FTX A;  4GU5 A;  5FQ8 A;  2XPZ A;  3B7T A;  5EIB E;  2PL2 A;  1BI7 B;  1U3C A;  4PUC A;  4NIK A;  4U0S A;  4J8Y A;  2XRZ A;  2P9S G;  1Y6I A;  4CT0 A;  3TWU A;  3SI5 A;  1QBQ A;  3DSX A;  1UN9 A;  5HKP A;  3QKY A;  4KT6 B;  3IKO B;  2GRM A;  3FUM A;  4U95 D;  3CKB A;  1BD8 A;  3D9L A;  3AU4 A;  3PUJ A;  2F0Y A;  4J8D A;  1FPP A;  3BEE A;  5JMN D;  3Q47 B;  2LAI A;  2VYI A;  3CSF A;  4GA0 A;  4QQI A;  4YVO A;  4BTB A;  3CVV A;  2AWI A;  3T5X A;  1FT1 A;  3CST A;  1DCQ A;  3ZU7 B;  5HRY A;  4CT4 A;  4ATZ D;  2MHK A;  3Q4A B;  4CGW A;  5BPP A;  5KJN A;  5CRV A;  4JHJ A;  2PM7 A;  1LF8 A;  3ESL A;  3IHY A;  1H2T C;  2MOW A;  3R7R A;  4G25 A;  2QZA A;  4XKB A;  4G8K A;  1IHB A;  2KZT A;  2NC9 A;  1V54 E;  1TNO A;  3UM2 A;  4APO A;  4U07 A;  3AG1 E;  2AXV A;  1X81 A;  4UI9 C;  4U7E B;  3G2V A;  1JWF A;  3J5P A;  3CHO A;  2NYJ A;  4F6R D;  4PS3 A;  5T4Y A;  4G26 A;  5ENN A;  5H7P A;  2LXM A;  2FO7 A;  2JLB A;  4FLB A;  5AYW D;  3HIZ A;  4JHK A;  2IEJ A;  4JZY A;  4BY6 A;  3TWT A;  5LOZ A;  1H19 A;  3AU5 A;  5IY5 E;  3ENE A;  1JWG A;  3ZHE A;  3Q73 A;  4O60 A;  3S7D A;  3E4B A;  2LSV A;  1K1B A;  1DC2 A;  1GW6 A;  3O4Z A;  4DLO A;  4EQF A;  1YA0 A;  2LSU A;  3FTU A;  4L1B A;  1XNF A;  3BQO A;  5ANL A;  4L2L A;  1V55 E;  2GGF A;  3LEW A;  4IUL A;  4I2W A;  3PZ3 A;  3U64 A;  4UWH A;  1TJF A;  2CHX A;  4JEU A;  3HXD A;  2P9U G;  5HS0 A;  3SNX A;  1Z3Y A;  4ME2 A;  1FCH A;  1LD7 A;  2Q7F A;  4BWR A;  5JHA A;  1DVP A;  1HO8 A;  1MJ0 A;  3OXL A;  1D8E A;  3K9I A;  3EIQ C;  5T3R A;  2VTB A;  2I9C A;  2BUG A;  1ELR A;  3CVN A;  2OVF A;  4JVS A;  2I2O A;  2QYJ A;  4G8L A;  2CG2 A;  3IBE A;  3D9O A;  3QAQ A;  4KVO A;  5JA4 D;  3UTM A;  2GRL A;  1TN7 A; 
#chains in the Genus database with same CATH homology
 4PS7 A;  3EHN A;  2L0T B;  4N39 A;  3FTW A;  3S7B A;  1IHG A;  4GMJ A;  3CVL A;  3KEZ A;  1UJJ A;  2AXU A;  1HG5 A;  3ZYM A;  5FQ6 A;  3ZYL A;  3CHS A;  4GPK A;  1NP7 A;  4BTA A;  3GW4 A;  3ASG A;  2WXQ A;  3MCX A;  4G23 A;  4UWG A;  2XGO A;  1E7U A;  3FUE A;  3LKU A;  4GCN A;  4MLP A;  5CHE E;  5KJL A;  2VGY A;  2LNI A;  4MKT A;  1OUV A;  2VSN A;  4O6F A;  3S7F A;  4RG9 A;  4HOR A;  2HM8 A;  3RO2 A;  5JJT A;  3VLF A;  2J09 A;  2FUL A;  3LDZ A;  3GZS A;  4F7A A;  3FUL A;  3SHF A;  3P1U A;  1HE8 A;  3FH8 A;  5JHB A;  3TGO A;  4AXH A;  2WXP A;  4EZL A;  4AY6 A;  4Y6W A;  4F3V A;  3CHR A;  3FUH A;  5BT1 A;  1E8Z A;  3D9I A;  3FHE A;  3Q49 B;  3AS4 A;  4AP2 A;  2XCC A;  3PEU B;  4CCA A;  2VJ8 A;  2X38 A;  3N71 A;  5FZR A;  4FLH A;  2PQN A;  1HZ4 A;  2VSO E;  2WXL A;  5FQ7 A;  4EZJ A;  3RRU A;  4PH4 B;  4DLQ A;  4E6H A;  3FP3 A;  2EQX A;  2RG8 A;  3LVQ E;  3GZ2 A;  4ABN A;  2NXP A;  4WNG A;  4AY5 A;  3FH5 A;  2Y3A A;  4ILI A;  2NSZ A;  3SZ7 A;  3NZU A;  4G2V A;  1B89 A;  3I5P A;  4ATG A;  1IQR A;  2WMO A;  3LY7 A;  4YND A;  5BW8 C;  3PUK A;  2QY7 A;  4LER A;  3UUX A;  2IU1 A;  4GZ6 A;  4U0U A;  1IQU A;  2HR2 A;  3APD A;  4UWK A;  5AIJ A;  2I1K A;  5D0O D;  1NZN A;  3NZS A;  3BG0 B;  4FJY A;  4I2Z A;  4BX9 A;  3JCK C;  2J9Q A;  2IF4 A;  4RVB A;  2X6I A;  5FZQ A;  4HOT A;  4TV3 A;  5CCL A;  2WQ6 A;  4WWP A;  1TJC A;  1QNF A;  4KZ0 A;  4NUR A;  4GCO A;  3CVU A;  2P58 C;  4AM9 A;  4KBQ A;  3I4R B;  4D10 C;  4KYO B;  4ILH B;  4F53 A;  3FEY A;  2UWJ G;  1UN8 A;  3CQG B;  4EPZ A;  5FQ4 A;  2VSY A;  3MGB A;  4BFR A;  2I6H A;  4A1S A;  3GYZ A;  5M72 A;  4CDM A;  4N2S A;  2DIW A;  1N52 A;  3C98 A;  1WAO 1;  3FTS A;  3PE4 A;  3T8M A;  1ZU2 A;  1KT1 A;  2CFZ A;  1QZ2 A;  2FF4 A;  1NA3 A;  3EIJ A;  2XGM A;  3LS8 A;  4B8C B;  4DI3 A;  2WXJ A;  5BNW A;  5DIZ A;  1SZ9 A;  3CVY A;  4IRU A;  3U66 A;  2WQ7 A;  1INZ A;  4J6I A;  3AS8 A;  3ASH A;  4G11 A;  3FFL A;  4HFG A;  1UW4 B;  4B89 A;  3HDX A;  2YHC A;  1EF1 C;  4HOQ A;  1S0P A;  3ZRH A;  4W9R A;  4KMO A;  3PEV B;  5EKQ D;  1L5J A;  3URZ A;  4AVX A;  4L2Y A;  3FU0 A;  3PZD A;  4I1O B;  4JPS A;  1OWN A;  3ASF A;  2OV8 A;  3L17 A;  3L22 A;  4KZC A;  3RRM B;  4EBA A;  2WB2 A;  3UMV A;  2DBA A;  2WXF A;  3D9N A;  5G05 C;  4CEM A;  5LP0 A;  5FTP A;  3UT8 A;  2OVB A;  3SBT B;  4AV7 A;  5C2Y A;  3SF4 A;  3MA5 A;  4URK A;  1EPU A;  3PNL B;  4RG6 A;  4GA2 A;  5JJ7 A;  2L9B A;  4XE0 A;  2WXI A;  2Y4U A;  3OXF A;  5BUZ A;  4UQY A;  3R7Q A;  3TG5 A;  5G04 C;  2BF0 X;  4WND A;  3RK6 A;  1H0A A;  3L08 A;  5ARG A;  2IOL A;  3HVE B;  4GZ3 A;  4HOU A;  4FU3 A;  3ONK A;  4Q94 A;  5JJ6 A;  2VQ2 A;  2WXG A;  2XEV A;  4XI9 A;  1OWO A;  2UY1 B;  2FBN A;  3QDN A;  2WXM A;  3FU5 A;  4UQZ A;  3UX4 A;  2AXZ A;  3QWW A;  4A3T A;  2E0I A;  2XHE A;  4WNF A;  2L0I A;  4HXI A;  4R7L A;  2VGX B;  3EDT B;  4GZC A;  4LEU A;  4U0Z A;  1ELK A;  4C0E A;  3CK8 A;  3SGH A;  1HF8 A;  2VGX A;  3CGH A;  1DNP A;  2KCL A;  2R5S A;  4GZD A;  2J08 A;  5KCM A;  3ML9 A;  3CVX A;  4G24 A;  4ANU A;  3ZPJ A;  3B7U X;  3TAX A;  1KT0 A;  3FDH A;  2J4B A;  4EEC A;  1A17 A;  3SBS A;  3ZYK A;  4A3V A;  4ACL A;  2V4L A;  2V8S E;  1JUQ A;  3QC1 A;  2AVP A;  3RO3 A;  5G2N A;  2HO1 A;  3PH0 C;  4EZK A;  3DPD A;  3TXN A;  2V5F A;  3RU0 A;  2DCP A;  4GAA A;  4MRU A;  2KC7 A;  2XQ0 A;  4GML A;  4J8F A;  4FHK A;  4B94 A;  5FT9 A;  3L16 A;  4ACK A;  4JL0 A;  3VLE A;  2CFU A;  1NA0 A;  1HX8 A;  4L23 A;  3CVW A;  4FP7 A;  4N3A A;  1EYH A;  1JPL A;  5CMY A;  4A55 A;  4FA6 A;  1QQE A;  5AJD A;  3PS6 A;  1WY6 A;  3FTZ A;  2VSX E;  4U63 A;  2WXO A;  4E85 A;  4FAD A;  2LO6 A;  2PZI A;  3CKC A;  5LCW J;  5CMW A;  3IEG A;  4BSX A;  3ML8 A;  3LPZ A;  2XGS A;  3UQ3 A;  2FEZ A;  3MX3 A;  2ZU6 B;  2Y4T A;  2BTD A;  3Q15 A;  5BV0 A;  3FTY A;  3GZ1 A;  4J8S A;  3VTX A;  2C2L A;  5G55 A;  3MV2 B;  3S7J A;  2XRY A;  4GA1 A;  4LUN U;  3TXM A;  4JA9 A;  3U9W A;  2L6J A;  3ZFW A;  2JEK A;  5HQ8 A;  3FU3 A;  3D3M A;  4YVQ C;  1X5B A;  3EJN A;  1FVH A;  4JA7 A;  2IJG X;  3QJZ A;  3FTX A;  4GU5 A;  5ARF A;  5FQ8 A;  4ANX A;  4I9C A;  2XPZ A;  1HXI A;  3B7T A;  2PL2 A;  3LYA A;  2WVI A;  3MKR A;  4WUY A;  1U3C A;  4PUC A;  1PY1 A;  4U0S A;  2PM6 A;  3G2U A;  4ANV A;  3B7S A;  4HS2 A;  2XRZ A;  4LCT A;  4KXK B;  3FUJ A;  3I3N A;  4CDN A;  2KCV A;  4DK5 A;  4JW1 A;  1BPO A;  4UWL A;  3CHM A;  4WAF A;  2MRI A;  3PRZ A;  4IN3 B;  1Y6I A;  2WXK A;  4CT0 A;  3QNK A;  3D9J A;  3SI5 A;  5ANR A;  4DPR A;  2IOS A;  1UN9 A;  1KLX A;  4TUU A;  2GW1 A;  3NQP A;  3ZGQ A;  3VLD A;  3DBS A;  4CRW A;  2CHW A;  3QKY A;  3KS2 A;  3CEQ A;  2KM4 A;  3U4T A;  1H2V C;  2KCK A;  1HFA A;  4KT6 B;  1HG2 A;  3CLJ A;  3IKO B;  3FUD A;  2J49 A;  2GRM A;  1H2U A;  1HS6 A;  2RD0 A;  3G2T A;  3LVR E;  3LCA A;  2ION A;  3FUM A;  3CKB A;  2X6K A;  3D9L A;  3LJ3 A;  3AU4 A;  3QAR A;  3PUJ A;  2J4D A;  2X6F A;  4N5C A;  4FJZ A;  4J8D A;  4HLE A;  3BEE A;  3G2W A;  3Q47 B;  2C0M A;  2R17 C;  5E76 A;  4FHJ A;  2LAI A;  1OWM A;  3QB2 A;  4QFV A;  3ZIM A;  4APF A;  2VYI A;  3CSF A;  4GA0 A;  4I1A A;  3HYM B;  2WXR A;  4YVO A;  1XGW A;  3EHM A;  1UJK A;  2IQC A;  3I4G A;  3D9P A;  4GYO A;  4BTB A;  2AWI A;  3T5X A;  3CVV A;  3B7R L;  3JQ0 A;  4XIF A;  4B0Z A;  3CST A;  3QOU A;  4WWO A;  3G2S A;  4HOS A;  4AEZ C;  4BT8 A;  4CT4 A;  4V3I A;  3CVQ A;  3MZL B;  1E90 A;  3CVP A;  3P2B A;  1PC2 A;  2FI7 A;  2VTB B;  5LX8 A;  2MHK A;  3FUK A;  3MJW A;  3Q4A B;  4ILG A;  3D9M A;  4CGW A;  5BPP A;  5KJN A;  2WXN A;  4JHJ A;  3HVE A;  5DBK A;  2WPV A;  3ZVV A;  2YQ8 A;  4FC8 A;  2UY1 A;  2PM7 A;  1LF8 A;  5EX0 A;  4AOF A;  4EBA G;  4N3C A;  3S2A A;  2XPI A;  1E96 B;  3ESL A;  4NAC A;  5KJM A;  3IV0 A;  3FU6 A;  3TL5 A;  4P29 A;  3IHY A;  5AJL A;  3APC A;  3RJV A;  4ANW A;  1H2T C;  2KZT B;  2MOW A;  2OOE A;  3R7R A;  1OWP A;  1EDU A;  3OAW A;  4G25 A;  4J8E A;  4XKB A;  3L6A A;  4GYY A;  1E7V A;  2KZT A;  2NC9 A;  4GYW A;  4K03 A;  3OXG A;  4H7Y A;  2IFU A;  4JHR A;  4WWN A;  4APO A;  1OWL A;  4U07 A;  2J07 A;  2AXV A;  3MEK A;  4I43 A;  3PVL A;  1UG3 A;  3FH7 A;  3UPV A;  4I6J A;  3D9K A;  2AW6 A;  4UI9 C;  5T8I A;  2QFC A;  3G2V A;  5D0Q D;  1JWF A;  3FY4 A;  3MV3 B;  4PDX A;  3JQ1 A;  1HH8 A;  3CHO A;  4WNE A;  3HHM A;  3SD5 A;  2A4Z A;  4XKC A;  3JUI A;  3O48 A;  1H6K A;  3CHQ A;  4OVU A;  4TRQ A;  4DJA A;  5J08 A;  3ZN3 A;  3JYS A;  3RIB A;  5FZS A;  3T5V A;  4PS3 A;  3FTV A;  4GZ5 A;  3ESK A;  3QWV A;  4NQ0 A;  4I9E A;  1VDY A;  2V0P A;  4G26 A;  5T4Y A;  4A1G A;  2ILR A;  3RKV A;  3PE3 A;  2WQH A;  2YIN A;  5ENN A;  2C0L A;  3BG1 B;  2FO7 A;  2JLB A;  4CDR A;  4C9B B;  3LXU X;  3OTN A;  3FWV A;  4FLB A;  5AYW D;  3HIZ A;  3LY8 A;  4JHK A;  4XX5 A;  3UT4 A;  3ZXS A;  4K0R A;  4G1T A;  2XPY A;  4JZY A;  1WM5 A;  5AEN A;  2A5U A;  5FWQ A;  4BY6 A;  1TEZ A;  4C0M A;  4Q96 A;  3CIA A;  5LOZ A;  3TG4 A;  3FUN A;  3NF1 A;  5E75 A;  3CK7 A;  1H19 A;  3ZHE B;  3AU5 A;  2YHE A;  5J90 A;  1E8W A;  2KAT A;  4NRH B;  3L54 A;  4FUL A;  3ENE A;  1Z3X A;  1E8Y A;  1JWG A;  3ZHE A;  3RRN B;  4LRZ A;  3IHV A;  4UI9 K;  4IYP A;  3S7D A;  4BT9 A;  3KAE A;  3U3W A;  3FUI A;  3E4B A;  4UWF A;  3WXX A;  2WM9 A;  4OYS A;  5KJK A;  4U8H A;  2LSV A;  3B13 A;  1W3B A;  2YNQ A;  1GW6 A;  2CHZ A;  3QWP A;  3O4Z A;  5G05 J;  5LCW C;  2CG3 A;  5HI7 A;  4DLO A;  4EQF A;  1ZBP A;  1FVF A;  1YA0 A;  2LSU A;  3FTU A;  3MYV A;  3PDN A;  1ELW A;  1XNF A;  4KVM A;  4L1B A;  4N2Q A;  2HYZ A;  1N54 A;  2XCB A;  3APF A;  3ONL A;  5ANL A;  2E2E A;  3ZEF A;  5LFA A;  2X6J A;  4L2L A;  3SFZ A;  4J0U A;  3CR3 A;  1MQS A;  5G04 J;  4Y6C A;  3ZYQ A;  2GGF A;  3CV0 A;  2WXH A;  2OND A;  3LEW A;  4IUL A;  4I2W A;  4CGV A;  3U64 A;  4UWH A;  1Z6T A;  4I17 A;  3FEX A;  1TJF A;  2CHX A;  4JEU A;  4JC8 A;  5A6C A;  3PNT B;  3SNX A;  2PQR A;  4AJW A;  3LY9 A;  3KD7 A;  4L7T A;  3ULQ A;  1Z3Y A;  4ME2 A;  1FCH A;  2Q7F A;  5A7D B;  3ASD A;  4BWR A;  1U3D A;  1E8X A;  4I6G A;  5C1D A;  1DVP A;  2X6H A;  1PAQ A;  5JHA A;  1HO8 A;  2I1J A;  5CCM A;  4PS8 A;  5EX3 A;  2X3M A;  4F1S A;  3CQC B;  4HVB A;  3OXL A;  4B8A A;  2R59 A;  3PRE A;  3K9I A;  3EIQ C;  5T3R A;  2VTB A;  2LAH A;  2I9C A;  2BUG A;  3FUF A;  4XZ4 A;  5A23 A;  3MKQ B;  1ELR A;  3Q5M A;  4JEH A;  3R9A B;  3CVN A;  4I1M A;  4OVV A;  4Q69 A;  2WMN A;  1SQM A;  2OVF A;  4JVS A;  1Y8M A;  4I6E A;  4UI9 J;  3VTY A;  2I2O A;  3MKQ A;  3L13 A;  3QK0 A;  5BV1 A;  4XI0 A;  2CG2 A;  4U04 A;  4UQX A;  3IBE A;  4RSY A;  3UT7 A;  3D9O A;  4GB9 A;  1P5Q A;  4MS6 A;  4N3B A;  3CK9 A;  4H7X A;  3AS5 A;  3QAQ A;  5FJY A;  4DI4 A;  1HU3 A;  1SZA A;  4KVO A;  5EDS A;  2GRL A;  3CHP A;  3TJP A;  2M63 A;  1IYG A;  4M3O A;  3ZW3 A;  4JXT A;  1MHQ A;  4BX8 A;  4AIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...