5CRUA

Crystal structure of the bro domain of hd-ptp
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
360
structure length
360
Chain Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
total genus 134
structure length 360
sequence length 360
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5cruA00
2R03A 3RAUA 5CRVA 3UM3A 3C3OA 3UM1A 2R02A 3ZXPA 3UM0A 2OEWA 2OEVA 1ZB1A 3C3QA 3C3RA 3UM2A 3R9MA 3ULYA 2XS8A 2XS1A 2R05A 5CRUA
chains in the Genus database with same CATH superfamily
1N94A 2Y69E 3TL5A 3FFLA 3IEGA 4G25A 3ESLA 3U9WA 3BG1B 4G11A 3TWXA 5DBKA 4UUCA 3FUIA 2F37A 2WB2A 1NP7A 3RIBA 4U0SA 4GMRA 4H7XA 1ELKA 2I1KA 4FHKA 4U0UA 5T8IA 4NURA 4N5CA 4J8DA 2XPYA 4Y6WA 2GROB 4HOQA 1QYMA 1E7VA 4FJYA 3FUFA 2XQ0A 4B0ZA 3OXFA 2AW6A 4TXPA 5AJLA 3Q7FA 3R7RA 3AG4E 2P9NG 4TXQA 4Y6CA 4IN3B 1OWOA 1JWFA 3MX3A 4AJWA 2F8YA 5LOZA 2J49A 3HG0D 2WMOA 5E75A 2X6IA 1K1AA 1OCZE 5M72A 4JW1A 3QWPA 4FADA 5JJTA 2LSUA 2EIKE 1IQUA 2IQCA 3OXLA 4KMOA 3J5PA 4U95D 2OVFA 4XIFA 2UWJG 3TXMA 1WG0A 2Y0BG 4DRXE 2R05A 1DCQA 4ZHBA 5J08A 3MV2B 1Y6IA 3CVYA 4HI8A 2ZISA 1N4SA 3FTUA 2XRZA 3JUEA 2VSOE 2L6JA 1HS6A 3HVEA 4CT4A 1TJFA 2LAHA 3ASHA 3UTMA 2CFUA 1V54E 4G1TA 2IU1A 1N4QA 3LVRE 4WNDA 3ONKA 4OAVB 4G23A 3B7RL 2KM4A 5G05C 3L13A 4DUIA 5CMYA 2XS8A 4EPZA 3ZFWA 2GRRB 1TNOA 4GTSA 2E2EA 4GZ5A 3ZW3A 4V3IA 1OXJA 4UWLA 1BPOA 4TV3A 5HQ8A 5HKPA 4LNUD 3ULQA 4I9CA 1WY6A 4JVSA 1H6OA 5EYLA 3TWRA 4KYOB 3P2BA 2HO1A 1ZU2A 1Q2ZA 1Z6TA 2DBAA 3MYVA 4PDXA 3APFA 3TWQA 1UN9A 3QB2A 3JQ0A 3R9AB 1FCHA 1KLXA 4A63B 5FQ4A 4Q69A 2XEHA 1SVXA 2AXVA 4HRMB 2IO2C 4HBDA 4DX1A 4J8YA 2JABA 2PQRA 1MYOA 3SNXA 3ZIMA 3Q47B 1JCSA 2WM9A 3PUJA 2OOEA 4G8KA 3T8KA 4CRWA 5A7DB 3B7SA 1S64A 4I43A 3V79K 3ASOE 2XZDG 5FZRA 3QARA 3G2TA 4K5BA 4M7CA 3DXKG 3LDZA 3Q7AA 2J09A 2P9IG 2CHXA 4LCTA 4B8AA 4GU5A 4U7EB 4K5CA 4RG6A 4ATGA 1JPLA 1KPSB 3FUJA 3RAUA 3TWWA 4HLEA 3ZVVA 3Q49B 4G2VA 2DYSE 5G55A 2OEWA 4BFRA 1ZB1A 3T5XA 3EHMA 4GZ3A 2LXMA 5FZQA 1QBQA 4KVOA 4WNEA 2EILE 1VDYA 3SD5A 5EIBE 2V4HC 3ZUVB 3E34A 2GRNB 3URZA 3E37A 3CHRA 2ETAA 2R59A 2UY1B 5EN5D 3LY9A 3FTXA 3HIZA 4J7WA 3CVXA 2EQXA 3RKVA 3SBSA 3DSXA 2XZTG 1U3CA 3L22A 3FU0A 3HXBA 3VTYA 4JEHA 3CK8A 3ASFA 4DK5A 3ISMC 3EUVA 3JXJA 3LS8A 3UIOC 4A55A 4TUUA 3V31A 3U4TA 5JJ6A 2DIWA 1ZBPA 3Q9NC 5EYPF 5ENOD 3LYAA 5BV1A 4B8CB 2WXMA 4U07A 2VSXE 5ANRA 2VSYA 3UPVA 2MHKA 2XGMA 3FUEA 3UX4A 3UIPC 3ULEG 1E8YA 2X6JA 4UWGA 2BKGA 3MA5A 3Q9UC 4HS2A 4FLHA 4LUNU 3FH5A 2QC9A 3PZDA 3ASNE 5ENRD 5FZSA 4KZCA 3RO3A 2PQNA 4BSZB 3AG1E 2DVWA 4K5AB 2L6BA 5KJKA 5JHBA 1HO8A 5HI7A 2AXUA 4O1PA 4GB9A 2LUHA 4GTQA 1SA4A 4W9RA 2LNIA 2I2OA 1IYGA 4C0MA 2ONDA 3UUXA 3HYMB 3HVEB 2WPVA 4I1AA 3I4RB 1TNUA 3AU5A 4WNFA 3E4BA 3R9MA 3SZ7A 4L7TA 4AM9A 4O1OA 4ANWA 1HX8A 3DRAA 3Q15A 3FTZA 2XEVA 4ILGA 2J07A 4FHJA 3HDXA 4J8FA 1SA5A 3J5QB 4A3VA 3D9PA 3E32A 4JA9A 3VTXA 4BETA 1D8DA 4EZLA 1MX6A 2P9SG 4JHJA 1IXVA 3TGOA 2J9QA 2JLBA 3TWUA 1NA3A 3LEWA 1N54A 4N3BA 1YA0A 3OTNA 3BQOA 2WXRA 1IQRA 2A4ZA 4BY6A 4G26A 3C98A 3V2XA 2IONA 2RFAA 4HRLA 2HE0A 2AVPA 2GW1A 3F6QA 3QOUA 3FEXA 4O60A 2B0OE 1S70B 4UQXA 3L16A 2P9PG 2H6HA 3VLEA 2BUGA 5ENQD 3G2VA 5FQ8A 4N3CA 1OWNA 2AJAA 3FY4A 4BWRA 3PE4A 1O1RA 4PS7A 1SW6A 3BUAA 1MZCA 3Q75A 4CEMA 3MGBA 1AP7A 3FU6A 1QQEA 1XGWA 3CR3A 4I6GA 3UT8A 3LXUX 1BD8A 2KCVA 4XI9A 2IF4A 5FT9A 3TG5A 3SO8A 4JHKA 3AJIA 2PZIA 2IY0C 1E90A 3FU3A 4BT9A 3CVUA 4GPMA 3DSUA 3FUNA 3FULA 2IOSA 3WG7E 4NACA 4LERA 3CV0A 4PH4B 3CVLA 5JJ7A 4BTAA 2XCCA 3CK9A 4NRHB 5A6CA 1BLXB 5D0QD 3SBTB 4IYPA 1MX4A 2EINE 4WWPA 1TYQG 4CCAA 1DC2A 1OUVA 4AP2A 5ARGA 2YINA 4GTTA 5G04C 4HORA 5C1DA 4FJZA 1W3BA 4FC8A 4N2QA 5FWQA 3EU9A 3FUMA 2B6CA 4B89A 1S0PA 4HNAD 4L1BA 2H6IA 5LX8A 1N0QA 1DVPA 5AYWD 3ZKJA 2WXJA 4EBAA 3UM1A 3CK7A 3HXCA 1Y8MA 4FLBA 2X3MA 4HVBA 2YHEA 4YDWA 5BUZA 3C3RA 3FWVA 4F53A 3QJZA 3EDTB 5FTPA 3L08A 3D9MA 3NF1A 3Q79A 4LEUA 1DCEA 4JC8A 2KATA 4YVOA 4GYOA 2DCPA 2WXFA 4PS8A 3QKYA 3CVWA 3HXDA 3FTYA 5KCMA 2V4LA 2ZU6B 3ZPJA 2V8SE 5G2NA 4JHRA 4L2YA 2CHWA 1AWCB 2VGYA 4N5QA 3G2UA 5BW8C 1OWLA 3ML9A 3DPDA 3NOCD 1N4PA 1IKND 4ANVA 3ZU7B 3MKQA 2C2LA 3EHQA 2J4BA 4JL0A 2C0LA 1X81A 5BXUA 3UT7A 3GW4A 3ZYLA 4GCOA 2HM8A 3D9IA 5KJNA 4FA6A 3TWVA 1HG5A 4WWNA 3CVQA 4GPKA 1NL4A 3T5VA 1GW6A 3SFYA 1XNFA 3BU8A 3AAAC 3B95A 3TXNA 4CT0A 5ENPD 2WMNA 4CYMD 1QNFA 4HXIA 4WUYA 5KNGA 3APCA 2QFCA 3EJNA 2F8XK 3ABKE 3JXIA 2WQ7A 3D9JA 3SFXA 1TN8A 3CVPA 1MJ0A 4I6JA 4APOA 2QYJA 2XPIA 5KWDA 5CECB 4F1PA 2NYJA 3SI5A 3UQ3A 1HZ4A 3PH0C 1BU9A 2WXLA 1V55E 3TG4A 3PNLB 3S7FA 3C5RA 4DLQA 4K03A 1EDUA 3ZN3A 3LKUA 4ILHB 4EECA 3KAEA 3KD7A 4RLYA 5EKQD 4J8EA 4ANXA 2ZXWE 2A5EA 3IHVA 4KT6B 3ASDA 4EHMA 4WWOA 1SQMA 4A1SA 1LD8A 2FBNA 3U64A 1KT0A 2OVBA 4UWKA 4U8YD 4HQDA 2WXGA 5AQBA 2BF0X 2ILRA 4CDMA 4I6EA 4I9EA 2IOLA 3C3QA 3JQ1A 1MQSA 1TEZA 4FU3A 5ANLA 3B7UX 4E6HA 4CGVA 1N52A 3E30A 3FUKA 4AV7A 2BKKB 3HXEA 4WAFA 2Y1LE 2YQ8A 4XZ4A 1D9SA 1LF8A 2KC7A 4Q94A 3HXFA 4NQ0A 5AN8A 1U2VG 1NFIE 2YNQA 3FDHA 1P5QA 3QWWA 3L82A 3AG2E 3MKRA 3L17A 1JUQA 1Z5SC 3Q5MA 3EHNA 3AU4A 5AJDA 3NZUA 4IRUA 4BX8A 4I2ZA 2A5UA 3HHMA 4UI9C 4ACLA 3FUDA 4TXRA 3D9HA 5D0OD 3UT4A 5FIOA 2VGXA 4GYYA 3B7TA 2QYUA 4ATZD 2XHEA 1L5JA 1N11A 2MYOA 3FH8A 4XKBA 4YNDA 4UQZA 1EYHA 2H6FA 4GA1A 5BT1A 4P29A 3ZYQA 1K8KG 3X2QE 2KXPC 5C2YA 3ZNGA 2ZGDA 2RKKA 3SQVA 5EX0A 4GCNA 1E7UA 4DX5D 1K3ZD 2FO1E 3W9GA 4A1GA 4BTBA 2WXHA 1H2TC 3CEQA 1KZPA 5LCWJ 3T8MA 3SF4A 4DI3A 4K0RA 3EHRA 2WVIA 3FUHA 2R02A 5BV0A 4JZYA 2P9LG 4HOSA 1YMPA 1E8ZA 3ABME 3KEAA 4YDOA 3DXMG 1KT1A 4R7LA 5B1AE 5CRVA 3NOGD 4U96D 4XKCA 1JCQA 2VSNA 5CERB 3DWLG 5AQ9A 4U04A 3MJWA 1WDYA 3CKCA 4Z68A 3CHQA 3ZGQA 5AQAA 4KXKB 2ETCA 4GTMA 1FT2A 2L0IA 3I5PA 1HG2A 4X8QA 3V30A 2LO6A 2LSVA 3UINC 5AAOA 2DWZA 2DZNA 3LCAA 2XGOA 3MKQB 3RJVA 5KJMA 2IJGX 4OVUA 1RZ4A 4URKA 2V5QC 2XENA 3RO2A 3RRMB 5IY5E 3D9OA 3HRAA 3GYZA 3UM3A 2EIME 2FEZA 3QWVA 2P58C 2WXIA 3S7DA 1O1TA 5E76A 5CMWA 2X38A 1YCSB 5D2MC 1OCOE 3AS8A 3CSTA 2VJ8A 3ULYA 3FEYA 4F6RD 2OCCE 5T3RA 3CLJA 3ENEA 4NIKA 4AY6A 2LAIA 2Y4UA 5A23A 4DJAA 3TAXA 2V0PA 1NA0A 4MBGA 3ZHEA 4AY5A 1UN8A 2JEKA 3D9NA 3DPYA 3PS6A 3W9FA 5EIDA 5LP0A 1MX2A 4HB5A 1OY3D 1HU3A 5ENTD 3B7BA 2FF4A 3CHOA 2LXLA 3PVLA 5BNWA 5FQ7A 4GYWA 3ZXPA 4OYSA 4F1SA 3V2OA 4I17A 3ESKA 3FH7A 3PZ3A 4EQFA 4AOFA 5AENA 3KS2A 3LJNA 4I1MA 3PEUB 2GRLA 2XCBA 3VLDA 3FP3A 3IXEA 3IBEA 4U8HA 4LRZA 4A3TA 3S2AA 1UJKA 3NZSA 4GTVA 3EIJA 2NXPA 2OEVA 1SZAA 2IEJA 2DZOA 4IULA 3L6AA 2I6HA 2J08A 2KZTA 4FP7A 3I3NA 1S63A 3C3OA 3IKOB 3PZ2A 4JXTA 1E96B 4H7YA 4MKTA 5CBNA 3SFZA 1WAO1 4KVMA 4L2LA 1TNZA 1G3NB 3KSQA 2FI7A 3PZ1A 1HE8A 3GZ2A 4TRQA 3LY7A 4U0ZA 3RRUA 3D9LA 2XS1A 3TWSA 3PUKA 3MV3B 2GRMA 3NB2A 5FJYA 3FU5A 1EF1C 5JHAA 2E0IA 2ETBA 4DPRA 2WQ6A 2GRPB 2QY7A 2R17C 3UM0A 2X6FA 3IV0A 2H6GA 3LVQE 4J8SA 2M63A 4BSXA 1TN7A 1BI8B 3G2SA 2CG2A 2R2LA 1ELWA 3JCKC 4DX7D 5G05J 3NQPA 1INZA 1N95A 4BT8A 3CHMA 2CHZA 1N4RA 5AIJA 3ASGA 3AG3E 4PUCA 2XGSA 4ABNA 5AARA 3CKBA 1A17A 4CGWA 2VQ2A 2VGXB 3JYSA 4HFGA 3UKUG 2KCKA 2VYIA 3CGHA 3RK6A 1FVHA 2R03A 4AVXA 3R7QA 3U3WA 3QAQA 3TWTA 2I9CA 5CEDB 4MLPA 2WXKA 2XRYA 5EDSA 4UI9K 4BX9A 1H0AA 4TUMA 3RU0A 2IO3C 1OWPA 4L23A 1U3DA 1LD7A 1PC2A 4J6IA 2FULA 3S7JA 2AXZA 3CSFA 2EIJE 3OAWA 1WM5A 3SHFA 5KBAA 3RRNB 2GRQB 4J0UA 4I1OB 5AQ7A 2PM6A 4AEZC 1OT8A 4QFVA 2WXNA 1IHBA 3UKRG 3U66A 2DYRE 3MEKA 4HOTA 1YYHA 4C48B 3AS5A 3DBSA 3AS4A 3KSLA 1IHGA 4C0EA 1UG3A 4O6FA 1JWGA 5T4YA 4HLLA 1LTXA 1QZ2A 1H6PA 3BG0B 1PAQA 3C72A 3E33A 5H7PA 1UW4B 4GZDA 3O4ZA 3ZYKA 3JUIA 2F0YA 4DLOA 4CZ2D 3MZLB 1SZ9A 5CRUA 4FULA 3L54A 3QNKA 1TN6A 1OWMA 3CQCB 1FT1A 3RSEG 5ARFA 3SGHA 1KZOA 3DSSA 1N9AA 4U63A 5KJLA 5CBOA 2L9BA 2WQHA 1O5MA 4UQYA 4G8LA 1HH8A 4U8VD 1NZNA 4GTPA 1HFAA 4GMJA 3S7BA 4UI9J 5D66A 2HYZA 3UI2A 4XEIG 2PL2A 1TNBA 3ZHEB 2VTBA 1UJJA 1TJCA 4N39A 3T9KA 2Y4TA 4JA7A 4I2WA 3OXGA 3K9IA 2P9KG 1B89A 3ZRHA 1MHQA 4DX6D 4EZKA 2NC9A 2GGFA 4G24A 3UMVA 4GZ6A 3L9TA 3Q73A 3FTVA 3Q4AB 4N3AA 3GZSA 2ZIRA 2R5SA 4HOUA 2J8SD 4JB8P 2XEEA 3PNTB 4F7AA 3MCXA 4GA0A 2WXQA 4ME2A 4HRNA 5CEAA 3EIQC 1N0RA 2IFUA 5B1BE 1H6KA 1H2VC 2KZTB 3EU5A 2I1JA 2J4DA 2X6HA 1JCRA 3SY2A 2BEDA 4RVBA 1K1BA 3VLFA 4MRUA 1BI7B 4D10C 4PS3A 3QK0A 4DX2A 4AIFA 5B3SE 2KBXA 3DEOA 4ILIA 2PM7A 3DSVA 4N2SA 4JD2G 5J90A 4BERA 1E8XA 4BEPA 2BTDA 5BPPA 3LY8A 4B94A 2HR2A 4LG6A 3G2WA 3ABLE 1UOHA 2CFZA 4GA2A 4RG9A 4GAAA 4XE0A 2OV8A 2C0MA 3PDNA 3UXGA 3FHEA 1OCRE 3BEEA 2XPZA 5EX3A 3QDNA 3Q78A 3PEVB 4CDRA 5ENSD 4UWFA 1PY1A 4WNGA 2VGEA 3LPZA 5CCMA 1H2UA 3D3MA 4XI0A 2YHCA 4LSZE 3N71A 2Q7FA 4APFA 4ZFHA 3CHSA 1X5BA 4Q96A 4KBQA 3UM2A 1HF8A 3TJPA 1FVFA 2X6KA 4L9PA 1OCCE 4M3OA 5JA4D 3DEPA 2RG8A 3NAWA 1EPUA 4YDEA 5LFAA 3ML8A 2NSZA 2V5FA 4AXHA 3IHYA 4XX5A 1NI1A 4E85A 5EILA 3GZ1A 5JMND 4RQIA 4C9BB 3NBNB 3APDA 4ANUA 5BXOA 4KZ0A 2P9UG 4OVVA 4BESA 1H19A 3PE3A 3P1UA 3ZEFA 3CVNA 1TR4A 3CVVA 3QC1A 5ITZF 2FO7A 1Z3YA 4F3VA 5CHEE 1E8WA 1FPPA 2P2CP 3FTSA 2RFMA 4GMLA 4LNGA 2L0TB 2PNNA 5FINA 3D9KA 2WXPA 3LJ3A 1A5EA 1HXIA 3I4GA 5LCWC 4HI9A 5CCLA 4UWHA 3ZXSA 4GTRA 3DSTA 4JEUA 3CHPA 4LNBA 4YDYA 4EZJA 2QZAA 2WXOA 4MS6A 3ONLA 3CIAA 3KEZA 5KNHD 4OAUC 2RD0A 1O1SA 3PREA 4GTOA 1RW2A 3B13A 5FQ6A 4ACKA 2ZGGA 5G04J 4CDNA 2AWIA 1ELRA 4QQIA 3O48A 4JPSA 3FTWA 1D8EA 3PZ4A 3CQGB 5ENNA 4RSYA 5HS0A 1TNYA 4YVQC 3WXXA 4B93B 4DI4A 5DIZA 3PRZA 2CG3A 4EBAG 3DSWA 5HRYA 2MOWA 4GZCA 1Z3XA 2MRIA 1DNPA 3ZYMA 2UY1A 2KCLA 2Y3AA 2VTBB
chains in the Genus database with same CATH topology
2R03A 3RAUA 5CRVA 3UM3A 3C3OA 3UM1A 2OJQA 2R02A 3ZXPA 3UM0A 2OEWA 4JIOA 2OEVA 1ZB1A 2OEXA 3C3QA 3C3RA 3UM2A 3R9MA 3ULYA 2XS8A 2XS1A 2R05A 5CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R03 A;  3RAU A;  5CRV A;  3UM3 A;  3C3O A;  3UM1 A;  2R02 A;  3ZXP A;  3UM0 A;  2OEW A;  2OEV A;  1ZB1 A;  3C3Q A;  3C3R A;  3UM2 A;  3R9M A;  3ULY A;  2XS8 A;  2XS1 A;  2R05 A;  5CRU A; 
#chains in the Genus database with same CATH topology
 1N94 A;  2Y69 E;  3TL5 A;  3FFL A;  3IEG A;  4G25 A;  3ESL A;  3U9W A;  3BG1 B;  4G11 A;  3TWX A;  5DBK A;  4UUC A;  3FUI A;  2F37 A;  2WB2 A;  1NP7 A;  3RIB A;  4U0S A;  4GMR A;  4H7X A;  1ELK A;  2I1K A;  4FHK A;  4U0U A;  5T8I A;  4NUR A;  4N5C A;  4J8D A;  2XPY A;  4Y6W A;  2GRO B;  4HOQ A;  1QYM A;  1E7V A;  4FJY A;  3FUF A;  2XQ0 A;  4B0Z A;  3OXF A;  2AW6 A;  4TXP A;  5AJL A;  3Q7F A;  3R7R A;  3AG4 E;  2P9N G;  4TXQ A;  4Y6C A;  4IN3 B;  1OWO A;  1JWF A;  3MX3 A;  4AJW A;  2F8Y A;  5LOZ A;  2J49 A;  3HG0 D;  2WMO A;  5E75 A;  2X6I A;  1K1A A;  1OCZ E;  5M72 A;  4JW1 A;  3QWP A;  4FAD A;  5JJT A;  2LSU A;  2EIK E;  1IQU A;  2IQC A;  3OXL A;  4KMO A;  3J5P A;  4U95 D;  2OVF A;  4XIF A;  2UWJ G;  3TXM A;  1WG0 A;  2Y0B G;  4DRX E;  2R05 A;  1DCQ A;  4ZHB A;  5J08 A;  3MV2 B;  1Y6I A;  3CVY A;  4HI8 A;  2ZIS A;  1N4S A;  3FTU A;  2XRZ A;  3JUE A;  2VSO E;  2L6J A;  1HS6 A;  3HVE A;  4CT4 A;  1TJF A;  2LAH A;  3ASH A;  3UTM A;  2CFU A;  1V54 E;  4G1T A;  2IU1 A;  1N4Q A;  3LVR E;  4WND A;  3ONK A;  4OAV B;  4G23 A;  3B7R L;  2KM4 A;  5G05 C;  3L13 A;  4DUI A;  5CMY A;  2XS8 A;  4EPZ A;  3ZFW A;  2GRR B;  1TNO A;  4GTS A;  2E2E A;  4GZ5 A;  3ZW3 A;  4V3I A;  1OXJ A;  4UWL A;  1BPO A;  4TV3 A;  5HQ8 A;  5HKP A;  4LNU D;  3ULQ A;  4I9C A;  1WY6 A;  4JVS A;  1H6O A;  5EYL A;  3TWR A;  4KYO B;  3P2B A;  2HO1 A;  1ZU2 A;  1Q2Z A;  1Z6T A;  2DBA A;  3MYV A;  4PDX A;  3APF A;  3TWQ A;  1UN9 A;  3QB2 A;  3JQ0 A;  3R9A B;  1FCH A;  1KLX A;  4A63 B;  5FQ4 A;  4Q69 A;  2XEH A;  1SVX A;  2AXV A;  4HRM B;  2IO2 C;  4HBD A;  4DX1 A;  4J8Y A;  2JAB A;  2PQR A;  1MYO A;  3SNX A;  3ZIM A;  3Q47 B;  1JCS A;  2WM9 A;  3PUJ A;  2OOE A;  4G8K A;  3T8K A;  4CRW A;  5A7D B;  3B7S A;  1S64 A;  4I43 A;  3V79 K;  3ASO E;  2XZD G;  5FZR A;  3QAR A;  3G2T A;  4K5B A;  4M7C A;  3DXK G;  3LDZ A;  3Q7A A;  2J09 A;  2P9I G;  2CHX A;  4LCT A;  4B8A A;  4GU5 A;  4U7E B;  4K5C A;  4RG6 A;  4ATG A;  1JPL A;  1KPS B;  3FUJ A;  3RAU A;  3TWW A;  4HLE A;  3ZVV A;  3Q49 B;  4G2V A;  2DYS E;  5G55 A;  2OEW A;  4BFR A;  1ZB1 A;  3T5X A;  3EHM A;  4GZ3 A;  2LXM A;  5FZQ A;  1QBQ A;  4KVO A;  4WNE A;  2EIL E;  1VDY A;  3SD5 A;  5EIB E;  2V4H C;  3ZUV B;  3E34 A;  2GRN B;  3URZ A;  3E37 A;  3CHR A;  2ETA A;  2R59 A;  2UY1 B;  5EN5 D;  3LY9 A;  3FTX A;  3HIZ A;  4J7W A;  3CVX A;  2EQX A;  3RKV A;  3SBS A;  3DSX A;  2XZT G;  1U3C A;  3L22 A;  3FU0 A;  3HXB A;  3VTY A;  4JEH A;  3CK8 A;  3ASF A;  4DK5 A;  3ISM C;  3EUV A;  3JXJ A;  3LS8 A;  3UIO C;  4A55 A;  4TUU A;  3V31 A;  3U4T A;  5JJ6 A;  2DIW A;  1ZBP A;  3Q9N C;  5EYP F;  5ENO D;  3LYA A;  5BV1 A;  4B8C B;  2WXM A;  4U07 A;  2VSX E;  5ANR A;  2VSY A;  3UPV A;  2MHK A;  2XGM A;  3FUE A;  3UX4 A;  3UIP C;  3ULE G;  1E8Y A;  2X6J A;  4UWG A;  2BKG A;  3MA5 A;  3Q9U C;  4HS2 A;  4FLH A;  4LUN U;  3FH5 A;  2QC9 A;  3PZD A;  3ASN E;  5ENR D;  5FZS A;  4KZC A;  3RO3 A;  2PQN A;  4BSZ B;  3AG1 E;  2DVW A;  4K5A B;  2L6B A;  5KJK A;  5JHB A;  1HO8 A;  5HI7 A;  2AXU A;  4O1P A;  4GB9 A;  2LUH A;  4GTQ A;  1SA4 A;  4W9R A;  2LNI A;  2I2O A;  1IYG A;  4C0M A;  2OND A;  3UUX A;  3HYM B;  3HVE B;  2WPV A;  4I1A A;  3I4R B;  1TNU A;  3AU5 A;  4WNF A;  3E4B A;  3R9M A;  3SZ7 A;  4L7T A;  4AM9 A;  4O1O A;  4ANW A;  1HX8 A;  3DRA A;  3Q15 A;  3FTZ A;  2XEV A;  4ILG A;  2J07 A;  4FHJ A;  3HDX A;  4J8F A;  1SA5 A;  3J5Q B;  4A3V A;  3D9P A;  3E32 A;  4JA9 A;  3VTX A;  4BET A;  1D8D A;  4EZL A;  1MX6 A;  2P9S G;  4JHJ A;  1IXV A;  3TGO A;  2J9Q A;  2JLB A;  3TWU A;  1NA3 A;  3LEW A;  1N54 A;  4N3B A;  1YA0 A;  3OTN A;  3BQO A;  2WXR A;  1IQR A;  2A4Z A;  4BY6 A;  4G26 A;  3C98 A;  3V2X A;  2ION A;  2RFA A;  4HRL A;  2HE0 A;  2AVP A;  2GW1 A;  3F6Q A;  3QOU A;  3FEX A;  4O60 A;  2B0O E;  1S70 B;  4UQX A;  3L16 A;  2P9P G;  2H6H A;  3VLE A;  2BUG A;  5ENQ D;  3G2V A;  5FQ8 A;  4N3C A;  1OWN A;  2AJA A;  3FY4 A;  4BWR A;  3PE4 A;  1O1R A;  4PS7 A;  1SW6 A;  3BUA A;  1MZC A;  3Q75 A;  4CEM A;  3MGB A;  1AP7 A;  3FU6 A;  1QQE A;  1XGW A;  3CR3 A;  4I6G A;  3UT8 A;  3LXU X;  1BD8 A;  2KCV A;  4XI9 A;  2IF4 A;  5FT9 A;  3TG5 A;  3SO8 A;  4JHK A;  3AJI A;  2PZI A;  2IY0 C;  1E90 A;  3FU3 A;  4BT9 A;  3CVU A;  4GPM A;  3DSU A;  3FUN A;  3FUL A;  2IOS A;  3WG7 E;  4NAC A;  4LER A;  3CV0 A;  4PH4 B;  3CVL A;  5JJ7 A;  4BTA A;  2XCC A;  3CK9 A;  4NRH B;  5A6C A;  1BLX B;  5D0Q D;  3SBT B;  4IYP A;  1MX4 A;  2EIN E;  4WWP A;  1TYQ G;  4CCA A;  1DC2 A;  1OUV A;  4AP2 A;  5ARG A;  2YIN A;  4GTT A;  5G04 C;  4HOR A;  5C1D A;  4FJZ A;  1W3B A;  4FC8 A;  4N2Q A;  5FWQ A;  3EU9 A;  3FUM A;  2B6C A;  4B89 A;  1S0P A;  4HNA D;  4L1B A;  2H6I A;  5LX8 A;  1N0Q A;  1DVP A;  5AYW D;  3ZKJ A;  2WXJ A;  4EBA A;  3UM1 A;  3CK7 A;  3HXC A;  1Y8M A;  4FLB A;  2X3M A;  4HVB A;  2YHE A;  4YDW A;  5BUZ A;  3C3R A;  3FWV A;  4F53 A;  3QJZ A;  3EDT B;  5FTP A;  3L08 A;  3D9M A;  3NF1 A;  3Q79 A;  4LEU A;  1DCE A;  4JC8 A;  2KAT A;  4YVO A;  4GYO A;  2DCP A;  2WXF A;  4PS8 A;  3QKY A;  3CVW A;  3HXD A;  3FTY A;  5KCM A;  2V4L A;  2ZU6 B;  3ZPJ A;  2V8S E;  5G2N A;  4JHR A;  4L2Y A;  2CHW A;  1AWC B;  2VGY A;  4N5Q A;  3G2U A;  5BW8 C;  1OWL A;  3ML9 A;  3DPD A;  3NOC D;  1N4P A;  1IKN D;  4ANV A;  3ZU7 B;  3MKQ A;  2C2L A;  3EHQ A;  2J4B A;  4JL0 A;  2C0L A;  1X81 A;  5BXU A;  3UT7 A;  3GW4 A;  3ZYL A;  4GCO A;  2HM8 A;  3D9I A;  5KJN A;  4FA6 A;  3TWV A;  1HG5 A;  4WWN A;  3CVQ A;  4GPK A;  1NL4 A;  3T5V A;  1GW6 A;  3SFY A;  1XNF A;  3BU8 A;  3AAA C;  3B95 A;  3TXN A;  4CT0 A;  5ENP D;  2WMN A;  4CYM D;  1QNF A;  4HXI A;  4WUY A;  5KNG A;  3APC A;  2QFC A;  3EJN A;  2F8X K;  3ABK E;  3JXI A;  2WQ7 A;  3D9J A;  3SFX A;  1TN8 A;  3CVP A;  1MJ0 A;  4I6J A;  4APO A;  2QYJ A;  2XPI A;  5KWD A;  5CEC B;  4F1P A;  2NYJ A;  3SI5 A;  3UQ3 A;  1HZ4 A;  3PH0 C;  1BU9 A;  2WXL A;  1V55 E;  3TG4 A;  3PNL B;  3S7F A;  3C5R A;  4DLQ A;  4K03 A;  1EDU A;  3ZN3 A;  3LKU A;  4ILH B;  4EEC A;  3KAE A;  3KD7 A;  4RLY A;  5EKQ D;  4J8E A;  4ANX A;  2ZXW E;  2A5E A;  3IHV A;  4KT6 B;  3ASD A;  4EHM A;  4WWO A;  1SQM A;  4A1S A;  1LD8 A;  2FBN A;  3U64 A;  1KT0 A;  2OVB A;  4UWK A;  4U8Y D;  4HQD A;  2WXG A;  5AQB A;  2BF0 X;  2ILR A;  4CDM A;  4I6E A;  4I9E A;  2IOL A;  3C3Q A;  3JQ1 A;  1MQS A;  1TEZ A;  4FU3 A;  5ANL A;  3B7U X;  4E6H A;  4CGV A;  1N52 A;  3E30 A;  3FUK A;  4AV7 A;  2BKK B;  3HXE A;  4WAF A;  2Y1L E;  2YQ8 A;  4XZ4 A;  1D9S A;  1LF8 A;  2KC7 A;  4Q94 A;  3HXF A;  4NQ0 A;  5AN8 A;  1U2V G;  1NFI E;  2YNQ A;  3FDH A;  1P5Q A;  3QWW A;  3L82 A;  3AG2 E;  3MKR A;  3L17 A;  1JUQ A;  1Z5S C;  3Q5M A;  3EHN A;  3AU4 A;  5AJD A;  3NZU A;  4IRU A;  4BX8 A;  4I2Z A;  2A5U A;  3HHM A;  4UI9 C;  4ACL A;  3FUD A;  4TXR A;  3D9H A;  5D0O D;  3UT4 A;  5FIO A;  2VGX A;  4GYY A;  3B7T A;  2QYU A;  4ATZ D;  2XHE A;  1L5J A;  1N11 A;  2MYO A;  3FH8 A;  4XKB A;  4YND A;  4UQZ A;  1EYH A;  2H6F A;  4GA1 A;  5BT1 A;  4P29 A;  3ZYQ A;  1K8K G;  3X2Q E;  2KXP C;  5C2Y A;  3ZNG A;  2ZGD A;  2RKK A;  3SQV A;  5EX0 A;  4GCN A;  1E7U A;  4DX5 D;  1K3Z D;  2FO1 E;  3W9G A;  4A1G A;  4BTB A;  2WXH A;  1H2T C;  3CEQ A;  1KZP A;  5LCW J;  3T8M A;  3SF4 A;  4DI3 A;  4K0R A;  3EHR A;  2WVI A;  3FUH A;  2R02 A;  5BV0 A;  4JZY A;  2P9L G;  4HOS A;  1YMP A;  1E8Z A;  3ABM E;  3KEA A;  4YDO A;  3DXM G;  1KT1 A;  4R7L A;  5B1A E;  5CRV A;  3NOG D;  4U96 D;  4XKC A;  1JCQ A;  2VSN A;  5CER B;  3DWL G;  5AQ9 A;  4U04 A;  3MJW A;  1WDY A;  3CKC A;  4Z68 A;  3CHQ A;  3ZGQ A;  5AQA A;  4KXK B;  2ETC A;  4GTM A;  1FT2 A;  2L0I A;  3I5P A;  1HG2 A;  4X8Q A;  3V30 A;  2LO6 A;  2LSV A;  3UIN C;  5AAO A;  2DWZ A;  2DZN A;  3LCA A;  2XGO A;  3MKQ B;  3RJV A;  5KJM A;  2IJG X;  4OVU A;  1RZ4 A;  4URK A;  2V5Q C;  2XEN A;  3RO2 A;  3RRM B;  5IY5 E;  3D9O A;  3HRA A;  3GYZ A;  3UM3 A;  2EIM E;  2FEZ A;  3QWV A;  2P58 C;  2WXI A;  3S7D A;  1O1T A;  5E76 A;  5CMW A;  2X38 A;  1YCS B;  5D2M C;  1OCO E;  3AS8 A;  3CST A;  2VJ8 A;  3ULY A;  3FEY A;  4F6R D;  2OCC E;  5T3R A;  3CLJ A;  3ENE A;  4NIK A;  4AY6 A;  2LAI A;  2Y4U A;  5A23 A;  4DJA A;  3TAX A;  2V0P A;  1NA0 A;  4MBG A;  3ZHE A;  4AY5 A;  1UN8 A;  2JEK A;  3D9N A;  3DPY A;  3PS6 A;  3W9F A;  5EID A;  5LP0 A;  1MX2 A;  4HB5 A;  1OY3 D;  1HU3 A;  5ENT D;  3B7B A;  2FF4 A;  3CHO A;  2LXL A;  3PVL A;  5BNW A;  5FQ7 A;  4GYW A;  3ZXP A;  4OYS A;  4F1S A;  3V2O A;  4I17 A;  3ESK A;  3FH7 A;  3PZ3 A;  4EQF A;  4AOF A;  5AEN A;  3KS2 A;  3LJN A;  4I1M A;  3PEU B;  2GRL A;  2XCB A;  3VLD A;  3FP3 A;  3IXE A;  3IBE A;  4U8H A;  4LRZ A;  4A3T A;  3S2A A;  1UJK A;  3NZS A;  4GTV A;  3EIJ A;  2NXP A;  2OEV A;  1SZA A;  2IEJ A;  2DZO A;  4IUL A;  3L6A A;  2I6H A;  2J08 A;  2KZT A;  4FP7 A;  3I3N A;  1S63 A;  3C3O A;  3IKO B;  3PZ2 A;  4JXT A;  1E96 B;  4H7Y A;  4MKT A;  5CBN A;  3SFZ A;  1WAO 1;  4KVM A;  4L2L A;  1TNZ A;  1G3N B;  3KSQ A;  2FI7 A;  3PZ1 A;  1HE8 A;  3GZ2 A;  4TRQ A;  3LY7 A;  4U0Z A;  3RRU A;  3D9L A;  2XS1 A;  3TWS A;  3PUK A;  3MV3 B;  2GRM A;  3NB2 A;  5FJY A;  3FU5 A;  1EF1 C;  5JHA A;  2E0I A;  2ETB A;  4DPR A;  2WQ6 A;  2GRP B;  2QY7 A;  2R17 C;  3UM0 A;  2X6F A;  3IV0 A;  2H6G A;  3LVQ E;  4J8S A;  2M63 A;  4BSX A;  1TN7 A;  1BI8 B;  3G2S A;  2CG2 A;  2R2L A;  1ELW A;  3JCK C;  4DX7 D;  5G05 J;  3NQP A;  1INZ A;  1N95 A;  4BT8 A;  3CHM A;  2CHZ A;  1N4R A;  5AIJ A;  3ASG A;  3AG3 E;  4PUC A;  2XGS A;  4ABN A;  5AAR A;  3CKB A;  1A17 A;  4CGW A;  2VQ2 A;  2VGX B;  3JYS A;  4HFG A;  3UKU G;  2KCK A;  2VYI A;  3CGH A;  3RK6 A;  1FVH A;  2R03 A;  4AVX A;  3R7Q A;  3U3W A;  3QAQ A;  3TWT A;  2I9C A;  5CED B;  4MLP A;  2WXK A;  2XRY A;  5EDS A;  4UI9 K;  4BX9 A;  1H0A A;  4TUM A;  3RU0 A;  2IO3 C;  1OWP A;  4L23 A;  1U3D A;  1LD7 A;  1PC2 A;  4J6I A;  2FUL A;  3S7J A;  2AXZ A;  3CSF A;  2EIJ E;  3OAW A;  1WM5 A;  3SHF A;  5KBA A;  3RRN B;  2GRQ B;  4J0U A;  4I1O B;  5AQ7 A;  2PM6 A;  4AEZ C;  1OT8 A;  4QFV A;  2WXN A;  1IHB A;  3UKR G;  3U66 A;  2DYR E;  3MEK A;  4HOT A;  1YYH A;  4C48 B;  3AS5 A;  3DBS A;  3AS4 A;  3KSL A;  1IHG A;  4C0E A;  1UG3 A;  4O6F A;  1JWG A;  5T4Y A;  4HLL A;  1LTX A;  1QZ2 A;  1H6P A;  3BG0 B;  1PAQ A;  3C72 A;  3E33 A;  5H7P A;  1UW4 B;  4GZD A;  3O4Z A;  3ZYK A;  3JUI A;  2F0Y A;  4DLO A;  4CZ2 D;  3MZL B;  1SZ9 A;  5CRU A;  4FUL A;  3L54 A;  3QNK A;  1TN6 A;  1OWM A;  3CQC B;  1FT1 A;  3RSE G;  5ARF A;  3SGH A;  1KZO A;  3DSS A;  1N9A A;  4U63 A;  5KJL A;  5CBO A;  2L9B A;  2WQH A;  1O5M A;  4UQY A;  4G8L A;  1HH8 A;  4U8V D;  1NZN A;  4GTP A;  1HFA A;  4GMJ A;  3S7B A;  4UI9 J;  5D66 A;  2HYZ A;  3UI2 A;  4XEI G;  2PL2 A;  1TNB A;  3ZHE B;  2VTB A;  1UJJ A;  1TJC A;  4N39 A;  3T9K A;  2Y4T A;  4JA7 A;  4I2W A;  3OXG A;  3K9I A;  2P9K G;  1B89 A;  3ZRH A;  1MHQ A;  4DX6 D;  4EZK A;  2NC9 A;  2GGF A;  4G24 A;  3UMV A;  4GZ6 A;  3L9T A;  3Q73 A;  3FTV A;  3Q4A B;  4N3A A;  3GZS A;  2ZIR A;  2R5S A;  4HOU A;  2J8S D;  4JB8 P;  2XEE A;  3PNT B;  4F7A A;  3MCX A;  4GA0 A;  2WXQ A;  4ME2 A;  4HRN A;  5CEA A;  3EIQ C;  1N0R A;  2IFU A;  5B1B E;  1H6K A;  1H2V C;  2KZT B;  3EU5 A;  2I1J A;  2J4D A;  2X6H A;  1JCR A;  3SY2 A;  2BED A;  4RVB A;  1K1B A;  3VLF A;  4MRU A;  1BI7 B;  4D10 C;  4PS3 A;  3QK0 A;  4DX2 A;  4AIF A;  5B3S E;  2KBX A;  3DEO A;  4ILI A;  2PM7 A;  3DSV A;  4N2S A;  4JD2 G;  5J90 A;  4BER A;  1E8X A;  4BEP A;  2BTD A;  5BPP A;  3LY8 A;  4B94 A;  2HR2 A;  4LG6 A;  3G2W A;  3ABL E;  1UOH A;  2CFZ A;  4GA2 A;  4RG9 A;  4GAA A;  4XE0 A;  2OV8 A;  2C0M A;  3PDN A;  3UXG A;  3FHE A;  1OCR E;  3BEE A;  2XPZ A;  5EX3 A;  3QDN A;  3Q78 A;  3PEV B;  4CDR A;  5ENS D;  4UWF A;  1PY1 A;  4WNG A;  2VGE A;  3LPZ A;  5CCM A;  1H2U A;  3D3M A;  4XI0 A;  2YHC A;  4LSZ E;  3N71 A;  2Q7F A;  4APF A;  4ZFH A;  3CHS A;  1X5B A;  4Q96 A;  4KBQ A;  3UM2 A;  1HF8 A;  3TJP A;  1FVF A;  2X6K A;  4L9P A;  1OCC E;  4M3O A;  5JA4 D;  3DEP A;  2RG8 A;  3NAW A;  1EPU A;  4YDE A;  5LFA A;  3ML8 A;  2NSZ A;  2V5F A;  4AXH A;  3IHY A;  4XX5 A;  1NI1 A;  4E85 A;  5EIL A;  3GZ1 A;  5JMN D;  4RQI A;  4C9B B;  3NBN B;  3APD A;  4ANU A;  5BXO A;  4KZ0 A;  2P9U G;  4OVV A;  4BES A;  1H19 A;  3PE3 A;  3P1U A;  3ZEF A;  3CVN A;  1TR4 A;  3CVV A;  3QC1 A;  5ITZ F;  2FO7 A;  1Z3Y A;  4F3V A;  5CHE E;  1E8W A;  1FPP A;  2P2C P;  3FTS A;  2RFM A;  4GML A;  4LNG A;  2L0T B;  2PNN A;  5FIN A;  3D9K A;  2WXP A;  3LJ3 A;  1A5E A;  1HXI A;  3I4G A;  5LCW C;  4HI9 A;  5CCL A;  4UWH A;  3ZXS A;  4GTR A;  3DST A;  4JEU A;  3CHP A;  4LNB A;  4YDY A;  4EZJ A;  2QZA A;  2WXO A;  4MS6 A;  3ONL A;  3CIA A;  3KEZ A;  5KNH D;  4OAU C;  2RD0 A;  1O1S A;  3PRE A;  4GTO A;  1RW2 A;  3B13 A;  5FQ6 A;  4ACK A;  2ZGG A;  5G04 J;  4CDN A;  2AWI A;  1ELR A;  4QQI A;  3O48 A;  4JPS A;  3FTW A;  1D8E A;  3PZ4 A;  3CQG B;  5ENN A;  4RSY A;  5HS0 A;  1TNY A;  4YVQ C;  3WXX A;  4B93 B;  4DI4 A;  5DIZ A;  3PRZ A;  2CG3 A;  4EBA G;  3DSW A;  5HRY A;  2MOW A;  4GZC A;  1Z3X A;  2MRI A;  1DNP A;  3ZYM A;  2UY1 A;  2KCL A;  2Y3A A;  2VTB B; 
#chains in the Genus database with same CATH homology
 2R03 A;  3RAU A;  5CRV A;  3UM3 A;  3C3O A;  3UM1 A;  2OJQ A;  2R02 A;  3ZXP A;  3UM0 A;  2OEW A;  4JIO A;  2OEV A;  1ZB1 A;  2OEX A;  3C3Q A;  3C3R A;  3UM2 A;  3R9M A;  3ULY A;  2XS8 A;  2XS1 A;  2R05 A;  5CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...