2IO2C

Crystal structure of human senp2 in complex with rangap1-sumo-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESSSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding, hydrolase
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2io2C00
2GROB 2IO3C 2IY0C 2GRNB 3UIOC 2GRRB 3UIPC 1KPSB 1Z5SC 5D2MC 2GRPB 2IO2C 2GRQB 3UINC
chains in the Genus database with same CATH superfamily
4N2SA 3QARA 5JHBA 2E0IA 3PREA 5FT9A 5KBAA 5EX3A 1Z5SC 4DK5A 3PZDA 5AQAA 4L23A 5CEAA 3D9MA 3AG2E 2VSXE 4E85A 4GA2A 5CMWA 1OCZE 2WXNA 2WMNA 4WAFA 4EQFA 4RQIA 3L08A 3D9NA 1Z6TA 4O1PA 1UOHA 4RG6A 4UWKA 4HVBA 3DSVA 3NZUA 3U9WA 1N94A 3ZN3A 2XHEA 4GZCA 1EPUA 2DBAA 4FC8A 5FQ8A 2P9UG 5HQ8A 3FH5A 2ZGDA 5KJMA 3UINC 3PEUB 4L2LA 5E75A 2V0PA 2GRLA 1IQUA 2LAIA 4AY6A 3UKRG 5LFAA 1K3ZD 3L13A 4G23A 1IYGA 3GZ1A 3JXIA 3VLFA 2JLBA 5D2MC 1RW2A 1U3DA 2VYIA 2IQCA 3FUJA 3ZIMA 3RRMB 4ANWA 3PNTB 3E33A 3FTVA 4EZJA 4TV3A 3AAAC 3O48A 4BFRA 1SVXA 3APFA 3W9GA 2BKGA 1SA4A 4DI4A 2AXVA 2XRYA 2ZXWE 4DLQA 4UQZA 4FU3A 3CHSA 3HXDA 3MA5A 3B7BA 2P58C 5EYPF 3DSTA 5FJYA 3TWTA 3E32A 2XPYA 1BD8A 4UWFA 5FZRA 2J4BA 4J8YA 2QFCA 1OWLA 3K9IA 4I1MA 3DEOA 2MYOA 1N0QA 2RKKA 3C98A 2I9CA 3NOGD 1N4SA 1N0RA 4X8QA 4EHMA 1QYMA 4TUUA 4ILIA 5CRUA 5KCMA 5T3RA 3AS8A 3E30A 5AJDA 4EZLA 1HXIA 4D10C 3D9IA 4ZHBA 4GZ3A 1QZ2A 2HM8A 3ASDA 5CBOA 2WVIA 5JHAA 4G11A 2X38A 5BT1A 2XGMA 3P2BA 2FEZA 4A1SA 1NA3A 2KCVA 2QYJA 3JUIA 2VSNA 2DIWA 4F53A 4TXRA 2HE0A 3QK0A 3ONKA 3KSLA 2H6FA 4I17A 3R9AB 1UN9A 4JD2G 4N5CA 4AY5A 2AJAA 2B0OE 4KVOA 3UM0A 3UM3A 1BLXB 4ILHB 4O60A 3KAEA 3Q49B 3DSXA 2YNQA 3BG1B 4FADA 3OXFA 2MOWA 3C3QA 3J5QB 2WXLA 3MV2B 4I9EA 4JEHA 5BNWA 2GRNB 3FU5A 1JCRA 4O1OA 3FHEA 2Y69E 3DSWA 4WNDA 3FWVA 3UT4A 3MKQA 3LCAA 2WXIA 1TN8A 4BESA 5CRVA 2C2LA 4LNGA 5KJKA 3D9PA 3LVQE 2ILRA 4HB5A 1ZU2A 3SBTB 5AJLA 3HVEB 3FTZA 3FULA 3FH7A 2ETCA 4GYWA 1OCRE 3JUEA 5ENNA 3ZW3A 1HG2A 5EDSA 4LRZA 4GB9A 2L9BA 4GTVA 2UY1A 3FUMA 1SZAA 1KZOA 2WXGA 2X6IA 1X81A 3HXFA 1MYOA 3EHMA 3ZHEA 3EUVA 1D8EA 4K5BA 3FUDA 2HO1A 3JYSA 3FEYA 4ACLA 3RKVA 4U8VD 5G05J 3CK9A 4HS2A 2PNNA 5G55A 3FDHA 3FH8A 2V8SE 2MRIA 5ITZF 3RK6A 3GZSA 4PH4B 2IF4A 3EHNA 5ENPD 3UXGA 2P9KG 3AJIA 2A5EA 4EZKA 4HRMB 1SZ9A 4GMJA 3CGHA 4K5CA 2XRZA 3TXNA 4G1TA 2J8SD 3W9FA 1ZBPA 3F6QA 4Q96A 3ESLA 5BV0A 4PUCA 4BSZB 2I1JA 2Q7FA 1Z3XA 2RD0A 3ZXSA 3FUEA 1OXJA 4UQXA 3SGHA 2J49A 3RJVA 2GW1A 4NRHB 4TXQA 4FJZA 4CYMD 4R7LA 2I1KA 3PZ2A 3Q75A 3AG3E 2AW6A 4BT8A 1FPPA 3BU8A 3PNLB 1TEZA 2H6GA 3ISMC 2RFAA 3MV3B 2CG2A 2Y3AA 1FVHA 1HU3A 2R17C 4DLOA 3C72A 2QZAA 4B94A 2DVWA 1N4RA 3DPDA 4HOTA 3LS8A 1H6OA 3NB2A 1PC2A 1WDYA 4CT0A 2CFZA 5EIBE 3B7SA 1HX8A 5ENOD 5C2YA 3R9MA 4HLLA 5IY5E 5HKPA 4JA7A 5D0OD 1SA5A 1DCQA 3AS5A 3CVLA 1NI1A 2XEEA 3DPYA 2LUHA 5ANLA 2C0LA 1BI7B 3KSQA 1TYQG 1E96B 5J90A 3Q9UC 2CFUA 2R02A 1OWNA 3PRZA 4Y6WA 2AXZA 4M3OA 1IQRA 5C1DA 5JA4D 3CEQA 3DSUA 2KM4A 2EINE 3CHPA 4BERA 2R59A 3HIZA 1V55E 4JA9A 4WUYA 1G3NB 4J6IA 2Y4TA 3ZPJA 1HFAA 4L1BA 3UTMA 2ZGGA 1HZ4A 4U8YD 1FT1A 2EILE 4G24A 4P29A 4DX5D 3DSSA 2BEDA 2WQ7A 5FIOA 3T5XA 4HRLA 4GZDA 4GCOA 1H2VC 4FLHA 5BXUA 2ONDA 2KCKA 1WAO1 4U07A 3MEKA 3G2SA 5FQ7A 3L16A 4EBAG 3G2UA 3N71A 3S7BA 2PM7A 3WG7E 3QJZA 4G2VA 3Q7FA 3CVWA 3CV0A 2XPZA 3CQCB 3HVEA 4FA6A 2R05A 3L9TA 4I2WA 3PS6A 3UT7A 2WXJA 4B8AA 3CHOA 3TL5A 4UI9C 4TUMA 1U3CA 2P9SG 4RSYA 1MJ0A 3KD7A 5CMYA 4GTRA 4RG9A 2WMOA 3Q47B 2VTBA 5G04J 1E7UA 5AENA 4W9RA 4CT4A 3JXJA 3SFXA 5JJ7A 1LD7A 3IEGA 2JEKA 4UUCA 4A55A 1TNOA 1TJFA 3DBSA 4XKBA 5FZSA 2EIJE 1IHBA 2WXRA 3I3NA 3QB2A 2KZTB 1EDUA 3CVYA 4U95D 3OAWA 4AXHA 1OT8A 3MCXA 5HRYA 2GRQB 4XI0A 3E37A 3OXGA 1IKND 5H7PA 4JHKA 1UJJA 3CHQA 3APCA 3ASNE 4N3CA 5LCWJ 1TNYA 4FJYA 1D9SA 1P5QA 4K5AB 3CVVA 4N2QA 3U4TA 4KT6B 2VGXA 4I6JA 4HQDA 3Q9NC 3TWSA 3ZVVA 1X5BA 1BI8B 3SBSA 2YHEA 2GGFA 4EECA 2P9PG 3TWQA 2WPVA 3I4GA 4HI8A 4EBAA 3NOCD 2WXFA 2J4DA 3HDXA 2V5QC 2WXPA 3ZYQA 5AQ7A 4BX9A 3IV0A 1H2UA 4WNFA 1NA0A 4CCAA 3NQPA 3MJWA 4I9CA 1Z3YA 4QFVA 4EPZA 4XX5A 3BUAA 4URKA 3ZEFA 5HI7A 1JWFA 4U0ZA 3APDA 4XE0A 1LD8A 2VGEA 3ASHA 1JWGA 4TXPA 2X6JA 3O4ZA 3R7RA 3MKRA 2DYSE 4BWRA 2XPIA 3FUHA 3DRAA 1EF1C 2GRRB 2IEJA 1N54A 2AWIA 3CVNA 2VQ2A 3ZYKA 4GPMA 3CVQA 5A7DB 3EHRA 3U64A 1H0AA 2LO6A 3LYAA 1U2VG 4MKTA 3QNKA 2ETBA 2YHCA 4JHJA 3D3MA 1W3BA 3L82A 2V4HC 4WWPA 3IXEA 4H7YA 1TN7A 4IRUA 2H6IA 3ABME 2LAHA 2GROB 1KPSB 3RAUA 5ANRA 4J8FA 4L7TA 3SI5A 5G04C 3ULYA 5FQ6A 4ATGA 4G25A 1TNBA 4UWGA 1YCSB 4ZFHA 3AG4E 2WB2A 2XEHA 1E8ZA 2FO7A 3KS2A 3EU5A 3ZFWA 3FTXA 2CG3A 1YMPA 2OCCE 2FI7A 3ESKA 3WXXA 4M7CA 2CHXA 3CKBA 3UMVA 3ULQA 2HYZA 2IY0C 4HORA 1ELWA 2L0TB 4AM9A 3FUIA 5FTPA 4F1PA 3IBEA 4DX6D 4WWOA 4BSXA 3Q73A 2J9QA 4AVXA 3LJ3A 1VDYA 1KLXA 5KNGA 2L6BA 2DZNA 4KXKB 4NACA 2IO2C 4APFA 4CGVA 5A6CA 3CKCA 2BF0X 4LCTA 4HXIA 1TNZA 4JPSA 1FCHA 3JCKC 4PS8A 5EN5D 1O1TA 1AP7A 4LUNU 1FVFA 3ASFA 5EILA 3ML8A 4GYYA 3TGOA 1OCCE 3E4BA 3ZNGA 2KCLA 2FO1E 2LSUA 4RLYA 4C0MA 2VSYA 3SO8A 1N4QA 2VSOE 5KNHD 2EIKE 3FUNA 4ABNA 1RZ4A 5FINA 2LSVA 3AU4A 1O1SA 4K03A 4LSZE 2OVFA 1D8DA 3G2TA 3PH0C 4ANUA 4J8DA 1E8XA 3S7FA 2XZTG 3ASGA 2GRMA 4UI9K 1S70B 3LPZA 2M63A 4CDNA 2HR2A 2V4LA 2FF4A 3DEPA 4U63A 1K8KG 4FHKA 3UUXA 3D9LA 3PZ3A 4J8EA 4KMOA 2R03A 1B89A 4YDYA 4OYSA 4APOA 3ZUVB 5BUZA 1JPLA 3ZYMA 4GTQA 3FTUA 3Q78A 3UKUG 3V2XA 2CHZA 5M72A 2J08A 5CERB 1QQEA 5AAOA 4DUIA 4LEUA 3TG5A 3NAWA 3UPVA 2WXMA 1KT1A 3L6AA 5FQ4A 4CRWA 2XENA 3DWLG 3G2VA 4I1OB 3UIOC 4I1AA 3LEWA 3SY2A 4LNUD 3KEAA 4G8LA 4MS6A 3ZXPA 4L9PA 1DVPA 4HI9A 1O1RA 3FP3A 4JHRA 1LTXA 1H19A 1UW4B 2LXLA 4GCNA 4DX1A 3CQGB 4GAAA 4YDEA 3C5RA 4AOFA 2ZU6B 4GPKA 3S7JA 3L54A 4A1GA 5CEDB 4LG6A 4I6GA 4GYOA 4N3BA 4MBGA 2AVPA 3LJNA 1O5MA 3FU6A 3HHMA 4AP2A 4K0RA 4AJWA 3MGBA 4GZ6A 3PE3A 1DNPA 3HXBA 4FHJA 4DX7D 3SFZA 3HXCA 4JB8P 4IN3B 2KATA 4AIFA 1S63A 3SQVA 5KWDA 3FTSA 5ENRD 1MHQA 1E90A 2IO3C 3EHQA 3LVRE 3V2OA 4OAUC 3CK7A 4B0ZA 3RRNB 4JXTA 3FTYA 3JQ1A 4NQ0A 1WG0A 4GZ5A 1MQSA 2P2CP 2XGOA 4MLPA 4U96D 5AQBA 3AG1E 3ABKE 4JW1A 3D9KA 3FUFA 4BY6A 2LNIA 5LP0A 2RG8A 3X2QE 4GA1A 5E76A 4JEUA 1OWOA 3RU0A 1MX6A 3L17A 5A23A 3U66A 4XI9A 3V31A 4A63B 5G05C 3S2AA 1K1BA 1OCOE 3ZGQA 1WY6A 4IULA 4Z68A 5AYWD 4BETA 3QDNA 3UT8A 3PUKA 1UG3A 3IHVA 2F8XK 4F1SA 2YINA 3TG4A 1PAQA 1PY1A 3CHRA 5B1BE 4YVOA 5FWQA 4XKCA 4AV7A 5EIDA 4BT9A 5ARFA 2XEVA 3CR3A 3CSTA 2WQ6A 4XIFA 3LY9A 2ZIRA 4C48B 2IOSA 3T8KA 2OVBA 3KEZA 3ENEA 4B89A 3FU3A 3P1UA 2BTDA 4YNDA 4XZ4A 4CGWA 4HOUA 4DX2A 3ABLE 1A5EA 4F6RD 3MKQB 4ACKA 5T8IA 3MYVA 2MHKA 4KYOB 4JZYA 4N3AA 5JMND 3SHFA 5AARA 1E7VA 3LY7A 2F8YA 3PE4A 1KT0A 4G26A 3TWWA 2PM6A 2V5FA 3FY4A 1HS6A 3NZSA 2DZOA 2UY1B 4HLEA 1DC2A 5ENQD 4DRXE 1SW6A 3IHYA 2WXHA 1JCSA 2PQNA 4ILGA 1NFIE 4RVBA 5AN8A 4CDRA 4GTTA 3ONLA 3ZHEB 1QBQA 3NBNB 1JUQA 4JL0A 4J7WA 5DBKA 3BQOA 1IXVA 2P9LG 3CVXA 3C3RA 4ATZD 3B7UX 3LXUX 3R7QA 1TN6A 3FU0A 3Q7AA 3SZ7A 2XS8A 3OXLA 4CEMA 3C3OA 4HBDA 3EIJA 2PQRA 1L5JA 2P9NG 2Y1LE 1TJCA 1UN8A 4XEIG 3RIBA 4UWLA 3FEXA 3HXEA 3CIAA 3G2WA 3CVUA 3EJNA 5BV1A 2WQHA 2E2EA 4I43A 2ETAA 2X6FA 1SQMA 2J09A 2XQ0A 3TWUA 4IYPA 1H6PA 4GMLA 4A3VA 3PEVB 1MX4A 5BPPA 3URZA 3B7RL 4HOSA 4DI3A 4GA0A 2L0IA 1EYHA 3CSFA 3MZLB 2IOLA 5EKQD 2XZDG 3BG0B 3D9OA 2EQXA 4Q94A 3RRUA 1FT2A 4HOQA 3RO2A 1UJKA 3EU9A 5AIJA 2X6HA 1XNFA 2VJ8A 4GTPA 4J0UA 3TAXA 4BTAA 4UWHA 2NXPA 4U7EB 2NSZA 1BPOA 3LY8A 4U0UA 2EIME 3QOUA 2AXUA 3QWPA 1TNUA 3L22A 4B8CB 1S64A 4WNGA 3V79K 4U0SA 1NP7A 4U04A 3AS4A 3GW4A 2QY7A 5ENSD 4HFGA 4N5QA 2BUGA 4J8SA 4Y6CA 3GZ2A 1Y6IA 3PZ1A 4OVUA 2I2OA 3HRAA 2FBNA 3RO3A 5BXOA 3U3WA 2A5UA 2R5SA 3SFYA 1A17A 2KXPC 4B93B 3T5VA 5EYLA 1IHGA 1KZPA 1NL4A 2YQ8A 3CHMA 4YVQC 1E8WA 1WM5A 4TRQA 4WWNA 1HO8A 2H6HA 2B6CA 3NF1A 3QAQA 4OVVA 4G8KA 5LCWC 1Q2ZA 5LOZA 4PS7A 3SD5A 3VLEA 2NYJA 1HF8A 1N11A 2P9IG 5JJTA 4GU5A 2NC9A 2WXKA 3UQ3A 2XCBA 5G2NA 4BTBA 4ANXA 5JJ6A 4DPRA 5B3SE 1N52A 3OTNA 2DYRE 4ME2A 4JC8A 1HH8A 4E6HA 3LDZA 4FP7A 3JQ0A 2I6HA 3TWVA 4I2ZA 4A3TA 5CBNA 3Q79A 3IKOB 1K1AA 2KZTA 4H7XA 2WXQA 4OAVB 3J5PA 3ML9A 2FULA 4KZ0A 1N9AA 3UM1A 3CVPA 4V3IA 2QC9A 4BX8A 5CECB 3FTWA 3PZ4A 3ASOE 2LXMA 3B95A 4DJAA 2GRPB 3TWXA 1OUVA 1MZCA 4LERA 5ARGA 4ANVA 2IONA 4CZ2D 3S7DA 2VTBB 2DCPA 4FLBA 4CDMA 5EX0A 5D66A 1BU9A 4C9BB 3MX3A 3CLJA 1V54E 4I6EA 2R2LA 5KJLA 5FZQA 3VLDA 2OV8A 2PZIA 1INZA 1LF8A 1TR4A 5BW8C 4KBQA 4PDXA 3VTYA 1N95A 1XGWA 3D9HA 4U8HA 5DIZA 3PUJA 2OOEA 3UM2A 4YDWA 5CHEE 3T9KA 1GW6A 3EDTB 2KBXA 2KC7A 4WNEA 4UI9J 1MX2A 3I5PA 3UI2A 1NZNA 2XGSA 3QWWA 3TXMA 2F0YA 2VGXB 1OWPA 3CK8A 3FUKA 1H2TC 1QNFA 1H6KA 4GTMA 2IFUA 2A4ZA 3RSEG 2C0MA 3DXKG 3HG0D 2L6JA 1HG5A 3AU5A 2DWZA 3B7TA 1OWMA 5LX8A 3Q15A 4O6FA 4F7AA 1E8YA 4PS3A 2RFMA 2Y0BG 5HS0A 3SNXA 5KJNA 1N4PA 3PDNA 3LKUA 3ZU7B 2JABA 2X3MA 1AWCB 1S0PA 4HNAD 4GTSA 5D0QD 1ZB1A 3ULEG 2Y4UA 3I4RB 1DCEA 3GYZA 3QWVA 4MRUA 3UX4A 2F37A 1ELRA 2UWJG 2OEWA 5J08A 4FULA 5CCMA 2X6KA 2ZISA 1YA0A 4QQIA 2IJGX 1JCQA 5AQ9A 4F3VA 3TWRA 5T4YA 2QYUA 4JVSA 2XS1A 3D9JA 3QKYA 3TJPA 4UQYA 4GMRA 3Q4AB 4KVMA 4KZCA 2VGYA 4LNBA 3B13A 1ELKA 4L2YA 2XCCA 1HE8A 3VTXA 3ZYLA 4BEPA 3DXMG 2CHWA 2WM9A 3ZKJA 1YYHA 4YDOA 3UIPC 3V30A 3SF4A 3T8MA 2PL2A 3FFLA 3E34A 4NURA 4C0EA 4HRNA 4Q69A 5CCLA 2J07A 1Y8MA 1OY3D 4N39A 2OEVA 3Q5MA 3HYMB 2IU1A 4GTOA 3EIQC 3QC1A 5ENTD 2WXOA 4NIKA 3BEEA 5B1AE 2BKKB 3ZRHA 3PVLA 4AEZC
chains in the Genus database with same CATH topology
2GROB 2IO3C 2IY0C 2GRNB 3UIOC 2GRRB 3UIPC 1KPSB 1Z5SC 5D2MC 2GRPB 2IO2C 2GRQB 3UINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRO B;  2IO3 C;  2IY0 C;  2GRN B;  3UIO C;  2GRR B;  3UIP C;  1KPS B;  1Z5S C;  5D2M C;  2GRP B;  2IO2 C;  2GRQ B;  3UIN C; 
#chains in the Genus database with same CATH topology
 4N2S A;  3QAR A;  5JHB A;  2E0I A;  3PRE A;  5FT9 A;  5KBA A;  5EX3 A;  1Z5S C;  4DK5 A;  3PZD A;  5AQA A;  4L23 A;  5CEA A;  3D9M A;  3AG2 E;  2VSX E;  4E85 A;  4GA2 A;  5CMW A;  1OCZ E;  2WXN A;  2WMN A;  4WAF A;  4EQF A;  4RQI A;  3L08 A;  3D9N A;  1Z6T A;  4O1P A;  1UOH A;  4RG6 A;  4UWK A;  4HVB A;  3DSV A;  3NZU A;  3U9W A;  1N94 A;  3ZN3 A;  2XHE A;  4GZC A;  1EPU A;  2DBA A;  4FC8 A;  5FQ8 A;  2P9U G;  5HQ8 A;  3FH5 A;  2ZGD A;  5KJM A;  3UIN C;  3PEU B;  4L2L A;  5E75 A;  2V0P A;  2GRL A;  1IQU A;  2LAI A;  4AY6 A;  3UKR G;  5LFA A;  1K3Z D;  3L13 A;  4G23 A;  1IYG A;  3GZ1 A;  3JXI A;  3VLF A;  2JLB A;  5D2M C;  1RW2 A;  1U3D A;  2VYI A;  2IQC A;  3FUJ A;  3ZIM A;  3RRM B;  4ANW A;  3PNT B;  3E33 A;  3FTV A;  4EZJ A;  4TV3 A;  3AAA C;  3O48 A;  4BFR A;  1SVX A;  3APF A;  3W9G A;  2BKG A;  1SA4 A;  4DI4 A;  2AXV A;  2XRY A;  2ZXW E;  4DLQ A;  4UQZ A;  4FU3 A;  3CHS A;  3HXD A;  3MA5 A;  3B7B A;  2P58 C;  5EYP F;  3DST A;  5FJY A;  3TWT A;  3E32 A;  2XPY A;  1BD8 A;  4UWF A;  5FZR A;  2J4B A;  4J8Y A;  2QFC A;  1OWL A;  3K9I A;  4I1M A;  3DEO A;  2MYO A;  1N0Q A;  2RKK A;  3C98 A;  2I9C A;  3NOG D;  1N4S A;  1N0R A;  4X8Q A;  4EHM A;  1QYM A;  4TUU A;  4ILI A;  5CRU A;  5KCM A;  5T3R A;  3AS8 A;  3E30 A;  5AJD A;  4EZL A;  1HXI A;  4D10 C;  3D9I A;  4ZHB A;  4GZ3 A;  1QZ2 A;  2HM8 A;  3ASD A;  5CBO A;  2WVI A;  5JHA A;  4G11 A;  2X38 A;  5BT1 A;  2XGM A;  3P2B A;  2FEZ A;  4A1S A;  1NA3 A;  2KCV A;  2QYJ A;  3JUI A;  2VSN A;  2DIW A;  4F53 A;  4TXR A;  2HE0 A;  3QK0 A;  3ONK A;  3KSL A;  2H6F A;  4I17 A;  3R9A B;  1UN9 A;  4JD2 G;  4N5C A;  4AY5 A;  2AJA A;  2B0O E;  4KVO A;  3UM0 A;  3UM3 A;  1BLX B;  4ILH B;  4O60 A;  3KAE A;  3Q49 B;  3DSX A;  2YNQ A;  3BG1 B;  4FAD A;  3OXF A;  2MOW A;  3C3Q A;  3J5Q B;  2WXL A;  3MV2 B;  4I9E A;  4JEH A;  5BNW A;  2GRN B;  3FU5 A;  1JCR A;  4O1O A;  3FHE A;  2Y69 E;  3DSW A;  4WND A;  3FWV A;  3UT4 A;  3MKQ A;  3LCA A;  2WXI A;  1TN8 A;  4BES A;  5CRV A;  2C2L A;  4LNG A;  5KJK A;  3D9P A;  3LVQ E;  2ILR A;  4HB5 A;  1ZU2 A;  3SBT B;  5AJL A;  3HVE B;  3FTZ A;  3FUL A;  3FH7 A;  2ETC A;  4GYW A;  1OCR E;  3JUE A;  5ENN A;  3ZW3 A;  1HG2 A;  5EDS A;  4LRZ A;  4GB9 A;  2L9B A;  4GTV A;  2UY1 A;  3FUM A;  1SZA A;  1KZO A;  2WXG A;  2X6I A;  1X81 A;  3HXF A;  1MYO A;  3EHM A;  3ZHE A;  3EUV A;  1D8E A;  4K5B A;  3FUD A;  2HO1 A;  3JYS A;  3FEY A;  4ACL A;  3RKV A;  4U8V D;  5G05 J;  3CK9 A;  4HS2 A;  2PNN A;  5G55 A;  3FDH A;  3FH8 A;  2V8S E;  2MRI A;  5ITZ F;  3RK6 A;  3GZS A;  4PH4 B;  2IF4 A;  3EHN A;  5ENP D;  3UXG A;  2P9K G;  3AJI A;  2A5E A;  4EZK A;  4HRM B;  1SZ9 A;  4GMJ A;  3CGH A;  4K5C A;  2XRZ A;  3TXN A;  4G1T A;  2J8S D;  3W9F A;  1ZBP A;  3F6Q A;  4Q96 A;  3ESL A;  5BV0 A;  4PUC A;  4BSZ B;  2I1J A;  2Q7F A;  1Z3X A;  2RD0 A;  3ZXS A;  3FUE A;  1OXJ A;  4UQX A;  3SGH A;  2J49 A;  3RJV A;  2GW1 A;  4NRH B;  4TXQ A;  4FJZ A;  4CYM D;  4R7L A;  2I1K A;  3PZ2 A;  3Q75 A;  3AG3 E;  2AW6 A;  4BT8 A;  1FPP A;  3BU8 A;  3PNL B;  1TEZ A;  2H6G A;  3ISM C;  2RFA A;  3MV3 B;  2CG2 A;  2Y3A A;  1FVH A;  1HU3 A;  2R17 C;  4DLO A;  3C72 A;  2QZA A;  4B94 A;  2DVW A;  1N4R A;  3DPD A;  4HOT A;  3LS8 A;  1H6O A;  3NB2 A;  1PC2 A;  1WDY A;  4CT0 A;  2CFZ A;  5EIB E;  3B7S A;  1HX8 A;  5ENO D;  5C2Y A;  3R9M A;  4HLL A;  5IY5 E;  5HKP A;  4JA7 A;  5D0O D;  1SA5 A;  1DCQ A;  3AS5 A;  3CVL A;  1NI1 A;  2XEE A;  3DPY A;  2LUH A;  5ANL A;  2C0L A;  1BI7 B;  3KSQ A;  1TYQ G;  1E96 B;  5J90 A;  3Q9U C;  2CFU A;  2R02 A;  1OWN A;  3PRZ A;  4Y6W A;  2AXZ A;  4M3O A;  1IQR A;  5C1D A;  5JA4 D;  3CEQ A;  3DSU A;  2KM4 A;  2EIN E;  3CHP A;  4BER A;  2R59 A;  3HIZ A;  1V55 E;  4JA9 A;  4WUY A;  1G3N B;  4J6I A;  2Y4T A;  3ZPJ A;  1HFA A;  4L1B A;  3UTM A;  2ZGG A;  1HZ4 A;  4U8Y D;  1FT1 A;  2EIL E;  4G24 A;  4P29 A;  4DX5 D;  3DSS A;  2BED A;  2WQ7 A;  5FIO A;  3T5X A;  4HRL A;  4GZD A;  4GCO A;  1H2V C;  4FLH A;  5BXU A;  2OND A;  2KCK A;  1WAO 1;  4U07 A;  3MEK A;  3G2S A;  5FQ7 A;  3L16 A;  4EBA G;  3G2U A;  3N71 A;  3S7B A;  2PM7 A;  3WG7 E;  3QJZ A;  4G2V A;  3Q7F A;  3CVW A;  3CV0 A;  2XPZ A;  3CQC B;  3HVE A;  4FA6 A;  2R05 A;  3L9T A;  4I2W A;  3PS6 A;  3UT7 A;  2WXJ A;  4B8A A;  3CHO A;  3TL5 A;  4UI9 C;  4TUM A;  1U3C A;  2P9S G;  4RSY A;  1MJ0 A;  3KD7 A;  5CMY A;  4GTR A;  4RG9 A;  2WMO A;  3Q47 B;  2VTB A;  5G04 J;  1E7U A;  5AEN A;  4W9R A;  4CT4 A;  3JXJ A;  3SFX A;  5JJ7 A;  1LD7 A;  3IEG A;  2JEK A;  4UUC A;  4A55 A;  1TNO A;  1TJF A;  3DBS A;  4XKB A;  5FZS A;  2EIJ E;  1IHB A;  2WXR A;  3I3N A;  3QB2 A;  2KZT B;  1EDU A;  3CVY A;  4U95 D;  3OAW A;  4AXH A;  1OT8 A;  3MCX A;  5HRY A;  2GRQ B;  4XI0 A;  3E37 A;  3OXG A;  1IKN D;  5H7P A;  4JHK A;  1UJJ A;  3CHQ A;  3APC A;  3ASN E;  4N3C A;  5LCW J;  1TNY A;  4FJY A;  1D9S A;  1P5Q A;  4K5A B;  3CVV A;  4N2Q A;  3U4T A;  4KT6 B;  2VGX A;  4I6J A;  4HQD A;  3Q9N C;  3TWS A;  3ZVV A;  1X5B A;  1BI8 B;  3SBS A;  2YHE A;  2GGF A;  4EEC A;  2P9P G;  3TWQ A;  2WPV A;  3I4G A;  4HI8 A;  4EBA A;  3NOC D;  2WXF A;  2J4D A;  3HDX A;  2V5Q C;  2WXP A;  3ZYQ A;  5AQ7 A;  4BX9 A;  3IV0 A;  1H2U A;  4WNF A;  1NA0 A;  4CCA A;  3NQP A;  3MJW A;  4I9C A;  1Z3Y A;  4QFV A;  4EPZ A;  4XX5 A;  3BUA A;  4URK A;  3ZEF A;  5HI7 A;  1JWF A;  4U0Z A;  3APD A;  4XE0 A;  1LD8 A;  2VGE A;  3ASH A;  1JWG A;  4TXP A;  2X6J A;  3O4Z A;  3R7R A;  3MKR A;  2DYS E;  4BWR A;  2XPI A;  3FUH A;  3DRA A;  1EF1 C;  2GRR B;  2IEJ A;  1N54 A;  2AWI A;  3CVN A;  2VQ2 A;  3ZYK A;  4GPM A;  3CVQ A;  5A7D B;  3EHR A;  3U64 A;  1H0A A;  2LO6 A;  3LYA A;  1U2V G;  4MKT A;  3QNK A;  2ETB A;  2YHC A;  4JHJ A;  3D3M A;  1W3B A;  3L82 A;  2V4H C;  4WWP A;  3IXE A;  4H7Y A;  1TN7 A;  4IRU A;  2H6I A;  3ABM E;  2LAH A;  2GRO B;  1KPS B;  3RAU A;  5ANR A;  4J8F A;  4L7T A;  3SI5 A;  5G04 C;  3ULY A;  5FQ6 A;  4ATG A;  4G25 A;  1TNB A;  4UWG A;  1YCS B;  4ZFH A;  3AG4 E;  2WB2 A;  2XEH A;  1E8Z A;  2FO7 A;  3KS2 A;  3EU5 A;  3ZFW A;  3FTX A;  2CG3 A;  1YMP A;  2OCC E;  2FI7 A;  3ESK A;  3WXX A;  4M7C A;  2CHX A;  3CKB A;  3UMV A;  3ULQ A;  2HYZ A;  2IY0 C;  4HOR A;  1ELW A;  2L0T B;  4AM9 A;  3FUI A;  5FTP A;  4F1P A;  3IBE A;  4DX6 D;  4WWO A;  4BSX A;  3Q73 A;  2J9Q A;  4AVX A;  3LJ3 A;  1VDY A;  1KLX A;  5KNG A;  2L6B A;  2DZN A;  4KXK B;  4NAC A;  2IO2 C;  4APF A;  4CGV A;  5A6C A;  3CKC A;  2BF0 X;  4LCT A;  4HXI A;  1TNZ A;  4JPS A;  1FCH A;  3JCK C;  4PS8 A;  5EN5 D;  1O1T A;  1AP7 A;  4LUN U;  1FVF A;  3ASF A;  5EIL A;  3ML8 A;  4GYY A;  3TGO A;  1OCC E;  3E4B A;  3ZNG A;  2KCL A;  2FO1 E;  2LSU A;  4RLY A;  4C0M A;  2VSY A;  3SO8 A;  1N4Q A;  2VSO E;  5KNH D;  2EIK E;  3FUN A;  4ABN A;  1RZ4 A;  5FIN A;  2LSV A;  3AU4 A;  1O1S A;  4K03 A;  4LSZ E;  2OVF A;  1D8D A;  3G2T A;  3PH0 C;  4ANU A;  4J8D A;  1E8X A;  3S7F A;  2XZT G;  3ASG A;  2GRM A;  4UI9 K;  1S70 B;  3LPZ A;  2M63 A;  4CDN A;  2HR2 A;  2V4L A;  2FF4 A;  3DEP A;  4U63 A;  1K8K G;  4FHK A;  3UUX A;  3D9L A;  3PZ3 A;  4J8E A;  4KMO A;  2R03 A;  1B89 A;  4YDY A;  4OYS A;  4APO A;  3ZUV B;  5BUZ A;  1JPL A;  3ZYM A;  4GTQ A;  3FTU A;  3Q78 A;  3UKU G;  3V2X A;  2CHZ A;  5M72 A;  2J08 A;  5CER B;  1QQE A;  5AAO A;  4DUI A;  4LEU A;  3TG5 A;  3NAW A;  3UPV A;  2WXM A;  1KT1 A;  3L6A A;  5FQ4 A;  4CRW A;  2XEN A;  3DWL G;  3G2V A;  4I1O B;  3UIO C;  4I1A A;  3LEW A;  3SY2 A;  4LNU D;  3KEA A;  4G8L A;  4MS6 A;  3ZXP A;  4L9P A;  1DVP A;  4HI9 A;  1O1R A;  3FP3 A;  4JHR A;  1LTX A;  1H19 A;  1UW4 B;  2LXL A;  4GCN A;  4DX1 A;  3CQG B;  4GAA A;  4YDE A;  3C5R A;  4AOF A;  2ZU6 B;  4GPK A;  3S7J A;  3L54 A;  4A1G A;  5CED B;  4LG6 A;  4I6G A;  4GYO A;  4N3B A;  4MBG A;  2AVP A;  3LJN A;  1O5M A;  3FU6 A;  3HHM A;  4AP2 A;  4K0R A;  4AJW A;  3MGB A;  4GZ6 A;  3PE3 A;  1DNP A;  3HXB A;  4FHJ A;  4DX7 D;  3SFZ A;  3HXC A;  4JB8 P;  4IN3 B;  2KAT A;  4AIF A;  1S63 A;  3SQV A;  5KWD A;  3FTS A;  5ENR D;  1MHQ A;  1E90 A;  2IO3 C;  3EHQ A;  3LVR E;  3V2O A;  4OAU C;  3CK7 A;  4B0Z A;  3RRN B;  4JXT A;  3FTY A;  3JQ1 A;  4NQ0 A;  1WG0 A;  4GZ5 A;  1MQS A;  2P2C P;  2XGO A;  4MLP A;  4U96 D;  5AQB A;  3AG1 E;  3ABK E;  4JW1 A;  3D9K A;  3FUF A;  4BY6 A;  2LNI A;  5LP0 A;  2RG8 A;  3X2Q E;  4GA1 A;  5E76 A;  4JEU A;  1OWO A;  3RU0 A;  1MX6 A;  3L17 A;  5A23 A;  3U66 A;  4XI9 A;  3V31 A;  4A63 B;  5G05 C;  3S2A A;  1K1B A;  1OCO E;  3ZGQ A;  1WY6 A;  4IUL A;  4Z68 A;  5AYW D;  4BET A;  3QDN A;  3UT8 A;  3PUK A;  1UG3 A;  3IHV A;  2F8X K;  4F1S A;  2YIN A;  3TG4 A;  1PAQ A;  1PY1 A;  3CHR A;  5B1B E;  4YVO A;  5FWQ A;  4XKC A;  4AV7 A;  5EID A;  4BT9 A;  5ARF A;  2XEV A;  3CR3 A;  3CST A;  2WQ6 A;  4XIF A;  3LY9 A;  2ZIR A;  4C48 B;  2IOS A;  3T8K A;  2OVB A;  3KEZ A;  3ENE A;  4B89 A;  3FU3 A;  3P1U A;  2BTD A;  4YND A;  4XZ4 A;  4CGW A;  4HOU A;  4DX2 A;  3ABL E;  1A5E A;  4F6R D;  3MKQ B;  4ACK A;  5T8I A;  3MYV A;  2MHK A;  4KYO B;  4JZY A;  4N3A A;  5JMN D;  3SHF A;  5AAR A;  1E7V A;  3LY7 A;  2F8Y A;  3PE4 A;  1KT0 A;  4G26 A;  3TWW A;  2PM6 A;  2V5F A;  3FY4 A;  1HS6 A;  3NZS A;  2DZO A;  2UY1 B;  4HLE A;  1DC2 A;  5ENQ D;  4DRX E;  1SW6 A;  3IHY A;  2WXH A;  1JCS A;  2PQN A;  4ILG A;  1NFI E;  4RVB A;  5AN8 A;  4CDR A;  4GTT A;  3ONL A;  3ZHE B;  1QBQ A;  3NBN B;  1JUQ A;  4JL0 A;  4J7W A;  5DBK A;  3BQO A;  1IXV A;  2P9L G;  3CVX A;  3C3R A;  4ATZ D;  3B7U X;  3LXU X;  3R7Q A;  1TN6 A;  3FU0 A;  3Q7A A;  3SZ7 A;  2XS8 A;  3OXL A;  4CEM A;  3C3O A;  4HBD A;  3EIJ A;  2PQR A;  1L5J A;  2P9N G;  2Y1L E;  1TJC A;  1UN8 A;  4XEI G;  3RIB A;  4UWL A;  3FEX A;  3HXE A;  3CIA A;  3G2W A;  3CVU A;  3EJN A;  5BV1 A;  2WQH A;  2E2E A;  4I43 A;  2ETA A;  2X6F A;  1SQM A;  2J09 A;  2XQ0 A;  3TWU A;  4IYP A;  1H6P A;  4GML A;  4A3V A;  3PEV B;  1MX4 A;  5BPP A;  3URZ A;  3B7R L;  4HOS A;  4DI3 A;  4GA0 A;  2L0I A;  1EYH A;  3CSF A;  3MZL B;  2IOL A;  5EKQ D;  2XZD G;  3BG0 B;  3D9O A;  2EQX A;  4Q94 A;  3RRU A;  1FT2 A;  4HOQ A;  3RO2 A;  1UJK A;  3EU9 A;  5AIJ A;  2X6H A;  1XNF A;  2VJ8 A;  4GTP A;  4J0U A;  3TAX A;  4BTA A;  4UWH A;  2NXP A;  4U7E B;  2NSZ A;  1BPO A;  3LY8 A;  4U0U A;  2EIM E;  3QOU A;  2AXU A;  3QWP A;  1TNU A;  3L22 A;  4B8C B;  1S64 A;  4WNG A;  3V79 K;  4U0S A;  1NP7 A;  4U04 A;  3AS4 A;  3GW4 A;  2QY7 A;  5ENS D;  4HFG A;  4N5Q A;  2BUG A;  4J8S A;  4Y6C A;  3GZ2 A;  1Y6I A;  3PZ1 A;  4OVU A;  2I2O A;  3HRA A;  2FBN A;  3RO3 A;  5BXO A;  3U3W A;  2A5U A;  2R5S A;  3SFY A;  1A17 A;  2KXP C;  4B93 B;  3T5V A;  5EYL A;  1IHG A;  1KZP A;  1NL4 A;  2YQ8 A;  3CHM A;  4YVQ C;  1E8W A;  1WM5 A;  4TRQ A;  4WWN A;  1HO8 A;  2H6H A;  2B6C A;  3NF1 A;  3QAQ A;  4OVV A;  4G8K A;  5LCW C;  1Q2Z A;  5LOZ A;  4PS7 A;  3SD5 A;  3VLE A;  2NYJ A;  1HF8 A;  1N11 A;  2P9I G;  5JJT A;  4GU5 A;  2NC9 A;  2WXK A;  3UQ3 A;  2XCB A;  5G2N A;  4BTB A;  4ANX A;  5JJ6 A;  4DPR A;  5B3S E;  1N52 A;  3OTN A;  2DYR E;  4ME2 A;  4JC8 A;  1HH8 A;  4E6H A;  3LDZ A;  4FP7 A;  3JQ0 A;  2I6H A;  3TWV A;  4I2Z A;  4A3T A;  5CBN A;  3Q79 A;  3IKO B;  1K1A A;  2KZT A;  4H7X A;  2WXQ A;  4OAV B;  3J5P A;  3ML9 A;  2FUL A;  4KZ0 A;  1N9A A;  3UM1 A;  3CVP A;  4V3I A;  2QC9 A;  4BX8 A;  5CEC B;  3FTW A;  3PZ4 A;  3ASO E;  2LXM A;  3B95 A;  4DJA A;  2GRP B;  3TWX A;  1OUV A;  1MZC A;  4LER A;  5ARG A;  4ANV A;  2ION A;  4CZ2 D;  3S7D A;  2VTB B;  2DCP A;  4FLB A;  4CDM A;  5EX0 A;  5D66 A;  1BU9 A;  4C9B B;  3MX3 A;  3CLJ A;  1V54 E;  4I6E A;  2R2L A;  5KJL A;  5FZQ A;  3VLD A;  2OV8 A;  2PZI A;  1INZ A;  1LF8 A;  1TR4 A;  5BW8 C;  4KBQ A;  4PDX A;  3VTY A;  1N95 A;  1XGW A;  3D9H A;  4U8H A;  5DIZ A;  3PUJ A;  2OOE A;  3UM2 A;  4YDW A;  5CHE E;  3T9K A;  1GW6 A;  3EDT B;  2KBX A;  2KC7 A;  4WNE A;  4UI9 J;  1MX2 A;  3I5P A;  3UI2 A;  1NZN A;  2XGS A;  3QWW A;  3TXM A;  2F0Y A;  2VGX B;  1OWP A;  3CK8 A;  3FUK A;  1H2T C;  1QNF A;  1H6K A;  4GTM A;  2IFU A;  2A4Z A;  3RSE G;  2C0M A;  3DXK G;  3HG0 D;  2L6J A;  1HG5 A;  3AU5 A;  2DWZ A;  3B7T A;  1OWM A;  5LX8 A;  3Q15 A;  4O6F A;  4F7A A;  1E8Y A;  4PS3 A;  2RFM A;  2Y0B G;  5HS0 A;  3SNX A;  5KJN A;  1N4P A;  3PDN A;  3LKU A;  3ZU7 B;  2JAB A;  2X3M A;  1AWC B;  1S0P A;  4HNA D;  4GTS A;  5D0Q D;  1ZB1 A;  3ULE G;  2Y4U A;  3I4R B;  1DCE A;  3GYZ A;  3QWV A;  4MRU A;  3UX4 A;  2F37 A;  1ELR A;  2UWJ G;  2OEW A;  5J08 A;  4FUL A;  5CCM A;  2X6K A;  2ZIS A;  1YA0 A;  4QQI A;  2IJG X;  1JCQ A;  5AQ9 A;  4F3V A;  3TWR A;  5T4Y A;  2QYU A;  4JVS A;  2XS1 A;  3D9J A;  3QKY A;  3TJP A;  4UQY A;  4GMR A;  3Q4A B;  4KVM A;  4KZC A;  2VGY A;  4LNB A;  3B13 A;  1ELK A;  4L2Y A;  2XCC A;  1HE8 A;  3VTX A;  3ZYL A;  4BEP A;  3DXM G;  2CHW A;  2WM9 A;  3ZKJ A;  1YYH A;  4YDO A;  3UIP C;  3V30 A;  3SF4 A;  3T8M A;  2PL2 A;  3FFL A;  3E34 A;  4NUR A;  4C0E A;  4HRN A;  4Q69 A;  5CCL A;  2J07 A;  1Y8M A;  1OY3 D;  4N39 A;  2OEV A;  3Q5M A;  3HYM B;  2IU1 A;  4GTO A;  3EIQ C;  3QC1 A;  5ENT D;  2WXO A;  4NIK A;  3BEE A;  5B1A E;  2BKK B;  3ZRH A;  3PVL A;  4AEZ C; 
#chains in the Genus database with same CATH homology
 2GRO B;  2IO3 C;  2IY0 C;  2GRN B;  3UIO C;  2GRR B;  3UIP C;  1KPS B;  1Z5S C;  5D2M C;  2GRP B;  2IO2 C;  2GRQ B;  3UIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...