2IO2C

Crystal structure of human senp2 in complex with rangap1-sumo-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESSSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2io2C00
5D2MC 1Z5SC 2GRQB 2GRRB 2IY0C 3UIPC 1KPSB 2GRPB 2IO2C 2IO3C 3UINC 3UIOC 2GRNB 2GROB
chains in the Genus database with same CATH superfamily
4CGVA 3T9KA 3C5RA 2VGEA 1Z3YA 1EDUA 2PZIA 3AU4A 1L5JA 2HM8A 3UUXA 4FP7A 4GTVA 4U95D 5AQ9A 1E8XA 1O1RA 1H0AA 3EHMA 2VQ2A 1YMPA 4MBGA 1TNZA 2KATA 4UQYA 1D8DA 4GMRA 2LUHA 3NQPA 5AJLA 3WXXA 3QAQA 5BUZA 5BXUA 1TNBA 2H6HA 4LUNU 3E34A 3FH5A 2VTBA 2AJAA 3ASFA 3TXMA 2J49A 2H6IA 3CHMA 4A63B 2P9SG 1HZ4A 1SVXA 4MLPA 2AW6A 3HXEA 5JA4D 3QOUA 4YDOA 2C0LA 2XPIA 4JZYA 3HDXA 4XIFA 5BXOA 2QYUA 4M7CA 4JEHA 5KJNA 2DVWA 2WXPA 3WG7E 2FULA 1HS6A 5JHAA 2RD0A 5A23A 2KZTA 3EU5A 3FEYA 1MX4A 2X6JA 4Q96A 1AP7A 1YCSB 4L1BA 3NB2A 2BTDA 5T4YA 5DIZA 3I4GA 4XEIG 5CEAA 3VTXA 1IQRA 3Q79A 2HYZA 4I1OB 1EPUA 3EDTB 4EHMA 3APDA 1OCOE 3FFLA 3ENEA 3URZA 3NBNB 1P5QA 5EYPF 2BEDA 3RRMB 3MJWA 1NP7A 3L13A 3HG0D 3JQ1A 3IKOB 3UTMA 4F53A 1TNYA 3O4ZA 3AG4E 2R03A 3CHPA 1BPOA 2H6FA 3CVYA 3B7SA 2FEZA 4C9BB 5ANRA 3C98A 3I4RB 4UWFA 3PZ1A 4OAVB 3S7BA 4F1SA 2XENA 4YDWA 1OCCE 4U07A 3CSTA 3NZSA 4Q69A 4I6EA 5JJ6A 1MX2A 4U8YD 3B7RL 1N4RA 1OY3D 4XZ4A 1JCQA 1B89A 3E4BA 1UN9A 1NL4A 3AG2E 4L23A 4FULA 4GTOA 3GYZA 3DSXA 2GGFA 4RG9A 2LNIA 2WQHA 3FTYA 3SY2A 2P9LG 2IU1A 4GA0A 2M63A 2X6IA 4MS6A 4WNDA 2ILRA 3LEWA 4UUCA 3W9GA 2XRYA 1TN8A 4YVQC 3L08A 5HI7A 2ZISA 2VGXA 2KXPC 3EJNA 3E33A 3QNKA 2WXRA 3D9NA 1HO8A 1V55E 4N3CA 5EIDA 1WDYA 3LJNA 5C2YA 4Y6WA 3SD5A 4ILGA 2XGSA 4I6JA 1OWMA 2XPZA 2YINA 4MKTA 5LOZA 5FZRA 3PRZA 3FEXA 3MKQB 3BEEA 5FWQA 2UWJG 1AWCB 3D9KA 4K5BA 2OCCE 3RRUA 5EKQD 2X38A 4EBAA 1JWGA 4HOSA 4C48B 5IY5E 4O1OA 1HG2A 5CRUA 1S64A 1PAQA 5BV1A 4GB9A 5KWDA 5CHEE 3DEPA 3SHFA 3Q4AB 2R59A 2QYJA 3BU8A 4J7WA 4I17A 1DCEA 1NZNA 3U4TA 4R7LA 4K0RA 4B94A 1KZPA 1H19A 2DWZA 3DXMG 1N9AA 3Q49B 5CRVA 2WQ6A 3UT7A 4EECA 3DXKG 3DPDA 3CKBA 3NF1A 4BETA 4K03A 5AJDA 2XGOA 5G2NA 4CEMA 3FY4A 3LPZA 2A5UA 4RSYA 2I1KA 2IY0C 3FUJA 3G2SA 1E96B 3G2UA 1X81A 4HORA 3T8MA 1NA0A 1KZOA 5KJMA 4G11A 2VJ8A 1MZCA 4N2QA 5G05J 3ZHEA 2LSUA 4JHKA 2PL2A 4J8DA 2ZU6B 2OEVA 3CIAA 5HRYA 1A5EA 2XS8A 3UT8A 3RO2A 3OXFA 2AWIA 5CEDB 4N3BA 4QQIA 5FJYA 1PC2A 4HQDA 2RKKA 4DRXE 3V79K 4JA7A 3FU3A 1OCZE 4G26A 3MEKA 3EHQA 4DLOA 4AY6A 4GTMA 3RSEG 4APFA 4WUYA 5BT1A 4K5AB 4HVBA 4JD2G 2F0YA 3MX3A 2V5FA 1TNUA 3L22A 3CVPA 3CK8A 5JJ7A 2MYOA 2LXLA 4JHRA 2Y4TA 5LCWC 3CHOA 5LCWJ 4FA6A 3PEUB 3Q9UC 4A55A 1UOHA 3FH7A 3TL5A 2ZGDA 3FUIA 2GRLA 4MRUA 4I9CA 1KPSB 3ML8A 3LVQE 3MV3B 5G55A 1K1BA 5T8IA 2WXGA 2FF4A 5ENSD 2BKKB 1DCQA 3ZW3A 2B6CA 3LDZA 5CCMA 4HI8A 3PUKA 4OYSA 2Y69E 1MJ0A 1N0RA 5E75A 4AIFA 2PM6A 5A6CA 4DI3A 4GTQA 1MX6A 2X6HA 1JCRA 5LFAA 4J0UA 4UI9J 4BX9A 1ELRA 4Q94A 1Z3XA 4U63A 3CHQA 3Q7AA 4LNBA 2Y4UA 3UQ3A 3KD7A 3W9FA 3GZSA 4E85A 2FBNA 2F8XK 3KS2A 3B13A 3I3NA 4G2VA 2F8YA 4I1MA 4IULA 1OXJA 2V8SE 5BNWA 1KT1A 1HFAA 5B1BE 3LCAA 1ZU2A 3TG4A 5HQ8A 3VLFA 1ZBPA 4BT8A 3CVNA 1LD7A 3ASNE 5KJKA 1H6KA 3DSWA 5EX3A 1E7UA 2NXPA 3UM1A 2ETCA 4GMJA 1OCRE 3CK7A 1N52A 1QZ2A 2ZGGA 1D8EA 2B0OE 3D9PA 4GPKA 4JEUA 3U3WA 4C0EA 3SF4A 1Y6IA 3OXLA 4U96D 1N0QA 1SA4A 4A1GA 5C1DA 2HR2A 3UM0A 3FH8A 3HHMA 2IO3C 1BI8B 3KEZA 2H6GA 4OVUA 5CMYA 1N94A 4ANWA 4GA1A 4HNAD 4PS7A 4AM9A 3ESKA 3PS6A 5AQ7A 4IRUA 2ZIRA 4HOUA 1NI1A 2HO1A 2EIJE 1HG5A 1HU3A 4PDXA 1Y8MA 2KM4A 4AP2A 3QB2A 4FADA 5H7PA 3ZYLA 5FIOA 1TNOA 3L6AA 3L16A 2CHWA 3E37A 5FINA 5JJTA 2LO6A 3HIZA 2V5QC 3PVLA 3CR3A 3FTXA 3LXUX 2CFZA 3ZNGA 2FO7A 1O1SA 2VSOE 2GRRB 4RLYA 3L54A 4RQIA 5AIJA 4GCOA 1H2VC 1HX8A 4ILIA 3RO3A 1HH8A 3DSTA 3RK6A 4J6IA 3DPYA 3CVXA 4U7EB 3BUAA 3C3QA 2WXJA 2WXLA 3RAUA 2AXUA 1JPLA 1G3NB 1MYOA 3DRAA 3GW4A 3QARA 4L9PA 4YVOA 2IOSA 3UIPC 1A17A 2XQ0A 5ENRD 4FHKA 3ABLE 2HE0A 2L0TB 2WM9A 4ILHB 1H6PA 2YQ8A 3HYMB 4CT0A 2R2LA 3PZ3A 1TYQG 2MHKA 1K3ZD 1IXVA 4BTBA 4KZ0A 4CGWA 2BUGA 5BW8C 4JB8P 5KNHD 4JVSA 4D10C 3JQ0A 3TJPA 3TWTA 3HRAA 3UIOC 4ZHBA 5ENTD 1OWLA 5JMND 3ESLA 3CKCA 4YNDA 3ASGA 4B0ZA 4Y6CA 5AAOA 4GPMA 2BKGA 4W9RA 3ULEG 4CDMA 4HBDA 2OVFA 3HXFA 4U0ZA 4HFGA 2PM7A 3UM2A 3HXBA 3J5QB 1RW2A 3EHRA 4V3IA 1QQEA 3PZ4A 1FCHA 3PEVB 3PDNA 2R02A 4KT6B 3QC1A 1TJFA 4B8AA 5HS0A 2V4HC 2ETAA 3HVEA 3UMVA 4PUCA 4PS8A 2GRNB 4DLQA 5J90A 2VTBB 1V54E 4LNUD 2OEWA 4JXTA 5CERB 3AJIA 5ENNA 3CQGB 3S7FA 3V2OA 5KCMA 2XEVA 2WXNA 4XKBA 2A5EA 1GW6A 4FU3A 2E2EA 2IJGX 4HLEA 2CG2A 5LP0A 3FUHA 1SQMA 4JPSA 3NOGD 2NC9A 2CFUA 1JCSA 3PREA 5KBAA 2Q7FA 4KYOB 4CT4A 3LY7A 2KZTB 3CHSA 4HLLA 3ZYKA 3ZU7B 3D9IA 2R17C 2XHEA 2P9PG 1O1TA 2WMNA 4DPRA 4WAFA 4UQZA 3FU5A 1HF8A 3V30A 5A7DB 3AG3E 2P2CP 5ENQD 1MHQA 3TWUA 1QNFA 4J8SA 3DWLG 3R9AB 4HI9A 4CZ2D 3ULYA 5BPPA 1JUQA 3KSQA 4EZLA 5CCLA 1XGWA 3D9MA 5AENA 4E6HA 2WB2A 2J9QA 3G2WA 1KLXA 3FTZA 2L6BA 3FUNA 2J8SD 3Q78A 4I43A 4BFRA 5ENOD 4CDRA 3V31A 1S70B 1YA0A 5CBNA 2VSNA 1K1AA 2J4BA 3OXGA 4M3OA 4GZ3A 4ANUA 4GTTA 1EYHA 5AQBA 4NQ0A 4ATGA 3RU0A 4DX5D 2CHXA 4TUMA 3MA5A 4NIKA 2GRQB 4GZCA 4U8HA 3MV2B 2IO2C 4B89A 3TG5A 1W3BA 1IHGA 3I5PA 3PH0C 2VGXB 5G04C 1FT2A 4DX6D 3FUEA 3PE4A 3O48A 4U0UA 3X2QE 3QDNA 5ENPD 3FUDA 3B95A 1HXIA 3QK0A 3PZDA 4KZCA 1BLXB 4N2SA 1FPPA 1VDYA 3IEGA 1E90A 1UW4B 3IV0A 3ZGQA 2IF4A 4APOA 5ARGA 2JABA 5FQ8A 3ZYMA 2XRZA 5J08A 3C3OA 4I1AA 1H2TC 2YNQA 1Z5SC 4J8YA 4XI0A 4I2ZA 3ASOE 3GZ2A 3L9TA 3TWRA 2OOEA 3UI2A 2LSVA 3TXNA 2EILE 1O5MA 2KCLA 1RZ4A 5KNGA 4NACA 1E8ZA 3LS8A 4F6RD 2XPYA 4GYYA 3ISMC 3RRNB 3L17A 3KSLA 4OVVA 3JUIA 3ZIMA 4X8QA 4URKA 1IKND 2E0IA 2WVIA 1N11A 2XZDG 2BF0X 3LY9A 3DEOA 1SZAA 3QWWA 2C2LA 4FHJA 4L2LA 3DSVA 3D9HA 1BD8A 1TEZA 3EU9A 2Y1LE 1OUVA 2OV8A 3MCXA 4TXQA 4BERA 3UXGA 1U3DA 2ETBA 3S7JA 1PY1A 4LG6A 3DBSA 3ZHEB 2VGYA 4F7AA 4B8CB 1N95A 1FT1A 3AAAC 4CYMD 4GMLA 4LSZE 3ULQA 4GCNA 1QBQA 3AS8A 4J8EA 4BTAA 2V0PA 1S0PA 4GTRA 4ACKA 2WXOA 4Z68A 3TGOA 2I6HA 4JHJA 5FQ4A 4GU5A 2DYSE 2J09A 4O60A 1K8KG 4TXRA 3G2TA 3KAEA 4EBAG 2P9UG 4JW1A 3PNTB 4H7YA 5FT9A 2AVPA 1TR4A 4FJZA 3SGHA 4AOFA 3FHEA 3F6QA 4BESA 2WXIA 4N5QA 3TWXA 4ANVA 4FLBA 2XEEA 3FTVA 2P9KG 1U2VG 4FC8A 1Q2ZA 3SFXA 2IEJA 3PUJA 4GA2A 4EPZA 4FJYA 4F3VA 3NZUA 1D9SA 1DNPA 4NURA 1H2UA 2P9IG 4RVBA 3FUFA 3HXDA 3UPVA 5M72A 3CVVA 2J4DA 3SZ7A 3OAWA 2WXMA 3JYSA 5AARA 4K5CA 3IBEA 4U04A 3UKUG 1ZB1A 1NFIE 5CBOA 2RFMA 3CV0A 3EIJA 3FTSA 1BI7B 5D66A 2X3MA 4NRHB 4TUUA 3RIBA 4DK5A 2QC9A 3CSFA 5LX8A 4IYPA 3R7RA 3DSSA 4GZ6A 3VLDA 4ACLA 4GYOA 1BU9A 1SZ9A 5D0OD 3U66A 2DZNA 3JUEA 4A1SA 3T8KA 4BT9A 1E8WA 3KEAA 2L9BA 2IONA 5EYLA 2KCVA 1LD8A 4BSZB 3FTUA 4AY5A 1UN8A 4LERA 4KBQA 4ATZD 4I2WA 2IQCA 2L0IA 2J07A 2RG8A 3CEQA 2VSXE 4WNEA 3T5XA 2P9NG 3JXIA 3TWSA 1LF8A 3PNLB 2XS1A 4DX1A 3MKQA 4PS3A 2L6JA 4HB5A 3Q5MA 2WQ7A 4DI4A 3JXJA 2GRPB 2WXKA 3LVRE 2I1JA 3RKVA 1OWNA 5JHBA 3FUKA 2I9CA 3MYVA 4LNGA 3ZN3A 4TV3A 3GZ1A 4XKCA 3J5PA 4G24A 3Q73A 2JLBA 5D0QD 4ME2A 2JEKA 3UT4A 1EF1C 3LKUA 5AN8A 2LAIA 1IYGA 4B93B 2X6KA 5HKPA 4HOTA 3TWQA 2DBAA 4BSXA 2X6FA 4G8LA 3FWVA 3ZYQA 1MQSA 3EHNA 4IN3B 3T5VA 3NOCD 3SNXA 2QZAA 4DUIA 3DSUA 1XNFA 1WAO1 5T3RA 4KVMA 4AEZC 2XEHA 4TXPA 4O1PA 4WNFA 3CGHA 2KBXA 3N71A 4GTPA 4GTSA 1TN7A 2P58C 4C0MA 5BV0A 5FQ6A 3QWPA 5E76A 5B1AE 3ZRHA 4HRLA 4DX2A 4UWLA 4EZJA 1N54A 3E30A 1TJCA 1OWPA 5B3SE 3D9JA 2MRIA 5FQ7A 4EZKA 3AU5A 3B7BA 3APFA 2YHEA 3C3RA 5FTPA 4DJAA 3BG1B 4CCAA 1H6OA 3FUMA 1N4SA 4AVXA 3TAXA 3CHRA 4G8KA 2WXHA 3FU0A 3JCKC 1UJKA 3MKRA 4PH4B 2XCBA 5D2MC 1INZA 4JC8A 4UI9K 2UY1A 1NA3A 3ABME 4WWNA 4U0SA 2R5SA 3G2VA 3TWVA 4L2YA 3LJ3A 3IHVA 1FVFA 3LYAA 4LEUA 5AQAA 3VTYA 3UX4A 2IOLA 4ANXA 4GAAA 3FP3A 3HXCA 4G23A 2GW1A 2XZTG 4ABNA 3E32A 2J08A 3ZVVA 3CVUA 4G1TA 4A3TA 3CQCB 2R05A 3IHYA 3ZPJA 3P2BA 3ONKA 4N3AA 1WG0A 2Y3AA 2PQRA 1ELWA 2OVBA 3NAWA 1SW6A 5DBKA 1OWOA 3D9LA 4L7TA 5EN5D 4O6FA 2RFAA 3CK9A 3Q9NC 2VYIA 3R9MA 4AV7A 2F37A 3SQVA 3IXEA 4CDNA 5EIBE 2WXFA 3AG1E 5EILA 3ASDA 3CVQA 2AXVA 4CRWA 1DC2A 3FULA 4HS2A 3Q15A 2DIWA 1E8YA 5AYWD 3B7TA 3UINC 4F1PA 3HVEB 3Q47B 2DCPA 2LXMA 4WWOA 3ONLA 5EX0A 5G05C 4WWPA 3PE3A 1WY6A 1SA5A 2A4ZA 1TN6A 3BG0B 4UQXA 5G04J 3Q7FA 4GYWA 3ML9A 4FLHA 4LRZA 4JA9A 2IFUA 4XE0A 4WNGA 4U8VD 3UKRG 2FI7A 2I2OA 3TWWA 4I9EA 3UM3A 3B7UX 3R7QA 4TRQA 5CECB 2NSZA 1YYHA 2EINE 3D3MA 4UWHA 4BEPA 3ZXPA 4N5CA 2UY1B 3K9IA 2ZXWE 3OTNA 3CVLA 1ELKA 3ZFWA 2MOWA 1DVPA 2QY7A 2WXQA 4AXHA 2CG3A 3SO8A 1IHBA 4LCTA 1UJJA 3QKYA 4YDEA 4HRMB 1WM5A 3ZUVB 2EIKE 4KXKB 2LAHA 2Y0BG 1FVHA 3SBTB 3CLJA 3FU6A 3U9WA 5ITZF 4BX8A 4I6GA 4GZ5A 2WPVA 4YDYA 1KT0A 3S2AA 2EQXA 1QYMA 3MGBA 1X5BA 4BY6A 3LY8A 4EQFA 3SBSA 3S7DA 4QFVA 3EUVA 3VLEA 4DX7D 3CVWA 2ONDA 4OAUC 1N4QA 2PQNA 2WMOA 4GZDA 3ZXSA 4ZFHA 3D9OA 4H7XA 1Z6TA 2XGMA 4KMOA 2FO1E 3MZLB 1IQUA 4UI9C 3FTWA 4P29A 2XCCA 4HRNA 3PZ2A 4UWKA 3ZEFA 5CMWA 5ANLA 3AS4A 1LTXA 4BWRA 4N39A 3C72A 3AS5A 1S63A 1E7VA 4UWGA 2PNNA 3EIQC 3APCA 5FZQA 4JL0A 3SI5A 3SFZA 4G25A 2GROB 2VSYA 2QFCA 2KC7A 4HXIA 4XX5A 2DZOA 1OT8A 4KVOA 3ASHA 3FDHA 3P1UA 2NYJA 4A3VA 2YHCA 1UG3A 2CHZA 2C0MA 3ZKJA 2V4LA 3RJVA 3ABKE 1U3CA 4RG6A 3Q75A 2KCKA 4HOQA 3L82A 5EDSA 5KJLA 5ARFA 3V2XA 4AJWA 4J8FA 3QJZA 3BQOA 3U64A 1HE8A 2EIME 4XI9A 1JWFA 5FZSA 2DYRE 1N4PA 3SFYA 2AXZA 2GRMA 3QWVA
chains in the Genus database with same CATH topology
5D2MC 1Z5SC 2GRQB 2GRRB 2IY0C 3UIPC 1KPSB 2GRPB 2IO2C 2IO3C 3UINC 3UIOC 2GRNB 2GROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M C;  1Z5S C;  2GRQ B;  2GRR B;  2IY0 C;  3UIP C;  1KPS B;  2GRP B;  2IO2 C;  2IO3 C;  3UIN C;  3UIO C;  2GRN B;  2GRO B; 
#chains in the Genus database with same CATH topology
 4CGV A;  3T9K A;  3C5R A;  2VGE A;  1Z3Y A;  1EDU A;  2PZI A;  3AU4 A;  1L5J A;  2HM8 A;  3UUX A;  4FP7 A;  4GTV A;  4U95 D;  5AQ9 A;  1E8X A;  1O1R A;  1H0A A;  3EHM A;  2VQ2 A;  1YMP A;  4MBG A;  1TNZ A;  2KAT A;  4UQY A;  1D8D A;  4GMR A;  2LUH A;  3NQP A;  5AJL A;  3WXX A;  3QAQ A;  5BUZ A;  5BXU A;  1TNB A;  2H6H A;  4LUN U;  3E34 A;  3FH5 A;  2VTB A;  2AJA A;  3ASF A;  3TXM A;  2J49 A;  2H6I A;  3CHM A;  4A63 B;  2P9S G;  1HZ4 A;  1SVX A;  4MLP A;  2AW6 A;  3HXE A;  5JA4 D;  3QOU A;  4YDO A;  2C0L A;  2XPI A;  4JZY A;  3HDX A;  4XIF A;  5BXO A;  2QYU A;  4M7C A;  4JEH A;  5KJN A;  2DVW A;  2WXP A;  3WG7 E;  2FUL A;  1HS6 A;  5JHA A;  2RD0 A;  5A23 A;  2KZT A;  3EU5 A;  3FEY A;  1MX4 A;  2X6J A;  4Q96 A;  1AP7 A;  1YCS B;  4L1B A;  3NB2 A;  2BTD A;  5T4Y A;  5DIZ A;  3I4G A;  4XEI G;  5CEA A;  3VTX A;  1IQR A;  3Q79 A;  2HYZ A;  4I1O B;  1EPU A;  3EDT B;  4EHM A;  3APD A;  1OCO E;  3FFL A;  3ENE A;  3URZ A;  3NBN B;  1P5Q A;  5EYP F;  2BED A;  3RRM B;  3MJW A;  1NP7 A;  3L13 A;  3HG0 D;  3JQ1 A;  3IKO B;  3UTM A;  4F53 A;  1TNY A;  3O4Z A;  3AG4 E;  2R03 A;  3CHP A;  1BPO A;  2H6F A;  3CVY A;  3B7S A;  2FEZ A;  4C9B B;  5ANR A;  3C98 A;  3I4R B;  4UWF A;  3PZ1 A;  4OAV B;  3S7B A;  4F1S A;  2XEN A;  4YDW A;  1OCC E;  4U07 A;  3CST A;  3NZS A;  4Q69 A;  4I6E A;  5JJ6 A;  1MX2 A;  4U8Y D;  3B7R L;  1N4R A;  1OY3 D;  4XZ4 A;  1JCQ A;  1B89 A;  3E4B A;  1UN9 A;  1NL4 A;  3AG2 E;  4L23 A;  4FUL A;  4GTO A;  3GYZ A;  3DSX A;  2GGF A;  4RG9 A;  2LNI A;  2WQH A;  3FTY A;  3SY2 A;  2P9L G;  2IU1 A;  4GA0 A;  2M63 A;  2X6I A;  4MS6 A;  4WND A;  2ILR A;  3LEW A;  4UUC A;  3W9G A;  2XRY A;  1TN8 A;  4YVQ C;  3L08 A;  5HI7 A;  2ZIS A;  2VGX A;  2KXP C;  3EJN A;  3E33 A;  3QNK A;  2WXR A;  3D9N A;  1HO8 A;  1V55 E;  4N3C A;  5EID A;  1WDY A;  3LJN A;  5C2Y A;  4Y6W A;  3SD5 A;  4ILG A;  2XGS A;  4I6J A;  1OWM A;  2XPZ A;  2YIN A;  4MKT A;  5LOZ A;  5FZR A;  3PRZ A;  3FEX A;  3MKQ B;  3BEE A;  5FWQ A;  2UWJ G;  1AWC B;  3D9K A;  4K5B A;  2OCC E;  3RRU A;  5EKQ D;  2X38 A;  4EBA A;  1JWG A;  4HOS A;  4C48 B;  5IY5 E;  4O1O A;  1HG2 A;  5CRU A;  1S64 A;  1PAQ A;  5BV1 A;  4GB9 A;  5KWD A;  5CHE E;  3DEP A;  3SHF A;  3Q4A B;  2R59 A;  2QYJ A;  3BU8 A;  4J7W A;  4I17 A;  1DCE A;  1NZN A;  3U4T A;  4R7L A;  4K0R A;  4B94 A;  1KZP A;  1H19 A;  2DWZ A;  3DXM G;  1N9A A;  3Q49 B;  5CRV A;  2WQ6 A;  3UT7 A;  4EEC A;  3DXK G;  3DPD A;  3CKB A;  3NF1 A;  4BET A;  4K03 A;  5AJD A;  2XGO A;  5G2N A;  4CEM A;  3FY4 A;  3LPZ A;  2A5U A;  4RSY A;  2I1K A;  2IY0 C;  3FUJ A;  3G2S A;  1E96 B;  3G2U A;  1X81 A;  4HOR A;  3T8M A;  1NA0 A;  1KZO A;  5KJM A;  4G11 A;  2VJ8 A;  1MZC A;  4N2Q A;  5G05 J;  3ZHE A;  2LSU A;  4JHK A;  2PL2 A;  4J8D A;  2ZU6 B;  2OEV A;  3CIA A;  5HRY A;  1A5E A;  2XS8 A;  3UT8 A;  3RO2 A;  3OXF A;  2AWI A;  5CED B;  4N3B A;  4QQI A;  5FJY A;  1PC2 A;  4HQD A;  2RKK A;  4DRX E;  3V79 K;  4JA7 A;  3FU3 A;  1OCZ E;  4G26 A;  3MEK A;  3EHQ A;  4DLO A;  4AY6 A;  4GTM A;  3RSE G;  4APF A;  4WUY A;  5BT1 A;  4K5A B;  4HVB A;  4JD2 G;  2F0Y A;  3MX3 A;  2V5F A;  1TNU A;  3L22 A;  3CVP A;  3CK8 A;  5JJ7 A;  2MYO A;  2LXL A;  4JHR A;  2Y4T A;  5LCW C;  3CHO A;  5LCW J;  4FA6 A;  3PEU B;  3Q9U C;  4A55 A;  1UOH A;  3FH7 A;  3TL5 A;  2ZGD A;  3FUI A;  2GRL A;  4MRU A;  4I9C A;  1KPS B;  3ML8 A;  3LVQ E;  3MV3 B;  5G55 A;  1K1B A;  5T8I A;  2WXG A;  2FF4 A;  5ENS D;  2BKK B;  1DCQ A;  3ZW3 A;  2B6C A;  3LDZ A;  5CCM A;  4HI8 A;  3PUK A;  4OYS A;  2Y69 E;  1MJ0 A;  1N0R A;  5E75 A;  4AIF A;  2PM6 A;  5A6C A;  4DI3 A;  4GTQ A;  1MX6 A;  2X6H A;  1JCR A;  5LFA A;  4J0U A;  4UI9 J;  4BX9 A;  1ELR A;  4Q94 A;  1Z3X A;  4U63 A;  3CHQ A;  3Q7A A;  4LNB A;  2Y4U A;  3UQ3 A;  3KD7 A;  3W9F A;  3GZS A;  4E85 A;  2FBN A;  2F8X K;  3KS2 A;  3B13 A;  3I3N A;  4G2V A;  2F8Y A;  4I1M A;  4IUL A;  1OXJ A;  2V8S E;  5BNW A;  1KT1 A;  1HFA A;  5B1B E;  3LCA A;  1ZU2 A;  3TG4 A;  5HQ8 A;  3VLF A;  1ZBP A;  4BT8 A;  3CVN A;  1LD7 A;  3ASN E;  5KJK A;  1H6K A;  3DSW A;  5EX3 A;  1E7U A;  2NXP A;  3UM1 A;  2ETC A;  4GMJ A;  1OCR E;  3CK7 A;  1N52 A;  1QZ2 A;  2ZGG A;  1D8E A;  2B0O E;  3D9P A;  4GPK A;  4JEU A;  3U3W A;  4C0E A;  3SF4 A;  1Y6I A;  3OXL A;  4U96 D;  1N0Q A;  1SA4 A;  4A1G A;  5C1D A;  2HR2 A;  3UM0 A;  3FH8 A;  3HHM A;  2IO3 C;  1BI8 B;  3KEZ A;  2H6G A;  4OVU A;  5CMY A;  1N94 A;  4ANW A;  4GA1 A;  4HNA D;  4PS7 A;  4AM9 A;  3ESK A;  3PS6 A;  5AQ7 A;  4IRU A;  2ZIR A;  4HOU A;  1NI1 A;  2HO1 A;  2EIJ E;  1HG5 A;  1HU3 A;  4PDX A;  1Y8M A;  2KM4 A;  4AP2 A;  3QB2 A;  4FAD A;  5H7P A;  3ZYL A;  5FIO A;  1TNO A;  3L6A A;  3L16 A;  2CHW A;  3E37 A;  5FIN A;  5JJT A;  2LO6 A;  3HIZ A;  2V5Q C;  3PVL A;  3CR3 A;  3FTX A;  3LXU X;  2CFZ A;  3ZNG A;  2FO7 A;  1O1S A;  2VSO E;  2GRR B;  4RLY A;  3L54 A;  4RQI A;  5AIJ A;  4GCO A;  1H2V C;  1HX8 A;  4ILI A;  3RO3 A;  1HH8 A;  3DST A;  3RK6 A;  4J6I A;  3DPY A;  3CVX A;  4U7E B;  3BUA A;  3C3Q A;  2WXJ A;  2WXL A;  3RAU A;  2AXU A;  1JPL A;  1G3N B;  1MYO A;  3DRA A;  3GW4 A;  3QAR A;  4L9P A;  4YVO A;  2IOS A;  3UIP C;  1A17 A;  2XQ0 A;  5ENR D;  4FHK A;  3ABL E;  2HE0 A;  2L0T B;  2WM9 A;  4ILH B;  1H6P A;  2YQ8 A;  3HYM B;  4CT0 A;  2R2L A;  3PZ3 A;  1TYQ G;  2MHK A;  1K3Z D;  1IXV A;  4BTB A;  4KZ0 A;  4CGW A;  2BUG A;  5BW8 C;  4JB8 P;  5KNH D;  4JVS A;  4D10 C;  3JQ0 A;  3TJP A;  3TWT A;  3HRA A;  3UIO C;  4ZHB A;  5ENT D;  1OWL A;  5JMN D;  3ESL A;  3CKC A;  4YND A;  3ASG A;  4B0Z A;  4Y6C A;  5AAO A;  4GPM A;  2BKG A;  4W9R A;  3ULE G;  4CDM A;  4HBD A;  2OVF A;  3HXF A;  4U0Z A;  4HFG A;  2PM7 A;  3UM2 A;  3HXB A;  3J5Q B;  1RW2 A;  3EHR A;  4V3I A;  1QQE A;  3PZ4 A;  1FCH A;  3PEV B;  3PDN A;  2R02 A;  4KT6 B;  3QC1 A;  1TJF A;  4B8A A;  5HS0 A;  2V4H C;  2ETA A;  3HVE A;  3UMV A;  4PUC A;  4PS8 A;  2GRN B;  4DLQ A;  5J90 A;  2VTB B;  1V54 E;  4LNU D;  2OEW A;  4JXT A;  5CER B;  3AJI A;  5ENN A;  3CQG B;  3S7F A;  3V2O A;  5KCM A;  2XEV A;  2WXN A;  4XKB A;  2A5E A;  1GW6 A;  4FU3 A;  2E2E A;  2IJG X;  4HLE A;  2CG2 A;  5LP0 A;  3FUH A;  1SQM A;  4JPS A;  3NOG D;  2NC9 A;  2CFU A;  1JCS A;  3PRE A;  5KBA A;  2Q7F A;  4KYO B;  4CT4 A;  3LY7 A;  2KZT B;  3CHS A;  4HLL A;  3ZYK A;  3ZU7 B;  3D9I A;  2R17 C;  2XHE A;  2P9P G;  1O1T A;  2WMN A;  4DPR A;  4WAF A;  4UQZ A;  3FU5 A;  1HF8 A;  3V30 A;  5A7D B;  3AG3 E;  2P2C P;  5ENQ D;  1MHQ A;  3TWU A;  1QNF A;  4J8S A;  3DWL G;  3R9A B;  4HI9 A;  4CZ2 D;  3ULY A;  5BPP A;  1JUQ A;  3KSQ A;  4EZL A;  5CCL A;  1XGW A;  3D9M A;  5AEN A;  4E6H A;  2WB2 A;  2J9Q A;  3G2W A;  1KLX A;  3FTZ A;  2L6B A;  3FUN A;  2J8S D;  3Q78 A;  4I43 A;  4BFR A;  5ENO D;  4CDR A;  3V31 A;  1S70 B;  1YA0 A;  5CBN A;  2VSN A;  1K1A A;  2J4B A;  3OXG A;  4M3O A;  4GZ3 A;  4ANU A;  4GTT A;  1EYH A;  5AQB A;  4NQ0 A;  4ATG A;  3RU0 A;  4DX5 D;  2CHX A;  4TUM A;  3MA5 A;  4NIK A;  2GRQ B;  4GZC A;  4U8H A;  3MV2 B;  2IO2 C;  4B89 A;  3TG5 A;  1W3B A;  1IHG A;  3I5P A;  3PH0 C;  2VGX B;  5G04 C;  1FT2 A;  4DX6 D;  3FUE A;  3PE4 A;  3O48 A;  4U0U A;  3X2Q E;  3QDN A;  5ENP D;  3FUD A;  3B95 A;  1HXI A;  3QK0 A;  3PZD A;  4KZC A;  1BLX B;  4N2S A;  1FPP A;  1VDY A;  3IEG A;  1E90 A;  1UW4 B;  3IV0 A;  3ZGQ A;  2IF4 A;  4APO A;  5ARG A;  2JAB A;  5FQ8 A;  3ZYM A;  2XRZ A;  5J08 A;  3C3O A;  4I1A A;  1H2T C;  2YNQ A;  1Z5S C;  4J8Y A;  4XI0 A;  4I2Z A;  3ASO E;  3GZ2 A;  3L9T A;  3TWR A;  2OOE A;  3UI2 A;  2LSV A;  3TXN A;  2EIL E;  1O5M A;  2KCL A;  1RZ4 A;  5KNG A;  4NAC A;  1E8Z A;  3LS8 A;  4F6R D;  2XPY A;  4GYY A;  3ISM C;  3RRN B;  3L17 A;  3KSL A;  4OVV A;  3JUI A;  3ZIM A;  4X8Q A;  4URK A;  1IKN D;  2E0I A;  2WVI A;  1N11 A;  2XZD G;  2BF0 X;  3LY9 A;  3DEO A;  1SZA A;  3QWW A;  2C2L A;  4FHJ A;  4L2L A;  3DSV A;  3D9H A;  1BD8 A;  1TEZ A;  3EU9 A;  2Y1L E;  1OUV A;  2OV8 A;  3MCX A;  4TXQ A;  4BER A;  3UXG A;  1U3D A;  2ETB A;  3S7J A;  1PY1 A;  4LG6 A;  3DBS A;  3ZHE B;  2VGY A;  4F7A A;  4B8C B;  1N95 A;  1FT1 A;  3AAA C;  4CYM D;  4GML A;  4LSZ E;  3ULQ A;  4GCN A;  1QBQ A;  3AS8 A;  4J8E A;  4BTA A;  2V0P A;  1S0P A;  4GTR A;  4ACK A;  2WXO A;  4Z68 A;  3TGO A;  2I6H A;  4JHJ A;  5FQ4 A;  4GU5 A;  2DYS E;  2J09 A;  4O60 A;  1K8K G;  4TXR A;  3G2T A;  3KAE A;  4EBA G;  2P9U G;  4JW1 A;  3PNT B;  4H7Y A;  5FT9 A;  2AVP A;  1TR4 A;  4FJZ A;  3SGH A;  4AOF A;  3FHE A;  3F6Q A;  4BES A;  2WXI A;  4N5Q A;  3TWX A;  4ANV A;  4FLB A;  2XEE A;  3FTV A;  2P9K G;  1U2V G;  4FC8 A;  1Q2Z A;  3SFX A;  2IEJ A;  3PUJ A;  4GA2 A;  4EPZ A;  4FJY A;  4F3V A;  3NZU A;  1D9S A;  1DNP A;  4NUR A;  1H2U A;  2P9I G;  4RVB A;  3FUF A;  3HXD A;  3UPV A;  5M72 A;  3CVV A;  2J4D A;  3SZ7 A;  3OAW A;  2WXM A;  3JYS A;  5AAR A;  4K5C A;  3IBE A;  4U04 A;  3UKU G;  1ZB1 A;  1NFI E;  5CBO A;  2RFM A;  3CV0 A;  3EIJ A;  3FTS A;  1BI7 B;  5D66 A;  2X3M A;  4NRH B;  4TUU A;  3RIB A;  4DK5 A;  2QC9 A;  3CSF A;  5LX8 A;  4IYP A;  3R7R A;  3DSS A;  4GZ6 A;  3VLD A;  4ACL A;  4GYO A;  1BU9 A;  1SZ9 A;  5D0O D;  3U66 A;  2DZN A;  3JUE A;  4A1S A;  3T8K A;  4BT9 A;  1E8W A;  3KEA A;  2L9B A;  2ION A;  5EYL A;  2KCV A;  1LD8 A;  4BSZ B;  3FTU A;  4AY5 A;  1UN8 A;  4LER A;  4KBQ A;  4ATZ D;  4I2W A;  2IQC A;  2L0I A;  2J07 A;  2RG8 A;  3CEQ A;  2VSX E;  4WNE A;  3T5X A;  2P9N G;  3JXI A;  3TWS A;  1LF8 A;  3PNL B;  2XS1 A;  4DX1 A;  3MKQ A;  4PS3 A;  2L6J A;  4HB5 A;  3Q5M A;  2WQ7 A;  4DI4 A;  3JXJ A;  2GRP B;  2WXK A;  3LVR E;  2I1J A;  3RKV A;  1OWN A;  5JHB A;  3FUK A;  2I9C A;  3MYV A;  4LNG A;  3ZN3 A;  4TV3 A;  3GZ1 A;  4XKC A;  3J5P A;  4G24 A;  3Q73 A;  2JLB A;  5D0Q D;  4ME2 A;  2JEK A;  3UT4 A;  1EF1 C;  3LKU A;  5AN8 A;  2LAI A;  1IYG A;  4B93 B;  2X6K A;  5HKP A;  4HOT A;  3TWQ A;  2DBA A;  4BSX A;  2X6F A;  4G8L A;  3FWV A;  3ZYQ A;  1MQS A;  3EHN A;  4IN3 B;  3T5V A;  3NOC D;  3SNX A;  2QZA A;  4DUI A;  3DSU A;  1XNF A;  1WAO 1;  5T3R A;  4KVM A;  4AEZ C;  2XEH A;  4TXP A;  4O1P A;  4WNF A;  3CGH A;  2KBX A;  3N71 A;  4GTP A;  4GTS A;  1TN7 A;  2P58 C;  4C0M A;  5BV0 A;  5FQ6 A;  3QWP A;  5E76 A;  5B1A E;  3ZRH A;  4HRL A;  4DX2 A;  4UWL A;  4EZJ A;  1N54 A;  3E30 A;  1TJC A;  1OWP A;  5B3S E;  3D9J A;  2MRI A;  5FQ7 A;  4EZK A;  3AU5 A;  3B7B A;  3APF A;  2YHE A;  3C3R A;  5FTP A;  4DJA A;  3BG1 B;  4CCA A;  1H6O A;  3FUM A;  1N4S A;  4AVX A;  3TAX A;  3CHR A;  4G8K A;  2WXH A;  3FU0 A;  3JCK C;  1UJK A;  3MKR A;  4PH4 B;  2XCB A;  5D2M C;  1INZ A;  4JC8 A;  4UI9 K;  2UY1 A;  1NA3 A;  3ABM E;  4WWN A;  4U0S A;  2R5S A;  3G2V A;  3TWV A;  4L2Y A;  3LJ3 A;  3IHV A;  1FVF A;  3LYA A;  4LEU A;  5AQA A;  3VTY A;  3UX4 A;  2IOL A;  4ANX A;  4GAA A;  3FP3 A;  3HXC A;  4G23 A;  2GW1 A;  2XZT G;  4ABN A;  3E32 A;  2J08 A;  3ZVV A;  3CVU A;  4G1T A;  4A3T A;  3CQC B;  2R05 A;  3IHY A;  3ZPJ A;  3P2B A;  3ONK A;  4N3A A;  1WG0 A;  2Y3A A;  2PQR A;  1ELW A;  2OVB A;  3NAW A;  1SW6 A;  5DBK A;  1OWO A;  3D9L A;  4L7T A;  5EN5 D;  4O6F A;  2RFA A;  3CK9 A;  3Q9N C;  2VYI A;  3R9M A;  4AV7 A;  2F37 A;  3SQV A;  3IXE A;  4CDN A;  5EIB E;  2WXF A;  3AG1 E;  5EIL A;  3ASD A;  3CVQ A;  2AXV A;  4CRW A;  1DC2 A;  3FUL A;  4HS2 A;  3Q15 A;  2DIW A;  1E8Y A;  5AYW D;  3B7T A;  3UIN C;  4F1P A;  3HVE B;  3Q47 B;  2DCP A;  2LXM A;  4WWO A;  3ONL A;  5EX0 A;  5G05 C;  4WWP A;  3PE3 A;  1WY6 A;  1SA5 A;  2A4Z A;  1TN6 A;  3BG0 B;  4UQX A;  5G04 J;  3Q7F A;  4GYW A;  3ML9 A;  4FLH A;  4LRZ A;  4JA9 A;  2IFU A;  4XE0 A;  4WNG A;  4U8V D;  3UKR G;  2FI7 A;  2I2O A;  3TWW A;  4I9E A;  3UM3 A;  3B7U X;  3R7Q A;  4TRQ A;  5CEC B;  2NSZ A;  1YYH A;  2EIN E;  3D3M A;  4UWH A;  4BEP A;  3ZXP A;  4N5C A;  2UY1 B;  3K9I A;  2ZXW E;  3OTN A;  3CVL A;  1ELK A;  3ZFW A;  2MOW A;  1DVP A;  2QY7 A;  2WXQ A;  4AXH A;  2CG3 A;  3SO8 A;  1IHB A;  4LCT A;  1UJJ A;  3QKY A;  4YDE A;  4HRM B;  1WM5 A;  3ZUV B;  2EIK E;  4KXK B;  2LAH A;  2Y0B G;  1FVH A;  3SBT B;  3CLJ A;  3FU6 A;  3U9W A;  5ITZ F;  4BX8 A;  4I6G A;  4GZ5 A;  2WPV A;  4YDY A;  1KT0 A;  3S2A A;  2EQX A;  1QYM A;  3MGB A;  1X5B A;  4BY6 A;  3LY8 A;  4EQF A;  3SBS A;  3S7D A;  4QFV A;  3EUV A;  3VLE A;  4DX7 D;  3CVW A;  2OND A;  4OAU C;  1N4Q A;  2PQN A;  2WMO A;  4GZD A;  3ZXS A;  4ZFH A;  3D9O A;  4H7X A;  1Z6T A;  2XGM A;  4KMO A;  2FO1 E;  3MZL B;  1IQU A;  4UI9 C;  3FTW A;  4P29 A;  2XCC A;  4HRN A;  3PZ2 A;  4UWK A;  3ZEF A;  5CMW A;  5ANL A;  3AS4 A;  1LTX A;  4BWR A;  4N39 A;  3C72 A;  3AS5 A;  1S63 A;  1E7V A;  4UWG A;  2PNN A;  3EIQ C;  3APC A;  5FZQ A;  4JL0 A;  3SI5 A;  3SFZ A;  4G25 A;  2GRO B;  2VSY A;  2QFC A;  2KC7 A;  4HXI A;  4XX5 A;  2DZO A;  1OT8 A;  4KVO A;  3ASH A;  3FDH A;  3P1U A;  2NYJ A;  4A3V A;  2YHC A;  1UG3 A;  2CHZ A;  2C0M A;  3ZKJ A;  2V4L A;  3RJV A;  3ABK E;  1U3C A;  4RG6 A;  3Q75 A;  2KCK A;  4HOQ A;  3L82 A;  5EDS A;  5KJL A;  5ARF A;  3V2X A;  4AJW A;  4J8F A;  3QJZ A;  3BQO A;  3U64 A;  1HE8 A;  2EIM E;  4XI9 A;  1JWF A;  5FZS A;  2DYR E;  1N4P A;  3SFY A;  2AXZ A;  2GRM A;  3QWV A; 
#chains in the Genus database with same CATH homology
 5D2M C;  1Z5S C;  2GRQ B;  2GRR B;  2IY0 C;  3UIP C;  1KPS B;  2GRP B;  2IO2 C;  2IO3 C;  3UIN C;  3UIO C;  2GRN B;  2GRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...