2IO2C

Crystal structure of human senp2 in complex with rangap1-sumo-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESSSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2io2C00
2GRQB 1Z5SC 2GRPB 2IY0C 3UIOC 2GRNB 1KPSB 2IO3C 2GROB 5D2MC 3UINC 3UIPC 2GRRB 2IO2C
chains in the Genus database with same CATH superfamily
3FFLA 2ETBA 1U2VG 3UPVA 1ELRA 2XENA 1TNUA 1N9AA 2KATA 4LRZA 5EIBE 4XE0A 3FEYA 1QNFA 3QWPA 2QC9A 3MKRA 1TNBA 3V2OA 2XZTG 3PNTB 1IQUA 3ASGA 1TYQG 4GTRA 4BSXA 2J09A 2OVFA 2P58C 1NA0A 3FTWA 1D8EA 1OUVA 3C72A 2MRIA 2DBAA 4EECA 2E0IA 4GA2A 4BEPA 4AV7A 4QQIA 3PREA 3LS8A 3AG4E 3D9PA 4IYPA 3MCXA 1A17A 2B6CA 3UI2A 3L82A 1Q2ZA 3W9GA 1JCQA 4KBQA 2Y69E 4HOQA 2XCBA 1YA0A 3B7BA 3TWTA 1U3CA 5FQ7A 3S7JA 4JXTA 2LO6A 3DBSA 4LERA 5FQ4A 4B89A 3S2AA 3ZPJA 1TN6A 1O1RA 5JHAA 1MHQA 3APFA 3E33A 2L6JA 4OVVA 3HHMA 3CK9A 4HLLA 2YQ8A 3TWRA 5ARGA 2CHWA 3FTSA 5G04C 4JPSA 3PUJA 2WM9A 4RG6A 3SO8A 1BU9A 3APDA 1UW4B 1KZPA 4G23A 3R9AB 3QC1A 1B89A 3CV0A 3OTNA 3FUMA 3SBTB 2XEVA 5LP0A 3UT8A 3FUKA 3LPZA 3CEQA 5AQ9A 3VLEA 5KJNA 4YDOA 5G04J 3CVNA 4L1BA 5BPPA 5AN8A 2FBNA 2M63A 4J8YA 3UXGA 2I1KA 3OXLA 4TV3A 3TWSA 4ABNA 3UTMA 3GYZA 4CGWA 4KZ0A 5LCWC 3AU4A 3DEOA 4EPZA 4BY6A 1BPOA 1E8WA 1TJCA 3FEXA 3MKQA 4XX5A 2OOEA 3G2UA 3HVEA 4G25A 2F8YA 2DCPA 5EDSA 3MV2B 1RZ4A 3C5RA 4J8SA 3L08A 3IEGA 1HG5A 3UKRG 2DYRE 2GRLA 3C3QA 1DCQA 4N39A 4IN3B 4MS6A 2CG3A 2WXMA 4U0UA 3DXKG 4N5CA 3G2WA 2P9PG 2YHCA 1IXVA 4G2VA 2FEZA 3SZ7A 3LEWA 3ASDA 5T4YA 4LNGA 2R03A 3DSVA 3PNLB 4UI9J 1H0AA 3HYMB 3SFXA 3OXGA 4DUIA 1SA4A 5CCLA 1NL4A 2XPZA 4LCTA 4CT0A 3RKVA 3NB2A 3X2QE 4XEIG 3SF4A 4E85A 1BLXB 1TN7A 4BT9A 3TAXA 4XIFA 3KEAA 2R59A 2XS8A 3OAWA 2R05A 4YVQC 4LG6A 4UQZA 1YMPA 4IULA 5EN5D 4UQYA 3QKYA 1N94A 4GTSA 1EYHA 4WNDA 3E30A 3EUVA 1O1SA 5FZSA 5A23A 3FU5A 1O1TA 3UX4A 5JJTA 2V8SE 4EBAG 4RG9A 3QOUA 3L54A 1MQSA 3ZYLA 2XRZA 4APOA 4AM9A 1KLXA 5C2YA 3RIBA 2WQ6A 2BF0X 4LUNU 3F6QA 3B7SA 4DJAA 1MX6A 2GRNB 4MKTA 1BI7B 2KBXA 4J8FA 1BI8B 4GPMA 2P9KG 4I1OB 5KJMA 3HG0D 2NC9A 4U04A 4LNUD 2AXVA 2A5UA 4GA1A 1WAO1 3RAUA 1BD8A 2GRPB 3AU5A 1N4PA 5AQBA 4CZ2D 5E75A 3FTUA 1VDYA 2I9CA 5A7DB 4F6RD 3G2VA 2HYZA 4O1PA 1A5EA 3G2SA 1AP7A 4BX9A 3SHFA 3ZXSA 3MYVA 5J08A 3O4ZA 1DC2A 5ITZF 4B8CB 4TXRA 5BW8C 1FT1A 3UIPC 5FTPA 4F1SA 1TR4A 4GZDA 1PAQA 3LJ3A 2XZDG 1S63A 4FC8A 1ZU2A 2MYOA 1N0RA 4WUYA 2AWIA 3TWVA 4URKA 3FUDA 2GRQB 2IJGX 2YHEA 3Q47B 1D8DA 5FZRA 3DEPA 3CHRA 4DI4A 2WB2A 3FU6A 4B0ZA 2PM6A 1QZ2A 1UN8A 3O48A 1X81A 2AXZA 5JHBA 2XGOA 3NF1A 2I6HA 3HXFA 3ULQA 4AVXA 2UY1A 1MJ0A 4HI8A 3EHQA 2PQRA 3HVEB 4OVUA 3W9FA 4OYSA 3PE4A 5CBOA 3P1UA 1P5QA 2WXRA 4FLBA 4B93B 2R2LA 2QY7A 3ZW3A 4KVMA 5FZQA 3E32A 4ACLA 3MJWA 1N4RA 3Q78A 4Q69A 2H6FA 4PS8A 2H6HA 3L16A 4I9CA 4XZ4A 5CEDB 3RRUA 1HO8A 1JWGA 1JUQA 4HORA 4C9BB 4RQIA 3JUEA 5ARFA 3I4GA 1MX4A 3DSSA 2V4LA 3QK0A 4JHKA 2L9BA 2FO1E 4AXHA 3S7FA 5C1DA 1OCCE 1MX2A 4KVOA 3AAAC 4FJZA 3ZHEA 3FUJA 3ZXPA 2VTBA 1HZ4A 3PVLA 4I1MA 3J5PA 4BFRA 3RO2A 3BQOA 2VSNA 2LSVA 3SNXA 3SGHA 2V0PA 5FIOA 3TXMA 4EZKA 5FT9A 2X38A 4HS2A 2X6IA 2OV8A 3ZUVB 4ACKA 2P9LG 4A3VA 3NAWA 4G11A 3D3MA 3FH7A 1HX8A 1SZ9A 2P9UG 1SW6A 4M7CA 3RJVA 2V4HC 1E90A 3HXDA 4U63A 3PE3A 4APFA 5ENQD 3DSXA 4I9EA 3MX3A 5AENA 1E7UA 3TWWA 2IO3C 2PNNA 2V5QC 4HQDA 4A1SA 2KCLA 5A6CA 4BETA 2WMNA 1E96B 2LAIA 5B3SE 2VQ2A 4O1OA 1RW2A 4A1GA 5AIJA 3FH8A 2GROB 4DLQA 4FP7A 3WG7E 4OAVB 3FH5A 3AS8A 2QYJA 2C0MA 1DVPA 2JEKA 4UWFA 2EINE 3ML9A 1ZB1A 3JCKC 3PUKA 5DIZA 1ELKA 1V55E 3PEVB 1K8KG 2AXUA 5BXUA 2WXFA 3S7BA 4N5QA 4UWGA 5BT1A 4GZ3A 1ELWA 3L17A 1IYGA 3IHYA 5ENTD 4R7LA 4LNBA 3CVLA 2LSUA 2YNQA 4V3IA 3ZYKA 1JCSA 4F3VA 4HI9A 3ASNE 1EPUA 4Q94A 1OWNA 4BTAA 2IO2C 4GTPA 4EZJA 4I2WA 5HKPA 3APCA 3DSTA 1N0QA 2KCKA 3T9KA 5M72A 4GMLA 3CKCA 3E34A 5T8IA 4HB5A 4HXIA 3SBSA 5T3RA 2V5FA 4GPKA 4GMRA 3CHOA 4ATGA 1YYHA 2IQCA 4NIKA 3CHSA 1TNZA 1K1BA 3KAEA 4AY6A 2HR2A 1QYMA 1LD8A 4HNAD 4WNGA 4GMJA 3CVPA 3CGHA 3ZGQA 3V79K 2NYJA 4ZHBA 3U3WA 4Y6CA 3S7DA 2UY1B 3EIQC 4C48B 3ABME 4GCOA 4CRWA 5ENRD 1INZA 3ZU7B 3D9JA 1LD7A 4F7AA 1NI1A 3C98A 3PZ2A 4GZCA 4JHJA 3Q9UC 2CHZA 3GW4A 4TUMA 1H6OA 3HXBA 4AIFA 3B7RL 3MV3B 1H2VC 3UT7A 2MOWA 4GTQA 5AJDA 1UJJA 4JB8P 4I17A 5JJ6A 2FO7A 3JUIA 2L6BA 4KMOA 3HRAA 4UI9C 1E8YA 3FP3A 2DIWA 3DPYA 4N2SA 2ILRA 4G1TA 4U7EB 4WWOA 5BNWA 3Q15A 1U3DA 3CVXA 5ENPD 4WWNA 4H7XA 2J4DA 4ILHB 3SI5A 3Q49B 5KJLA 1N4QA 5ENOD 2OEVA 4FULA 1H19A 4KT6B 4N3AA 2EIKE 3BUAA 1UG3A 3PEUB 4G24A 3L9TA 4GTMA 4I43A 1WG0A 3R9MA 3KSQA 3ZHEB 4KYOB 4QFVA 3CVUA 4Y6WA 2ETAA 2VTBB 1HS6A 1K3ZD 2IOSA 2BTDA 3QAQA 3GZ1A 2RFAA 4BT8A 3D9KA 3PS6A 4YVOA 2LNIA 4MRUA 1FVFA 1H6PA 5FJYA 1OWPA 3Q7AA 4O6FA 4I2ZA 5CERB 2QZAA 3LKUA 2VYIA 2IF4A 3FULA 5AARA 2L0TB 2XGSA 3RK6A 3ULEG 2BUGA 3UMVA 5FQ8A 4DRXE 4EHMA 3U66A 4HRNA 4L7TA 1OY3D 3JXIA 3RRMB 4JD2G 4PS3A 4UI9K 2NSZA 4CEMA 2X6HA 4B94A 3GZ2A 3CSFA 3RU0A 4DX5D 2LAHA 4X8QA 1K1AA 3D9IA 5EKQD 3ASOE 3PZ3A 2R5SA 1SA5A 3MZLB 2CFUA 4ANXA 2FULA 3HIZA 2ZXWE 4DI3A 2I2OA 2OCCE 3NZUA 4BSZB 1N11A 2CG2A 2L0IA 2EQXA 4U0ZA 3BG1B 2P9SG 5LX8A 3CVYA 2RFMA 1H2UA 3FDHA 3RSEG 4O60A 1WDYA 5ANRA 2PQNA 4GTTA 1EDUA 5G55A 4N3CA 3V31A 4FHKA 3CHPA 4NACA 2XPYA 4GTVA 3ZNGA 3Q79A 4DX7D 4F1PA 4UWLA 1G3NB 3UM1A 3AG3E 3Q75A 3KSLA 4XI9A 2Q7FA 4UWHA 5CCMA 3D9NA 2J8SD 2MHKA 2EILE 3AS5A 5BV1A 4NRHB 2WXPA 2PM7A 4EBAA 1SVXA 1NFIE 2Y3AA 4G26A 5ANLA 5HI7A 3NBNB 3NOGD 2ZGGA 4WNEA 1IHGA 2B0OE 2VSOE 2BEDA 3R7QA 2AVPA 3I5PA 3T5VA 4L2YA 2DVWA 1W3BA 4ILGA 2EIJE 5D0QD 1MYOA 1OXJA 3PRZA 3ML8A 4NQ0A 2DYSE 2J49A 2KZTA 3FUIA 4HVBA 3Q4AB 4AOFA 3CLJA 1S70B 4J7WA 2GRMA 3B95A 4U95D 2J08A 4DX6D 3UQ3A 5BXOA 2Y1LE 2Y4TA 3NZSA 1HF8A 1V54E 2IFUA 4RSYA 3DXMG 5AJLA 1S0PA 2NXPA 3FU3A 4ZFHA 3QDNA 2VJ8A 2DWZA 1QBQA 2KXPC 3JXJA 4BERA 3DPDA 4WAFA 3EU9A 1OCRE 2EIME 2X6FA 3HXCA 3DSWA 3LY8A 4BESA 1LF8A 4AP2A 5KWDA 3EHMA 4HOSA 4Z68A 2BKGA 5EYLA 3ESLA 1KPSB 5G05J 2CHXA 2WMOA 5EILA 1S64A 5EX0A 4JHRA 3AG2E 3IBEA 3RRNB 4JEUA 4DX2A 5BUZA 3Q7FA 3EIJA 5B1AE 3U4TA 1DNPA 4I6GA 1NA3A 4UUCA 1XGWA 4I1AA 3ISMC 2KCVA 5AYWD 5JA4D 2ZIRA 2GRRB 2F0YA 1ZBPA 2JLBA 2AW6A 2C0LA 5D0OD 1MZCA 4RLYA 4FHJA 2WXKA 2P9IG 4B8AA 4WWPA 3DSUA 4XKBA 2HE0A 2WQ7A 1N95A 2HM8A 2XGMA 3J5QB 3FTYA 3ZYMA 1UOHA 1IQRA 4TRQA 2C2LA 3ASFA 3ZIMA 3JYSA 5JJ7A 3CHMA 4DPRA 5KCMA 4H7YA 2WXLA 4YNDA 3T8KA 3N71A 4PS7A 4BTBA 4MLPA 3Q73A 4A55A 5CMYA 1L5JA 1OWMA 5HS0A 3TL5A 5KJKA 5BV0A 1UJKA 1Z3XA 1TNYA 4G8KA 1OWOA 4F53A 4UQXA 3QARA 3ULYA 4A63B 3E37A 1KT1A 4CT4A 1Y8MA 5CMWA 2I1JA 5ENNA 4DX1A 3HDXA 3NQPA 4K5CA 3LVQE 1N4SA 1N54A 2QFCA 3MA5A 4KZCA 3TXNA 1H6KA 2OVBA 2VGEA 3ONKA 4YDYA 2J4BA 2XHEA 5IY5E 4ANVA 2E2EA 2KM4A 4ANUA 4TUUA 3ENEA 4N3BA 3PZ1A 2XEHA 3FTZA 1H2TC 4YDEA 3HXEA 3QWWA 1Y6IA 5EX3A 3LCAA 4HOUA 5EYPF 2WPVA 4U07A 1KT0A 2XPIA 2ZISA 3LXUX 3URZA 3EHNA 3I4RB 3IXEA 3TWXA 5G2NA 4XKCA 5ENSD 3FU0A 1Z5SC 1UN9A 3WXXA 2WXIA 5CRUA 5B1BE 4BWRA 2YINA 5CRVA 2HO1A 3AJIA 4PH4B 3TGOA 2UWJG 2DZNA 3EJNA 2JABA 5D66A 4UWKA 2KZTB 3CQCB 3FWVA 1OCZE 4U8HA 3CK8A 3NOCD 2ETCA 2GW1A 1DCEA 2VSXE 4CGVA 3BEEA 3MEKA 3QWVA 1FVHA 4FU3A 3EDTB 2QYUA 4E6HA 1TJFA 4AY5A 4WNFA 3C3OA 4GYWA 3D9HA 2A5EA 3LY7A 3Q5MA 2WXNA 5DBKA 3CIAA 4AJWA 3MGBA 3KEZA 2R02A 3KS2A 5E76A 1JWFA 2OEWA 3E4BA 2WXJA 5LCWJ 4ILIA 3B7UX 2ZGDA 2F8XK 4HRMB 4GYOA 4M3OA 2VGXA 3BG0B 4JL0A 3U64A 3CVQA 4PDXA 2X3MA 5KNGA 2AJAA 2VGYA 2Y4UA 4MBGA 3CQGB 4FA6A 2H6GA 4P29A 2LXLA 4GB9A 3TG5A 1D9SA 1LTXA 2XEEA 3TWQA 2IONA 3VTXA 3ESKA 1SQMA 1N52A 3CHQA 5KNHD 2IOLA 3CK7A 2J07A 2KC7A 4C0MA 4FADA 2WVIA 3FUHA 4KXKB 3ASHA 1FT2A 3AS4A 3JQ0A 2VSYA 3FUEA 2ONDA 5CEAA 3FY4A 3T5XA 1GW6A 2WXHA 4K5BA 4U8YD 2WXOA 4DLOA 3ZYQA 1FPPA 4GZ6A 3RO3A 3U9WA 4CDRA 2ZU6B 3ZRHA 4ME2A 4HLEA 4TXQA 5HQ8A 3TG4A 3LYAA 4RVBA 3ABLE 5D2MC 4N2QA 2IY0C 3C3RA 3SFZA 1SZAA 4HRLA 5J90A 3V2XA 1AWCB 5H7PA 2LUHA 1IKND 3D9MA 3CR3A 1Z6TA 3QNKA 2PZIA 4YDWA 4ATZD 5HRYA 4XI0A 5CHEE 3LY9A 3OXFA 3SQVA 1TNOA 4U8VD 3L22A 5AQ7A 4NURA 4JW1A 4EZLA 3QB2A 4GCNA 3V30A 2FI7A 4L9PA 2DZOA 3I3NA 1HG2A 3VTYA 3ZN3A 3ABKE 4K03A 3JQ1A 5JMND 2RG8A 3UM0A 3ZVVA 4LSZE 3UM2A 3ONLA 4Q96A 3PZ4A 3KD7A 2XCCA 4I6EA 4U96D 1HE8A 3LVRE 1OWLA 3UM3A 1TEZA 4GZ5A 3UKUG 5FINA 1KZOA 4GAAA 2XQ0A 3ZEFA 2P9NG 4OAUC 2PL2A 2BKKB 1JPLA 2IEJA 2CFZA 1OCOE 4JVSA 3BU8A 5AAOA 3UIOC 3G2TA 4JC8A 4GA0A 2H6IA 3AG1E 1E8ZA 1YCSB 1EF1C 5KBAA 3B13A 3PZDA 1WM5A 4PUCA 2P2CP 4L23A 1XNFA 4G8LA 1PY1A 5FWQA 3TWUA 2J9QA 3PDNA 4BX8A 4JA7A 4ANWA 3EHRA 4JZYA 3LJNA 3D9OA 4J8DA 4CDMA 3ZFWA 1HH8A 5CBNA 2X6KA 2XRYA 4JEHA 3PH0C 4AEZC 2X6JA 5LFAA 4W9RA 3FUFA 3B7TA 3FTXA 3LDZA 1JCRA 2IU1A 4LEUA 4JA9A 3IKOB 2LXMA 4GTOA 3IV0A 5CECB 3ZKJA 4J6IA 2WQHA 3EU5A 4L2LA 4HOTA 5FQ6A 4K0RA 3VLFA 2XS1A 3IHVA 1IHBA 3P2BA 5LOZA 4HBDA 3VLDA 3SY2A 1Z3YA 3CVVA 2A4ZA 2R17C 4GYYA 3MKQB 4J8EA 3L6AA 5G05C 3DRAA 1O5MA 1WY6A 4DK5A 3D9LA 1FCHA 3UINC 1PC2A 4CDNA 3K9IA 3GZSA 1E8XA 3T8MA 3FUNA 4C0EA 2GGFA 2F37A 5AQAA 1NZNA 3QJZA 4FJYA 4GU5A 3Q9NC 1E7VA 2RD0A 4D10C 5EIDA 4EQFA 2VGXB 1HU3A 4IRUA 3SFYA 3UT4A 2WXQA 4CCAA 3SD5A 3CVWA 3DWLG 3CSTA 4CYMD 4U0SA 3L13A 1X5BA 4TXPA 2Y0BG 4HFGA 3R7RA 2FF4A 3FTVA 3UUXA 3TJPA 1NP7A 4K5AB 4FLHA 2RKKA 2WXGA 3FHEA 4A3TA 1OT8A 4J0UA 4I6JA 1HFAA 3CKBA 1QQEA 1HXIA 1TN8A
chains in the Genus database with same CATH topology
2GRQB 1Z5SC 2GRPB 2IY0C 3UIOC 2GRNB 1KPSB 2IO3C 2GROB 5D2MC 3UINC 3UIPC 2GRRB 2IO2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRQ B;  1Z5S C;  2GRP B;  2IY0 C;  3UIO C;  2GRN B;  1KPS B;  2IO3 C;  2GRO B;  5D2M C;  3UIN C;  3UIP C;  2GRR B;  2IO2 C; 
#chains in the Genus database with same CATH topology
 3FFL A;  2ETB A;  1U2V G;  3UPV A;  1ELR A;  2XEN A;  1TNU A;  1N9A A;  2KAT A;  4LRZ A;  5EIB E;  4XE0 A;  3FEY A;  1QNF A;  3QWP A;  2QC9 A;  3MKR A;  1TNB A;  3V2O A;  2XZT G;  3PNT B;  1IQU A;  3ASG A;  1TYQ G;  4GTR A;  4BSX A;  2J09 A;  2OVF A;  2P58 C;  1NA0 A;  3FTW A;  1D8E A;  1OUV A;  3C72 A;  2MRI A;  2DBA A;  4EEC A;  2E0I A;  4GA2 A;  4BEP A;  4AV7 A;  4QQI A;  3PRE A;  3LS8 A;  3AG4 E;  3D9P A;  4IYP A;  3MCX A;  1A17 A;  2B6C A;  3UI2 A;  3L82 A;  1Q2Z A;  3W9G A;  1JCQ A;  4KBQ A;  2Y69 E;  4HOQ A;  2XCB A;  1YA0 A;  3B7B A;  3TWT A;  1U3C A;  5FQ7 A;  3S7J A;  4JXT A;  2LO6 A;  3DBS A;  4LER A;  5FQ4 A;  4B89 A;  3S2A A;  3ZPJ A;  1TN6 A;  1O1R A;  5JHA A;  1MHQ A;  3APF A;  3E33 A;  2L6J A;  4OVV A;  3HHM A;  3CK9 A;  4HLL A;  2YQ8 A;  3TWR A;  5ARG A;  2CHW A;  3FTS A;  5G04 C;  4JPS A;  3PUJ A;  2WM9 A;  4RG6 A;  3SO8 A;  1BU9 A;  3APD A;  1UW4 B;  1KZP A;  4G23 A;  3R9A B;  3QC1 A;  1B89 A;  3CV0 A;  3OTN A;  3FUM A;  3SBT B;  2XEV A;  5LP0 A;  3UT8 A;  3FUK A;  3LPZ A;  3CEQ A;  5AQ9 A;  3VLE A;  5KJN A;  4YDO A;  5G04 J;  3CVN A;  4L1B A;  5BPP A;  5AN8 A;  2FBN A;  2M63 A;  4J8Y A;  3UXG A;  2I1K A;  3OXL A;  4TV3 A;  3TWS A;  4ABN A;  3UTM A;  3GYZ A;  4CGW A;  4KZ0 A;  5LCW C;  3AU4 A;  3DEO A;  4EPZ A;  4BY6 A;  1BPO A;  1E8W A;  1TJC A;  3FEX A;  3MKQ A;  4XX5 A;  2OOE A;  3G2U A;  3HVE A;  4G25 A;  2F8Y A;  2DCP A;  5EDS A;  3MV2 B;  1RZ4 A;  3C5R A;  4J8S A;  3L08 A;  3IEG A;  1HG5 A;  3UKR G;  2DYR E;  2GRL A;  3C3Q A;  1DCQ A;  4N39 A;  4IN3 B;  4MS6 A;  2CG3 A;  2WXM A;  4U0U A;  3DXK G;  4N5C A;  3G2W A;  2P9P G;  2YHC A;  1IXV A;  4G2V A;  2FEZ A;  3SZ7 A;  3LEW A;  3ASD A;  5T4Y A;  4LNG A;  2R03 A;  3DSV A;  3PNL B;  4UI9 J;  1H0A A;  3HYM B;  3SFX A;  3OXG A;  4DUI A;  1SA4 A;  5CCL A;  1NL4 A;  2XPZ A;  4LCT A;  4CT0 A;  3RKV A;  3NB2 A;  3X2Q E;  4XEI G;  3SF4 A;  4E85 A;  1BLX B;  1TN7 A;  4BT9 A;  3TAX A;  4XIF A;  3KEA A;  2R59 A;  2XS8 A;  3OAW A;  2R05 A;  4YVQ C;  4LG6 A;  4UQZ A;  1YMP A;  4IUL A;  5EN5 D;  4UQY A;  3QKY A;  1N94 A;  4GTS A;  1EYH A;  4WND A;  3E30 A;  3EUV A;  1O1S A;  5FZS A;  5A23 A;  3FU5 A;  1O1T A;  3UX4 A;  5JJT A;  2V8S E;  4EBA G;  4RG9 A;  3QOU A;  3L54 A;  1MQS A;  3ZYL A;  2XRZ A;  4APO A;  4AM9 A;  1KLX A;  5C2Y A;  3RIB A;  2WQ6 A;  2BF0 X;  4LUN U;  3F6Q A;  3B7S A;  4DJA A;  1MX6 A;  2GRN B;  4MKT A;  1BI7 B;  2KBX A;  4J8F A;  1BI8 B;  4GPM A;  2P9K G;  4I1O B;  5KJM A;  3HG0 D;  2NC9 A;  4U04 A;  4LNU D;  2AXV A;  2A5U A;  4GA1 A;  1WAO 1;  3RAU A;  1BD8 A;  2GRP B;  3AU5 A;  1N4P A;  5AQB A;  4CZ2 D;  5E75 A;  3FTU A;  1VDY A;  2I9C A;  5A7D B;  4F6R D;  3G2V A;  2HYZ A;  4O1P A;  1A5E A;  3G2S A;  1AP7 A;  4BX9 A;  3SHF A;  3ZXS A;  3MYV A;  5J08 A;  3O4Z A;  1DC2 A;  5ITZ F;  4B8C B;  4TXR A;  5BW8 C;  1FT1 A;  3UIP C;  5FTP A;  4F1S A;  1TR4 A;  4GZD A;  1PAQ A;  3LJ3 A;  2XZD G;  1S63 A;  4FC8 A;  1ZU2 A;  2MYO A;  1N0R A;  4WUY A;  2AWI A;  3TWV A;  4URK A;  3FUD A;  2GRQ B;  2IJG X;  2YHE A;  3Q47 B;  1D8D A;  5FZR A;  3DEP A;  3CHR A;  4DI4 A;  2WB2 A;  3FU6 A;  4B0Z A;  2PM6 A;  1QZ2 A;  1UN8 A;  3O48 A;  1X81 A;  2AXZ A;  5JHB A;  2XGO A;  3NF1 A;  2I6H A;  3HXF A;  3ULQ A;  4AVX A;  2UY1 A;  1MJ0 A;  4HI8 A;  3EHQ A;  2PQR A;  3HVE B;  4OVU A;  3W9F A;  4OYS A;  3PE4 A;  5CBO A;  3P1U A;  1P5Q A;  2WXR A;  4FLB A;  4B93 B;  2R2L A;  2QY7 A;  3ZW3 A;  4KVM A;  5FZQ A;  3E32 A;  4ACL A;  3MJW A;  1N4R A;  3Q78 A;  4Q69 A;  2H6F A;  4PS8 A;  2H6H A;  3L16 A;  4I9C A;  4XZ4 A;  5CED B;  3RRU A;  1HO8 A;  1JWG A;  1JUQ A;  4HOR A;  4C9B B;  4RQI A;  3JUE A;  5ARF A;  3I4G A;  1MX4 A;  3DSS A;  2V4L A;  3QK0 A;  4JHK A;  2L9B A;  2FO1 E;  4AXH A;  3S7F A;  5C1D A;  1OCC E;  1MX2 A;  4KVO A;  3AAA C;  4FJZ A;  3ZHE A;  3FUJ A;  3ZXP A;  2VTB A;  1HZ4 A;  3PVL A;  4I1M A;  3J5P A;  4BFR A;  3RO2 A;  3BQO A;  2VSN A;  2LSV A;  3SNX A;  3SGH A;  2V0P A;  5FIO A;  3TXM A;  4EZK A;  5FT9 A;  2X38 A;  4HS2 A;  2X6I A;  2OV8 A;  3ZUV B;  4ACK A;  2P9L G;  4A3V A;  3NAW A;  4G11 A;  3D3M A;  3FH7 A;  1HX8 A;  1SZ9 A;  2P9U G;  1SW6 A;  4M7C A;  3RJV A;  2V4H C;  1E90 A;  3HXD A;  4U63 A;  3PE3 A;  4APF A;  5ENQ D;  3DSX A;  4I9E A;  3MX3 A;  5AEN A;  1E7U A;  3TWW A;  2IO3 C;  2PNN A;  2V5Q C;  4HQD A;  4A1S A;  2KCL A;  5A6C A;  4BET A;  2WMN A;  1E96 B;  2LAI A;  5B3S E;  2VQ2 A;  4O1O A;  1RW2 A;  4A1G A;  5AIJ A;  3FH8 A;  2GRO B;  4DLQ A;  4FP7 A;  3WG7 E;  4OAV B;  3FH5 A;  3AS8 A;  2QYJ A;  2C0M A;  1DVP A;  2JEK A;  4UWF A;  2EIN E;  3ML9 A;  1ZB1 A;  3JCK C;  3PUK A;  5DIZ A;  1ELK A;  1V55 E;  3PEV B;  1K8K G;  2AXU A;  5BXU A;  2WXF A;  3S7B A;  4N5Q A;  4UWG A;  5BT1 A;  4GZ3 A;  1ELW A;  3L17 A;  1IYG A;  3IHY A;  5ENT D;  4R7L A;  4LNB A;  3CVL A;  2LSU A;  2YNQ A;  4V3I A;  3ZYK A;  1JCS A;  4F3V A;  4HI9 A;  3ASN E;  1EPU A;  4Q94 A;  1OWN A;  4BTA A;  2IO2 C;  4GTP A;  4EZJ A;  4I2W A;  5HKP A;  3APC A;  3DST A;  1N0Q A;  2KCK A;  3T9K A;  5M72 A;  4GML A;  3CKC A;  3E34 A;  5T8I A;  4HB5 A;  4HXI A;  3SBS A;  5T3R A;  2V5F A;  4GPK A;  4GMR A;  3CHO A;  4ATG A;  1YYH A;  2IQC A;  4NIK A;  3CHS A;  1TNZ A;  1K1B A;  3KAE A;  4AY6 A;  2HR2 A;  1QYM A;  1LD8 A;  4HNA D;  4WNG A;  4GMJ A;  3CVP A;  3CGH A;  3ZGQ A;  3V79 K;  2NYJ A;  4ZHB A;  3U3W A;  4Y6C A;  3S7D A;  2UY1 B;  3EIQ C;  4C48 B;  3ABM E;  4GCO A;  4CRW A;  5ENR D;  1INZ A;  3ZU7 B;  3D9J A;  1LD7 A;  4F7A A;  1NI1 A;  3C98 A;  3PZ2 A;  4GZC A;  4JHJ A;  3Q9U C;  2CHZ A;  3GW4 A;  4TUM A;  1H6O A;  3HXB A;  4AIF A;  3B7R L;  3MV3 B;  1H2V C;  3UT7 A;  2MOW A;  4GTQ A;  5AJD A;  1UJJ A;  4JB8 P;  4I17 A;  5JJ6 A;  2FO7 A;  3JUI A;  2L6B A;  4KMO A;  3HRA A;  4UI9 C;  1E8Y A;  3FP3 A;  2DIW A;  3DPY A;  4N2S A;  2ILR A;  4G1T A;  4U7E B;  4WWO A;  5BNW A;  3Q15 A;  1U3D A;  3CVX A;  5ENP D;  4WWN A;  4H7X A;  2J4D A;  4ILH B;  3SI5 A;  3Q49 B;  5KJL A;  1N4Q A;  5ENO D;  2OEV A;  4FUL A;  1H19 A;  4KT6 B;  4N3A A;  2EIK E;  3BUA A;  1UG3 A;  3PEU B;  4G24 A;  3L9T A;  4GTM A;  4I43 A;  1WG0 A;  3R9M A;  3KSQ A;  3ZHE B;  4KYO B;  4QFV A;  3CVU A;  4Y6W A;  2ETA A;  2VTB B;  1HS6 A;  1K3Z D;  2IOS A;  2BTD A;  3QAQ A;  3GZ1 A;  2RFA A;  4BT8 A;  3D9K A;  3PS6 A;  4YVO A;  2LNI A;  4MRU A;  1FVF A;  1H6P A;  5FJY A;  1OWP A;  3Q7A A;  4O6F A;  4I2Z A;  5CER B;  2QZA A;  3LKU A;  2VYI A;  2IF4 A;  3FUL A;  5AAR A;  2L0T B;  2XGS A;  3RK6 A;  3ULE G;  2BUG A;  3UMV A;  5FQ8 A;  4DRX E;  4EHM A;  3U66 A;  4HRN A;  4L7T A;  1OY3 D;  3JXI A;  3RRM B;  4JD2 G;  4PS3 A;  4UI9 K;  2NSZ A;  4CEM A;  2X6H A;  4B94 A;  3GZ2 A;  3CSF A;  3RU0 A;  4DX5 D;  2LAH A;  4X8Q A;  1K1A A;  3D9I A;  5EKQ D;  3ASO E;  3PZ3 A;  2R5S A;  1SA5 A;  3MZL B;  2CFU A;  4ANX A;  2FUL A;  3HIZ A;  2ZXW E;  4DI3 A;  2I2O A;  2OCC E;  3NZU A;  4BSZ B;  1N11 A;  2CG2 A;  2L0I A;  2EQX A;  4U0Z A;  3BG1 B;  2P9S G;  5LX8 A;  3CVY A;  2RFM A;  1H2U A;  3FDH A;  3RSE G;  4O60 A;  1WDY A;  5ANR A;  2PQN A;  4GTT A;  1EDU A;  5G55 A;  4N3C A;  3V31 A;  4FHK A;  3CHP A;  4NAC A;  2XPY A;  4GTV A;  3ZNG A;  3Q79 A;  4DX7 D;  4F1P A;  4UWL A;  1G3N B;  3UM1 A;  3AG3 E;  3Q75 A;  3KSL A;  4XI9 A;  2Q7F A;  4UWH A;  5CCM A;  3D9N A;  2J8S D;  2MHK A;  2EIL E;  3AS5 A;  5BV1 A;  4NRH B;  2WXP A;  2PM7 A;  4EBA A;  1SVX A;  1NFI E;  2Y3A A;  4G26 A;  5ANL A;  5HI7 A;  3NBN B;  3NOG D;  2ZGG A;  4WNE A;  1IHG A;  2B0O E;  2VSO E;  2BED A;  3R7Q A;  2AVP A;  3I5P A;  3T5V A;  4L2Y A;  2DVW A;  1W3B A;  4ILG A;  2EIJ E;  5D0Q D;  1MYO A;  1OXJ A;  3PRZ A;  3ML8 A;  4NQ0 A;  2DYS E;  2J49 A;  2KZT A;  3FUI A;  4HVB A;  3Q4A B;  4AOF A;  3CLJ A;  1S70 B;  4J7W A;  2GRM A;  3B95 A;  4U95 D;  2J08 A;  4DX6 D;  3UQ3 A;  5BXO A;  2Y1L E;  2Y4T A;  3NZS A;  1HF8 A;  1V54 E;  2IFU A;  4RSY A;  3DXM G;  5AJL A;  1S0P A;  2NXP A;  3FU3 A;  4ZFH A;  3QDN A;  2VJ8 A;  2DWZ A;  1QBQ A;  2KXP C;  3JXJ A;  4BER A;  3DPD A;  4WAF A;  3EU9 A;  1OCR E;  2EIM E;  2X6F A;  3HXC A;  3DSW A;  3LY8 A;  4BES A;  1LF8 A;  4AP2 A;  5KWD A;  3EHM A;  4HOS A;  4Z68 A;  2BKG A;  5EYL A;  3ESL A;  1KPS B;  5G05 J;  2CHX A;  2WMO A;  5EIL A;  1S64 A;  5EX0 A;  4JHR A;  3AG2 E;  3IBE A;  3RRN B;  4JEU A;  4DX2 A;  5BUZ A;  3Q7F A;  3EIJ A;  5B1A E;  3U4T A;  1DNP A;  4I6G A;  1NA3 A;  4UUC A;  1XGW A;  4I1A A;  3ISM C;  2KCV A;  5AYW D;  5JA4 D;  2ZIR A;  2GRR B;  2F0Y A;  1ZBP A;  2JLB A;  2AW6 A;  2C0L A;  5D0O D;  1MZC A;  4RLY A;  4FHJ A;  2WXK A;  2P9I G;  4B8A A;  4WWP A;  3DSU A;  4XKB A;  2HE0 A;  2WQ7 A;  1N95 A;  2HM8 A;  2XGM A;  3J5Q B;  3FTY A;  3ZYM A;  1UOH A;  1IQR A;  4TRQ A;  2C2L A;  3ASF A;  3ZIM A;  3JYS A;  5JJ7 A;  3CHM A;  4DPR A;  5KCM A;  4H7Y A;  2WXL A;  4YND A;  3T8K A;  3N71 A;  4PS7 A;  4BTB A;  4MLP A;  3Q73 A;  4A55 A;  5CMY A;  1L5J A;  1OWM A;  5HS0 A;  3TL5 A;  5KJK A;  5BV0 A;  1UJK A;  1Z3X A;  1TNY A;  4G8K A;  1OWO A;  4F53 A;  4UQX A;  3QAR A;  3ULY A;  4A63 B;  3E37 A;  1KT1 A;  4CT4 A;  1Y8M A;  5CMW A;  2I1J A;  5ENN A;  4DX1 A;  3HDX A;  3NQP A;  4K5C A;  3LVQ E;  1N4S A;  1N54 A;  2QFC A;  3MA5 A;  4KZC A;  3TXN A;  1H6K A;  2OVB A;  2VGE A;  3ONK A;  4YDY A;  2J4B A;  2XHE A;  5IY5 E;  4ANV A;  2E2E A;  2KM4 A;  4ANU A;  4TUU A;  3ENE A;  4N3B A;  3PZ1 A;  2XEH A;  3FTZ A;  1H2T C;  4YDE A;  3HXE A;  3QWW A;  1Y6I A;  5EX3 A;  3LCA A;  4HOU A;  5EYP F;  2WPV A;  4U07 A;  1KT0 A;  2XPI A;  2ZIS A;  3LXU X;  3URZ A;  3EHN A;  3I4R B;  3IXE A;  3TWX A;  5G2N A;  4XKC A;  5ENS D;  3FU0 A;  1Z5S C;  1UN9 A;  3WXX A;  2WXI A;  5CRU A;  5B1B E;  4BWR A;  2YIN A;  5CRV A;  2HO1 A;  3AJI A;  4PH4 B;  3TGO A;  2UWJ G;  2DZN A;  3EJN A;  2JAB A;  5D66 A;  4UWK A;  2KZT B;  3CQC B;  3FWV A;  1OCZ E;  4U8H A;  3CK8 A;  3NOC D;  2ETC A;  2GW1 A;  1DCE A;  2VSX E;  4CGV A;  3BEE A;  3MEK A;  3QWV A;  1FVH A;  4FU3 A;  3EDT B;  2QYU A;  4E6H A;  1TJF A;  4AY5 A;  4WNF A;  3C3O A;  4GYW A;  3D9H A;  2A5E A;  3LY7 A;  3Q5M A;  2WXN A;  5DBK A;  3CIA A;  4AJW A;  3MGB A;  3KEZ A;  2R02 A;  3KS2 A;  5E76 A;  1JWF A;  2OEW A;  3E4B A;  2WXJ A;  5LCW J;  4ILI A;  3B7U X;  2ZGD A;  2F8X K;  4HRM B;  4GYO A;  4M3O A;  2VGX A;  3BG0 B;  4JL0 A;  3U64 A;  3CVQ A;  4PDX A;  2X3M A;  5KNG A;  2AJA A;  2VGY A;  2Y4U A;  4MBG A;  3CQG B;  4FA6 A;  2H6G A;  4P29 A;  2LXL A;  4GB9 A;  3TG5 A;  1D9S A;  1LTX A;  2XEE A;  3TWQ A;  2ION A;  3VTX A;  3ESK A;  1SQM A;  1N52 A;  3CHQ A;  5KNH D;  2IOL A;  3CK7 A;  2J07 A;  2KC7 A;  4C0M A;  4FAD A;  2WVI A;  3FUH A;  4KXK B;  3ASH A;  1FT2 A;  3AS4 A;  3JQ0 A;  2VSY A;  3FUE A;  2OND A;  5CEA A;  3FY4 A;  3T5X A;  1GW6 A;  2WXH A;  4K5B A;  4U8Y D;  2WXO A;  4DLO A;  3ZYQ A;  1FPP A;  4GZ6 A;  3RO3 A;  3U9W A;  4CDR A;  2ZU6 B;  3ZRH A;  4ME2 A;  4HLE A;  4TXQ A;  5HQ8 A;  3TG4 A;  3LYA A;  4RVB A;  3ABL E;  5D2M C;  4N2Q A;  2IY0 C;  3C3R A;  3SFZ A;  1SZA A;  4HRL A;  5J90 A;  3V2X A;  1AWC B;  5H7P A;  2LUH A;  1IKN D;  3D9M A;  3CR3 A;  1Z6T A;  3QNK A;  2PZI A;  4YDW A;  4ATZ D;  5HRY A;  4XI0 A;  5CHE E;  3LY9 A;  3OXF A;  3SQV A;  1TNO A;  4U8V D;  3L22 A;  5AQ7 A;  4NUR A;  4JW1 A;  4EZL A;  3QB2 A;  4GCN A;  3V30 A;  2FI7 A;  4L9P A;  2DZO A;  3I3N A;  1HG2 A;  3VTY A;  3ZN3 A;  3ABK E;  4K03 A;  3JQ1 A;  5JMN D;  2RG8 A;  3UM0 A;  3ZVV A;  4LSZ E;  3UM2 A;  3ONL A;  4Q96 A;  3PZ4 A;  3KD7 A;  2XCC A;  4I6E A;  4U96 D;  1HE8 A;  3LVR E;  1OWL A;  3UM3 A;  1TEZ A;  4GZ5 A;  3UKU G;  5FIN A;  1KZO A;  4GAA A;  2XQ0 A;  3ZEF A;  2P9N G;  4OAU C;  2PL2 A;  2BKK B;  1JPL A;  2IEJ A;  2CFZ A;  1OCO E;  4JVS A;  3BU8 A;  5AAO A;  3UIO C;  3G2T A;  4JC8 A;  4GA0 A;  2H6I A;  3AG1 E;  1E8Z A;  1YCS B;  1EF1 C;  5KBA A;  3B13 A;  3PZD A;  1WM5 A;  4PUC A;  2P2C P;  4L23 A;  1XNF A;  4G8L A;  1PY1 A;  5FWQ A;  3TWU A;  2J9Q A;  3PDN A;  4BX8 A;  4JA7 A;  4ANW A;  3EHR A;  4JZY A;  3LJN A;  3D9O A;  4J8D A;  4CDM A;  3ZFW A;  1HH8 A;  5CBN A;  2X6K A;  2XRY A;  4JEH A;  3PH0 C;  4AEZ C;  2X6J A;  5LFA A;  4W9R A;  3FUF A;  3B7T A;  3FTX A;  3LDZ A;  1JCR A;  2IU1 A;  4LEU A;  4JA9 A;  3IKO B;  2LXM A;  4GTO A;  3IV0 A;  5CEC B;  3ZKJ A;  4J6I A;  2WQH A;  3EU5 A;  4L2L A;  4HOT A;  5FQ6 A;  4K0R A;  3VLF A;  2XS1 A;  3IHV A;  1IHB A;  3P2B A;  5LOZ A;  4HBD A;  3VLD A;  3SY2 A;  1Z3Y A;  3CVV A;  2A4Z A;  2R17 C;  4GYY A;  3MKQ B;  4J8E A;  3L6A A;  5G05 C;  3DRA A;  1O5M A;  1WY6 A;  4DK5 A;  3D9L A;  1FCH A;  3UIN C;  1PC2 A;  4CDN A;  3K9I A;  3GZS A;  1E8X A;  3T8M A;  3FUN A;  4C0E A;  2GGF A;  2F37 A;  5AQA A;  1NZN A;  3QJZ A;  4FJY A;  4GU5 A;  3Q9N C;  1E7V A;  2RD0 A;  4D10 C;  5EID A;  4EQF A;  2VGX B;  1HU3 A;  4IRU A;  3SFY A;  3UT4 A;  2WXQ A;  4CCA A;  3SD5 A;  3CVW A;  3DWL G;  3CST A;  4CYM D;  4U0S A;  3L13 A;  1X5B A;  4TXP A;  2Y0B G;  4HFG A;  3R7R A;  2FF4 A;  3FTV A;  3UUX A;  3TJP A;  1NP7 A;  4K5A B;  4FLH A;  2RKK A;  2WXG A;  3FHE A;  4A3T A;  1OT8 A;  4J0U A;  4I6J A;  1HFA A;  3CKB A;  1QQE A;  1HXI A;  1TN8 A; 
#chains in the Genus database with same CATH homology
 2GRQ B;  1Z5S C;  2GRP B;  2IY0 C;  3UIO C;  2GRN B;  1KPS B;  2IO3 C;  2GRO B;  5D2M C;  3UIN C;  3UIP C;  2GRR B;  2IO2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...