3UINC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 56
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uinC00
2IY0C 2GRQB 2GROB 3UINC 2GRPB 1Z5SC 2IO2C 3UIPC 5D2MC 2IO3C 3UIOC 2GRNB 1KPSB 2GRRB
chains in the Genus database with same CATH superfamily
3BQOA 1NFIE 3DEPA 4K0RA 2WXFA 3C3RA 2KCVA 1LD7A 4CZ2D 3HXDA 3ONLA 1BI8B 2P58C 5FQ7A 3U64A 1TR4A 1OT8A 1EPUA 3SF4A 1YA0A 1OCOE 5DBKA 2XS8A 3OAWA 4GB9A 3SFZA 4MS6A 5J08A 4J6IA 3SZ7A 4F53A 3FUMA 3QJZA 3CHQA 1G3NB 4GYWA 5AENA 5JJ7A 3ULEG 1S0PA 3DEOA 4BETA 5H7PA 3R9AB 4UI9C 2I1KA 3UT7A 2X6KA 4IYPA 4NRHB 5FWQA 5ANRA 3D9NA 4E85A 4PS3A 3DWLG 2IQCA 3SBSA 5D66A 5BT1A 3MJWA 4PUCA 3PUJA 2XEHA 3B7BA 3PZ4A 5BNWA 3Q78A 4GYOA 4FULA 4CT0A 5AAOA 4ZHBA 1KZOA 1L5JA 3UX4A 2DZNA 1LD8A 2VSXE 4K03A 4TXRA 4V3IA 5G04C 3FWVA 4LSZE 1IHGA 5C1DA 3FP3A 2MRIA 5AN8A 4I6EA 1NP7A 4I9CA 3C3QA 4UI9J 3PS6A 2Y69E 4UQXA 3I5PA 4WWNA 3U3WA 4F6RD 5BUZA 3GZSA 4GTOA 4EHMA 1S63A 4EZJA 4HOTA 2I2OA 4HLLA 4BT8A 1EDUA 3TWXA 5ANLA 4R7LA 4G25A 3BU8A 2XPYA 4N2SA 3ASGA 1FVFA 1U3CA 2WM9A 4I43A 5KCMA 2WXGA 2EIJE 1UJKA 3SFXA 4JEHA 4F1PA 2RD0A 4GTMA 1YYHA 3MV3B 3HVEB 5G04J 4K5CA 3ULQA 2VGXA 1O1TA 3AS4A 3SNXA 1H2UA 4I1OB 4ILHB 3CQCB 3CVNA 4PDXA 1W3BA 1Z5SC 3DSWA 5J90A 1OY3D 1YCSB 3MV2B 4N5CA 5HKPA 3E32A 4YDEA 3U4TA 2BKGA 2VYIA 1MJ0A 3SHFA 3TJPA 2J07A 3P1UA 4C0EA 3LY9A 1K1AA 1SA4A 1JPLA 4JA7A 1EF1C 2YHCA 3KD7A 2F8XK 1NI1A 1KT0A 3UPVA 4OAVB 5KJKA 2YNQA 4JD2G 4UQZA 3KEAA 3FTVA 3BG0B 3JXJA 3ZYKA 3FDHA 4LUNU 4LNGA 4MRUA 1MZCA 3U66A 4KXKB 4FLHA 3LXUX 1HS6A 3HG0D 3ULYA 4M3OA 2WXKA 3AU4A 3TGOA 3RRUA 1Q2ZA 4DUIA 2DZOA 2ETBA 5D0QD 2YINA 3HXCA 1K8KG 2VGEA 5ARFA 3AS8A 4U0ZA 4BT9A 3RO2A 5KWDA 3L54A 3QAQA 2XQ0A 4G23A 2L6JA 2V0PA 3DSVA 3ZKJA 3MYVA 2XCCA 3MKQA 5C2YA 3FEYA 1HO8A 2HYZA 4EPZA 2R03A 3R7RA 3D9LA 3CVYA 4KBQA 4EQFA 4AXHA 4NURA 2WPVA 4N3BA 4N39A 2EIKE 3AJIA 4GZCA 5ENRD 3X2QE 3DSTA 3AS5A 4E6HA 3PZDA 2DIWA 1Y6IA 2FF4A 2AJAA 2DYSE 5FZRA 2HM8A 4WNEA 4GZ5A 1DCQA 3UKUG 2ONDA 3FU0A 4ABNA 2XZTG 3TL5A 2WXQA 4N3CA 5FQ4A 1N95A 4AP2A 5CEDB 5AQAA 1X81A 1H19A 5AQ7A 2WXNA 2EQXA 1N4QA 1EYHA 2I6HA 3KEZA 3L16A 4WWPA 3S7DA 2IOLA 2I9CA 3Q49B 3EHMA 2YHEA 4HQDA 3I3NA 1XGWA 4HFGA 4HNAD 3Q9NC 4HXIA 3UT8A 5EKQD 2X38A 3E37A 4FJZA 5ENOD 2OOEA 2AXVA 5T8IA 2CHZA 1ZU2A 4QFVA 3D9HA 4UWLA 5JHAA 4HI8A 3IBEA 4OYSA 4TXPA 2QYUA 4Y6WA 2AW6A 4O6FA 3CV0A 2BKKB 1QYMA 3CVVA 4JW1A 1PC2A 2L6BA 2WXMA 5KJLA 1NA0A 3ZXPA 3AG1E 2QY7A 3QK0A 4U63A 4YVQC 3CSFA 3NOGD 4A55A 5HQ8A 4A3VA 3B95A 2BTDA 1SQMA 1NA3A 2AXUA 1QBQA 1VDYA 3FUIA 2DBAA 3FTSA 5ENSD 3FUJA 3JXIA 1WDYA 4LRZA 2VJ8A 5BPPA 4BSZB 4JXTA 4TUMA 5CMYA 3PREA 3EHQA 4BESA 4BTBA 4ILIA 4GPKA 3FUNA 1A17A 4A3TA 3LY8A 2XENA 5BXOA 2C0LA 1JCQA 2KXPC 4B8CB 2IO2C 3I4GA 3JCKC 2XGSA 1O5MA 2GRPB 2F37A 2CFZA 3EU5A 3SBTB 1IXVA 4I17A 3SO8A 3HXFA 3CK7A 4ATGA 3K9IA 4GTTA 1OXJA 3AG2E 5JJ6A 4I2WA 4XE0A 4PH4B 1N11A 1TN8A 3UUXA 4FADA 1YMPA 4LNUD 1B89A 5G2NA 3G2SA 4A1GA 1WM5A 2DYRE 2H6GA 1S70B 2UWJG 3QWPA 2OEWA 2GRNB 1PAQA 2L0IA 4EZKA 2DCPA 3APCA 3PZ3A 3PZ2A 3TWUA 3NAWA 4I9EA 5LCWC 3UM2A 4FLBA 4KVMA 3L9TA 3HYMB 3ZUVB 3DPDA 4OVVA 3ZNGA 3CQGB 2YQ8A 1BLXB 3DSUA 4U7EB 4PS8A 2OCCE 3UM1A 3L08A 3CKBA 5CRVA 1TNOA 3L82A 2FULA 4BSXA 3CVLA 4CDMA 3V79K 5B3SE 3DXKG 1E7UA 2J4BA 1HZ4A 1MHQA 3KAEA 2XGMA 3EIJA 3OTNA 2WVIA 1E8YA 1E90A 3T9KA 4W9RA 2GRMA 1OWPA 5LCWJ 3ABME 3CHMA 2KZTB 3EJNA 2FI7A 4LERA 3V2OA 4CGVA 3ZIMA 3SGHA 5D2MC 4U04A 2FEZA 4DX6D 2HE0A 4JHKA 1UN9A 3GZ2A 4GMJA 2LAIA 2WXLA 5A7DB 1HX8A 3PUKA 3TG4A 5ENNA 4ACLA 4KVOA 4HORA 3PE3A 1LF8A 2XPZA 2CHWA 1SW6A 4I6GA 1KZPA 4BEPA 2R2LA 4G26A 2IY0C 4BX8A 4C0MA 2X6HA 4UWKA 3FTWA 3FTXA 4G2VA 2X3MA 3ESLA 5AJDA 3LYAA 5AJLA 3ML8A 3CLJA 3D9OA 4B89A 3AG3E 2IU1A 3ESKA 4YNDA 4XI9A 2WQ6A 2XHEA 3DPYA 1RZ4A 3FUDA 3PE4A 3ENEA 2ETCA 2XEEA 4URKA 1D8DA 5LFAA 1OWMA 4EBAG 2XEVA 2IFUA 2WXHA 3EHNA 1MQSA 4YDWA 5EIBE 2VTBB 2FO7A 1N4RA 3ONKA 1XNFA 4J8YA 1O1RA 1HG2A 4I1MA 1UG3A 3UQ3A 2GROB 1D9SA 4G11A 3HVEA 2R02A 4U07A 2XRZA 3EU9A 2XS1A 2V8SE 3V2XA 4OVUA 3KSQA 4KMOA 2WXJA 3DRAA 2V4LA 4ME2A 3RAUA 4Q69A 1UN8A 2P9LG 3D9MA 4N3AA 4F3VA 4A63B 3VLFA 2J09A 3RIBA 4GTQA 4HVBA 2J8SD 4UI9K 2IJGX 2VSYA 3BUAA 3CK8A 3C3OA 3FUFA 2WQHA 3HXEA 1NL4A 1E8ZA 5ITZF 4JVSA 4RQIA 4CEMA 3CHOA 2A5EA 3ABLE 3NZSA 4GZ3A 4ANXA 4X8QA 3V30A 3TWTA 4H7XA 3LVQE 3EDTB 1JUQA 4B8AA 4RVBA 2GGFA 2KCLA 3NOCD 3LY7A 4J8FA 5JA4D 2GRQB 3ZN3A 3OXLA 4IULA 4L7TA 3T5VA 4J8SA 2GRLA 3FH5A 2GRRB 5FZQA 4HRMB 4FHKA 4GCOA 3FH8A 3IEGA 2RG8A 1TNUA 1H6KA 3NB2A 4LG6A 1IYGA 3RJVA 3O4ZA 2ZIRA 3UI2A 3CVUA 3RKVA 4G8KA 4L9PA 2L0TB 2R59A 2AWIA 5G55A 3FTZA 3C72A 4GCNA 3QOUA 4MLPA 2R5SA 1HXIA 5EDSA 4AOFA 4XZ4A 1N52A 3QKYA 1ZBPA 3QNKA 1SZAA 3PDNA 4DI3A 4HOSA 1X5BA 1JWGA 1V54E 4NQ0A 2ILRA 3W9GA 3Q9UC 3APDA 3MKQB 5IY5E 5D0OD 4FU3A 5FZSA 3LDZA 4J8DA 3QARA 3QB2A 2BF0X 5ARGA 4DX1A 4KZ0A 5G05C 4DK5A 3CVPA 4WNFA 3UT4A 1NZNA 3J5QB 5FIOA 4JC8A 4Y6CA 3IHVA 5AQBA 3TWSA 3QWVA 4KYOB 2LO6A 2UY1B 1UJJA 2WMOA 4ANVA 3ZGQA 5KJNA 2NSZA 4AV7A 4ANUA 1JCRA 2XZDG 3ML9A 3RRNB 1DNPA 1ZB1A 4C9BB 3TG5A 2MHKA 2XRYA 3GW4A 2LXLA 2Y4UA 4GTVA 3ASNE 4EZLA 3CGHA 5EILA 1KT1A 1TNYA 5G05J 1JCSA 3TWRA 4GAAA 1K3ZD 3Q75A 1TJCA 3FU6A 4LCTA 5HS0A 2OVBA 2KATA 3ZPJA 3UM3A 4JZYA 3KSLA 3PRZA 2X6FA 2AXZA 3SQVA 3BEEA 1SZ9A 4IN3B 4JA9A 3Q47B 4A1SA 2E0IA 2J9QA 3APFA 3LS8A 2CG2A 3S2AA 2PNNA 3AU5A 3C98A 4K5AB 3D9JA 3ZHEB 4YVOA 5FINA 5M72A 3Q73A 4HRNA 1QNFA 2V5QC 2WXPA 2VGYA 4P29A 5B1BE 5CBOA 2A4ZA 3NZUA 4NACA 3FFLA 4XI0A 5KNGA 2QZAA 1RW2A 3J5PA 3C5RA 4O1OA 5ENQD 2IOSA 4DRXE 5FQ8A 2P9NG 3MGBA 3NQPA 3R7QA 3MEKA 1TJFA 2NC9A 5CHEE 2NYJA 1H0AA 3FY4A 2F0YA 3E4BA 3EUVA 3F6QA 3RSEG 3ZYLA 2ZGGA 4LNBA 1HF8A 4BX9A 4JEUA 4FJYA 1LTXA 4DPRA 4CCAA 2P9KG 4HRLA 4DX2A 4MKTA 3CHSA 3CVQA 2Y4TA 3Q79A 3D9IA 5EYLA 2E2EA 5FT9A 2FO1E 4ANWA 1KLXA 3FUKA 2Y3AA 4UUCA 2B0OE 5CEAA 4GPMA 3B7RL 4RLYA 2XPIA 4UWGA 3Q5MA 1HG5A 5FJYA 4U8YD 3N71A 5A23A 4I6JA 5FTPA 3CHRA 4G8LA 4CT4A 3HIZA 5DIZA 4TUUA 5T3RA 2KCKA 3FTYA 5A6CA 3HDXA 2ZU6B 4U0SA 3ASHA 1HE8A 4KT6B 4L2LA 1JWFA 4YDOA 3SFYA 4U0UA 1TN6A 2Y0BG 2IF4A 4CDRA 4I2ZA 3ABKE 1K1BA 3UKRG 3TWWA 4U95D 1BU9A 3UIPC 2V4HC 3UMVA 2PM7A 1N0QA 1OCRE 2VQ2A 2R17C 2KM4A 2QFCA 1FCHA 3KS2A 3UM0A 1N94A 3B7TA 4L23A 1H6PA 2X6JA 3R9MA 1MX6A 3EIQC 4U8VD 3Q7AA 3DSSA 3WXXA 1ELKA 3O48A 3PVLA 1Z6TA 3CK9A 4TXQA 4HI9A 2EILE 1HH8A 4BY6A 4GMRA 2P9UG 2HO1A 2KZTA 5EYPF 4AM9A 3PZ1A 2MOWA 1MX2A 3FH7A 1OWNA 2ZXWE 2NXPA 4FA6A 4APFA 4FC8A 4UWFA 3FTUA 3L13A 1FT2A 1OWLA 4RG9A 3NF1A 4G24A 2Q7FA 1WY6A 2P9PG 1D8EA 3TAXA 2J08A 4L1BA 2LUHA 2JEKA 5JMND 1FVHA 1FPPA 1IHBA 3L17A 1BPOA 4XX5A 3QDNA 4RSYA 3OXGA 1OUVA 5FQ6A 3NBNB 3L22A 2PQNA 1U3DA 1E96B 4AY6A 4G1TA 5B1AE 4GA0A 3ZXSA 4TRQA 5T4YA 4BWRA 1HFAA 2PM6A 3RU0A 5JHBA 4JPSA 2WXIA 1UOHA 3ASOE 1IQUA 3ZRHA 3PNTB 3E34A 4WAFA 4GYYA 3RRMB 3BG1B 1A5EA 1SA5A 2VTBA 3DXMG 3FUEA 4N5QA 3B13A 3TXNA 4HB5A 3ISMC 4WNGA 5AYWD 2F8YA 3RK6A 2C0MA 4CDNA 3L6AA 1H2TC 1TNBA 3LJNA 3ZEFA 4L2YA 3PH0C 2J4DA 4CGWA 3Q4AB 3ASDA 4ACKA 4F1SA 3TWQA 4LEUA 2C2LA 2H6IA 5EX3A 2LXMA 3LKUA 2IEJA 2IO3C 1U2VG 5CMWA 5LP0A 3UTMA 5ENTD 4GTSA 2OEVA 4J8EA 4FHJA 2QC9A 1Z3XA 2WXRA 3QWWA 2L9BA 3JUIA 1BD8A 3CSTA 3I4RB 4JL0A 2J49A 2VGXB 4AVXA 4Q94A 4EBAA 1V55E 4NIKA 1UW4B 3IKOB 2PZIA 1N0RA 3HHMA 4U8HA 4UQYA 2OVFA 2RKKA 3D9KA 5AIJA 4EECA 1N9AA 3T8MA 2HR2A 1TYQG 3MZLB 3FULA 4WUYA 1OWOA 3CVWA 3TWVA 3T5XA 3JQ0A 1TNZA 2EINE 5AARA 1DVPA 2AVPA 4U96D 3S7BA 2BUGA 3JUEA 4HOUA 4B94A 3LPZA 4HLEA 1MYOA 5EN5D 4JB8P 4GMLA 3UIOC 4OAUC 4IRUA 5CERB 3PNLB 4KZCA 2OV8A 5KJMA 4XKBA 3HXBA 4WWOA 4C48B 4H7YA 1WG0A 4MBGA 3UXGA 1E7VA 4GZ6A 3JYSA 3VLDA 5EX0A 3IHYA 4APOA 3T8KA 4HBDA 1INZA 3G2UA 3ZVVA 3D9PA 3D3MA 2JABA 3ASFA 2R05A 4WNDA 3EHRA 1OCCE 4J0UA 3FEXA 5BXUA 1GW6A 4TV3A 3B7SA 4AY5A 2XGOA 3LJ3A 2LSUA 3G2VA 3Q15A 4PS7A 2LAHA 2RFAA 2XCBA 4GA1A 5CRUA 2BEDA 3ZYQA 2H6FA 2KC7A 3AG4E 4AIFA 4FP7A 4CYMD 3VTYA 3DSXA 1P5QA 3ZYMA 3HRAA 1DCEA 3S7JA 4B93B 3G2TA 5E76A 3DBSA 4B0ZA 2VSNA 2UY1A 2LSVA 3RO3A 3VLEA 3G2WA 2QYJA 1QQEA 4GZDA 3E33A 3FHEA 3QC1A 3S7FA 3VTXA 1FT1A 2DVWA 3ZW3A 3ZFWA 4UWHA 2Y1LE 1PY1A 2PQRA 3MX3A 4O60A 4YDYA 4BFRA 5E75A 3V31A 2CHXA 1Z3YA 5CCLA 1WAO1 4HS2A 3CEQA 4DLQA 2ETAA 4DJAA 3SI5A 5ENPD 5HRYA 3ZU7B 2PL2A 5JJTA 3LEWA 3FU3A 3URZA 4K5BA 4XIFA 2VSOE 1TEZA 2RFMA 3ZHEA 2WMNA 1IKND 4BTAA 2V5FA 1S64A 2P9IG 5KBAA 5LOZA 4D10C 4DLOA 1MX4A 4N2QA 2X6IA 4F7AA 4XEIG 2DWZA 2ZGDA 4O1PA 5BW8C 3MCXA 5EIDA 1ELRA 3UINC 4J7WA 1ELWA 3AAAC 3TXMA 4HOQA 2ZISA 5KNHD 1Y8MA 3GZ1A 3FUHA 4AEZC 1AP7A 4GTPA 3W9FA 5LX8A 5BV0A 5BV1A 4GU5A 3MKRA 3PEVB 1N54A 1OCZE 2JLBA 4Q96A 2LNIA 2GW1A 3U9WA 5AQ9A 1HU3A 5HI7A 4JHRA 5CCMA 3CR3A 4XKCA 1DC2A 5CBNA 2P2CP 3P2BA 2M63A 3PEUB 2CFUA 3MA5A 3CKCA 1SVXA 2WB2A 3FU5A 2P9SG 4QQIA 4AJWA 3IXEA 4GTRA 3GYZA 2B6CA 4I1AA 3IV0A 4CRWA 4DX7D 3OXFA 1E8XA 3LVRE 3CVXA 4ZFHA 3JQ1A 4ILGA 3E30A 2MYOA 1O1SA 1E8WA 3SD5A 5CECB 1QZ2A 3Q7FA 3WG7E 1N4SA 3LCAA 2FBNA 2EIME 1BI7B 2WXOA 1H6OA 4DI4A 3B7UX 4M7CA 4DX5D 4JHJA 4ATZD 2I1JA 1AWCB 3CIAA 3SY2A 4BERA 2WQ7A 4GA2A 3CHPA 2KBXA 4Z68A 1KPSB 2H6HA 2CG3A 2A5UA 1H2VC 1N4PA 1TN7A 4RG6A 1IQRA 2IONA
chains in the Genus database with same CATH topology
2IY0C 2GRQB 2GROB 3UINC 2GRPB 1Z5SC 2IO2C 3UIPC 5D2MC 2IO3C 3UIOC 2GRNB 1KPSB 2GRRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY0 C;  2GRQ B;  2GRO B;  3UIN C;  2GRP B;  1Z5S C;  2IO2 C;  3UIP C;  5D2M C;  2IO3 C;  3UIO C;  2GRN B;  1KPS B;  2GRR B; 
#chains in the Genus database with same CATH topology
 3BQO A;  1NFI E;  3DEP A;  4K0R A;  2WXF A;  3C3R A;  2KCV A;  1LD7 A;  4CZ2 D;  3HXD A;  3ONL A;  1BI8 B;  2P58 C;  5FQ7 A;  3U64 A;  1TR4 A;  1OT8 A;  1EPU A;  3SF4 A;  1YA0 A;  1OCO E;  5DBK A;  2XS8 A;  3OAW A;  4GB9 A;  3SFZ A;  4MS6 A;  5J08 A;  4J6I A;  3SZ7 A;  4F53 A;  3FUM A;  3QJZ A;  3CHQ A;  1G3N B;  4GYW A;  5AEN A;  5JJ7 A;  3ULE G;  1S0P A;  3DEO A;  4BET A;  5H7P A;  3R9A B;  4UI9 C;  2I1K A;  3UT7 A;  2X6K A;  4IYP A;  4NRH B;  5FWQ A;  5ANR A;  3D9N A;  4E85 A;  4PS3 A;  3DWL G;  2IQC A;  3SBS A;  5D66 A;  5BT1 A;  3MJW A;  4PUC A;  3PUJ A;  2XEH A;  3B7B A;  3PZ4 A;  5BNW A;  3Q78 A;  4GYO A;  4FUL A;  4CT0 A;  5AAO A;  4ZHB A;  1KZO A;  1L5J A;  3UX4 A;  2DZN A;  1LD8 A;  2VSX E;  4K03 A;  4TXR A;  4V3I A;  5G04 C;  3FWV A;  4LSZ E;  1IHG A;  5C1D A;  3FP3 A;  2MRI A;  5AN8 A;  4I6E A;  1NP7 A;  4I9C A;  3C3Q A;  4UI9 J;  3PS6 A;  2Y69 E;  4UQX A;  3I5P A;  4WWN A;  3U3W A;  4F6R D;  5BUZ A;  3GZS A;  4GTO A;  4EHM A;  1S63 A;  4EZJ A;  4HOT A;  2I2O A;  4HLL A;  4BT8 A;  1EDU A;  3TWX A;  5ANL A;  4R7L A;  4G25 A;  3BU8 A;  2XPY A;  4N2S A;  3ASG A;  1FVF A;  1U3C A;  2WM9 A;  4I43 A;  5KCM A;  2WXG A;  2EIJ E;  1UJK A;  3SFX A;  4JEH A;  4F1P A;  2RD0 A;  4GTM A;  1YYH A;  3MV3 B;  3HVE B;  5G04 J;  4K5C A;  3ULQ A;  2VGX A;  1O1T A;  3AS4 A;  3SNX A;  1H2U A;  4I1O B;  4ILH B;  3CQC B;  3CVN A;  4PDX A;  1W3B A;  1Z5S C;  3DSW A;  5J90 A;  1OY3 D;  1YCS B;  3MV2 B;  4N5C A;  5HKP A;  3E32 A;  4YDE A;  3U4T A;  2BKG A;  2VYI A;  1MJ0 A;  3SHF A;  3TJP A;  2J07 A;  3P1U A;  4C0E A;  3LY9 A;  1K1A A;  1SA4 A;  1JPL A;  4JA7 A;  1EF1 C;  2YHC A;  3KD7 A;  2F8X K;  1NI1 A;  1KT0 A;  3UPV A;  4OAV B;  5KJK A;  2YNQ A;  4JD2 G;  4UQZ A;  3KEA A;  3FTV A;  3BG0 B;  3JXJ A;  3ZYK A;  3FDH A;  4LUN U;  4LNG A;  4MRU A;  1MZC A;  3U66 A;  4KXK B;  4FLH A;  3LXU X;  1HS6 A;  3HG0 D;  3ULY A;  4M3O A;  2WXK A;  3AU4 A;  3TGO A;  3RRU A;  1Q2Z A;  4DUI A;  2DZO A;  2ETB A;  5D0Q D;  2YIN A;  3HXC A;  1K8K G;  2VGE A;  5ARF A;  3AS8 A;  4U0Z A;  4BT9 A;  3RO2 A;  5KWD A;  3L54 A;  3QAQ A;  2XQ0 A;  4G23 A;  2L6J A;  2V0P A;  3DSV A;  3ZKJ A;  3MYV A;  2XCC A;  3MKQ A;  5C2Y A;  3FEY A;  1HO8 A;  2HYZ A;  4EPZ A;  2R03 A;  3R7R A;  3D9L A;  3CVY A;  4KBQ A;  4EQF A;  4AXH A;  4NUR A;  2WPV A;  4N3B A;  4N39 A;  2EIK E;  3AJI A;  4GZC A;  5ENR D;  3X2Q E;  3DST A;  3AS5 A;  4E6H A;  3PZD A;  2DIW A;  1Y6I A;  2FF4 A;  2AJA A;  2DYS E;  5FZR A;  2HM8 A;  4WNE A;  4GZ5 A;  1DCQ A;  3UKU G;  2OND A;  3FU0 A;  4ABN A;  2XZT G;  3TL5 A;  2WXQ A;  4N3C A;  5FQ4 A;  1N95 A;  4AP2 A;  5CED B;  5AQA A;  1X81 A;  1H19 A;  5AQ7 A;  2WXN A;  2EQX A;  1N4Q A;  1EYH A;  2I6H A;  3KEZ A;  3L16 A;  4WWP A;  3S7D A;  2IOL A;  2I9C A;  3Q49 B;  3EHM A;  2YHE A;  4HQD A;  3I3N A;  1XGW A;  4HFG A;  4HNA D;  3Q9N C;  4HXI A;  3UT8 A;  5EKQ D;  2X38 A;  3E37 A;  4FJZ A;  5ENO D;  2OOE A;  2AXV A;  5T8I A;  2CHZ A;  1ZU2 A;  4QFV A;  3D9H A;  4UWL A;  5JHA A;  4HI8 A;  3IBE A;  4OYS A;  4TXP A;  2QYU A;  4Y6W A;  2AW6 A;  4O6F A;  3CV0 A;  2BKK B;  1QYM A;  3CVV A;  4JW1 A;  1PC2 A;  2L6B A;  2WXM A;  5KJL A;  1NA0 A;  3ZXP A;  3AG1 E;  2QY7 A;  3QK0 A;  4U63 A;  4YVQ C;  3CSF A;  3NOG D;  4A55 A;  5HQ8 A;  4A3V A;  3B95 A;  2BTD A;  1SQM A;  1NA3 A;  2AXU A;  1QBQ A;  1VDY A;  3FUI A;  2DBA A;  3FTS A;  5ENS D;  3FUJ A;  3JXI A;  1WDY A;  4LRZ A;  2VJ8 A;  5BPP A;  4BSZ B;  4JXT A;  4TUM A;  5CMY A;  3PRE A;  3EHQ A;  4BES A;  4BTB A;  4ILI A;  4GPK A;  3FUN A;  1A17 A;  4A3T A;  3LY8 A;  2XEN A;  5BXO A;  2C0L A;  1JCQ A;  2KXP C;  4B8C B;  2IO2 C;  3I4G A;  3JCK C;  2XGS A;  1O5M A;  2GRP B;  2F37 A;  2CFZ A;  3EU5 A;  3SBT B;  1IXV A;  4I17 A;  3SO8 A;  3HXF A;  3CK7 A;  4ATG A;  3K9I A;  4GTT A;  1OXJ A;  3AG2 E;  5JJ6 A;  4I2W A;  4XE0 A;  4PH4 B;  1N11 A;  1TN8 A;  3UUX A;  4FAD A;  1YMP A;  4LNU D;  1B89 A;  5G2N A;  3G2S A;  4A1G A;  1WM5 A;  2DYR E;  2H6G A;  1S70 B;  2UWJ G;  3QWP A;  2OEW A;  2GRN B;  1PAQ A;  2L0I A;  4EZK A;  2DCP A;  3APC A;  3PZ3 A;  3PZ2 A;  3TWU A;  3NAW A;  4I9E A;  5LCW C;  3UM2 A;  4FLB A;  4KVM A;  3L9T A;  3HYM B;  3ZUV B;  3DPD A;  4OVV A;  3ZNG A;  3CQG B;  2YQ8 A;  1BLX B;  3DSU A;  4U7E B;  4PS8 A;  2OCC E;  3UM1 A;  3L08 A;  3CKB A;  5CRV A;  1TNO A;  3L82 A;  2FUL A;  4BSX A;  3CVL A;  4CDM A;  3V79 K;  5B3S E;  3DXK G;  1E7U A;  2J4B A;  1HZ4 A;  1MHQ A;  3KAE A;  2XGM A;  3EIJ A;  3OTN A;  2WVI A;  1E8Y A;  1E90 A;  3T9K A;  4W9R A;  2GRM A;  1OWP A;  5LCW J;  3ABM E;  3CHM A;  2KZT B;  3EJN A;  2FI7 A;  4LER A;  3V2O A;  4CGV A;  3ZIM A;  3SGH A;  5D2M C;  4U04 A;  2FEZ A;  4DX6 D;  2HE0 A;  4JHK A;  1UN9 A;  3GZ2 A;  4GMJ A;  2LAI A;  2WXL A;  5A7D B;  1HX8 A;  3PUK A;  3TG4 A;  5ENN A;  4ACL A;  4KVO A;  4HOR A;  3PE3 A;  1LF8 A;  2XPZ A;  2CHW A;  1SW6 A;  4I6G A;  1KZP A;  4BEP A;  2R2L A;  4G26 A;  2IY0 C;  4BX8 A;  4C0M A;  2X6H A;  4UWK A;  3FTW A;  3FTX A;  4G2V A;  2X3M A;  3ESL A;  5AJD A;  3LYA A;  5AJL A;  3ML8 A;  3CLJ A;  3D9O A;  4B89 A;  3AG3 E;  2IU1 A;  3ESK A;  4YND A;  4XI9 A;  2WQ6 A;  2XHE A;  3DPY A;  1RZ4 A;  3FUD A;  3PE4 A;  3ENE A;  2ETC A;  2XEE A;  4URK A;  1D8D A;  5LFA A;  1OWM A;  4EBA G;  2XEV A;  2IFU A;  2WXH A;  3EHN A;  1MQS A;  4YDW A;  5EIB E;  2VTB B;  2FO7 A;  1N4R A;  3ONK A;  1XNF A;  4J8Y A;  1O1R A;  1HG2 A;  4I1M A;  1UG3 A;  3UQ3 A;  2GRO B;  1D9S A;  4G11 A;  3HVE A;  2R02 A;  4U07 A;  2XRZ A;  3EU9 A;  2XS1 A;  2V8S E;  3V2X A;  4OVU A;  3KSQ A;  4KMO A;  2WXJ A;  3DRA A;  2V4L A;  4ME2 A;  3RAU A;  4Q69 A;  1UN8 A;  2P9L G;  3D9M A;  4N3A A;  4F3V A;  4A63 B;  3VLF A;  2J09 A;  3RIB A;  4GTQ A;  4HVB A;  2J8S D;  4UI9 K;  2IJG X;  2VSY A;  3BUA A;  3CK8 A;  3C3O A;  3FUF A;  2WQH A;  3HXE A;  1NL4 A;  1E8Z A;  5ITZ F;  4JVS A;  4RQI A;  4CEM A;  3CHO A;  2A5E A;  3ABL E;  3NZS A;  4GZ3 A;  4ANX A;  4X8Q A;  3V30 A;  3TWT A;  4H7X A;  3LVQ E;  3EDT B;  1JUQ A;  4B8A A;  4RVB A;  2GGF A;  2KCL A;  3NOC D;  3LY7 A;  4J8F A;  5JA4 D;  2GRQ B;  3ZN3 A;  3OXL A;  4IUL A;  4L7T A;  3T5V A;  4J8S A;  2GRL A;  3FH5 A;  2GRR B;  5FZQ A;  4HRM B;  4FHK A;  4GCO A;  3FH8 A;  3IEG A;  2RG8 A;  1TNU A;  1H6K A;  3NB2 A;  4LG6 A;  1IYG A;  3RJV A;  3O4Z A;  2ZIR A;  3UI2 A;  3CVU A;  3RKV A;  4G8K A;  4L9P A;  2L0T B;  2R59 A;  2AWI A;  5G55 A;  3FTZ A;  3C72 A;  4GCN A;  3QOU A;  4MLP A;  2R5S A;  1HXI A;  5EDS A;  4AOF A;  4XZ4 A;  1N52 A;  3QKY A;  1ZBP A;  3QNK A;  1SZA A;  3PDN A;  4DI3 A;  4HOS A;  1X5B A;  1JWG A;  1V54 E;  4NQ0 A;  2ILR A;  3W9G A;  3Q9U C;  3APD A;  3MKQ B;  5IY5 E;  5D0O D;  4FU3 A;  5FZS A;  3LDZ A;  4J8D A;  3QAR A;  3QB2 A;  2BF0 X;  5ARG A;  4DX1 A;  4KZ0 A;  5G05 C;  4DK5 A;  3CVP A;  4WNF A;  3UT4 A;  1NZN A;  3J5Q B;  5FIO A;  4JC8 A;  4Y6C A;  3IHV A;  5AQB A;  3TWS A;  3QWV A;  4KYO B;  2LO6 A;  2UY1 B;  1UJJ A;  2WMO A;  4ANV A;  3ZGQ A;  5KJN A;  2NSZ A;  4AV7 A;  4ANU A;  1JCR A;  2XZD G;  3ML9 A;  3RRN B;  1DNP A;  1ZB1 A;  4C9B B;  3TG5 A;  2MHK A;  2XRY A;  3GW4 A;  2LXL A;  2Y4U A;  4GTV A;  3ASN E;  4EZL A;  3CGH A;  5EIL A;  1KT1 A;  1TNY A;  5G05 J;  1JCS A;  3TWR A;  4GAA A;  1K3Z D;  3Q75 A;  1TJC A;  3FU6 A;  4LCT A;  5HS0 A;  2OVB A;  2KAT A;  3ZPJ A;  3UM3 A;  4JZY A;  3KSL A;  3PRZ A;  2X6F A;  2AXZ A;  3SQV A;  3BEE A;  1SZ9 A;  4IN3 B;  4JA9 A;  3Q47 B;  4A1S A;  2E0I A;  2J9Q A;  3APF A;  3LS8 A;  2CG2 A;  3S2A A;  2PNN A;  3AU5 A;  3C98 A;  4K5A B;  3D9J A;  3ZHE B;  4YVO A;  5FIN A;  5M72 A;  3Q73 A;  4HRN A;  1QNF A;  2V5Q C;  2WXP A;  2VGY A;  4P29 A;  5B1B E;  5CBO A;  2A4Z A;  3NZU A;  4NAC A;  3FFL A;  4XI0 A;  5KNG A;  2QZA A;  1RW2 A;  3J5P A;  3C5R A;  4O1O A;  5ENQ D;  2IOS A;  4DRX E;  5FQ8 A;  2P9N G;  3MGB A;  3NQP A;  3R7Q A;  3MEK A;  1TJF A;  2NC9 A;  5CHE E;  2NYJ A;  1H0A A;  3FY4 A;  2F0Y A;  3E4B A;  3EUV A;  3F6Q A;  3RSE G;  3ZYL A;  2ZGG A;  4LNB A;  1HF8 A;  4BX9 A;  4JEU A;  4FJY A;  1LTX A;  4DPR A;  4CCA A;  2P9K G;  4HRL A;  4DX2 A;  4MKT A;  3CHS A;  3CVQ A;  2Y4T A;  3Q79 A;  3D9I A;  5EYL A;  2E2E A;  5FT9 A;  2FO1 E;  4ANW A;  1KLX A;  3FUK A;  2Y3A A;  4UUC A;  2B0O E;  5CEA A;  4GPM A;  3B7R L;  4RLY A;  2XPI A;  4UWG A;  3Q5M A;  1HG5 A;  5FJY A;  4U8Y D;  3N71 A;  5A23 A;  4I6J A;  5FTP A;  3CHR A;  4G8L A;  4CT4 A;  3HIZ A;  5DIZ A;  4TUU A;  5T3R A;  2KCK A;  3FTY A;  5A6C A;  3HDX A;  2ZU6 B;  4U0S A;  3ASH A;  1HE8 A;  4KT6 B;  4L2L A;  1JWF A;  4YDO A;  3SFY A;  4U0U A;  1TN6 A;  2Y0B G;  2IF4 A;  4CDR A;  4I2Z A;  3ABK E;  1K1B A;  3UKR G;  3TWW A;  4U95 D;  1BU9 A;  3UIP C;  2V4H C;  3UMV A;  2PM7 A;  1N0Q A;  1OCR E;  2VQ2 A;  2R17 C;  2KM4 A;  2QFC A;  1FCH A;  3KS2 A;  3UM0 A;  1N94 A;  3B7T A;  4L23 A;  1H6P A;  2X6J A;  3R9M A;  1MX6 A;  3EIQ C;  4U8V D;  3Q7A A;  3DSS A;  3WXX A;  1ELK A;  3O48 A;  3PVL A;  1Z6T A;  3CK9 A;  4TXQ A;  4HI9 A;  2EIL E;  1HH8 A;  4BY6 A;  4GMR A;  2P9U G;  2HO1 A;  2KZT A;  5EYP F;  4AM9 A;  3PZ1 A;  2MOW A;  1MX2 A;  3FH7 A;  1OWN A;  2ZXW E;  2NXP A;  4FA6 A;  4APF A;  4FC8 A;  4UWF A;  3FTU A;  3L13 A;  1FT2 A;  1OWL A;  4RG9 A;  3NF1 A;  4G24 A;  2Q7F A;  1WY6 A;  2P9P G;  1D8E A;  3TAX A;  2J08 A;  4L1B A;  2LUH A;  2JEK A;  5JMN D;  1FVH A;  1FPP A;  1IHB A;  3L17 A;  1BPO A;  4XX5 A;  3QDN A;  4RSY A;  3OXG A;  1OUV A;  5FQ6 A;  3NBN B;  3L22 A;  2PQN A;  1U3D A;  1E96 B;  4AY6 A;  4G1T A;  5B1A E;  4GA0 A;  3ZXS A;  4TRQ A;  5T4Y A;  4BWR A;  1HFA A;  2PM6 A;  3RU0 A;  5JHB A;  4JPS A;  2WXI A;  1UOH A;  3ASO E;  1IQU A;  3ZRH A;  3PNT B;  3E34 A;  4WAF A;  4GYY A;  3RRM B;  3BG1 B;  1A5E A;  1SA5 A;  2VTB A;  3DXM G;  3FUE A;  4N5Q A;  3B13 A;  3TXN A;  4HB5 A;  3ISM C;  4WNG A;  5AYW D;  2F8Y A;  3RK6 A;  2C0M A;  4CDN A;  3L6A A;  1H2T C;  1TNB A;  3LJN A;  3ZEF A;  4L2Y A;  3PH0 C;  2J4D A;  4CGW A;  3Q4A B;  3ASD A;  4ACK A;  4F1S A;  3TWQ A;  4LEU A;  2C2L A;  2H6I A;  5EX3 A;  2LXM A;  3LKU A;  2IEJ A;  2IO3 C;  1U2V G;  5CMW A;  5LP0 A;  3UTM A;  5ENT D;  4GTS A;  2OEV A;  4J8E A;  4FHJ A;  2QC9 A;  1Z3X A;  2WXR A;  3QWW A;  2L9B A;  3JUI A;  1BD8 A;  3CST A;  3I4R B;  4JL0 A;  2J49 A;  2VGX B;  4AVX A;  4Q94 A;  4EBA A;  1V55 E;  4NIK A;  1UW4 B;  3IKO B;  2PZI A;  1N0R A;  3HHM A;  4U8H A;  4UQY A;  2OVF A;  2RKK A;  3D9K A;  5AIJ A;  4EEC A;  1N9A A;  3T8M A;  2HR2 A;  1TYQ G;  3MZL B;  3FUL A;  4WUY A;  1OWO A;  3CVW A;  3TWV A;  3T5X A;  3JQ0 A;  1TNZ A;  2EIN E;  5AAR A;  1DVP A;  2AVP A;  4U96 D;  3S7B A;  2BUG A;  3JUE A;  4HOU A;  4B94 A;  3LPZ A;  4HLE A;  1MYO A;  5EN5 D;  4JB8 P;  4GML A;  3UIO C;  4OAU C;  4IRU A;  5CER B;  3PNL B;  4KZC A;  2OV8 A;  5KJM A;  4XKB A;  3HXB A;  4WWO A;  4C48 B;  4H7Y A;  1WG0 A;  4MBG A;  3UXG A;  1E7V A;  4GZ6 A;  3JYS A;  3VLD A;  5EX0 A;  3IHY A;  4APO A;  3T8K A;  4HBD A;  1INZ A;  3G2U A;  3ZVV A;  3D9P A;  3D3M A;  2JAB A;  3ASF A;  2R05 A;  4WND A;  3EHR A;  1OCC E;  4J0U A;  3FEX A;  5BXU A;  1GW6 A;  4TV3 A;  3B7S A;  4AY5 A;  2XGO A;  3LJ3 A;  2LSU A;  3G2V A;  3Q15 A;  4PS7 A;  2LAH A;  2RFA A;  2XCB A;  4GA1 A;  5CRU A;  2BED A;  3ZYQ A;  2H6F A;  2KC7 A;  3AG4 E;  4AIF A;  4FP7 A;  4CYM D;  3VTY A;  3DSX A;  1P5Q A;  3ZYM A;  3HRA A;  1DCE A;  3S7J A;  4B93 B;  3G2T A;  5E76 A;  3DBS A;  4B0Z A;  2VSN A;  2UY1 A;  2LSV A;  3RO3 A;  3VLE A;  3G2W A;  2QYJ A;  1QQE A;  4GZD A;  3E33 A;  3FHE A;  3QC1 A;  3S7F A;  3VTX A;  1FT1 A;  2DVW A;  3ZW3 A;  3ZFW A;  4UWH A;  2Y1L E;  1PY1 A;  2PQR A;  3MX3 A;  4O60 A;  4YDY A;  4BFR A;  5E75 A;  3V31 A;  2CHX A;  1Z3Y A;  5CCL A;  1WAO 1;  4HS2 A;  3CEQ A;  4DLQ A;  2ETA A;  4DJA A;  3SI5 A;  5ENP D;  5HRY A;  3ZU7 B;  2PL2 A;  5JJT A;  3LEW A;  3FU3 A;  3URZ A;  4K5B A;  4XIF A;  2VSO E;  1TEZ A;  2RFM A;  3ZHE A;  2WMN A;  1IKN D;  4BTA A;  2V5F A;  1S64 A;  2P9I G;  5KBA A;  5LOZ A;  4D10 C;  4DLO A;  1MX4 A;  4N2Q A;  2X6I A;  4F7A A;  4XEI G;  2DWZ A;  2ZGD A;  4O1P A;  5BW8 C;  3MCX A;  5EID A;  1ELR A;  3UIN C;  4J7W A;  1ELW A;  3AAA C;  3TXM A;  4HOQ A;  2ZIS A;  5KNH D;  1Y8M A;  3GZ1 A;  3FUH A;  4AEZ C;  1AP7 A;  4GTP A;  3W9F A;  5LX8 A;  5BV0 A;  5BV1 A;  4GU5 A;  3MKR A;  3PEV B;  1N54 A;  1OCZ E;  2JLB A;  4Q96 A;  2LNI A;  2GW1 A;  3U9W A;  5AQ9 A;  1HU3 A;  5HI7 A;  4JHR A;  5CCM A;  3CR3 A;  4XKC A;  1DC2 A;  5CBN A;  2P2C P;  3P2B A;  2M63 A;  3PEU B;  2CFU A;  3MA5 A;  3CKC A;  1SVX A;  2WB2 A;  3FU5 A;  2P9S G;  4QQI A;  4AJW A;  3IXE A;  4GTR A;  3GYZ A;  2B6C A;  4I1A A;  3IV0 A;  4CRW A;  4DX7 D;  3OXF A;  1E8X A;  3LVR E;  3CVX A;  4ZFH A;  3JQ1 A;  4ILG A;  3E30 A;  2MYO A;  1O1S A;  1E8W A;  3SD5 A;  5CEC B;  1QZ2 A;  3Q7F A;  3WG7 E;  1N4S A;  3LCA A;  2FBN A;  2EIM E;  1BI7 B;  2WXO A;  1H6O A;  4DI4 A;  3B7U X;  4M7C A;  4DX5 D;  4JHJ A;  4ATZ D;  2I1J A;  1AWC B;  3CIA A;  3SY2 A;  4BER A;  2WQ7 A;  4GA2 A;  3CHP A;  2KBX A;  4Z68 A;  1KPS B;  2H6H A;  2CG3 A;  2A5U A;  1H2V C;  1N4P A;  1TN7 A;  4RG6 A;  1IQR A;  2ION A; 
#chains in the Genus database with same CATH homology
 2IY0 C;  2GRQ B;  2GRO B;  3UIN C;  2GRP B;  1Z5S C;  2IO2 C;  3UIP C;  5D2M C;  2IO3 C;  3UIO C;  2GRN B;  1KPS B;  2GRR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...