3UINC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 56
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uinC00
1Z5SC 5D2MC 2IO3C 2GRRB 2IY0C 3UINC 1KPSB 2GRQB 3UIOC 2IO2C 2GRNB 3UIPC 2GROB 2GRPB
chains in the Genus database with same CATH superfamily
5FJYA 4ACLA 1Z3XA 3SZ7A 1U2VG 1N9AA 5B1AE 4B93B 4OVUA 2HYZA 4RLYA 3RRUA 3ONLA 4GYYA 2AXZA 4AVXA 4CEMA 5C1DA 3KSLA 1K3ZD 1FPPA 3Q15A 3CSTA 2R02A 5HRYA 3ULYA 1TR4A 3E30A 2DYRE 2F8YA 4JXTA 3PE3A 2Y0BG 3QAQA 1NA0A 3FTYA 3CVVA 3CVXA 3SBTB 3D9LA 3UKRG 3O4ZA 3DBSA 4DK5A 4E85A 3AG2E 3G2WA 5JMND 1HS6A 3CKBA 3FUIA 4I1AA 1N4RA 3B7UX 4KT6B 3QJZA 4ATGA 4OYSA 3E4BA 2C0LA 4J8YA 2WQ7A 4U0SA 2J08A 3ASHA 1IHGA 3Q5MA 5KJLA 4L9PA 4RG9A 2R2LA 4TUMA 1MZCA 2VJ8A 5JHAA 4K0RA 5FQ4A 1E7VA 1OWLA 2F8XK 2P9IG 4U8YD 1HX8A 1K1AA 3EHMA 1FT1A 5AENA 2BEDA 3MKQA 1IYGA 2ZU6B 4ME2A 4JPSA 3RK6A 1IXVA 4K5CA 3BUAA 1IQUA 5FWQA 4HLLA 4ACKA 2HO1A 4N3AA 5BUZA 3FUNA 3FEYA 1X81A 2WXHA 4EBAA 5CCLA 2ONDA 1HO8A 4YDOA 2XCCA 4C0MA 3OTNA 5FIOA 4YNDA 3R7QA 1S70B 4U07A 3LXUX 4YDYA 3ULEG 4GZ6A 4ZHBA 5ENTD 3DPYA 3HG0D 1D8EA 4LNGA 4PS8A 3EJNA 4ATZD 3QWVA 1OT8A 5AYWD 1HH8A 4CGVA 2XGMA 5BXOA 4JB8P 1LF8A 4UQZA 1E96B 3NZUA 2GW1A 2VGEA 4A3VA 4JD2G 4G23A 3ZYMA 1N52A 3CVLA 4JL0A 1FCHA 4CDMA 3L22A 4B89A 2P9PG 2P2CP 5KWDA 1NI1A 4J8SA 2IEJA 4XIFA 4DI4A 1TJFA 3AJIA 3IHYA 4GTMA 1TNBA 3ASOE 2JABA 4FHJA 1LD7A 2C2LA 3PEVB 3NB2A 3UTMA 2MHKA 4FLBA 5FT9A 3QK0A 1D9SA 3EIJA 4U95D 4TXRA 4LCTA 4UWKA 4KYOB 4U63A 2KM4A 3ASNE 1KZPA 5FZSA 2A5UA 3BG0B 3DEPA 3AS4A 3FUHA 4CGWA 4GCNA 5EKQD 4GZ5A 1MQSA 3ESKA 1E8YA 5AQ9A 4GTTA 1OY3D 1ELRA 2R5SA 4BX8A 3LDZA 3RAUA 5AJDA 3UM1A 3PEUB 1IKND 2L0IA 3ZXPA 1AWCB 2ZGDA 3ZEFA 2IFUA 4G11A 2ZIRA 1SQMA 1E8WA 2J9QA 3TWXA 2WXMA 4IRUA 3UXGA 3HVEA 1IHBA 1EF1C 4A3TA 1KT0A 4I6JA 4TV3A 4ANXA 4HVBA 1N11A 3MZLB 3MJWA 5KJKA 2VYIA 1S63A 4M3OA 4G8KA 3PVLA 4ILGA 5JJ7A 1TNUA 3E34A 4URKA 2QYUA 3CVWA 3JCKC 2IU1A 4MKTA 3OXFA 3TAXA 3CHMA 2BKGA 4L1BA 3T8MA 3L54A 5FQ6A 3CVYA 2OVBA 3ML8A 3OAWA 1H2UA 3FWVA 3AG3E 3LVRE 3TWVA 1NZNA 1YYHA 5CERB 4G1TA 3AAAC 2XRZA 4RQIA 3HRAA 4EPZA 3TXNA 2DWZA 3UKUG 3LJ3A 4GYWA 3HIZA 4DUIA 2LO6A 4HLEA 3EDTB 3SF4A 3VLDA 3Q7AA 1SA5A 4C9BB 2HM8A 1L5JA 3T9KA 2EIME 3FU0A 5FZQA 2WVIA 3PS6A 3ABLE 5BXUA 1A5EA 2QYJA 4LERA 1BD8A 3QNKA 4CT0A 1TNYA 5AARA 2H6FA 3VLFA 3RU0A 4EQFA 4K03A 1OCZE 4F7AA 4I9CA 3SO8A 3CV0A 3P1UA 1H2VC 5DIZA 5H7PA 2WXPA 3CEQA 3JXJA 3IV0A 4BY6A 3RJVA 1TJCA 3FUEA 3CR3A 3TWQA 2YNQA 4LUNU 4IN3B 4F1PA 3G2UA 5C2YA 2P9LG 4XI9A 1P5QA 3RKVA 2V5FA 4WNDA 4HOSA 3FFLA 1HG2A 3ZU7B 3SBSA 4DLQA 5A6CA 3FU6A 4L2YA 2WM9A 3L13A 3EHNA 4KBQA 1OWOA 3L9TA 1BPOA 4N2SA 4I43A 2PNNA 4CYMD 4ZFHA 3CVQA 2KZTA 3BEEA 4DX5D 2CFUA 2MYOA 3B13A 1UOHA 3PDNA 3ASDA 2I1KA 2I2OA 1WAO1 4GAAA 3PZ2A 4GCOA 4GMLA 3DXMG 3Q4AB 2ILRA 4CCAA 3UM3A 5T8IA 4HQDA 3ONKA 3D9PA 2WXIA 2ZISA 5BV1A 3FULA 3RRMB 4BFRA 3ISMC 3Q7FA 3WXXA 2CG2A 4J8FA 3V79K 4KMOA 4GMJA 3MKRA 2R17C 1HFAA 2CHZA 2V8SE 2DYSE 3AS8A 1H6OA 4L2LA 2BUGA 3FY4A 1HF8A 3CVPA 3NBNB 3C3QA 4GTRA 5CECB 1BI8B 3KSQA 4YDEA 2I9CA 1MX4A 2F37A 3Q9UC 3SD5A 5BNWA 3NQPA 3RO2A 3UUXA 4Q69A 4U7EB 3QDNA 3GW4A 3IHVA 3U4TA 1MX6A 3JYSA 1GW6A 4LEUA 4I6GA 3NOCD 5HKPA 4AXHA 4PDXA 5KCMA 3ZN3A 3AG1E 2Y3AA 1WY6A 3ZYLA 3ML9A 4HOUA 4EZKA 1QBQA 1SW6A 2GRLA 3ZYQA 3APCA 4CZ2D 5HI7A 1JCRA 3C5RA 1WDYA 3KD7A 5CCMA 2WB2A 4KVMA 3FTVA 5JJ6A 4A1GA 3ZIMA 2DVWA 3ZNGA 3L08A 3KAEA 1AP7A 1OCCE 3QC1A 4AY5A 4D10C 3PZ1A 3PZDA 5LP0A 3QB2A 3CLJA 4LNUD 5D2MC 2FO7A 3VLEA 4ILIA 3UT8A 3UX4A 3DSSA 1N4SA 3CHQA 3S7BA 2AXVA 1EDUA 5CHEE 2WMOA 4PS7A 3FU5A 4MRUA 4XI0A 3ZXSA 1HG5A 1K8KG 1EPUA 5CRUA 5KJMA 1DC2A 3APFA 2WXOA 3CHPA 1SA4A 4NIKA 3OXLA 4AIFA 3Q78A 3UI2A 4BSZB 4CDNA 2EQXA 4DX1A 2PZIA 5CMWA 5EILA 2GGFA 4UWLA 2IOLA 5FTPA 4K5BA 5J08A 3HXFA 1OWNA 3SQVA 3QWWA 3CKCA 3TWTA 4WNFA 4FP7A 2CG3A 1BU9A 2R59A 4LSZE 4JA7A 3ZVVA 4GYOA 3UMVA 5AQ7A 4GTVA 2OOEA 1N95A 3RRNB 5E75A 4I6EA 2XQ0A 4GTQA 2PQNA 2C0MA 4GPKA 4FJZA 4A55A 2GROB 2QY7A 3SNXA 3MGBA 3T8KA 2WQHA 4N5QA 2HE0A 3Q49B 3F6QA 1B89A 2VSNA 1ZU2A 1Z3YA 3GZSA 4U96D 4BX9A 1NA3A 2J49A 2JLBA 5KNGA 4J7WA 3VTYA 1E7UA 3BQOA 5AJLA 5ANLA 3ZFWA 4GA2A 4N3CA 4LNBA 4FC8A 1OWPA 3TWWA 4TRQA 1OWMA 4P29A 3LVQE 5ANRA 1JPLA 1LTXA 2XPYA 4Y6WA 2BKKB 2H6HA 4HB5A 3C98A 3PNTB 4G8LA 5AQBA 3D9JA 3UM2A 4N2QA 4OVVA 2KCKA 4WWPA 3FH7A 3FTXA 3FUMA 4AM9A 3SFZA 3V2OA 1G3NB 4FU3A 4GZDA 2KCVA 3ZGQA 3HYMB 4AEZC 2LUHA 2LSUA 3LY8A 1Z5SC 2ZGGA 3Q79A 4G26A 1N0RA 1N94A 2P9KG 3PREA 3EHRA 5AN8A 3S2AA 3I3NA 4F6RD 4M7CA 5JHBA 1N0QA 2GRRB 2V4HC 4FA6A 3KEZA 5ENOD 3MKQB 5E76A 3AU5A 2XENA 2ETCA 3URZA 2X6FA 5FINA 4O1OA 2XZTG 4DLOA 4ANUA 5M72A 2RKKA 2PQRA 4PH4B 2OCCE 4JEHA 4UQXA 3GZ1A 4NACA 3I4RB 3DSWA 2XS8A 3JQ1A 1XGWA 2B0OE 4GTPA 1DCEA 3KEAA 2DIWA 3FUKA 4HI8A 3FH8A 1O1RA 1O1SA 3FHEA 1N54A 3G2TA 4XE0A 4GTOA 1E8XA 3ZYKA 2XHEA 1WG0A 2Y69E 4W9RA 3HHMA 2OEWA 2Q7FA 4GA1A 4APOA 2V5QC 1RW2A 4Y6CA 2MOWA 2X6IA 3KS2A 2XGOA 4BTAA 5CEAA 1PC2A 2JEKA 4L7TA 2NXPA 4U0ZA 1QNFA 2I6HA 1W3BA 4I17A 4V3IA 2NSZA 2OEVA 5B3SE 3X2QE 5EX0A 3DSTA 4HRLA 5CMYA 2J8SD 3CHRA 2GRMA 2OV8A 3UM0A 2WXRA 3L6AA 3D3MA 1SZAA 4I2ZA 2NYJA 5BT1A 4DI3A 2WMNA 5G04J 2ETBA 3G2VA 4QQIA 4ANVA 3ZHEA 3TJPA 3RIBA 3CVUA 4A63B 4H7XA 3D9KA 3DSUA 4UQYA 3TWSA 3UINC 5KBAA 5EYLA 2HR2A 4JHJA 3U64A 2RG8A 3UIOC 4JHKA 1K1BA 4B0ZA 2PM6A 1JWGA 1NP7A 3ABME 4YVOA 1Y6IA 4AOFA 5LFAA 2F0YA 3D9HA 4EZLA 1LD8A 4X8QA 2J09A 2RD0A 1H19A 4C0EA 4UI9K 4BT9A 3RO3A 3Q75A 2FO1E 3IXEA 2XEHA 4DX2A 2M63A 4OAVB 4B8AA 1TEZA 3Q73A 4BESA 2X6KA 4ABNA 4WWNA 2E0IA 4WAFA 5LCWJ 2L6BA 3UPVA 4UUCA 5A23A 3HVEB 3ZW3A 4N3BA 2V4LA 2EILE 3TG5A 4O1PA 4KVOA 2IY0C 1FVFA 1S0PA 2ETAA 2QZAA 2WPVA 4I1MA 4XKCA 2YHEA 4XKBA 3FH5A 2XEEA 2UWJG 5ENNA 1FT2A 4GPMA 5FQ7A 3D9NA 4Q96A 3L17A 3MYVA 4YDWA 5BV0A 3SFXA 1NFIE 2VTBA 3NZSA 3E33A 5ENSD 2LXLA 3U3WA 1SVXA 4GZ3A 4UWHA 2X3MA 1N4QA 1KT1A 3CSFA 3R9AB 4FULA 5AQAA 1YMPA 3D9IA 3ZPJA 5CEDB 4MBGA 4PS3A 2KC7A 2GRNB 4UWGA 3AU4A 1TN7A 3DXKG 3EIQC 4JC8A 2NC9A 3LPZA 2VGYA 3NOGD 3U9WA 3CQCB 1ELWA 3ZHEB 4U0UA 1BI7B 3TXMA 4U04A 2LNIA 3HXEA 3IBEA 4IYPA 1DCQA 2V0PA 3B7TA 3UT7A 3LY9A 3QWPA 4DX7D 5G05J 1HU3A 5JJTA 2XGSA 4LG6A 4GTSA 3EU9A 4L23A 4HORA 2XPZA 1E90A 2IONA 3JQ0A 1FVHA 4TXQA 2AXUA 2WXNA 1MYOA 2LAIA 3C3OA 3D9OA 2EINE 4Z68A 1KLXA 1V55E 3PRZA 2PM7A 3CIAA 2X6HA 4BSXA 3RSEG 1U3CA 2WXFA 4WUYA 4OAUC 2LXMA 4GA0A 5BW8C 5D0QD 5CRVA 2OVFA 4I9EA 4Q94A 3FUJA 2LAHA 4NQ0A 3FUDA 3LJNA 1Z6TA 2KZTB 3CGHA 4WNGA 1JCSA 5ENPD 4JVSA 1TN6A 1HE8A 3NAWA 5LX8A 4ILHB 3LEWA 5G04C 5EIDA 4G2VA 3FP3A 2VTBB 4IULA 2PL2A 3Q47B 5D66A 4A1SA 4HOTA 1UN8A 2DZNA 1PAQA 4CRWA 1MJ0A 2I1JA 2AVPA 4HXIA 2CHWA 3LY7A 3MA5A 3U66A 2H6GA 2RFAA 5EN5D 4AJWA 1HXIA 4FJYA 3PZ4A 1N4PA 3R9MA 3BG1B 1UN9A 4F1SA 1UJJA 4HBDA 3B7SA 3APDA 1TN8A 4NRHB 4JW1A 4MS6A 4N39A 1EYHA 4MLPA 3TWUA 3PUKA 1OCRE 2KBXA 2IO3C 4RSYA 3FU3A 1JWFA 4EHMA 5LCWC 2XCBA 3QOUA 5ARGA 4I2WA 3ULQA 4C48B 2IQCA 5D0OD 1PY1A 3S7FA 5JA4D 1BLXB 5G55A 1YCSB 3NF1A 3SI5A 1TNOA 4AY6A 2EIKE 3MV2B 3O48A 1INZA 3FEXA 3J5QB 2WXJA 3DPDA 4G25A 4UWFA 3R7RA 1U3DA 2YHCA 1S64A 5AIJA 2A4ZA 3DSVA 3W9FA 4EZJA 3HXCA 2J07A 3ZUVB 4KZCA 3V30A 2WXQA 1QQEA 3I5PA 3ASFA 3T5VA 3EHQA 4CT4A 3S7DA 2KXPC 3OXGA 4AV7A 1V54E 5ITZF 1O5MA 4XX5A 2Y1LE 3FDHA 4U8VD 2Y4UA 3ASGA 4WWOA 2X6JA 3P2BA 4HFGA 2FULA 3AG4E 2YQ8A 3BU8A 3CHSA 4UI9J 4GB9A 1QYMA 2DZOA 2B6CA 3DWLG 3MCXA 4BT8A 1Y8MA 3D9MA 5LOZA 4APFA 1H0AA 2H6IA 1ZB1A 3PZ3A 4B8CB 3LS8A 4NURA 2P9NG 5G05C 4KZ0A 4YVQC 1WM5A 1Q2ZA 5DBKA 4J6IA 2XZDG 4BERA 2DCPA 3GYZA 3L16A 1KPSB 3MEKA 2FF4A 1JCQA 3CQGB 3JUEA 4FLHA 2R03A 4HS2A 1UW4B 3W9GA 4B94A 4BETA 2FEZA 3E37A 3CK9A 1TNZA 2DBAA 3HXBA 3UT4A 4O6FA 5CBNA 3LYAA 4R7LA 2XS1A 3S7JA 3ABKE 5ENQD 4K5AB 3ENEA 3V2XA 2QFCA 4FADA 2XPIA 2AW6A 3G2SA 3B95A 3K9IA 2CFZA 4U8HA 4HOQA 1UG3A 4PUCA 3B7BA 3TG4A 4I1OB 2BF0X 2P9UG 3SHFA 3UQ3A 2X38A 2VSYA 3LCAA 1IQRA 4N5CA 2CHXA 4O60A 3GZ2A 3PH0C 2P9SG 5CBOA 4JA9A 4WNEA 1H6KA 3DSXA 5T4YA 5IY5E 3SY2A 1OXJA 2FBNA 2A5EA 2IJGX 2WXLA 3UIPC 2L9BA 3TGOA 3EU5A 4F53A 4ANWA 3MV3B 5EX3A 2VGXA 5KNHD 3FTZA 5B1BE 3CK7A 5AAOA 4RVBA 3VTXA 3ESLA 2UY1A 4TXPA 5EIBE 4J8EA 4JZYA 4CDRA 1H6PA 3CVNA 4DJAA 1ZBPA 1YA0A 2XEVA 3DEOA 1A17A 4HI9A 3TWRA 4KXKB 1O1TA 5G2NA 3ZKJA 1MX2A 2VSOE 5FQ8A 1H2TC 3JXIA 3QARA 1D8DA 5T3RA 2LSVA 2R05A 4JHRA 4EBAG 5ENRD 3C3RA 2L0TB 1JUQA 1HZ4A 3N71A 2XRYA 1XNFA 4BTBA 2L6JA 2E2EA 2IOSA 2BTDA 3V31A 3C72A 3FTUA 2IO2C 4GU5A 2VQ2A 2KCLA 1QZ2A 2EIJE 5FZRA 1MHQA 4HRMB 3I4GA 4LRZA 1RZ4A 3FTWA 2AJAA 4JEUA 4XZ4A 3L82A 4FHKA 1ELKA 5KJNA 1OUVA 2IF4A 3QKYA 4GZCA 4BEPA 2WQ6A 1DNPA 1OCOE 4TUUA 1E8ZA 2ZXWE 3SGHA 2RFMA 2GRQB 4DRXE 4QFVA 4GMRA 1VDYA 3EUVA 1X5BA 4BWRA 2FI7A 5ARFA 2GRPB 1KZOA 3PE4A 5EDSA 3Q9NC 5BPPA 4RG6A 4EECA 3TL5A 2J4DA 3J5PA 1SZ9A 3DRAA 2J4BA 4F3VA 3PUJA 3B7RL 4UI9C 4J8DA 3JUIA 2MRIA 1DVPA 2YINA 2KATA 3CK8A 3FTSA 3HDXA 3CHOA 5HQ8A 4XEIG 2WXKA 4DX6D 2WXGA 2VGXB 1UJKA 4HNAD 4HRNA 3FUFA 4E6HA 2UY1B 3LKUA 1TYQG 4H7YA 4J0UA 5A7DB 3PNLB 5HS0A 4AP2A 3IKOB 3ZRHA 2AWIA 3SFYA 3AS5A 3T5XA 3WG7E 3MX3A 3E32A 3IEGA 2Y4TA 2VSXE 4G24A 5EYPF 2P58C 2QC9A 1NL4A 5J90A 3HXDA 4DPRA
chains in the Genus database with same CATH topology
1Z5SC 5D2MC 2IO3C 2GRRB 2IY0C 3UINC 1KPSB 2GRQB 3UIOC 2IO2C 2GRNB 3UIPC 2GROB 2GRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S C;  5D2M C;  2IO3 C;  2GRR B;  2IY0 C;  3UIN C;  1KPS B;  2GRQ B;  3UIO C;  2IO2 C;  2GRN B;  3UIP C;  2GRO B;  2GRP B; 
#chains in the Genus database with same CATH topology
 5FJY A;  4ACL A;  1Z3X A;  3SZ7 A;  1U2V G;  1N9A A;  5B1A E;  4B93 B;  4OVU A;  2HYZ A;  4RLY A;  3RRU A;  3ONL A;  4GYY A;  2AXZ A;  4AVX A;  4CEM A;  5C1D A;  3KSL A;  1K3Z D;  1FPP A;  3Q15 A;  3CST A;  2R02 A;  5HRY A;  3ULY A;  1TR4 A;  3E30 A;  2DYR E;  2F8Y A;  4JXT A;  3PE3 A;  2Y0B G;  3QAQ A;  1NA0 A;  3FTY A;  3CVV A;  3CVX A;  3SBT B;  3D9L A;  3UKR G;  3O4Z A;  3DBS A;  4DK5 A;  4E85 A;  3AG2 E;  3G2W A;  5JMN D;  1HS6 A;  3CKB A;  3FUI A;  4I1A A;  1N4R A;  3B7U X;  4KT6 B;  3QJZ A;  4ATG A;  4OYS A;  3E4B A;  2C0L A;  4J8Y A;  2WQ7 A;  4U0S A;  2J08 A;  3ASH A;  1IHG A;  3Q5M A;  5KJL A;  4L9P A;  4RG9 A;  2R2L A;  4TUM A;  1MZC A;  2VJ8 A;  5JHA A;  4K0R A;  5FQ4 A;  1E7V A;  1OWL A;  2F8X K;  2P9I G;  4U8Y D;  1HX8 A;  1K1A A;  3EHM A;  1FT1 A;  5AEN A;  2BED A;  3MKQ A;  1IYG A;  2ZU6 B;  4ME2 A;  4JPS A;  3RK6 A;  1IXV A;  4K5C A;  3BUA A;  1IQU A;  5FWQ A;  4HLL A;  4ACK A;  2HO1 A;  4N3A A;  5BUZ A;  3FUN A;  3FEY A;  1X81 A;  2WXH A;  4EBA A;  5CCL A;  2OND A;  1HO8 A;  4YDO A;  2XCC A;  4C0M A;  3OTN A;  5FIO A;  4YND A;  3R7Q A;  1S70 B;  4U07 A;  3LXU X;  4YDY A;  3ULE G;  4GZ6 A;  4ZHB A;  5ENT D;  3DPY A;  3HG0 D;  1D8E A;  4LNG A;  4PS8 A;  3EJN A;  4ATZ D;  3QWV A;  1OT8 A;  5AYW D;  1HH8 A;  4CGV A;  2XGM A;  5BXO A;  4JB8 P;  1LF8 A;  4UQZ A;  1E96 B;  3NZU A;  2GW1 A;  2VGE A;  4A3V A;  4JD2 G;  4G23 A;  3ZYM A;  1N52 A;  3CVL A;  4JL0 A;  1FCH A;  4CDM A;  3L22 A;  4B89 A;  2P9P G;  2P2C P;  5KWD A;  1NI1 A;  4J8S A;  2IEJ A;  4XIF A;  4DI4 A;  1TJF A;  3AJI A;  3IHY A;  4GTM A;  1TNB A;  3ASO E;  2JAB A;  4FHJ A;  1LD7 A;  2C2L A;  3PEV B;  3NB2 A;  3UTM A;  2MHK A;  4FLB A;  5FT9 A;  3QK0 A;  1D9S A;  3EIJ A;  4U95 D;  4TXR A;  4LCT A;  4UWK A;  4KYO B;  4U63 A;  2KM4 A;  3ASN E;  1KZP A;  5FZS A;  2A5U A;  3BG0 B;  3DEP A;  3AS4 A;  3FUH A;  4CGW A;  4GCN A;  5EKQ D;  4GZ5 A;  1MQS A;  3ESK A;  1E8Y A;  5AQ9 A;  4GTT A;  1OY3 D;  1ELR A;  2R5S A;  4BX8 A;  3LDZ A;  3RAU A;  5AJD A;  3UM1 A;  3PEU B;  1IKN D;  2L0I A;  3ZXP A;  1AWC B;  2ZGD A;  3ZEF A;  2IFU A;  4G11 A;  2ZIR A;  1SQM A;  1E8W A;  2J9Q A;  3TWX A;  2WXM A;  4IRU A;  3UXG A;  3HVE A;  1IHB A;  1EF1 C;  4A3T A;  1KT0 A;  4I6J A;  4TV3 A;  4ANX A;  4HVB A;  1N11 A;  3MZL B;  3MJW A;  5KJK A;  2VYI A;  1S63 A;  4M3O A;  4G8K A;  3PVL A;  4ILG A;  5JJ7 A;  1TNU A;  3E34 A;  4URK A;  2QYU A;  3CVW A;  3JCK C;  2IU1 A;  4MKT A;  3OXF A;  3TAX A;  3CHM A;  2BKG A;  4L1B A;  3T8M A;  3L54 A;  5FQ6 A;  3CVY A;  2OVB A;  3ML8 A;  3OAW A;  1H2U A;  3FWV A;  3AG3 E;  3LVR E;  3TWV A;  1NZN A;  1YYH A;  5CER B;  4G1T A;  3AAA C;  2XRZ A;  4RQI A;  3HRA A;  4EPZ A;  3TXN A;  2DWZ A;  3UKU G;  3LJ3 A;  4GYW A;  3HIZ A;  4DUI A;  2LO6 A;  4HLE A;  3EDT B;  3SF4 A;  3VLD A;  3Q7A A;  1SA5 A;  4C9B B;  2HM8 A;  1L5J A;  3T9K A;  2EIM E;  3FU0 A;  5FZQ A;  2WVI A;  3PS6 A;  3ABL E;  5BXU A;  1A5E A;  2QYJ A;  4LER A;  1BD8 A;  3QNK A;  4CT0 A;  1TNY A;  5AAR A;  2H6F A;  3VLF A;  3RU0 A;  4EQF A;  4K03 A;  1OCZ E;  4F7A A;  4I9C A;  3SO8 A;  3CV0 A;  3P1U A;  1H2V C;  5DIZ A;  5H7P A;  2WXP A;  3CEQ A;  3JXJ A;  3IV0 A;  4BY6 A;  3RJV A;  1TJC A;  3FUE A;  3CR3 A;  3TWQ A;  2YNQ A;  4LUN U;  4IN3 B;  4F1P A;  3G2U A;  5C2Y A;  2P9L G;  4XI9 A;  1P5Q A;  3RKV A;  2V5F A;  4WND A;  4HOS A;  3FFL A;  1HG2 A;  3ZU7 B;  3SBS A;  4DLQ A;  5A6C A;  3FU6 A;  4L2Y A;  2WM9 A;  3L13 A;  3EHN A;  4KBQ A;  1OWO A;  3L9T A;  1BPO A;  4N2S A;  4I43 A;  2PNN A;  4CYM D;  4ZFH A;  3CVQ A;  2KZT A;  3BEE A;  4DX5 D;  2CFU A;  2MYO A;  3B13 A;  1UOH A;  3PDN A;  3ASD A;  2I1K A;  2I2O A;  1WAO 1;  4GAA A;  3PZ2 A;  4GCO A;  4GML A;  3DXM G;  3Q4A B;  2ILR A;  4CCA A;  3UM3 A;  5T8I A;  4HQD A;  3ONK A;  3D9P A;  2WXI A;  2ZIS A;  5BV1 A;  3FUL A;  3RRM B;  4BFR A;  3ISM C;  3Q7F A;  3WXX A;  2CG2 A;  4J8F A;  3V79 K;  4KMO A;  4GMJ A;  3MKR A;  2R17 C;  1HFA A;  2CHZ A;  2V8S E;  2DYS E;  3AS8 A;  1H6O A;  4L2L A;  2BUG A;  3FY4 A;  1HF8 A;  3CVP A;  3NBN B;  3C3Q A;  4GTR A;  5CEC B;  1BI8 B;  3KSQ A;  4YDE A;  2I9C A;  1MX4 A;  2F37 A;  3Q9U C;  3SD5 A;  5BNW A;  3NQP A;  3RO2 A;  3UUX A;  4Q69 A;  4U7E B;  3QDN A;  3GW4 A;  3IHV A;  3U4T A;  1MX6 A;  3JYS A;  1GW6 A;  4LEU A;  4I6G A;  3NOC D;  5HKP A;  4AXH A;  4PDX A;  5KCM A;  3ZN3 A;  3AG1 E;  2Y3A A;  1WY6 A;  3ZYL A;  3ML9 A;  4HOU A;  4EZK A;  1QBQ A;  1SW6 A;  2GRL A;  3ZYQ A;  3APC A;  4CZ2 D;  5HI7 A;  1JCR A;  3C5R A;  1WDY A;  3KD7 A;  5CCM A;  2WB2 A;  4KVM A;  3FTV A;  5JJ6 A;  4A1G A;  3ZIM A;  2DVW A;  3ZNG A;  3L08 A;  3KAE A;  1AP7 A;  1OCC E;  3QC1 A;  4AY5 A;  4D10 C;  3PZ1 A;  3PZD A;  5LP0 A;  3QB2 A;  3CLJ A;  4LNU D;  5D2M C;  2FO7 A;  3VLE A;  4ILI A;  3UT8 A;  3UX4 A;  3DSS A;  1N4S A;  3CHQ A;  3S7B A;  2AXV A;  1EDU A;  5CHE E;  2WMO A;  4PS7 A;  3FU5 A;  4MRU A;  4XI0 A;  3ZXS A;  1HG5 A;  1K8K G;  1EPU A;  5CRU A;  5KJM A;  1DC2 A;  3APF A;  2WXO A;  3CHP A;  1SA4 A;  4NIK A;  3OXL A;  4AIF A;  3Q78 A;  3UI2 A;  4BSZ B;  4CDN A;  2EQX A;  4DX1 A;  2PZI A;  5CMW A;  5EIL A;  2GGF A;  4UWL A;  2IOL A;  5FTP A;  4K5B A;  5J08 A;  3HXF A;  1OWN A;  3SQV A;  3QWW A;  3CKC A;  3TWT A;  4WNF A;  4FP7 A;  2CG3 A;  1BU9 A;  2R59 A;  4LSZ E;  4JA7 A;  3ZVV A;  4GYO A;  3UMV A;  5AQ7 A;  4GTV A;  2OOE A;  1N95 A;  3RRN B;  5E75 A;  4I6E A;  2XQ0 A;  4GTQ A;  2PQN A;  2C0M A;  4GPK A;  4FJZ A;  4A55 A;  2GRO B;  2QY7 A;  3SNX A;  3MGB A;  3T8K A;  2WQH A;  4N5Q A;  2HE0 A;  3Q49 B;  3F6Q A;  1B89 A;  2VSN A;  1ZU2 A;  1Z3Y A;  3GZS A;  4U96 D;  4BX9 A;  1NA3 A;  2J49 A;  2JLB A;  5KNG A;  4J7W A;  3VTY A;  1E7U A;  3BQO A;  5AJL A;  5ANL A;  3ZFW A;  4GA2 A;  4N3C A;  4LNB A;  4FC8 A;  1OWP A;  3TWW A;  4TRQ A;  1OWM A;  4P29 A;  3LVQ E;  5ANR A;  1JPL A;  1LTX A;  2XPY A;  4Y6W A;  2BKK B;  2H6H A;  4HB5 A;  3C98 A;  3PNT B;  4G8L A;  5AQB A;  3D9J A;  3UM2 A;  4N2Q A;  4OVV A;  2KCK A;  4WWP A;  3FH7 A;  3FTX A;  3FUM A;  4AM9 A;  3SFZ A;  3V2O A;  1G3N B;  4FU3 A;  4GZD A;  2KCV A;  3ZGQ A;  3HYM B;  4AEZ C;  2LUH A;  2LSU A;  3LY8 A;  1Z5S C;  2ZGG A;  3Q79 A;  4G26 A;  1N0R A;  1N94 A;  2P9K G;  3PRE A;  3EHR A;  5AN8 A;  3S2A A;  3I3N A;  4F6R D;  4M7C A;  5JHB A;  1N0Q A;  2GRR B;  2V4H C;  4FA6 A;  3KEZ A;  5ENO D;  3MKQ B;  5E76 A;  3AU5 A;  2XEN A;  2ETC A;  3URZ A;  2X6F A;  5FIN A;  4O1O A;  2XZT G;  4DLO A;  4ANU A;  5M72 A;  2RKK A;  2PQR A;  4PH4 B;  2OCC E;  4JEH A;  4UQX A;  3GZ1 A;  4NAC A;  3I4R B;  3DSW A;  2XS8 A;  3JQ1 A;  1XGW A;  2B0O E;  4GTP A;  1DCE A;  3KEA A;  2DIW A;  3FUK A;  4HI8 A;  3FH8 A;  1O1R A;  1O1S A;  3FHE A;  1N54 A;  3G2T A;  4XE0 A;  4GTO A;  1E8X A;  3ZYK A;  2XHE A;  1WG0 A;  2Y69 E;  4W9R A;  3HHM A;  2OEW A;  2Q7F A;  4GA1 A;  4APO A;  2V5Q C;  1RW2 A;  4Y6C A;  2MOW A;  2X6I A;  3KS2 A;  2XGO A;  4BTA A;  5CEA A;  1PC2 A;  2JEK A;  4L7T A;  2NXP A;  4U0Z A;  1QNF A;  2I6H A;  1W3B A;  4I17 A;  4V3I A;  2NSZ A;  2OEV A;  5B3S E;  3X2Q E;  5EX0 A;  3DST A;  4HRL A;  5CMY A;  2J8S D;  3CHR A;  2GRM A;  2OV8 A;  3UM0 A;  2WXR A;  3L6A A;  3D3M A;  1SZA A;  4I2Z A;  2NYJ A;  5BT1 A;  4DI3 A;  2WMN A;  5G04 J;  2ETB A;  3G2V A;  4QQI A;  4ANV A;  3ZHE A;  3TJP A;  3RIB A;  3CVU A;  4A63 B;  4H7X A;  3D9K A;  3DSU A;  4UQY A;  3TWS A;  3UIN C;  5KBA A;  5EYL A;  2HR2 A;  4JHJ A;  3U64 A;  2RG8 A;  3UIO C;  4JHK A;  1K1B A;  4B0Z A;  2PM6 A;  1JWG A;  1NP7 A;  3ABM E;  4YVO A;  1Y6I A;  4AOF A;  5LFA A;  2F0Y A;  3D9H A;  4EZL A;  1LD8 A;  4X8Q A;  2J09 A;  2RD0 A;  1H19 A;  4C0E A;  4UI9 K;  4BT9 A;  3RO3 A;  3Q75 A;  2FO1 E;  3IXE A;  2XEH A;  4DX2 A;  2M63 A;  4OAV B;  4B8A A;  1TEZ A;  3Q73 A;  4BES A;  2X6K A;  4ABN A;  4WWN A;  2E0I A;  4WAF A;  5LCW J;  2L6B A;  3UPV A;  4UUC A;  5A23 A;  3HVE B;  3ZW3 A;  4N3B A;  2V4L A;  2EIL E;  3TG5 A;  4O1P A;  4KVO A;  2IY0 C;  1FVF A;  1S0P A;  2ETA A;  2QZA A;  2WPV A;  4I1M A;  4XKC A;  2YHE A;  4XKB A;  3FH5 A;  2XEE A;  2UWJ G;  5ENN A;  1FT2 A;  4GPM A;  5FQ7 A;  3D9N A;  4Q96 A;  3L17 A;  3MYV A;  4YDW A;  5BV0 A;  3SFX A;  1NFI E;  2VTB A;  3NZS A;  3E33 A;  5ENS D;  2LXL A;  3U3W A;  1SVX A;  4GZ3 A;  4UWH A;  2X3M A;  1N4Q A;  1KT1 A;  3CSF A;  3R9A B;  4FUL A;  5AQA A;  1YMP A;  3D9I A;  3ZPJ A;  5CED B;  4MBG A;  4PS3 A;  2KC7 A;  2GRN B;  4UWG A;  3AU4 A;  1TN7 A;  3DXK G;  3EIQ C;  4JC8 A;  2NC9 A;  3LPZ A;  2VGY A;  3NOG D;  3U9W A;  3CQC B;  1ELW A;  3ZHE B;  4U0U A;  1BI7 B;  3TXM A;  4U04 A;  2LNI A;  3HXE A;  3IBE A;  4IYP A;  1DCQ A;  2V0P A;  3B7T A;  3UT7 A;  3LY9 A;  3QWP A;  4DX7 D;  5G05 J;  1HU3 A;  5JJT A;  2XGS A;  4LG6 A;  4GTS A;  3EU9 A;  4L23 A;  4HOR A;  2XPZ A;  1E90 A;  2ION A;  3JQ0 A;  1FVH A;  4TXQ A;  2AXU A;  2WXN A;  1MYO A;  2LAI A;  3C3O A;  3D9O A;  2EIN E;  4Z68 A;  1KLX A;  1V55 E;  3PRZ A;  2PM7 A;  3CIA A;  2X6H A;  4BSX A;  3RSE G;  1U3C A;  2WXF A;  4WUY A;  4OAU C;  2LXM A;  4GA0 A;  5BW8 C;  5D0Q D;  5CRV A;  2OVF A;  4I9E A;  4Q94 A;  3FUJ A;  2LAH A;  4NQ0 A;  3FUD A;  3LJN A;  1Z6T A;  2KZT B;  3CGH A;  4WNG A;  1JCS A;  5ENP D;  4JVS A;  1TN6 A;  1HE8 A;  3NAW A;  5LX8 A;  4ILH B;  3LEW A;  5G04 C;  5EID A;  4G2V A;  3FP3 A;  2VTB B;  4IUL A;  2PL2 A;  3Q47 B;  5D66 A;  4A1S A;  4HOT A;  1UN8 A;  2DZN A;  1PAQ A;  4CRW A;  1MJ0 A;  2I1J A;  2AVP A;  4HXI A;  2CHW A;  3LY7 A;  3MA5 A;  3U66 A;  2H6G A;  2RFA A;  5EN5 D;  4AJW A;  1HXI A;  4FJY A;  3PZ4 A;  1N4P A;  3R9M A;  3BG1 B;  1UN9 A;  4F1S A;  1UJJ A;  4HBD A;  3B7S A;  3APD A;  1TN8 A;  4NRH B;  4JW1 A;  4MS6 A;  4N39 A;  1EYH A;  4MLP A;  3TWU A;  3PUK A;  1OCR E;  2KBX A;  2IO3 C;  4RSY A;  3FU3 A;  1JWF A;  4EHM A;  5LCW C;  2XCB A;  3QOU A;  5ARG A;  4I2W A;  3ULQ A;  4C48 B;  2IQC A;  5D0O D;  1PY1 A;  3S7F A;  5JA4 D;  1BLX B;  5G55 A;  1YCS B;  3NF1 A;  3SI5 A;  1TNO A;  4AY6 A;  2EIK E;  3MV2 B;  3O48 A;  1INZ A;  3FEX A;  3J5Q B;  2WXJ A;  3DPD A;  4G25 A;  4UWF A;  3R7R A;  1U3D A;  2YHC A;  1S64 A;  5AIJ A;  2A4Z A;  3DSV A;  3W9F A;  4EZJ A;  3HXC A;  2J07 A;  3ZUV B;  4KZC A;  3V30 A;  2WXQ A;  1QQE A;  3I5P A;  3ASF A;  3T5V A;  3EHQ A;  4CT4 A;  3S7D A;  2KXP C;  3OXG A;  4AV7 A;  1V54 E;  5ITZ F;  1O5M A;  4XX5 A;  2Y1L E;  3FDH A;  4U8V D;  2Y4U A;  3ASG A;  4WWO A;  2X6J A;  3P2B A;  4HFG A;  2FUL A;  3AG4 E;  2YQ8 A;  3BU8 A;  3CHS A;  4UI9 J;  4GB9 A;  1QYM A;  2DZO A;  2B6C A;  3DWL G;  3MCX A;  4BT8 A;  1Y8M A;  3D9M A;  5LOZ A;  4APF A;  1H0A A;  2H6I A;  1ZB1 A;  3PZ3 A;  4B8C B;  3LS8 A;  4NUR A;  2P9N G;  5G05 C;  4KZ0 A;  4YVQ C;  1WM5 A;  1Q2Z A;  5DBK A;  4J6I A;  2XZD G;  4BER A;  2DCP A;  3GYZ A;  3L16 A;  1KPS B;  3MEK A;  2FF4 A;  1JCQ A;  3CQG B;  3JUE A;  4FLH A;  2R03 A;  4HS2 A;  1UW4 B;  3W9G A;  4B94 A;  4BET A;  2FEZ A;  3E37 A;  3CK9 A;  1TNZ A;  2DBA A;  3HXB A;  3UT4 A;  4O6F A;  5CBN A;  3LYA A;  4R7L A;  2XS1 A;  3S7J A;  3ABK E;  5ENQ D;  4K5A B;  3ENE A;  3V2X A;  2QFC A;  4FAD A;  2XPI A;  2AW6 A;  3G2S A;  3B95 A;  3K9I A;  2CFZ A;  4U8H A;  4HOQ A;  1UG3 A;  4PUC A;  3B7B A;  3TG4 A;  4I1O B;  2BF0 X;  2P9U G;  3SHF A;  3UQ3 A;  2X38 A;  2VSY A;  3LCA A;  1IQR A;  4N5C A;  2CHX A;  4O60 A;  3GZ2 A;  3PH0 C;  2P9S G;  5CBO A;  4JA9 A;  4WNE A;  1H6K A;  3DSX A;  5T4Y A;  5IY5 E;  3SY2 A;  1OXJ A;  2FBN A;  2A5E A;  2IJG X;  2WXL A;  3UIP C;  2L9B A;  3TGO A;  3EU5 A;  4F53 A;  4ANW A;  3MV3 B;  5EX3 A;  2VGX A;  5KNH D;  3FTZ A;  5B1B E;  3CK7 A;  5AAO A;  4RVB A;  3VTX A;  3ESL A;  2UY1 A;  4TXP A;  5EIB E;  4J8E A;  4JZY A;  4CDR A;  1H6P A;  3CVN A;  4DJA A;  1ZBP A;  1YA0 A;  2XEV A;  3DEO A;  1A17 A;  4HI9 A;  3TWR A;  4KXK B;  1O1T A;  5G2N A;  3ZKJ A;  1MX2 A;  2VSO E;  5FQ8 A;  1H2T C;  3JXI A;  3QAR A;  1D8D A;  5T3R A;  2LSV A;  2R05 A;  4JHR A;  4EBA G;  5ENR D;  3C3R A;  2L0T B;  1JUQ A;  1HZ4 A;  3N71 A;  2XRY A;  1XNF A;  4BTB A;  2L6J A;  2E2E A;  2IOS A;  2BTD A;  3V31 A;  3C72 A;  3FTU A;  2IO2 C;  4GU5 A;  2VQ2 A;  2KCL A;  1QZ2 A;  2EIJ E;  5FZR A;  1MHQ A;  4HRM B;  3I4G A;  4LRZ A;  1RZ4 A;  3FTW A;  2AJA A;  4JEU A;  4XZ4 A;  3L82 A;  4FHK A;  1ELK A;  5KJN A;  1OUV A;  2IF4 A;  3QKY A;  4GZC A;  4BEP A;  2WQ6 A;  1DNP A;  1OCO E;  4TUU A;  1E8Z A;  2ZXW E;  3SGH A;  2RFM A;  2GRQ B;  4DRX E;  4QFV A;  4GMR A;  1VDY A;  3EUV A;  1X5B A;  4BWR A;  2FI7 A;  5ARF A;  2GRP B;  1KZO A;  3PE4 A;  5EDS A;  3Q9N C;  5BPP A;  4RG6 A;  4EEC A;  3TL5 A;  2J4D A;  3J5P A;  1SZ9 A;  3DRA A;  2J4B A;  4F3V A;  3PUJ A;  3B7R L;  4UI9 C;  4J8D A;  3JUI A;  2MRI A;  1DVP A;  2YIN A;  2KAT A;  3CK8 A;  3FTS A;  3HDX A;  3CHO A;  5HQ8 A;  4XEI G;  2WXK A;  4DX6 D;  2WXG A;  2VGX B;  1UJK A;  4HNA D;  4HRN A;  3FUF A;  4E6H A;  2UY1 B;  3LKU A;  1TYQ G;  4H7Y A;  4J0U A;  5A7D B;  3PNL B;  5HS0 A;  4AP2 A;  3IKO B;  3ZRH A;  2AWI A;  3SFY A;  3AS5 A;  3T5X A;  3WG7 E;  3MX3 A;  3E32 A;  3IEG A;  2Y4T A;  2VSX E;  4G24 A;  5EYP F;  2P58 C;  2QC9 A;  1NL4 A;  5J90 A;  3HXD A;  4DPR A; 
#chains in the Genus database with same CATH homology
 1Z5S C;  5D2M C;  2IO3 C;  2GRR B;  2IY0 C;  3UIN C;  1KPS B;  2GRQ B;  3UIO C;  2IO2 C;  2GRN B;  3UIP C;  2GRO B;  2GRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...