3UINC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/isomerase/protein binding
molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uinC00
3UIPC 1Z5SC 3UINC 2GRRB 3UIOC 2GRNB 2GRQB 2IO3C 2IO2C 1KPSB 2GROB 5D2MC 2GRPB 2IY0C
chains in the Genus database with same CATH superfamily
3NZUA 3VLDA 3TWQA 4GAAA 3ZVVA 4NQ0A 2R02A 5DIZA 3VLEA 1WY6A 3KAEA 3ZU7B 4HRNA 4OVVA 3PZ1A 4XZ4A 3MKRA 3VTYA 1PC2A 3ISMC 5BXUA 2B0OE 2J09A 1S70B 1AP7A 4BESA 3D9MA 4HLLA 4HI8A 4FJZA 3K9IA 2HO1A 3Q47B 3ZEFA 4ATGA 2CFUA 3PRZA 3ESKA 3DXMG 4KT6B 3Q9NC 4N39A 3UPVA 4F53A 3FULA 2PZIA 1OXJA 2Y1LE 4GMLA 2LNIA 2LUHA 3ZYMA 2WMNA 5JHAA 1HG5A 2UY1A 1LTXA 3TWRA 2XRYA 2RKKA 1Z5SC 2AW6A 1KZPA 2X6IA 1ZU2A 5JA4D 4QFVA 3O48A 3V2XA 2AVPA 2J4BA 4HI9A 5ENOD 2R59A 3KEZA 3V79K 1MZCA 3EHNA 4WNGA 1OWMA 3WXXA 2GRRB 1E7UA 3FEXA 4OVUA 1MJ0A 2Y0BG 4U0UA 4W9RA 3EU5A 2CHXA 1AWCB 4B93B 5A7DB 1H6OA 1WDYA 4CZ2D 1TNBA 1V55E 3JCKC 3ZFWA 2I1JA 3EHRA 4I17A 3DPDA 3UT4A 4GYYA 3TAXA 3Q79A 1O5MA 3MKQB 2OVFA 2DBAA 3E4BA 3WG7E 5T8IA 1N95A 5BPPA 3Q4AB 2P9LG 2R5SA 4UWHA 5E76A 3W9FA 3GZ2A 3S7DA 4R7LA 3FU0A 1HX8A 4YDYA 2IF4A 2ZGDA 2DYRE 2M63A 2XS1A 4HQDA 1L5JA 2GW1A 4ANXA 5ENPD 4OAVB 5JJ6A 3D9JA 3ZHEA 4HVBA 2IQCA 4I6JA 2GRMA 5G2NA 3R9AB 4ACKA 3CK8A 2P2CP 4GYWA 1DVPA 3J5PA 5BNWA 2XZTG 2WB2A 2VGXB 4DJAA 4J7WA 4J8FA 1N4PA 4XIFA 2PNNA 5B3SE 4FU3A 2XRZA 2LSUA 1N54A 1EYHA 1S0PA 1NP7A 1FT1A 3L6AA 1BLXB 4TXPA 2L9BA 3NOGD 3GW4A 4TXRA 3B7TA 3QB2A 1ZB1A 3SZ7A 3DSSA 1E8ZA 4WUYA 2L6BA 2PQRA 3LS8A 1UG3A 2UWJG 3LVRE 3SBTB 1X5BA 2HR2A 1SA5A 1SA4A 3QKYA 3FH7A 1JCSA 3FU6A 3ZW3A 3GZ1A 2WXMA 2XGSA 4LNUD 3JUEA 4U7EB 5FQ7A 4GZCA 2BKGA 2X6HA 4HNAD 5AENA 2EINE 2I9CA 3CHPA 4YVOA 5ENNA 1Q2ZA 3CQGB 3CEQA 2YHEA 5KNHD 3ASOE 3T8KA 3U66A 2JLBA 5AQ9A 3Q49B 5BV1A 5HKPA 1O1TA 3BG0B 3ZUVB 5FZRA 4EZJA 4U07A 4AM9A 4BX9A 3L9TA 3V2OA 5ENQD 3PZ4A 3DRAA 3IV0A 2BEDA 2P9UG 5KNGA 4ANVA 2YNQA 1HH8A 1IQUA 3ESLA 2KCKA 3OTNA 1ELKA 4HOSA 4QQIA 3CVVA 3CHQA 3JQ1A 4O6FA 3BG1B 4EZLA 2OV8A 3UM0A 1H2TC 1WM5A 3G2VA 2V5FA 1JWFA 3FUJA 3ZNGA 1MX2A 2JABA 2VGEA 1INZA 2J07A 3G2WA 1H2UA 1H6KA 1OWOA 4DLQA 3E33A 4UI9K 5A23A 3IKOB 3CHRA 3UM1A 5KBAA 4FP7A 2WVIA 3C98A 1E8XA 3HYMB 3CIAA 4N3BA 4L2YA 3PE3A 1TN8A 2P9PG 3EHQA 4UUCA 4FULA 2FBNA 3B95A 3FTWA 2LSVA 1UN9A 2XPIA 3QWPA 3GYZA 2VJ8A 5HQ8A 3CSTA 3QNKA 2CHWA 3LY9A 3FU5A 2KCLA 2KC7A 4MRUA 2ETAA 4JHJA 2CHZA 3AG4E 2L6JA 4LCTA 4FLHA 1FCHA 1BI8B 2QY7A 2WXIA 3JXJA 3L13A 4G24A 2GRNB 4AY5A 4GZ6A 5CCLA 4CDRA 2IOSA 3DSTA 4A3TA 4CDMA 4FA6A 3C72A 1D8EA 3L16A 3PUJA 3LVQE 3SGHA 4J8SA 1N4QA 4B8CB 2IU1A 2GROB 3TWTA 2X6JA 4RVBA 4A3VA 4GTOA 1FT2A 4OAUC 3PZDA 2DVWA 5AARA 3EJNA 3MGBA 5B1BE 3EU9A 4PS3A 3QAQA 2FF4A 3PE4A 2H6GA 4DX7D 4L7TA 3D9IA 2C2LA 2RFAA 2YQ8A 2VGYA 5ANRA 4PS7A 4LG6A 4LNBA 2WXKA 2IO3C 4GPKA 1B89A 5CEDB 5EYPF 1N4SA 1TR4A 1FVHA 2KZTB 4G26A 3SNXA 4FADA 2HM8A 4GZ3A 2NXPA 3FTZA 1P5QA 1N94A 3ASGA 3OXFA 3D3MA 5EKQD 4Q96A 2WMOA 4U63A 3CSFA 3SY2A 2WQ6A 3V30A 3FUNA 5CBNA 2VTBA 2J08A 4DX5D 2YHCA 4CGVA 4O1PA 2XEVA 4WWOA 5FZSA 4AY6A 1JCRA 4GCNA 2WXGA 1DC2A 1LF8A 2ZISA 4MKTA 4AOFA 2ETBA 3EHMA 1U3DA 4P29A 4BSZB 5ENSD 3DEPA 5EIDA 4M3OA 4HOTA 3R7RA 1OWNA 3CHMA 2VSNA 2L0TB 4LERA 3LCAA 3VTXA 3E30A 1EPUA 3DSXA 3FDHA 4I1AA 4KMOA 2H6IA 5FZQA 1TJFA 2KBXA 3X2QE 4N3AA 3TJPA 4CYMD 4N5CA 3LEWA 5FQ4A 3QK0A 1H0AA 3FH5A 2WXQA 3BEEA 4KVOA 1A17A 3OXLA 5D2MC 4JEHA 3LJNA 1YA0A 3QC1A 4DK5A 2I1KA 1Z6TA 4GMRA 5CBOA 2X38A 4TXQA 4GU5A 2H6FA 4DX6D 3FTUA 1E8WA 3HXBA 4HOQA 5KCMA 5KJLA 1KT1A 3UKRG 4B89A 2H6HA 5CERB 3UINC 3BU8A 3W9GA 3ZYLA 3CQCB 4HBDA 2X3MA 3P1UA 3DBSA 3C5RA 1SVXA 4BX8A 1UJJA 4XKCA 3RJVA 5HI7A 3CVYA 4U0SA 1NA0A 3JYSA 4M7CA 2MHKA 3CGHA 4K5CA 4Y6CA 4DI3A 2QC9A 4UI9C 4KVMA 2J9QA 4I1OB 2LAHA 2IONA 2XEEA 2ZIRA 4RG6A 3ZKJA 4F7AA 2WXOA 3T9KA 4JC8A 3FEYA 4C9BB 4E85A 3RIBA 1E8YA 1MX6A 3DWLG 4AVXA 1KLXA 3LY8A 3D9KA 4I6GA 4TV3A 2BUGA 2X6KA 3RSEG 5BV0A 4BSXA 2FI7A 3LKUA 4TUMA 4GTTA 3G2TA 4AEZC 1KZOA 1N4RA 3TWVA 3PEVB 3U3WA 3FY4A 1QZ2A 4GTSA 3LDZA 2AXZA 4GB9A 3UQ3A 1NFIE 5E75A 3TWSA 1VDYA 4XX5A 2CG2A 3U4TA 2J49A 4DX2A 3MYVA 5AYWD 3EUVA 4Y6WA 1MX4A 3FUMA 4U8HA 2R17C 4EBAA 1BU9A 1NL4A 3HXCA 4HS2A 3SD5A 1XGWA 3HVEB 4GCOA 5ARFA 4BETA 2QZAA 1MYOA 1NA3A 4ILGA 5G05C 2J4DA 3TWUA 1N9AA 4GTQA 4L9PA 2KXPC 2LAIA 3ZYQA 3FTVA 1OUVA 3CVWA 1TNYA 3DSUA 4YNDA 3S2AA 1NZNA 3FTSA 2DIWA 1H6PA 3CVLA 4XE0A 3CK9A 3CHOA 1DCQA 3JXIA 5CHEE 3L22A 2Y4UA 3FHEA 4U0ZA 4X8QA 1S64A 3D9PA 2RFMA 2V4LA 3PEUB 2QYJA 2DWZA 1N0RA 4GMJA 3R7QA 5JMND 2OEWA 2OVBA 5ANLA 4YDOA 1K3ZD 2XQ0A 3ABME 1TEZA 1FVFA 4LEUA 3QWVA 1SW6A 4GYOA 3RRMB 3FTYA 1ELRA 3UTMA 4TRQA 4JW1A 2MRIA 5EDSA 1OCCE 4L23A 3ASHA 5BUZA 5AQ7A 4CGWA 4CT0A 5IY5E 4NACA 3ZPJA 5LP0A 2R05A 3PVLA 3ULQA 3HG0D 4CDNA 4Q69A 4IULA 4F6RD 3HRAA 3CKCA 2VQ2A 3D9OA 5G04C 2UY1B 1N11A 2F8XK 4YDEA 3EIQC 5G55A 4WNEA 4N5QA 2WXLA 2RD0A 3APCA 3HIZA 1E7VA 2EIJE 4G1TA 4IN3B 1QYMA 3QJZA 2V4HC 4LNGA 1H2VC 4J8DA 4AV7A 5AQAA 3RAUA 2A4ZA 2P58C 4GZ5A 3Q7AA 3NAWA 2FO7A 3T8MA 1D9SA 4UI9J 1UW4B 3BQOA 4A1GA 1Z3XA 4ME2A 5C1DA 5AAOA 4MLPA 3FWVA 3APFA 4NIKA 4WNFA 4RG9A 5FT9A 4I43A 4K03A 3NQPA 4FLBA 4BTAA 4J8EA 3PNLB 2BKKB 4H7YA 3CVQA 3APDA 5FQ8A 5ENRD 1MHQA 1TNZA 1IQRA 4GTMA 5CMYA 3G2SA 1HF8A 4A1SA 3UT7A 2J8SD 4K5AB 2XGMA 3AS4A 1TNUA 1YMPA 1IYGA 2CG3A 1IHGA 3HXEA 4G8KA 2XPZA 3UX4A 5ITZF 3MV2B 1HXIA 3SQVA 3UM2A 3B7UX 4MBGA 1Y8MA 4ANWA 3UM3A 4GZDA 3ML9A 3E34A 4XKBA 4KXKB 1PY1A 3QWWA 3ZHEB 3CVUA 2XCBA 4BWRA 3MEKA 1LD8A 2PM7A 4J6IA 3NOCD 4UQZA 3TL5A 3ZXPA 3EDTB 3AAAC 1TN7A 5AQBA 4N3CA 4UWGA 2HE0A 1IKND 4BERA 3PUKA 3C3RA 4XEIG 5D66A 4WWNA 4APOA 1DNPA 4EQFA 5D0QD 4RQIA 1Z3YA 3FTXA 3AG2E 3MKQA 4G25A 1BI7B 3JUIA 2WXRA 3SFYA 4DX1A 4EZKA 1EF1C 3E37A 3RRUA 4I2WA 5CRUA 3ASNE 2WQ7A 3RKVA 5HRYA 5AJDA 3ZGQA 2OCCE 4L2LA 2AJAA 2WXPA 4DUIA 2AWIA 3ZYKA 2XPYA 4AP2A 5EX0A 2DZNA 4JXTA 3SI5A 1OWLA 3KEAA 4FJYA 2Y69E 5EILA 1HE8A 2Q7FA 4JHRA 4A55A 2F0YA 3OAWA 4WAFA 3AG1E 2MOWA 2VGXA 3LJ3A 3ABKE 3B7BA 4URKA 4PUCA 2HYZA 5LOZA 4HRLA 3U9WA 4WWPA 3CVPA 3CVNA 3N71A 1QQEA 3URZA 2VSOE 2P9SG 4JZYA 2ZGGA 1MQSA 3F6QA 2XENA 2E2EA 2GRPB 4JVSA 3ABLE 4GTRA 3GZSA 5HS0A 4BFRA 5ARGA 5KWDA 5AJLA 2EILE 2KM4A 1WG0A 3OXGA 2KCVA 3FP3A 4CT4A 3PREA 1BPOA 4UQXA 4BT8A 4JD2G 4NRHB 4KBQA 3Q5MA 1FPPA 2P9IG 1RW2A 3NB2A 2Y3AA 4ANUA 5J90A 3U64A 3IHYA 4PS8A 5G04J 3AS8A 3SF4A 4MS6A 5C2YA 2EIKE 3TWXA 3UKUG 1X81A 4GTVA 2ZXWE 3LXUX 4GA2A 3AU5A 5FQ6A 5LCWC 3I4RB 4U96D 4TUUA 5JJTA 4HXIA 5CECB 1UN8A 4ZHBA 2WM9A 2XCCA 4K5BA 3L82A 4G8LA 2PQNA 3DEOA 4I2ZA 3DPYA 2GGFA 2XGOA 4GA1A 3J5QB 3D9LA 5CCMA 3I5PA 1TNOA 2X6FA 5KJNA 2I2OA 2DZOA 4HOUA 3MV3B 2NC9A 4UWKA 5FIOA 1IXVA 4ZFHA 3RRNB 1S63A 2Y4TA 4HLEA 4O1OA 1UOHA 2V5QC 3HXFA 2P9KG 2C0LA 2VSYA 3PZ3A 4B0ZA 4G23A 4YDWA 5BXOA 4EPZA 3B7SA 5EIBE 2ZU6B 3O4ZA 2JEKA 5CMWA 4V3IA 3HDXA 3PH0C 4C48B 3LYAA 4RLYA 5JJ7A 4ILIA 4Z68A 3PS6A 3CKBA 4B8AA 4KZ0A 3TXNA 3ZRHA 3SFXA 3PNTB 1ELWA 3C3QA 3D9NA 2KATA 4C0EA 4YVQC 1GW6A 3DSVA 3V31A 2FULA 4O60A 3ML8A 2WPVA 5B1AE 1TYQG 3FUKA 3Q78A 3BUAA 3RK6A 4N2SA 3PZ2A 3ZXSA 5D0OD 1OY3D 4PDXA 1ZBPA 2ONDA 4J0UA 2ETCA 3FU3A 3SO8A 4RSYA 4JHKA 5H7PA 1KPSB 3HXDA 4I9EA 4HRMB 3IXEA 2WQHA 4NURA 4U04A 4FHJA 3ENEA 2IFUA 2L0IA 5KJMA 3FUHA 3G2UA 3TGOA 2XHEA 3B13A 3UI2A 4A63B 4DPRA 5FINA 5CRVA 3FH8A 4CEMA 3UIPC 1U3CA 4ACLA 2WXFA 4B94A 1OCZE 4D10C 3C3OA 5DBKA 3AU4A 2DYSE 4HORA 2LO6A 2RG8A 4U95D 2I6HA 1HZ4A 2P9NG 2V0PA 3LPZA 2VTBB 4DRXE 4IYPA 4HB5A 2ILRA 5M72A 3TXMA 3KS2A 2IO2C 3RO3A 5JHBA 3PDNA 3CR3A 4I1MA 5A6CA 1OT8A 2NSZA 1YCSB 2KZTA 3MJWA 4WNDA 3AG3E 3B7RL 4FC8A 3QARA 3ZN3A 4G11A 4I9CA 1QBQA 5LCWJ 3KSQA 2IEJA 4UWFA 3HHMA 1OCOE 2XEHA 3FUEA 3VLFA 4HFGA 2WXJA 4E6HA 1NI1A 1HS6A 1Y6IA 3UT8A 4GPMA 3EIJA 1D8DA 5EYLA 4K0RA 5AIJA 2V8SE 1RZ4A 4KZCA 2XZDG 3UUXA 2A5EA 3DSWA 3IHVA 4KYOB 5EX3A 2OEVA 2A5UA 2IY0C 3CV0A 5BT1A 3ONLA 4JPSA 5CEAA 2WXHA 2E0IA 4L1BA 5T4YA 2GRLA 3CK7A 3KD7A 5BW8C 2F37A 4UWLA 2AXUA 1IHBA 4C0MA 3AJIA 5FJYA 3L54A 3UXGA 1SZ9A 3FUIA 4F3VA 1U2VG 5FTPA 4LUNU 2DCPA 1N52A 3SBSA 5KJKA 3KSLA 4N2QA 1XNFA 3Q9UC 4JL0A 4JEUA 3MZLB 4JA9A 2PM6A 3E32A 4XI0A 2LXMA 3LY7A 4U8YD 1QNFA 3ZIMA 1PAQA 4BY6A 1SZAA 3RO2A 3ASFA 3FFLA 4F1PA 2QYUA 2NYJA 1EDUA 1K8KG 1HG2A 1YYHA 3D9HA 2FO1E 4PH4B 3CLJA 4CRWA 3Q7FA 4AIFA 3ONKA 4LRZA 1K1BA 3IEGA 2XS8A 4Q94A 3I4GA 2AXVA 2VSXE 2PL2A 3QOUA 2IOLA 3UMVA 3Q75A 1E96B 1OWPA 5T3RA 2QFCA 3TWWA 4JA7A 2F8YA 3TG5A 5ENTD 2BF0X 1O1RA 1JWGA 4IRUA 1DCEA 3P2BA 1SQMA 5FWQA 5LX8A 1E90A 3T5VA 4GA0A 3ULEG 4XI9A 4GTPA 2R03A 5LFAA 3MA5A 3S7JA 1N0QA 4ILHB 3SHFA 4FHKA 1W3BA 2LXLA 2VYIA 3R9MA 3ULYA 1H19A 2IJGX 4LSZE 3MCXA 4AJWA 1UJKA 1O1SA 4ATZD 3SFZA 4DLOA 2YINA 3I3NA 1KT0A 5EN5D 2B6CA 4H7XA 5G05J 4EBAG 1TJCA 4BT9A 1WAO1 2EIME 3ASDA 3UIOC 4BEPA 4I6EA 3T5XA 3S7FA 1G3NB 2BTDA 2CFZA 5AN8A 2OOEA 2EQXA 3MX3A 1JUQA 4UQYA 3S7BA 2MYOA 3Q73A 3CVXA 4J8YA 4EECA 4DI4A 3RU0A 1TN6A 3DXKG 5J08A 2WXNA 1JPLA 3FUDA 4OYSA 3L17A 4U8VD 1V54E 4F1SA 4BTBA 1HFAA 1A5EA 4CCAA 4JB8P 3L08A 2GRQB 4ABNA 3NBNB 1JCQA 3NF1A 3HVEA 3TG4A 1BD8A 4AXHA 4APFA 3NZSA 3FUFA 2C0MA 3AS5A 3JQ0A 1OCRE 4EHMA 3CHSA 2R2LA 1LD7A 1HO8A 2FEZA 1HU3A 3QDNA 3IBEA 3Q15A 4G2VA 1K1AA
chains in the Genus database with same CATH topology
3UIPC 1Z5SC 3UINC 2GRRB 3UIOC 2GRNB 2GRQB 2IO3C 2IO2C 1KPSB 2GROB 5D2MC 2GRPB 2IY0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIP C;  1Z5S C;  3UIN C;  2GRR B;  3UIO C;  2GRN B;  2GRQ B;  2IO3 C;  2IO2 C;  1KPS B;  2GRO B;  5D2M C;  2GRP B;  2IY0 C; 
#chains in the Genus database with same CATH topology
 3NZU A;  3VLD A;  3TWQ A;  4GAA A;  3ZVV A;  4NQ0 A;  2R02 A;  5DIZ A;  3VLE A;  1WY6 A;  3KAE A;  3ZU7 B;  4HRN A;  4OVV A;  3PZ1 A;  4XZ4 A;  3MKR A;  3VTY A;  1PC2 A;  3ISM C;  5BXU A;  2B0O E;  2J09 A;  1S70 B;  1AP7 A;  4BES A;  3D9M A;  4HLL A;  4HI8 A;  4FJZ A;  3K9I A;  2HO1 A;  3Q47 B;  3ZEF A;  4ATG A;  2CFU A;  3PRZ A;  3ESK A;  3DXM G;  4KT6 B;  3Q9N C;  4N39 A;  3UPV A;  4F53 A;  3FUL A;  2PZI A;  1OXJ A;  2Y1L E;  4GML A;  2LNI A;  2LUH A;  3ZYM A;  2WMN A;  5JHA A;  1HG5 A;  2UY1 A;  1LTX A;  3TWR A;  2XRY A;  2RKK A;  1Z5S C;  2AW6 A;  1KZP A;  2X6I A;  1ZU2 A;  5JA4 D;  4QFV A;  3O48 A;  3V2X A;  2AVP A;  2J4B A;  4HI9 A;  5ENO D;  2R59 A;  3KEZ A;  3V79 K;  1MZC A;  3EHN A;  4WNG A;  1OWM A;  3WXX A;  2GRR B;  1E7U A;  3FEX A;  4OVU A;  1MJ0 A;  2Y0B G;  4U0U A;  4W9R A;  3EU5 A;  2CHX A;  1AWC B;  4B93 B;  5A7D B;  1H6O A;  1WDY A;  4CZ2 D;  1TNB A;  1V55 E;  3JCK C;  3ZFW A;  2I1J A;  3EHR A;  4I17 A;  3DPD A;  3UT4 A;  4GYY A;  3TAX A;  3Q79 A;  1O5M A;  3MKQ B;  2OVF A;  2DBA A;  3E4B A;  3WG7 E;  5T8I A;  1N95 A;  5BPP A;  3Q4A B;  2P9L G;  2R5S A;  4UWH A;  5E76 A;  3W9F A;  3GZ2 A;  3S7D A;  4R7L A;  3FU0 A;  1HX8 A;  4YDY A;  2IF4 A;  2ZGD A;  2DYR E;  2M63 A;  2XS1 A;  4HQD A;  1L5J A;  2GW1 A;  4ANX A;  5ENP D;  4OAV B;  5JJ6 A;  3D9J A;  3ZHE A;  4HVB A;  2IQC A;  4I6J A;  2GRM A;  5G2N A;  3R9A B;  4ACK A;  3CK8 A;  2P2C P;  4GYW A;  1DVP A;  3J5P A;  5BNW A;  2XZT G;  2WB2 A;  2VGX B;  4DJA A;  4J7W A;  4J8F A;  1N4P A;  4XIF A;  2PNN A;  5B3S E;  4FU3 A;  2XRZ A;  2LSU A;  1N54 A;  1EYH A;  1S0P A;  1NP7 A;  1FT1 A;  3L6A A;  1BLX B;  4TXP A;  2L9B A;  3NOG D;  3GW4 A;  4TXR A;  3B7T A;  3QB2 A;  1ZB1 A;  3SZ7 A;  3DSS A;  1E8Z A;  4WUY A;  2L6B A;  2PQR A;  3LS8 A;  1UG3 A;  2UWJ G;  3LVR E;  3SBT B;  1X5B A;  2HR2 A;  1SA5 A;  1SA4 A;  3QKY A;  3FH7 A;  1JCS A;  3FU6 A;  3ZW3 A;  3GZ1 A;  2WXM A;  2XGS A;  4LNU D;  3JUE A;  4U7E B;  5FQ7 A;  4GZC A;  2BKG A;  2X6H A;  4HNA D;  5AEN A;  2EIN E;  2I9C A;  3CHP A;  4YVO A;  5ENN A;  1Q2Z A;  3CQG B;  3CEQ A;  2YHE A;  5KNH D;  3ASO E;  3T8K A;  3U66 A;  2JLB A;  5AQ9 A;  3Q49 B;  5BV1 A;  5HKP A;  1O1T A;  3BG0 B;  3ZUV B;  5FZR A;  4EZJ A;  4U07 A;  4AM9 A;  4BX9 A;  3L9T A;  3V2O A;  5ENQ D;  3PZ4 A;  3DRA A;  3IV0 A;  2BED A;  2P9U G;  5KNG A;  4ANV A;  2YNQ A;  1HH8 A;  1IQU A;  3ESL A;  2KCK A;  3OTN A;  1ELK A;  4HOS A;  4QQI A;  3CVV A;  3CHQ A;  3JQ1 A;  4O6F A;  3BG1 B;  4EZL A;  2OV8 A;  3UM0 A;  1H2T C;  1WM5 A;  3G2V A;  2V5F A;  1JWF A;  3FUJ A;  3ZNG A;  1MX2 A;  2JAB A;  2VGE A;  1INZ A;  2J07 A;  3G2W A;  1H2U A;  1H6K A;  1OWO A;  4DLQ A;  3E33 A;  4UI9 K;  5A23 A;  3IKO B;  3CHR A;  3UM1 A;  5KBA A;  4FP7 A;  2WVI A;  3C98 A;  1E8X A;  3HYM B;  3CIA A;  4N3B A;  4L2Y A;  3PE3 A;  1TN8 A;  2P9P G;  3EHQ A;  4UUC A;  4FUL A;  2FBN A;  3B95 A;  3FTW A;  2LSV A;  1UN9 A;  2XPI A;  3QWP A;  3GYZ A;  2VJ8 A;  5HQ8 A;  3CST A;  3QNK A;  2CHW A;  3LY9 A;  3FU5 A;  2KCL A;  2KC7 A;  4MRU A;  2ETA A;  4JHJ A;  2CHZ A;  3AG4 E;  2L6J A;  4LCT A;  4FLH A;  1FCH A;  1BI8 B;  2QY7 A;  2WXI A;  3JXJ A;  3L13 A;  4G24 A;  2GRN B;  4AY5 A;  4GZ6 A;  5CCL A;  4CDR A;  2IOS A;  3DST A;  4A3T A;  4CDM A;  4FA6 A;  3C72 A;  1D8E A;  3L16 A;  3PUJ A;  3LVQ E;  3SGH A;  4J8S A;  1N4Q A;  4B8C B;  2IU1 A;  2GRO B;  3TWT A;  2X6J A;  4RVB A;  4A3V A;  4GTO A;  1FT2 A;  4OAU C;  3PZD A;  2DVW A;  5AAR A;  3EJN A;  3MGB A;  5B1B E;  3EU9 A;  4PS3 A;  3QAQ A;  2FF4 A;  3PE4 A;  2H6G A;  4DX7 D;  4L7T A;  3D9I A;  2C2L A;  2RFA A;  2YQ8 A;  2VGY A;  5ANR A;  4PS7 A;  4LG6 A;  4LNB A;  2WXK A;  2IO3 C;  4GPK A;  1B89 A;  5CED B;  5EYP F;  1N4S A;  1TR4 A;  1FVH A;  2KZT B;  4G26 A;  3SNX A;  4FAD A;  2HM8 A;  4GZ3 A;  2NXP A;  3FTZ A;  1P5Q A;  1N94 A;  3ASG A;  3OXF A;  3D3M A;  5EKQ D;  4Q96 A;  2WMO A;  4U63 A;  3CSF A;  3SY2 A;  2WQ6 A;  3V30 A;  3FUN A;  5CBN A;  2VTB A;  2J08 A;  4DX5 D;  2YHC A;  4CGV A;  4O1P A;  2XEV A;  4WWO A;  5FZS A;  4AY6 A;  1JCR A;  4GCN A;  2WXG A;  1DC2 A;  1LF8 A;  2ZIS A;  4MKT A;  4AOF A;  2ETB A;  3EHM A;  1U3D A;  4P29 A;  4BSZ B;  5ENS D;  3DEP A;  5EID A;  4M3O A;  4HOT A;  3R7R A;  1OWN A;  3CHM A;  2VSN A;  2L0T B;  4LER A;  3LCA A;  3VTX A;  3E30 A;  1EPU A;  3DSX A;  3FDH A;  4I1A A;  4KMO A;  2H6I A;  5FZQ A;  1TJF A;  2KBX A;  3X2Q E;  4N3A A;  3TJP A;  4CYM D;  4N5C A;  3LEW A;  5FQ4 A;  3QK0 A;  1H0A A;  3FH5 A;  2WXQ A;  3BEE A;  4KVO A;  1A17 A;  3OXL A;  5D2M C;  4JEH A;  3LJN A;  1YA0 A;  3QC1 A;  4DK5 A;  2I1K A;  1Z6T A;  4GMR A;  5CBO A;  2X38 A;  4TXQ A;  4GU5 A;  2H6F A;  4DX6 D;  3FTU A;  1E8W A;  3HXB A;  4HOQ A;  5KCM A;  5KJL A;  1KT1 A;  3UKR G;  4B89 A;  2H6H A;  5CER B;  3UIN C;  3BU8 A;  3W9G A;  3ZYL A;  3CQC B;  4HBD A;  2X3M A;  3P1U A;  3DBS A;  3C5R A;  1SVX A;  4BX8 A;  1UJJ A;  4XKC A;  3RJV A;  5HI7 A;  3CVY A;  4U0S A;  1NA0 A;  3JYS A;  4M7C A;  2MHK A;  3CGH A;  4K5C A;  4Y6C A;  4DI3 A;  2QC9 A;  4UI9 C;  4KVM A;  2J9Q A;  4I1O B;  2LAH A;  2ION A;  2XEE A;  2ZIR A;  4RG6 A;  3ZKJ A;  4F7A A;  2WXO A;  3T9K A;  4JC8 A;  3FEY A;  4C9B B;  4E85 A;  3RIB A;  1E8Y A;  1MX6 A;  3DWL G;  4AVX A;  1KLX A;  3LY8 A;  3D9K A;  4I6G A;  4TV3 A;  2BUG A;  2X6K A;  3RSE G;  5BV0 A;  4BSX A;  2FI7 A;  3LKU A;  4TUM A;  4GTT A;  3G2T A;  4AEZ C;  1KZO A;  1N4R A;  3TWV A;  3PEV B;  3U3W A;  3FY4 A;  1QZ2 A;  4GTS A;  3LDZ A;  2AXZ A;  4GB9 A;  3UQ3 A;  1NFI E;  5E75 A;  3TWS A;  1VDY A;  4XX5 A;  2CG2 A;  3U4T A;  2J49 A;  4DX2 A;  3MYV A;  5AYW D;  3EUV A;  4Y6W A;  1MX4 A;  3FUM A;  4U8H A;  2R17 C;  4EBA A;  1BU9 A;  1NL4 A;  3HXC A;  4HS2 A;  3SD5 A;  1XGW A;  3HVE B;  4GCO A;  5ARF A;  4BET A;  2QZA A;  1MYO A;  1NA3 A;  4ILG A;  5G05 C;  2J4D A;  3TWU A;  1N9A A;  4GTQ A;  4L9P A;  2KXP C;  2LAI A;  3ZYQ A;  3FTV A;  1OUV A;  3CVW A;  1TNY A;  3DSU A;  4YND A;  3S2A A;  1NZN A;  3FTS A;  2DIW A;  1H6P A;  3CVL A;  4XE0 A;  3CK9 A;  3CHO A;  1DCQ A;  3JXI A;  5CHE E;  3L22 A;  2Y4U A;  3FHE A;  4U0Z A;  4X8Q A;  1S64 A;  3D9P A;  2RFM A;  2V4L A;  3PEU B;  2QYJ A;  2DWZ A;  1N0R A;  4GMJ A;  3R7Q A;  5JMN D;  2OEW A;  2OVB A;  5ANL A;  4YDO A;  1K3Z D;  2XQ0 A;  3ABM E;  1TEZ A;  1FVF A;  4LEU A;  3QWV A;  1SW6 A;  4GYO A;  3RRM B;  3FTY A;  1ELR A;  3UTM A;  4TRQ A;  4JW1 A;  2MRI A;  5EDS A;  1OCC E;  4L23 A;  3ASH A;  5BUZ A;  5AQ7 A;  4CGW A;  4CT0 A;  5IY5 E;  4NAC A;  3ZPJ A;  5LP0 A;  2R05 A;  3PVL A;  3ULQ A;  3HG0 D;  4CDN A;  4Q69 A;  4IUL A;  4F6R D;  3HRA A;  3CKC A;  2VQ2 A;  3D9O A;  5G04 C;  2UY1 B;  1N11 A;  2F8X K;  4YDE A;  3EIQ C;  5G55 A;  4WNE A;  4N5Q A;  2WXL A;  2RD0 A;  3APC A;  3HIZ A;  1E7V A;  2EIJ E;  4G1T A;  4IN3 B;  1QYM A;  3QJZ A;  2V4H C;  4LNG A;  1H2V C;  4J8D A;  4AV7 A;  5AQA A;  3RAU A;  2A4Z A;  2P58 C;  4GZ5 A;  3Q7A A;  3NAW A;  2FO7 A;  3T8M A;  1D9S A;  4UI9 J;  1UW4 B;  3BQO A;  4A1G A;  1Z3X A;  4ME2 A;  5C1D A;  5AAO A;  4MLP A;  3FWV A;  3APF A;  4NIK A;  4WNF A;  4RG9 A;  5FT9 A;  4I43 A;  4K03 A;  3NQP A;  4FLB A;  4BTA A;  4J8E A;  3PNL B;  2BKK B;  4H7Y A;  3CVQ A;  3APD A;  5FQ8 A;  5ENR D;  1MHQ A;  1TNZ A;  1IQR A;  4GTM A;  5CMY A;  3G2S A;  1HF8 A;  4A1S A;  3UT7 A;  2J8S D;  4K5A B;  2XGM A;  3AS4 A;  1TNU A;  1YMP A;  1IYG A;  2CG3 A;  1IHG A;  3HXE A;  4G8K A;  2XPZ A;  3UX4 A;  5ITZ F;  3MV2 B;  1HXI A;  3SQV A;  3UM2 A;  3B7U X;  4MBG A;  1Y8M A;  4ANW A;  3UM3 A;  4GZD A;  3ML9 A;  3E34 A;  4XKB A;  4KXK B;  1PY1 A;  3QWW A;  3ZHE B;  3CVU A;  2XCB A;  4BWR A;  3MEK A;  1LD8 A;  2PM7 A;  4J6I A;  3NOC D;  4UQZ A;  3TL5 A;  3ZXP A;  3EDT B;  3AAA C;  1TN7 A;  5AQB A;  4N3C A;  4UWG A;  2HE0 A;  1IKN D;  4BER A;  3PUK A;  3C3R A;  4XEI G;  5D66 A;  4WWN A;  4APO A;  1DNP A;  4EQF A;  5D0Q D;  4RQI A;  1Z3Y A;  3FTX A;  3AG2 E;  3MKQ A;  4G25 A;  1BI7 B;  3JUI A;  2WXR A;  3SFY A;  4DX1 A;  4EZK A;  1EF1 C;  3E37 A;  3RRU A;  4I2W A;  5CRU A;  3ASN E;  2WQ7 A;  3RKV A;  5HRY A;  5AJD A;  3ZGQ A;  2OCC E;  4L2L A;  2AJA A;  2WXP A;  4DUI A;  2AWI A;  3ZYK A;  2XPY A;  4AP2 A;  5EX0 A;  2DZN A;  4JXT A;  3SI5 A;  1OWL A;  3KEA A;  4FJY A;  2Y69 E;  5EIL A;  1HE8 A;  2Q7F A;  4JHR A;  4A55 A;  2F0Y A;  3OAW A;  4WAF A;  3AG1 E;  2MOW A;  2VGX A;  3LJ3 A;  3ABK E;  3B7B A;  4URK A;  4PUC A;  2HYZ A;  5LOZ A;  4HRL A;  3U9W A;  4WWP A;  3CVP A;  3CVN A;  3N71 A;  1QQE A;  3URZ A;  2VSO E;  2P9S G;  4JZY A;  2ZGG A;  1MQS A;  3F6Q A;  2XEN A;  2E2E A;  2GRP B;  4JVS A;  3ABL E;  4GTR A;  3GZS A;  5HS0 A;  4BFR A;  5ARG A;  5KWD A;  5AJL A;  2EIL E;  2KM4 A;  1WG0 A;  3OXG A;  2KCV A;  3FP3 A;  4CT4 A;  3PRE A;  1BPO A;  4UQX A;  4BT8 A;  4JD2 G;  4NRH B;  4KBQ A;  3Q5M A;  1FPP A;  2P9I G;  1RW2 A;  3NB2 A;  2Y3A A;  4ANU A;  5J90 A;  3U64 A;  3IHY A;  4PS8 A;  5G04 J;  3AS8 A;  3SF4 A;  4MS6 A;  5C2Y A;  2EIK E;  3TWX A;  3UKU G;  1X81 A;  4GTV A;  2ZXW E;  3LXU X;  4GA2 A;  3AU5 A;  5FQ6 A;  5LCW C;  3I4R B;  4U96 D;  4TUU A;  5JJT A;  4HXI A;  5CEC B;  1UN8 A;  4ZHB A;  2WM9 A;  2XCC A;  4K5B A;  3L82 A;  4G8L A;  2PQN A;  3DEO A;  4I2Z A;  3DPY A;  2GGF A;  2XGO A;  4GA1 A;  3J5Q B;  3D9L A;  5CCM A;  3I5P A;  1TNO A;  2X6F A;  5KJN A;  2I2O A;  2DZO A;  4HOU A;  3MV3 B;  2NC9 A;  4UWK A;  5FIO A;  1IXV A;  4ZFH A;  3RRN B;  1S63 A;  2Y4T A;  4HLE A;  4O1O A;  1UOH A;  2V5Q C;  3HXF A;  2P9K G;  2C0L A;  2VSY A;  3PZ3 A;  4B0Z A;  4G23 A;  4YDW A;  5BXO A;  4EPZ A;  3B7S A;  5EIB E;  2ZU6 B;  3O4Z A;  2JEK A;  5CMW A;  4V3I A;  3HDX A;  3PH0 C;  4C48 B;  3LYA A;  4RLY A;  5JJ7 A;  4ILI A;  4Z68 A;  3PS6 A;  3CKB A;  4B8A A;  4KZ0 A;  3TXN A;  3ZRH A;  3SFX A;  3PNT B;  1ELW A;  3C3Q A;  3D9N A;  2KAT A;  4C0E A;  4YVQ C;  1GW6 A;  3DSV A;  3V31 A;  2FUL A;  4O60 A;  3ML8 A;  2WPV A;  5B1A E;  1TYQ G;  3FUK A;  3Q78 A;  3BUA A;  3RK6 A;  4N2S A;  3PZ2 A;  3ZXS A;  5D0O D;  1OY3 D;  4PDX A;  1ZBP A;  2OND A;  4J0U A;  2ETC A;  3FU3 A;  3SO8 A;  4RSY A;  4JHK A;  5H7P A;  1KPS B;  3HXD A;  4I9E A;  4HRM B;  3IXE A;  2WQH A;  4NUR A;  4U04 A;  4FHJ A;  3ENE A;  2IFU A;  2L0I A;  5KJM A;  3FUH A;  3G2U A;  3TGO A;  2XHE A;  3B13 A;  3UI2 A;  4A63 B;  4DPR A;  5FIN A;  5CRV A;  3FH8 A;  4CEM A;  3UIP C;  1U3C A;  4ACL A;  2WXF A;  4B94 A;  1OCZ E;  4D10 C;  3C3O A;  5DBK A;  3AU4 A;  2DYS E;  4HOR A;  2LO6 A;  2RG8 A;  4U95 D;  2I6H A;  1HZ4 A;  2P9N G;  2V0P A;  3LPZ A;  2VTB B;  4DRX E;  4IYP A;  4HB5 A;  2ILR A;  5M72 A;  3TXM A;  3KS2 A;  2IO2 C;  3RO3 A;  5JHB A;  3PDN A;  3CR3 A;  4I1M A;  5A6C A;  1OT8 A;  2NSZ A;  1YCS B;  2KZT A;  3MJW A;  4WND A;  3AG3 E;  3B7R L;  4FC8 A;  3QAR A;  3ZN3 A;  4G11 A;  4I9C A;  1QBQ A;  5LCW J;  3KSQ A;  2IEJ A;  4UWF A;  3HHM A;  1OCO E;  2XEH A;  3FUE A;  3VLF A;  4HFG A;  2WXJ A;  4E6H A;  1NI1 A;  1HS6 A;  1Y6I A;  3UT8 A;  4GPM A;  3EIJ A;  1D8D A;  5EYL A;  4K0R A;  5AIJ A;  2V8S E;  1RZ4 A;  4KZC A;  2XZD G;  3UUX A;  2A5E A;  3DSW A;  3IHV A;  4KYO B;  5EX3 A;  2OEV A;  2A5U A;  2IY0 C;  3CV0 A;  5BT1 A;  3ONL A;  4JPS A;  5CEA A;  2WXH A;  2E0I A;  4L1B A;  5T4Y A;  2GRL A;  3CK7 A;  3KD7 A;  5BW8 C;  2F37 A;  4UWL A;  2AXU A;  1IHB A;  4C0M A;  3AJI A;  5FJY A;  3L54 A;  3UXG A;  1SZ9 A;  3FUI A;  4F3V A;  1U2V G;  5FTP A;  4LUN U;  2DCP A;  1N52 A;  3SBS A;  5KJK A;  3KSL A;  4N2Q A;  1XNF A;  3Q9U C;  4JL0 A;  4JEU A;  3MZL B;  4JA9 A;  2PM6 A;  3E32 A;  4XI0 A;  2LXM A;  3LY7 A;  4U8Y D;  1QNF A;  3ZIM A;  1PAQ A;  4BY6 A;  1SZA A;  3RO2 A;  3ASF A;  3FFL A;  4F1P A;  2QYU A;  2NYJ A;  1EDU A;  1K8K G;  1HG2 A;  1YYH A;  3D9H A;  2FO1 E;  4PH4 B;  3CLJ A;  4CRW A;  3Q7F A;  4AIF A;  3ONK A;  4LRZ A;  1K1B A;  3IEG A;  2XS8 A;  4Q94 A;  3I4G A;  2AXV A;  2VSX E;  2PL2 A;  3QOU A;  2IOL A;  3UMV A;  3Q75 A;  1E96 B;  1OWP A;  5T3R A;  2QFC A;  3TWW A;  4JA7 A;  2F8Y A;  3TG5 A;  5ENT D;  2BF0 X;  1O1R A;  1JWG A;  4IRU A;  1DCE A;  3P2B A;  1SQM A;  5FWQ A;  5LX8 A;  1E90 A;  3T5V A;  4GA0 A;  3ULE G;  4XI9 A;  4GTP A;  2R03 A;  5LFA A;  3MA5 A;  3S7J A;  1N0Q A;  4ILH B;  3SHF A;  4FHK A;  1W3B A;  2LXL A;  2VYI A;  3R9M A;  3ULY A;  1H19 A;  2IJG X;  4LSZ E;  3MCX A;  4AJW A;  1UJK A;  1O1S A;  4ATZ D;  3SFZ A;  4DLO A;  2YIN A;  3I3N A;  1KT0 A;  5EN5 D;  2B6C A;  4H7X A;  5G05 J;  4EBA G;  1TJC A;  4BT9 A;  1WAO 1;  2EIM E;  3ASD A;  3UIO C;  4BEP A;  4I6E A;  3T5X A;  3S7F A;  1G3N B;  2BTD A;  2CFZ A;  5AN8 A;  2OOE A;  2EQX A;  3MX3 A;  1JUQ A;  4UQY A;  3S7B A;  2MYO A;  3Q73 A;  3CVX A;  4J8Y A;  4EEC A;  4DI4 A;  3RU0 A;  1TN6 A;  3DXK G;  5J08 A;  2WXN A;  1JPL A;  3FUD A;  4OYS A;  3L17 A;  4U8V D;  1V54 E;  4F1S A;  4BTB A;  1HFA A;  1A5E A;  4CCA A;  4JB8 P;  3L08 A;  2GRQ B;  4ABN A;  3NBN B;  1JCQ A;  3NF1 A;  3HVE A;  3TG4 A;  1BD8 A;  4AXH A;  4APF A;  3NZS A;  3FUF A;  2C0M A;  3AS5 A;  3JQ0 A;  1OCR E;  4EHM A;  3CHS A;  2R2L A;  1LD7 A;  1HO8 A;  2FEZ A;  1HU3 A;  3QDN A;  3IBE A;  3Q15 A;  4G2V A;  1K1A A; 
#chains in the Genus database with same CATH homology
 3UIP C;  1Z5S C;  3UIN C;  2GRR B;  3UIO C;  2GRN B;  2GRQ B;  2IO3 C;  2IO2 C;  1KPS B;  2GRO B;  5D2M C;  2GRP B;  2IY0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...