4DI4A

Crystal structure of a 3:1 complex of treponema pallidum tatp(t) (tp0957) bound to tatt (tp0956)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
273
Chain Sequence
DADFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TatT (Tp0956)
publication title Structural and Thermodynamic Characterization of the Interaction between Two Periplasmic Treponema pallidum Lipoproteins that are Components of a TPR-Protein-Associated TRAP Transporter (TPAT).
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
molecule tags Transport protein
total genus 103
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4di4A00
4DI3A 3U64A 4DI4A
chains in the Genus database with same CATH superfamily
3C3QA 1D8DA 3ZHEB 1O1SA 1S63A 5LOZA 4P29A 2BKGA 2WM9A 3QB2A 4N5QA 3QK0A 1IQRA 1Q2ZA 2FBNA 4UWGA 3ZUVB 1SQMA 1OWOA 3QAQA 4URKA 2IOSA 4A3VA 4A63B 3JXIA 2YHEA 5EYLA 5AJDA 4CDNA 3FU3A 3CQCB 3CEQA 3ULEG 4AIFA 1X81A 5JA4D 4UWKA 4WWNA 1OY3D 2VGXB 3CHPA 2BKKB 2WQ7A 4QFVA 5CECB 3QWPA 4R7LA 4KYOB 4UUCA 1QQEA 2QYUA 4DUIA 2H6HA 4XEIG 4E85A 2OVFA 2AXZA 2QFCA 3U9WA 5AQ9A 1N54A 2BTDA 4F7AA 1OWLA 2AXUA 1U3CA 2FEZA 4F53A 4JL0A 4YDEA 4ILHB 1N95A 3FFLA 1Z6TA 3B7BA 5ENRD 3JUEA 3UM1A 4LERA 1NP7A 5CRUA 4LSZE 4IULA 1H6KA 2XGMA 2WXJA 3FU5A 5T4YA 3ABLE 3OXFA 1BU9A 3W9FA 4CT0A 3B7SA 4KZ0A 3C5RA 4I2ZA 4A1SA 3RRNB 1Z5SC 3LKUA 1NZNA 3TWRA 2WXLA 4AV7A 1MHQA 3UPVA 3AU4A 4I1OB 3UM3A 1INZA 5IY5E 3I3NA 5H7PA 4OAUC 4AOFA 2F8XK 3NF1A 2QY7A 2GRMA 4HOUA 3LJNA 4UWHA 4FLBA 3OXLA 3L9TA 1ZU2A 3ONKA 2M63A 3SNXA 4C48B 4K5AB 4W9RA 2LNIA 3FULA 3FTUA 3L54A 4PS3A 4ZHBA 3ONLA 4PS7A 1YCSB 4GCNA 5AENA 4ILGA 4A55A 4U8VD 5KCMA 3AG4E 4G11A 1E90A 3EHQA 2HO1A 1E8YA 1FCHA 2VJ8A 3R7QA 4I17A 1TNOA 4B89A 2R03A 4HS2A 3DBSA 3Q7FA 2PZIA 3FUKA 2I1KA 2KCVA 2IFUA 2P9PG 4AP2A 2P9SG 2NYJA 5FQ8A 1MX2A 3HVEB 3APCA 3ZU7B 1OWMA 1KZPA 2FO7A 3F6QA 3L13A 4GYOA 2XRYA 1SW6A 1Y6IA 4HOSA 3CGHA 3ASNE 4HB5A 3CHQA 5BXUA 2J9QA 3FY4A 2WXFA 5G05C 3TWUA 3L08A 2EQXA 3HXEA 1DCEA 3LYAA 4UI9K 3B95A 2DZNA 4U04A 2IEJA 2X38A 5BUZA 3FTVA 2H6GA 3UIPC 2RKKA 4LG6A 4UI9J 2X6FA 2ZXWE 4HRMB 3L22A 4EZJA 5D66A 4FA6A 2PQRA 3L6AA 3OXGA 3APFA 3CVNA 5CEAA 3FTWA 3PH0C 5AJLA 1N94A 4HORA 4GA2A 2P9LG 2XZTG 3LY7A 3RSEG 4HVBA 4CZ2D 3TWSA 5CCLA 1OCZE 3CIAA 3ABME 3CHOA 3S2AA 2WVIA 4O60A 3BG1B 4I6EA 2J08A 3ZGQA 4GTQA 1HH8A 3SGHA 1MX6A 3JCKC 5ITZF 4B94A 3QC1A 2XEHA 1H2UA 3DSUA 2PNNA 4J8YA 4HNAD 3RO2A 2XENA 4EECA 2OVBA 3PE3A 3D9MA 3HDXA 5BV0A 4LNGA 3FP3A 3CVWA 4XI9A 5A23A 5JMND 4G25A 2GGFA 4A3TA 1Z3XA 4JVSA 3J5QB 3CV0A 4KMOA 3PZ4A 3ZYMA 3DEPA 4XI0A 2MYOA 5B1AE 3U66A 3HXFA 4KXKB 1SA5A 3QARA 3PZ1A 2UY1A 3QNKA 2B0OE 3GW4A 4HRLA 2VTBB 3B7TA 2ILRA 3ULQA 5G2NA 3DSWA 5AQ7A 3V2XA 3IEGA 3MJWA 3CKBA 5T8IA 2XPZA 4X8QA 3PUJA 3JQ1A 4GTRA 4JA7A 5HI7A 2J8SD 2CHXA 2VSXE 2DYSE 3FTZA 3I5PA 1HU3A 3D9PA 1FVHA 2J09A 4APOA 4BTBA 5A7DB 4FJYA 2E0IA 3I4RB 4HI8A 3W9GA 4J0UA 1H19A 2JEKA 5ANLA 4MLPA 3SQVA 2WXRA 4BERA 1BD8A 3O48A 4WWPA 4XE0A 5LCWC 5JJ6A 5DIZA 2DWZA 4Y6CA 1ELKA 2WXNA 2Y3AA 3T8KA 3CK8A 4YVQC 1PC2A 2VGEA 3Q75A 2CFUA 2JLBA 4GMLA 3QDNA 1KPSB 4I9CA 4O6FA 4ATGA 1V54E 4O1PA 2OEVA 3GZ1A 1N4RA 1OCRE 4WNDA 4ILIA 4LRZA 1TN8A 2ONDA 1XGWA 4DX7D 4GZ3A 2FF4A 4JHKA 4MBGA 2VSOE 5AIJA 3FH5A 4F6RD 1SVXA 4RG6A 3APDA 4XKCA 5FIOA 2CHZA 2XS8A 2XS1A 2YHCA 3LXUX 4XIFA 3CVVA 3IHYA 2KC7A 1O5MA 1MJ0A 1N4QA 4GZ5A 3C3RA 4LEUA 2PM6A 4GTOA 4EPZA 2NSZA 2JABA 3EU5A 4AVXA 2AJAA 2WPVA 3ZKJA 3LCAA 2WXQA 2C0MA 1KT0A 2MHKA 3MKQB 3TL5A 4Q69A 2HYZA 4GAAA 1O1TA 3E30A 3CK7A 2RD0A 4GYYA 4HFGA 4BX8A 5KJMA 2BUGA 3K9IA 2WMOA 1XNFA 3TWTA 3UM0A 1IKND 4ME2A 2OCCE 5EX0A 3EDTB 1SA4A 3VLDA 5LFAA 4L9PA 1BLXB 3CSFA 3KS2A 3AS4A 4TV3A 3ESKA 4U8YD 2CG2A 1TNUA 1N0QA 3ZFWA 2R02A 5KJNA 1OXJA 5D2MC 4C0MA 3FUHA 3C72A 1A5EA 3TJPA 4DJAA 2X6IA 1BI8B 2GRLA 3PNTB 3LVRE 1EF1C 1BPOA 2KXPC 2OV8A 2L0IA 5ENOD 3U64A 5B3SE 4JHJA 3FUIA 2XEVA 3I4GA 2LO6A 2XCCA 4HRNA 4AY5A 2PL2A 3ASFA 3SF4A 1UW4B 2CG3A 3KD7A 2BEDA 5CMYA 3TXNA 3BUAA 5JJ7A 3T5VA 2WQHA 4H7XA 5AN8A 3ZXPA 1AP7A 1QBQA 3FDHA 3T9KA 1RZ4A 4UQZA 4MRUA 5AARA 3B7RL 1DCQA 2P58C 3ML9A 1TEZA 4I9EA 4I2WA 2Y4TA 2ETCA 4BESA 3FUEA 3D9OA 2QC9A 4GZ6A 3X2QE 5EIDA 4J7WA 3TWXA 4NURA 3DSTA 4FP7A 4DI3A 3C3OA 3UM2A 5G55A 3QOUA 4FLHA 5BNWA 3Q9NC 3CVYA 3P1UA 2I9CA 1PY1A 3DPDA 4B8CB 2YINA 4DLQA 4GMRA 5FQ4A 4ZFHA 2L0TB 4UWLA 5KWDA 4TRQA 1DNPA 3JYSA 1N4PA 4I6JA 4N2QA 2XGSA 4ATZD 2P2CP 2X6HA 4ANXA 2F8YA 1E7UA 1UOHA 5EYPF 1GW6A 1K1BA 2EIKE 2QZAA 1O1RA 2YNQA 3GYZA 5AQAA 2XHEA 4CGVA 4PUCA 2LSUA 3ABKE 3S7BA 2OEWA 2X3MA 5G04J 3T8MA 5ENTD 1JUQA 3LPZA 5E75A 1LF8A 5CBOA 1YYHA 2VSNA 1N52A 4XKBA 4AY6A 4FHJA 3U4TA 4BX9A 5EIBE 3HYMB 2UWJG 2EILE 1NA3A 2FULA 3MEKA 3SFYA 3RIBA 2A5UA 4L2YA 4AM9A 4TUMA 3TWVA 1QNFA 3S7DA 4GTVA 5CBNA 3CSTA 4OVUA 4AJWA 1NI1A 3AG2E 3VLFA 2WQ6A 3SY2A 3HHMA 2YQ8A 4LUNU 3UI2A 3Q47B 3DWLG 3UKRG 3EUVA 2KZTB 3D9HA 4U0UA 4FJZA 5CEDB 4BTAA 2WXOA 2P9UG 1W3BA 1FT2A 3LY8A 5HS0A 1JCRA 3NZUA 3HXCA 3R9AB 3NZSA 4U07A 1Y8MA 3T5XA 1K3ZD 2I2OA 4J8SA 1DVPA 4WNFA 2IO2C 3GZSA 5ARGA 4CEMA 4EHMA 2RFMA 2X6JA 1E8WA 4DX2A 4EZKA 4WUYA 4JHRA 1D9SA 5CMWA 4ACKA 4G2VA 1KLXA 2H6FA 1LD7A 3UX4A 5CHEE 4CYMD 4JB8P 4EBAG 3CHMA 2LAHA 1RW2A 5FZRA 5C2YA 4G8LA 3E4BA 1X5BA 3PUKA 3TXMA 3JXJA 3FHEA 4BWRA 5ENNA 4GA0A 5AQBA 1HX8A 2WXKA 4C9BB 1IHBA 2HR2A 2GROB 2V0PA 3QWWA 4ANWA 2XQ0A 5EKQD 3SD5A 1JWFA 3KAEA 4CGWA 2I6HA 3FEYA 3ASDA 4PDXA 3OAWA 3DXMG 1S0PA 2F0YA 2F37A 3ULYA 4H7YA 4RQIA 3NBNB 2NXPA 3FUDA 4G1TA 3RRUA 4O1OA 2WXGA 1KT1A 2KATA 4DK5A 3PZ2A 2R2LA 1IQUA 3AU5A 1UG3A 2VQ2A 4YDYA 5J90A 2IONA 1E7VA 3MX3A 2MRIA 4CRWA 3NB2A 3D3MA 4N3CA 3Q5MA 4N39A 2C2LA 4N3AA 5ENQD 2KM4A 5ANRA 1HG5A 4L23A 3MCXA 4HI9A 3WG7E 5BW8C 5HKPA 2NC9A 1HZ4A 4JEHA 4ABNA 2ZISA 4MKTA 3Q49B 4JZYA 4Q96A 3E33A 1IHGA 1N11A 1D8EA 4JA9A 5CCMA 5EX3A 1FT1A 3PZ3A 5J08A 2DYRE 3PE4A 4GPKA 3VLEA 3HRAA 1A17A 2XEEA 5FJYA 1KZOA 1PAQA 3D9JA 4UQXA 2RFAA 4OVVA 3BEEA 1S70B 3EU9A 2ETAA 3QWVA 3FUMA 4GA1A 3V79K 4GPMA 3CVQA 3EIJA 1EPUA 1EDUA 3NQPA 4BT9A 1SZAA 2ETBA 2J4BA 4MS6A 4XX5A 4GTPA 1WY6A 3MYVA 3BU8A 1ZBPA 1OWPA 1IXVA 3KEZA 2GRQB 5HQ8A 3E32A 4UWFA 4GCOA 4Q94A 4UI9C 4ANUA 5AAOA 3Q9UC 3DSSA 4HLEA 4B0ZA 3MV3B 3VTYA 4JW1A 3D9NA 4APFA 3CR3A 4U96D 4K0RA 3L16A 4CT4A 2R59A 5KJLA 3JUIA 1UN8A 1TJFA 3R7RA 3SBTB 4TUUA 5D0QD 1OCOE 5KJKA 1JCSA 4KVMA 2WXHA 3AS8A 4TXPA 4C0EA 4JC8A 1HF8A 1TNYA 4DI4A 1NL4A 5JHBA 3ZW3A 5CERB 3ENEA 3ZYKA 5D0OD 4KZCA 3Q7AA 3UMVA 1OT8A 2KCKA 3CHSA 1E96B 3DRAA 3Q4AB 4JPSA 4N2SA 4YDWA 3HIZA 4FULA 1S64A 2VSYA 3DEOA 3FH8A 3NAWA 4HOTA 1IYGA 3CLJA 3B13A 1QZ2A 5KNHD 5FINA 4CDMA 3G2UA 2AXVA 3SFXA 1WG0A 4FADA 3FUNA 2LUHA 3CVPA 2XRZA 5EDSA 2FO1E 3SI5A 4QQIA 3G2WA 4I1MA 4NIKA 1H6PA 3RU0A 4BSXA 4V3IA 5C1DA 2GRNB 1HO8A 3LS8A 2V8SE 3ZHEA 1JCQA 3AG3E 5M72A 5G05J 5JJTA 1K1AA 3AJIA 1FVFA 4A1GA 2FI7A 4KVOA 3PREA 4IRUA 3RAUA 4GTSA 4G24A 3SO8A 3L17A 5FQ7A 2WXPA 3D9LA 3VTXA 2J49A 3ASOE 3SHFA 3UQ3A 3BQOA 3PZDA 2XZDG 4PH4B 4HQDA 4YNDA 2VGXA 3ISMC 3HXDA 1MX4A 2XPIA 4DX1A 3V2OA 3UT8A 1HE8A 4I1AA 3PRZA 1E8ZA 1HFAA 2ZGDA 2XGOA 3CVXA 1OCCE 1MYOA 1JWGA 1WAO1 3NOCD 3G2TA 4B93B 5LX8A 2LAIA 4U63A 4OAVB 2ZIRA 3EHRA 1TJCA 2BF0X 3GZ2A 3AAAC 3QJZA 4LNUD 3B7UX 4K5BA 2GW1A 1K8KG 3IV0A 1H2VC 2IY0C 5EILA 2R17C 2OOEA 3KEAA 4KBQA 4AEZC 3U3WA 1SZ9A 3P2BA 1V55E 4NQ0A 4DX5D 3V30A 4F3VA 3JQ0A 2L6JA 4FC8A 4WNEA 2VYIA 4K03A 4LCTA 4GZCA 2ZU6B 2DVWA 1NFIE 2J07A 1L5JA 4AXHA 4RVBA 4J8DA 2A4ZA 1VDYA 3TWWA 2H6IA 3ZIMA 1TN6A 2QYJA 5FQ6A 3ZN3A 5FT9A 4J8EA 2V5FA 3O4ZA 2Y69E 1OWNA 3E34A 1ELRA 5ARFA 4HLLA 4BFRA 2L9BA 2LXMA 3E37A 2A5EA 3TG5A 5E76A 5LP0A 2IJGX 3KSLA 1N4SA 1QYMA 3MV2B 4U95D 3RKVA 3CVUA 2X6KA 1JPLA 2HM8A 5LCWJ 3IBEA 3FTXA 5DBKA 3UKUG 4BETA 2LXLA 3CQGB 4FHKA 2KCLA 3EHMA 4U8HA 3Q15A 3FWVA 2AVPA 2EIME 3LDZA 4N5CA 3S7FA 3WXXA 1AWCB 3HVEA 4BT8A 2R05A 2KZTA 3NOGD 4RLYA 1EYHA 3PVLA 3SZ7A 4RG9A 3ZVVA 4DPRA 2XCBA 4J8FA 4DX6D 3J5PA 3PDNA 3EIQC 3BG0B 2HE0A 4KT6B 2EINE 3G2VA 2L6BA 3ZEFA 4WWOA 4G26A 1MZCA 3UT7A 3C98A 3ZNGA 4HXIA 4K5CA 3DPYA 2DIWA 5HRYA 2XPYA 3EHNA 5BT1A 4EQFA 3FU6A 2GRPB 3URZA 3UT4A 5FWQA 3RJVA 1LD8A 1LTXA 1U3DA 3LVQE 5KNGA 3UTMA 2Y1LE 3AG1E 1UJKA 3PS6A 2E2EA 5FZSA 4DLOA 3Q79A 3IHVA 3ZYQA 4DRXE 4TXRA 2CHWA 3UXGA 4GTMA 4CCAA 3FTSA 2AWIA 2R5SA 1TN7A 4LNBA 4G8KA 4D10C 5T3RA 3TAXA 4M3OA 4F1SA 2WXMA 4I43A 5ENPD 4NACA 3ASGA 4EBAA 3ZXSA 3IXEA 1YA0A 2V4LA 3EJNA 3SFZA 1NA0A 2PQNA 2RG8A 2DCPA 3UIOC 4NRHB 2DBAA 2UY1B 2LSVA 2ZGGA 2KBXA 3MA5A 3HXBA 3AS5A 3RO3A 4GU5A 4ACLA 4PS8A 4L1BA 3R9MA 4FU3A 4JD2G 3CHRA 5G04C 2I1JA 4GMJA 5JHAA 4HBDA 2J4DA 3PNLB 2IF4A 4CDRA 3ASHA 1FPPA 3RRMB 4OYSA 4TXQA 4BSZB 5FTPA 3G2SA 4I6GA 4U0ZA 1MQSA 4L2LA 2IOLA 3S7JA 1ELWA 2VTBA 4IYPA 3OTNA 1YMPA 3CK9A 4WNGA 2EIJE 3ZPJA 1WDYA 3KSQA 4J6IA 1UJJA 3PEUB 3Q78A 5BV1A 4YDOA 4HOQA 3D9IA 4JEUA 3FTYA 4EZLA 2IO3C 5EN5D 3RK6A 2P9NG 2B6CA 2P9KG 3IKOB 3ZRHA 5CRVA 1BI7B 1H0AA 3HG0D 3MKRA 3PEVB 3QKYA 4B8AA 1G3NB 2WMNA 2C0LA 3LY9A 4BEPA 4IN3B 1HS6A 2Q7FA 3DSXA 4GTTA 2AW6A 5AYWD 1H2TC 4N3BA 3LJ3A 4G23A 1E8XA 1N0RA 3ML8A 3UINC 1TNBA 2CFZA 3ZYLA 1UN9A 3Q73A 4U0SA 4GYWA 1HXIA 1OUVA 5KBAA 4U7EB 3TGOA 1H6OA 2Y0BG 2GRRB 1Z3YA 3V31A 2V4HC 2PM7A 3SBSA 3ESLA 3DXKG 5A6CA 4GB9A 2WB2A 4L7TA 1P5QA 3FH7A 5BXOA 1WM5A 3UUXA 3TWQA 4XZ4A 1TYQG 3TG4A 3LEWA 4GZDA 5BPPA 5ENSD 3L82A 3CVLA 4UQYA 4WAFA 3FEXA 4M7CA 4RSYA 4JXTA 3FU0A 4YVOA 2DZOA 2V5QC 2VGYA 2Y4UA 3D9KA 3N71A 5FZQA 5B1BE 3MGBA 4Y6WA 3FUFA 1HG2A 3CKCA 1B89A 1U2VG 2P9IG 1TR4A 4BY6A 3DSVA 4E6HA 1N9AA 2MOWA 3MKQA 2WXIA 2IU1A 3MZLB 1DC2A 4ANVA 1TNZA 4Z68A 2IQCA 1ZB1A 4F1PA 3FUJA
chains in the Genus database with same CATH topology
4KBQA 3CHMA 4AEZC 4J0UA 1H19A 2LAHA 3U3WA 2JEKA 3ZHEB 5FZRA 1SZ9A 3P2BA 4MLPA 5ANLA 5C2YA 3E4BA 1X5BA 4NQ0A 2WXRA 4F3VA 3JQ0A 3PUKA 5LOZA 4P29A 2L6JA 3O48A 4FC8A 4XE0A 4WWPA 5LCWC 3TXMA 4WNEA 5DIZA 4Y6CA 5JJ6A 2VYIA 2WM9A 1ELKA 3FHEA 3QB2A 4K03A 2WXNA 4LCTA 4GA0A 4GZCA 5ENNA 4BWRA 2Y3AA 3CK8A 2ZU6B 4YVQC 1PC2A 1HX8A 2WXKA 3QK0A 1IQRA 2FBNA 2CFUA 2J07A 2JLBA 4GMLA 4C9BB 3QDNA 1L5JA 2HR2A 4UWGA 4I9CA 2V0PA 3QWWA 4O6FA 4AXHA 4RVBA 4ANWA 4ATGA 2XQ0A 1SQMA 1OWOA 2A4ZA 3QAQA 1VDYA 4J8DA 5EKQD 3SD5A 4URKA 2IOSA 1JWFA 3KAEA 3GZ1A 4A3VA 3ZIMA 4CGWA 2I6HA 2YHEA 3FEYA 3ASDA 4WNDA 4PDXA 5FQ6A 5AJDA 3ZN3A 4ILIA 3OAWA 3FU3A 3CQCB 4CDNA 3CEQA 5FT9A 4LRZA 4J8EA 4AIFA 1S0PA 2ONDA 2V5FA 1XGWA 4UWKA 4WWNA 3O4ZA 2FF4A 4GZ3A 1OWNA 4H7YA 2VGXB 3CHPA 1ELRA 4JHKA 2VSOE 5ARFA 2WQ7A 4QFVA 5AIJA 4BFRA 3FH5A 2NXPA 3QWPA 3FUDA 4RG6A 4G1TA 2L9BA 3RRUA 4R7LA 2WXGA 1KT1A 3APDA 3TG5A 4XKCA 5E76A 4KYOB 2KATA 5LP0A 4DK5A 2IJGX 2CHZA 3AU5A 1IQUA 1QQEA 1UG3A 2VQ2A 2YHCA 3LXUX 4XIFA 5J90A 3CVVA 3IHYA 4E85A 2IONA 2KC7A 3MV2B 1E7VA 3MX3A 3RKVA 4GZ5A 2MRIA 2OVFA 3CVUA 4CRWA 2AXZA 2QFCA 3U9WA 4LEUA 3D3MA 2X6KA 4N3CA 1N54A 1JPLA 2BTDA 2HM8A 2PM6A 3Q5MA 2C2LA 1OWLA 2AXUA 4N39A 4EPZA 4F7AA 5LCWJ 3IBEA 1U3CA 4N3AA 2FEZA 4F53A 3FTXA 5DBKA 2NSZA 4JL0A 4AVXA 2WPVA 2KM4A 4ILHB 5ANRA 1HG5A 4L23A 3MCXA 3CQGB 4FHKA 3LCAA 2KCLA 5BW8C 2WXQA 3FFLA 3EHMA 2C0MA 4U8HA 1KT0A 2MHKA 3MKQB 3TL5A 4Q69A 2NC9A 3FWVA 3Q15A 2AVPA 1HZ4A 1Z6TA 4JEHA 2HYZA 3LDZA 4GAAA 4N5CA 3S7FA 3WXXA 3HVEA 4BT8A 4ABNA 3CK7A 2KZTA 2RD0A 4MKTA 4GYYA 3Q49B 4HFGA 4BX8A 4JZYA 5KJMA 2BUGA 4LERA 1NP7A 3K9IA 1IHGA 4Q96A 1EYHA 2WMOA 1XNFA 3PVLA 3SZ7A 4IULA 4RG9A 1H6KA 2XGMA 4JA9A 3ZVVA 5CCMA 5EX3A 4DPRA 2XCBA 4J8FA 4ME2A 2WXJA 3FU5A 5EX0A 3EDTB 3PDNA 5T4YA 3EIQC 3OXFA 4CT0A 3B7SA 3BG0B 4KZ0A 3VLDA 5J08A 5LFAA 4KT6B 4I2ZA 3G2VA 3PE4A 3CSFA 4A1SA 3KS2A 4GPKA 3ZEFA 4WWOA 3AS4A 3VLEA 4TV3A 4G26A 3ESKA 3UT7A 3RRNB 3C98A 3LKUA 1NZNA 2CG2A 1A17A 2WXLA 4HXIA 4AV7A 1MHQA 3ZFWA 2DIWA 3UPVA 3AU4A 2XPYA 5FJYA 5KJNA 4I1OB 3EHNA 5BT1A 4EQFA 3FU6A 1INZA 1PAQA 3I3NA 3D9JA 3URZA 3UT4A 4C0MA 4AOFA 5FWQA 3RJVA 4UQXA 3FUHA 3NF1A 2QY7A 1U3DA 4OVVA 3BEEA 3TJPA 2GRMA 3LVQE 4HOUA 4DJAA 2X6IA 1UJKA 2GRLA 4UWHA 3PNTB 4FLBA 3OXLA 3PS6A 3LVRE 1EF1C 2E2EA 5FZSA 4DLOA 1BPOA 3QWVA 3FUMA 3IHVA 1ZU2A 4GA1A 2OV8A 3ZYQA 2CHWA 3ONKA 2M63A 3SNXA 2L0IA 4W9RA 3U64A 2LNIA 3CVQA 3FULA 3EIJA 3FTUA 4CCAA 3L54A 4PS3A 4JHJA 3ONLA 1EPUA 1EDUA 2AWIA 3FTSA 4PS7A 3FUIA 2R5SA 3NQPA 2XEVA 3I4GA 4BT9A 4GCNA 2LO6A 2XCCA 4AY5A 4D10C 1SZAA 5AENA 5T3RA 3TAXA 4M3OA 4F1SA 2WXMA 4I43A 2J4BA 2PL2A 4ILGA 4MS6A 4XX5A 3ASFA 3SF4A 4A55A 1UW4B 2CG3A 1WY6A 3KD7A 4NACA 3ASGA 4EBAA 3MYVA 5KCMA 3ZXSA 1YA0A 1ZBPA 4G11A 5CMYA 3TXNA 5JJ7A 1E90A 3T5VA 2HO1A 1OWPA 3KEZA 1E8YA 1FCHA 5HQ8A 2VJ8A 2WQHA 4UWFA 4H7XA 4GCOA 2V4LA 4Q94A 3EJNA 3R7QA 4I17A 3FDHA 4UI9C 4B89A 4UQZA 1NA0A 2PQNA 2RG8A 2DCPA 3SFZA 4HS2A 4MRUA 4ANUA 3B7RL 4NRHB 2DBAA 2UY1B 3DBSA 2PZIA 2P58C 3FUKA 2I1KA 2KCVA 2LSVA 3ML9A 2IFUA 4HLEA 4AP2A 1TEZA 4B0ZA 3MV3B 4I9EA 5FQ8A 3VTYA 4I2WA 4JW1A 3D9NA 2Y4TA 4APFA 3MA5A 3CR3A 3FUEA 3HVEB 4K0RA 3D9OA 3AS5A 3RO3A 3APCA 4GU5A 4ACLA 4GZ6A 1OWMA 3L16A 4PS8A 4L1BA 4FU3A 4NURA 4CT4A 4DI3A 4FP7A 2R59A 3CHRA 5G04C 5KJLA 2I1JA 2FO7A 3L13A 4GMJA 5JHAA 4GYOA 2XRYA 3JUIA 1UN8A 1TJFA 2J4DA 1Y6IA 4HOSA 5G55A 3PNLB 3R7RA 3QOUA 4FLHA 3SBTB 3CGHA 4TUUA 3CHQA 5BNWA 5D0QD 2J9QA 3FY4A 5KJKA 3CVYA 2IF4A 3P1UA 2I9CA 4KVMA 4CDRA 1PY1A 3ASHA 3DPDA 2WXFA 2WXHA 3AS8A 5G05C 4B8CB 4C0EA 2YINA 4JC8A 3RRMB 1HF8A 4OYSA 4DLQA 3L08A 5FQ4A 2L0TB 2EQXA 4UWLA 5FTPA 4DI4A 5JHBA 4TRQA 3ZW3A 3G2SA 4I6GA 3ENEA 3LYAA 4U0ZA 3ZYKA 4UI9K 5D0OD 1MQSA 4KZCA 4L2LA 3UMVA 4U04A 2IOLA 1DNPA 2KCKA 3CHSA 2X38A 3S7JA 1E96B 5BUZA 3Q4AB 1ELWA 4JPSA 3JYSA 4N2SA 4I6JA 3FTVA 3HIZA 2VTBA 4FULA 2XGSA 4N2QA 4IYPA 4UI9J 2VSYA 2X6HA 3FH8A 4ANXA 4HOTA 1IYGA 3OTNA 4WNGA 3CK9A 1E7UA 2X6FA 3CLJA 3ZPJA 3B13A 3L22A 4EZJA 1QZ2A 4CDMA 3G2UA 2AXVA 4J6IA 4FA6A 1GW6A 2PQRA 1UJJA 3PEUB 2YNQA 3L6AA 5BV1A 3OXGA 4HOQA 3APFA 3D9IA 4JEUA 4FADA 3CVNA 3FUNA 3GYZA 3FTWA 3CVPA 3PH0C 5AJLA 3FTYA 2XRZA 5EDSA 4HORA 4EZLA 4GA2A 3SI5A 2XHEA 3RK6A 4CGVA 3LY7A 4PUCA 4HVBA 3IKOB 3ZRHA 2LSUA 3G2WA 4I1MA 3S7BA 5CCLA 1H0AA 2X3MA 3RU0A 3CIAA 3MKRA 3PEVB 3QKYA 5G04J 4BSXA 4B8AA 4V3IA 2WMNA 5C1DA 2C0LA 3T8MA 3LY9A 1HO8A 3CHOA 4IN3B 1HS6A 2Q7FA 2V8SE 3LS8A 1JUQA 3LPZA 5E75A 1LF8A 3ZHEA 3S2AA 2AW6A 2WVIA 5AYWD 1H2TC 2VSNA 3BG1B 5M72A 1N52A 4N3BA 3LJ3A 4I6EA 4XKBA 4G23A 5G05J 4AY6A 4FHJA 5JJTA 1E8XA 2J08A 3U4TA 4BX9A 3ML8A 3ZYLA 2CFZA 3ZGQA 3HYMB 1UN9A 1FVFA 2UWJG 1HH8A 4U0SA 3SGHA 4A1GA 2FI7A 3JCKC 4KVOA 1NA3A 2FULA 3MEKA 4GYWA 1HXIA 3PREA 1OUVA 4IRUA 4B94A 3QC1A 3TGOA 3RIBA 2A5UA 4L2YA 4AM9A 4G24A 1H2UA 1Z3YA 1QNFA 3S7DA 3L17A 3CSTA 5FQ7A 3RO2A 2WXPA 4OVUA 4AJWA 2PM7A 3SBSA 4EECA 3ESLA 3D9LA 3VTXA 2OVBA 3PE3A 3D9MA 3HDXA 3VLFA 2WQ6A 5A6CA 2J49A 4GB9A 2WB2A 5BV0A 3HHMA 2YQ8A 4L7TA 3FP3A 3SHFA 3UQ3A 1P5QA 3FH7A 3PZDA 4LUNU 4PH4B 1WM5A 3Q47B 4YNDA 3UUXA 3CVWA 4XI9A 5A23A 2VGXA 4G25A 2GGFA 4XZ4A 2KZTB 4U0UA 1Z3XA 3TG4A 2XPIA 4A3TA 4FJZA 3LEWA 3UT8A 4JVSA 4GZDA 4BTAA 2WXOA 5BPPA 3CV0A 1W3BA 4KMOA 1HE8A 4I1AA 3CVLA 4UQYA 4WAFA 3ZYMA 3PRZA 1E8ZA 1HFAA 3LY8A 3FEXA 4XI0A 4RSYA 3U66A 4JXTA 3FU0A 3NZUA 4YVOA 4KXKB 2XGOA 3R9AB 3NZSA 4U07A 2VGYA 3CVXA 2Y4UA 3D9KA 3QARA 2UY1A 3N71A 3QNKA 5FZQA 1Y8MA 3T5XA 3MGBA 4Y6WA 3FUFA 1HG2A 3CKCA 1B89A 3GW4A 1JWGA 1WAO1 2I2OA 4J8SA 2VTBB 3B7TA 2ILRA 1DVPA 3G2TA 3ULQA 5G2NA 4WNFA 5LX8A 2LAIA 4U63A 3GZSA 4BY6A 3IEGA 3MJWA 3CKBA 5T8IA 4E6HA 2XPZA 1TJCA 3PUJA 5ARGA 4CEMA 3JQ1A 2MOWA 3MKQA 4JA7A 2WXIA 2X6JA 5HI7A 2CHXA 2BF0X 2IU1A 3GZ2A 2VSXE 3MZLB 1E8WA 3QJZA 3B7UX 4EZKA 4ANVA 4WUYA 4JHRA 3FTZA 3I5PA 5CMWA 2GW1A 1HU3A 3D9PA 3IV0A 2IQCA 4ACKA 4G2VA 1FVHA 1KLXA 2J09A 4APOA 4BTBA 5A7DB 1H2VC 5CHEE 4FJYA 3UX4A 4EBAG 2E0IA 2R17C 2OOEA 3I4RB 3FUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI3 A;  3U64 A;  4DI4 A; 
#chains in the Genus database with same CATH topology
 3C3Q A;  1D8D A;  3ZHE B;  1O1S A;  1S63 A;  5LOZ A;  4P29 A;  2BKG A;  2WM9 A;  3QB2 A;  4N5Q A;  3QK0 A;  1IQR A;  1Q2Z A;  2FBN A;  4UWG A;  3ZUV B;  1SQM A;  1OWO A;  3QAQ A;  4URK A;  2IOS A;  4A3V A;  4A63 B;  3JXI A;  2YHE A;  5EYL A;  5AJD A;  4CDN A;  3FU3 A;  3CQC B;  3CEQ A;  3ULE G;  4AIF A;  1X81 A;  5JA4 D;  4UWK A;  4WWN A;  1OY3 D;  2VGX B;  3CHP A;  2BKK B;  2WQ7 A;  4QFV A;  5CEC B;  3QWP A;  4R7L A;  4KYO B;  4UUC A;  1QQE A;  2QYU A;  4DUI A;  2H6H A;  4XEI G;  4E85 A;  2OVF A;  2AXZ A;  2QFC A;  3U9W A;  5AQ9 A;  1N54 A;  2BTD A;  4F7A A;  1OWL A;  2AXU A;  1U3C A;  2FEZ A;  4F53 A;  4JL0 A;  4YDE A;  4ILH B;  1N95 A;  3FFL A;  1Z6T A;  3B7B A;  5ENR D;  3JUE A;  3UM1 A;  4LER A;  1NP7 A;  5CRU A;  4LSZ E;  4IUL A;  1H6K A;  2XGM A;  2WXJ A;  3FU5 A;  5T4Y A;  3ABL E;  3OXF A;  1BU9 A;  3W9F A;  4CT0 A;  3B7S A;  4KZ0 A;  3C5R A;  4I2Z A;  4A1S A;  3RRN B;  1Z5S C;  3LKU A;  1NZN A;  3TWR A;  2WXL A;  4AV7 A;  1MHQ A;  3UPV A;  3AU4 A;  4I1O B;  3UM3 A;  1INZ A;  5IY5 E;  3I3N A;  5H7P A;  4OAU C;  4AOF A;  2F8X K;  3NF1 A;  2QY7 A;  2GRM A;  4HOU A;  3LJN A;  4UWH A;  4FLB A;  3OXL A;  3L9T A;  1ZU2 A;  3ONK A;  2M63 A;  3SNX A;  4C48 B;  4K5A B;  4W9R A;  2LNI A;  3FUL A;  3FTU A;  3L54 A;  4PS3 A;  4ZHB A;  3ONL A;  4PS7 A;  1YCS B;  4GCN A;  5AEN A;  4ILG A;  4A55 A;  4U8V D;  5KCM A;  3AG4 E;  4G11 A;  1E90 A;  3EHQ A;  2HO1 A;  1E8Y A;  1FCH A;  2VJ8 A;  3R7Q A;  4I17 A;  1TNO A;  4B89 A;  2R03 A;  4HS2 A;  3DBS A;  3Q7F A;  2PZI A;  3FUK A;  2I1K A;  2KCV A;  2IFU A;  2P9P G;  4AP2 A;  2P9S G;  2NYJ A;  5FQ8 A;  1MX2 A;  3HVE B;  3APC A;  3ZU7 B;  1OWM A;  1KZP A;  2FO7 A;  3F6Q A;  3L13 A;  4GYO A;  2XRY A;  1SW6 A;  1Y6I A;  4HOS A;  3CGH A;  3ASN E;  4HB5 A;  3CHQ A;  5BXU A;  2J9Q A;  3FY4 A;  2WXF A;  5G05 C;  3TWU A;  3L08 A;  2EQX A;  3HXE A;  1DCE A;  3LYA A;  4UI9 K;  3B95 A;  2DZN A;  4U04 A;  2IEJ A;  2X38 A;  5BUZ A;  3FTV A;  2H6G A;  3UIP C;  2RKK A;  4LG6 A;  4UI9 J;  2X6F A;  2ZXW E;  4HRM B;  3L22 A;  4EZJ A;  5D66 A;  4FA6 A;  2PQR A;  3L6A A;  3OXG A;  3APF A;  3CVN A;  5CEA A;  3FTW A;  3PH0 C;  5AJL A;  1N94 A;  4HOR A;  4GA2 A;  2P9L G;  2XZT G;  3LY7 A;  3RSE G;  4HVB A;  4CZ2 D;  3TWS A;  5CCL A;  1OCZ E;  3CIA A;  3ABM E;  3CHO A;  3S2A A;  2WVI A;  4O60 A;  3BG1 B;  4I6E A;  2J08 A;  3ZGQ A;  4GTQ A;  1HH8 A;  3SGH A;  1MX6 A;  3JCK C;  5ITZ F;  4B94 A;  3QC1 A;  2XEH A;  1H2U A;  3DSU A;  2PNN A;  4J8Y A;  4HNA D;  3RO2 A;  2XEN A;  4EEC A;  2OVB A;  3PE3 A;  3D9M A;  3HDX A;  5BV0 A;  4LNG A;  3FP3 A;  3CVW A;  4XI9 A;  5A23 A;  5JMN D;  4G25 A;  2GGF A;  4A3T A;  1Z3X A;  4JVS A;  3J5Q B;  3CV0 A;  4KMO A;  3PZ4 A;  3ZYM A;  3DEP A;  4XI0 A;  2MYO A;  5B1A E;  3U66 A;  3HXF A;  4KXK B;  1SA5 A;  3QAR A;  3PZ1 A;  2UY1 A;  3QNK A;  2B0O E;  3GW4 A;  4HRL A;  2VTB B;  3B7T A;  2ILR A;  3ULQ A;  5G2N A;  3DSW A;  5AQ7 A;  3V2X A;  3IEG A;  3MJW A;  3CKB A;  5T8I A;  2XPZ A;  4X8Q A;  3PUJ A;  3JQ1 A;  4GTR A;  4JA7 A;  5HI7 A;  2J8S D;  2CHX A;  2VSX E;  2DYS E;  3FTZ A;  3I5P A;  1HU3 A;  3D9P A;  1FVH A;  2J09 A;  4APO A;  4BTB A;  5A7D B;  4FJY A;  2E0I A;  3I4R B;  4HI8 A;  3W9G A;  4J0U A;  1H19 A;  2JEK A;  5ANL A;  4MLP A;  3SQV A;  2WXR A;  4BER A;  1BD8 A;  3O48 A;  4WWP A;  4XE0 A;  5LCW C;  5JJ6 A;  5DIZ A;  2DWZ A;  4Y6C A;  1ELK A;  2WXN A;  2Y3A A;  3T8K A;  3CK8 A;  4YVQ C;  1PC2 A;  2VGE A;  3Q75 A;  2CFU A;  2JLB A;  4GML A;  3QDN A;  1KPS B;  4I9C A;  4O6F A;  4ATG A;  1V54 E;  4O1P A;  2OEV A;  3GZ1 A;  1N4R A;  1OCR E;  4WND A;  4ILI A;  4LRZ A;  1TN8 A;  2OND A;  1XGW A;  4DX7 D;  4GZ3 A;  2FF4 A;  4JHK A;  4MBG A;  2VSO E;  5AIJ A;  3FH5 A;  4F6R D;  1SVX A;  4RG6 A;  3APD A;  4XKC A;  5FIO A;  2CHZ A;  2XS8 A;  2XS1 A;  2YHC A;  3LXU X;  4XIF A;  3CVV A;  3IHY A;  2KC7 A;  1O5M A;  1MJ0 A;  1N4Q A;  4GZ5 A;  3C3R A;  4LEU A;  2PM6 A;  4GTO A;  4EPZ A;  2NSZ A;  2JAB A;  3EU5 A;  4AVX A;  2AJA A;  2WPV A;  3ZKJ A;  3LCA A;  2WXQ A;  2C0M A;  1KT0 A;  2MHK A;  3MKQ B;  3TL5 A;  4Q69 A;  2HYZ A;  4GAA A;  1O1T A;  3E30 A;  3CK7 A;  2RD0 A;  4GYY A;  4HFG A;  4BX8 A;  5KJM A;  2BUG A;  3K9I A;  2WMO A;  1XNF A;  3TWT A;  3UM0 A;  1IKN D;  4ME2 A;  2OCC E;  5EX0 A;  3EDT B;  1SA4 A;  3VLD A;  5LFA A;  4L9P A;  1BLX B;  3CSF A;  3KS2 A;  3AS4 A;  4TV3 A;  3ESK A;  4U8Y D;  2CG2 A;  1TNU A;  1N0Q A;  3ZFW A;  2R02 A;  5KJN A;  1OXJ A;  5D2M C;  4C0M A;  3FUH A;  3C72 A;  1A5E A;  3TJP A;  4DJA A;  2X6I A;  1BI8 B;  2GRL A;  3PNT B;  3LVR E;  1EF1 C;  1BPO A;  2KXP C;  2OV8 A;  2L0I A;  5ENO D;  3U64 A;  5B3S E;  4JHJ A;  3FUI A;  2XEV A;  3I4G A;  2LO6 A;  2XCC A;  4HRN A;  4AY5 A;  2PL2 A;  3ASF A;  3SF4 A;  1UW4 B;  2CG3 A;  3KD7 A;  2BED A;  5CMY A;  3TXN A;  3BUA A;  5JJ7 A;  3T5V A;  2WQH A;  4H7X A;  5AN8 A;  3ZXP A;  1AP7 A;  1QBQ A;  3FDH A;  3T9K A;  1RZ4 A;  4UQZ A;  4MRU A;  5AAR A;  3B7R L;  1DCQ A;  2P58 C;  3ML9 A;  1TEZ A;  4I9E A;  4I2W A;  2Y4T A;  2ETC A;  4BES A;  3FUE A;  3D9O A;  2QC9 A;  4GZ6 A;  3X2Q E;  5EID A;  4J7W A;  3TWX A;  4NUR A;  3DST A;  4FP7 A;  4DI3 A;  3C3O A;  3UM2 A;  5G55 A;  3QOU A;  4FLH A;  5BNW A;  3Q9N C;  3CVY A;  3P1U A;  2I9C A;  1PY1 A;  3DPD A;  4B8C B;  2YIN A;  4DLQ A;  4GMR A;  5FQ4 A;  4ZFH A;  2L0T B;  4UWL A;  5KWD A;  4TRQ A;  1DNP A;  3JYS A;  1N4P A;  4I6J A;  4N2Q A;  2XGS A;  4ATZ D;  2P2C P;  2X6H A;  4ANX A;  2F8Y A;  1E7U A;  1UOH A;  5EYP F;  1GW6 A;  1K1B A;  2EIK E;  2QZA A;  1O1R A;  2YNQ A;  3GYZ A;  5AQA A;  2XHE A;  4CGV A;  4PUC A;  2LSU A;  3ABK E;  3S7B A;  2OEW A;  2X3M A;  5G04 J;  3T8M A;  5ENT D;  1JUQ A;  3LPZ A;  5E75 A;  1LF8 A;  5CBO A;  1YYH A;  2VSN A;  1N52 A;  4XKB A;  4AY6 A;  4FHJ A;  3U4T A;  4BX9 A;  5EIB E;  3HYM B;  2UWJ G;  2EIL E;  1NA3 A;  2FUL A;  3MEK A;  3SFY A;  3RIB A;  2A5U A;  4L2Y A;  4AM9 A;  4TUM A;  3TWV A;  1QNF A;  3S7D A;  4GTV A;  5CBN A;  3CST A;  4OVU A;  4AJW A;  1NI1 A;  3AG2 E;  3VLF A;  2WQ6 A;  3SY2 A;  3HHM A;  2YQ8 A;  4LUN U;  3UI2 A;  3Q47 B;  3DWL G;  3UKR G;  3EUV A;  2KZT B;  3D9H A;  4U0U A;  4FJZ A;  5CED B;  4BTA A;  2WXO A;  2P9U G;  1W3B A;  1FT2 A;  3LY8 A;  5HS0 A;  1JCR A;  3NZU A;  3HXC A;  3R9A B;  3NZS A;  4U07 A;  1Y8M A;  3T5X A;  1K3Z D;  2I2O A;  4J8S A;  1DVP A;  4WNF A;  2IO2 C;  3GZS A;  5ARG A;  4CEM A;  4EHM A;  2RFM A;  2X6J A;  1E8W A;  4DX2 A;  4EZK A;  4WUY A;  4JHR A;  1D9S A;  5CMW A;  4ACK A;  4G2V A;  1KLX A;  2H6F A;  1LD7 A;  3UX4 A;  5CHE E;  4CYM D;  4JB8 P;  4EBA G;  3CHM A;  2LAH A;  1RW2 A;  5FZR A;  5C2Y A;  4G8L A;  3E4B A;  1X5B A;  3PUK A;  3TXM A;  3JXJ A;  3FHE A;  4BWR A;  5ENN A;  4GA0 A;  5AQB A;  1HX8 A;  2WXK A;  4C9B B;  1IHB A;  2HR2 A;  2GRO B;  2V0P A;  3QWW A;  4ANW A;  2XQ0 A;  5EKQ D;  3SD5 A;  1JWF A;  3KAE A;  4CGW A;  2I6H A;  3FEY A;  3ASD A;  4PDX A;  3OAW A;  3DXM G;  1S0P A;  2F0Y A;  2F37 A;  3ULY A;  4H7Y A;  4RQI A;  3NBN B;  2NXP A;  3FUD A;  4G1T A;  3RRU A;  4O1O A;  2WXG A;  1KT1 A;  2KAT A;  4DK5 A;  3PZ2 A;  2R2L A;  1IQU A;  3AU5 A;  1UG3 A;  2VQ2 A;  4YDY A;  5J90 A;  2ION A;  1E7V A;  3MX3 A;  2MRI A;  4CRW A;  3NB2 A;  3D3M A;  4N3C A;  3Q5M A;  4N39 A;  2C2L A;  4N3A A;  5ENQ D;  2KM4 A;  5ANR A;  1HG5 A;  4L23 A;  3MCX A;  4HI9 A;  3WG7 E;  5BW8 C;  5HKP A;  2NC9 A;  1HZ4 A;  4JEH A;  4ABN A;  2ZIS A;  4MKT A;  3Q49 B;  4JZY A;  4Q96 A;  3E33 A;  1IHG A;  1N11 A;  1D8E A;  4JA9 A;  5CCM A;  5EX3 A;  1FT1 A;  3PZ3 A;  5J08 A;  2DYR E;  3PE4 A;  4GPK A;  3VLE A;  3HRA A;  1A17 A;  2XEE A;  5FJY A;  1KZO A;  1PAQ A;  3D9J A;  4UQX A;  2RFA A;  4OVV A;  3BEE A;  1S70 B;  3EU9 A;  2ETA A;  3QWV A;  3FUM A;  4GA1 A;  3V79 K;  4GPM A;  3CVQ A;  3EIJ A;  1EPU A;  1EDU A;  3NQP A;  4BT9 A;  1SZA A;  2ETB A;  2J4B A;  4MS6 A;  4XX5 A;  4GTP A;  1WY6 A;  3MYV A;  3BU8 A;  1ZBP A;  1OWP A;  1IXV A;  3KEZ A;  2GRQ B;  5HQ8 A;  3E32 A;  4UWF A;  4GCO A;  4Q94 A;  4UI9 C;  4ANU A;  5AAO A;  3Q9U C;  3DSS A;  4HLE A;  4B0Z A;  3MV3 B;  3VTY A;  4JW1 A;  3D9N A;  4APF A;  3CR3 A;  4U96 D;  4K0R A;  3L16 A;  4CT4 A;  2R59 A;  5KJL A;  3JUI A;  1UN8 A;  1TJF A;  3R7R A;  3SBT B;  4TUU A;  5D0Q D;  1OCO E;  5KJK A;  1JCS A;  4KVM A;  2WXH A;  3AS8 A;  4TXP A;  4C0E A;  4JC8 A;  1HF8 A;  1TNY A;  4DI4 A;  1NL4 A;  5JHB A;  3ZW3 A;  5CER B;  3ENE A;  3ZYK A;  5D0O D;  4KZC A;  3Q7A A;  3UMV A;  1OT8 A;  2KCK A;  3CHS A;  1E96 B;  3DRA A;  3Q4A B;  4JPS A;  4N2S A;  4YDW A;  3HIZ A;  4FUL A;  1S64 A;  2VSY A;  3DEO A;  3FH8 A;  3NAW A;  4HOT A;  1IYG A;  3CLJ A;  3B13 A;  1QZ2 A;  5KNH D;  5FIN A;  4CDM A;  3G2U A;  2AXV A;  3SFX A;  1WG0 A;  4FAD A;  3FUN A;  2LUH A;  3CVP A;  2XRZ A;  5EDS A;  2FO1 E;  3SI5 A;  4QQI A;  3G2W A;  4I1M A;  4NIK A;  1H6P A;  3RU0 A;  4BSX A;  4V3I A;  5C1D A;  2GRN B;  1HO8 A;  3LS8 A;  2V8S E;  3ZHE A;  1JCQ A;  3AG3 E;  5M72 A;  5G05 J;  5JJT A;  1K1A A;  3AJI A;  1FVF A;  4A1G A;  2FI7 A;  4KVO A;  3PRE A;  4IRU A;  3RAU A;  4GTS A;  4G24 A;  3SO8 A;  3L17 A;  5FQ7 A;  2WXP A;  3D9L A;  3VTX A;  2J49 A;  3ASO E;  3SHF A;  3UQ3 A;  3BQO A;  3PZD A;  2XZD G;  4PH4 B;  4HQD A;  4YND A;  2VGX A;  3ISM C;  3HXD A;  1MX4 A;  2XPI A;  4DX1 A;  3V2O A;  3UT8 A;  1HE8 A;  4I1A A;  3PRZ A;  1E8Z A;  1HFA A;  2ZGD A;  2XGO A;  3CVX A;  1OCC E;  1MYO A;  1JWG A;  1WAO 1;  3NOC D;  3G2T A;  4B93 B;  5LX8 A;  2LAI A;  4U63 A;  4OAV B;  2ZIR A;  3EHR A;  1TJC A;  2BF0 X;  3GZ2 A;  3AAA C;  3QJZ A;  4LNU D;  3B7U X;  4K5B A;  2GW1 A;  1K8K G;  3IV0 A;  1H2V C;  2IY0 C;  5EIL A;  2R17 C;  2OOE A;  3KEA A;  4KBQ A;  4AEZ C;  3U3W A;  1SZ9 A;  3P2B A;  1V55 E;  4NQ0 A;  4DX5 D;  3V30 A;  4F3V A;  3JQ0 A;  2L6J A;  4FC8 A;  4WNE A;  2VYI A;  4K03 A;  4LCT A;  4GZC A;  2ZU6 B;  2DVW A;  1NFI E;  2J07 A;  1L5J A;  4AXH A;  4RVB A;  4J8D A;  2A4Z A;  1VDY A;  3TWW A;  2H6I A;  3ZIM A;  1TN6 A;  2QYJ A;  5FQ6 A;  3ZN3 A;  5FT9 A;  4J8E A;  2V5F A;  3O4Z A;  2Y69 E;  1OWN A;  3E34 A;  1ELR A;  5ARF A;  4HLL A;  4BFR A;  2L9B A;  2LXM A;  3E37 A;  2A5E A;  3TG5 A;  5E76 A;  5LP0 A;  2IJG X;  3KSL A;  1N4S A;  1QYM A;  3MV2 B;  4U95 D;  3RKV A;  3CVU A;  2X6K A;  1JPL A;  2HM8 A;  5LCW J;  3IBE A;  3FTX A;  5DBK A;  3UKU G;  4BET A;  2LXL A;  3CQG B;  4FHK A;  2KCL A;  3EHM A;  4U8H A;  3Q15 A;  3FWV A;  2AVP A;  2EIM E;  3LDZ A;  4N5C A;  3S7F A;  3WXX A;  1AWC B;  3HVE A;  4BT8 A;  2R05 A;  2KZT A;  3NOG D;  4RLY A;  1EYH A;  3PVL A;  3SZ7 A;  4RG9 A;  3ZVV A;  4DPR A;  2XCB A;  4J8F A;  4DX6 D;  3J5P A;  3PDN A;  3EIQ C;  3BG0 B;  2HE0 A;  4KT6 B;  2EIN E;  3G2V A;  2L6B A;  3ZEF A;  4WWO A;  4G26 A;  1MZC A;  3UT7 A;  3C98 A;  3ZNG A;  4HXI A;  4K5C A;  3DPY A;  2DIW A;  5HRY A;  2XPY A;  3EHN A;  5BT1 A;  4EQF A;  3FU6 A;  2GRP B;  3URZ A;  3UT4 A;  5FWQ A;  3RJV A;  1LD8 A;  1LTX A;  1U3D A;  3LVQ E;  5KNG A;  3UTM A;  2Y1L E;  3AG1 E;  1UJK A;  3PS6 A;  2E2E A;  5FZS A;  4DLO A;  3Q79 A;  3IHV A;  3ZYQ A;  4DRX E;  4TXR A;  2CHW A;  3UXG A;  4GTM A;  4CCA A;  3FTS A;  2AWI A;  2R5S A;  1TN7 A;  4LNB A;  4G8K A;  4D10 C;  5T3R A;  3TAX A;  4M3O A;  4F1S A;  2WXM A;  4I43 A;  5ENP D;  4NAC A;  3ASG A;  4EBA A;  3ZXS A;  3IXE A;  1YA0 A;  2V4L A;  3EJN A;  3SFZ A;  1NA0 A;  2PQN A;  2RG8 A;  2DCP A;  3UIO C;  4NRH B;  2DBA A;  2UY1 B;  2LSV A;  2ZGG A;  2KBX A;  3MA5 A;  3HXB A;  3AS5 A;  3RO3 A;  4GU5 A;  4ACL A;  4PS8 A;  4L1B A;  3R9M A;  4FU3 A;  4JD2 G;  3CHR A;  5G04 C;  2I1J A;  4GMJ A;  5JHA A;  4HBD A;  2J4D A;  3PNL B;  2IF4 A;  4CDR A;  3ASH A;  1FPP A;  3RRM B;  4OYS A;  4TXQ A;  4BSZ B;  5FTP A;  3G2S A;  4I6G A;  4U0Z A;  1MQS A;  4L2L A;  2IOL A;  3S7J A;  1ELW A;  2VTB A;  4IYP A;  3OTN A;  1YMP A;  3CK9 A;  4WNG A;  2EIJ E;  3ZPJ A;  1WDY A;  3KSQ A;  4J6I A;  1UJJ A;  3PEU B;  3Q78 A;  5BV1 A;  4YDO A;  4HOQ A;  3D9I A;  4JEU A;  3FTY A;  4EZL A;  2IO3 C;  5EN5 D;  3RK6 A;  2P9N G;  2B6C A;  2P9K G;  3IKO B;  3ZRH A;  5CRV A;  1BI7 B;  1H0A A;  3HG0 D;  3MKR A;  3PEV B;  3QKY A;  4B8A A;  1G3N B;  2WMN A;  2C0L A;  3LY9 A;  4BEP A;  4IN3 B;  1HS6 A;  2Q7F A;  3DSX A;  4GTT A;  2AW6 A;  5AYW D;  1H2T C;  4N3B A;  3LJ3 A;  4G23 A;  1E8X A;  1N0R A;  3ML8 A;  3UIN C;  1TNB A;  2CFZ A;  3ZYL A;  1UN9 A;  3Q73 A;  4U0S A;  4GYW A;  1HXI A;  1OUV A;  5KBA A;  4U7E B;  3TGO A;  1H6O A;  2Y0B G;  2GRR B;  1Z3Y A;  3V31 A;  2V4H C;  2PM7 A;  3SBS A;  3ESL A;  3DXK G;  5A6C A;  4GB9 A;  2WB2 A;  4L7T A;  1P5Q A;  3FH7 A;  5BXO A;  1WM5 A;  3UUX A;  3TWQ A;  4XZ4 A;  1TYQ G;  3TG4 A;  3LEW A;  4GZD A;  5BPP A;  5ENS D;  3L82 A;  3CVL A;  4UQY A;  4WAF A;  3FEX A;  4M7C A;  4RSY A;  4JXT A;  3FU0 A;  4YVO A;  2DZO A;  2V5Q C;  2VGY A;  2Y4U A;  3D9K A;  3N71 A;  5FZQ A;  5B1B E;  3MGB A;  4Y6W A;  3FUF A;  1HG2 A;  3CKC A;  1B89 A;  1U2V G;  2P9I G;  1TR4 A;  4BY6 A;  3DSV A;  4E6H A;  1N9A A;  2MOW A;  3MKQ A;  2WXI A;  2IU1 A;  3MZL B;  1DC2 A;  4ANV A;  1TNZ A;  4Z68 A;  2IQC A;  1ZB1 A;  4F1P A;  3FUJ A; 
#chains in the Genus database with same CATH homology
 4KBQ A;  3CHM A;  4AEZ C;  4J0U A;  1H19 A;  2LAH A;  3U3W A;  2JEK A;  3ZHE B;  5FZR A;  1SZ9 A;  3P2B A;  4MLP A;  5ANL A;  5C2Y A;  3E4B A;  1X5B A;  4NQ0 A;  2WXR A;  4F3V A;  3JQ0 A;  3PUK A;  5LOZ A;  4P29 A;  2L6J A;  3O48 A;  4FC8 A;  4XE0 A;  4WWP A;  5LCW C;  3TXM A;  4WNE A;  5DIZ A;  4Y6C A;  5JJ6 A;  2VYI A;  2WM9 A;  1ELK A;  3FHE A;  3QB2 A;  4K03 A;  2WXN A;  4LCT A;  4GA0 A;  4GZC A;  5ENN A;  4BWR A;  2Y3A A;  3CK8 A;  2ZU6 B;  4YVQ C;  1PC2 A;  1HX8 A;  2WXK A;  3QK0 A;  1IQR A;  2FBN A;  2CFU A;  2J07 A;  2JLB A;  4GML A;  4C9B B;  3QDN A;  1L5J A;  2HR2 A;  4UWG A;  4I9C A;  2V0P A;  3QWW A;  4O6F A;  4AXH A;  4RVB A;  4ANW A;  4ATG A;  2XQ0 A;  1SQM A;  1OWO A;  2A4Z A;  3QAQ A;  1VDY A;  4J8D A;  5EKQ D;  3SD5 A;  4URK A;  2IOS A;  1JWF A;  3KAE A;  3GZ1 A;  4A3V A;  3ZIM A;  4CGW A;  2I6H A;  2YHE A;  3FEY A;  3ASD A;  4WND A;  4PDX A;  5FQ6 A;  5AJD A;  3ZN3 A;  4ILI A;  3OAW A;  3FU3 A;  3CQC B;  4CDN A;  3CEQ A;  5FT9 A;  4LRZ A;  4J8E A;  4AIF A;  1S0P A;  2OND A;  2V5F A;  1XGW A;  4UWK A;  4WWN A;  3O4Z A;  2FF4 A;  4GZ3 A;  1OWN A;  4H7Y A;  2VGX B;  3CHP A;  1ELR A;  4JHK A;  2VSO E;  5ARF A;  2WQ7 A;  4QFV A;  5AIJ A;  4BFR A;  3FH5 A;  2NXP A;  3QWP A;  3FUD A;  4RG6 A;  4G1T A;  2L9B A;  3RRU A;  4R7L A;  2WXG A;  1KT1 A;  3APD A;  3TG5 A;  4XKC A;  5E76 A;  4KYO B;  2KAT A;  5LP0 A;  4DK5 A;  2IJG X;  2CHZ A;  3AU5 A;  1IQU A;  1QQE A;  1UG3 A;  2VQ2 A;  2YHC A;  3LXU X;  4XIF A;  5J90 A;  3CVV A;  3IHY A;  4E85 A;  2ION A;  2KC7 A;  3MV2 B;  1E7V A;  3MX3 A;  3RKV A;  4GZ5 A;  2MRI A;  2OVF A;  3CVU A;  4CRW A;  2AXZ A;  2QFC A;  3U9W A;  4LEU A;  3D3M A;  2X6K A;  4N3C A;  1N54 A;  1JPL A;  2BTD A;  2HM8 A;  2PM6 A;  3Q5M A;  2C2L A;  1OWL A;  2AXU A;  4N39 A;  4EPZ A;  4F7A A;  5LCW J;  3IBE A;  1U3C A;  4N3A A;  2FEZ A;  4F53 A;  3FTX A;  5DBK A;  2NSZ A;  4JL0 A;  4AVX A;  2WPV A;  2KM4 A;  4ILH B;  5ANR A;  1HG5 A;  4L23 A;  3MCX A;  3CQG B;  4FHK A;  3LCA A;  2KCL A;  5BW8 C;  2WXQ A;  3FFL A;  3EHM A;  2C0M A;  4U8H A;  1KT0 A;  2MHK A;  3MKQ B;  3TL5 A;  4Q69 A;  2NC9 A;  3FWV A;  3Q15 A;  2AVP A;  1HZ4 A;  1Z6T A;  4JEH A;  2HYZ A;  3LDZ A;  4GAA A;  4N5C A;  3S7F A;  3WXX A;  3HVE A;  4BT8 A;  4ABN A;  3CK7 A;  2KZT A;  2RD0 A;  4MKT A;  4GYY A;  3Q49 B;  4HFG A;  4BX8 A;  4JZY A;  5KJM A;  2BUG A;  4LER A;  1NP7 A;  3K9I A;  1IHG A;  4Q96 A;  1EYH A;  2WMO A;  1XNF A;  3PVL A;  3SZ7 A;  4IUL A;  4RG9 A;  1H6K A;  2XGM A;  4JA9 A;  3ZVV A;  5CCM A;  5EX3 A;  4DPR A;  2XCB A;  4J8F A;  4ME2 A;  2WXJ A;  3FU5 A;  5EX0 A;  3EDT B;  3PDN A;  5T4Y A;  3EIQ C;  3OXF A;  4CT0 A;  3B7S A;  3BG0 B;  4KZ0 A;  3VLD A;  5J08 A;  5LFA A;  4KT6 B;  4I2Z A;  3G2V A;  3PE4 A;  3CSF A;  4A1S A;  3KS2 A;  4GPK A;  3ZEF A;  4WWO A;  3AS4 A;  3VLE A;  4TV3 A;  4G26 A;  3ESK A;  3UT7 A;  3RRN B;  3C98 A;  3LKU A;  1NZN A;  2CG2 A;  1A17 A;  2WXL A;  4HXI A;  4AV7 A;  1MHQ A;  3ZFW A;  2DIW A;  3UPV A;  3AU4 A;  2XPY A;  5FJY A;  5KJN A;  4I1O B;  3EHN A;  5BT1 A;  4EQF A;  3FU6 A;  1INZ A;  1PAQ A;  3I3N A;  3D9J A;  3URZ A;  3UT4 A;  4C0M A;  4AOF A;  5FWQ A;  3RJV A;  4UQX A;  3FUH A;  3NF1 A;  2QY7 A;  1U3D A;  4OVV A;  3BEE A;  3TJP A;  2GRM A;  3LVQ E;  4HOU A;  4DJA A;  2X6I A;  1UJK A;  2GRL A;  4UWH A;  3PNT B;  4FLB A;  3OXL A;  3PS6 A;  3LVR E;  1EF1 C;  2E2E A;  5FZS A;  4DLO A;  1BPO A;  3QWV A;  3FUM A;  3IHV A;  1ZU2 A;  4GA1 A;  2OV8 A;  3ZYQ A;  2CHW A;  3ONK A;  2M63 A;  3SNX A;  2L0I A;  4W9R A;  3U64 A;  2LNI A;  3CVQ A;  3FUL A;  3EIJ A;  3FTU A;  4CCA A;  3L54 A;  4PS3 A;  4JHJ A;  3ONL A;  1EPU A;  1EDU A;  2AWI A;  3FTS A;  4PS7 A;  3FUI A;  2R5S A;  3NQP A;  2XEV A;  3I4G A;  4BT9 A;  4GCN A;  2LO6 A;  2XCC A;  4AY5 A;  4D10 C;  1SZA A;  5AEN A;  5T3R A;  3TAX A;  4M3O A;  4F1S A;  2WXM A;  4I43 A;  2J4B A;  2PL2 A;  4ILG A;  4MS6 A;  4XX5 A;  3ASF A;  3SF4 A;  4A55 A;  1UW4 B;  2CG3 A;  1WY6 A;  3KD7 A;  4NAC A;  3ASG A;  4EBA A;  3MYV A;  5KCM A;  3ZXS A;  1YA0 A;  1ZBP A;  4G11 A;  5CMY A;  3TXN A;  5JJ7 A;  1E90 A;  3T5V A;  2HO1 A;  1OWP A;  3KEZ A;  1E8Y A;  1FCH A;  5HQ8 A;  2VJ8 A;  2WQH A;  4UWF A;  4H7X A;  4GCO A;  2V4L A;  4Q94 A;  3EJN A;  3R7Q A;  4I17 A;  3FDH A;  4UI9 C;  4B89 A;  4UQZ A;  1NA0 A;  2PQN A;  2RG8 A;  2DCP A;  3SFZ A;  4HS2 A;  4MRU A;  4ANU A;  3B7R L;  4NRH B;  2DBA A;  2UY1 B;  3DBS A;  2PZI A;  2P58 C;  3FUK A;  2I1K A;  2KCV A;  2LSV A;  3ML9 A;  2IFU A;  4HLE A;  4AP2 A;  1TEZ A;  4B0Z A;  3MV3 B;  4I9E A;  5FQ8 A;  3VTY A;  4I2W A;  4JW1 A;  3D9N A;  2Y4T A;  4APF A;  3MA5 A;  3CR3 A;  3FUE A;  3HVE B;  4K0R A;  3D9O A;  3AS5 A;  3RO3 A;  3APC A;  4GU5 A;  4ACL A;  4GZ6 A;  1OWM A;  3L16 A;  4PS8 A;  4L1B A;  4FU3 A;  4NUR A;  4CT4 A;  4DI3 A;  4FP7 A;  2R59 A;  3CHR A;  5G04 C;  5KJL A;  2I1J A;  2FO7 A;  3L13 A;  4GMJ A;  5JHA A;  4GYO A;  2XRY A;  3JUI A;  1UN8 A;  1TJF A;  2J4D A;  1Y6I A;  4HOS A;  5G55 A;  3PNL B;  3R7R A;  3QOU A;  4FLH A;  3SBT B;  3CGH A;  4TUU A;  3CHQ A;  5BNW A;  5D0Q D;  2J9Q A;  3FY4 A;  5KJK A;  3CVY A;  2IF4 A;  3P1U A;  2I9C A;  4KVM A;  4CDR A;  1PY1 A;  3ASH A;  3DPD A;  2WXF A;  2WXH A;  3AS8 A;  5G05 C;  4B8C B;  4C0E A;  2YIN A;  4JC8 A;  3RRM B;  1HF8 A;  4OYS A;  4DLQ A;  3L08 A;  5FQ4 A;  2L0T B;  2EQX A;  4UWL A;  5FTP A;  4DI4 A;  5JHB A;  4TRQ A;  3ZW3 A;  3G2S A;  4I6G A;  3ENE A;  3LYA A;  4U0Z A;  3ZYK A;  4UI9 K;  5D0O D;  1MQS A;  4KZC A;  4L2L A;  3UMV A;  4U04 A;  2IOL A;  1DNP A;  2KCK A;  3CHS A;  2X38 A;  3S7J A;  1E96 B;  5BUZ A;  3Q4A B;  1ELW A;  4JPS A;  3JYS A;  4N2S A;  4I6J A;  3FTV A;  3HIZ A;  2VTB A;  4FUL A;  2XGS A;  4N2Q A;  4IYP A;  4UI9 J;  2VSY A;  2X6H A;  3FH8 A;  4ANX A;  4HOT A;  1IYG A;  3OTN A;  4WNG A;  3CK9 A;  1E7U A;  2X6F A;  3CLJ A;  3ZPJ A;  3B13 A;  3L22 A;  4EZJ A;  1QZ2 A;  4CDM A;  3G2U A;  2AXV A;  4J6I A;  4FA6 A;  1GW6 A;  2PQR A;  1UJJ A;  3PEU B;  2YNQ A;  3L6A A;  5BV1 A;  3OXG A;  4HOQ A;  3APF A;  3D9I A;  4JEU A;  4FAD A;  3CVN A;  3FUN A;  3GYZ A;  3FTW A;  3CVP A;  3PH0 C;  5AJL A;  3FTY A;  2XRZ A;  5EDS A;  4HOR A;  4EZL A;  4GA2 A;  3SI5 A;  2XHE A;  3RK6 A;  4CGV A;  3LY7 A;  4PUC A;  4HVB A;  3IKO B;  3ZRH A;  2LSU A;  3G2W A;  4I1M A;  3S7B A;  5CCL A;  1H0A A;  2X3M A;  3RU0 A;  3CIA A;  3MKR A;  3PEV B;  3QKY A;  5G04 J;  4BSX A;  4B8A A;  4V3I A;  2WMN A;  5C1D A;  2C0L A;  3T8M A;  3LY9 A;  1HO8 A;  3CHO A;  4IN3 B;  1HS6 A;  2Q7F A;  2V8S E;  3LS8 A;  1JUQ A;  3LPZ A;  5E75 A;  1LF8 A;  3ZHE A;  3S2A A;  2AW6 A;  2WVI A;  5AYW D;  1H2T C;  2VSN A;  3BG1 B;  5M72 A;  1N52 A;  4N3B A;  3LJ3 A;  4I6E A;  4XKB A;  4G23 A;  5G05 J;  4AY6 A;  4FHJ A;  5JJT A;  1E8X A;  2J08 A;  3U4T A;  4BX9 A;  3ML8 A;  3ZYL A;  2CFZ A;  3ZGQ A;  3HYM B;  1UN9 A;  1FVF A;  2UWJ G;  1HH8 A;  4U0S A;  3SGH A;  4A1G A;  2FI7 A;  3JCK C;  4KVO A;  1NA3 A;  2FUL A;  3MEK A;  4GYW A;  1HXI A;  3PRE A;  1OUV A;  4IRU A;  4B94 A;  3QC1 A;  3TGO A;  3RIB A;  2A5U A;  4L2Y A;  4AM9 A;  4G24 A;  1H2U A;  1Z3Y A;  1QNF A;  3S7D A;  3L17 A;  3CST A;  5FQ7 A;  3RO2 A;  2WXP A;  4OVU A;  4AJW A;  2PM7 A;  3SBS A;  4EEC A;  3ESL A;  3D9L A;  3VTX A;  2OVB A;  3PE3 A;  3D9M A;  3HDX A;  3VLF A;  2WQ6 A;  5A6C A;  2J49 A;  4GB9 A;  2WB2 A;  5BV0 A;  3HHM A;  2YQ8 A;  4L7T A;  3FP3 A;  3SHF A;  3UQ3 A;  1P5Q A;  3FH7 A;  3PZD A;  4LUN U;  4PH4 B;  1WM5 A;  3Q47 B;  4YND A;  3UUX A;  3CVW A;  4XI9 A;  5A23 A;  2VGX A;  4G25 A;  2GGF A;  4XZ4 A;  2KZT B;  4U0U A;  1Z3X A;  3TG4 A;  2XPI A;  4A3T A;  4FJZ A;  3LEW A;  3UT8 A;  4JVS A;  4GZD A;  4BTA A;  2WXO A;  5BPP A;  3CV0 A;  1W3B A;  4KMO A;  1HE8 A;  4I1A A;  3CVL A;  4UQY A;  4WAF A;  3ZYM A;  3PRZ A;  1E8Z A;  1HFA A;  3LY8 A;  3FEX A;  4XI0 A;  4RSY A;  3U66 A;  4JXT A;  3FU0 A;  3NZU A;  4YVO A;  4KXK B;  2XGO A;  3R9A B;  3NZS A;  4U07 A;  2VGY A;  3CVX A;  2Y4U A;  3D9K A;  3QAR A;  2UY1 A;  3N71 A;  3QNK A;  5FZQ A;  1Y8M A;  3T5X A;  3MGB A;  4Y6W A;  3FUF A;  1HG2 A;  3CKC A;  1B89 A;  3GW4 A;  1JWG A;  1WAO 1;  2I2O A;  4J8S A;  2VTB B;  3B7T A;  2ILR A;  1DVP A;  3G2T A;  3ULQ A;  5G2N A;  4WNF A;  5LX8 A;  2LAI A;  4U63 A;  3GZS A;  4BY6 A;  3IEG A;  3MJW A;  3CKB A;  5T8I A;  4E6H A;  2XPZ A;  1TJC A;  3PUJ A;  5ARG A;  4CEM A;  3JQ1 A;  2MOW A;  3MKQ A;  4JA7 A;  2WXI A;  2X6J A;  5HI7 A;  2CHX A;  2BF0 X;  2IU1 A;  3GZ2 A;  2VSX E;  3MZL B;  1E8W A;  3QJZ A;  3B7U X;  4EZK A;  4ANV A;  4WUY A;  4JHR A;  3FTZ A;  3I5P A;  5CMW A;  2GW1 A;  1HU3 A;  3D9P A;  3IV0 A;  2IQC A;  4ACK A;  4G2V A;  1FVH A;  1KLX A;  2J09 A;  4APO A;  4BTB A;  5A7D B;  1H2V C;  5CHE E;  4FJY A;  3UX4 A;  4EBA G;  2E0I A;  2R17 C;  2OOE A;  3I4R B;  3FUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...