4DI4A

Crystal structure of a 3:1 complex of treponema pallidum tatp(t) (tp0957) bound to tatt (tp0956)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
273
Chain Sequence
DADFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TatT (Tp0956)
publication title Structural and Thermodynamic Characterization of the Interaction between Two Periplasmic Treponema pallidum Lipoproteins that are Components of a TPR-Protein-Associated TRAP Transporter (TPAT).
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
total genus 103
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4di4A00
3U64A 4DI3A 4DI4A
chains in the Genus database with same CATH superfamily
3SO8A 1OWNA 1OCZE 4BX8A 5CEDB 5AQ9A 4MRUA 2GW1A 1N4PA 1U3CA 4XZ4A 5AARA 1QZ2A 5ENTD 2LNIA 4DUIA 3DBSA 4CYMD 4CEMA 2PZIA 4G8LA 4ME2A 1TN8A 1WAO1 2DZOA 1LD8A 4YVOA 3MX3A 4APFA 2LO6A 3SFYA 4B93B 1OY3D 3B95A 2UY1B 2PQRA 3FEYA 4GA1A 2IFUA 3CHQA 3ULQA 4NACA 2QC9A 3Q78A 2VYIA 5AQAA 2J9QA 4XI9A 4N39A 3FUEA 3APFA 5AENA 4E85A 2ZIRA 4HNAD 3PREA 2L6BA 4GYYA 2X6HA 4HS2A 1N94A 2ETAA 4I2ZA 4TXRA 1AWCB 1HFAA 3EIJA 5A23A 3I3NA 1TN6A 1GW6A 2CFZA 2P9SG 4AIFA 4BERA 2EILE 3Q79A 2VSYA 3AS5A 4RG6A 3UM2A 4UWKA 2KCKA 4J6IA 2Y1LE 4DI4A 5G55A 2YNQA 3NOCD 4HXIA 5H7PA 1LTXA 3RIBA 4N2QA 3FH5A 3FTSA 3U66A 2LSUA 1MYOA 1OCOE 3CQCB 3DSWA 1EYHA 5D66A 1N52A 5EX0A 3GYZA 4GCNA 5AQBA 3TWRA 3MYVA 4NURA 5DIZA 4A1SA 5HQ8A 1V54E 5D0OD 1Z5SC 3ZU7B 3FTZA 2IQCA 1Y6IA 4U8VD 1N4RA 4U7EB 4GPKA 4DX2A 3MKRA 5ENPD 3UM0A 2OV8A 3KD7A 5AAOA 3T5XA 4LUNU 3G2WA 3HVEB 3FUJA 3ABME 5C1DA 3CK8A 2F8YA 2QYJA 2PM6A 1MX6A 1MQSA 4IULA 4AV7A 4ACKA 4C0EA 3FTXA 2KZTB 2R05A 2P2CP 2R17C 1H6PA 3SI5A 3U64A 4QFVA 2ZXWE 2GRPB 1TNOA 2WXJA 3FUNA 2QYUA 4O6FA 3ZYMA 2WXMA 3FUIA 3X2QE 4UQYA 3FP3A 4JZYA 5AJLA 4YDYA 4JC8A 2WVIA 3UT8A 3U3WA 5FQ7A 2HO1A 4C48B 3K9IA 4FJYA 5KNGA 4GMLA 4GU5A 4OAUC 4U8YD 3URZA 3QWPA 4GCOA 4XE0A 1OCCE 1H6KA 3E32A 4JW1A 1K8KG 2VTBA 1HO8A 1YA0A 2WXLA 4A3VA 1OWPA 3CLJA 2B6CA 3CHOA 2IOSA 3QK0A 4Q94A 2HYZA 4DLQA 4H7XA 4GYOA 3Q7AA 1N4SA 4UI9J 2I2OA 3O48A 3CVXA 1MZCA 1L5JA 4AP2A 4I1OB 2IEJA 1BU9A 1OUVA 5ANRA 1JCQA 1NI1A 3HHMA 5E76A 3DRAA 4G8KA 4BSXA 1Y8MA 1BI8B 3Q49B 5BV0A 4I9CA 2H6FA 2XEEA 3D9MA 2ZISA 3R9MA 3CVYA 3AJIA 3OXFA 3L82A 3CHMA 5KJNA 5JHBA 3PS6A 3KAEA 1LF8A 4FLBA 5ENRD 4RSYA 3RAUA 2IO3C 1JWGA 4U0UA 2F37A 4U8HA 3MCXA 3HRAA 3CVWA 2AWIA 4L7TA 4FADA 4U0SA 2FULA 5FTPA 3ISMC 3RJVA 4YVQC 2WXRA 3UIPC 3JQ1A 4U63A 5EYLA 4ANUA 2IONA 4DX7D 5J08A 5G04C 1IQUA 4WNGA 1AP7A 3KEAA 4U96D 1FVFA 5LCWC 1YCSB 2EQXA 4XX5A 1KLXA 4YNDA 3C3QA 4GMRA 4N5CA 3UM1A 2MOWA 3TWTA 1K1AA 3ZN3A 1VDYA 4EBAG 3FULA 1FVHA 4TXPA 5BXUA 3NOGD 2NC9A 1PY1A 4ANWA 3CKCA 4WWPA 5G05J 1DCEA 2VQ2A 3HXFA 4GZ6A 2WMOA 2WXPA 4G23A 2IU1A 2Y0BG 1FPPA 1WM5A 4GTSA 4CRWA 2C2LA 4EZJA 1FCHA 1SVXA 2RKKA 2WQ7A 3P1UA 1RW2A 1OCRE 3LCAA 3C98A 3UUXA 3D9LA 2ONDA 3AG3E 2DVWA 5FT9A 2C0LA 1K1BA 4HOSA 1H2VC 2WXQA 1UOHA 3TWUA 2R02A 3NQPA 3LY7A 4K03A 3AAAC 2XHEA 1SA4A 2KCLA 1IQRA 2BTDA 3FU0A 4TRQA 4KXKB 4KT6B 2DZNA 4HRNA 2J49A 3EJNA 3CVQA 5C2YA 3SZ7A 3OXGA 3PE4A 2I1JA 3E4BA 4LCTA 4L23A 1Z3YA 2VSXE 3ZPJA 3LVRE 1TYQG 5KJMA 2A4ZA 4KVOA 3IHVA 1SA5A 3QKYA 3HXDA 3UT7A 2WXFA 2P9IG 5JA4D 1YMPA 4UUCA 3NB2A 3ABKE 3BEEA 3R7RA 4L2LA 3CVPA 5CMYA 4CZ2D 2JABA 3BU8A 4W9RA 2GRLA 3Q7FA 5KJKA 3NZUA 3FTWA 4WWOA 1H6OA 2DIWA 1ZBPA 3SBSA 5EIBE 2YHCA 1TR4A 3FH7A 3NBNB 4FA6A 4B8CB 3UINC 2UWJG 2FO1E 3AG1E 4GZ3A 5EYPF 3LJNA 3ZRHA 4O1OA 5ARFA 4Z68A 5B1AE 3IXEA 3ASHA 3ZW3A 4CGVA 5HI7A 2Q7FA 3FUMA 2V5QC 1N0QA 3QAQA 3MKQA 3ZXSA 3MGBA 5FZRA 4TUMA 4ZHBA 2CG3A 1P5QA 3SFXA 4U0ZA 3CEQA 1NA3A 3JUEA 4CT0A 3QNKA 3ML9A 4AM9A 3FHEA 3Q75A 5ENSD 2IJGX 1TJCA 3ASNE 2WB2A 4HI9A 2Y4UA 3TWWA 1PAQA 4EECA 3MEKA 1MJ0A 2X6JA 3RU0A 2OEVA 2BKKB 5EIDA 1MX2A 4JEUA 4HOQA 3ZXPA 3E37A 3PZ2A 1HXIA 2Y3AA 3DSXA 2P9UG 3ASGA 2XS8A 2FBNA 5JJ7A 3SGHA 4DX1A 2F0YA 3G2SA 4L1BA 4GMJA 4PS7A 2E0IA 4FP7A 3J5PA 3ULYA 3ZYKA 1TN7A 1KT1A 3UT4A 4EHMA 4QQIA 3LJ3A 3TXMA 5FWQA 2BUGA 3G2VA 4OAVB 3ML8A 4AXHA 1EDUA 5KBAA 1JCSA 4GZ5A 5BPPA 1B89A 5FZSA 5FZQA 3ULEG 3UIOC 5B1BE 3APDA 5CECB 4K5CA 5A6CA 5D2MC 3R7QA 4XI0A 1HG5A 1UG3A 3ZFWA 3C3RA 4BFRA 2KBXA 2GROB 2JEKA 2XENA 4C9BB 3UI2A 3QOUA 4BY6A 2LAIA 5AN8A 2NSZA 3L08A 4G2VA 1UW4B 3KSLA 1IKND 1SZAA 3FFLA 3NAWA 4EZKA 3JXJA 5LX8A 2F8XK 2FF4A 3SFZA 3W9GA 2BKGA 3CQGB 3E33A 4JB8P 5DBKA 4L9PA 3L13A 2V4LA 4K0RA 3LEWA 3AU5A 5CCLA 1UN8A 4PDXA 4AEZC 1IHGA 2LUHA 3HIZA 5A7DB 1QQEA 1KPSB 4EZLA 3I4GA 2XEVA 5CMWA 1E8YA 1HX8A 1TNUA 1DCQA 3TG4A 3CHRA 3S2AA 3B13A 3T5VA 3CK9A 4LEUA 4U95D 3T8KA 1D9SA 4JEHA 3CR3A 3TL5A 5CEAA 2RFMA 2XPIA 1NA0A 5EILA 2X38A 3BUAA 2KCVA 1BPOA 3S7DA 5JHAA 4UQZA 5ENOD 3Q9NC 3CK7A 1KZOA 5FJYA 2AXZA 3DSVA 4LSZE 1PC2A 2BEDA 3JYSA 3FY4A 3LPZA 5LOZA 3IBEA 4G11A 4RLYA 3RO2A 3D9JA 4FU3A 5ARGA 2I6HA 2IF4A 4O60A 2GRRB 2R59A 3Q5MA 1XNFA 4XKBA 2XQ0A 2CG2A 2KXPC 3ENEA 2EIJE 4KVMA 2AVPA 3ZKJA 5FQ8A 5ANLA 5G04J 2AW6A 4JHKA 1UN9A 3V31A 2XCCA 2X3MA 3MA5A 4J8YA 4PS8A 5IY5E 3ZHEA 4BEPA 1IHBA 3TJPA 2ZGGA 3ASOE 3IV0A 2V5FA 2B0OE 4WUYA 2P9LG 3D9OA 2EINE 3L54A 3TWXA 5AYWD 3AS4A 4LERA 3LS8A 5CERB 1N0RA 3FTYA 4KZCA 1S70B 3B7RL 3V2XA 4HVBA 4XEIG 4MS6A 4Q96A 4BETA 1BLXB 1JUQA 3CKBA 4IRUA 2XGMA 5KCMA 3D9PA 3NZSA 4BX9A 2FEZA 3EDTB 5ENQD 3S7JA 3GZSA 1O1RA 4MBGA 2NXPA 2VTBB 1JCRA 3EHRA 3SQVA 3VLEA 3Q9UC 4GB9A 2R2LA 1EF1C 3HXCA 2MHKA 2VGYA 4GPMA 2RFAA 4P29A 4N5QA 3CVVA 4GTMA 3UTMA 2JLBA 1X81A 4KMOA 3W9FA 2AJAA 3RRMB 3ZYLA 4Y6CA 2J07A 1Z3XA 2EIKE 1S0PA 2NYJA 3Q4AB 4WAFA 3SF4A 4DJAA 4ANXA 3SNXA 4AJWA 4F1PA 4F3VA 1Q2ZA 1A5EA 1TJFA 1QNFA 3HDXA 2L9BA 3FU6A 2QY7A 3PUKA 4BT8A 1D8DA 1MX4A 2HR2A 4WNDA 2IO2C 1OWMA 4M3OA 3UPVA 4G26A 4ABNA 1SQMA 2WXKA 4A55A 3RK6A 4LNBA 5JJ6A 4NQ0A 4F53A 5BV1A 1H19A 2GRMA 3UM3A 2WQHA 4WWNA 2WXGA 4RG9A 4ILGA 2Y69E 2V4HC 4FULA 3U9WA 4JHRA 4IYPA 4GAAA 3GZ1A 2QFCA 1HS6A 2J4DA 4I6JA 1OWOA 2WXHA 1E8WA 4WNEA 1ELRA 2V8SE 4URKA 3T9KA 1RZ4A 3V30A 3CHPA 3FUKA 4JD2G 2A5EA 1HF8A 5HRYA 4JXTA 3FTUA 4AY5A 3TG5A 1WG0A 2X6KA 5CRUA 5LP0A 4B0ZA 4O1PA 3IKOB 4TUUA 3QB2A 3B7SA 3VLFA 1QYMA 3WXXA 4APOA 2EIME 5EN5D 1HG2A 3OTNA 1N9AA 5B3SE 4TXQA 3VTYA 2J4BA 2OVFA 4RQIA 5EDSA 1DNPA 3ESKA 5BXOA 4K5AB 5HKPA 3TWSA 3QJZA 4HLEA 4ILIA 3JUIA 4PH4B 4BT9A 5BUZA 5CHEE 3ZNGA 3FUDA 4GYWA 4GA2A 3F6QA 4CDNA 1E90A 2UY1A 4J8SA 2XEHA 2OEWA 3PH0C 3ZVVA 3RRNB 3LYAA 3ESLA 2CHZA 1EPUA 1NFIE 1DC2A 1E7VA 2ETBA 3RKVA 4J7WA 3QARA 4AVXA 4LRZA 3VTXA 2YINA 3TXNA 5FQ6A 3S7BA 4EQFA 1X5BA 3L6AA 4OVVA 4H7YA 1U2VG 3RSEG 2KM4A 4ANVA 3CSFA 4I2WA 4GTPA 3OXLA 1V55E 3D9HA 4G25A 1NP7A 1IYGA 2KC7A 2WXNA 4JA9A 2AXUA 5LFAA 1IXVA 3QDNA 2VSNA 3SHFA 1XGWA 3D9IA 3DWLG 3D3MA 2C0MA 4ILHB 5FIOA 3DEOA 3UKRG 4GTTA 5M72A 3ASFA 3LVQE 4MKTA 2LXMA 3ZEFA 4DX5D 1TNBA 1OWLA 4J8DA 4J8FA 3MKQB 4GZDA 5EX3A 4B89A 3QWVA 3CVUA 3PNLB 4TV3A 3EHMA 4X8QA 2P9NG 4DLOA 5ITZF 1Z6TA 3G2UA 1HZ4A 3CIAA 4HB5A 3PEUB 3UXGA 4HOTA 3QC1A 4EBAA 1O1TA 2ZGDA 2GRNB 3SBTB 1WDYA 1W3BA 2A5UA 4ZFHA 3D9NA 5JMND 5CCMA 4JHJA 4YDWA 4HOUA 2L0TB 3DXMG 2GRQB 5AJDA 3HVEA 2QZAA 3TWVA 1HU3A 4J0UA 3DXKG 3L9TA 2XRYA 3NF1A 3D9KA 2J08A 4DK5A 3T8MA 4FHKA 2KZTA 4PS3A 3N71A 5BW8C 4JL0A 3B7BA 1N11A 2PQNA 3UMVA 4FJZA 3L22A 4YDEA 4I6EA 3ZGQA 2L0IA 4I17A 3LXUX 4RVBA 5KJLA 3CSTA 1JPLA 2AXVA 3FU3A 3JCKC 4G24A 2H6GA 4BTBA 2VJ8A 4HBDA 2XCBA 3RRUA 3C3OA 4R7LA 4A3TA 2BF0X 5HS0A 5BNWA 3O4ZA 4LNGA 2PNNA 3PZ3A 2MRIA 2DBAA 2KATA 2DYRE 2CHXA 3OAWA 4A63B 3L17A 3LDZA 3C5RA 3FTVA 1A17A 3B7UX 4WNFA 2YQ8A 4U04A 3FDHA 2X6IA 4I6GA 4G1TA 3TWQA 2J09A 1HE8A 2IY0C 1K3ZD 5CRVA 3ONKA 1N54A 3APCA 2WXOA 3CV0A 4HFGA 3G2TA 2WPVA 1OXJA 2WXIA 2L6JA 2P58C 4HRMB 2IOLA 4Q69A 2FI7A 1SW6A 2XZTG 2VGEA 5T3RA 5JJTA 3V79K 1TNYA 4DI3A 4ATGA 4KZ0A 4EPZA 4JA7A 1E8ZA 3AG2E 4V3IA 3FEXA 1OT8A 1FT1A 4BWRA 3WG7E 3KSQA 5T8IA 5KWDA 5AIJA 4KYOB 4UWHA 4B94A 5LCWJ 4HLLA 2M63A 5T4YA 2DYSE 4GZCA 2HE0A 4DPRA 3DEPA 4M7CA 2XPZA 3LY8A 2DCPA 4AY6A 2H6HA 1D8EA 5E75A 1UJKA 4CGWA 4I1AA 5EKQD 3P2BA 1O5MA 2VSOE 3I5PA 3MJWA 1O1SA 1N4QA 1E8XA 2E2EA 2MYOA 4FHJA 4GA0A 3DPYA 4N3BA 1S63A 4N3CA 4FC8A 3HXBA 3SD5A 4DRXE 3Q73A 2WM9A 3E30A 3DSTA 4UWFA 1BD8A 3MZLB 2XRZA 4N2SA 1G3NB 4UQXA 4ATZD 4MLPA 4UWGA 3ASDA 3LKUA 1TNZA 1NL4A 4C0MA 1ELWA 3BG1B 1KZPA 1JWFA 2PM7A 2P9PG 4D10C 4BSZB 2Y4TA 4HRLA 5J90A 4GTQA 4A1GA 2XZDG 2I9CA 3ZHEB 4HORA 3DPDA 2VGXA 5G2NA 3EHQA 3IEGA 3IHYA 3FUFA 5D0QD 3DSUA 3E34A 4I1MA 1U3DA 4Y6WA 2XGSA 3J5QB 4GTRA 3S7FA 3HG0D 2OCCE 3CVNA 3C72A 2HM8A 3DSSA 5CBNA 4NRHB 4UI9C 3FUHA 3CVLA 4F7AA 1UJJA 1E96B 3VLDA 4BESA 3UKUG 4FLHA 1YYHA 4LNUD 4N3AA 3B7TA 2OOEA 4I9EA 1LD7A 4NIKA 3PUJA 3QWWA 4IN3B 3ONLA 5FINA 4YDOA 4GTVA 3PEVB 4CCAA 1E7UA 1N95A 4K5BA 1DVPA 3R9AB 4XKCA 3SY2A 1BI7B 3FU5A 2OVBA 2LAHA 4JPSA 4XIFA 3V2OA 4OVUA 2CHWA 3TAXA 4JVSA 1ELKA 3PZ1A 2VGXB 4HI8A 2ILRA 2YHEA 2LXLA 4UI9K 4F1SA 2X6FA 3GW4A 3JXIA 4GTOA 5CBOA 1TEZA 4CDRA 4E6HA 1H0AA 1FT2A 4PUCA 3AG4E 3PVLA 2RD0A 1QBQA 4HQDA 2R03A 2R5SA 5AQ7A 3UQ3A 3I4RB 3CGHA 2GGFA 3EIQC 1NZNA 2RG8A 2XGOA 2ETCA 4ACLA 5BT1A 3PDNA 3ABLE 3EU5A 1KT0A 4UWLA 2WQ6A 4BTAA 5G05C 3LY9A 1H2TC 3PZ4A 2J8SD 4KBQA 4F6RD 3JQ0A 4B8AA 1ZU2A 3U4TA 2LSVA 2V0PA 3MV3B 3AU4A 2DWZA 3PZDA 3ZIMA 3EU9A 3BG0B 3PE3A 1S64A 2WMNA 2ZU6B 3UX4A 2CFUA 4LG6A 2XPYA 3MV2B 4I43A 4J8EA 3PNTB 3ZUVB 1HH8A 3FWVA 4L2YA 1ZB1A 2H6IA 1INZA 4OYSA 3EHNA 4U07A 3ZYQA 2I1KA 3AS8A 3KS2A 3HYMB 3EUVA 3GZ2A 3HXEA 5KNHD 5ENNA 3KEZA 3CHSA 3BQOA 5FQ4A 3Q47B 1MHQA 3RO3A 3FH8A 1SZ9A 2PL2A 2P9KG 4AOFA 1WY6A 3Q15A 1H2UA 2FO7A 4CT4A 3L16A 4CDMA 4DX6D 3PRZA 3TGOA 2XS1A
chains in the Genus database with same CATH topology
2XHEA 4HVBA 4MS6A 2KCLA 2MRIA 2DBAA 4Q96A 1OWNA 1IQRA 1JUQA 2BTDA 4BX8A 2KATA 4MRUA 2GW1A 2CHXA 3FU0A 3CKBA 4IRUA 4KXKB 3OAWA 4TRQA 1U3CA 2XGMA 5KCMA 4XZ4A 3L17A 1QZ2A 3LDZA 4KT6B 3D9PA 3NZSA 2J49A 4BX9A 3EJNA 2FEZA 3FTVA 1A17A 2LNIA 3B7UX 4WNFA 3EDTB 3DBSA 3CVQA 5C2YA 2PZIA 2YQ8A 4ME2A 4U04A 3S7JA 4CEMA 3SZ7A 3OXGA 3PE4A 1WAO1 3FDHA 2I1JA 2X6IA 3GZSA 3E4BA 4I6GA 4YVOA 3MX3A 4G1TA 4APFA 2LO6A 4LCTA 4L23A 1Z3YA 2NXPA 2J09A 2UY1B 2PQRA 2VSXE 2VTBB 1HE8A 3ZPJA 3FEYA 3LVRE 5KJMA 2A4ZA 4KVOA 3IHVA 3QKYA 3VLEA 4GA1A 2IFUA 3CHQA 3ONKA 3UT7A 3ULQA 1N54A 2WXFA 4NACA 3APCA 4GB9A 2WXOA 2VYIA 3CV0A 4HFGA 1EF1C 3G2TA 2MHKA 2VGYA 2WPVA 2J9QA 4XI9A 4N39A 3BEEA 3R7RA 4P29A 2WXIA 3FUEA 2L6JA 2P58C 4L2LA 3CVPA 5CMYA 2IOLA 3CVVA 4Q69A 4W9RA 3APFA 2GRLA 2JLBA 5AENA 4KMOA 2FI7A 5KJKA 3NZUA 3RRMB 5T3RA 4Y6CA 2J07A 3ZYLA 5JJTA 3FTWA 4WWOA 1Z3XA 2DIWA 4E85A 1ZBPA 1S0PA 3SBSA 3Q4AB 4WAFA 3SF4A 2YHCA 4ATGA 4DI3A 3FH7A 4KZ0A 4DJAA 4JA7A 4EPZA 4FA6A 4ANXA 3SNXA 1E8ZA 4AJWA 4B8CB 2UWJG 4F3VA 4V3IA 3PREA 3FEXA 1TJFA 1QNFA 3HDXA 4GYYA 4BWRA 2L9BA 2X6HA 5T8IA 3FU6A 2QY7A 4GZ3A 3PUKA 4HS2A 4BT8A 4I2ZA 5AIJA 4KYOB 4UWHA 3ZRHA 4B94A 5LCWJ 5ARFA 1HFAA 2HR2A 2M63A 3EIJA 4WNDA 5T4YA 5A23A 3ASHA 4GZCA 3I3NA 3ZW3A 4CGVA 5HI7A 1OWMA 2Q7FA 1GW6A 3FUMA 4M3OA 2CFZA 3QAQA 4AIFA 3MKQA 4G26A 4DPRA 4ABNA 3UPVA 3ZXSA 3MGBA 5FZRA 2VSYA 3AS5A 2CG3A 4RG6A 2XPZA 4UWKA 3LY8A 2DCPA 2KCKA 1P5QA 4J6IA 4DI4A 1SQMA 2WXKA 4A55A 5G55A 4AY6A 4U0ZA 2YNQA 3NQPA 4HXIA 3RK6A 3CEQA 5E75A 1NA3A 1UJKA 4CGWA 4CT0A 4I1AA 5JJ6A 4NQ0A 3QNKA 3ML9A 3RIBA 4AM9A 4F53A 4N2QA 3FH5A 3FTSA 3FHEA 5EKQD 3P2BA 5BV1A 2VSOE 3I5PA 1H19A 3U66A 3MJWA 2LSUA 2GRMA 3CQCB 2IJGX 1E8XA 2E2EA 1EYHA 1TJCA 4FHJA 4GA0A 2WB2A 1N52A 5EX0A 4N3BA 2Y4UA 2WQHA 4N3CA 1PAQA 4WWNA 4EECA 4FC8A 3GYZA 4GCNA 2WXGA 3MEKA 4RG9A 3SD5A 3MYVA 4ILGA 2X6JA 3RU0A 4FULA 2WM9A 3U9WA 4NURA 4JHRA 5DIZA 4A1SA 5HQ8A 4IYPA 4JEUA 4UWFA 4GAAA 3GZ1A 5D0OD 2QFCA 3MZLB 3FTZA 2XRZA 4N2SA 2IQCA 1HS6A 4UQXA 1Y6IA 4HOQA 2J4DA 1HXIA 4I6JA 1OWOA 2Y3AA 4GPKA 4MLPA 4UWGA 3ASDA 2WXHA 3LKUA 1E8WA 3MKRA 4WNEA 2OV8A 4C0MA 1ELRA 3KD7A 1ELWA 3T5XA 2V8SE 4URKA 3BG1B 4LUNU 3ASGA 3G2WA 3CHPA 3HVEB 3FUKA 3FUJA 1JWFA 5C1DA 1HF8A 2FBNA 3CK8A 4JXTA 5JJ7A 2PM7A 2PM6A 3SGHA 1MQSA 4D10C 3FTUA 4IULA 2Y4TA 4ACKA 4AV7A 4AY5A 5J90A 3G2SA 4C0EA 3TG5A 3FTXA 2KZTB 2X6KA 4L1BA 4GMJA 4PS7A 4B0ZA 5LP0A 4A1GA 3IKOB 2I9CA 4TUUA 3QB2A 2R17C 3SI5A 2E0IA 3ZHEB 3U64A 4HORA 4FP7A 4QFVA 3B7SA 2WXJA 3DPDA 3ZYKA 3FUNA 3VLFA 3WXXA 2VGXA 4APOA 4O6FA 1KT1A 5G2NA 1HG2A 2WXMA 3ZYMA 3FUIA 4UQYA 3UT4A 3OTNA 3IEGA 3FP3A 4JZYA 5AJLA 3IHYA 3FUFA 5D0QD 3VTYA 4JC8A 2J4BA 2WVIA 2OVFA 4I1MA 3LJ3A 3UT8A 1U3DA 4Y6WA 3TXMA 5FWQA 3U3WA 2BUGA 2XGSA 5FQ7A 3G2VA 5EDSA 1DNPA 3ESKA 3ML8A 2HO1A 3K9IA 4AXHA 3S7FA 4FJYA 1EDUA 3CVNA 4GZ5A 4GMLA 5BPPA 2HM8A 3QJZA 4GU5A 4HLEA 4ILIA 4NRHB 3JUIA 4PH4B 3FUHA 4UI9C 3CVLA 4BT9A 4F7AA 1UJJA 5BUZA 3URZA 1B89A 5FZSA 5FZQA 5CHEE 3QWPA 3FUDA 4GCOA 3APDA 4XE0A 4GYWA 1E96B 3VLDA 4GA2A 1H6KA 4FLHA 4CDNA 5A6CA 3R7QA 4XI0A 1HG5A 1UG3A 4JW1A 1E90A 4N3AA 3ZFWA 4BFRA 2JEKA 2UY1A 4J8SA 2VTBA 1HO8A 3B7TA 1YA0A 4C9BB 2WXLA 2OOEA 3PH0C 4A3VA 3ZVVA 4I9EA 3RRNB 1OWPA 3CLJA 3CHOA 2IOSA 3QK0A 3LYAA 3ESLA 3PUJA 3QWWA 4IN3B 2CHZA 4Q94A 3ONLA 3QOUA 4BY6A 2LAIA 1EPUA 2HYZA 2NSZA 3L08A 1E7VA 4G2VA 3RKVA 4DLQA 3QARA 4H7XA 4GYOA 3PEVB 4AVXA 4LRZA 1UW4B 4UI9J 4CCAA 3VTXA 2I2OA 2YINA 3TXNA 5FQ6A 3S7BA 4EQFA 3O48A 1SZAA 3CVXA 1E7UA 1X5BA 3FFLA 3L6AA 4OVVA 4EZKA 5LX8A 1DVPA 4H7YA 3R9AB 2FF4A 3SFZA 1L5JA 4XKCA 2KM4A 4AP2A 4ANVA 3CSFA 3CQGB 4I1OB 4I2WA 5DBKA 3FU5A 3OXLA 3L13A 2V4LA 2OVBA 1OUVA 4K0RA 3LEWA 5ANRA 3AU5A 4G25A 2LAHA 4JPSA 4XIFA 5CCLA 1NP7A 1IYGA 1UN8A 2KC7A 3HHMA 4PDXA 5E76A 4AEZC 4OVUA 2CHWA 4BSXA 3TAXA 1IHGA 1Y8MA 4JVSA 1ELKA 2WXNA 2VGXB 3HIZA 5A7DB 1QQEA 2ILRA 2YHEA 3Q49B 5BV0A 4JA9A 4UI9K 4F1SA 2X6FA 4I9CA 3GW4A 2AXUA 1TEZA 4EZLA 5LFAA 3QDNA 3I4GA 2XEVA 5CMWA 2VSNA 1E8YA 1HX8A 4CDRA 4E6HA 3SHFA 1XGWA 3D9MA 3TG4A 3CHRA 3D9IA 3S2AA 3B13A 3T5VA 1H0AA 3CVYA 3D3MA 2C0MA 4ILHB 3CK9A 3OXFA 4LEUA 3CHMA 5KJNA 5JHBA 3PS6A 5M72A 4PUCA 3ASFA 3LVQE 4MKTA 3KAEA 4JEHA 3PVLA 2RD0A 3CR3A 3ZEFA 1LF8A 4FLBA 3TL5A 4RSYA 1JWGA 4U0UA 2R5SA 3UQ3A 3I4RB 4U8HA 3MCXA 3CGHA 1OWLA 2XPIA 4J8DA 1NA0A 4J8FA 2GGFA 3MKQB 2X38A 3EIQC 2KCVA 4GZDA 3CVWA 1NZNA 2AWIA 2RG8A 1BPOA 5EX3A 3S7DA 4L7TA 5JHAA 4B89A 2XGOA 3QWVA 4UQZA 4FADA 3CVUA 3PNLB 4U0SA 4TV3A 3EHMA 4ACLA 5BT1A 3PDNA 4DLOA 3CK7A 2FULA 5FTPA 1Z6TA 3G2UA 1HZ4A 3RJVA 3CIAA 4YVQC 5FJYA 2WXRA 2AXZA 3PEUB 3JQ1A 1PC2A 4U63A 4HOTA 1KT0A 3JYSA 3QC1A 4UWLA 4ANUA 2IONA 4BTAA 5G05C 4EBAA 2WQ6A 3FY4A 3LY9A 3LPZA 5J08A 5G04C 1IQUA 1H2TC 4WNGA 3IBEA 5LOZA 3SBTB 1FVFA 1W3BA 2A5UA 5LCWC 4G11A 4KBQA 3D9NA 2EQXA 4XX5A 3JQ0A 3RO2A 3D9JA 1KLXA 4B8AA 4FU3A 4YNDA 1ZU2A 5ARGA 3U4TA 2LSVA 2V0PA 3MV3B 5CCMA 4JHJA 4N5CA 4HOUA 3AU4A 2I6HA 2L0TB 2IF4A 2MOWA 3PZDA 3ZIMA 3BG0B 3PE3A 2WMNA 2R59A 3ZN3A 3Q5MA 1XNFA 2ZU6B 4XKBA 2CFUA 3UX4A 1VDYA 4EBAG 2XPYA 3MV2B 5AJDA 2XQ0A 3FULA 2CG2A 1FVHA 3ENEA 3HVEA 4I43A 4J8EA 1HU3A 2NC9A 1PY1A 3PNTB 4J0UA 3CKCA 1HH8A 3FWVA 4KVMA 4ANWA 4L2YA 2AVPA 4WWPA 5G05J 1INZA 2XRYA 4OYSA 3EHNA 3NF1A 3D9KA 5ANLA 2VQ2A 5FQ8A 5G04J 2J08A 4U07A 4GZ6A 3ZYQA 4DK5A 3T8MA 4FHKA 2KZTA 2AW6A 2WMOA 4JHKA 2I1KA 1UN9A 2WXPA 3AS8A 3N71A 4G23A 4PS3A 5BW8C 4JL0A 2IU1A 2XCCA 3KS2A 2X3MA 3HYMB 2PQNA 1WM5A 3MA5A 3UMVA 3GZ2A 4PS8A 4FJZA 4CRWA 3L22A 3ZHEA 4I6EA 2C2LA 2L0IA 3ZGQA 1FCHA 4I17A 5ENNA 3LXUX 3TJPA 4EZJA 3KEZA 3CHSA 4RVBA 5KJLA 3CSTA 1JPLA 2AXVA 3FU3A 5FQ4A 2WQ7A 3IV0A 3JCKC 2V5FA 3LCAA 3P1UA 3Q47B 4G24A 1MHQA 4BTBA 2VJ8A 3C98A 3UUXA 4WUYA 3RO3A 3FH8A 2XCBA 1SZ9A 3D9OA 3RRUA 2PL2A 3D9LA 4R7LA 2ONDA 3L54A 4A3TA 4AOFA 1WY6A 3Q15A 5AYWD 3AS4A 1H2UA 4LERA 3LS8A 2FO7A 4CT4A 2BF0X 3L16A 5FT9A 4CDMA 2C0LA 3PRZA 4HOSA 1H2VC 3FTYA 4KZCA 2WXQA 3TGOA 5BNWA 3O4ZA 3LY7A 3B7RL 4K03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U64 A;  4DI3 A;  4DI4 A; 
#chains in the Genus database with same CATH topology
 3SO8 A;  1OWN A;  1OCZ E;  4BX8 A;  5CED B;  5AQ9 A;  4MRU A;  2GW1 A;  1N4P A;  1U3C A;  4XZ4 A;  5AAR A;  1QZ2 A;  5ENT D;  2LNI A;  4DUI A;  3DBS A;  4CYM D;  4CEM A;  2PZI A;  4G8L A;  4ME2 A;  1TN8 A;  1WAO 1;  2DZO A;  1LD8 A;  4YVO A;  3MX3 A;  4APF A;  2LO6 A;  3SFY A;  4B93 B;  1OY3 D;  3B95 A;  2UY1 B;  2PQR A;  3FEY A;  4GA1 A;  2IFU A;  3CHQ A;  3ULQ A;  4NAC A;  2QC9 A;  3Q78 A;  2VYI A;  5AQA A;  2J9Q A;  4XI9 A;  4N39 A;  3FUE A;  3APF A;  5AEN A;  4E85 A;  2ZIR A;  4HNA D;  3PRE A;  2L6B A;  4GYY A;  2X6H A;  4HS2 A;  1N94 A;  2ETA A;  4I2Z A;  4TXR A;  1AWC B;  1HFA A;  3EIJ A;  5A23 A;  3I3N A;  1TN6 A;  1GW6 A;  2CFZ A;  2P9S G;  4AIF A;  4BER A;  2EIL E;  3Q79 A;  2VSY A;  3AS5 A;  4RG6 A;  3UM2 A;  4UWK A;  2KCK A;  4J6I A;  2Y1L E;  4DI4 A;  5G55 A;  2YNQ A;  3NOC D;  4HXI A;  5H7P A;  1LTX A;  3RIB A;  4N2Q A;  3FH5 A;  3FTS A;  3U66 A;  2LSU A;  1MYO A;  1OCO E;  3CQC B;  3DSW A;  1EYH A;  5D66 A;  1N52 A;  5EX0 A;  3GYZ A;  4GCN A;  5AQB A;  3TWR A;  3MYV A;  4NUR A;  5DIZ A;  4A1S A;  5HQ8 A;  1V54 E;  5D0O D;  1Z5S C;  3ZU7 B;  3FTZ A;  2IQC A;  1Y6I A;  4U8V D;  1N4R A;  4U7E B;  4GPK A;  4DX2 A;  3MKR A;  5ENP D;  3UM0 A;  2OV8 A;  3KD7 A;  5AAO A;  3T5X A;  4LUN U;  3G2W A;  3HVE B;  3FUJ A;  3ABM E;  5C1D A;  3CK8 A;  2F8Y A;  2QYJ A;  2PM6 A;  1MX6 A;  1MQS A;  4IUL A;  4AV7 A;  4ACK A;  4C0E A;  3FTX A;  2KZT B;  2R05 A;  2P2C P;  2R17 C;  1H6P A;  3SI5 A;  3U64 A;  4QFV A;  2ZXW E;  2GRP B;  1TNO A;  2WXJ A;  3FUN A;  2QYU A;  4O6F A;  3ZYM A;  2WXM A;  3FUI A;  3X2Q E;  4UQY A;  3FP3 A;  4JZY A;  5AJL A;  4YDY A;  4JC8 A;  2WVI A;  3UT8 A;  3U3W A;  5FQ7 A;  2HO1 A;  4C48 B;  3K9I A;  4FJY A;  5KNG A;  4GML A;  4GU5 A;  4OAU C;  4U8Y D;  3URZ A;  3QWP A;  4GCO A;  4XE0 A;  1OCC E;  1H6K A;  3E32 A;  4JW1 A;  1K8K G;  2VTB A;  1HO8 A;  1YA0 A;  2WXL A;  4A3V A;  1OWP A;  3CLJ A;  2B6C A;  3CHO A;  2IOS A;  3QK0 A;  4Q94 A;  2HYZ A;  4DLQ A;  4H7X A;  4GYO A;  3Q7A A;  1N4S A;  4UI9 J;  2I2O A;  3O48 A;  3CVX A;  1MZC A;  1L5J A;  4AP2 A;  4I1O B;  2IEJ A;  1BU9 A;  1OUV A;  5ANR A;  1JCQ A;  1NI1 A;  3HHM A;  5E76 A;  3DRA A;  4G8K A;  4BSX A;  1Y8M A;  1BI8 B;  3Q49 B;  5BV0 A;  4I9C A;  2H6F A;  2XEE A;  3D9M A;  2ZIS A;  3R9M A;  3CVY A;  3AJI A;  3OXF A;  3L82 A;  3CHM A;  5KJN A;  5JHB A;  3PS6 A;  3KAE A;  1LF8 A;  4FLB A;  5ENR D;  4RSY A;  3RAU A;  2IO3 C;  1JWG A;  4U0U A;  2F37 A;  4U8H A;  3MCX A;  3HRA A;  3CVW A;  2AWI A;  4L7T A;  4FAD A;  4U0S A;  2FUL A;  5FTP A;  3ISM C;  3RJV A;  4YVQ C;  2WXR A;  3UIP C;  3JQ1 A;  4U63 A;  5EYL A;  4ANU A;  2ION A;  4DX7 D;  5J08 A;  5G04 C;  1IQU A;  4WNG A;  1AP7 A;  3KEA A;  4U96 D;  1FVF A;  5LCW C;  1YCS B;  2EQX A;  4XX5 A;  1KLX A;  4YND A;  3C3Q A;  4GMR A;  4N5C A;  3UM1 A;  2MOW A;  3TWT A;  1K1A A;  3ZN3 A;  1VDY A;  4EBA G;  3FUL A;  1FVH A;  4TXP A;  5BXU A;  3NOG D;  2NC9 A;  1PY1 A;  4ANW A;  3CKC A;  4WWP A;  5G05 J;  1DCE A;  2VQ2 A;  3HXF A;  4GZ6 A;  2WMO A;  2WXP A;  4G23 A;  2IU1 A;  2Y0B G;  1FPP A;  1WM5 A;  4GTS A;  4CRW A;  2C2L A;  4EZJ A;  1FCH A;  1SVX A;  2RKK A;  2WQ7 A;  3P1U A;  1RW2 A;  1OCR E;  3LCA A;  3C98 A;  3UUX A;  3D9L A;  2OND A;  3AG3 E;  2DVW A;  5FT9 A;  2C0L A;  1K1B A;  4HOS A;  1H2V C;  2WXQ A;  1UOH A;  3TWU A;  2R02 A;  3NQP A;  3LY7 A;  4K03 A;  3AAA C;  2XHE A;  1SA4 A;  2KCL A;  1IQR A;  2BTD A;  3FU0 A;  4TRQ A;  4KXK B;  4KT6 B;  2DZN A;  4HRN A;  2J49 A;  3EJN A;  3CVQ A;  5C2Y A;  3SZ7 A;  3OXG A;  3PE4 A;  2I1J A;  3E4B A;  4LCT A;  4L23 A;  1Z3Y A;  2VSX E;  3ZPJ A;  3LVR E;  1TYQ G;  5KJM A;  2A4Z A;  4KVO A;  3IHV A;  1SA5 A;  3QKY A;  3HXD A;  3UT7 A;  2WXF A;  2P9I G;  5JA4 D;  1YMP A;  4UUC A;  3NB2 A;  3ABK E;  3BEE A;  3R7R A;  4L2L A;  3CVP A;  5CMY A;  4CZ2 D;  2JAB A;  3BU8 A;  4W9R A;  2GRL A;  3Q7F A;  5KJK A;  3NZU A;  3FTW A;  4WWO A;  1H6O A;  2DIW A;  1ZBP A;  3SBS A;  5EIB E;  2YHC A;  1TR4 A;  3FH7 A;  3NBN B;  4FA6 A;  4B8C B;  3UIN C;  2UWJ G;  2FO1 E;  3AG1 E;  4GZ3 A;  5EYP F;  3LJN A;  3ZRH A;  4O1O A;  5ARF A;  4Z68 A;  5B1A E;  3IXE A;  3ASH A;  3ZW3 A;  4CGV A;  5HI7 A;  2Q7F A;  3FUM A;  2V5Q C;  1N0Q A;  3QAQ A;  3MKQ A;  3ZXS A;  3MGB A;  5FZR A;  4TUM A;  4ZHB A;  2CG3 A;  1P5Q A;  3SFX A;  4U0Z A;  3CEQ A;  1NA3 A;  3JUE A;  4CT0 A;  3QNK A;  3ML9 A;  4AM9 A;  3FHE A;  3Q75 A;  5ENS D;  2IJG X;  1TJC A;  3ASN E;  2WB2 A;  4HI9 A;  2Y4U A;  3TWW A;  1PAQ A;  4EEC A;  3MEK A;  1MJ0 A;  2X6J A;  3RU0 A;  2OEV A;  2BKK B;  5EID A;  1MX2 A;  4JEU A;  4HOQ A;  3ZXP A;  3E37 A;  3PZ2 A;  1HXI A;  2Y3A A;  3DSX A;  2P9U G;  3ASG A;  2XS8 A;  2FBN A;  5JJ7 A;  3SGH A;  4DX1 A;  2F0Y A;  3G2S A;  4L1B A;  4GMJ A;  4PS7 A;  2E0I A;  4FP7 A;  3J5P A;  3ULY A;  3ZYK A;  1TN7 A;  1KT1 A;  3UT4 A;  4EHM A;  4QQI A;  3LJ3 A;  3TXM A;  5FWQ A;  2BUG A;  3G2V A;  4OAV B;  3ML8 A;  4AXH A;  1EDU A;  5KBA A;  1JCS A;  4GZ5 A;  5BPP A;  1B89 A;  5FZS A;  5FZQ A;  3ULE G;  3UIO C;  5B1B E;  3APD A;  5CEC B;  4K5C A;  5A6C A;  5D2M C;  3R7Q A;  4XI0 A;  1HG5 A;  1UG3 A;  3ZFW A;  3C3R A;  4BFR A;  2KBX A;  2GRO B;  2JEK A;  2XEN A;  4C9B B;  3UI2 A;  3QOU A;  4BY6 A;  2LAI A;  5AN8 A;  2NSZ A;  3L08 A;  4G2V A;  1UW4 B;  3KSL A;  1IKN D;  1SZA A;  3FFL A;  3NAW A;  4EZK A;  3JXJ A;  5LX8 A;  2F8X K;  2FF4 A;  3SFZ A;  3W9G A;  2BKG A;  3CQG B;  3E33 A;  4JB8 P;  5DBK A;  4L9P A;  3L13 A;  2V4L A;  4K0R A;  3LEW A;  3AU5 A;  5CCL A;  1UN8 A;  4PDX A;  4AEZ C;  1IHG A;  2LUH A;  3HIZ A;  5A7D B;  1QQE A;  1KPS B;  4EZL A;  3I4G A;  2XEV A;  5CMW A;  1E8Y A;  1HX8 A;  1TNU A;  1DCQ A;  3TG4 A;  3CHR A;  3S2A A;  3B13 A;  3T5V A;  3CK9 A;  4LEU A;  4U95 D;  3T8K A;  1D9S A;  4JEH A;  3CR3 A;  3TL5 A;  5CEA A;  2RFM A;  2XPI A;  1NA0 A;  5EIL A;  2X38 A;  3BUA A;  2KCV A;  1BPO A;  3S7D A;  5JHA A;  4UQZ A;  5ENO D;  3Q9N C;  3CK7 A;  1KZO A;  5FJY A;  2AXZ A;  3DSV A;  4LSZ E;  1PC2 A;  2BED A;  3JYS A;  3FY4 A;  3LPZ A;  5LOZ A;  3IBE A;  4G11 A;  4RLY A;  3RO2 A;  3D9J A;  4FU3 A;  5ARG A;  2I6H A;  2IF4 A;  4O60 A;  2GRR B;  2R59 A;  3Q5M A;  1XNF A;  4XKB A;  2XQ0 A;  2CG2 A;  2KXP C;  3ENE A;  2EIJ E;  4KVM A;  2AVP A;  3ZKJ A;  5FQ8 A;  5ANL A;  5G04 J;  2AW6 A;  4JHK A;  1UN9 A;  3V31 A;  2XCC A;  2X3M A;  3MA5 A;  4J8Y A;  4PS8 A;  5IY5 E;  3ZHE A;  4BEP A;  1IHB A;  3TJP A;  2ZGG A;  3ASO E;  3IV0 A;  2V5F A;  2B0O E;  4WUY A;  2P9L G;  3D9O A;  2EIN E;  3L54 A;  3TWX A;  5AYW D;  3AS4 A;  4LER A;  3LS8 A;  5CER B;  1N0R A;  3FTY A;  4KZC A;  1S70 B;  3B7R L;  3V2X A;  4HVB A;  4XEI G;  4MS6 A;  4Q96 A;  4BET A;  1BLX B;  1JUQ A;  3CKB A;  4IRU A;  2XGM A;  5KCM A;  3D9P A;  3NZS A;  4BX9 A;  2FEZ A;  3EDT B;  5ENQ D;  3S7J A;  3GZS A;  1O1R A;  4MBG A;  2NXP A;  2VTB B;  1JCR A;  3EHR A;  3SQV A;  3VLE A;  3Q9U C;  4GB9 A;  2R2L A;  1EF1 C;  3HXC A;  2MHK A;  2VGY A;  4GPM A;  2RFA A;  4P29 A;  4N5Q A;  3CVV A;  4GTM A;  3UTM A;  2JLB A;  1X81 A;  4KMO A;  3W9F A;  2AJA A;  3RRM B;  3ZYL A;  4Y6C A;  2J07 A;  1Z3X A;  2EIK E;  1S0P A;  2NYJ A;  3Q4A B;  4WAF A;  3SF4 A;  4DJA A;  4ANX A;  3SNX A;  4AJW A;  4F1P A;  4F3V A;  1Q2Z A;  1A5E A;  1TJF A;  1QNF A;  3HDX A;  2L9B A;  3FU6 A;  2QY7 A;  3PUK A;  4BT8 A;  1D8D A;  1MX4 A;  2HR2 A;  4WND A;  2IO2 C;  1OWM A;  4M3O A;  3UPV A;  4G26 A;  4ABN A;  1SQM A;  2WXK A;  4A55 A;  3RK6 A;  4LNB A;  5JJ6 A;  4NQ0 A;  4F53 A;  5BV1 A;  1H19 A;  2GRM A;  3UM3 A;  2WQH A;  4WWN A;  2WXG A;  4RG9 A;  4ILG A;  2Y69 E;  2V4H C;  4FUL A;  3U9W A;  4JHR A;  4IYP A;  4GAA A;  3GZ1 A;  2QFC A;  1HS6 A;  2J4D A;  4I6J A;  1OWO A;  2WXH A;  1E8W A;  4WNE A;  1ELR A;  2V8S E;  4URK A;  3T9K A;  1RZ4 A;  3V30 A;  3CHP A;  3FUK A;  4JD2 G;  2A5E A;  1HF8 A;  5HRY A;  4JXT A;  3FTU A;  4AY5 A;  3TG5 A;  1WG0 A;  2X6K A;  5CRU A;  5LP0 A;  4B0Z A;  4O1P A;  3IKO B;  4TUU A;  3QB2 A;  3B7S A;  3VLF A;  1QYM A;  3WXX A;  4APO A;  2EIM E;  5EN5 D;  1HG2 A;  3OTN A;  1N9A A;  5B3S E;  4TXQ A;  3VTY A;  2J4B A;  2OVF A;  4RQI A;  5EDS A;  1DNP A;  3ESK A;  5BXO A;  4K5A B;  5HKP A;  3TWS A;  3QJZ A;  4HLE A;  4ILI A;  3JUI A;  4PH4 B;  4BT9 A;  5BUZ A;  5CHE E;  3ZNG A;  3FUD A;  4GYW A;  4GA2 A;  3F6Q A;  4CDN A;  1E90 A;  2UY1 A;  4J8S A;  2XEH A;  2OEW A;  3PH0 C;  3ZVV A;  3RRN B;  3LYA A;  3ESL A;  2CHZ A;  1EPU A;  1NFI E;  1DC2 A;  1E7V A;  2ETB A;  3RKV A;  4J7W A;  3QAR A;  4AVX A;  4LRZ A;  3VTX A;  2YIN A;  3TXN A;  5FQ6 A;  3S7B A;  4EQF A;  1X5B A;  3L6A A;  4OVV A;  4H7Y A;  1U2V G;  3RSE G;  2KM4 A;  4ANV A;  3CSF A;  4I2W A;  4GTP A;  3OXL A;  1V55 E;  3D9H A;  4G25 A;  1NP7 A;  1IYG A;  2KC7 A;  2WXN A;  4JA9 A;  2AXU A;  5LFA A;  1IXV A;  3QDN A;  2VSN A;  3SHF A;  1XGW A;  3D9I A;  3DWL G;  3D3M A;  2C0M A;  4ILH B;  5FIO A;  3DEO A;  3UKR G;  4GTT A;  5M72 A;  3ASF A;  3LVQ E;  4MKT A;  2LXM A;  3ZEF A;  4DX5 D;  1TNB A;  1OWL A;  4J8D A;  4J8F A;  3MKQ B;  4GZD A;  5EX3 A;  4B89 A;  3QWV A;  3CVU A;  3PNL B;  4TV3 A;  3EHM A;  4X8Q A;  2P9N G;  4DLO A;  5ITZ F;  1Z6T A;  3G2U A;  1HZ4 A;  3CIA A;  4HB5 A;  3PEU B;  3UXG A;  4HOT A;  3QC1 A;  4EBA A;  1O1T A;  2ZGD A;  2GRN B;  3SBT B;  1WDY A;  1W3B A;  2A5U A;  4ZFH A;  3D9N A;  5JMN D;  5CCM A;  4JHJ A;  4YDW A;  4HOU A;  2L0T B;  3DXM G;  2GRQ B;  5AJD A;  3HVE A;  2QZA A;  3TWV A;  1HU3 A;  4J0U A;  3DXK G;  3L9T A;  2XRY A;  3NF1 A;  3D9K A;  2J08 A;  4DK5 A;  3T8M A;  4FHK A;  2KZT A;  4PS3 A;  3N71 A;  5BW8 C;  4JL0 A;  3B7B A;  1N11 A;  2PQN A;  3UMV A;  4FJZ A;  3L22 A;  4YDE A;  4I6E A;  3ZGQ A;  2L0I A;  4I17 A;  3LXU X;  4RVB A;  5KJL A;  3CST A;  1JPL A;  2AXV A;  3FU3 A;  3JCK C;  4G24 A;  2H6G A;  4BTB A;  2VJ8 A;  4HBD A;  2XCB A;  3RRU A;  3C3O A;  4R7L A;  4A3T A;  2BF0 X;  5HS0 A;  5BNW A;  3O4Z A;  4LNG A;  2PNN A;  3PZ3 A;  2MRI A;  2DBA A;  2KAT A;  2DYR E;  2CHX A;  3OAW A;  4A63 B;  3L17 A;  3LDZ A;  3C5R A;  3FTV A;  1A17 A;  3B7U X;  4WNF A;  2YQ8 A;  4U04 A;  3FDH A;  2X6I A;  4I6G A;  4G1T A;  3TWQ A;  2J09 A;  1HE8 A;  2IY0 C;  1K3Z D;  5CRV A;  3ONK A;  1N54 A;  3APC A;  2WXO A;  3CV0 A;  4HFG A;  3G2T A;  2WPV A;  1OXJ A;  2WXI A;  2L6J A;  2P58 C;  4HRM B;  2IOL A;  4Q69 A;  2FI7 A;  1SW6 A;  2XZT G;  2VGE A;  5T3R A;  5JJT A;  3V79 K;  1TNY A;  4DI3 A;  4ATG A;  4KZ0 A;  4EPZ A;  4JA7 A;  1E8Z A;  3AG2 E;  4V3I A;  3FEX A;  1OT8 A;  1FT1 A;  4BWR A;  3WG7 E;  3KSQ A;  5T8I A;  5KWD A;  5AIJ A;  4KYO B;  4UWH A;  4B94 A;  5LCW J;  4HLL A;  2M63 A;  5T4Y A;  2DYS E;  4GZC A;  2HE0 A;  4DPR A;  3DEP A;  4M7C A;  2XPZ A;  3LY8 A;  2DCP A;  4AY6 A;  2H6H A;  1D8E A;  5E75 A;  1UJK A;  4CGW A;  4I1A A;  5EKQ D;  3P2B A;  1O5M A;  2VSO E;  3I5P A;  3MJW A;  1O1S A;  1N4Q A;  1E8X A;  2E2E A;  2MYO A;  4FHJ A;  4GA0 A;  3DPY A;  4N3B A;  1S63 A;  4N3C A;  4FC8 A;  3HXB A;  3SD5 A;  4DRX E;  3Q73 A;  2WM9 A;  3E30 A;  3DST A;  4UWF A;  1BD8 A;  3MZL B;  2XRZ A;  4N2S A;  1G3N B;  4UQX A;  4ATZ D;  4MLP A;  4UWG A;  3ASD A;  3LKU A;  1TNZ A;  1NL4 A;  4C0M A;  1ELW A;  3BG1 B;  1KZP A;  1JWF A;  2PM7 A;  2P9P G;  4D10 C;  4BSZ B;  2Y4T A;  4HRL A;  5J90 A;  4GTQ A;  4A1G A;  2XZD G;  2I9C A;  3ZHE B;  4HOR A;  3DPD A;  2VGX A;  5G2N A;  3EHQ A;  3IEG A;  3IHY A;  3FUF A;  5D0Q D;  3DSU A;  3E34 A;  4I1M A;  1U3D A;  4Y6W A;  2XGS A;  3J5Q B;  4GTR A;  3S7F A;  3HG0 D;  2OCC E;  3CVN A;  3C72 A;  2HM8 A;  3DSS A;  5CBN A;  4NRH B;  4UI9 C;  3FUH A;  3CVL A;  4F7A A;  1UJJ A;  1E96 B;  3VLD A;  4BES A;  3UKU G;  4FLH A;  1YYH A;  4LNU D;  4N3A A;  3B7T A;  2OOE A;  4I9E A;  1LD7 A;  4NIK A;  3PUJ A;  3QWW A;  4IN3 B;  3ONL A;  5FIN A;  4YDO A;  4GTV A;  3PEV B;  4CCA A;  1E7U A;  1N95 A;  4K5B A;  1DVP A;  3R9A B;  4XKC A;  3SY2 A;  1BI7 B;  3FU5 A;  2OVB A;  2LAH A;  4JPS A;  4XIF A;  3V2O A;  4OVU A;  2CHW A;  3TAX A;  4JVS A;  1ELK A;  3PZ1 A;  2VGX B;  4HI8 A;  2ILR A;  2YHE A;  2LXL A;  4UI9 K;  4F1S A;  2X6F A;  3GW4 A;  3JXI A;  4GTO A;  5CBO A;  1TEZ A;  4CDR A;  4E6H A;  1H0A A;  1FT2 A;  4PUC A;  3AG4 E;  3PVL A;  2RD0 A;  1QBQ A;  4HQD A;  2R03 A;  2R5S A;  5AQ7 A;  3UQ3 A;  3I4R B;  3CGH A;  2GGF A;  3EIQ C;  1NZN A;  2RG8 A;  2XGO A;  2ETC A;  4ACL A;  5BT1 A;  3PDN A;  3ABL E;  3EU5 A;  1KT0 A;  4UWL A;  2WQ6 A;  4BTA A;  5G05 C;  3LY9 A;  1H2T C;  3PZ4 A;  2J8S D;  4KBQ A;  4F6R D;  3JQ0 A;  4B8A A;  1ZU2 A;  3U4T A;  2LSV A;  2V0P A;  3MV3 B;  3AU4 A;  2DWZ A;  3PZD A;  3ZIM A;  3EU9 A;  3BG0 B;  3PE3 A;  1S64 A;  2WMN A;  2ZU6 B;  3UX4 A;  2CFU A;  4LG6 A;  2XPY A;  3MV2 B;  4I43 A;  4J8E A;  3PNT B;  3ZUV B;  1HH8 A;  3FWV A;  4L2Y A;  1ZB1 A;  2H6I A;  1INZ A;  4OYS A;  3EHN A;  4U07 A;  3ZYQ A;  2I1K A;  3AS8 A;  3KS2 A;  3HYM B;  3EUV A;  3GZ2 A;  3HXE A;  5KNH D;  5ENN A;  3KEZ A;  3CHS A;  3BQO A;  5FQ4 A;  3Q47 B;  1MHQ A;  3RO3 A;  3FH8 A;  1SZ9 A;  2PL2 A;  2P9K G;  4AOF A;  1WY6 A;  3Q15 A;  1H2U A;  2FO7 A;  4CT4 A;  3L16 A;  4CDM A;  4DX6 D;  3PRZ A;  3TGO A;  2XS1 A; 
#chains in the Genus database with same CATH homology
 2XHE A;  4HVB A;  4MS6 A;  2KCL A;  2MRI A;  2DBA A;  4Q96 A;  1OWN A;  1IQR A;  1JUQ A;  2BTD A;  4BX8 A;  2KAT A;  4MRU A;  2GW1 A;  2CHX A;  3FU0 A;  3CKB A;  4IRU A;  4KXK B;  3OAW A;  4TRQ A;  1U3C A;  2XGM A;  5KCM A;  4XZ4 A;  3L17 A;  1QZ2 A;  3LDZ A;  4KT6 B;  3D9P A;  3NZS A;  2J49 A;  4BX9 A;  3EJN A;  2FEZ A;  3FTV A;  1A17 A;  2LNI A;  3B7U X;  4WNF A;  3EDT B;  3DBS A;  3CVQ A;  5C2Y A;  2PZI A;  2YQ8 A;  4ME2 A;  4U04 A;  3S7J A;  4CEM A;  3SZ7 A;  3OXG A;  3PE4 A;  1WAO 1;  3FDH A;  2I1J A;  2X6I A;  3GZS A;  3E4B A;  4I6G A;  4YVO A;  3MX3 A;  4G1T A;  4APF A;  2LO6 A;  4LCT A;  4L23 A;  1Z3Y A;  2NXP A;  2J09 A;  2UY1 B;  2PQR A;  2VSX E;  2VTB B;  1HE8 A;  3ZPJ A;  3FEY A;  3LVR E;  5KJM A;  2A4Z A;  4KVO A;  3IHV A;  3QKY A;  3VLE A;  4GA1 A;  2IFU A;  3CHQ A;  3ONK A;  3UT7 A;  3ULQ A;  1N54 A;  2WXF A;  4NAC A;  3APC A;  4GB9 A;  2WXO A;  2VYI A;  3CV0 A;  4HFG A;  1EF1 C;  3G2T A;  2MHK A;  2VGY A;  2WPV A;  2J9Q A;  4XI9 A;  4N39 A;  3BEE A;  3R7R A;  4P29 A;  2WXI A;  3FUE A;  2L6J A;  2P58 C;  4L2L A;  3CVP A;  5CMY A;  2IOL A;  3CVV A;  4Q69 A;  4W9R A;  3APF A;  2GRL A;  2JLB A;  5AEN A;  4KMO A;  2FI7 A;  5KJK A;  3NZU A;  3RRM B;  5T3R A;  4Y6C A;  2J07 A;  3ZYL A;  5JJT A;  3FTW A;  4WWO A;  1Z3X A;  2DIW A;  4E85 A;  1ZBP A;  1S0P A;  3SBS A;  3Q4A B;  4WAF A;  3SF4 A;  2YHC A;  4ATG A;  4DI3 A;  3FH7 A;  4KZ0 A;  4DJA A;  4JA7 A;  4EPZ A;  4FA6 A;  4ANX A;  3SNX A;  1E8Z A;  4AJW A;  4B8C B;  2UWJ G;  4F3V A;  4V3I A;  3PRE A;  3FEX A;  1TJF A;  1QNF A;  3HDX A;  4GYY A;  4BWR A;  2L9B A;  2X6H A;  5T8I A;  3FU6 A;  2QY7 A;  4GZ3 A;  3PUK A;  4HS2 A;  4BT8 A;  4I2Z A;  5AIJ A;  4KYO B;  4UWH A;  3ZRH A;  4B94 A;  5LCW J;  5ARF A;  1HFA A;  2HR2 A;  2M63 A;  3EIJ A;  4WND A;  5T4Y A;  5A23 A;  3ASH A;  4GZC A;  3I3N A;  3ZW3 A;  4CGV A;  5HI7 A;  1OWM A;  2Q7F A;  1GW6 A;  3FUM A;  4M3O A;  2CFZ A;  3QAQ A;  4AIF A;  3MKQ A;  4G26 A;  4DPR A;  4ABN A;  3UPV A;  3ZXS A;  3MGB A;  5FZR A;  2VSY A;  3AS5 A;  2CG3 A;  4RG6 A;  2XPZ A;  4UWK A;  3LY8 A;  2DCP A;  2KCK A;  1P5Q A;  4J6I A;  4DI4 A;  1SQM A;  2WXK A;  4A55 A;  5G55 A;  4AY6 A;  4U0Z A;  2YNQ A;  3NQP A;  4HXI A;  3RK6 A;  3CEQ A;  5E75 A;  1NA3 A;  1UJK A;  4CGW A;  4CT0 A;  4I1A A;  5JJ6 A;  4NQ0 A;  3QNK A;  3ML9 A;  3RIB A;  4AM9 A;  4F53 A;  4N2Q A;  3FH5 A;  3FTS A;  3FHE A;  5EKQ D;  3P2B A;  5BV1 A;  2VSO E;  3I5P A;  1H19 A;  3U66 A;  3MJW A;  2LSU A;  2GRM A;  3CQC B;  2IJG X;  1E8X A;  2E2E A;  1EYH A;  1TJC A;  4FHJ A;  4GA0 A;  2WB2 A;  1N52 A;  5EX0 A;  4N3B A;  2Y4U A;  2WQH A;  4N3C A;  1PAQ A;  4WWN A;  4EEC A;  4FC8 A;  3GYZ A;  4GCN A;  2WXG A;  3MEK A;  4RG9 A;  3SD5 A;  3MYV A;  4ILG A;  2X6J A;  3RU0 A;  4FUL A;  2WM9 A;  3U9W A;  4NUR A;  4JHR A;  5DIZ A;  4A1S A;  5HQ8 A;  4IYP A;  4JEU A;  4UWF A;  4GAA A;  3GZ1 A;  5D0O D;  2QFC A;  3MZL B;  3FTZ A;  2XRZ A;  4N2S A;  2IQC A;  1HS6 A;  4UQX A;  1Y6I A;  4HOQ A;  2J4D A;  1HXI A;  4I6J A;  1OWO A;  2Y3A A;  4GPK A;  4MLP A;  4UWG A;  3ASD A;  2WXH A;  3LKU A;  1E8W A;  3MKR A;  4WNE A;  2OV8 A;  4C0M A;  1ELR A;  3KD7 A;  1ELW A;  3T5X A;  2V8S E;  4URK A;  3BG1 B;  4LUN U;  3ASG A;  3G2W A;  3CHP A;  3HVE B;  3FUK A;  3FUJ A;  1JWF A;  5C1D A;  1HF8 A;  2FBN A;  3CK8 A;  4JXT A;  5JJ7 A;  2PM7 A;  2PM6 A;  3SGH A;  1MQS A;  4D10 C;  3FTU A;  4IUL A;  2Y4T A;  4ACK A;  4AV7 A;  4AY5 A;  5J90 A;  3G2S A;  4C0E A;  3TG5 A;  3FTX A;  2KZT B;  2X6K A;  4L1B A;  4GMJ A;  4PS7 A;  4B0Z A;  5LP0 A;  4A1G A;  3IKO B;  2I9C A;  4TUU A;  3QB2 A;  2R17 C;  3SI5 A;  2E0I A;  3ZHE B;  3U64 A;  4HOR A;  4FP7 A;  4QFV A;  3B7S A;  2WXJ A;  3DPD A;  3ZYK A;  3FUN A;  3VLF A;  3WXX A;  2VGX A;  4APO A;  4O6F A;  1KT1 A;  5G2N A;  1HG2 A;  2WXM A;  3ZYM A;  3FUI A;  4UQY A;  3UT4 A;  3OTN A;  3IEG A;  3FP3 A;  4JZY A;  5AJL A;  3IHY A;  3FUF A;  5D0Q D;  3VTY A;  4JC8 A;  2J4B A;  2WVI A;  2OVF A;  4I1M A;  3LJ3 A;  3UT8 A;  1U3D A;  4Y6W A;  3TXM A;  5FWQ A;  3U3W A;  2BUG A;  2XGS A;  5FQ7 A;  3G2V A;  5EDS A;  1DNP A;  3ESK A;  3ML8 A;  2HO1 A;  3K9I A;  4AXH A;  3S7F A;  4FJY A;  1EDU A;  3CVN A;  4GZ5 A;  4GML A;  5BPP A;  2HM8 A;  3QJZ A;  4GU5 A;  4HLE A;  4ILI A;  4NRH B;  3JUI A;  4PH4 B;  3FUH A;  4UI9 C;  3CVL A;  4BT9 A;  4F7A A;  1UJJ A;  5BUZ A;  3URZ A;  1B89 A;  5FZS A;  5FZQ A;  5CHE E;  3QWP A;  3FUD A;  4GCO A;  3APD A;  4XE0 A;  4GYW A;  1E96 B;  3VLD A;  4GA2 A;  1H6K A;  4FLH A;  4CDN A;  5A6C A;  3R7Q A;  4XI0 A;  1HG5 A;  1UG3 A;  4JW1 A;  1E90 A;  4N3A A;  3ZFW A;  4BFR A;  2JEK A;  2UY1 A;  4J8S A;  2VTB A;  1HO8 A;  3B7T A;  1YA0 A;  4C9B B;  2WXL A;  2OOE A;  3PH0 C;  4A3V A;  3ZVV A;  4I9E A;  3RRN B;  1OWP A;  3CLJ A;  3CHO A;  2IOS A;  3QK0 A;  3LYA A;  3ESL A;  3PUJ A;  3QWW A;  4IN3 B;  2CHZ A;  4Q94 A;  3ONL A;  3QOU A;  4BY6 A;  2LAI A;  1EPU A;  2HYZ A;  2NSZ A;  3L08 A;  1E7V A;  4G2V A;  3RKV A;  4DLQ A;  3QAR A;  4H7X A;  4GYO A;  3PEV B;  4AVX A;  4LRZ A;  1UW4 B;  4UI9 J;  4CCA A;  3VTX A;  2I2O A;  2YIN A;  3TXN A;  5FQ6 A;  3S7B A;  4EQF A;  3O48 A;  1SZA A;  3CVX A;  1E7U A;  1X5B A;  3FFL A;  3L6A A;  4OVV A;  4EZK A;  5LX8 A;  1DVP A;  4H7Y A;  3R9A B;  2FF4 A;  3SFZ A;  1L5J A;  4XKC A;  2KM4 A;  4AP2 A;  4ANV A;  3CSF A;  3CQG B;  4I1O B;  4I2W A;  5DBK A;  3FU5 A;  3OXL A;  3L13 A;  2V4L A;  2OVB A;  1OUV A;  4K0R A;  3LEW A;  5ANR A;  3AU5 A;  4G25 A;  2LAH A;  4JPS A;  4XIF A;  5CCL A;  1NP7 A;  1IYG A;  1UN8 A;  2KC7 A;  3HHM A;  4PDX A;  5E76 A;  4AEZ C;  4OVU A;  2CHW A;  4BSX A;  3TAX A;  1IHG A;  1Y8M A;  4JVS A;  1ELK A;  2WXN A;  2VGX B;  3HIZ A;  5A7D B;  1QQE A;  2ILR A;  2YHE A;  3Q49 B;  5BV0 A;  4JA9 A;  4UI9 K;  4F1S A;  2X6F A;  4I9C A;  3GW4 A;  2AXU A;  1TEZ A;  4EZL A;  5LFA A;  3QDN A;  3I4G A;  2XEV A;  5CMW A;  2VSN A;  1E8Y A;  1HX8 A;  4CDR A;  4E6H A;  3SHF A;  1XGW A;  3D9M A;  3TG4 A;  3CHR A;  3D9I A;  3S2A A;  3B13 A;  3T5V A;  1H0A A;  3CVY A;  3D3M A;  2C0M A;  4ILH B;  3CK9 A;  3OXF A;  4LEU A;  3CHM A;  5KJN A;  5JHB A;  3PS6 A;  5M72 A;  4PUC A;  3ASF A;  3LVQ E;  4MKT A;  3KAE A;  4JEH A;  3PVL A;  2RD0 A;  3CR3 A;  3ZEF A;  1LF8 A;  4FLB A;  3TL5 A;  4RSY A;  1JWG A;  4U0U A;  2R5S A;  3UQ3 A;  3I4R B;  4U8H A;  3MCX A;  3CGH A;  1OWL A;  2XPI A;  4J8D A;  1NA0 A;  4J8F A;  2GGF A;  3MKQ B;  2X38 A;  3EIQ C;  2KCV A;  4GZD A;  3CVW A;  1NZN A;  2AWI A;  2RG8 A;  1BPO A;  5EX3 A;  3S7D A;  4L7T A;  5JHA A;  4B89 A;  2XGO A;  3QWV A;  4UQZ A;  4FAD A;  3CVU A;  3PNL B;  4U0S A;  4TV3 A;  3EHM A;  4ACL A;  5BT1 A;  3PDN A;  4DLO A;  3CK7 A;  2FUL A;  5FTP A;  1Z6T A;  3G2U A;  1HZ4 A;  3RJV A;  3CIA A;  4YVQ C;  5FJY A;  2WXR A;  2AXZ A;  3PEU B;  3JQ1 A;  1PC2 A;  4U63 A;  4HOT A;  1KT0 A;  3JYS A;  3QC1 A;  4UWL A;  4ANU A;  2ION A;  4BTA A;  5G05 C;  4EBA A;  2WQ6 A;  3FY4 A;  3LY9 A;  3LPZ A;  5J08 A;  5G04 C;  1IQU A;  1H2T C;  4WNG A;  3IBE A;  5LOZ A;  3SBT B;  1FVF A;  1W3B A;  2A5U A;  5LCW C;  4G11 A;  4KBQ A;  3D9N A;  2EQX A;  4XX5 A;  3JQ0 A;  3RO2 A;  3D9J A;  1KLX A;  4B8A A;  4FU3 A;  4YND A;  1ZU2 A;  5ARG A;  3U4T A;  2LSV A;  2V0P A;  3MV3 B;  5CCM A;  4JHJ A;  4N5C A;  4HOU A;  3AU4 A;  2I6H A;  2L0T B;  2IF4 A;  2MOW A;  3PZD A;  3ZIM A;  3BG0 B;  3PE3 A;  2WMN A;  2R59 A;  3ZN3 A;  3Q5M A;  1XNF A;  2ZU6 B;  4XKB A;  2CFU A;  3UX4 A;  1VDY A;  4EBA G;  2XPY A;  3MV2 B;  5AJD A;  2XQ0 A;  3FUL A;  2CG2 A;  1FVH A;  3ENE A;  3HVE A;  4I43 A;  4J8E A;  1HU3 A;  2NC9 A;  1PY1 A;  3PNT B;  4J0U A;  3CKC A;  1HH8 A;  3FWV A;  4KVM A;  4ANW A;  4L2Y A;  2AVP A;  4WWP A;  5G05 J;  1INZ A;  2XRY A;  4OYS A;  3EHN A;  3NF1 A;  3D9K A;  5ANL A;  2VQ2 A;  5FQ8 A;  5G04 J;  2J08 A;  4U07 A;  4GZ6 A;  3ZYQ A;  4DK5 A;  3T8M A;  4FHK A;  2KZT A;  2AW6 A;  2WMO A;  4JHK A;  2I1K A;  1UN9 A;  2WXP A;  3AS8 A;  3N71 A;  4G23 A;  4PS3 A;  5BW8 C;  4JL0 A;  2IU1 A;  2XCC A;  3KS2 A;  2X3M A;  3HYM B;  2PQN A;  1WM5 A;  3MA5 A;  3UMV A;  3GZ2 A;  4PS8 A;  4FJZ A;  4CRW A;  3L22 A;  3ZHE A;  4I6E A;  2C2L A;  2L0I A;  3ZGQ A;  1FCH A;  4I17 A;  5ENN A;  3LXU X;  3TJP A;  4EZJ A;  3KEZ A;  3CHS A;  4RVB A;  5KJL A;  3CST A;  1JPL A;  2AXV A;  3FU3 A;  5FQ4 A;  2WQ7 A;  3IV0 A;  3JCK C;  2V5F A;  3LCA A;  3P1U A;  3Q47 B;  4G24 A;  1MHQ A;  4BTB A;  2VJ8 A;  3C98 A;  3UUX A;  4WUY A;  3RO3 A;  3FH8 A;  2XCB A;  1SZ9 A;  3D9O A;  3RRU A;  2PL2 A;  3D9L A;  4R7L A;  2OND A;  3L54 A;  4A3T A;  4AOF A;  1WY6 A;  3Q15 A;  5AYW D;  3AS4 A;  1H2U A;  4LER A;  3LS8 A;  2FO7 A;  4CT4 A;  2BF0 X;  3L16 A;  5FT9 A;  4CDM A;  2C0L A;  3PRZ A;  4HOS A;  1H2V C;  3FTY A;  4KZC A;  2WXQ A;  3TGO A;  5BNW A;  3O4Z A;  3LY7 A;  3B7R L;  4K03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...