4DI4A

Crystal structure of a 3:1 complex of treponema pallidum tatp(t) (tp0957) bound to tatt (tp0956)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
273
Chain Sequence
DADFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Characterization of the Interaction between Two Periplasmic Treponema pallidum Lipoproteins that are Components of a TPR-Protein-Associated TRAP Transporter (TPAT).
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
molecule tags Transport protein
molecule keywords TatT (Tp0956)
total genus 103
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4di4A00
4DI4A 3U64A 4DI3A
chains in the Genus database with same CATH superfamily
5AQAA 2KC7A 1INZA 3LVQE 5FT9A 1N4PA 3SFXA 2GRLA 3AG1E 5AARA 5CCLA 5HI7A 1BU9A 1JCSA 4XI9A 3HXEA 3PDNA 4G23A 4ATGA 3Q15A 3G2WA 3KSQA 1Y6IA 3LY7A 3NF1A 1TYQG 1ELWA 3FY4A 2AXVA 2EIME 3ZYLA 4BERA 2KZTA 1KT1A 1NP7A 3BQOA 5CCMA 4H7XA 5CERB 4ILHB 3UKUG 3KEZA 3RIBA 3QAQA 4A55A 1L5JA 4PS3A 4UWGA 3D9PA 4BT8A 4OYSA 3CQCB 3RU0A 1WY6A 5ITZF 3PRZA 3P2BA 3ZHEA 5C2YA 2FEZA 3EHQA 1HXIA 2XCCA 3TWRA 4DI4A 2KATA 2LXLA 5FQ6A 3CHMA 1PAQA 2F8YA 4BT9A 3RO2A 2XZTG 3HXBA 3ZVVA 4O1PA 3PEVB 4GB9A 3UM3A 4HI9A 3UQ3A 3FTYA 2KBXA 3CHOA 2VSYA 3MCXA 3TG4A 4BSXA 3FWVA 4XI0A 2J9QA 2GRRB 2L6JA 2UWJG 3GZ2A 2IEJA 4I1OB 3ESLA 5JHAA 2UY1A 4G24A 4I9EA 2ZISA 1OWPA 2BKKB 2XQ0A 3C5RA 3ASFA 1NI1A 3I4RB 2VGYA 4WWNA 4CCAA 2ZGGA 3AJIA 2LSUA 4LNUD 3Q7FA 5FIOA 4LCTA 4AXHA 3L6AA 5D0OD 4FA6A 4PH4B 1S0PA 3FH5A 4ZHBA 4L1BA 4IN3B 2LO6A 3LY9A 4R7LA 2VTBB 1IQUA 4QQIA 1D8DA 2ONDA 4FHJA 4LEUA 4A3VA 4YDWA 5T8IA 3EUVA 4JEHA 4XX5A 1OCRE 3IV0A 4HORA 3Q78A 4E6HA 3D9LA 3LCAA 1JWFA 3NOCD 4ANVA 4OVVA 3KS2A 2WXFA 3KEAA 2KCVA 4TXPA 4GTTA 4GTMA 2WM9A 4RG9A 2E0IA 4ABNA 1K3ZD 5LCWJ 4EECA 5FINA 2WXNA 3UTMA 4HFGA 5ANLA 4F7AA 4Q69A 4I1MA 3NQPA 4FC8A 1OCCE 4EZJA 4UI9J 3CV0A 3HRAA 2LNIA 3EHRA 1UN8A 2WXGA 1HX8A 3D9OA 3FTVA 2C0MA 2RKKA 4N5CA 4V3IA 4LERA 3AU4A 3EU9A 1KLXA 4M7CA 3FTXA 4EQFA 5BT1A 2JLBA 3GW4A 3MZLB 1Z6TA 1MYOA 4GZ5A 4XEIG 4J0UA 4ZFHA 1O5MA 2LAHA 2R02A 4GYOA 3CKCA 3TWVA 4JHKA 3O4ZA 5G2NA 4NURA 4YDYA 4HRLA 3S7BA 3SNXA 2EILE 3VLEA 1UOHA 3SZ7A 2Y3AA 3LJNA 3J5QB 5CHEE 4KXKB 4DX2A 3MJWA 1V54E 2Y4UA 1TJCA 1X81A 2BUGA 5J08A 3FDHA 1H2VC 1ZB1A 2QFCA 4GTOA 2IU1A 3PS6A 3ABKE 3ASHA 4D10C 1G3NB 4YVQC 4F53A 2OEWA 3QWPA 3HG0D 4AEZC 3R9AB 4EPZA 3MA5A 4JXTA 3TXNA 2DZNA 3ESKA 1ZU2A 4AJWA 1N95A 4GZ6A 1O1TA 2KZTB 3PVLA 4HOSA 4LNBA 2WXQA 4L9PA 2X6KA 2C0LA 3ULQA 2WXOA 2WMOA 5DBKA 4FLBA 2WVIA 3AG3E 4IYPA 4KZCA 2BTDA 3DBSA 4IRUA 1JPLA 2PQRA 1TNYA 5LP0A 3CHSA 4N5QA 2R03A 3JQ1A 3Q5MA 3CR3A 2P2CP 2OVFA 5ENOD 1MX4A 1S63A 1SA5A 2KXPC 5ENQD 4JPSA 5ARFA 3Q75A 4HB5A 4RVBA 4OAUC 2P9LG 3V30A 2GGFA 2NSZA 3B95A 2J4BA 3I5PA 3I4GA 3ZFWA 1TN6A 1U3DA 4B89A 3P1UA 5FJYA 2R05A 3PZ3A 2DVWA 3L13A 1IQRA 1H6KA 2IO3C 1NL4A 4OVUA 2IJGX 3T5XA 2VGXA 4FHKA 5ENRD 4N2QA 3Q73A 5EYPF 5HQ8A 3VTYA 5H7PA 1DCEA 1OT8A 4JVSA 4O1OA 5G04J 2WPVA 4C9BB 1AP7A 4XE0A 4BTAA 4N3BA 1HG2A 1EYHA 2WXMA 5D66A 4I1AA 5KJLA 1QBQA 3LY8A 1KZOA 3ML9A 1HU3A 1IHGA 1DCQA 3V2XA 3TAXA 5BV0A 2HM8A 5G04C 4LUNU 2GW1A 1H6PA 1ELKA 2OOEA 5D0QD 2GRQB 2XPIA 2V8SE 2B0OE 3QARA 2RFMA 4DUIA 1TNBA 4LNGA 5DIZA 1H0AA 2DCPA 4HOUA 3FEYA 4JL0A 5EDSA 2VTBA 3E30A 3JXIA 3ZXSA 5BV1A 4L7TA 3AS5A 3Q47B 4JEUA 4YDOA 3ZIMA 4MLPA 4J6IA 3R7RA 3HDXA 4F6RD 3U4TA 1XGWA 4BESA 4RG6A 3ZEFA 3SD5A 3DWLG 4CEMA 2J8SD 3B7SA 3RO3A 1P5QA 2P9SG 3ZW3A 2JABA 1N4SA 4WNDA 3D9KA 3UIPC 4DRXE 2AVPA 2L9BA 5JJTA 1OXJA 1WM5A 1Z3XA 3PE4A 3JXJA 1MX6A 4JD2G 1XNFA 3MYVA 4DX6D 4TUMA 4EZLA 2WXHA 1FVHA 1MJ0A 4J8EA 4UUCA 2KCLA 3O48A 4KT6B 4C0MA 3CVLA 4K03A 2BKGA 1Z5SC 2I9CA 2WXKA 2OEVA 3FUIA 3RAUA 2CHXA 5AJDA 4Q94A 1HE8A 1OCOE 2R59A 4GPKA 3TJPA 2WQ7A 3G2TA 2XS1A 4MS6A 4M3OA 4XKCA 3NBNB 4HS2A 3AAAC 4U7EB 3CVPA 3NB2A 4CGVA 2FULA 1TNZA 2CFZA 3QB2A 1OWLA 4B8AA 4HXIA 3CHPA 2ZIRA 4AVXA 2V0PA 4GA0A 3CK8A 5JJ7A 2EIJE 4HLLA 3FUNA 3FTZA 3LEWA 2P9IG 4GYYA 2ETAA 3UUXA 3ZGQA 3S7FA 3L08A 1BLXB 3L82A 4U8VD 1N54A 3C98A 4DPRA 1OUVA 4PUCA 1UN9A 1K1AA 3UM0A 3S7JA 5BUZA 5E76A 3T9KA 3FTWA 1N4QA 3DSWA 4OAVB 1IXVA 1N9AA 4KBQA 2DWZA 2PM6A 1K8KG 4FJZA 1NFIE 1U2VG 1NZNA 2AJAA 1JWGA 4L2LA 1N4RA 3LJ3A 3GZSA 5M72A 1TNOA 3AU5A 4G25A 1LD7A 2DBAA 2CG2A 5CRVA 5FZRA 5JA4D 5LOZA 3FFLA 4U0ZA 5AJLA 2WB2A 3IHVA 2LAIA 2QYUA 2AXZA 2A4ZA 4GMLA 3CVYA 2VGXB 2HYZA 1QNFA 4WUYA 3CVQA 4JA7A 4FADA 3MV3B 2F0YA 1A17A 2FF4A 5KJKA 4DX1A 4KZ0A 1JCQA 2A5EA 3FUFA 2P9PG 4JA9A 1LTXA 1X5BA 3JYSA 1E96B 4WNEA 3X2QE 4GA1A 1VDYA 3D3MA 4A3TA 4O60A 2OV8A 2C2LA 4U63A 4GZDA 4U04A 4TV3A 3UKRG 3C3QA 1Q2ZA 3TG5A 1EDUA 3URZA 3PNTB 2GRNB 4K5AB 3B7BA 4TXRA 2XCBA 4K5BA 2I6HA 3D9HA 2P9KG 5D2MC 2Y1LE 5BW8C 4A1GA 2DIWA 4UQXA 2WQHA 2WXRA 4U8HA 2P9UG 3PUKA 3CHRA 2P58C 4E85A 4GAAA 3FU5A 2NXPA 3QWVA 4H7YA 2IO2C 4U0SA 4UWFA 2AW6A 3LXUX 2Q7FA 1FT2A 3B7TA 3IHYA 1TNUA 4HRMB 3C3OA 5HKPA 5EKQD 2J08A 2PNNA 1WG0A 2P9NG 4G26A 4AP2A 3PZ2A 1H2UA 3K9IA 4WNFA 1YA0A 1K1BA 3T8MA 3NZUA 4F1PA 3CVUA 4K5CA 2LXMA 5BPPA 3R9MA 5HS0A 3EU5A 2LSVA 2BF0X 3IKOB 3OXFA 4W9RA 3HXCA 1E8YA 3CEQA 2H6FA 4O6FA 1OY3D 1GW6A 3ASDA 2R2LA 4ACKA 4NQ0A 4CGWA 3FH8A 5JHBA 1TEZA 3N71A 4JHJA 2XPYA 4KYOB 4KVMA 3VTXA 2Y69E 4U07A 1E90A 3B13A 1YCSB 2A5UA 5T3RA 2IFUA 2ETCA 1ELRA 3EIQC 4TRQA 3UIOC 3DXKG 4L2YA 1OWNA 3UXGA 2VSNA 5FTPA 4CRWA 5KJNA 1A5EA 4ATZD 3NAWA 2JEKA 5AYWD 3ZKJA 4EBAG 5LX8A 5AQ7A 5KCMA 5A23A 3OAWA 3UINC 1JCRA 3IEGA 1FVFA 5CEDB 3PZDA 4ANWA 1RZ4A 5J90A 3EIJA 4J8FA 2OCCE 1N0RA 5AQBA 2H6HA 2RFAA 1H6OA 1SA4A 3FTUA 4BFRA 4GCOA 3EJNA 5CECB 4GCNA 4GMJA 3HYMB 3C72A 3UI2A 2IONA 3FTSA 2EINE 1JUQA 2CFUA 2VSOE 2ZXWE 1SQMA 5ANRA 2X38A 5G05C 2HO1A 4FU3A 1MX2A 3GZ1A 3FUHA 4RLYA 1N52A 1S70B 5KWDA 1N0QA 3LVRE 3SF4A 2QYJA 4BWRA 3CIAA 2PL2A 4HOQA 1PC2A 4Z68A 1DVPA 1HS6A 4GTQA 4GU5A 3Q7AA 2YHCA 3ULYA 3RSEG 3C3RA 4B8CB 5EIBE 2R5SA 2ZGDA 4URKA 1TR4A 4DJAA 4B0ZA 2E2EA 4UQZA 1YMPA 4I17A 5IY5E 2WXIA 1EF1C 4CYMD 4ME2A 1Y8MA 2HE0A 3ASGA 4CDNA 3BU8A 3HHMA 5KNHD 5AN8A 3ASOE 3E4BA 5FZQA 3W9FA 3ZRHA 4YDEA 4MKTA 5FQ7A 4J8YA 3MX3A 4UWKA 3PREA 2FI7A 4P29A 3ULEG 4BY6A 3ZHEB 3FU3A 4QFVA 1BD8A 3FUKA 4BETA 4GZCA 2IOLA 2I2OA 1YYHA 3VLDA 2AWIA 3DSSA 1WAO1 4I9CA 3UPVA 2WXLA 5CMWA 5AQ9A 3FUDA 3QOUA 4XIFA 4I6JA 4WNGA 5FWQA 1UW4B 3QK0A 2MHKA 4FP7A 3CK9A 4NIKA 4GA2A 1E8XA 3UM2A 3UT8A 2XEVA 3KSLA 2V4LA 2XGSA 3WG7E 2M63A 1V55E 3ABME 3CQGB 4GZ3A 2BEDA 1OWMA 1S64A 4UQYA 2J09A 3Q9UC 2DZOA 2J4DA 3QNKA 4TUUA 5EILA 3Q9NC 1TN7A 2WQ6A 2I1KA 2X6JA 4HRNA 4U8YD 3CHQA 3SQVA 3TWXA 2WMNA 3HXDA 2CHZA 3D9NA 4PDXA 3PEUB 4GYWA 5CBOA 4GTRA 1UJKA 4APOA 4HOTA 3UM1A 3HIZA 2KM4A 4HBDA 3BUAA 4LG6A 3ZUVB 5LFAA 5KJMA 3L9TA 5JMND 3DRAA 3LKUA 3SY2A 4HVBA 4BX8A 2XHEA 5ARGA 3BG1B 1HZ4A 4A1SA 4DX7D 4EHMA 3RJVA 5KNGA 4KVOA 2GROB 3MKRA 2J07A 2YQ8A 3BG0B 2VQ2A 3RRUA 1W3BA 4AY6A 2AXUA 4DI3A 3QC1A 2Y0BG 3PZ1A 3CK7A 3AG4E 4DLOA 4YNDA 3EDTB 1EPUA 3TWTA 1MQSA 3GYZA 5EX0A 2RG8A 3MV2B 2FO7A 4UWLA 3KAEA 3MEKA 3UMVA 3TWSA 2QC9A 4GMRA 2MRIA 4JHRA 5EYLA 2V4HC 3PE3A 3S2AA 5B3SE 2OVBA 5EX3A 1O1RA 3LPZA 3CKBA 2L6BA 4HI8A 3NOGD 1IKND 1RW2A 3EHNA 2ILRA 4BX9A 3RK6A 4HQDA 4CDMA 4ILIA 3WXXA 3CVXA 3OTNA 4J7WA 4BEPA 3L22A 3FU6A 3SFZA 3S7DA 2DYSE 4G11A 1MZCA 3SI5A 4N3AA 3CVVA 2UY1B 1FPPA 2RD0A 3ZYQA 1LD8A 3ISMC 3QWWA 3TL5A 2Y4TA 1B89A 4GTVA 3FUMA 1UJJA 3SBTB 1N94A 3JCKC 4JW1A 1E8ZA 3DPDA 3APDA 2V5QC 3QKYA 1BI8B 3ONLA 5T4YA 3DXMG 3Q49B 5AIJA 1SZ9A 3L54A 4DLQA 5HRYA 3SHFA 2F37A 3VLFA 4BTBA 3OXLA 5CRUA 1E8WA 4Y6CA 3CVWA 2LUHA 2EIKE 2ZU6B 1D9SA 2XEHA 3CLJA 4JB8P 2EQXA 1IHBA 2FBNA 5CBNA 3KD7A 3B7RL 3E34A 3LS8A 3V2OA 2YNQA 1QZ2A 3APFA 4I2WA 4HNAD 3ENEA 4FULA 4C48B 1U3CA 3DPYA 3AS8A 4NACA 2L0IA 3T8KA 2WXJA 4ACLA 3PH0C 1N11A 2NYJA 4CT0A 3ONKA 3G2UA 2HR2A 3PZ4A 2QY7A 1FCHA 2XRYA 3TWQA 1ZBPA 5JJ6A 3DEOA 2J49A 3E32A 4G2VA 5ENSD 3ASNE 4X8QA 4IULA 5ENTD 4UWHA 2MOWA 5B1AE 3SGHA 3FUEA 5FQ4A 3U66A 4N3CA 3DSXA 1BPOA 3U3WA 1TN8A 4WAFA 2NC9A 3IBEA 2XGOA 3PUJA 1MHQA 3UX4A 2IF4A 2CHWA 3R7QA 3ZN3A 4ANUA 3JUIA 3L16A 4I2ZA 3QJZA 3EHMA 1O1SA 1NA0A 1FT1A 4XKBA 2IQCA 1WDYA 4F3VA 3D9IA 4NRHB 1E7VA 3TWWA 4I6EA 4YVOA 3HVEB 3HVEA 5C1DA 5ENNA 3CGHA 5CEAA 4WWOA 5FZSA 2V5FA 2ETBA 4G1TA 3ML8A 3V31A 2X6HA 4WWPA 3DSUA 3SFYA 1SVXA 3FULA 1HH8A 2YHEA 2VJ8A 3FP3A 2XZDG 3MKQB 5EIDA 1AWCB 3IXEA 1QQEA 4B93B 2F8XK 3FUJA 3Q79A 1Z3YA 2VGEA 4PS7A 2XRZA 3TGOA 2H6GA 4DX5D 4AM9A 3SBSA 4UI9K 4FLHA 5A7DB 3ZNGA 1OWOA 4TXQA 4FJYA 3FHEA 3UT7A 3E33A 3E37A 3U64A 4J8SA 3G2SA 2WXPA 2FO1E 5KBAA 1BI7B 2XS8A 4KMOA 4EZKA 3MGBA 3SO8A 1HF8A 1H2TC 2XEEA 3L17A 1D8EA 4N39A 3OXGA 2CG3A 4Y6WA 1UG3A 4AOFA 4GPMA 2PQNA 4F1SA 3ZPJA 5EN5D 3ZU7B 3TWUA 1IYGA 5AENA 3FU0A 1NA3A 4LSZE 2XPZA 3DSVA 1KZPA 4EBAA 5ENPD 4LRZA 2XGMA 5B1BE 3D9JA 2X6FA 3APCA 4BSZB 4AV7A 2GRPB 4AIFA 4XZ4A 2X3MA 3F6QA 4JC8A 4RSYA 1OCZE 3TXMA 1HG5A 3DEPA 4APFA 3I3NA 4UI9C 2KCKA 3AS4A 1TJFA 1KPSB 4PS8A 3RRMB 4N2SA 2IOSA 3V79K 1LF8A 3JUEA 3PNLB 5FQ8A 3CSTA 2MYOA 5LCWC 2L0TB 4G8KA 1HO8A 3AG2E 3MKQA 3FH7A 1SW6A 3JQ0A 4CDRA 4C0EA 1DC2A 4U95D 2YINA 3CSFA 3ZYMA 1KT0A 3BEEA 4I6GA 2IY0C 1SZAA 4AY5A 2H6IA 2GRMA 5A6CA 2X6IA 4MBGA 1E7UA 4U0UA 4MRUA 5G55A 3HXFA 3G2VA 4L23A 5AAOA 3RRNB 3D9MA 3RKVA 5BXUA 3B7UX 4G8LA 3J5PA 1PY1A 2XENA 3LDZA 4ILGA 3ABLE 1DNPA 2PM7A 4B94A 3FEXA 2VYIA 3Q4AB 3QDNA 1H19A 3CVNA 4ANXA 3W9GA 1HFAA 2QZAA 5G05J 2R17C 2PZIA 4I43A 3ZYKA 3LYAA 5BNWA 3DSTA 4DK5A 5E75A 4J8DA 1QYMA 4JZYA 3UT4A 4U96D 2I1JA 5CMYA 4RQIA 4Q96A 2VSXE 3T5VA 4CT4A 2B6CA 3U9WA 4CZ2D 3ZXPA 2DYRE 5BXOA 3NZSA 4GTPA 4K0RA 4GTSA 4A63B 4HLEA
chains in the Genus database with same CATH topology
3DPDA 2KC7A 5HQ8A 3VTYA 3APDA 1INZA 3QKYA 3ONLA 3LVQE 4JVSA 5FT9A 5G04J 2WPVA 5T4YA 4O6FA 4C9BB 2GRLA 3Q49B 5AIJA 1GW6A 1SZ9A 4XE0A 4BTAA 3ASDA 4N3BA 5CCLA 3L54A 5HI7A 1HG2A 4ACKA 4NQ0A 1EYHA 2WXMA 4DLQA 4CGWA 3SHFA 3FH8A 4I1AA 4XI9A 3PDNA 3VLFA 5JHBA 4G23A 3N71A 4ATGA 3Q15A 4JHJA 1TEZA 3G2WA 4BTBA 2XPYA 5KJLA 3OXLA 4KYOB 1Y6IA 3LY8A 3LY7A 3NF1A 4KVMA 1ELWA 1E8WA 4Y6CA 3VTXA 4U07A 3CVWA 1E90A 3ML9A 1HU3A 3FY4A 2ZU6B 3B13A 2A5UA 2AXVA 5T3RA 3ZYLA 1IHGA 2IFUA 3EIQC 1ELRA 4TRQA 2KZTA 3CLJA 3TAXA 1KT1A 1NP7A 2EQXA 2FBNA 3KD7A 4JW1A 4L2YA 5BV0A 1OWNA 4CRWA 2VSNA 3B7RL 5FTPA 5CCMA 4H7XA 3LS8A 2HM8A 5G04C 5KJNA 4LUNU 2GW1A 2YNQA 1QZ2A 3APFA 4ILHB 2JEKA 5AYWD 4I2WA 3ENEA 4FULA 4EBAG 3KEZA 3RIBA 5LX8A 5KCMA 3QAQA 1ELKA 1L5JA 4A55A 5A23A 4PS3A 4UWGA 2OOEA 1U3CA 3OAWA 5D0QD 2XPIA 3AS8A 3IEGA 2V8SE 1FVFA 3QARA 3D9PA 4BT8A 3PZDA 4OYSA 3CQCB 3RU0A 1WY6A 4ANWA 4NACA 5DIZA 1H0AA 2L0IA 3PRZA 3P2BA 2DCPA 4HOUA 3ZHEA 3EIJA 3FEYA 5C2YA 5J90A 4J8FA 4JL0A 2FEZA 5EDSA 2WXJA 2VTBA 4ACLA 1HXIA 3PH0C 2XCCA 3ZXSA 4DI4A 5BV1A 2KATA 4CT0A 5FQ6A 3CHMA 3FTUA 1PAQA 4BFRA 4L7TA 4GCOA 3EJNA 4BT9A 3AS5A 3ONKA 3G2UA 2HR2A 4GCNA 2QY7A 1FCHA 4GMJA 3Q47B 3HYMB 4JEUA 3RO2A 3ZIMA 4MLPA 3ZVVA 2IONA 3FTSA 1JUQA 2CFUA 3PEVB 2XRYA 4J6IA 1ZBPA 5JJ6A 4GB9A 2VSOE 2J49A 1SQMA 3UQ3A 4G2VA 5ANRA 2X38A 5G05C 3FTYA 3R7RA 2HO1A 3HDXA 3U4TA 1XGWA 3CHOA 4FU3A 4RG6A 3ZEFA 4IULA 3SD5A 4UWHA 4CEMA 2MOWA 3U66A 3GZ1A 3FUEA 2VSYA 3MCXA 5FQ4A 3SGHA 3TG4A 4N3CA 3FWVA 4BSXA 1BPOA 3B7SA 4XI0A 3RO3A 3U3WA 2J9QA 2L6JA 2UWJG 1P5QA 3FUHA 3GZ2A 4WAFA 4I1OB 2NC9A 3ESLA 1N52A 3IBEA 3ZW3A 2XGOA 5JHAA 2UY1A 4WNDA 4G24A 3D9KA 3PUJA 1MHQA 3UX4A 2IF4A 4I9EA 2CHWA 1OWPA 3R7QA 2AVPA 2L9BA 3ZN3A 4ANUA 1WM5A 1Z3XA 3LVRE 3PE4A 5JJTA 2XQ0A 3JUIA 3ASFA 3L16A 3I4RB 3SF4A 4I2ZA 4BWRA 3CIAA 1XNFA 2VGYA 3QJZA 2PL2A 4HOQA 4WWNA 4CCAA 3EHMA 1PC2A 3MYVA 1NA0A 2LSUA 1DVPA 4XKBA 2IQCA 1HS6A 4EZLA 4LCTA 4AXHA 3L6AA 4F3VA 5D0OD 4FA6A 4PH4B 1S0PA 2WXHA 3FH5A 4GU5A 4L1BA 1FVHA 4IN3B 2LO6A 3D9IA 2YHCA 3LY9A 4J8EA 2KCLA 4NRHB 1E7VA 3O48A 4R7LA 2VTBB 1IQUA 4KT6B 4C0MA 3CVLA 4K03A 4B8CB 2ONDA 4FHJA 4LEUA 2I9CA 2WXKA 4A3VA 4I6EA 4YVOA 3FUIA 2CHXA 2R5SA 3HVEB 5AJDA 4Q94A 1HE8A 4URKA 3HVEA 5T8IA 2R59A 4GPKA 4DJAA 4B0ZA 3TJPA 2WQ7A 2E2EA 4JEHA 4UQZA 4XX5A 5C1DA 3IV0A 4I17A 5ENNA 3CGHA 3G2TA 4WWOA 4HORA 2WXIA 1EF1C 4MS6A 4M3OA 4E6HA 4XKCA 4ME2A 1Y8MA 5FZSA 4HS2A 3D9LA 3LCAA 1JWFA 4FHKA 4ANVA 3CVPA 4OVVA 4CGVA 2FULA 2V5FA 3KS2A 3ASGA 2WXFA 4CDNA 4G1TA 2CFZA 2KCVA 3QB2A 3HHMA 3ML8A 1OWLA 4B8AA 4HXIA 3CHPA 2X6HA 4WWPA 4AVXA 3E4BA 2V0PA 4GA0A 3FULA 1HH8A 3CK8A 2YHEA 5FZQA 5JJ7A 2VJ8A 3FP3A 2WM9A 4RG9A 3ZRHA 3FUNA 3FTZA 2E0IA 3LEWA 4ABNA 4MKTA 5FQ7A 5LCWJ 4EECA 4GYYA 3MKQB 3MX3A 3UUXA 4UWKA 3PREA 3ZGQA 2FI7A 4P29A 1QQEA 2WXNA 3S7FA 4BY6A 3FUJA 3FU3A 3L08A 3ZHEB 1Z3YA 4HFGA 4PS7A 4QFVA 5ANLA 2XRZA 4F7AA 1N54A 4Q69A 3C98A 4DPRA 1OUVA 4PUCA 3TGOA 3FUKA 4I1MA 4GZCA 1UN9A 2IOLA 3NQPA 2I2OA 4FC8A 4EZJA 4UI9J 3CV0A 3S7JA 4AM9A 4HLEA 3SBSA 2LNIA 4UI9K 5BUZA 4FLHA 3VLDA 2AWIA 5E76A 1UN8A 2WXGA 1HX8A 3D9OA 1WAO1 3FTWA 4I9CA 3UPVA 2WXLA 3FTVA 5CMWA 4KBQA 2C0MA 4N5CA 3FUDA 4V3IA 2PM6A 5A7DB 3QOUA 1OWOA 4LERA 4XIFA 4FJZA 4FJYA 3AU4A 1NZNA 3FHEA 4I6JA 4WNGA 3UT7A 1KLXA 1JWGA 4L2LA 5FWQA 1UW4B 3FTXA 4EQFA 3U64A 3QK0A 4J8SA 5BT1A 3G2SA 2WXPA 2MHKA 3LJ3A 4FP7A 2JLBA 3GW4A 3GZSA 3CK9A 3MZLB 5M72A 1Z6TA 4GA2A 1E8XA 4GZ5A 3AU5A 3UT8A 4G25A 4KMOA 2XEVA 3MGBA 4EZKA 2V4LA 2XGSA 4J0UA 2DBAA 1UJJA 1HF8A 2M63A 1H2TC 2CG2A 2LAHA 3CQGB 4GZ3A 5FZRA 3L17A 4GYOA 1OWMA 3CKCA 5LOZA 4JHKA 3FFLA 4N39A 3O4ZA 5G2NA 4UQYA 2J09A 2CG3A 3OXGA 4NURA 4U0ZA 3IHVA 5AJLA 2WB2A 2J4DA 3QNKA 3S7BA 4TUUA 2LAIA 4Y6WA 2AXZA 1UG3A 2A4ZA 3SNXA 4GMLA 3CVYA 4AOFA 2VGXB 2I1KA 2WQ6A 2PQNA 2X6JA 2HYZA 4F1SA 1QNFA 3VLEA 4WUYA 2Y3AA 3SZ7A 3ZPJA 3CHQA 5CHEE 4KXKB 1IYGA 5AENA 3FU0A 3MJWA 3CVQA 2Y4UA 1NA3A 4JA7A 1TJCA 2BUGA 2WMNA 2XPZA 4FADA 2CHZA 4EBAA 4LRZA 5J08A 4N2QA 3MV3B 3FDHA 2XGMA 1H2VC 3D9NA 4PDXA 3D9JA 1A17A 2QFCA 2FF4A 3PEUB 4GYWA 5KJKA 2IU1A 3PS6A 1UJKA 4APOA 4HOTA 3ASHA 3HIZA 2KM4A 2X6FA 3APCA 4KZ0A 4AV7A 4D10C 4AIFA 4YVQC 4XZ4A 5LFAA 2X3MA 4RSYA 4JC8A 4F53A 5KJMA 3QWPA 3TXMA 3FUFA 1HG5A 4AEZC 4JA9A 3R9AB 4EPZA 3MA5A 1X5BA 3JYSA 4APFA 1E96B 3I3NA 4WNEA 4JXTA 3TXNA 3LKUA 4HVBA 3ESKA 4UI9C 2XHEA 4BX8A 2KCKA 5ARGA 3BG1B 3AS4A 1ZU2A 4GA1A 1HZ4A 4AJWA 1TJFA 4A1SA 1VDYA 3D3MA 4PS8A 3RRMB 3RJVA 4N2SA 2IOSA 4A3TA 1LF8A 4GZ6A 4KVOA 3PNLB 3MKRA 2KZTB 2OV8A 3PVLA 4HOSA 2C2LA 2J07A 5FQ8A 2WXQA 2X6KA 2C0LA 2YQ8A 3CSTA 3BG0B 2VQ2A 3RRUA 5LCWC 1W3BA 4GZDA 4U04A 4U63A 3ULQA 2L0TB 4TV3A 1HO8A 4AY6A 2AXUA 3MKQA 3QC1A 3FH7A 4DI3A 3TG5A 2WXOA 1EDUA 2WMOA 5DBKA 4FLBA 2WVIA 3CK7A 4DLOA 3JQ0A 4YNDA 3URZA 4CDRA 3PNTB 3EDTB 4IYPA 4KZCA 2BTDA 4C0EA 2YINA 1EPUA 3DBSA 3CSFA 3ZYMA 1KT0A 1MQSA 2XCBA 3BEEA 1JPLA 4I6GA 4IRUA 2PQRA 3GYZA 5LP0A 1SZAA 4AY5A 5EX0A 3CHSA 2GRMA 2I6HA 2RG8A 3MV2B 5A6CA 2FO7A 4UWLA 2X6IA 3KAEA 3MEKA 3UMVA 1E7UA 4U0UA 5BW8C 4MRUA 5G55A 4A1GA 3G2VA 4L23A 3RRNB 2DIWA 4UQXA 2MRIA 3D9MA 3JQ1A 2WQHA 3Q5MA 4JHRA 3RKVA 2WXRA 4U8HA 3B7UX 3PUKA 1PY1A 3CHRA 3PE3A 2P58C 3LDZA 3S2AA 4ILGA 1DNPA 2PM7A 3CR3A 2OVFA 4B94A 4E85A 4GAAA 3FEXA 2VYIA 2NXPA 3FU5A 3Q4AB 3QDNA 2OVBA 3QWVA 4H7YA 1H19A 5EX3A 4U0SA 3CVNA 4UWFA 4ANXA 3LPZA 2AW6A 3LXUX 4JPSA 3CKBA 1HFAA 5ARFA 2Q7FA 3B7TA 3IHYA 5G05J 4RVBA 2R17C 5EKQD 2J08A 3EHNA 2GGFA 2PZIA 2NSZA 4I43A 2ILRA 3ZYKA 2J4BA 3I5PA 4BX9A 3I4GA 3RK6A 3LYAA 4CDMA 5BNWA 4G26A 4AP2A 4DK5A 4ILIA 3WXXA 3ZFWA 3CVXA 5E75A 3OTNA 1H2UA 3L22A 3FU6A 4J8DA 3K9IA 1U3DA 4WNFA 1YA0A 4B89A 4JZYA 3SFZA 3P1UA 3UT4A 2I1JA 3T8MA 3S7DA 5CMYA 3NZUA 4G11A 3SI5A 4N3AA 4Q96A 5FJYA 3CVUA 5BPPA 3CVVA 3L13A 2UY1B 2VSXE 3T5VA 4CT4A 3U9WA 2RD0A 1IQRA 2LSVA 2BF0X 3ZYQA 3IKOB 1H6KA 3OXFA 3QWWA 4W9RA 3TL5A 3NZSA 1E8YA 2Y4TA 1B89A 4K0RA 3FUMA 2IJGX 4OVUA 3SBTB 3T5XA 2VGXA 3CEQA 3JCKC 1E8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI4 A;  3U64 A;  4DI3 A; 
#chains in the Genus database with same CATH topology
 5AQA A;  2KC7 A;  1INZ A;  3LVQ E;  5FT9 A;  1N4P A;  3SFX A;  2GRL A;  3AG1 E;  5AAR A;  5CCL A;  5HI7 A;  1BU9 A;  1JCS A;  4XI9 A;  3HXE A;  3PDN A;  4G23 A;  4ATG A;  3Q15 A;  3G2W A;  3KSQ A;  1Y6I A;  3LY7 A;  3NF1 A;  1TYQ G;  1ELW A;  3FY4 A;  2AXV A;  2EIM E;  3ZYL A;  4BER A;  2KZT A;  1KT1 A;  1NP7 A;  3BQO A;  5CCM A;  4H7X A;  5CER B;  4ILH B;  3UKU G;  3KEZ A;  3RIB A;  3QAQ A;  4A55 A;  1L5J A;  4PS3 A;  4UWG A;  3D9P A;  4BT8 A;  4OYS A;  3CQC B;  3RU0 A;  1WY6 A;  5ITZ F;  3PRZ A;  3P2B A;  3ZHE A;  5C2Y A;  2FEZ A;  3EHQ A;  1HXI A;  2XCC A;  3TWR A;  4DI4 A;  2KAT A;  2LXL A;  5FQ6 A;  3CHM A;  1PAQ A;  2F8Y A;  4BT9 A;  3RO2 A;  2XZT G;  3HXB A;  3ZVV A;  4O1P A;  3PEV B;  4GB9 A;  3UM3 A;  4HI9 A;  3UQ3 A;  3FTY A;  2KBX A;  3CHO A;  2VSY A;  3MCX A;  3TG4 A;  4BSX A;  3FWV A;  4XI0 A;  2J9Q A;  2GRR B;  2L6J A;  2UWJ G;  3GZ2 A;  2IEJ A;  4I1O B;  3ESL A;  5JHA A;  2UY1 A;  4G24 A;  4I9E A;  2ZIS A;  1OWP A;  2BKK B;  2XQ0 A;  3C5R A;  3ASF A;  1NI1 A;  3I4R B;  2VGY A;  4WWN A;  4CCA A;  2ZGG A;  3AJI A;  2LSU A;  4LNU D;  3Q7F A;  5FIO A;  4LCT A;  4AXH A;  3L6A A;  5D0O D;  4FA6 A;  4PH4 B;  1S0P A;  3FH5 A;  4ZHB A;  4L1B A;  4IN3 B;  2LO6 A;  3LY9 A;  4R7L A;  2VTB B;  1IQU A;  4QQI A;  1D8D A;  2OND A;  4FHJ A;  4LEU A;  4A3V A;  4YDW A;  5T8I A;  3EUV A;  4JEH A;  4XX5 A;  1OCR E;  3IV0 A;  4HOR A;  3Q78 A;  4E6H A;  3D9L A;  3LCA A;  1JWF A;  3NOC D;  4ANV A;  4OVV A;  3KS2 A;  2WXF A;  3KEA A;  2KCV A;  4TXP A;  4GTT A;  4GTM A;  2WM9 A;  4RG9 A;  2E0I A;  4ABN A;  1K3Z D;  5LCW J;  4EEC A;  5FIN A;  2WXN A;  3UTM A;  4HFG A;  5ANL A;  4F7A A;  4Q69 A;  4I1M A;  3NQP A;  4FC8 A;  1OCC E;  4EZJ A;  4UI9 J;  3CV0 A;  3HRA A;  2LNI A;  3EHR A;  1UN8 A;  2WXG A;  1HX8 A;  3D9O A;  3FTV A;  2C0M A;  2RKK A;  4N5C A;  4V3I A;  4LER A;  3AU4 A;  3EU9 A;  1KLX A;  4M7C A;  3FTX A;  4EQF A;  5BT1 A;  2JLB A;  3GW4 A;  3MZL B;  1Z6T A;  1MYO A;  4GZ5 A;  4XEI G;  4J0U A;  4ZFH A;  1O5M A;  2LAH A;  2R02 A;  4GYO A;  3CKC A;  3TWV A;  4JHK A;  3O4Z A;  5G2N A;  4NUR A;  4YDY A;  4HRL A;  3S7B A;  3SNX A;  2EIL E;  3VLE A;  1UOH A;  3SZ7 A;  2Y3A A;  3LJN A;  3J5Q B;  5CHE E;  4KXK B;  4DX2 A;  3MJW A;  1V54 E;  2Y4U A;  1TJC A;  1X81 A;  2BUG A;  5J08 A;  3FDH A;  1H2V C;  1ZB1 A;  2QFC A;  4GTO A;  2IU1 A;  3PS6 A;  3ABK E;  3ASH A;  4D10 C;  1G3N B;  4YVQ C;  4F53 A;  2OEW A;  3QWP A;  3HG0 D;  4AEZ C;  3R9A B;  4EPZ A;  3MA5 A;  4JXT A;  3TXN A;  2DZN A;  3ESK A;  1ZU2 A;  4AJW A;  1N95 A;  4GZ6 A;  1O1T A;  2KZT B;  3PVL A;  4HOS A;  4LNB A;  2WXQ A;  4L9P A;  2X6K A;  2C0L A;  3ULQ A;  2WXO A;  2WMO A;  5DBK A;  4FLB A;  2WVI A;  3AG3 E;  4IYP A;  4KZC A;  2BTD A;  3DBS A;  4IRU A;  1JPL A;  2PQR A;  1TNY A;  5LP0 A;  3CHS A;  4N5Q A;  2R03 A;  3JQ1 A;  3Q5M A;  3CR3 A;  2P2C P;  2OVF A;  5ENO D;  1MX4 A;  1S63 A;  1SA5 A;  2KXP C;  5ENQ D;  4JPS A;  5ARF A;  3Q75 A;  4HB5 A;  4RVB A;  4OAU C;  2P9L G;  3V30 A;  2GGF A;  2NSZ A;  3B95 A;  2J4B A;  3I5P A;  3I4G A;  3ZFW A;  1TN6 A;  1U3D A;  4B89 A;  3P1U A;  5FJY A;  2R05 A;  3PZ3 A;  2DVW A;  3L13 A;  1IQR A;  1H6K A;  2IO3 C;  1NL4 A;  4OVU A;  2IJG X;  3T5X A;  2VGX A;  4FHK A;  5ENR D;  4N2Q A;  3Q73 A;  5EYP F;  5HQ8 A;  3VTY A;  5H7P A;  1DCE A;  1OT8 A;  4JVS A;  4O1O A;  5G04 J;  2WPV A;  4C9B B;  1AP7 A;  4XE0 A;  4BTA A;  4N3B A;  1HG2 A;  1EYH A;  2WXM A;  5D66 A;  4I1A A;  5KJL A;  1QBQ A;  3LY8 A;  1KZO A;  3ML9 A;  1HU3 A;  1IHG A;  1DCQ A;  3V2X A;  3TAX A;  5BV0 A;  2HM8 A;  5G04 C;  4LUN U;  2GW1 A;  1H6P A;  1ELK A;  2OOE A;  5D0Q D;  2GRQ B;  2XPI A;  2V8S E;  2B0O E;  3QAR A;  2RFM A;  4DUI A;  1TNB A;  4LNG A;  5DIZ A;  1H0A A;  2DCP A;  4HOU A;  3FEY A;  4JL0 A;  5EDS A;  2VTB A;  3E30 A;  3JXI A;  3ZXS A;  5BV1 A;  4L7T A;  3AS5 A;  3Q47 B;  4JEU A;  4YDO A;  3ZIM A;  4MLP A;  4J6I A;  3R7R A;  3HDX A;  4F6R D;  3U4T A;  1XGW A;  4BES A;  4RG6 A;  3ZEF A;  3SD5 A;  3DWL G;  4CEM A;  2J8S D;  3B7S A;  3RO3 A;  1P5Q A;  2P9S G;  3ZW3 A;  2JAB A;  1N4S A;  4WND A;  3D9K A;  3UIP C;  4DRX E;  2AVP A;  2L9B A;  5JJT A;  1OXJ A;  1WM5 A;  1Z3X A;  3PE4 A;  3JXJ A;  1MX6 A;  4JD2 G;  1XNF A;  3MYV A;  4DX6 D;  4TUM A;  4EZL A;  2WXH A;  1FVH A;  1MJ0 A;  4J8E A;  4UUC A;  2KCL A;  3O48 A;  4KT6 B;  4C0M A;  3CVL A;  4K03 A;  2BKG A;  1Z5S C;  2I9C A;  2WXK A;  2OEV A;  3FUI A;  3RAU A;  2CHX A;  5AJD A;  4Q94 A;  1HE8 A;  1OCO E;  2R59 A;  4GPK A;  3TJP A;  2WQ7 A;  3G2T A;  2XS1 A;  4MS6 A;  4M3O A;  4XKC A;  3NBN B;  4HS2 A;  3AAA C;  4U7E B;  3CVP A;  3NB2 A;  4CGV A;  2FUL A;  1TNZ A;  2CFZ A;  3QB2 A;  1OWL A;  4B8A A;  4HXI A;  3CHP A;  2ZIR A;  4AVX A;  2V0P A;  4GA0 A;  3CK8 A;  5JJ7 A;  2EIJ E;  4HLL A;  3FUN A;  3FTZ A;  3LEW A;  2P9I G;  4GYY A;  2ETA A;  3UUX A;  3ZGQ A;  3S7F A;  3L08 A;  1BLX B;  3L82 A;  4U8V D;  1N54 A;  3C98 A;  4DPR A;  1OUV A;  4PUC A;  1UN9 A;  1K1A A;  3UM0 A;  3S7J A;  5BUZ A;  5E76 A;  3T9K A;  3FTW A;  1N4Q A;  3DSW A;  4OAV B;  1IXV A;  1N9A A;  4KBQ A;  2DWZ A;  2PM6 A;  1K8K G;  4FJZ A;  1NFI E;  1U2V G;  1NZN A;  2AJA A;  1JWG A;  4L2L A;  1N4R A;  3LJ3 A;  3GZS A;  5M72 A;  1TNO A;  3AU5 A;  4G25 A;  1LD7 A;  2DBA A;  2CG2 A;  5CRV A;  5FZR A;  5JA4 D;  5LOZ A;  3FFL A;  4U0Z A;  5AJL A;  2WB2 A;  3IHV A;  2LAI A;  2QYU A;  2AXZ A;  2A4Z A;  4GML A;  3CVY A;  2VGX B;  2HYZ A;  1QNF A;  4WUY A;  3CVQ A;  4JA7 A;  4FAD A;  3MV3 B;  2F0Y A;  1A17 A;  2FF4 A;  5KJK A;  4DX1 A;  4KZ0 A;  1JCQ A;  2A5E A;  3FUF A;  2P9P G;  4JA9 A;  1LTX A;  1X5B A;  3JYS A;  1E96 B;  4WNE A;  3X2Q E;  4GA1 A;  1VDY A;  3D3M A;  4A3T A;  4O60 A;  2OV8 A;  2C2L A;  4U63 A;  4GZD A;  4U04 A;  4TV3 A;  3UKR G;  3C3Q A;  1Q2Z A;  3TG5 A;  1EDU A;  3URZ A;  3PNT B;  2GRN B;  4K5A B;  3B7B A;  4TXR A;  2XCB A;  4K5B A;  2I6H A;  3D9H A;  2P9K G;  5D2M C;  2Y1L E;  5BW8 C;  4A1G A;  2DIW A;  4UQX A;  2WQH A;  2WXR A;  4U8H A;  2P9U G;  3PUK A;  3CHR A;  2P58 C;  4E85 A;  4GAA A;  3FU5 A;  2NXP A;  3QWV A;  4H7Y A;  2IO2 C;  4U0S A;  4UWF A;  2AW6 A;  3LXU X;  2Q7F A;  1FT2 A;  3B7T A;  3IHY A;  1TNU A;  4HRM B;  3C3O A;  5HKP A;  5EKQ D;  2J08 A;  2PNN A;  1WG0 A;  2P9N G;  4G26 A;  4AP2 A;  3PZ2 A;  1H2U A;  3K9I A;  4WNF A;  1YA0 A;  1K1B A;  3T8M A;  3NZU A;  4F1P A;  3CVU A;  4K5C A;  2LXM A;  5BPP A;  3R9M A;  5HS0 A;  3EU5 A;  2LSV A;  2BF0 X;  3IKO B;  3OXF A;  4W9R A;  3HXC A;  1E8Y A;  3CEQ A;  2H6F A;  4O6F A;  1OY3 D;  1GW6 A;  3ASD A;  2R2L A;  4ACK A;  4NQ0 A;  4CGW A;  3FH8 A;  5JHB A;  1TEZ A;  3N71 A;  4JHJ A;  2XPY A;  4KYO B;  4KVM A;  3VTX A;  2Y69 E;  4U07 A;  1E90 A;  3B13 A;  1YCS B;  2A5U A;  5T3R A;  2IFU A;  2ETC A;  1ELR A;  3EIQ C;  4TRQ A;  3UIO C;  3DXK G;  4L2Y A;  1OWN A;  3UXG A;  2VSN A;  5FTP A;  4CRW A;  5KJN A;  1A5E A;  4ATZ D;  3NAW A;  2JEK A;  5AYW D;  3ZKJ A;  4EBA G;  5LX8 A;  5AQ7 A;  5KCM A;  5A23 A;  3OAW A;  3UIN C;  1JCR A;  3IEG A;  1FVF A;  5CED B;  3PZD A;  4ANW A;  1RZ4 A;  5J90 A;  3EIJ A;  4J8F A;  2OCC E;  1N0R A;  5AQB A;  2H6H A;  2RFA A;  1H6O A;  1SA4 A;  3FTU A;  4BFR A;  4GCO A;  3EJN A;  5CEC B;  4GCN A;  4GMJ A;  3HYM B;  3C72 A;  3UI2 A;  2ION A;  3FTS A;  2EIN E;  1JUQ A;  2CFU A;  2VSO E;  2ZXW E;  1SQM A;  5ANR A;  2X38 A;  5G05 C;  2HO1 A;  4FU3 A;  1MX2 A;  3GZ1 A;  3FUH A;  4RLY A;  1N52 A;  1S70 B;  5KWD A;  1N0Q A;  3LVR E;  3SF4 A;  2QYJ A;  4BWR A;  3CIA A;  2PL2 A;  4HOQ A;  1PC2 A;  4Z68 A;  1DVP A;  1HS6 A;  4GTQ A;  4GU5 A;  3Q7A A;  2YHC A;  3ULY A;  3RSE G;  3C3R A;  4B8C B;  5EIB E;  2R5S A;  2ZGD A;  4URK A;  1TR4 A;  4DJA A;  4B0Z A;  2E2E A;  4UQZ A;  1YMP A;  4I17 A;  5IY5 E;  2WXI A;  1EF1 C;  4CYM D;  4ME2 A;  1Y8M A;  2HE0 A;  3ASG A;  4CDN A;  3BU8 A;  3HHM A;  5KNH D;  5AN8 A;  3ASO E;  3E4B A;  5FZQ A;  3W9F A;  3ZRH A;  4YDE A;  4MKT A;  5FQ7 A;  4J8Y A;  3MX3 A;  4UWK A;  3PRE A;  2FI7 A;  4P29 A;  3ULE G;  4BY6 A;  3ZHE B;  3FU3 A;  4QFV A;  1BD8 A;  3FUK A;  4BET A;  4GZC A;  2IOL A;  2I2O A;  1YYH A;  3VLD A;  2AWI A;  3DSS A;  1WAO 1;  4I9C A;  3UPV A;  2WXL A;  5CMW A;  5AQ9 A;  3FUD A;  3QOU A;  4XIF A;  4I6J A;  4WNG A;  5FWQ A;  1UW4 B;  3QK0 A;  2MHK A;  4FP7 A;  3CK9 A;  4NIK A;  4GA2 A;  1E8X A;  3UM2 A;  3UT8 A;  2XEV A;  3KSL A;  2V4L A;  2XGS A;  3WG7 E;  2M63 A;  1V55 E;  3ABM E;  3CQG B;  4GZ3 A;  2BED A;  1OWM A;  1S64 A;  4UQY A;  2J09 A;  3Q9U C;  2DZO A;  2J4D A;  3QNK A;  4TUU A;  5EIL A;  3Q9N C;  1TN7 A;  2WQ6 A;  2I1K A;  2X6J A;  4HRN A;  4U8Y D;  3CHQ A;  3SQV A;  3TWX A;  2WMN A;  3HXD A;  2CHZ A;  3D9N A;  4PDX A;  3PEU B;  4GYW A;  5CBO A;  4GTR A;  1UJK A;  4APO A;  4HOT A;  3UM1 A;  3HIZ A;  2KM4 A;  4HBD A;  3BUA A;  4LG6 A;  3ZUV B;  5LFA A;  5KJM A;  3L9T A;  5JMN D;  3DRA A;  3LKU A;  3SY2 A;  4HVB A;  4BX8 A;  2XHE A;  5ARG A;  3BG1 B;  1HZ4 A;  4A1S A;  4DX7 D;  4EHM A;  3RJV A;  5KNG A;  4KVO A;  2GRO B;  3MKR A;  2J07 A;  2YQ8 A;  3BG0 B;  2VQ2 A;  3RRU A;  1W3B A;  4AY6 A;  2AXU A;  4DI3 A;  3QC1 A;  2Y0B G;  3PZ1 A;  3CK7 A;  3AG4 E;  4DLO A;  4YND A;  3EDT B;  1EPU A;  3TWT A;  1MQS A;  3GYZ A;  5EX0 A;  2RG8 A;  3MV2 B;  2FO7 A;  4UWL A;  3KAE A;  3MEK A;  3UMV A;  3TWS A;  2QC9 A;  4GMR A;  2MRI A;  4JHR A;  5EYL A;  2V4H C;  3PE3 A;  3S2A A;  5B3S E;  2OVB A;  5EX3 A;  1O1R A;  3LPZ A;  3CKB A;  2L6B A;  4HI8 A;  3NOG D;  1IKN D;  1RW2 A;  3EHN A;  2ILR A;  4BX9 A;  3RK6 A;  4HQD A;  4CDM A;  4ILI A;  3WXX A;  3CVX A;  3OTN A;  4J7W A;  4BEP A;  3L22 A;  3FU6 A;  3SFZ A;  3S7D A;  2DYS E;  4G11 A;  1MZC A;  3SI5 A;  4N3A A;  3CVV A;  2UY1 B;  1FPP A;  2RD0 A;  3ZYQ A;  1LD8 A;  3ISM C;  3QWW A;  3TL5 A;  2Y4T A;  1B89 A;  4GTV A;  3FUM A;  1UJJ A;  3SBT B;  1N94 A;  3JCK C;  4JW1 A;  1E8Z A;  3DPD A;  3APD A;  2V5Q C;  3QKY A;  1BI8 B;  3ONL A;  5T4Y A;  3DXM G;  3Q49 B;  5AIJ A;  1SZ9 A;  3L54 A;  4DLQ A;  5HRY A;  3SHF A;  2F37 A;  3VLF A;  4BTB A;  3OXL A;  5CRU A;  1E8W A;  4Y6C A;  3CVW A;  2LUH A;  2EIK E;  2ZU6 B;  1D9S A;  2XEH A;  3CLJ A;  4JB8 P;  2EQX A;  1IHB A;  2FBN A;  5CBN A;  3KD7 A;  3B7R L;  3E34 A;  3LS8 A;  3V2O A;  2YNQ A;  1QZ2 A;  3APF A;  4I2W A;  4HNA D;  3ENE A;  4FUL A;  4C48 B;  1U3C A;  3DPY A;  3AS8 A;  4NAC A;  2L0I A;  3T8K A;  2WXJ A;  4ACL A;  3PH0 C;  1N11 A;  2NYJ A;  4CT0 A;  3ONK A;  3G2U A;  2HR2 A;  3PZ4 A;  2QY7 A;  1FCH A;  2XRY A;  3TWQ A;  1ZBP A;  5JJ6 A;  3DEO A;  2J49 A;  3E32 A;  4G2V A;  5ENS D;  3ASN E;  4X8Q A;  4IUL A;  5ENT D;  4UWH A;  2MOW A;  5B1A E;  3SGH A;  3FUE A;  5FQ4 A;  3U66 A;  4N3C A;  3DSX A;  1BPO A;  3U3W A;  1TN8 A;  4WAF A;  2NC9 A;  3IBE A;  2XGO A;  3PUJ A;  1MHQ A;  3UX4 A;  2IF4 A;  2CHW A;  3R7Q A;  3ZN3 A;  4ANU A;  3JUI A;  3L16 A;  4I2Z A;  3QJZ A;  3EHM A;  1O1S A;  1NA0 A;  1FT1 A;  4XKB A;  2IQC A;  1WDY A;  4F3V A;  3D9I A;  4NRH B;  1E7V A;  3TWW A;  4I6E A;  4YVO A;  3HVE B;  3HVE A;  5C1D A;  5ENN A;  3CGH A;  5CEA A;  4WWO A;  5FZS A;  2V5F A;  2ETB A;  4G1T A;  3ML8 A;  3V31 A;  2X6H A;  4WWP A;  3DSU A;  3SFY A;  1SVX A;  3FUL A;  1HH8 A;  2YHE A;  2VJ8 A;  3FP3 A;  2XZD G;  3MKQ B;  5EID A;  1AWC B;  3IXE A;  1QQE A;  4B93 B;  2F8X K;  3FUJ A;  3Q79 A;  1Z3Y A;  2VGE A;  4PS7 A;  2XRZ A;  3TGO A;  2H6G A;  4DX5 D;  4AM9 A;  3SBS A;  4UI9 K;  4FLH A;  5A7D B;  3ZNG A;  1OWO A;  4TXQ A;  4FJY A;  3FHE A;  3UT7 A;  3E33 A;  3E37 A;  3U64 A;  4J8S A;  3G2S A;  2WXP A;  2FO1 E;  5KBA A;  1BI7 B;  2XS8 A;  4KMO A;  4EZK A;  3MGB A;  3SO8 A;  1HF8 A;  1H2T C;  2XEE A;  3L17 A;  1D8E A;  4N39 A;  3OXG A;  2CG3 A;  4Y6W A;  1UG3 A;  4AOF A;  4GPM A;  2PQN A;  4F1S A;  3ZPJ A;  5EN5 D;  3ZU7 B;  3TWU A;  1IYG A;  5AEN A;  3FU0 A;  1NA3 A;  4LSZ E;  2XPZ A;  3DSV A;  1KZP A;  4EBA A;  5ENP D;  4LRZ A;  2XGM A;  5B1B E;  3D9J A;  2X6F A;  3APC A;  4BSZ B;  4AV7 A;  2GRP B;  4AIF A;  4XZ4 A;  2X3M A;  3F6Q A;  4JC8 A;  4RSY A;  1OCZ E;  3TXM A;  1HG5 A;  3DEP A;  4APF A;  3I3N A;  4UI9 C;  2KCK A;  3AS4 A;  1TJF A;  1KPS B;  4PS8 A;  3RRM B;  4N2S A;  2IOS A;  3V79 K;  1LF8 A;  3JUE A;  3PNL B;  5FQ8 A;  3CST A;  2MYO A;  5LCW C;  2L0T B;  4G8K A;  1HO8 A;  3AG2 E;  3MKQ A;  3FH7 A;  1SW6 A;  3JQ0 A;  4CDR A;  4C0E A;  1DC2 A;  4U95 D;  2YIN A;  3CSF A;  3ZYM A;  1KT0 A;  3BEE A;  4I6G A;  2IY0 C;  1SZA A;  4AY5 A;  2H6I A;  2GRM A;  5A6C A;  2X6I A;  4MBG A;  1E7U A;  4U0U A;  4MRU A;  5G55 A;  3HXF A;  3G2V A;  4L23 A;  5AAO A;  3RRN B;  3D9M A;  3RKV A;  5BXU A;  3B7U X;  4G8L A;  3J5P A;  1PY1 A;  2XEN A;  3LDZ A;  4ILG A;  3ABL E;  1DNP A;  2PM7 A;  4B94 A;  3FEX A;  2VYI A;  3Q4A B;  3QDN A;  1H19 A;  3CVN A;  4ANX A;  3W9G A;  1HFA A;  2QZA A;  5G05 J;  2R17 C;  2PZI A;  4I43 A;  3ZYK A;  3LYA A;  5BNW A;  3DST A;  4DK5 A;  5E75 A;  4J8D A;  1QYM A;  4JZY A;  3UT4 A;  4U96 D;  2I1J A;  5CMY A;  4RQI A;  4Q96 A;  2VSX E;  3T5V A;  4CT4 A;  2B6C A;  3U9W A;  4CZ2 D;  3ZXP A;  2DYR E;  5BXO A;  3NZS A;  4GTP A;  4K0R A;  4GTS A;  4A63 B;  4HLE A; 
#chains in the Genus database with same CATH homology
 3DPD A;  2KC7 A;  5HQ8 A;  3VTY A;  3APD A;  1INZ A;  3QKY A;  3ONL A;  3LVQ E;  4JVS A;  5FT9 A;  5G04 J;  2WPV A;  5T4Y A;  4O6F A;  4C9B B;  2GRL A;  3Q49 B;  5AIJ A;  1GW6 A;  1SZ9 A;  4XE0 A;  4BTA A;  3ASD A;  4N3B A;  5CCL A;  3L54 A;  5HI7 A;  1HG2 A;  4ACK A;  4NQ0 A;  1EYH A;  2WXM A;  4DLQ A;  4CGW A;  3SHF A;  3FH8 A;  4I1A A;  4XI9 A;  3PDN A;  3VLF A;  5JHB A;  4G23 A;  3N71 A;  4ATG A;  3Q15 A;  4JHJ A;  1TEZ A;  3G2W A;  4BTB A;  2XPY A;  5KJL A;  3OXL A;  4KYO B;  1Y6I A;  3LY8 A;  3LY7 A;  3NF1 A;  4KVM A;  1ELW A;  1E8W A;  4Y6C A;  3VTX A;  4U07 A;  3CVW A;  1E90 A;  3ML9 A;  1HU3 A;  3FY4 A;  2ZU6 B;  3B13 A;  2A5U A;  2AXV A;  5T3R A;  3ZYL A;  1IHG A;  2IFU A;  3EIQ C;  1ELR A;  4TRQ A;  2KZT A;  3CLJ A;  3TAX A;  1KT1 A;  1NP7 A;  2EQX A;  2FBN A;  3KD7 A;  4JW1 A;  4L2Y A;  5BV0 A;  1OWN A;  4CRW A;  2VSN A;  3B7R L;  5FTP A;  5CCM A;  4H7X A;  3LS8 A;  2HM8 A;  5G04 C;  5KJN A;  4LUN U;  2GW1 A;  2YNQ A;  1QZ2 A;  3APF A;  4ILH B;  2JEK A;  5AYW D;  4I2W A;  3ENE A;  4FUL A;  4EBA G;  3KEZ A;  3RIB A;  5LX8 A;  5KCM A;  3QAQ A;  1ELK A;  1L5J A;  4A55 A;  5A23 A;  4PS3 A;  4UWG A;  2OOE A;  1U3C A;  3OAW A;  5D0Q D;  2XPI A;  3AS8 A;  3IEG A;  2V8S E;  1FVF A;  3QAR A;  3D9P A;  4BT8 A;  3PZD A;  4OYS A;  3CQC B;  3RU0 A;  1WY6 A;  4ANW A;  4NAC A;  5DIZ A;  1H0A A;  2L0I A;  3PRZ A;  3P2B A;  2DCP A;  4HOU A;  3ZHE A;  3EIJ A;  3FEY A;  5C2Y A;  5J90 A;  4J8F A;  4JL0 A;  2FEZ A;  5EDS A;  2WXJ A;  2VTB A;  4ACL A;  1HXI A;  3PH0 C;  2XCC A;  3ZXS A;  4DI4 A;  5BV1 A;  2KAT A;  4CT0 A;  5FQ6 A;  3CHM A;  3FTU A;  1PAQ A;  4BFR A;  4L7T A;  4GCO A;  3EJN A;  4BT9 A;  3AS5 A;  3ONK A;  3G2U A;  2HR2 A;  4GCN A;  2QY7 A;  1FCH A;  4GMJ A;  3Q47 B;  3HYM B;  4JEU A;  3RO2 A;  3ZIM A;  4MLP A;  3ZVV A;  2ION A;  3FTS A;  1JUQ A;  2CFU A;  3PEV B;  2XRY A;  4J6I A;  1ZBP A;  5JJ6 A;  4GB9 A;  2VSO E;  2J49 A;  1SQM A;  3UQ3 A;  4G2V A;  5ANR A;  2X38 A;  5G05 C;  3FTY A;  3R7R A;  2HO1 A;  3HDX A;  3U4T A;  1XGW A;  3CHO A;  4FU3 A;  4RG6 A;  3ZEF A;  4IUL A;  3SD5 A;  4UWH A;  4CEM A;  2MOW A;  3U66 A;  3GZ1 A;  3FUE A;  2VSY A;  3MCX A;  5FQ4 A;  3SGH A;  3TG4 A;  4N3C A;  3FWV A;  4BSX A;  1BPO A;  3B7S A;  4XI0 A;  3RO3 A;  3U3W A;  2J9Q A;  2L6J A;  2UWJ G;  1P5Q A;  3FUH A;  3GZ2 A;  4WAF A;  4I1O B;  2NC9 A;  3ESL A;  1N52 A;  3IBE A;  3ZW3 A;  2XGO A;  5JHA A;  2UY1 A;  4WND A;  4G24 A;  3D9K A;  3PUJ A;  1MHQ A;  3UX4 A;  2IF4 A;  4I9E A;  2CHW A;  1OWP A;  3R7Q A;  2AVP A;  2L9B A;  3ZN3 A;  4ANU A;  1WM5 A;  1Z3X A;  3LVR E;  3PE4 A;  5JJT A;  2XQ0 A;  3JUI A;  3ASF A;  3L16 A;  3I4R B;  3SF4 A;  4I2Z A;  4BWR A;  3CIA A;  1XNF A;  2VGY A;  3QJZ A;  2PL2 A;  4HOQ A;  4WWN A;  4CCA A;  3EHM A;  1PC2 A;  3MYV A;  1NA0 A;  2LSU A;  1DVP A;  4XKB A;  2IQC A;  1HS6 A;  4EZL A;  4LCT A;  4AXH A;  3L6A A;  4F3V A;  5D0O D;  4FA6 A;  4PH4 B;  1S0P A;  2WXH A;  3FH5 A;  4GU5 A;  4L1B A;  1FVH A;  4IN3 B;  2LO6 A;  3D9I A;  2YHC A;  3LY9 A;  4J8E A;  2KCL A;  4NRH B;  1E7V A;  3O48 A;  4R7L A;  2VTB B;  1IQU A;  4KT6 B;  4C0M A;  3CVL A;  4K03 A;  4B8C B;  2OND A;  4FHJ A;  4LEU A;  2I9C A;  2WXK A;  4A3V A;  4I6E A;  4YVO A;  3FUI A;  2CHX A;  2R5S A;  3HVE B;  5AJD A;  4Q94 A;  1HE8 A;  4URK A;  3HVE A;  5T8I A;  2R59 A;  4GPK A;  4DJA A;  4B0Z A;  3TJP A;  2WQ7 A;  2E2E A;  4JEH A;  4UQZ A;  4XX5 A;  5C1D A;  3IV0 A;  4I17 A;  5ENN A;  3CGH A;  3G2T A;  4WWO A;  4HOR A;  2WXI A;  1EF1 C;  4MS6 A;  4M3O A;  4E6H A;  4XKC A;  4ME2 A;  1Y8M A;  5FZS A;  4HS2 A;  3D9L A;  3LCA A;  1JWF A;  4FHK A;  4ANV A;  3CVP A;  4OVV A;  4CGV A;  2FUL A;  2V5F A;  3KS2 A;  3ASG A;  2WXF A;  4CDN A;  4G1T A;  2CFZ A;  2KCV A;  3QB2 A;  3HHM A;  3ML8 A;  1OWL A;  4B8A A;  4HXI A;  3CHP A;  2X6H A;  4WWP A;  4AVX A;  3E4B A;  2V0P A;  4GA0 A;  3FUL A;  1HH8 A;  3CK8 A;  2YHE A;  5FZQ A;  5JJ7 A;  2VJ8 A;  3FP3 A;  2WM9 A;  4RG9 A;  3ZRH A;  3FUN A;  3FTZ A;  2E0I A;  3LEW A;  4ABN A;  4MKT A;  5FQ7 A;  5LCW J;  4EEC A;  4GYY A;  3MKQ B;  3MX3 A;  3UUX A;  4UWK A;  3PRE A;  3ZGQ A;  2FI7 A;  4P29 A;  1QQE A;  2WXN A;  3S7F A;  4BY6 A;  3FUJ A;  3FU3 A;  3L08 A;  3ZHE B;  1Z3Y A;  4HFG A;  4PS7 A;  4QFV A;  5ANL A;  2XRZ A;  4F7A A;  1N54 A;  4Q69 A;  3C98 A;  4DPR A;  1OUV A;  4PUC A;  3TGO A;  3FUK A;  4I1M A;  4GZC A;  1UN9 A;  2IOL A;  3NQP A;  2I2O A;  4FC8 A;  4EZJ A;  4UI9 J;  3CV0 A;  3S7J A;  4AM9 A;  4HLE A;  3SBS A;  2LNI A;  4UI9 K;  5BUZ A;  4FLH A;  3VLD A;  2AWI A;  5E76 A;  1UN8 A;  2WXG A;  1HX8 A;  3D9O A;  1WAO 1;  3FTW A;  4I9C A;  3UPV A;  2WXL A;  3FTV A;  5CMW A;  4KBQ A;  2C0M A;  4N5C A;  3FUD A;  4V3I A;  2PM6 A;  5A7D B;  3QOU A;  1OWO A;  4LER A;  4XIF A;  4FJZ A;  4FJY A;  3AU4 A;  1NZN A;  3FHE A;  4I6J A;  4WNG A;  3UT7 A;  1KLX A;  1JWG A;  4L2L A;  5FWQ A;  1UW4 B;  3FTX A;  4EQF A;  3U64 A;  3QK0 A;  4J8S A;  5BT1 A;  3G2S A;  2WXP A;  2MHK A;  3LJ3 A;  4FP7 A;  2JLB A;  3GW4 A;  3GZS A;  3CK9 A;  3MZL B;  5M72 A;  1Z6T A;  4GA2 A;  1E8X A;  4GZ5 A;  3AU5 A;  3UT8 A;  4G25 A;  4KMO A;  2XEV A;  3MGB A;  4EZK A;  2V4L A;  2XGS A;  4J0U A;  2DBA A;  1UJJ A;  1HF8 A;  2M63 A;  1H2T C;  2CG2 A;  2LAH A;  3CQG B;  4GZ3 A;  5FZR A;  3L17 A;  4GYO A;  1OWM A;  3CKC A;  5LOZ A;  4JHK A;  3FFL A;  4N39 A;  3O4Z A;  5G2N A;  4UQY A;  2J09 A;  2CG3 A;  3OXG A;  4NUR A;  4U0Z A;  3IHV A;  5AJL A;  2WB2 A;  2J4D A;  3QNK A;  3S7B A;  4TUU A;  2LAI A;  4Y6W A;  2AXZ A;  1UG3 A;  2A4Z A;  3SNX A;  4GML A;  3CVY A;  4AOF A;  2VGX B;  2I1K A;  2WQ6 A;  2PQN A;  2X6J A;  2HYZ A;  4F1S A;  1QNF A;  3VLE A;  4WUY A;  2Y3A A;  3SZ7 A;  3ZPJ A;  3CHQ A;  5CHE E;  4KXK B;  1IYG A;  5AEN A;  3FU0 A;  3MJW A;  3CVQ A;  2Y4U A;  1NA3 A;  4JA7 A;  1TJC A;  2BUG A;  2WMN A;  2XPZ A;  4FAD A;  2CHZ A;  4EBA A;  4LRZ A;  5J08 A;  4N2Q A;  3MV3 B;  3FDH A;  2XGM A;  1H2V C;  3D9N A;  4PDX A;  3D9J A;  1A17 A;  2QFC A;  2FF4 A;  3PEU B;  4GYW A;  5KJK A;  2IU1 A;  3PS6 A;  1UJK A;  4APO A;  4HOT A;  3ASH A;  3HIZ A;  2KM4 A;  2X6F A;  3APC A;  4KZ0 A;  4AV7 A;  4D10 C;  4AIF A;  4YVQ C;  4XZ4 A;  5LFA A;  2X3M A;  4RSY A;  4JC8 A;  4F53 A;  5KJM A;  3QWP A;  3TXM A;  3FUF A;  1HG5 A;  4AEZ C;  4JA9 A;  3R9A B;  4EPZ A;  3MA5 A;  1X5B A;  3JYS A;  4APF A;  1E96 B;  3I3N A;  4WNE A;  4JXT A;  3TXN A;  3LKU A;  4HVB A;  3ESK A;  4UI9 C;  2XHE A;  4BX8 A;  2KCK A;  5ARG A;  3BG1 B;  3AS4 A;  1ZU2 A;  4GA1 A;  1HZ4 A;  4AJW A;  1TJF A;  4A1S A;  1VDY A;  3D3M A;  4PS8 A;  3RRM B;  3RJV A;  4N2S A;  2IOS A;  4A3T A;  1LF8 A;  4GZ6 A;  4KVO A;  3PNL B;  3MKR A;  2KZT B;  2OV8 A;  3PVL A;  4HOS A;  2C2L A;  2J07 A;  5FQ8 A;  2WXQ A;  2X6K A;  2C0L A;  2YQ8 A;  3CST A;  3BG0 B;  2VQ2 A;  3RRU A;  5LCW C;  1W3B A;  4GZD A;  4U04 A;  4U63 A;  3ULQ A;  2L0T B;  4TV3 A;  1HO8 A;  4AY6 A;  2AXU A;  3MKQ A;  3QC1 A;  3FH7 A;  4DI3 A;  3TG5 A;  2WXO A;  1EDU A;  2WMO A;  5DBK A;  4FLB A;  2WVI A;  3CK7 A;  4DLO A;  3JQ0 A;  4YND A;  3URZ A;  4CDR A;  3PNT B;  3EDT B;  4IYP A;  4KZC A;  2BTD A;  4C0E A;  2YIN A;  1EPU A;  3DBS A;  3CSF A;  3ZYM A;  1KT0 A;  1MQS A;  2XCB A;  3BEE A;  1JPL A;  4I6G A;  4IRU A;  2PQR A;  3GYZ A;  5LP0 A;  1SZA A;  4AY5 A;  5EX0 A;  3CHS A;  2GRM A;  2I6H A;  2RG8 A;  3MV2 B;  5A6C A;  2FO7 A;  4UWL A;  2X6I A;  3KAE A;  3MEK A;  3UMV A;  1E7U A;  4U0U A;  5BW8 C;  4MRU A;  5G55 A;  4A1G A;  3G2V A;  4L23 A;  3RRN B;  2DIW A;  4UQX A;  2MRI A;  3D9M A;  3JQ1 A;  2WQH A;  3Q5M A;  4JHR A;  3RKV A;  2WXR A;  4U8H A;  3B7U X;  3PUK A;  1PY1 A;  3CHR A;  3PE3 A;  2P58 C;  3LDZ A;  3S2A A;  4ILG A;  1DNP A;  2PM7 A;  3CR3 A;  2OVF A;  4B94 A;  4E85 A;  4GAA A;  3FEX A;  2VYI A;  2NXP A;  3FU5 A;  3Q4A B;  3QDN A;  2OVB A;  3QWV A;  4H7Y A;  1H19 A;  5EX3 A;  4U0S A;  3CVN A;  4UWF A;  4ANX A;  3LPZ A;  2AW6 A;  3LXU X;  4JPS A;  3CKB A;  1HFA A;  5ARF A;  2Q7F A;  3B7T A;  3IHY A;  5G05 J;  4RVB A;  2R17 C;  5EKQ D;  2J08 A;  3EHN A;  2GGF A;  2PZI A;  2NSZ A;  4I43 A;  2ILR A;  3ZYK A;  2J4B A;  3I5P A;  4BX9 A;  3I4G A;  3RK6 A;  3LYA A;  4CDM A;  5BNW A;  4G26 A;  4AP2 A;  4DK5 A;  4ILI A;  3WXX A;  3ZFW A;  3CVX A;  5E75 A;  3OTN A;  1H2U A;  3L22 A;  3FU6 A;  4J8D A;  3K9I A;  1U3D A;  4WNF A;  1YA0 A;  4B89 A;  4JZY A;  3SFZ A;  3P1U A;  3UT4 A;  2I1J A;  3T8M A;  3S7D A;  5CMY A;  3NZU A;  4G11 A;  3SI5 A;  4N3A A;  4Q96 A;  5FJY A;  3CVU A;  5BPP A;  3CVV A;  3L13 A;  2UY1 B;  2VSX E;  3T5V A;  4CT4 A;  3U9W A;  2RD0 A;  1IQR A;  2LSV A;  2BF0 X;  3ZYQ A;  3IKO B;  1H6K A;  3OXF A;  3QWW A;  4W9R A;  3TL5 A;  3NZS A;  1E8Y A;  2Y4T A;  1B89 A;  4K0R A;  3FUM A;  2IJG X;  4OVU A;  3SBT B;  3T5X A;  2VGX A;  3CEQ A;  3JCK C;  1E8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...