4DI4A

Crystal structure of a 3:1 complex of treponema pallidum tatp(t) (tp0957) bound to tatt (tp0956)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
273
Chain Sequence
DADFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Characterization of the Interaction between Two Periplasmic Treponema pallidum Lipoproteins that are Components of a TPR-Protein-Associated TRAP Transporter (TPAT).
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
molecule tags Transport protein
molecule keywords TatT (Tp0956)
total genus 103
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4di4A00
3U64A 4DI3A 4DI4A
chains in the Genus database with same CATH superfamily
1UW4B 4EZKA 4HOUA 3Q79A 4DUIA 3CHOA 2F8XK 3CVPA 4I1AA 3FUNA 3Q49B 3EU9A 2AJAA 4HOTA 1NI1A 5KCMA 4U96D 4JHJA 1MX2A 5EX3A 2KM4A 2XGMA 3PEUB 3ABKE 2H6GA 2Y4UA 4FP7A 1YCSB 3UIPC 2P9KG 3SFYA 1LTXA 5KJMA 1HXIA 2WQ6A 1OWNA 2GW1A 1O1RA 1S63A 1FT2A 3FTVA 1WG0A 5LCWC 3ESKA 2LAIA 3FEYA 2KC7A 3LVRE 4H7YA 4GTSA 2EINE 2WMNA 4F53A 4C9BB 4DX5D 3ML9A 3B95A 2L0TB 2OVBA 3I5PA 5D0OD 2A5UA 4LNUD 4DK5A 2NXPA 3HXBA 5B1AE 2BKGA 3HDXA 3DXKG 3CLJA 3D9NA 5ANLA 3D9OA 2F37A 3BEEA 3VLDA 4EBAG 3SI5A 3OTNA 3AS8A 4GU5A 2WXOA 5B1BE 3QJZA 3CGHA 4GYOA 3ZHEB 3C5RA 4CGVA 3LJ3A 3SF4A 3GZSA 4EZJA 4WAFA 2UWJG 2OV8A 3PNLB 2QYUA 1SQMA 2VSOE 1NA0A 3EDTB 4F6RD 3FUJA 5HS0A 3MKRA 4GTPA 2KCKA 4IULA 1E8WA 4YDYA 1SZAA 2L6JA 4WNEA 4HXIA 3MGBA 3C98A 2V0PA 3CVVA 5EIDA 5JMND 5AYWD 1UN8A 5EILA 3HG0D 2C0LA 5DBKA 2DZOA 3R7RA 1OUVA 3UT4A 1KT0A 3FUIA 2V8SE 4GZ6A 3DSXA 4KVMA 3CVLA 3LJNA 4LEUA 3TXMA 3QDNA 3EHQA 3CVYA 3T5VA 3G2WA 2JEKA 2IJGX 3JYSA 3FH5A 1TN8A 2VSYA 4P29A 4KZCA 2LO6A 3WXXA 4FU3A 3PDNA 3LKUA 1OWOA 3PNTB 3TWUA 2XCCA 3PZ1A 4O60A 4KMOA 4GPKA 4G26A 5ARFA 2Y69E 3JUEA 5BV1A 4A55A 2B0OE 2H6IA 3L6AA 1LF8A 2C0MA 1S70B 2IOLA 4H7XA 3Q15A 2FEZA 1MQSA 4GTRA 1B89A 1N95A 2C2LA 4TXQA 1TEZA 4GYWA 3L22A 3NZUA 5ENPD 1RZ4A 5ENQD 4LSZE 4B8CB 5JJ7A 1N4RA 3GYZA 3I4GA 5KBAA 4BTAA 3UM1A 2IEJA 1MHQA 5BNWA 1OCCE 4JPSA 1FVHA 1NA3A 3APCA 2X6KA 3PZ4A 4BT9A 2QZAA 2QYJA 3BG1B 2H6HA 3MEKA 3KEZA 4FJYA 2RFAA 4I9EA 2F8YA 3V31A 3CHPA 2VGYA 3DEPA 3Q78A 3BUAA 2J09A 2XPZA 4JB8P 3IXEA 4ANUA 2VQ2A 4L1BA 1ELWA 4U0ZA 4CYMD 3UT8A 4BERA 5T3RA 4EBAA 3MYVA 4RSYA 2BUGA 5KWDA 2L6BA 4I1OB 4U63A 3HRAA 3ZUVB 4ANVA 5CMWA 4GZ3A 2IO2C 4WNGA 4ABNA 5FWQA 2AXZA 4KYOB 4BX9A 1D8EA 3FDHA 3ZEFA 3ZXSA 3D9MA 1WM5A 5BT1A 4M7CA 2J4DA 2AXUA 1DC2A 3GZ2A 4JHKA 3WG7E 4Y6CA 2CG3A 1Y8MA 3LDZA 3VLFA 4BETA 2E0IA 2H6FA 4YNDA 3SHFA 1E7UA 1E96B 4JC8A 2YHEA 4L23A 1HO8A 4X8QA 4UQYA 3SBSA 1KPSB 3E30A 4GPMA 4LERA 4TRQA 3T8MA 4TUUA 1H6KA 3TXNA 3ZXPA 1V55E 1N4QA 4HVBA 3DSSA 5EIBE 1TNOA 3ZHEA 2IQCA 4ACLA 1HF8A 1IQUA 3TWXA 1TN6A 2ONDA 3D3MA 3QWPA 4N2QA 1BI8B 4F3VA 2MRIA 1HX8A 1QZ2A 1OT8A 3EIJA 2AVPA 2ETAA 2RFMA 5J08A 3FY4A 4Z68A 3B7TA 3QB2A 4G1TA 4TXPA 2BKKB 5FZRA 3PVLA 3FU0A 3W9FA 5A23A 3DPDA 4YVOA 4DX6D 1JCQA 4U0SA 2R59A 1YYHA 4JA7A 4FADA 2ZU6B 1E8XA 5CCLA 1JCRA 4I1MA 2WXMA 3RO3A 4HBDA 3G2VA 3RAUA 3ASHA 4HI8A 4HOQA 5KJNA 2YINA 3O4ZA 2CHXA 4ATGA 5FQ4A 3CSFA 2ILRA 4BFRA 3TJPA 3CIAA 3RO2A 1NZNA 1UN9A 2P2CP 2J9QA 5EX0A 4UUCA 2X6FA 3DRAA 2X38A 2XHEA 3Q9UC 2P9PG 4FJZA 4OVUA 2VGEA 3CSTA 3NAWA 5CECB 3CHQA 3ONKA 2HYZA 4FHKA 2IONA 2WB2A 3LXUX 1IXVA 5JJTA 4NIKA 5CMYA 2R05A 1N11A 3UM2A 4YDOA 3IBEA 4G23A 3ABME 1TJFA 1WY6A 1X5BA 3ZKJA 2XS8A 4BEPA 4LNGA 4RVBA 3FUKA 3L17A 2PNNA 3P2BA 1IYGA 2WXLA 2GRQB 2P9IG 3SO8A 3FHEA 1OCOE 3E32A 5CRVA 5D0QD 4J8SA 1KZPA 2XPIA 3ZN3A 4IN3B 3Q5MA 3UKRG 4HOSA 4AM9A 3DWLG 4M3OA 4CEMA 4V3IA 4LCTA 3AG3E 4I2ZA 3LVQE 2PM6A 5HKPA 3FH7A 3W9GA 4GZ5A 4XEIG 2BEDA 3J5QB 5JHBA 4GA0A 2XEEA 1PY1A 3RU0A 5T4YA 1E8YA 1HG5A 4GMRA 1EYHA 5ENNA 3KSQA 3R9AB 3EHNA 4RG9A 2FULA 2GRNB 3V30A 2DYSE 2UY1B 4ANWA 3ESLA 2HR2A 4I6JA 2NSZA 2P9NG 5CHEE 4DRXE 3SY2A 3B13A 4J8FA 2GRPB 5JHAA 4DLOA 2EQXA 2ZISA 3JXJA 4DLQA 2QFCA 4XZ4A 4B0ZA 3TG5A 3R9MA 3SGHA 2WXGA 4UQXA 3RSEG 4AJWA 4DX1A 2XQ0A 2A4ZA 4OYSA 4UI9J 1H6PA 3SBTB 4I6EA 2FI7A 2VGXB 4R7LA 3ZYMA 4PH4B 3CK8A 3AG4E 4CCAA 1KLXA 1G3NB 1UOHA 3AJIA 4O6FA 5J90A 1OWMA 2X6IA 3QAQA 1DCEA 4W9RA 3FTXA 3AG2E 2XRZA 3D9JA 2V4HC 2IFUA 3UM0A 2FO1E 4ANXA 3O48A 4KBQA 5CBOA 3SD5A 1S0PA 2LNIA 5ENOD 3X2QE 4DI4A 2XCBA 1L5JA 3CVNA 5KJLA 4JEUA 1HH8A 3QC1A 5AENA 4XKBA 1U3CA 2WQ7A 5FINA 3VTXA 2M63A 4UQZA 1OXJA 5IY5E 4HNAD 4GAAA 4TUMA 3ZGQA 1WDYA 1MX6A 4DJAA 2ETCA 1H2TC 1ELRA 5A7DB 3BU8A 4KXKB 3CKBA 4UWLA 3U9WA 3MCXA 3PH0C 2ZXWE 4G24A 4HFGA 4IYPA 4Q94A 3I3NA 3C3OA 3S2AA 1UJJA 1H6OA 1H2UA 3RRNB 5BXUA 3G2UA 2LXMA 4ME2A 3CHSA 3PRZA 3DSTA 5C1DA 3CVUA 3DEOA 3SQVA 3TAXA 1E90A 4AV7A 1QYMA 1TNBA 2WMOA 4U8VD 3TWSA 4N39A 3ZNGA 5E75A 2RKKA 1H2VC 4CDMA 1HFAA 3LY7A 4GYYA 3FH8A 2L0IA 3FULA 4HRLA 3ABLE 3HXFA 4XIFA 1BU9A 4B89A 5G55A 4HORA 2DVWA 4PUCA 2MOWA 4PS8A 1KT1A 2RD0A 3B7SA 3UIOC 4TXRA 3UQ3A 1SVXA 2FF4A 1O1TA 4I2WA 3UX4A 1HU3A 1K8KG 2BTDA 5CERB 1X81A 1N0QA 3S7FA 1BPOA 1UJKA 1MX4A 3FWVA 4RQIA 4EPZA 3QARA 3ULEG 3OXGA 4U04A 2NYJA 5AIJA 4L9PA 2HO1A 5G04J 4BWRA 3AAAC 5LFAA 5CRUA 2PQNA 3N71A 1INZA 3AU5A 2A5EA 3I4RB 4CZ2D 4EHMA 4D10C 2EILE 3IEGA 4JXTA 1E7VA 3EJNA 3T9KA 4J0UA 1TNZA 4WWOA 3D9KA 2XEHA 3PE4A 1Z6TA 5LCWJ 5G05J 2I2OA 5HI7A 4ZHBA 4JL0A 4K5CA 3TL5A 3RK6A 2X6JA 3FU6A 2CHWA 2WVIA 1QQEA 4AY5A 4AY6A 3L9TA 3TG4A 4U07A 1BI7B 1MZCA 3S7BA 2DBAA 3L13A 3MJWA 4I17A 5CEAA 1JUQA 3QKYA 4K5AB 3ZRHA 2WXPA 3FUMA 5HQ8A 4MKTA 1P5QA 1WAO1 4KT6B 2WPVA 5AQ7A 4G25A 2YHCA 3ULQA 4B94A 1JPLA 1IHGA 1YA0A 1JWFA 1EF1C 4LRZA 2J49A 3R7QA 2P9LG 3CHMA 4ATZD 3EIQC 4BSXA 2Q7FA 4FC8A 3ASDA 3KS2A 3E4BA 3PE3A 1DNPA 3IHYA 2IO3C 4J8EA 2VJ8A 4GB9A 3APFA 3UUXA 1N0RA 3KEAA 1H0AA 4JZYA 3TWRA 3ZYLA 5AARA 3LY9A 3JQ1A 1UG3A 3FUHA 2P9UG 1E8ZA 3FUFA 3S7JA 4UI9K 2XZDG 2BF0X 5T8IA 3E33A 4JHRA 2I1KA 1BD8A 4EZLA 3E34A 1ZBPA 4JD2G 4Q96A 5HRYA 3DSUA 4AVXA 3ZIMA 4QQIA 4PS7A 3FTWA 4AEZC 1SZ9A 1HZ4A 3ML8A 5BXOA 4QFVA 3Q7FA 1GW6A 3MV3B 1EPUA 2E2EA 3AS4A 4RG6A 3CVWA 2J08A 2JABA 1TN7A 1SA4A 3PS6A 1NP7A 2XZTG 3U4TA 1N52A 4Y6WA 2IOSA 2ZGDA 3DSWA 2HM8A 4O1OA 2WM9A 4B93B 3PREA 3CVQA 3RRMB 4L2LA 3L54A 2XEVA 3BQOA 4GTMA 3T8KA 2WXFA 2GRLA 2CG2A 3CKCA 4A3VA 3ULYA 5FQ7A 2WQHA 4BESA 4NACA 5G2NA 1A17A 5FZQA 5JJ6A 3BG0B 2XRYA 4BT8A 1OY3D 2KATA 5BUZA 4CGWA 5CBNA 3QWWA 3CK9A 4GZCA 4XKCA 3UM3A 2YQ8A 1K3ZD 3ISMC 2LSVA 4BX8A 4UWHA 2ZIRA 2EIKE 3ASGA 3ZYKA 2LAHA 2QC9A 3L08A 3B7BA 4MRUA 2V5FA 3EHMA 3JQ0A 4DI3A 1Y6IA 2F0YA 5M72A 1S64A 4JW1A 5FT9A 4HLEA 2VSXE 2XGOA 2OCCE 1NFIE 2X3MA 2I1JA 3GZ1A 3CR3A 1AP7A 4A1GA 4I43A 3V79K 5D2MC 2IY0C 1PAQA 4FLBA 5AQ9A 1YMPA 4ILIA 3UMVA 2WXNA 4LG6A 4U8YD 4APFA 4JVSA 1TNYA 1D8DA 4DX2A 2OEVA 1A5EA 3HVEA 1LD7A 3NB2A 2R2LA 3LCAA 4N3CA 4DPRA 2VGXA 1O1SA 3DXMG 4C0EA 3UTMA 3FU5A 4E6HA 4HRMB 3V2OA 5CEDB 2J4BA 3FTUA 4GMLA 4J8DA 1EDUA 3SFXA 3CV0A 2VTBB 3ZYQA 3TWWA 2I6HA 4N3AA 4FULA 3LYAA 4G11A 1SA5A 2RG8A 3OXFA 4OVVA 3C3QA 2X6HA 4CRWA 3ZVVA 4L7TA 5D66A 3Q75A 2IU1A 5FQ6A 1MYOA 3QNKA 5LOZA 2PM7A 5LX8A 5KNGA 3NBNB 1V54E 4XE0A 4C0MA 1BLXB 2WXIA 4KZ0A 1OWPA 1RW2A 4IRUA 1OCZE 2AWIA 5KNHD 2KZTB 2KZTA 3PZDA 4ILGA 2WXRA 3VLEA 3MZLB 3FEXA 3RKVA 4E85A 4A1SA 5BV0A 3Q7AA 3LEWA 3NQPA 4HS2A 3UXGA 2EIME 3MKQB 2YNQA 4DX7D 1K1AA 3SFZA 4HLLA 3Q73A 3U64A 4K0RA 1DCQA 3RIBA 4YVQC 5B3SE 3HHMA 2QY7A 3IV0A 3DPYA 2Y1LE 2KXPC 3D9HA 3ASNE 2IF4A 1TR4A 2PQRA 2PZIA 1AWCB 4AXHA 4JA9A 3HVEB 4N5CA 3MA5A 2XENA 3GW4A 5BPPA 3EU5A 4XI9A 4K5BA 3U3WA 1O5MA 2Y3AA 2FO7A 4RLYA 5G05C 3LPZA 1W3BA 1TJCA 2WXKA 3D9IA 3CVXA 2I9CA 3OAWA 2VTBA 4CDRA 1N94A 5AN8A 1K1BA 4AOFA 5ANRA 4WWNA 2KBXA 5ENRD 4A3TA 2DYRE 5EYLA 4BSZB 3IHVA 4N5QA 3FUEA 2KCVA 4HQDA 3JCKC 2GRMA 3DBSA 2R5SA 4OAVB 5KJKA 3F6QA 3FFLA 4G8LA 5ENTD 2EIJE 4PDXA 5AJLA 3NOCD 2XPYA 4F1PA 3LS8A 3HIZA 1IHBA 4GCNA 2LUHA 3FUDA 1FVFA 2R02A 5EN5D 4ACKA 3UINC 1HS6A 1KZOA 1Q2ZA 5BW8C 4G2VA 3PUJA 4U8HA 3AU4A 5AQAA 4NURA 1QBQA 2V4LA 3CK7A 5EKQD 3FTYA 3FU3A 4GTQA 2Y4TA 3EHRA 4KVOA 1U2VG 3D9PA 2HE0A 4XI0A 3ZW3A 5ITZF 3ASOE 3DSVA 4CT4A 1TNUA 2DZNA 4WUYA 4MBGA 1Z3YA 1H19A 2JLBA 3TWVA 2WXJA 4YDWA 2ZGGA 3V2XA 2MYOA 2ETBA 4YDEA 4B8AA 1HG2A 5AJDA 5H7PA 3ZFWA 3G2TA 2GRRB 3UKUG 3C3RA 4G8KA 3UI2A 4GMJA 1ZB1A 2GROB 3G2SA 3PUKA 5JA4D 2CFUA 4A63B 3L16A 3NZSA 5FJYA 4HI9A 1JWGA 4Q69A 1XGWA 5EDSA 4URKA 4F1SA 4L2YA 3B7UX 4UWGA 1PC2A 3ZU7B 4CDNA 1SW6A 2OEWA 2B6CA 4BY6A 3K9IA 4ILHB 2OOEA 4APOA 2AXVA 3RJVA 4GTVA 2MHKA 4WNFA 4GA2A 2LSUA 3RRUA 3U66A 3IKOB 5ENSD 4PS3A 5G04C 2FBNA 3PEVB 3QOUA 3J5PA 3PZ2A 3HYMB 3OXLA 1VDYA 4K03A 3EUVA 2R03A 5ARGA 1XNFA 3CHRA 3KSLA 3Q4AB 4J6IA 4EECA 3QK0A 4EQFA 1U3DA 2VYIA 1IQRA 1NL4A 5EYPF 5E76A 4NRHB 3ONLA 3TWTA 5AAOA 4UI9C 4XX5A 3Q9NC 3VTYA 1MJ0A 2XS1A 3SNXA 4O1PA 2DWZA 1N9AA 5A6CA 3Q47B 4FLHA 2CHZA 4F7AA 3B7RL 1D9SA 3FTZA 1TYQG 5AQBA 4AIFA 1JCSA 1ZU2A 4AP2A 4LUNU 4BTBA 4C48B 4WNDA 4HB5A 3NOGD 1N4PA 1QNFA 2LXLA 3CEQA 4N3BA 1OWLA 3CQCB 4GCOA 3TWQA 3ZPJA 3MV2B 4U7EB 1Z3XA 4NQ0A 2V5QC 4I6GA 2J8SD 3URZA 4WWPA 4MS6A 3SZ7A 4HRNA 5FTPA 3QWVA 1FCHA 3T5XA 2OVFA 3MX3A 2Y0BG 2UY1A 3UT7A 3JUIA 3AS5A 2VSNA 4U95D 3HXDA 3P1UA 4J7WA 4JEHA 1HE8A 2P58C 3KAEA 2DCPA 3LY8A 3C72A 2PL2A 4GZDA 2KCLA 2P9SG 2WXHA 2DIWA 3ENEA 5FQ8A 2WXQA 4GTTA 1DVPA 4GTOA 3CQGB 1FT1A 2L9BA 4N2SA 2XGSA 4U0UA 3ASFA 5LP0A 3UPVA 4MLPA 1Z5SC 3FP3A 3JXIA 4CT0A 4UWFA 3MKQA 4GA1A 3HXEA 3PZ3A 3NF1A 4J8YA 1IKND 3KD7A 5C2YA 5DIZA 3HXCA 2R17C 3AG1E 5CCMA 5FZSA 2NC9A 1ELKA 1LD8A 4FHJA 4I9CA 3S7DA 4TV3A 1FPPA 3FTSA 1N54A 5FIOA 3E37A 3APDA 4FA6A 2AW6A 2GGFA 4LNBA 1OCRE 4ZFHA 4OAUC 4UWKA 1N4SA 2CFZA 2J07A 3L82A 3TGOA 3D9LA
chains in the Genus database with same CATH topology
3IEGA 4JXTA 5A23A 1E7VA 5BW8C 3U3WA 3EJNA 4J0UA 4WWOA 2Y3AA 2FO7A 3D9KA 5G05C 1UW4B 3DPDA 3PE4A 4YVOA 4EZKA 4HOUA 4U0SA 2R59A 1Z6TA 3LPZA 3CHOA 5G05J 5LCWJ 1W3BA 2I2OA 3CVPA 4I1AA 4JA7A 5HI7A 1TJCA 3FUNA 4FADA 3Q49B 4JL0A 2WXKA 3D9IA 3CVXA 2ZU6B 1E8XA 4HOTA 2I9CA 3OAWA 3RK6A 3TL5A 5KCMA 2X6JA 3FU6A 4CDRA 5CCLA 2VTBA 4JHJA 2CHWA 2WVIA 1QQEA 4I1MA 4AY5A 5EX3A 2KM4A 2XGMA 3PEUB 2WXMA 3RO3A 4AY6A 3TG4A 4AOFA 4U07A 3G2VA 5ANRA 2Y4UA 4WWNA 4A3TA 3ASHA 4FP7A 4HOQA 3S7BA 5KJNA 2YINA 2DBAA 3L13A 3MJWA 3O4ZA 4I17A 3IHVA 5KJMA 1HXIA 2WQ6A 1JUQA 2CHXA 3FUEA 3QKYA 3ZRHA 2WXPA 4ATGA 3FUMA 5FQ4A 1OWNA 2GW1A 5HQ8A 2KCVA 3JCKC 2GRMA 3DBSA 3CSFA 2R5SA 2ILRA 4BFRA 5KJKA 4MKTA 1P5QA 1WAO1 3TJPA 3CIAA 3RO2A 4KT6B 1NZNA 3FFLA 2WPVA 1UN9A 3FTVA 2J9QA 5EX0A 4G25A 4PDXA 3ESKA 5LCWC 2YHCA 5AJLA 3ULQA 4B94A 1JPLA 2X6FA 1IHGA 2XPYA 1YA0A 2X38A 1JWFA 1EF1C 2XHEA 2LAIA 4LRZA 3LS8A 2J49A 3FEYA 3HIZA 2KC7A 3LVRE 3R7QA 4FJZA 4GCNA 4OVUA 3CSTA 3CHMA 3FUDA 4H7YA 3EIQC 1FVFA 4BSXA 3CHQA 4ACKA 2WMNA 3ONKA 4F53A 2Q7FA 4C9BB 4FC8A 3ML9A 2HYZA 3ASDA 1HS6A 3E4BA 3KS2A 2L0TB 2OVBA 3PE3A 3PUJA 1DNPA 4G2VA 4U8HA 3AU4A 3I5PA 3IHYA 4D10C 5KJLA 4J8EA 2A5UA 2VJ8A 4FHKA 2IONA 4GB9A 2NXPA 5D0OD 4DK5A 3APFA 3UUXA 2WB2A 4NURA 1H0AA 3LXUX 3HDXA 5JJTA 3CLJA 3D9NA 4JZYA 3ZYLA 5CMYA 2V4LA 3CK7A 3LY9A 3JQ1A 5ANLA 5EKQD 3D9OA 3FTYA 1UG3A 3FU3A 3BEEA 3VLDA 2Y4TA 3FUHA 1E8ZA 3FUFA 3IBEA 4EBAG 4G23A 3S7JA 4UI9K 3SI5A 1TJFA 1WY6A 2BF0X 3AS8A 1X5BA 3OTNA 4GU5A 4KVOA 5T8IA 2WXOA 3QJZA 3CGHA 4GYOA 4JHRA 3ZHEB 4CGVA 4RVBA 3D9PA 3FUKA 2I1KA 3L17A 3LJ3A 3SF4A 4EZLA 3P2BA 3GZSA 4EZJA 4WAFA 2UWJG 4XI0A 1IYGA 2OV8A 2WXLA 3PNLB 3ZW3A 1ZBPA 4Q96A 4CT4A 1SQMA 2VSOE 4WUYA 4AVXA 3FHEA 3ZIMA 1NA0A 3EDTB 5D0QD 4J8SA 4PS7A 3FTWA 4AEZC 1Z3YA 1H19A 2JLBA 2XPIA 3FUJA 3ZN3A 4IN3B 3Q5MA 1SZ9A 2WXJA 4HOSA 1HZ4A 3MKRA 4M3OA 3ML8A 4AM9A 4CEMA 2KCKA 4QFVA 4V3IA 4IULA 4LCTA 1E8WA 4I2ZA 3LVQE 2PM6A 4B8AA 3FH7A 1HG2A 1GW6A 4GZ5A 5AJDA 3ZFWA 3MV3B 1SZAA 3G2TA 1EPUA 2E2EA 2L6JA 5JHBA 4WNEA 4GA0A 3AS4A 1PY1A 4RG6A 3RU0A 4HXIA 3CVWA 3MGBA 4GMJA 3C98A 2J08A 2V0PA 5T4YA 1E8YA 1HG5A 3CVVA 3G2SA 3PUKA 3PS6A 1EYHA 5AYWD 1NP7A 5ENNA 1UN8A 3U4TA 1N52A 2CFUA 3R9AB 4Y6WA 3EHNA 4RG9A 2C0LA 2FULA 3L16A 5DBKA 3NZSA 2IOSA 5FJYA 3R7RA 2HM8A 1OUVA 1JWGA 2UY1B 4ANWA 1XGWA 2HR2A 3ESLA 4Q69A 5EDSA 2WM9A 4I6JA 2NSZA 3UT4A 3PREA 4F1SA 4URKA 1KT0A 3B7UX 3FUIA 2V8SE 4L2YA 4GZ6A 4UWGA 5CHEE 3B13A 4J8FA 4KVMA 1PC2A 3CVQA 3RRMB 4CDNA 3CVLA 4L2LA 3L54A 2XEVA 3QDNA 4LEUA 3TXMA 4DLOA 5JHAA 3CVYA 2WXFA 4BY6A 2GRLA 2CG2A 2EQXA 3CKCA 3K9IA 4A3VA 3T5VA 3G2WA 2JEKA 2IJGX 5FQ7A 4DLQA 2WQHA 2QFCA 3JYSA 4ILHB 2OOEA 3FH5A 4XZ4A 4B0ZA 2VSYA 3TG5A 4P29A 3SGHA 2WXGA 4UQXA 4APOA 4AJWA 4NACA 4KZCA 5G2NA 2LO6A 2XQ0A 2AXVA 3WXXA 2A4ZA 1A17A 4OYSA 5FZQA 4FU3A 5JJ6A 3BG0B 3RJVA 2XRYA 2MHKA 3PDNA 4BT8A 2KATA 1OWOA 3LKUA 4UI9J 4WNFA 5BUZA 4GA2A 2LSUA 3RRUA 3PNTB 3IKOB 4CGWA 3SBTB 3U66A 4PS3A 2XCCA 2FI7A 2FBNA 3QWWA 3CK9A 4I6EA 5G04C 3PEVB 4GZCA 3QOUA 2VGXB 4XKCA 3HYMB 4R7LA 3ZYMA 3OXLA 4PH4B 4KMOA 1VDYA 4GPKA 3CK8A 4K03A 4G26A 2YQ8A 1KLXA 4CCAA 5ARFA 5ARGA 1XNFA 2LSVA 4BX8A 5BV1A 4UWHA 3CHRA 4O6FA 5J90A 1OWMA 3Q4AB 2X6IA 3QAQA 3ASGA 4J6IA 4EECA 3QK0A 4W9RA 4EQFA 4A55A 1U3DA 3FTXA 1LF8A 2C0MA 3L6AA 3ZYKA 2XRZA 2IOLA 2LAHA 4H7XA 2VYIA 3Q15A 3D9JA 3L08A 2IFUA 1IQRA 2FEZA 2V5FA 3EHMA 4MRUA 5E76A 1MQSA 3JQ0A 4NRHB 4DI3A 3ONLA 1Y6IA 1B89A 5M72A 2C2LA 1TEZA 4JW1A 4UI9C 4GYWA 5FT9A 4HLEA 2VSXE 4ANXA 4XX5A 2XGOA 3L22A 3NZUA 3O48A 4KBQA 3VTYA 2X3MA 2I1JA 3GZ1A 4B8CB 3SNXA 5JJ7A 3SD5A 5A6CA 3CR3A 1S0PA 2LNIA 3GYZA 3I4GA 3Q47B 4FLHA 2CHZA 4BTAA 4F7AA 3TGOA 3B7RL 4DI4A 4A1GA 2XCBA 4I43A 1L5JA 3CVNA 1MHQA 1PAQA 5BNWA 4JEUA 1HH8A 4JPSA 1FVHA 1NA3A 3FTZA 3QC1A 4FLBA 5AENA 4XKBA 4AIFA 4ILIA 3APCA 2X6KA 1U3CA 4BT9A 3UMVA 1ZU2A 2WXNA 4AP2A 4LUNU 2WQ7A 3BG1B 3VTXA 4APFA 4JVSA 2M63A 4UQZA 4BTBA 4GAAA 3MEKA 4WNDA 3KEZA 4FJYA 3ZGQA 1QNFA 4I9EA 3HVEA 3CEQA 3CHPA 4N3BA 4DJAA 1OWLA 2VGYA 3CQCB 1H2TC 3LCAA 2J09A 1ELRA 2XPZA 4N3CA 4GCOA 5A7DB 4DPRA 2VGXA 2VQ2A 4KXKB 4ANUA 3CKBA 4L1BA 1ELWA 3ZPJA 3MV2B 4UWLA 3MCXA 3U9WA 4C0EA 3PH0C 3FU5A 4U0ZA 4G24A 4E6HA 4HFGA 3UT8A 4IYPA 1Z3XA 4NQ0A 4Q94A 3I3NA 5T3RA 2J4BA 4EBAA 3FTUA 4GMLA 3MYVA 4I6GA 3S2AA 4RSYA 1UJJA 4J8DA 3URZA 1EDUA 1H2UA 3RRNB 2BUGA 4WWPA 4MS6A 3CV0A 3G2UA 2VTBB 3ZYQA 4I1OB 3SZ7A 4U63A 4ME2A 2I6HA 5FTPA 3CHSA 3PRZA 4N3AA 4ANVA 5CMWA 4GZ3A 5C1DA 3QWVA 1FCHA 3T5XA 2OVFA 4FULA 3LYAA 3CVUA 3MX3A 4G11A 4WNGA 5FWQA 4ABNA 2RG8A 2UY1A 3OXFA 3TAXA 2AXZA 4KYOB 3UT7A 1E90A 4BX9A 4OVVA 2X6HA 3FDHA 3JUIA 4CRWA 3ZVVA 3AS5A 2VSNA 4L7TA 3ZEFA 3ZXSA 3D9MA 1WM5A 2IU1A 4AV7A 5BT1A 5FQ6A 2WMOA 2J4DA 3P1UA 2AXUA 4N39A 3GZ2A 3QNKA 4JHKA 5E75A 5LOZA 2PM7A 4JEHA 1HE8A 1H2VC 4CDMA 5LX8A 4Y6CA 1HFAA 3LY7A 4GYYA 3FH8A 2L0IA 2P58C 3KAEA 2DCPA 4XE0A 2CG3A 4C0MA 3LY8A 2WXIA 3FULA 1Y8MA 4XIFA 4KZ0A 4B89A 3LDZA 1OWPA 2PL2A 3VLFA 4GZDA 5G55A 2KCLA 4IRUA 2WXHA 2E0IA 4HORA 4YNDA 2DIWA 4PUCA 2AWIA 3ENEA 5FQ8A 1E7UA 3SHFA 2MOWA 1E96B 2WXQA 2KZTB 2KZTA 3PZDA 4JC8A 1DVPA 4PS8A 1KT1A 3CQGB 2RD0A 2L9BA 4ILGA 4N2SA 3B7SA 2XGSA 4U0UA 3ASFA 3UQ3A 2WXRA 2YHEA 4L23A 1HO8A 3VLEA 5LP0A 3UPVA 2FF4A 4I2WA 3MZLB 3UX4A 1HU3A 3FEXA 4MLPA 3FP3A 3RKVA 4E85A 4UQYA 3SBSA 4CT0A 4UWFA 2BTDA 4A1SA 3MKQA 5BV0A 4GA1A 4LERA 4TRQA 3T8MA 4TUUA 1H6KA 3TXNA 3S7FA 4HVBA 3LEWA 3NQPA 3NF1A 4HS2A 1BPOA 1UJKA 3KD7A 3FWVA 3ZHEA 5C2YA 4EPZA 2IQCA 3MKQB 2YNQA 1HF8A 5DIZA 1IQUA 4ACLA 3QARA 3SFZA 2ONDA 3D3MA 3QWPA 2R17C 4K0RA 3U64A 4N2QA 3OXGA 5CCMA 4U04A 3RIBA 4F3VA 2MRIA 5FZSA 4YVQC 2NC9A 3HHMA 2QY7A 3IV0A 1HX8A 5AIJA 1ELKA 4FHJA 4I9CA 3S7DA 4TV3A 2HO1A 1QZ2A 2IF4A 3FTSA 2PQRA 2PZIA 1N54A 3EIJA 2AVPA 4AXHA 4JA9A 3HVEB 5G04J 4N5CA 5J08A 3APDA 4BWRA 4FA6A 2AW6A 3FY4A 2GGFA 5LFAA 3B7TA 3MA5A 2PQNA 3QB2A 3N71A 4G1TA 3GW4A 4UWKA 2CFZA 5BPPA 1INZA 2J07A 4XI9A 5FZRA 3AU5A 3PVLA 3FU0A 3I4RB 3D9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U64 A;  4DI3 A;  4DI4 A; 
#chains in the Genus database with same CATH topology
 1UW4 B;  4EZK A;  4HOU A;  3Q79 A;  4DUI A;  3CHO A;  2F8X K;  3CVP A;  4I1A A;  3FUN A;  3Q49 B;  3EU9 A;  2AJA A;  4HOT A;  1NI1 A;  5KCM A;  4U96 D;  4JHJ A;  1MX2 A;  5EX3 A;  2KM4 A;  2XGM A;  3PEU B;  3ABK E;  2H6G A;  2Y4U A;  4FP7 A;  1YCS B;  3UIP C;  2P9K G;  3SFY A;  1LTX A;  5KJM A;  1HXI A;  2WQ6 A;  1OWN A;  2GW1 A;  1O1R A;  1S63 A;  1FT2 A;  3FTV A;  1WG0 A;  5LCW C;  3ESK A;  2LAI A;  3FEY A;  2KC7 A;  3LVR E;  4H7Y A;  4GTS A;  2EIN E;  2WMN A;  4F53 A;  4C9B B;  4DX5 D;  3ML9 A;  3B95 A;  2L0T B;  2OVB A;  3I5P A;  5D0O D;  2A5U A;  4LNU D;  4DK5 A;  2NXP A;  3HXB A;  5B1A E;  2BKG A;  3HDX A;  3DXK G;  3CLJ A;  3D9N A;  5ANL A;  3D9O A;  2F37 A;  3BEE A;  3VLD A;  4EBA G;  3SI5 A;  3OTN A;  3AS8 A;  4GU5 A;  2WXO A;  5B1B E;  3QJZ A;  3CGH A;  4GYO A;  3ZHE B;  3C5R A;  4CGV A;  3LJ3 A;  3SF4 A;  3GZS A;  4EZJ A;  4WAF A;  2UWJ G;  2OV8 A;  3PNL B;  2QYU A;  1SQM A;  2VSO E;  1NA0 A;  3EDT B;  4F6R D;  3FUJ A;  5HS0 A;  3MKR A;  4GTP A;  2KCK A;  4IUL A;  1E8W A;  4YDY A;  1SZA A;  2L6J A;  4WNE A;  4HXI A;  3MGB A;  3C98 A;  2V0P A;  3CVV A;  5EID A;  5JMN D;  5AYW D;  1UN8 A;  5EIL A;  3HG0 D;  2C0L A;  5DBK A;  2DZO A;  3R7R A;  1OUV A;  3UT4 A;  1KT0 A;  3FUI A;  2V8S E;  4GZ6 A;  3DSX A;  4KVM A;  3CVL A;  3LJN A;  4LEU A;  3TXM A;  3QDN A;  3EHQ A;  3CVY A;  3T5V A;  3G2W A;  2JEK A;  2IJG X;  3JYS A;  3FH5 A;  1TN8 A;  2VSY A;  4P29 A;  4KZC A;  2LO6 A;  3WXX A;  4FU3 A;  3PDN A;  3LKU A;  1OWO A;  3PNT B;  3TWU A;  2XCC A;  3PZ1 A;  4O60 A;  4KMO A;  4GPK A;  4G26 A;  5ARF A;  2Y69 E;  3JUE A;  5BV1 A;  4A55 A;  2B0O E;  2H6I A;  3L6A A;  1LF8 A;  2C0M A;  1S70 B;  2IOL A;  4H7X A;  3Q15 A;  2FEZ A;  1MQS A;  4GTR A;  1B89 A;  1N95 A;  2C2L A;  4TXQ A;  1TEZ A;  4GYW A;  3L22 A;  3NZU A;  5ENP D;  1RZ4 A;  5ENQ D;  4LSZ E;  4B8C B;  5JJ7 A;  1N4R A;  3GYZ A;  3I4G A;  5KBA A;  4BTA A;  3UM1 A;  2IEJ A;  1MHQ A;  5BNW A;  1OCC E;  4JPS A;  1FVH A;  1NA3 A;  3APC A;  2X6K A;  3PZ4 A;  4BT9 A;  2QZA A;  2QYJ A;  3BG1 B;  2H6H A;  3MEK A;  3KEZ A;  4FJY A;  2RFA A;  4I9E A;  2F8Y A;  3V31 A;  3CHP A;  2VGY A;  3DEP A;  3Q78 A;  3BUA A;  2J09 A;  2XPZ A;  4JB8 P;  3IXE A;  4ANU A;  2VQ2 A;  4L1B A;  1ELW A;  4U0Z A;  4CYM D;  3UT8 A;  4BER A;  5T3R A;  4EBA A;  3MYV A;  4RSY A;  2BUG A;  5KWD A;  2L6B A;  4I1O B;  4U63 A;  3HRA A;  3ZUV B;  4ANV A;  5CMW A;  4GZ3 A;  2IO2 C;  4WNG A;  4ABN A;  5FWQ A;  2AXZ A;  4KYO B;  4BX9 A;  1D8E A;  3FDH A;  3ZEF A;  3ZXS A;  3D9M A;  1WM5 A;  5BT1 A;  4M7C A;  2J4D A;  2AXU A;  1DC2 A;  3GZ2 A;  4JHK A;  3WG7 E;  4Y6C A;  2CG3 A;  1Y8M A;  3LDZ A;  3VLF A;  4BET A;  2E0I A;  2H6F A;  4YND A;  3SHF A;  1E7U A;  1E96 B;  4JC8 A;  2YHE A;  4L23 A;  1HO8 A;  4X8Q A;  4UQY A;  3SBS A;  1KPS B;  3E30 A;  4GPM A;  4LER A;  4TRQ A;  3T8M A;  4TUU A;  1H6K A;  3TXN A;  3ZXP A;  1V55 E;  1N4Q A;  4HVB A;  3DSS A;  5EIB E;  1TNO A;  3ZHE A;  2IQC A;  4ACL A;  1HF8 A;  1IQU A;  3TWX A;  1TN6 A;  2OND A;  3D3M A;  3QWP A;  4N2Q A;  1BI8 B;  4F3V A;  2MRI A;  1HX8 A;  1QZ2 A;  1OT8 A;  3EIJ A;  2AVP A;  2ETA A;  2RFM A;  5J08 A;  3FY4 A;  4Z68 A;  3B7T A;  3QB2 A;  4G1T A;  4TXP A;  2BKK B;  5FZR A;  3PVL A;  3FU0 A;  3W9F A;  5A23 A;  3DPD A;  4YVO A;  4DX6 D;  1JCQ A;  4U0S A;  2R59 A;  1YYH A;  4JA7 A;  4FAD A;  2ZU6 B;  1E8X A;  5CCL A;  1JCR A;  4I1M A;  2WXM A;  3RO3 A;  4HBD A;  3G2V A;  3RAU A;  3ASH A;  4HI8 A;  4HOQ A;  5KJN A;  2YIN A;  3O4Z A;  2CHX A;  4ATG A;  5FQ4 A;  3CSF A;  2ILR A;  4BFR A;  3TJP A;  3CIA A;  3RO2 A;  1NZN A;  1UN9 A;  2P2C P;  2J9Q A;  5EX0 A;  4UUC A;  2X6F A;  3DRA A;  2X38 A;  2XHE A;  3Q9U C;  2P9P G;  4FJZ A;  4OVU A;  2VGE A;  3CST A;  3NAW A;  5CEC B;  3CHQ A;  3ONK A;  2HYZ A;  4FHK A;  2ION A;  2WB2 A;  3LXU X;  1IXV A;  5JJT A;  4NIK A;  5CMY A;  2R05 A;  1N11 A;  3UM2 A;  4YDO A;  3IBE A;  4G23 A;  3ABM E;  1TJF A;  1WY6 A;  1X5B A;  3ZKJ A;  2XS8 A;  4BEP A;  4LNG A;  4RVB A;  3FUK A;  3L17 A;  2PNN A;  3P2B A;  1IYG A;  2WXL A;  2GRQ B;  2P9I G;  3SO8 A;  3FHE A;  1OCO E;  3E32 A;  5CRV A;  5D0Q D;  4J8S A;  1KZP A;  2XPI A;  3ZN3 A;  4IN3 B;  3Q5M A;  3UKR G;  4HOS A;  4AM9 A;  3DWL G;  4M3O A;  4CEM A;  4V3I A;  4LCT A;  3AG3 E;  4I2Z A;  3LVQ E;  2PM6 A;  5HKP A;  3FH7 A;  3W9G A;  4GZ5 A;  4XEI G;  2BED A;  3J5Q B;  5JHB A;  4GA0 A;  2XEE A;  1PY1 A;  3RU0 A;  5T4Y A;  1E8Y A;  1HG5 A;  4GMR A;  1EYH A;  5ENN A;  3KSQ A;  3R9A B;  3EHN A;  4RG9 A;  2FUL A;  2GRN B;  3V30 A;  2DYS E;  2UY1 B;  4ANW A;  3ESL A;  2HR2 A;  4I6J A;  2NSZ A;  2P9N G;  5CHE E;  4DRX E;  3SY2 A;  3B13 A;  4J8F A;  2GRP B;  5JHA A;  4DLO A;  2EQX A;  2ZIS A;  3JXJ A;  4DLQ A;  2QFC A;  4XZ4 A;  4B0Z A;  3TG5 A;  3R9M A;  3SGH A;  2WXG A;  4UQX A;  3RSE G;  4AJW A;  4DX1 A;  2XQ0 A;  2A4Z A;  4OYS A;  4UI9 J;  1H6P A;  3SBT B;  4I6E A;  2FI7 A;  2VGX B;  4R7L A;  3ZYM A;  4PH4 B;  3CK8 A;  3AG4 E;  4CCA A;  1KLX A;  1G3N B;  1UOH A;  3AJI A;  4O6F A;  5J90 A;  1OWM A;  2X6I A;  3QAQ A;  1DCE A;  4W9R A;  3FTX A;  3AG2 E;  2XRZ A;  3D9J A;  2V4H C;  2IFU A;  3UM0 A;  2FO1 E;  4ANX A;  3O48 A;  4KBQ A;  5CBO A;  3SD5 A;  1S0P A;  2LNI A;  5ENO D;  3X2Q E;  4DI4 A;  2XCB A;  1L5J A;  3CVN A;  5KJL A;  4JEU A;  1HH8 A;  3QC1 A;  5AEN A;  4XKB A;  1U3C A;  2WQ7 A;  5FIN A;  3VTX A;  2M63 A;  4UQZ A;  1OXJ A;  5IY5 E;  4HNA D;  4GAA A;  4TUM A;  3ZGQ A;  1WDY A;  1MX6 A;  4DJA A;  2ETC A;  1H2T C;  1ELR A;  5A7D B;  3BU8 A;  4KXK B;  3CKB A;  4UWL A;  3U9W A;  3MCX A;  3PH0 C;  2ZXW E;  4G24 A;  4HFG A;  4IYP A;  4Q94 A;  3I3N A;  3C3O A;  3S2A A;  1UJJ A;  1H6O A;  1H2U A;  3RRN B;  5BXU A;  3G2U A;  2LXM A;  4ME2 A;  3CHS A;  3PRZ A;  3DST A;  5C1D A;  3CVU A;  3DEO A;  3SQV A;  3TAX A;  1E90 A;  4AV7 A;  1QYM A;  1TNB A;  2WMO A;  4U8V D;  3TWS A;  4N39 A;  3ZNG A;  5E75 A;  2RKK A;  1H2V C;  4CDM A;  1HFA A;  3LY7 A;  4GYY A;  3FH8 A;  2L0I A;  3FUL A;  4HRL A;  3ABL E;  3HXF A;  4XIF A;  1BU9 A;  4B89 A;  5G55 A;  4HOR A;  2DVW A;  4PUC A;  2MOW A;  4PS8 A;  1KT1 A;  2RD0 A;  3B7S A;  3UIO C;  4TXR A;  3UQ3 A;  1SVX A;  2FF4 A;  1O1T A;  4I2W A;  3UX4 A;  1HU3 A;  1K8K G;  2BTD A;  5CER B;  1X81 A;  1N0Q A;  3S7F A;  1BPO A;  1UJK A;  1MX4 A;  3FWV A;  4RQI A;  4EPZ A;  3QAR A;  3ULE G;  3OXG A;  4U04 A;  2NYJ A;  5AIJ A;  4L9P A;  2HO1 A;  5G04 J;  4BWR A;  3AAA C;  5LFA A;  5CRU A;  2PQN A;  3N71 A;  1INZ A;  3AU5 A;  2A5E A;  3I4R B;  4CZ2 D;  4EHM A;  4D10 C;  2EIL E;  3IEG A;  4JXT A;  1E7V A;  3EJN A;  3T9K A;  4J0U A;  1TNZ A;  4WWO A;  3D9K A;  2XEH A;  3PE4 A;  1Z6T A;  5LCW J;  5G05 J;  2I2O A;  5HI7 A;  4ZHB A;  4JL0 A;  4K5C A;  3TL5 A;  3RK6 A;  2X6J A;  3FU6 A;  2CHW A;  2WVI A;  1QQE A;  4AY5 A;  4AY6 A;  3L9T A;  3TG4 A;  4U07 A;  1BI7 B;  1MZC A;  3S7B A;  2DBA A;  3L13 A;  3MJW A;  4I17 A;  5CEA A;  1JUQ A;  3QKY A;  4K5A B;  3ZRH A;  2WXP A;  3FUM A;  5HQ8 A;  4MKT A;  1P5Q A;  1WAO 1;  4KT6 B;  2WPV A;  5AQ7 A;  4G25 A;  2YHC A;  3ULQ A;  4B94 A;  1JPL A;  1IHG A;  1YA0 A;  1JWF A;  1EF1 C;  4LRZ A;  2J49 A;  3R7Q A;  2P9L G;  3CHM A;  4ATZ D;  3EIQ C;  4BSX A;  2Q7F A;  4FC8 A;  3ASD A;  3KS2 A;  3E4B A;  3PE3 A;  1DNP A;  3IHY A;  2IO3 C;  4J8E A;  2VJ8 A;  4GB9 A;  3APF A;  3UUX A;  1N0R A;  3KEA A;  1H0A A;  4JZY A;  3TWR A;  3ZYL A;  5AAR A;  3LY9 A;  3JQ1 A;  1UG3 A;  3FUH A;  2P9U G;  1E8Z A;  3FUF A;  3S7J A;  4UI9 K;  2XZD G;  2BF0 X;  5T8I A;  3E33 A;  4JHR A;  2I1K A;  1BD8 A;  4EZL A;  3E34 A;  1ZBP A;  4JD2 G;  4Q96 A;  5HRY A;  3DSU A;  4AVX A;  3ZIM A;  4QQI A;  4PS7 A;  3FTW A;  4AEZ C;  1SZ9 A;  1HZ4 A;  3ML8 A;  5BXO A;  4QFV A;  3Q7F A;  1GW6 A;  3MV3 B;  1EPU A;  2E2E A;  3AS4 A;  4RG6 A;  3CVW A;  2J08 A;  2JAB A;  1TN7 A;  1SA4 A;  3PS6 A;  1NP7 A;  2XZT G;  3U4T A;  1N52 A;  4Y6W A;  2IOS A;  2ZGD A;  3DSW A;  2HM8 A;  4O1O A;  2WM9 A;  4B93 B;  3PRE A;  3CVQ A;  3RRM B;  4L2L A;  3L54 A;  2XEV A;  3BQO A;  4GTM A;  3T8K A;  2WXF A;  2GRL A;  2CG2 A;  3CKC A;  4A3V A;  3ULY A;  5FQ7 A;  2WQH A;  4BES A;  4NAC A;  5G2N A;  1A17 A;  5FZQ A;  5JJ6 A;  3BG0 B;  2XRY A;  4BT8 A;  1OY3 D;  2KAT A;  5BUZ A;  4CGW A;  5CBN A;  3QWW A;  3CK9 A;  4GZC A;  4XKC A;  3UM3 A;  2YQ8 A;  1K3Z D;  3ISM C;  2LSV A;  4BX8 A;  4UWH A;  2ZIR A;  2EIK E;  3ASG A;  3ZYK A;  2LAH A;  2QC9 A;  3L08 A;  3B7B A;  4MRU A;  2V5F A;  3EHM A;  3JQ0 A;  4DI3 A;  1Y6I A;  2F0Y A;  5M72 A;  1S64 A;  4JW1 A;  5FT9 A;  4HLE A;  2VSX E;  2XGO A;  2OCC E;  1NFI E;  2X3M A;  2I1J A;  3GZ1 A;  3CR3 A;  1AP7 A;  4A1G A;  4I43 A;  3V79 K;  5D2M C;  2IY0 C;  1PAQ A;  4FLB A;  5AQ9 A;  1YMP A;  4ILI A;  3UMV A;  2WXN A;  4LG6 A;  4U8Y D;  4APF A;  4JVS A;  1TNY A;  1D8D A;  4DX2 A;  2OEV A;  1A5E A;  3HVE A;  1LD7 A;  3NB2 A;  2R2L A;  3LCA A;  4N3C A;  4DPR A;  2VGX A;  1O1S A;  3DXM G;  4C0E A;  3UTM A;  3FU5 A;  4E6H A;  4HRM B;  3V2O A;  5CED B;  2J4B A;  3FTU A;  4GML A;  4J8D A;  1EDU A;  3SFX A;  3CV0 A;  2VTB B;  3ZYQ A;  3TWW A;  2I6H A;  4N3A A;  4FUL A;  3LYA A;  4G11 A;  1SA5 A;  2RG8 A;  3OXF A;  4OVV A;  3C3Q A;  2X6H A;  4CRW A;  3ZVV A;  4L7T A;  5D66 A;  3Q75 A;  2IU1 A;  5FQ6 A;  1MYO A;  3QNK A;  5LOZ A;  2PM7 A;  5LX8 A;  5KNG A;  3NBN B;  1V54 E;  4XE0 A;  4C0M A;  1BLX B;  2WXI A;  4KZ0 A;  1OWP A;  1RW2 A;  4IRU A;  1OCZ E;  2AWI A;  5KNH D;  2KZT B;  2KZT A;  3PZD A;  4ILG A;  2WXR A;  3VLE A;  3MZL B;  3FEX A;  3RKV A;  4E85 A;  4A1S A;  5BV0 A;  3Q7A A;  3LEW A;  3NQP A;  4HS2 A;  3UXG A;  2EIM E;  3MKQ B;  2YNQ A;  4DX7 D;  1K1A A;  3SFZ A;  4HLL A;  3Q73 A;  3U64 A;  4K0R A;  1DCQ A;  3RIB A;  4YVQ C;  5B3S E;  3HHM A;  2QY7 A;  3IV0 A;  3DPY A;  2Y1L E;  2KXP C;  3D9H A;  3ASN E;  2IF4 A;  1TR4 A;  2PQR A;  2PZI A;  1AWC B;  4AXH A;  4JA9 A;  3HVE B;  4N5C A;  3MA5 A;  2XEN A;  3GW4 A;  5BPP A;  3EU5 A;  4XI9 A;  4K5B A;  3U3W A;  1O5M A;  2Y3A A;  2FO7 A;  4RLY A;  5G05 C;  3LPZ A;  1W3B A;  1TJC A;  2WXK A;  3D9I A;  3CVX A;  2I9C A;  3OAW A;  2VTB A;  4CDR A;  1N94 A;  5AN8 A;  1K1B A;  4AOF A;  5ANR A;  4WWN A;  2KBX A;  5ENR D;  4A3T A;  2DYR E;  5EYL A;  4BSZ B;  3IHV A;  4N5Q A;  3FUE A;  2KCV A;  4HQD A;  3JCK C;  2GRM A;  3DBS A;  2R5S A;  4OAV B;  5KJK A;  3F6Q A;  3FFL A;  4G8L A;  5ENT D;  2EIJ E;  4PDX A;  5AJL A;  3NOC D;  2XPY A;  4F1P A;  3LS8 A;  3HIZ A;  1IHB A;  4GCN A;  2LUH A;  3FUD A;  1FVF A;  2R02 A;  5EN5 D;  4ACK A;  3UIN C;  1HS6 A;  1KZO A;  1Q2Z A;  5BW8 C;  4G2V A;  3PUJ A;  4U8H A;  3AU4 A;  5AQA A;  4NUR A;  1QBQ A;  2V4L A;  3CK7 A;  5EKQ D;  3FTY A;  3FU3 A;  4GTQ A;  2Y4T A;  3EHR A;  4KVO A;  1U2V G;  3D9P A;  2HE0 A;  4XI0 A;  3ZW3 A;  5ITZ F;  3ASO E;  3DSV A;  4CT4 A;  1TNU A;  2DZN A;  4WUY A;  4MBG A;  1Z3Y A;  1H19 A;  2JLB A;  3TWV A;  2WXJ A;  4YDW A;  2ZGG A;  3V2X A;  2MYO A;  2ETB A;  4YDE A;  4B8A A;  1HG2 A;  5AJD A;  5H7P A;  3ZFW A;  3G2T A;  2GRR B;  3UKU G;  3C3R A;  4G8K A;  3UI2 A;  4GMJ A;  1ZB1 A;  2GRO B;  3G2S A;  3PUK A;  5JA4 D;  2CFU A;  4A63 B;  3L16 A;  3NZS A;  5FJY A;  4HI9 A;  1JWG A;  4Q69 A;  1XGW A;  5EDS A;  4URK A;  4F1S A;  4L2Y A;  3B7U X;  4UWG A;  1PC2 A;  3ZU7 B;  4CDN A;  1SW6 A;  2OEW A;  2B6C A;  4BY6 A;  3K9I A;  4ILH B;  2OOE A;  4APO A;  2AXV A;  3RJV A;  4GTV A;  2MHK A;  4WNF A;  4GA2 A;  2LSU A;  3RRU A;  3U66 A;  3IKO B;  5ENS D;  4PS3 A;  5G04 C;  2FBN A;  3PEV B;  3QOU A;  3J5P A;  3PZ2 A;  3HYM B;  3OXL A;  1VDY A;  4K03 A;  3EUV A;  2R03 A;  5ARG A;  1XNF A;  3CHR A;  3KSL A;  3Q4A B;  4J6I A;  4EEC A;  3QK0 A;  4EQF A;  1U3D A;  2VYI A;  1IQR A;  1NL4 A;  5EYP F;  5E76 A;  4NRH B;  3ONL A;  3TWT A;  5AAO A;  4UI9 C;  4XX5 A;  3Q9N C;  3VTY A;  1MJ0 A;  2XS1 A;  3SNX A;  4O1P A;  2DWZ A;  1N9A A;  5A6C A;  3Q47 B;  4FLH A;  2CHZ A;  4F7A A;  3B7R L;  1D9S A;  3FTZ A;  1TYQ G;  5AQB A;  4AIF A;  1JCS A;  1ZU2 A;  4AP2 A;  4LUN U;  4BTB A;  4C48 B;  4WND A;  4HB5 A;  3NOG D;  1N4P A;  1QNF A;  2LXL A;  3CEQ A;  4N3B A;  1OWL A;  3CQC B;  4GCO A;  3TWQ A;  3ZPJ A;  3MV2 B;  4U7E B;  1Z3X A;  4NQ0 A;  2V5Q C;  4I6G A;  2J8S D;  3URZ A;  4WWP A;  4MS6 A;  3SZ7 A;  4HRN A;  5FTP A;  3QWV A;  1FCH A;  3T5X A;  2OVF A;  3MX3 A;  2Y0B G;  2UY1 A;  3UT7 A;  3JUI A;  3AS5 A;  2VSN A;  4U95 D;  3HXD A;  3P1U A;  4J7W A;  4JEH A;  1HE8 A;  2P58 C;  3KAE A;  2DCP A;  3LY8 A;  3C72 A;  2PL2 A;  4GZD A;  2KCL A;  2P9S G;  2WXH A;  2DIW A;  3ENE A;  5FQ8 A;  2WXQ A;  4GTT A;  1DVP A;  4GTO A;  3CQG B;  1FT1 A;  2L9B A;  4N2S A;  2XGS A;  4U0U A;  3ASF A;  5LP0 A;  3UPV A;  4MLP A;  1Z5S C;  3FP3 A;  3JXI A;  4CT0 A;  4UWF A;  3MKQ A;  4GA1 A;  3HXE A;  3PZ3 A;  3NF1 A;  4J8Y A;  1IKN D;  3KD7 A;  5C2Y A;  5DIZ A;  3HXC A;  2R17 C;  3AG1 E;  5CCM A;  5FZS A;  2NC9 A;  1ELK A;  1LD8 A;  4FHJ A;  4I9C A;  3S7D A;  4TV3 A;  1FPP A;  3FTS A;  1N54 A;  5FIO A;  3E37 A;  3APD A;  4FA6 A;  2AW6 A;  2GGF A;  4LNB A;  1OCR E;  4ZFH A;  4OAU C;  4UWK A;  1N4S A;  2CFZ A;  2J07 A;  3L82 A;  3TGO A;  3D9L A; 
#chains in the Genus database with same CATH homology
 3IEG A;  4JXT A;  5A23 A;  1E7V A;  5BW8 C;  3U3W A;  3EJN A;  4J0U A;  4WWO A;  2Y3A A;  2FO7 A;  3D9K A;  5G05 C;  1UW4 B;  3DPD A;  3PE4 A;  4YVO A;  4EZK A;  4HOU A;  4U0S A;  2R59 A;  1Z6T A;  3LPZ A;  3CHO A;  5G05 J;  5LCW J;  1W3B A;  2I2O A;  3CVP A;  4I1A A;  4JA7 A;  5HI7 A;  1TJC A;  3FUN A;  4FAD A;  3Q49 B;  4JL0 A;  2WXK A;  3D9I A;  3CVX A;  2ZU6 B;  1E8X A;  4HOT A;  2I9C A;  3OAW A;  3RK6 A;  3TL5 A;  5KCM A;  2X6J A;  3FU6 A;  4CDR A;  5CCL A;  2VTB A;  4JHJ A;  2CHW A;  2WVI A;  1QQE A;  4I1M A;  4AY5 A;  5EX3 A;  2KM4 A;  2XGM A;  3PEU B;  2WXM A;  3RO3 A;  4AY6 A;  3TG4 A;  4AOF A;  4U07 A;  3G2V A;  5ANR A;  2Y4U A;  4WWN A;  4A3T A;  3ASH A;  4FP7 A;  4HOQ A;  3S7B A;  5KJN A;  2YIN A;  2DBA A;  3L13 A;  3MJW A;  3O4Z A;  4I17 A;  3IHV A;  5KJM A;  1HXI A;  2WQ6 A;  1JUQ A;  2CHX A;  3FUE A;  3QKY A;  3ZRH A;  2WXP A;  4ATG A;  3FUM A;  5FQ4 A;  1OWN A;  2GW1 A;  5HQ8 A;  2KCV A;  3JCK C;  2GRM A;  3DBS A;  3CSF A;  2R5S A;  2ILR A;  4BFR A;  5KJK A;  4MKT A;  1P5Q A;  1WAO 1;  3TJP A;  3CIA A;  3RO2 A;  4KT6 B;  1NZN A;  3FFL A;  2WPV A;  1UN9 A;  3FTV A;  2J9Q A;  5EX0 A;  4G25 A;  4PDX A;  3ESK A;  5LCW C;  2YHC A;  5AJL A;  3ULQ A;  4B94 A;  1JPL A;  2X6F A;  1IHG A;  2XPY A;  1YA0 A;  2X38 A;  1JWF A;  1EF1 C;  2XHE A;  2LAI A;  4LRZ A;  3LS8 A;  2J49 A;  3FEY A;  3HIZ A;  2KC7 A;  3LVR E;  3R7Q A;  4FJZ A;  4GCN A;  4OVU A;  3CST A;  3CHM A;  3FUD A;  4H7Y A;  3EIQ C;  1FVF A;  4BSX A;  3CHQ A;  4ACK A;  2WMN A;  3ONK A;  4F53 A;  2Q7F A;  4C9B B;  4FC8 A;  3ML9 A;  2HYZ A;  3ASD A;  1HS6 A;  3E4B A;  3KS2 A;  2L0T B;  2OVB A;  3PE3 A;  3PUJ A;  1DNP A;  4G2V A;  4U8H A;  3AU4 A;  3I5P A;  3IHY A;  4D10 C;  5KJL A;  4J8E A;  2A5U A;  2VJ8 A;  4FHK A;  2ION A;  4GB9 A;  2NXP A;  5D0O D;  4DK5 A;  3APF A;  3UUX A;  2WB2 A;  4NUR A;  1H0A A;  3LXU X;  3HDX A;  5JJT A;  3CLJ A;  3D9N A;  4JZY A;  3ZYL A;  5CMY A;  2V4L A;  3CK7 A;  3LY9 A;  3JQ1 A;  5ANL A;  5EKQ D;  3D9O A;  3FTY A;  1UG3 A;  3FU3 A;  3BEE A;  3VLD A;  2Y4T A;  3FUH A;  1E8Z A;  3FUF A;  3IBE A;  4EBA G;  4G23 A;  3S7J A;  4UI9 K;  3SI5 A;  1TJF A;  1WY6 A;  2BF0 X;  3AS8 A;  1X5B A;  3OTN A;  4GU5 A;  4KVO A;  5T8I A;  2WXO A;  3QJZ A;  3CGH A;  4GYO A;  4JHR A;  3ZHE B;  4CGV A;  4RVB A;  3D9P A;  3FUK A;  2I1K A;  3L17 A;  3LJ3 A;  3SF4 A;  4EZL A;  3P2B A;  3GZS A;  4EZJ A;  4WAF A;  2UWJ G;  4XI0 A;  1IYG A;  2OV8 A;  2WXL A;  3PNL B;  3ZW3 A;  1ZBP A;  4Q96 A;  4CT4 A;  1SQM A;  2VSO E;  4WUY A;  4AVX A;  3FHE A;  3ZIM A;  1NA0 A;  3EDT B;  5D0Q D;  4J8S A;  4PS7 A;  3FTW A;  4AEZ C;  1Z3Y A;  1H19 A;  2JLB A;  2XPI A;  3FUJ A;  3ZN3 A;  4IN3 B;  3Q5M A;  1SZ9 A;  2WXJ A;  4HOS A;  1HZ4 A;  3MKR A;  4M3O A;  3ML8 A;  4AM9 A;  4CEM A;  2KCK A;  4QFV A;  4V3I A;  4IUL A;  4LCT A;  1E8W A;  4I2Z A;  3LVQ E;  2PM6 A;  4B8A A;  3FH7 A;  1HG2 A;  1GW6 A;  4GZ5 A;  5AJD A;  3ZFW A;  3MV3 B;  1SZA A;  3G2T A;  1EPU A;  2E2E A;  2L6J A;  5JHB A;  4WNE A;  4GA0 A;  3AS4 A;  1PY1 A;  4RG6 A;  3RU0 A;  4HXI A;  3CVW A;  3MGB A;  4GMJ A;  3C98 A;  2J08 A;  2V0P A;  5T4Y A;  1E8Y A;  1HG5 A;  3CVV A;  3G2S A;  3PUK A;  3PS6 A;  1EYH A;  5AYW D;  1NP7 A;  5ENN A;  1UN8 A;  3U4T A;  1N52 A;  2CFU A;  3R9A B;  4Y6W A;  3EHN A;  4RG9 A;  2C0L A;  2FUL A;  3L16 A;  5DBK A;  3NZS A;  2IOS A;  5FJY A;  3R7R A;  2HM8 A;  1OUV A;  1JWG A;  2UY1 B;  4ANW A;  1XGW A;  2HR2 A;  3ESL A;  4Q69 A;  5EDS A;  2WM9 A;  4I6J A;  2NSZ A;  3UT4 A;  3PRE A;  4F1S A;  4URK A;  1KT0 A;  3B7U X;  3FUI A;  2V8S E;  4L2Y A;  4GZ6 A;  4UWG A;  5CHE E;  3B13 A;  4J8F A;  4KVM A;  1PC2 A;  3CVQ A;  3RRM B;  4CDN A;  3CVL A;  4L2L A;  3L54 A;  2XEV A;  3QDN A;  4LEU A;  3TXM A;  4DLO A;  5JHA A;  3CVY A;  2WXF A;  4BY6 A;  2GRL A;  2CG2 A;  2EQX A;  3CKC A;  3K9I A;  4A3V A;  3T5V A;  3G2W A;  2JEK A;  2IJG X;  5FQ7 A;  4DLQ A;  2WQH A;  2QFC A;  3JYS A;  4ILH B;  2OOE A;  3FH5 A;  4XZ4 A;  4B0Z A;  2VSY A;  3TG5 A;  4P29 A;  3SGH A;  2WXG A;  4UQX A;  4APO A;  4AJW A;  4NAC A;  4KZC A;  5G2N A;  2LO6 A;  2XQ0 A;  2AXV A;  3WXX A;  2A4Z A;  1A17 A;  4OYS A;  5FZQ A;  4FU3 A;  5JJ6 A;  3BG0 B;  3RJV A;  2XRY A;  2MHK A;  3PDN A;  4BT8 A;  2KAT A;  1OWO A;  3LKU A;  4UI9 J;  4WNF A;  5BUZ A;  4GA2 A;  2LSU A;  3RRU A;  3PNT B;  3IKO B;  4CGW A;  3SBT B;  3U66 A;  4PS3 A;  2XCC A;  2FI7 A;  2FBN A;  3QWW A;  3CK9 A;  4I6E A;  5G04 C;  3PEV B;  4GZC A;  3QOU A;  2VGX B;  4XKC A;  3HYM B;  4R7L A;  3ZYM A;  3OXL A;  4PH4 B;  4KMO A;  1VDY A;  4GPK A;  3CK8 A;  4K03 A;  4G26 A;  2YQ8 A;  1KLX A;  4CCA A;  5ARF A;  5ARG A;  1XNF A;  2LSV A;  4BX8 A;  5BV1 A;  4UWH A;  3CHR A;  4O6F A;  5J90 A;  1OWM A;  3Q4A B;  2X6I A;  3QAQ A;  3ASG A;  4J6I A;  4EEC A;  3QK0 A;  4W9R A;  4EQF A;  4A55 A;  1U3D A;  3FTX A;  1LF8 A;  2C0M A;  3L6A A;  3ZYK A;  2XRZ A;  2IOL A;  2LAH A;  4H7X A;  2VYI A;  3Q15 A;  3D9J A;  3L08 A;  2IFU A;  1IQR A;  2FEZ A;  2V5F A;  3EHM A;  4MRU A;  5E76 A;  1MQS A;  3JQ0 A;  4NRH B;  4DI3 A;  3ONL A;  1Y6I A;  1B89 A;  5M72 A;  2C2L A;  1TEZ A;  4JW1 A;  4UI9 C;  4GYW A;  5FT9 A;  4HLE A;  2VSX E;  4ANX A;  4XX5 A;  2XGO A;  3L22 A;  3NZU A;  3O48 A;  4KBQ A;  3VTY A;  2X3M A;  2I1J A;  3GZ1 A;  4B8C B;  3SNX A;  5JJ7 A;  3SD5 A;  5A6C A;  3CR3 A;  1S0P A;  2LNI A;  3GYZ A;  3I4G A;  3Q47 B;  4FLH A;  2CHZ A;  4BTA A;  4F7A A;  3TGO A;  3B7R L;  4DI4 A;  4A1G A;  2XCB A;  4I43 A;  1L5J A;  3CVN A;  1MHQ A;  1PAQ A;  5BNW A;  4JEU A;  1HH8 A;  4JPS A;  1FVH A;  1NA3 A;  3FTZ A;  3QC1 A;  4FLB A;  5AEN A;  4XKB A;  4AIF A;  4ILI A;  3APC A;  2X6K A;  1U3C A;  4BT9 A;  3UMV A;  1ZU2 A;  2WXN A;  4AP2 A;  4LUN U;  2WQ7 A;  3BG1 B;  3VTX A;  4APF A;  4JVS A;  2M63 A;  4UQZ A;  4BTB A;  4GAA A;  3MEK A;  4WND A;  3KEZ A;  4FJY A;  3ZGQ A;  1QNF A;  4I9E A;  3HVE A;  3CEQ A;  3CHP A;  4N3B A;  4DJA A;  1OWL A;  2VGY A;  3CQC B;  1H2T C;  3LCA A;  2J09 A;  1ELR A;  2XPZ A;  4N3C A;  4GCO A;  5A7D B;  4DPR A;  2VGX A;  2VQ2 A;  4KXK B;  4ANU A;  3CKB A;  4L1B A;  1ELW A;  3ZPJ A;  3MV2 B;  4UWL A;  3MCX A;  3U9W A;  4C0E A;  3PH0 C;  3FU5 A;  4U0Z A;  4G24 A;  4E6H A;  4HFG A;  3UT8 A;  4IYP A;  1Z3X A;  4NQ0 A;  4Q94 A;  3I3N A;  5T3R A;  2J4B A;  4EBA A;  3FTU A;  4GML A;  3MYV A;  4I6G A;  3S2A A;  4RSY A;  1UJJ A;  4J8D A;  3URZ A;  1EDU A;  1H2U A;  3RRN B;  2BUG A;  4WWP A;  4MS6 A;  3CV0 A;  3G2U A;  2VTB B;  3ZYQ A;  4I1O B;  3SZ7 A;  4U63 A;  4ME2 A;  2I6H A;  5FTP A;  3CHS A;  3PRZ A;  4N3A A;  4ANV A;  5CMW A;  4GZ3 A;  5C1D A;  3QWV A;  1FCH A;  3T5X A;  2OVF A;  4FUL A;  3LYA A;  3CVU A;  3MX3 A;  4G11 A;  4WNG A;  5FWQ A;  4ABN A;  2RG8 A;  2UY1 A;  3OXF A;  3TAX A;  2AXZ A;  4KYO B;  3UT7 A;  1E90 A;  4BX9 A;  4OVV A;  2X6H A;  3FDH A;  3JUI A;  4CRW A;  3ZVV A;  3AS5 A;  2VSN A;  4L7T A;  3ZEF A;  3ZXS A;  3D9M A;  1WM5 A;  2IU1 A;  4AV7 A;  5BT1 A;  5FQ6 A;  2WMO A;  2J4D A;  3P1U A;  2AXU A;  4N39 A;  3GZ2 A;  3QNK A;  4JHK A;  5E75 A;  5LOZ A;  2PM7 A;  4JEH A;  1HE8 A;  1H2V C;  4CDM A;  5LX8 A;  4Y6C A;  1HFA A;  3LY7 A;  4GYY A;  3FH8 A;  2L0I A;  2P58 C;  3KAE A;  2DCP A;  4XE0 A;  2CG3 A;  4C0M A;  3LY8 A;  2WXI A;  3FUL A;  1Y8M A;  4XIF A;  4KZ0 A;  4B89 A;  3LDZ A;  1OWP A;  2PL2 A;  3VLF A;  4GZD A;  5G55 A;  2KCL A;  4IRU A;  2WXH A;  2E0I A;  4HOR A;  4YND A;  2DIW A;  4PUC A;  2AWI A;  3ENE A;  5FQ8 A;  1E7U A;  3SHF A;  2MOW A;  1E96 B;  2WXQ A;  2KZT B;  2KZT A;  3PZD A;  4JC8 A;  1DVP A;  4PS8 A;  1KT1 A;  3CQG B;  2RD0 A;  2L9B A;  4ILG A;  4N2S A;  3B7S A;  2XGS A;  4U0U A;  3ASF A;  3UQ3 A;  2WXR A;  2YHE A;  4L23 A;  1HO8 A;  3VLE A;  5LP0 A;  3UPV A;  2FF4 A;  4I2W A;  3MZL B;  3UX4 A;  1HU3 A;  3FEX A;  4MLP A;  3FP3 A;  3RKV A;  4E85 A;  4UQY A;  3SBS A;  4CT0 A;  4UWF A;  2BTD A;  4A1S A;  3MKQ A;  5BV0 A;  4GA1 A;  4LER A;  4TRQ A;  3T8M A;  4TUU A;  1H6K A;  3TXN A;  3S7F A;  4HVB A;  3LEW A;  3NQP A;  3NF1 A;  4HS2 A;  1BPO A;  1UJK A;  3KD7 A;  3FWV A;  3ZHE A;  5C2Y A;  4EPZ A;  2IQC A;  3MKQ B;  2YNQ A;  1HF8 A;  5DIZ A;  1IQU A;  4ACL A;  3QAR A;  3SFZ A;  2OND A;  3D3M A;  3QWP A;  2R17 C;  4K0R A;  3U64 A;  4N2Q A;  3OXG A;  5CCM A;  4U04 A;  3RIB A;  4F3V A;  2MRI A;  5FZS A;  4YVQ C;  2NC9 A;  3HHM A;  2QY7 A;  3IV0 A;  1HX8 A;  5AIJ A;  1ELK A;  4FHJ A;  4I9C A;  3S7D A;  4TV3 A;  2HO1 A;  1QZ2 A;  2IF4 A;  3FTS A;  2PQR A;  2PZI A;  1N54 A;  3EIJ A;  2AVP A;  4AXH A;  4JA9 A;  3HVE B;  5G04 J;  4N5C A;  5J08 A;  3APD A;  4BWR A;  4FA6 A;  2AW6 A;  3FY4 A;  2GGF A;  5LFA A;  3B7T A;  3MA5 A;  2PQN A;  3QB2 A;  3N71 A;  4G1T A;  3GW4 A;  4UWK A;  2CFZ A;  5BPP A;  1INZ A;  2J07 A;  4XI9 A;  5FZR A;  3AU5 A;  3PVL A;  3FU0 A;  3I4R B;  3D9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...