4DI4A

Crystal structure of a 3:1 complex of treponema pallidum tatp(t) (tp0957) bound to tatt (tp0956)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
273
Chain Sequence
b'DADFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TatT (Tp0956)
publication title Structural and Thermodynamic Characterization of the Interaction between Two Periplasmic Treponema pallidum Lipoproteins that are Components of a TPR-Protein-Associated TRAP Transporter (TPAT).
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
molecule tags Transport protein
total genus 103
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4di4A00
3U64A 4DI4A 4DI3A
chains in the Genus database with same CATH superfamily
5FQ7A 4IULA 5ARGA 2LSVA 4I9CA 5KJKA 3UM0A 4DPRA 2Y0BG 5G05J 2A5UA 3Q79A 3RRUA 3L13A 2QC9A 1S64A 5CCMA 4G2VA 5HQ8A 3FY4A 4I1MA 3VLEA 3ZUVB 3CQGB 3CK7A 4YDOA 4AIFA 2UY1B 1KZPA 2HM8A 4PS8A 4HI9A 2UY1A 2DBAA 2WXNA 4J8DA 3LPZA 4RVBA 5AYWD 1KZOA 3IEGA 3L54A 4J8FA 1AWCB 1QBQA 4N5CA 2CFZA 4KT6B 1Z5SC 1D8DA 1EPUA 3FTUA 3PZ4A 2DVWA 4ILIA 3QWPA 1O5MA 5KNGA 3SFXA 4DX2A 2XPYA 3TAXA 3TWWA 4CGVA 1Z3XA 1H2TC 4FA6A 1N4RA 3RO3A 4PUCA 3NZSA 5AJDA 3ULEG 2NYJA 3LJNA 4U0ZA 3UKRG 2VGYA 4GMRA 3MEKA 1UW4B 4I2WA 4HRMB 3ZXSA 2WQ6A 2MRIA 3SGHA 4BWRA 1HFAA 5B1BE 4GZ5A 1Y8MA 3Q9NC 3D9IA 4U8HA 5D66A 5C2YA 3CVNA 4L2LA 4Y6CA 3ML8A 3UM1A 3ZKJA 3MZLB 3CVUA 1MX4A 1NA0A 1QNFA 4NRHB 1E8ZA 2RFMA 1DC2A 4EECA 2XCBA 2GRMA 3UKUG 1TEZA 1DNPA 3U66A 4WAFA 2Y3AA 3V2XA 1XGWA 4JHRA 5CCLA 4GMLA 2X3MA 3CHPA 3EJNA 5G04J 4HRNA 4G23A 4M3OA 3SBSA 1TJFA 1HE8A 3UM3A 3CKCA 3BEEA 3C3QA 3CHSA 2ETCA 5A6CA 2LSUA 1IHGA 2P9SG 4N3BA 2WXQA 5AQ7A 3W9FA 1O1TA 4XI9A 2IY0C 4BT9A 1N54A 5EDSA 1QZ2A 1JWFA 2X6KA 5AQBA 5JJ6A 4XE0A 4O1PA 5KNHD 2IF4A 3LVQE 1SA5A 3ZIMA 5CBNA 2PZIA 2QYJA 4UWFA 4H7YA 1RW2A 1H6KA 4GZ3A 1UN8A 1K1AA 2XZTG 4LEUA 5FQ4A 3QB2A 4BY6A 4Q69A 2P2CP 4L1BA 3FU3A 3ZYMA 1KLXA 3KEZA 3RKVA 4DLOA 3EU9A 2CHZA 2BEDA 3I5PA 3EHRA 1BD8A 5ENPD 5ENQD 4HVBA 2HO1A 4MRUA 4E85A 5CECB 2P9KG 3TWSA 3KS2A 2GRRB 3DSTA 4CT4A 3B7TA 4U8VD 3LXUX 5G05C 4BX9A 4IN3B 5DIZA 2P9PG 1EYHA 1A17A 3SFYA 4OAVB 3HDXA 3TGOA 2VSXE 4KXKB 4WWNA 3HG0D 1K8KG 3WG7E 1FVFA 3PZDA 4U0UA 4CCAA 3UMVA 2H6HA 3TL5A 3IKOB 1ZB1A 3ESKA 4FJZA 3PZ1A 2I6HA 4LG6A 3ZYQA 3B95A 2NSZA 2VJ8A 3ZGQA 3ISMC 2XZDG 3UT8A 4QQIA 2XHEA 3ABLE 3LDZA 4L9PA 4YDWA 2DYSE 5AJLA 2ZXWE 2WXIA 2ETAA 3DRAA 5CEDB 2ONDA 3V79K 5B3SE 1OWLA 2HE0A 2JEKA 4JEHA 2R2LA 1X5BA 3F6QA 2KM4A 3QJZA 3TG5A 4NIKA 3G2SA 3CVQA 2LUHA 4XKBA 1EF1C 5AIJA 4RG9A 4I6GA 2IO2C 4OVUA 2DIWA 1TN6A 3ZU7B 1O1RA 1HS6A 3DEOA 3PNTB 4IYPA 4ATGA 1NZNA 4JPSA 2FI7A 3QNKA 2BKKB 2J08A 4HXIA 4UWKA 2J49A 2F8YA 1N52A 3FHEA 3FWVA 3GZ1A 3IHVA 3CQCB 3SI5A 3MKRA 2ETBA 3TXNA 2ZU6B 1TNBA 2KATA 4GU5A 1H6OA 3S7JA 1NA3A 3AAAC 4GTMA 3HIZA 2QYUA 5EKQD 3FEXA 3D9PA 2KCLA 5LP0A 4B8AA 3FTYA 3FU0A 3D9KA 3U64A 2WXGA 5ANRA 2WXJA 3SBTB 3HHMA 2EILE 2UWJG 3C3OA 4ACKA 4F6RD 4C0EA 4I1AA 3V31A 4G26A 1H19A 4GZDA 1MX6A 3HXCA 3RAUA 2WB2A 4O1OA 5BNWA 3NAWA 3NOCD 4KBQA 2GGFA 3PE4A 4GYWA 4K5CA 3DPYA 2YNQA 4F7AA 3L16A 3L17A 3VLFA 3TG4A 3KEAA 1XNFA 4ILHB 4PDXA 5EX3A 2PM6A 4GB9A 1TNZA 2XPIA 3MA5A 4HS2A 3ASDA 4GCOA 4YVQC 4DK5A 2I9CA 2X6HA 3OXFA 3KD7A 5FZSA 4B8CB 3SF4A 5HS0A 2F37A 3T8KA 1HG2A 3J5PA 5KJMA 2XCCA 2P9LG 3GZ2A 4CZ2D 4U96D 3EDTB 2WXKA 4JXTA 4GTSA 4EQFA 4B89A 4BEPA 3QC1A 2PM7A 2WM9A 2V0PA 5BW8C 3ONLA 3U9WA 1NL4A 2MOWA 3JXIA 4CRWA 4I17A 2XRYA 4FLBA 1B89A 4TXQA 4HOUA 2F0YA 1JCRA 4CT0A 3FUHA 4KVMA 3CVPA 3FUNA 3E32A 3JXJA 1Y6IA 1SZ9A 4M7CA 2V5QC 3E33A 2WXRA 3MV3B 3LEWA 5A7DB 2JLBA 1Z6TA 3FTZA 4X8QA 3LYAA 5HI7A 3FDHA 4J8EA 3FULA 1N4PA 4JB8P 2AXZA 2I1JA 3DBSA 2CG2A 5ENTD 4HOTA 3NB2A 5ENNA 2AWIA 3AG2E 4AJWA 4G8LA 3AU5A 4TXRA 5AARA 4UI9C 5ARFA 3ASHA 3Q5MA 5ITZF 5T4YA 5FZQA 3EUVA 5T8IA 4JA7A 4YNDA 4R7LA 5G55A 4WNGA 2AW6A 4ACLA 2CHXA 3ABME 3UXGA 1DCEA 4D10C 2J8SD 2H6FA 3ZYLA 4N2SA 3LKUA 3SFZA 1TR4A 1V55E 5CMWA 1HX8A 4PS3A 4U95D 1FPPA 2YHCA 5J90A 4APFA 1FCHA 3MV2B 2EIME 4B0ZA 1TYQG 2FO1E 2L6JA 3APDA 1H6PA 2XS8A 3B7RL 3EIJA 3AG3E 2DWZA 2ZIRA 4TV3A 2XGMA 2C0LA 1SZAA 4E6HA 3BU8A 3Q7FA 3PEUB 2VGXB 3CHRA 1OCOE 5BV0A 2OCCE 3TWTA 5EIBE 4NQ0A 4LCTA 2VGXA 3IHYA 3QOUA 4G24A 3QWWA 4XX5A 3ULYA 5KBAA 1DVPA 5KCMA 1D8EA 3G2WA 4C9BB 2GRNB 2WXHA 1P5QA 4WNFA 2GRLA 1KT1A 2AXUA 4Q94A 2L0TB 2FULA 2MYOA 3V2OA 1VDYA 4KZ0A 5FQ8A 1MZCA 4EZKA 3C3RA 4U07A 3TWQA 2C0MA 2OEVA 1N0RA 4DUIA 1PC2A 4MS6A 3DSXA 1WG0A 3DEPA 2EIJE 4AV7A 3Q9UC 3TWUA 3DSUA 4DLQA 3PRZA 5FINA 5BXOA 4JHJA 3JQ1A 2R05A 1N0QA 3C72A 2YINA 2WXMA 4AM9A 1PAQA 4HLLA 1WY6A 4J8YA 1YCSB 5G2NA 1E90A 3D9LA 2ZGGA 5EILA 3JUEA 4AP2A 4FJYA 5FQ6A 2KXPC 2ILRA 2R03A 3TWXA 1BLXB 5HRYA 3S7FA 1TNYA 2IONA 3D9OA 3Q15A 3HXFA 4O60A 2HYZA 2EQXA 3IBEA 2DZNA 4CYMD 4HFGA 3CHMA 2B0OE 4F1PA 1O1SA 5IY5E 2P58C 2Y69E 4Y6WA 3I3NA 3UQ3A 1JCQA 4HOQA 1LD7A 4DI3A 3UINC 3CLJA 2WMNA 4J8SA 2WVIA 3HXEA 4ILGA 1HF8A 3FH7A 4A55A 2IJGX 2C2LA 3SZ7A 3LS8A 4G25A 3SY2A 3E37A 5CEAA 4F1SA 3PUKA 3NZUA 5ENSD 3DSWA 2ZISA 4N39A 4DX6D 3ASOE 4UWGA 4L2YA 1U3DA 4KMOA 3P1UA 3CR3A 3CV0A 5T3RA 3TJPA 3HRAA 3CSFA 3LJ3A 1Q2ZA 2QZAA 4ANVA 3PS6A 2RG8A 3WXXA 5EYLA 2WXOA 2XGSA 4CDNA 5BPPA 4LUNU 4RLYA 1TNOA 4J0UA 4L7TA 3TXMA 1MQSA 4P29A 4JEUA 3AS4A 2PQRA 1HH8A 4ZFHA 1E8YA 3VLDA 1HU3A 4WNDA 2KZTB 2BKGA 2A4ZA 1JWGA 4BX8A 3B13A 3NOGD 2AXVA 2OOEA 4UI9J 2KZTA 1MJ0A 1DCQA 4YVOA 4U7EB 4HB5A 2M63A 4BT8A 3CHOA 5AENA 1YMPA 1L5JA 4LNGA 4GA0A 1K3ZD 3TWRA 1OT8A 3U3WA 2I1KA 3FTVA 4FC8A 3T8MA 4EZLA 5LCWC 3R7RA 4ANUA 4B93B 1N94A 3D9JA 3QK0A 4TUUA 3R9MA 2Y4TA 3QKYA 4IRUA 3JCKC 4HBDA 2J9QA 1U2VG 5KWDA 1OCZE 4JW1A 3AS5A 2XQ0A 4A3VA 2XEVA 3PE3A 4HQDA 5J08A 3B7UX 4LNBA 3OTNA 2DYRE 1HO8A 1BI8B 2KCKA 3L82A 3FEYA 4C0MA 3BG1B 3SO8A 3R9AB 1E7VA 2LXMA 4JL0A 4CEMA 1E96B 3UTMA 5JHAA 2VSYA 4K5BA 1D9SA 4OVVA 5D0QD 2L6BA 1UG3A 2NC9A 1PY1A 4I2ZA 2WQHA 3RK6A 4DX7D 4HNAD 2FO7A 1LF8A 3O48A 3UIPC 4GAAA 5D0OD 5EX0A 3MGBA 1UJJA 2HR2A 2OVBA 3QDNA 3SHFA 3PEVB 3FTWA 3ZNGA 2V4HC 4MKTA 3CK9A 3E34A 5C1DA 3G2UA 4EPZA 4I6JA 5M72A 3Q7AA 3Q75A 4ANWA 1W3BA 2RFAA 3CKBA 1WM5A 1OUVA 4J6IA 2IU1A 3L22A 4WWOA 1G3NB 3FTSA 4ABNA 4URKA 4JC8A 2PNNA 3PREA 2V8SE 4GTVA 3ZFWA 4FULA 3QWVA 5CRUA 5DBKA 4B94A 4BETA 3DSVA 3FU6A 4UUCA 3RIBA 2NXPA 3UUXA 1IQRA 1E7UA 2V4LA 3DWLG 5CMYA 5FWQA 3AJIA 3K9IA 2XEEA 3S2AA 1NP7A 3RRMB 4BERA 4WWPA 1LD8A 3MX3A 4GYOA 1WAO1 2A5EA 1S63A 5CRVA 1MYOA 1FT2A 2EIKE 4A63B 3FUFA 5EIDA 4CGWA 3UI2A 2CHWA 2P9NG 4TXPA 4A3TA 5ENOD 3UM2A 4FHKA 2IOLA 3ZW3A 3VTYA 1TNUA 1A5EA 1V54E 5AAOA 4NURA 1OY3D 3O4ZA 3MKQB 2BTDA 3CVLA 2X6FA 3V30A 3CVXA 5FT9A 4CDMA 3MKQA 3L9TA 2LXLA 3DSSA 3AU4A 3T9KA 3UIOC 3NBNB 4BTBA 3SQVA 4V3IA 4JHKA 4AEZC 1S0PA 4N3AA 5E75A 4HLEA 3JUIA 4TRQA 2BUGA 4GTTA 1IHBA 3L6AA 4N3CA 5BT1A 5FJYA 4JD2G 2DZOA 2OVFA 2OEWA 4DI4A 2R17C 1BI7B 3N71A 2AJAA 4LNUD 4A1SA 3OXGA 4UQYA 2Y4UA 4QFVA 2DCPA 2WQ7A 1N4QA 3JQ0A 3ASFA 3PDNA 3DPDA 2LAHA 4YDYA 3B7SA 5LFAA 5FZRA 3GYZA 2X38A 2I2OA 2CFUA 2JABA 2YHEA 4WNEA 4GTQA 3C5RA 2YQ8A 3HVEB 3T5XA 1TJCA 3D3MA 4UQZA 1BU9A 3W9GA 5LCWJ 1MHQA 3G2VA 3HVEA 4EZJA 2KCVA 2VSOE 1OWMA 3ZPJA 4U63A 4UQXA 3B7BA 4LRZA 1N11A 4XEIG 3X2QE 4ME2A 4W9RA 1JPLA 3Q47B 3S7DA 2FEZA 3HYMB 4I1OB 1S70B 3PZ2A 4AXHA 2H6GA 5CHEE 4L23A 4FP7A 4J7WA 3EHQA 4FHJA 5CBOA 3CEQA 3ZXPA 3MYVA 1FVHA 3FUEA 1OWPA 2V5FA 3FH8A 2PQNA 5A23A 3ZEFA 3PUJA 1JCSA 5BV1A 2H6IA 4F53A 2J07A 4BSXA 1GW6A 4K0RA 4EBAA 4GZCA 1RZ4A 3E4BA 1IQUA 3AG4E 4JVSA 1LTXA 4UI9K 1H2UA 2RD0A 5E76A 5EN5D 2Q7FA 1QQEA 1NFIE 1E8XA 3ULQA 1ELRA 1KPSB 4JA9A 3ZN3A 1UOHA 3EIQC 1HXIA 2XS1A 3DXKG 4HORA 4APOA 3CGHA 4GTPA 2XGOA 3FU5A 4I9EA 1HG5A 1WDYA 5ENRD 1UN9A 5D2MC 2WXLA 5JA4D 2IOSA 4HRLA 1YA0A 3AG1E 4FU3A 3CK8A 3PNLB 4ZHBA 2L0IA 4GA1A 4I43A 3D9HA 1NI1A 2WXPA 4C48B 2GRQB 4U0SA 3R7QA 1SW6A 3BUAA 1FT1A 3UT7A 1JUQA 3HXBA 3FUIA 2R59A 3FFLA 5KJNA 2B6CA 3E30A 1X81A 2IO3C 3ASGA 3S7BA 4RQIA 3G2TA 2VTBB 3I4GA 5LX8A 3QARA 1TN8A 5LOZA 1E8WA 4BTAA 3GZSA 2VTBA 2GRPB 1IXVA 3FUMA 1YYHA 4I6EA 4DX1A 2KBXA 4PS7A 4GA2A 4GMJA 2AVPA 3OAWA 4H7XA 3CVYA 2XPZA 4N2QA 3GW4A 1OXJA 2LAIA 3Q4AB 2F8XK 2FF4A 2FBNA 3L08A 1K1BA 4G1TA 3D9MA 3FP3A 4DJAA 5BUZA 3P2BA 3AS8A 2LNIA 4TUMA 4ANXA 2PL2A 4DRXE 1SVXA 4AVXA 4K03A 1ZBPA 1U3CA 3MCXA 4OAUC 3FUDA 3RSEG 4Z68A 1QYMA 1H0AA 4O6FA 1OWOA 4KVOA 2ZGDA 5JJTA 1UJKA 5B1AE 3QAQA 5FTPA 3T5VA 2WMOA 2VSNA 4GYYA 4GCNA 2IFUA 3Q49B 4NACA 4KZCA 3NQPA 4AY6A 4PH4B 3LY7A 5JMND 3EU5A 4XIFA 4GTOA 2GW1A 4WUYA 3APCA 3RO2A 3RU0A 1OCRE 2E0IA 3URZA 1HZ4A 3KSLA 4FADA 2E2EA 3ZVVA 3LY9A 1N95A 5HKPA 3LVRE 4XZ4A 3PZ3A 5ANLA 3LY8A 2GROB 3EHMA 4N5QA 2RKKA 1IKND 3ESLA 3CIAA 3FH5A 4AOFA 3ZRHA 1AP7A 4HI8A 3UPVA 3BG0B 4A1GA 3ONKA 4UWLA 4ATZD 3KSQA 3OXLA 3EHNA 2X6JA 3FUJA 4MLPA 2WXFA 4BSZB 4KYOB 4XKCA 1OWNA 2IEJA 1IYGA 1N4SA 4U04A 4BESA 2XENA 3IXEA 5EYPF 3SNXA 1KT0A 2J4DA 4GTRA 3UX4A 3DXMG 2J4BA 1N9AA 2P9IG 1SQMA 1EDUA 3C98A 3RJVA 4OYSA 1OCCE 2R02A 2P9UG 5BXUA 4EBAG 2X6IA 3FUKA 5JHBA 3IV0A 2EINE 3Q73A 5AQ9A 3ML9A 2LO6A 5G04C 4DX5D 1Z3YA 3UT4A 3CSTA 2BF0X 3D9NA 4BFRA 3JYSA 5AQAA 2Y1LE 2L9BA 3J5QB 2OV8A 4F3VA 3BQOA 2KC7A 2VQ2A 2VYIA 3RRNB 2MHKA 4U8YD 4YDEA 4RSYA 3APFA 2XRZA 2QFCA 5FIOA 4RG6A 3ZYKA 3CVWA 5AN8A 4AY5A 2WPVA 3NF1A 2J09A 3PVLA 4EHMA 3PH0C 4MBGA 4GPKA 4LSZE 3KAEA 5H7PA 3I4RB 4G8KA 4JZYA 1MX2A 5CERB 3LCAA 3ABKE 3HXDA 3CVVA 1INZA 4FLHA 5JJ7A 3ASNE 4GPMA 2IQCA 1BPOA 3MJWA 3FTXA 4UWHA 3VTXA 3CHQA 2R5SA 1TN7A 1SA4A 3TWVA 2XEHA 3Q78A 2QY7A 4GZ6A 3ZHEB 2CG3A 3ZHEA 4K5AB 3U4TA 4CDRA 4LERA 4Q96A 3ENEA 1ELWA 4G11A 2VGEA 1ELKA 5KJLA 4XI0A 1ZU2A 4HOSA 1H2VC 3SD5A
chains in the Genus database with same CATH topology
3WXXA 2WXOA 5FQ7A 4IULA 2XGSA 5E76A 4CDNA 5ARGA 5BPPA 4LUNU 2LSVA 4C0EA 4I9CA 2Q7FA 1QQEA 4I1AA 4DPRA 5KJKA 4G26A 1H19A 4J0UA 5G05J 1E8XA 4GZDA 4L7TA 3ULQA 3TXMA 1MQSA 2A5UA 1ELRA 4JA9A 3L13A 3RRUA 3ZN3A 2WB2A 4P29A 4JEUA 5CCMA 3EIQC 5BNWA 4G2VA 1HXIA 3AS4A 5HQ8A 2PQRA 1HH8A 4HORA 3FY4A 4I1MA 3CGHA 4KBQA 3VLEA 4APOA 1E8YA 3CQGB 3CK7A 2GGFA 3PE4A 2XGOA 4GYWA 3FU5A 3VLDA 1HU3A 4WNDA 2KZTB 4I9EA 2YNQA 4AIFA 2A4ZA 4F7AA 1JWGA 2UY1B 3B13A 4BX8A 1HG5A 2AXVA 3L16A 3L17A 3VLFA 2OOEA 4UI9J 1UN9A 3TG4A 2HM8A 1XNFA 4ILHB 4PDXA 2WXLA 2KZTA 4PS8A 2IOSA 5EX3A 2PM6A 4YVOA 2UY1A 2DBAA 2WXNA 4GB9A 1YA0A 4FU3A 2XPIA 4J8DA 3CK8A 3LPZA 2M63A 3PNLB 2L0IA 4GA1A 4RVBA 3CHOA 4I43A 5AYWD 4BT8A 5AENA 3MA5A 4HS2A 3IEGA 2WXPA 3ASDA 3L54A 4GCOA 4YVQC 1L5JA 4DK5A 4J8FA 4GA0A 2I9CA 3U3WA 2I1KA 4N5CA 3FTVA 4FC8A 3T8MA 4EZLA 5LCWC 3R7RA 2CFZA 2X6HA 4U0SA 4ANUA 4KT6B 3D9JA 3OXFA 3KD7A 5FZSA 4B8CB 3R7QA 3SF4A 1EPUA 3QK0A 4TUUA 3FTUA 2Y4TA 3QKYA 4IRUA 3UT7A 3JCKC 1HG2A 4ILIA 5KJMA 1JUQA 2XCCA 3QWPA 3GZ2A 3EDTB 2WXKA 3FUIA 2R59A 2J9QA 4JXTA 2XPYA 3FFLA 5KJNA 4EQFA 4B89A 3TAXA 3QC1A 4JW1A 4CGVA 2PM7A 3S7BA 1Z3XA 3AS5A 3ASGA 1H2TC 2WM9A 2V0PA 5BW8C 3ONLA 3U9WA 2XQ0A 3G2TA 4A3VA 4FA6A 2MOWA 2XEVA 3PE3A 3RO3A 2VTBB 3I4GA 5LX8A 5J08A 4CRWA 4I17A 2XRYA 3QARA 3B7UX 4PUCA 4FLBA 1B89A 3NZSA 5LOZA 5AJDA 3OTNA 1E8WA 4BTAA 3GZSA 4HOUA 4U0ZA 2VTBA 2VGYA 3MEKA 1HO8A 3FUMA 1UW4B 4I6EA 4I2WA 3ZXSA 2KCKA 4CT0A 2WQ6A 4PS7A 3FEYA 3FUHA 4KVMA 4C0MA 3CVPA 4GA2A 3FUNA 4GMJA 2AVPA 3BG1B 2MRIA 3OAWA 3SGHA 3R9AB 4H7XA 1E7VA 4BWRA 4JL0A 4CEMA 3CVYA 1E96B 2XPZA 1HFAA 5JHAA 2VSYA 1Y6IA 4N2QA 3GW4A 1SZ9A 4OVVA 5D0QD 2LAIA 3Q4AB 4GZ5A 1Y8MA 2FF4A 1UG3A 3D9IA 4U8HA 5C2YA 2WXRA 2NC9A 3MV3B 3CVNA 4L2LA 1PY1A 2FBNA 3L08A 3LEWA 4G1TA 4Y6CA 2JLBA 5A7DB 4I2ZA 2WQHA 3RK6A 1Z6TA 3FTZA 3D9MA 3ML8A 3FP3A 4DJAA 5BUZA 3MZLB 3P2BA 3LYAA 3CVUA 2FO7A 3AS8A 1NA0A 1QNFA 2LNIA 4NRHB 3FDHA 1LF8A 1E8ZA 5HI7A 4ANXA 3O48A 2PL2A 4J8EA 4GAAA 5D0OD 3FULA 4EECA 2AXZA 5EX0A 4AVXA 2XCBA 3MGBA 2I1JA 2GRMA 1UJJA 2HR2A 2OVBA 3DBSA 4K03A 1ZBPA 2CG2A 1TEZA 1U3CA 1DNPA 3MCXA 3U66A 3QDNA 4WAFA 2Y3AA 3SHFA 3FUDA 1XGWA 1H0AA 3PEVB 3FTWA 4HOTA 4MKTA 3CK9A 4JHRA 5C1DA 3G2UA 5ENNA 4O6FA 1OWOA 4EPZA 5CCLA 2AWIA 4KVOA 4I6JA 5M72A 4AJWA 5JJTA 1UJKA 3AU5A 4GMLA 3QAQA 2X3MA 5FTPA 3T5VA 2WMOA 4UI9C 3CHPA 2VSNA 3EJNA 3ASHA 3Q5MA 4GYYA 5ARFA 5G04J 4GCNA 2IFUA 3Q49B 4G23A 4NACA 4KZCA 3NQPA 4M3OA 5T4YA 5FZQA 4ANWA 4AY6A 1W3BA 4PH4B 3LY7A 3SBSA 1TJFA 3CKBA 4XIFA 1HE8A 1WM5A 5T8IA 3CKCA 2GW1A 1OUVA 4JA7A 4WUYA 3APCA 4J6IA 4YNDA 3BEEA 3RO2A 2IU1A 3L22A 4R7LA 3CHSA 3RU0A 5G55A 4WNGA 2AW6A 4WWOA 4ACLA 2CHXA 2E0IA 3URZA 1HZ4A 4FADA 5A6CA 3FTSA 4ABNA 2LSUA 4URKA 4D10C 2E2EA 3ZYLA 1IHGA 4JC8A 3ZVVA 4N2SA 3PREA 3LY9A 4N3BA 2V8SE 2WXQA 3ZFWA 4FULA 3LVRE 3LKUA 4XI9A 4XZ4A 3SFZA 3QWVA 5ANLA 5CMWA 3LY8A 3EHMA 5DBKA 4BT9A 4B94A 3ESLA 1HX8A 1N54A 3CIAA 5EDSA 4PS3A 1QZ2A 3FH5A 2YHCA 5J90A 1JWFA 3FU6A 4APFA 1FCHA 3MV2B 2X6KA 5JJ6A 3RIBA 4XE0A 4AOFA 2IF4A 3ZRHA 2NXPA 4B0ZA 3UUXA 3LVQE 3ZIMA 1IQRA 1E7UA 2PZIA 4UWFA 2L6JA 3UPVA 4H7YA 2V4LA 3APDA 3BG0B 4A1GA 3ONKA 4UWLA 5CMYA 1H6KA 4GZ3A 3B7RL 3EIJA 3OXLA 5FWQA 3EHNA 1UN8A 2X6JA 3FUJA 3K9IA 4TV3A 4MLPA 3S2AA 2WXFA 1NP7A 2XGMA 2C0LA 3RRMB 4LEUA 4KYOB 5FQ4A 4XKCA 3QB2A 1OWNA 1SZAA 4E6HA 4BY6A 4WWPA 3PEUB 4Q69A 1IYGA 2VGXB 3CHRA 3MX3A 4GYOA 4L1BA 4U04A 5BV0A 1WAO1 3FU3A 3SNXA 3ZYMA 1KT0A 4NQ0A 2J4DA 1KLXA 3KEZA 4LCTA 2VGXA 3IHYA 3RKVA 3QOUA 4G24A 3QWWA 3UX4A 4XX5A 4DLOA 2J4BA 2CHZA 3FUFA 3I5PA 4CGWA 1DVPA 5KCMA 3G2WA 4C9BB 2CHWA 2WXHA 1P5QA 1SQMA 4WNFA 4A3TA 1EDUA 2GRLA 4HVBA 1KT1A 2HO1A 4MRUA 4FHKA 2IOLA 3C98A 2AXUA 4Q94A 3ZW3A 4E85A 3VTYA 2L0TB 2FULA 3RJVA 4OYSA 1VDYA 3KS2A 4NURA 3O4ZA 4KZ0A 4CT4A 3MKQB 5FQ8A 3B7TA 2BTDA 3CVLA 3LXUX 5G05C 4BX9A 4EZKA 2X6FA 4IN3B 5DIZA 4EBAG 5FT9A 1EYHA 1A17A 2X6IA 3FUKA 3MKQA 4CDMA 3CVXA 3HDXA 4U07A 2C0MA 5JHBA 3TGOA 2VSXE 4KXKB 3IV0A 4WWNA 1PC2A 3AU4A 1FVFA 3ML9A 3PZDA 4MS6A 4U0UA 4CCAA 4BTBA 3UMVA 2LO6A 5G04C 3TL5A 1Z3YA 4V3IA 3IKOB 4JHKA 3UT4A 3ESKA 4AEZC 3CSTA 2BF0X 4FJZA 4AV7A 1S0PA 3D9NA 4N3AA 2I6HA 5E75A 4HLEA 4BFRA 3JYSA 4DLQA 3JUIA 3PRZA 4TRQA 3ZYQA 2L9BA 2NSZA 4JHJA 2BUGA 3JQ1A 3L6AA 2OV8A 2YINA 4F3VA 2WXMA 4N3CA 2VJ8A 4AM9A 1PAQA 5BT1A 3ZGQA 3UT8A 2KC7A 1WY6A 5FJYA 2VQ2A 2XHEA 2OVFA 2VYIA 3LDZA 3RRNB 5G2NA 2MHKA 4DI4A 2R17C 1E90A 3D9LA 3N71A 5AJLA 4AP2A 2WXIA 4FJYA 5FQ6A 4RSYA 4A1SA 3OXGA 4UQYA 2Y4UA 2ILRA 3APFA 2XRZA 4QFVA 2ONDA 2DCPA 2QFCA 4RG6A 2WQ7A 3ZYKA 3CVWA 1OWLA 2JEKA 3S7FA 4AY5A 2WPVA 2IONA 3D9OA 3JQ0A 3ASFA 3NF1A 3PDNA 4JEHA 2J09A 1X5BA 3PVLA 3Q15A 3DPDA 2LAHA 3B7SA 2KM4A 5LFAA 3PH0C 3QJZA 3TG5A 3G2SA 2HYZA 5FZRA 3GYZA 4GPKA 3CVQA 2EQXA 3IBEA 2X38A 2I2OA 2CFUA 3KAEA 1EF1C 2YHEA 3I4RB 4JZYA 4WNEA 4XKBA 5AIJA 2YQ8A 3HVEB 3LCAA 4HFGA 4RG9A 3CHMA 3T5XA 4I6GA 3CVVA 1TJCA 1H2UA 3D3MA 4UQZA 4OVUA 2DIWA 1INZA 4FLHA 5JJ7A 5LCWJ 1MHQA 3G2VA 3HVEA 4EZJA 2KCVA 1HS6A 2VSOE 1OWMA 2P58C 3PNTB 3ZPJA 2IQCA 4U63A 4IYPA 1BPOA 4ATGA 1NZNA 3MJWA 4JPSA 3FTXA 4UWHA 4Y6WA 3I3NA 3UQ3A 4UQXA 4LRZA 2FI7A 3VTXA 3CHQA 4HOQA 4ME2A 4W9RA 1JPLA 2J08A 3QNKA 4HXIA 4UWKA 2J49A 2R5SA 3Q47B 3S7DA 4DI3A 2FEZA 3HYMB 4I1OB 1N52A 3FHEA 3FWVA 3CLJA 2WMNA 4J8SA 2WVIA 3GZ1A 4AXHA 3IHVA 4ILGA 4L23A 5CHEE 4FP7A 2QY7A 4GZ6A 3CQCB 1HF8A 3FH7A 3SI5A 4FHJA 3ZHEB 4A55A 2IJGX 2C2LA 3MKRA 3CEQA 3SZ7A 2CG3A 3TXNA 3LS8A 4G25A 2ZU6B 2KATA 3MYVA 1FVHA 4GU5A 3FUEA 3S7JA 3U4TA 3ZHEA 4CDRA 4F1SA 3PUKA 3NZUA 4LERA 1OWPA 2V5FA 4Q96A 3FH8A 1NA3A 2PQNA 5A23A 3ZEFA 4N39A 3ENEA 3PUJA 5BV1A 3HIZA 4UWGA 4F53A 2J07A 4L2YA 1U3DA 4BSXA 4KMOA 3P1UA 1ELWA 4G11A 1GW6A 3CR3A 1ELKA 5EKQD 3FEXA 3CV0A 5KJLA 4K0RA 3D9PA 5T3RA 2KCLA 4XI0A 5LP0A 3TJPA 4B8AA 4EBAA 4GZCA 1ZU2A 4HOSA 3FTYA 3FU0A 3D9KA 3U64A 3CSFA 3LJ3A 3E4BA 1IQUA 1H2VC 2WXGA 5ANRA 2WXJA 4JVSA 3SBTB 3HHMA 2UWJG 4ANVA 4UI9K 4ACKA 3SD5A 3PS6A 2RG8A 2RD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U64 A;  4DI4 A;  4DI3 A; 
#chains in the Genus database with same CATH topology
 5FQ7 A;  4IUL A;  5ARG A;  2LSV A;  4I9C A;  5KJK A;  3UM0 A;  4DPR A;  2Y0B G;  5G05 J;  2A5U A;  3Q79 A;  3RRU A;  3L13 A;  2QC9 A;  1S64 A;  5CCM A;  4G2V A;  5HQ8 A;  3FY4 A;  4I1M A;  3VLE A;  3ZUV B;  3CQG B;  3CK7 A;  4YDO A;  4AIF A;  2UY1 B;  1KZP A;  2HM8 A;  4PS8 A;  4HI9 A;  2UY1 A;  2DBA A;  2WXN A;  4J8D A;  3LPZ A;  4RVB A;  5AYW D;  1KZO A;  3IEG A;  3L54 A;  4J8F A;  1AWC B;  1QBQ A;  4N5C A;  2CFZ A;  4KT6 B;  1Z5S C;  1D8D A;  1EPU A;  3FTU A;  3PZ4 A;  2DVW A;  4ILI A;  3QWP A;  1O5M A;  5KNG A;  3SFX A;  4DX2 A;  2XPY A;  3TAX A;  3TWW A;  4CGV A;  1Z3X A;  1H2T C;  4FA6 A;  1N4R A;  3RO3 A;  4PUC A;  3NZS A;  5AJD A;  3ULE G;  2NYJ A;  3LJN A;  4U0Z A;  3UKR G;  2VGY A;  4GMR A;  3MEK A;  1UW4 B;  4I2W A;  4HRM B;  3ZXS A;  2WQ6 A;  2MRI A;  3SGH A;  4BWR A;  1HFA A;  5B1B E;  4GZ5 A;  1Y8M A;  3Q9N C;  3D9I A;  4U8H A;  5D66 A;  5C2Y A;  3CVN A;  4L2L A;  4Y6C A;  3ML8 A;  3UM1 A;  3ZKJ A;  3MZL B;  3CVU A;  1MX4 A;  1NA0 A;  1QNF A;  4NRH B;  1E8Z A;  2RFM A;  1DC2 A;  4EEC A;  2XCB A;  2GRM A;  3UKU G;  1TEZ A;  1DNP A;  3U66 A;  4WAF A;  2Y3A A;  3V2X A;  1XGW A;  4JHR A;  5CCL A;  4GML A;  2X3M A;  3CHP A;  3EJN A;  5G04 J;  4HRN A;  4G23 A;  4M3O A;  3SBS A;  1TJF A;  1HE8 A;  3UM3 A;  3CKC A;  3BEE A;  3C3Q A;  3CHS A;  2ETC A;  5A6C A;  2LSU A;  1IHG A;  2P9S G;  4N3B A;  2WXQ A;  5AQ7 A;  3W9F A;  1O1T A;  4XI9 A;  2IY0 C;  4BT9 A;  1N54 A;  5EDS A;  1QZ2 A;  1JWF A;  2X6K A;  5AQB A;  5JJ6 A;  4XE0 A;  4O1P A;  5KNH D;  2IF4 A;  3LVQ E;  1SA5 A;  3ZIM A;  5CBN A;  2PZI A;  2QYJ A;  4UWF A;  4H7Y A;  1RW2 A;  1H6K A;  4GZ3 A;  1UN8 A;  1K1A A;  2XZT G;  4LEU A;  5FQ4 A;  3QB2 A;  4BY6 A;  4Q69 A;  2P2C P;  4L1B A;  3FU3 A;  3ZYM A;  1KLX A;  3KEZ A;  3RKV A;  4DLO A;  3EU9 A;  2CHZ A;  2BED A;  3I5P A;  3EHR A;  1BD8 A;  5ENP D;  5ENQ D;  4HVB A;  2HO1 A;  4MRU A;  4E85 A;  5CEC B;  2P9K G;  3TWS A;  3KS2 A;  2GRR B;  3DST A;  4CT4 A;  3B7T A;  4U8V D;  3LXU X;  5G05 C;  4BX9 A;  4IN3 B;  5DIZ A;  2P9P G;  1EYH A;  1A17 A;  3SFY A;  4OAV B;  3HDX A;  3TGO A;  2VSX E;  4KXK B;  4WWN A;  3HG0 D;  1K8K G;  3WG7 E;  1FVF A;  3PZD A;  4U0U A;  4CCA A;  3UMV A;  2H6H A;  3TL5 A;  3IKO B;  1ZB1 A;  3ESK A;  4FJZ A;  3PZ1 A;  2I6H A;  4LG6 A;  3ZYQ A;  3B95 A;  2NSZ A;  2VJ8 A;  3ZGQ A;  3ISM C;  2XZD G;  3UT8 A;  4QQI A;  2XHE A;  3ABL E;  3LDZ A;  4L9P A;  4YDW A;  2DYS E;  5AJL A;  2ZXW E;  2WXI A;  2ETA A;  3DRA A;  5CED B;  2OND A;  3V79 K;  5B3S E;  1OWL A;  2HE0 A;  2JEK A;  4JEH A;  2R2L A;  1X5B A;  3F6Q A;  2KM4 A;  3QJZ A;  3TG5 A;  4NIK A;  3G2S A;  3CVQ A;  2LUH A;  4XKB A;  1EF1 C;  5AIJ A;  4RG9 A;  4I6G A;  2IO2 C;  4OVU A;  2DIW A;  1TN6 A;  3ZU7 B;  1O1R A;  1HS6 A;  3DEO A;  3PNT B;  4IYP A;  4ATG A;  1NZN A;  4JPS A;  2FI7 A;  3QNK A;  2BKK B;  2J08 A;  4HXI A;  4UWK A;  2J49 A;  2F8Y A;  1N52 A;  3FHE A;  3FWV A;  3GZ1 A;  3IHV A;  3CQC B;  3SI5 A;  3MKR A;  2ETB A;  3TXN A;  2ZU6 B;  1TNB A;  2KAT A;  4GU5 A;  1H6O A;  3S7J A;  1NA3 A;  3AAA C;  4GTM A;  3HIZ A;  2QYU A;  5EKQ D;  3FEX A;  3D9P A;  2KCL A;  5LP0 A;  4B8A A;  3FTY A;  3FU0 A;  3D9K A;  3U64 A;  2WXG A;  5ANR A;  2WXJ A;  3SBT B;  3HHM A;  2EIL E;  2UWJ G;  3C3O A;  4ACK A;  4F6R D;  4C0E A;  4I1A A;  3V31 A;  4G26 A;  1H19 A;  4GZD A;  1MX6 A;  3HXC A;  3RAU A;  2WB2 A;  4O1O A;  5BNW A;  3NAW A;  3NOC D;  4KBQ A;  2GGF A;  3PE4 A;  4GYW A;  4K5C A;  3DPY A;  2YNQ A;  4F7A A;  3L16 A;  3L17 A;  3VLF A;  3TG4 A;  3KEA A;  1XNF A;  4ILH B;  4PDX A;  5EX3 A;  2PM6 A;  4GB9 A;  1TNZ A;  2XPI A;  3MA5 A;  4HS2 A;  3ASD A;  4GCO A;  4YVQ C;  4DK5 A;  2I9C A;  2X6H A;  3OXF A;  3KD7 A;  5FZS A;  4B8C B;  3SF4 A;  5HS0 A;  2F37 A;  3T8K A;  1HG2 A;  3J5P A;  5KJM A;  2XCC A;  2P9L G;  3GZ2 A;  4CZ2 D;  4U96 D;  3EDT B;  2WXK A;  4JXT A;  4GTS A;  4EQF A;  4B89 A;  4BEP A;  3QC1 A;  2PM7 A;  2WM9 A;  2V0P A;  5BW8 C;  3ONL A;  3U9W A;  1NL4 A;  2MOW A;  3JXI A;  4CRW A;  4I17 A;  2XRY A;  4FLB A;  1B89 A;  4TXQ A;  4HOU A;  2F0Y A;  1JCR A;  4CT0 A;  3FUH A;  4KVM A;  3CVP A;  3FUN A;  3E32 A;  3JXJ A;  1Y6I A;  1SZ9 A;  4M7C A;  2V5Q C;  3E33 A;  2WXR A;  3MV3 B;  3LEW A;  5A7D B;  2JLB A;  1Z6T A;  3FTZ A;  4X8Q A;  3LYA A;  5HI7 A;  3FDH A;  4J8E A;  3FUL A;  1N4P A;  4JB8 P;  2AXZ A;  2I1J A;  3DBS A;  2CG2 A;  5ENT D;  4HOT A;  3NB2 A;  5ENN A;  2AWI A;  3AG2 E;  4AJW A;  4G8L A;  3AU5 A;  4TXR A;  5AAR A;  4UI9 C;  5ARF A;  3ASH A;  3Q5M A;  5ITZ F;  5T4Y A;  5FZQ A;  3EUV A;  5T8I A;  4JA7 A;  4YND A;  4R7L A;  5G55 A;  4WNG A;  2AW6 A;  4ACL A;  2CHX A;  3ABM E;  3UXG A;  1DCE A;  4D10 C;  2J8S D;  2H6F A;  3ZYL A;  4N2S A;  3LKU A;  3SFZ A;  1TR4 A;  1V55 E;  5CMW A;  1HX8 A;  4PS3 A;  4U95 D;  1FPP A;  2YHC A;  5J90 A;  4APF A;  1FCH A;  3MV2 B;  2EIM E;  4B0Z A;  1TYQ G;  2FO1 E;  2L6J A;  3APD A;  1H6P A;  2XS8 A;  3B7R L;  3EIJ A;  3AG3 E;  2DWZ A;  2ZIR A;  4TV3 A;  2XGM A;  2C0L A;  1SZA A;  4E6H A;  3BU8 A;  3Q7F A;  3PEU B;  2VGX B;  3CHR A;  1OCO E;  5BV0 A;  2OCC E;  3TWT A;  5EIB E;  4NQ0 A;  4LCT A;  2VGX A;  3IHY A;  3QOU A;  4G24 A;  3QWW A;  4XX5 A;  3ULY A;  5KBA A;  1DVP A;  5KCM A;  1D8E A;  3G2W A;  4C9B B;  2GRN B;  2WXH A;  1P5Q A;  4WNF A;  2GRL A;  1KT1 A;  2AXU A;  4Q94 A;  2L0T B;  2FUL A;  2MYO A;  3V2O A;  1VDY A;  4KZ0 A;  5FQ8 A;  1MZC A;  4EZK A;  3C3R A;  4U07 A;  3TWQ A;  2C0M A;  2OEV A;  1N0R A;  4DUI A;  1PC2 A;  4MS6 A;  3DSX A;  1WG0 A;  3DEP A;  2EIJ E;  4AV7 A;  3Q9U C;  3TWU A;  3DSU A;  4DLQ A;  3PRZ A;  5FIN A;  5BXO A;  4JHJ A;  3JQ1 A;  2R05 A;  1N0Q A;  3C72 A;  2YIN A;  2WXM A;  4AM9 A;  1PAQ A;  4HLL A;  1WY6 A;  4J8Y A;  1YCS B;  5G2N A;  1E90 A;  3D9L A;  2ZGG A;  5EIL A;  3JUE A;  4AP2 A;  4FJY A;  5FQ6 A;  2KXP C;  2ILR A;  2R03 A;  3TWX A;  1BLX B;  5HRY A;  3S7F A;  1TNY A;  2ION A;  3D9O A;  3Q15 A;  3HXF A;  4O60 A;  2HYZ A;  2EQX A;  3IBE A;  2DZN A;  4CYM D;  4HFG A;  3CHM A;  2B0O E;  4F1P A;  1O1S A;  5IY5 E;  2P58 C;  2Y69 E;  4Y6W A;  3I3N A;  3UQ3 A;  1JCQ A;  4HOQ A;  1LD7 A;  4DI3 A;  3UIN C;  3CLJ A;  2WMN A;  4J8S A;  2WVI A;  3HXE A;  4ILG A;  1HF8 A;  3FH7 A;  4A55 A;  2IJG X;  2C2L A;  3SZ7 A;  3LS8 A;  4G25 A;  3SY2 A;  3E37 A;  5CEA A;  4F1S A;  3PUK A;  3NZU A;  5ENS D;  3DSW A;  2ZIS A;  4N39 A;  4DX6 D;  3ASO E;  4UWG A;  4L2Y A;  1U3D A;  4KMO A;  3P1U A;  3CR3 A;  3CV0 A;  5T3R A;  3TJP A;  3HRA A;  3CSF A;  3LJ3 A;  1Q2Z A;  2QZA A;  4ANV A;  3PS6 A;  2RG8 A;  3WXX A;  5EYL A;  2WXO A;  2XGS A;  4CDN A;  5BPP A;  4LUN U;  4RLY A;  1TNO A;  4J0U A;  4L7T A;  3TXM A;  1MQS A;  4P29 A;  4JEU A;  3AS4 A;  2PQR A;  1HH8 A;  4ZFH A;  1E8Y A;  3VLD A;  1HU3 A;  4WND A;  2KZT B;  2BKG A;  2A4Z A;  1JWG A;  4BX8 A;  3B13 A;  3NOG D;  2AXV A;  2OOE A;  4UI9 J;  2KZT A;  1MJ0 A;  1DCQ A;  4YVO A;  4U7E B;  4HB5 A;  2M63 A;  4BT8 A;  3CHO A;  5AEN A;  1YMP A;  1L5J A;  4LNG A;  4GA0 A;  1K3Z D;  3TWR A;  1OT8 A;  3U3W A;  2I1K A;  3FTV A;  4FC8 A;  3T8M A;  4EZL A;  5LCW C;  3R7R A;  4ANU A;  4B93 B;  1N94 A;  3D9J A;  3QK0 A;  4TUU A;  3R9M A;  2Y4T A;  3QKY A;  4IRU A;  3JCK C;  4HBD A;  2J9Q A;  1U2V G;  5KWD A;  1OCZ E;  4JW1 A;  3AS5 A;  2XQ0 A;  4A3V A;  2XEV A;  3PE3 A;  4HQD A;  5J08 A;  3B7U X;  4LNB A;  3OTN A;  2DYR E;  1HO8 A;  1BI8 B;  2KCK A;  3L82 A;  3FEY A;  4C0M A;  3BG1 B;  3SO8 A;  3R9A B;  1E7V A;  2LXM A;  4JL0 A;  4CEM A;  1E96 B;  3UTM A;  5JHA A;  2VSY A;  4K5B A;  1D9S A;  4OVV A;  5D0Q D;  2L6B A;  1UG3 A;  2NC9 A;  1PY1 A;  4I2Z A;  2WQH A;  3RK6 A;  4DX7 D;  4HNA D;  2FO7 A;  1LF8 A;  3O48 A;  3UIP C;  4GAA A;  5D0O D;  5EX0 A;  3MGB A;  1UJJ A;  2HR2 A;  2OVB A;  3QDN A;  3SHF A;  3PEV B;  3FTW A;  3ZNG A;  2V4H C;  4MKT A;  3CK9 A;  3E34 A;  5C1D A;  3G2U A;  4EPZ A;  4I6J A;  5M72 A;  3Q7A A;  3Q75 A;  4ANW A;  1W3B A;  2RFA A;  3CKB A;  1WM5 A;  1OUV A;  4J6I A;  2IU1 A;  3L22 A;  4WWO A;  1G3N B;  3FTS A;  4ABN A;  4URK A;  4JC8 A;  2PNN A;  3PRE A;  2V8S E;  4GTV A;  3ZFW A;  4FUL A;  3QWV A;  5CRU A;  5DBK A;  4B94 A;  4BET A;  3DSV A;  3FU6 A;  4UUC A;  3RIB A;  2NXP A;  3UUX A;  1IQR A;  1E7U A;  2V4L A;  3DWL G;  5CMY A;  5FWQ A;  3AJI A;  3K9I A;  2XEE A;  3S2A A;  1NP7 A;  3RRM B;  4BER A;  4WWP A;  1LD8 A;  3MX3 A;  4GYO A;  1WAO 1;  2A5E A;  1S63 A;  5CRV A;  1MYO A;  1FT2 A;  2EIK E;  4A63 B;  3FUF A;  5EID A;  4CGW A;  3UI2 A;  2CHW A;  2P9N G;  4TXP A;  4A3T A;  5ENO D;  3UM2 A;  4FHK A;  2IOL A;  3ZW3 A;  3VTY A;  1TNU A;  1A5E A;  1V54 E;  5AAO A;  4NUR A;  1OY3 D;  3O4Z A;  3MKQ B;  2BTD A;  3CVL A;  2X6F A;  3V30 A;  3CVX A;  5FT9 A;  4CDM A;  3MKQ A;  3L9T A;  2LXL A;  3DSS A;  3AU4 A;  3T9K A;  3UIO C;  3NBN B;  4BTB A;  3SQV A;  4V3I A;  4JHK A;  4AEZ C;  1S0P A;  4N3A A;  5E75 A;  4HLE A;  3JUI A;  4TRQ A;  2BUG A;  4GTT A;  1IHB A;  3L6A A;  4N3C A;  5BT1 A;  5FJY A;  4JD2 G;  2DZO A;  2OVF A;  2OEW A;  4DI4 A;  2R17 C;  1BI7 B;  3N71 A;  2AJA A;  4LNU D;  4A1S A;  3OXG A;  4UQY A;  2Y4U A;  4QFV A;  2DCP A;  2WQ7 A;  1N4Q A;  3JQ0 A;  3ASF A;  3PDN A;  3DPD A;  2LAH A;  4YDY A;  3B7S A;  5LFA A;  5FZR A;  3GYZ A;  2X38 A;  2I2O A;  2CFU A;  2JAB A;  2YHE A;  4WNE A;  4GTQ A;  3C5R A;  2YQ8 A;  3HVE B;  3T5X A;  1TJC A;  3D3M A;  4UQZ A;  1BU9 A;  3W9G A;  5LCW J;  1MHQ A;  3G2V A;  3HVE A;  4EZJ A;  2KCV A;  2VSO E;  1OWM A;  3ZPJ A;  4U63 A;  4UQX A;  3B7B A;  4LRZ A;  1N11 A;  4XEI G;  3X2Q E;  4ME2 A;  4W9R A;  1JPL A;  3Q47 B;  3S7D A;  2FEZ A;  3HYM B;  4I1O B;  1S70 B;  3PZ2 A;  4AXH A;  2H6G A;  5CHE E;  4L23 A;  4FP7 A;  4J7W A;  3EHQ A;  4FHJ A;  5CBO A;  3CEQ A;  3ZXP A;  3MYV A;  1FVH A;  3FUE A;  1OWP A;  2V5F A;  3FH8 A;  2PQN A;  5A23 A;  3ZEF A;  3PUJ A;  1JCS A;  5BV1 A;  2H6I A;  4F53 A;  2J07 A;  4BSX A;  1GW6 A;  4K0R A;  4EBA A;  4GZC A;  1RZ4 A;  3E4B A;  1IQU A;  3AG4 E;  4JVS A;  1LTX A;  4UI9 K;  1H2U A;  2RD0 A;  5E76 A;  5EN5 D;  2Q7F A;  1QQE A;  1NFI E;  1E8X A;  3ULQ A;  1ELR A;  1KPS B;  4JA9 A;  3ZN3 A;  1UOH A;  3EIQ C;  1HXI A;  2XS1 A;  3DXK G;  4HOR A;  4APO A;  3CGH A;  4GTP A;  2XGO A;  3FU5 A;  4I9E A;  1HG5 A;  1WDY A;  5ENR D;  1UN9 A;  5D2M C;  2WXL A;  5JA4 D;  2IOS A;  4HRL A;  1YA0 A;  3AG1 E;  4FU3 A;  3CK8 A;  3PNL B;  4ZHB A;  2L0I A;  4GA1 A;  4I43 A;  3D9H A;  1NI1 A;  2WXP A;  4C48 B;  2GRQ B;  4U0S A;  3R7Q A;  1SW6 A;  3BUA A;  1FT1 A;  3UT7 A;  1JUQ A;  3HXB A;  3FUI A;  2R59 A;  3FFL A;  5KJN A;  2B6C A;  3E30 A;  1X81 A;  2IO3 C;  3ASG A;  3S7B A;  4RQI A;  3G2T A;  2VTB B;  3I4G A;  5LX8 A;  3QAR A;  1TN8 A;  5LOZ A;  1E8W A;  4BTA A;  3GZS A;  2VTB A;  2GRP B;  1IXV A;  3FUM A;  1YYH A;  4I6E A;  4DX1 A;  2KBX A;  4PS7 A;  4GA2 A;  4GMJ A;  2AVP A;  3OAW A;  4H7X A;  3CVY A;  2XPZ A;  4N2Q A;  3GW4 A;  1OXJ A;  2LAI A;  3Q4A B;  2F8X K;  2FF4 A;  2FBN A;  3L08 A;  1K1B A;  4G1T A;  3D9M A;  3FP3 A;  4DJA A;  5BUZ A;  3P2B A;  3AS8 A;  2LNI A;  4TUM A;  4ANX A;  2PL2 A;  4DRX E;  1SVX A;  4AVX A;  4K03 A;  1ZBP A;  1U3C A;  3MCX A;  4OAU C;  3FUD A;  3RSE G;  4Z68 A;  1QYM A;  1H0A A;  4O6F A;  1OWO A;  4KVO A;  2ZGD A;  5JJT A;  1UJK A;  5B1A E;  3QAQ A;  5FTP A;  3T5V A;  2WMO A;  2VSN A;  4GYY A;  4GCN A;  2IFU A;  3Q49 B;  4NAC A;  4KZC A;  3NQP A;  4AY6 A;  4PH4 B;  3LY7 A;  5JMN D;  3EU5 A;  4XIF A;  4GTO A;  2GW1 A;  4WUY A;  3APC A;  3RO2 A;  3RU0 A;  1OCR E;  2E0I A;  3URZ A;  1HZ4 A;  3KSL A;  4FAD A;  2E2E A;  3ZVV A;  3LY9 A;  1N95 A;  5HKP A;  3LVR E;  4XZ4 A;  3PZ3 A;  5ANL A;  3LY8 A;  2GRO B;  3EHM A;  4N5Q A;  2RKK A;  1IKN D;  3ESL A;  3CIA A;  3FH5 A;  4AOF A;  3ZRH A;  1AP7 A;  4HI8 A;  3UPV A;  3BG0 B;  4A1G A;  3ONK A;  4UWL A;  4ATZ D;  3KSQ A;  3OXL A;  3EHN A;  2X6J A;  3FUJ A;  4MLP A;  2WXF A;  4BSZ B;  4KYO B;  4XKC A;  1OWN A;  2IEJ A;  1IYG A;  1N4S A;  4U04 A;  4BES A;  2XEN A;  3IXE A;  5EYP F;  3SNX A;  1KT0 A;  2J4D A;  4GTR A;  3UX4 A;  3DXM G;  2J4B A;  1N9A A;  2P9I G;  1SQM A;  1EDU A;  3C98 A;  3RJV A;  4OYS A;  1OCC E;  2R02 A;  2P9U G;  5BXU A;  4EBA G;  2X6I A;  3FUK A;  5JHB A;  3IV0 A;  2EIN E;  3Q73 A;  5AQ9 A;  3ML9 A;  2LO6 A;  5G04 C;  4DX5 D;  1Z3Y A;  3UT4 A;  3CST A;  2BF0 X;  3D9N A;  4BFR A;  3JYS A;  5AQA A;  2Y1L E;  2L9B A;  3J5Q B;  2OV8 A;  4F3V A;  3BQO A;  2KC7 A;  2VQ2 A;  2VYI A;  3RRN B;  2MHK A;  4U8Y D;  4YDE A;  4RSY A;  3APF A;  2XRZ A;  2QFC A;  5FIO A;  4RG6 A;  3ZYK A;  3CVW A;  5AN8 A;  4AY5 A;  2WPV A;  3NF1 A;  2J09 A;  3PVL A;  4EHM A;  3PH0 C;  4MBG A;  4GPK A;  4LSZ E;  3KAE A;  5H7P A;  3I4R B;  4G8K A;  4JZY A;  1MX2 A;  5CER B;  3LCA A;  3ABK E;  3HXD A;  3CVV A;  1INZ A;  4FLH A;  5JJ7 A;  3ASN E;  4GPM A;  2IQC A;  1BPO A;  3MJW A;  3FTX A;  4UWH A;  3VTX A;  3CHQ A;  2R5S A;  1TN7 A;  1SA4 A;  3TWV A;  2XEH A;  3Q78 A;  2QY7 A;  4GZ6 A;  3ZHE B;  2CG3 A;  3ZHE A;  4K5A B;  3U4T A;  4CDR A;  4LER A;  4Q96 A;  3ENE A;  1ELW A;  4G11 A;  2VGE A;  1ELK A;  5KJL A;  4XI0 A;  1ZU2 A;  4HOS A;  1H2V C;  3SD5 A; 
#chains in the Genus database with same CATH homology
 3WXX A;  2WXO A;  5FQ7 A;  4IUL A;  2XGS A;  5E76 A;  4CDN A;  5ARG A;  5BPP A;  4LUN U;  2LSV A;  4C0E A;  4I9C A;  2Q7F A;  1QQE A;  4I1A A;  4DPR A;  5KJK A;  4G26 A;  1H19 A;  4J0U A;  5G05 J;  1E8X A;  4GZD A;  4L7T A;  3ULQ A;  3TXM A;  1MQS A;  2A5U A;  1ELR A;  4JA9 A;  3L13 A;  3RRU A;  3ZN3 A;  2WB2 A;  4P29 A;  4JEU A;  5CCM A;  3EIQ C;  5BNW A;  4G2V A;  1HXI A;  3AS4 A;  5HQ8 A;  2PQR A;  1HH8 A;  4HOR A;  3FY4 A;  4I1M A;  3CGH A;  4KBQ A;  3VLE A;  4APO A;  1E8Y A;  3CQG B;  3CK7 A;  2GGF A;  3PE4 A;  2XGO A;  4GYW A;  3FU5 A;  3VLD A;  1HU3 A;  4WND A;  2KZT B;  4I9E A;  2YNQ A;  4AIF A;  2A4Z A;  4F7A A;  1JWG A;  2UY1 B;  3B13 A;  4BX8 A;  1HG5 A;  2AXV A;  3L16 A;  3L17 A;  3VLF A;  2OOE A;  4UI9 J;  1UN9 A;  3TG4 A;  2HM8 A;  1XNF A;  4ILH B;  4PDX A;  2WXL A;  2KZT A;  4PS8 A;  2IOS A;  5EX3 A;  2PM6 A;  4YVO A;  2UY1 A;  2DBA A;  2WXN A;  4GB9 A;  1YA0 A;  4FU3 A;  2XPI A;  4J8D A;  3CK8 A;  3LPZ A;  2M63 A;  3PNL B;  2L0I A;  4GA1 A;  4RVB A;  3CHO A;  4I43 A;  5AYW D;  4BT8 A;  5AEN A;  3MA5 A;  4HS2 A;  3IEG A;  2WXP A;  3ASD A;  3L54 A;  4GCO A;  4YVQ C;  1L5J A;  4DK5 A;  4J8F A;  4GA0 A;  2I9C A;  3U3W A;  2I1K A;  4N5C A;  3FTV A;  4FC8 A;  3T8M A;  4EZL A;  5LCW C;  3R7R A;  2CFZ A;  2X6H A;  4U0S A;  4ANU A;  4KT6 B;  3D9J A;  3OXF A;  3KD7 A;  5FZS A;  4B8C B;  3R7Q A;  3SF4 A;  1EPU A;  3QK0 A;  4TUU A;  3FTU A;  2Y4T A;  3QKY A;  4IRU A;  3UT7 A;  3JCK C;  1HG2 A;  4ILI A;  5KJM A;  1JUQ A;  2XCC A;  3QWP A;  3GZ2 A;  3EDT B;  2WXK A;  3FUI A;  2R59 A;  2J9Q A;  4JXT A;  2XPY A;  3FFL A;  5KJN A;  4EQF A;  4B89 A;  3TAX A;  3QC1 A;  4JW1 A;  4CGV A;  2PM7 A;  3S7B A;  1Z3X A;  3AS5 A;  3ASG A;  1H2T C;  2WM9 A;  2V0P A;  5BW8 C;  3ONL A;  3U9W A;  2XQ0 A;  3G2T A;  4A3V A;  4FA6 A;  2MOW A;  2XEV A;  3PE3 A;  3RO3 A;  2VTB B;  3I4G A;  5LX8 A;  5J08 A;  4CRW A;  4I17 A;  2XRY A;  3QAR A;  3B7U X;  4PUC A;  4FLB A;  1B89 A;  3NZS A;  5LOZ A;  5AJD A;  3OTN A;  1E8W A;  4BTA A;  3GZS A;  4HOU A;  4U0Z A;  2VTB A;  2VGY A;  3MEK A;  1HO8 A;  3FUM A;  1UW4 B;  4I6E A;  4I2W A;  3ZXS A;  2KCK A;  4CT0 A;  2WQ6 A;  4PS7 A;  3FEY A;  3FUH A;  4KVM A;  4C0M A;  3CVP A;  4GA2 A;  3FUN A;  4GMJ A;  2AVP A;  3BG1 B;  2MRI A;  3OAW A;  3SGH A;  3R9A B;  4H7X A;  1E7V A;  4BWR A;  4JL0 A;  4CEM A;  3CVY A;  1E96 B;  2XPZ A;  1HFA A;  5JHA A;  2VSY A;  1Y6I A;  4N2Q A;  3GW4 A;  1SZ9 A;  4OVV A;  5D0Q D;  2LAI A;  3Q4A B;  4GZ5 A;  1Y8M A;  2FF4 A;  1UG3 A;  3D9I A;  4U8H A;  5C2Y A;  2WXR A;  2NC9 A;  3MV3 B;  3CVN A;  4L2L A;  1PY1 A;  2FBN A;  3L08 A;  3LEW A;  4G1T A;  4Y6C A;  2JLB A;  5A7D B;  4I2Z A;  2WQH A;  3RK6 A;  1Z6T A;  3FTZ A;  3D9M A;  3ML8 A;  3FP3 A;  4DJA A;  5BUZ A;  3MZL B;  3P2B A;  3LYA A;  3CVU A;  2FO7 A;  3AS8 A;  1NA0 A;  1QNF A;  2LNI A;  4NRH B;  3FDH A;  1LF8 A;  1E8Z A;  5HI7 A;  4ANX A;  3O48 A;  2PL2 A;  4J8E A;  4GAA A;  5D0O D;  3FUL A;  4EEC A;  2AXZ A;  5EX0 A;  4AVX A;  2XCB A;  3MGB A;  2I1J A;  2GRM A;  1UJJ A;  2HR2 A;  2OVB A;  3DBS A;  4K03 A;  1ZBP A;  2CG2 A;  1TEZ A;  1U3C A;  1DNP A;  3MCX A;  3U66 A;  3QDN A;  4WAF A;  2Y3A A;  3SHF A;  3FUD A;  1XGW A;  1H0A A;  3PEV B;  3FTW A;  4HOT A;  4MKT A;  3CK9 A;  4JHR A;  5C1D A;  3G2U A;  5ENN A;  4O6F A;  1OWO A;  4EPZ A;  5CCL A;  2AWI A;  4KVO A;  4I6J A;  5M72 A;  4AJW A;  5JJT A;  1UJK A;  3AU5 A;  4GML A;  3QAQ A;  2X3M A;  5FTP A;  3T5V A;  2WMO A;  4UI9 C;  3CHP A;  2VSN A;  3EJN A;  3ASH A;  3Q5M A;  4GYY A;  5ARF A;  5G04 J;  4GCN A;  2IFU A;  3Q49 B;  4G23 A;  4NAC A;  4KZC A;  3NQP A;  4M3O A;  5T4Y A;  5FZQ A;  4ANW A;  4AY6 A;  1W3B A;  4PH4 B;  3LY7 A;  3SBS A;  1TJF A;  3CKB A;  4XIF A;  1HE8 A;  1WM5 A;  5T8I A;  3CKC A;  2GW1 A;  1OUV A;  4JA7 A;  4WUY A;  3APC A;  4J6I A;  4YND A;  3BEE A;  3RO2 A;  2IU1 A;  3L22 A;  4R7L A;  3CHS A;  3RU0 A;  5G55 A;  4WNG A;  2AW6 A;  4WWO A;  4ACL A;  2CHX A;  2E0I A;  3URZ A;  1HZ4 A;  4FAD A;  5A6C A;  3FTS A;  4ABN A;  2LSU A;  4URK A;  4D10 C;  2E2E A;  3ZYL A;  1IHG A;  4JC8 A;  3ZVV A;  4N2S A;  3PRE A;  3LY9 A;  4N3B A;  2V8S E;  2WXQ A;  3ZFW A;  4FUL A;  3LVR E;  3LKU A;  4XI9 A;  4XZ4 A;  3SFZ A;  3QWV A;  5ANL A;  5CMW A;  3LY8 A;  3EHM A;  5DBK A;  4BT9 A;  4B94 A;  3ESL A;  1HX8 A;  1N54 A;  3CIA A;  5EDS A;  4PS3 A;  1QZ2 A;  3FH5 A;  2YHC A;  5J90 A;  1JWF A;  3FU6 A;  4APF A;  1FCH A;  3MV2 B;  2X6K A;  5JJ6 A;  3RIB A;  4XE0 A;  4AOF A;  2IF4 A;  3ZRH A;  2NXP A;  4B0Z A;  3UUX A;  3LVQ E;  3ZIM A;  1IQR A;  1E7U A;  2PZI A;  4UWF A;  2L6J A;  3UPV A;  4H7Y A;  2V4L A;  3APD A;  3BG0 B;  4A1G A;  3ONK A;  4UWL A;  5CMY A;  1H6K A;  4GZ3 A;  3B7R L;  3EIJ A;  3OXL A;  5FWQ A;  3EHN A;  1UN8 A;  2X6J A;  3FUJ A;  3K9I A;  4TV3 A;  4MLP A;  3S2A A;  2WXF A;  1NP7 A;  2XGM A;  2C0L A;  3RRM B;  4LEU A;  4KYO B;  5FQ4 A;  4XKC A;  3QB2 A;  1OWN A;  1SZA A;  4E6H A;  4BY6 A;  4WWP A;  3PEU B;  4Q69 A;  1IYG A;  2VGX B;  3CHR A;  3MX3 A;  4GYO A;  4L1B A;  4U04 A;  5BV0 A;  1WAO 1;  3FU3 A;  3SNX A;  3ZYM A;  1KT0 A;  4NQ0 A;  2J4D A;  1KLX A;  3KEZ A;  4LCT A;  2VGX A;  3IHY A;  3RKV A;  3QOU A;  4G24 A;  3QWW A;  3UX4 A;  4XX5 A;  4DLO A;  2J4B A;  2CHZ A;  3FUF A;  3I5P A;  4CGW A;  1DVP A;  5KCM A;  3G2W A;  4C9B B;  2CHW A;  2WXH A;  1P5Q A;  1SQM A;  4WNF A;  4A3T A;  1EDU A;  2GRL A;  4HVB A;  1KT1 A;  2HO1 A;  4MRU A;  4FHK A;  2IOL A;  3C98 A;  2AXU A;  4Q94 A;  3ZW3 A;  4E85 A;  3VTY A;  2L0T B;  2FUL A;  3RJV A;  4OYS A;  1VDY A;  3KS2 A;  4NUR A;  3O4Z A;  4KZ0 A;  4CT4 A;  3MKQ B;  5FQ8 A;  3B7T A;  2BTD A;  3CVL A;  3LXU X;  5G05 C;  4BX9 A;  4EZK A;  2X6F A;  4IN3 B;  5DIZ A;  4EBA G;  5FT9 A;  1EYH A;  1A17 A;  2X6I A;  3FUK A;  3MKQ A;  4CDM A;  3CVX A;  3HDX A;  4U07 A;  2C0M A;  5JHB A;  3TGO A;  2VSX E;  4KXK B;  3IV0 A;  4WWN A;  1PC2 A;  3AU4 A;  1FVF A;  3ML9 A;  3PZD A;  4MS6 A;  4U0U A;  4CCA A;  4BTB A;  3UMV A;  2LO6 A;  5G04 C;  3TL5 A;  1Z3Y A;  4V3I A;  3IKO B;  4JHK A;  3UT4 A;  3ESK A;  4AEZ C;  3CST A;  2BF0 X;  4FJZ A;  4AV7 A;  1S0P A;  3D9N A;  4N3A A;  2I6H A;  5E75 A;  4HLE A;  4BFR A;  3JYS A;  4DLQ A;  3JUI A;  3PRZ A;  4TRQ A;  3ZYQ A;  2L9B A;  2NSZ A;  4JHJ A;  2BUG A;  3JQ1 A;  3L6A A;  2OV8 A;  2YIN A;  4F3V A;  2WXM A;  4N3C A;  2VJ8 A;  4AM9 A;  1PAQ A;  5BT1 A;  3ZGQ A;  3UT8 A;  2KC7 A;  1WY6 A;  5FJY A;  2VQ2 A;  2XHE A;  2OVF A;  2VYI A;  3LDZ A;  3RRN B;  5G2N A;  2MHK A;  4DI4 A;  2R17 C;  1E90 A;  3D9L A;  3N71 A;  5AJL A;  4AP2 A;  2WXI A;  4FJY A;  5FQ6 A;  4RSY A;  4A1S A;  3OXG A;  4UQY A;  2Y4U A;  2ILR A;  3APF A;  2XRZ A;  4QFV A;  2OND A;  2DCP A;  2QFC A;  4RG6 A;  2WQ7 A;  3ZYK A;  3CVW A;  1OWL A;  2JEK A;  3S7F A;  4AY5 A;  2WPV A;  2ION A;  3D9O A;  3JQ0 A;  3ASF A;  3NF1 A;  3PDN A;  4JEH A;  2J09 A;  1X5B A;  3PVL A;  3Q15 A;  3DPD A;  2LAH A;  3B7S A;  2KM4 A;  5LFA A;  3PH0 C;  3QJZ A;  3TG5 A;  3G2S A;  2HYZ A;  5FZR A;  3GYZ A;  4GPK A;  3CVQ A;  2EQX A;  3IBE A;  2X38 A;  2I2O A;  2CFU A;  3KAE A;  1EF1 C;  2YHE A;  3I4R B;  4JZY A;  4WNE A;  4XKB A;  5AIJ A;  2YQ8 A;  3HVE B;  3LCA A;  4HFG A;  4RG9 A;  3CHM A;  3T5X A;  4I6G A;  3CVV A;  1TJC A;  1H2U A;  3D3M A;  4UQZ A;  4OVU A;  2DIW A;  1INZ A;  4FLH A;  5JJ7 A;  5LCW J;  1MHQ A;  3G2V A;  3HVE A;  4EZJ A;  2KCV A;  1HS6 A;  2VSO E;  1OWM A;  2P58 C;  3PNT B;  3ZPJ A;  2IQC A;  4U63 A;  4IYP A;  1BPO A;  4ATG A;  1NZN A;  3MJW A;  4JPS A;  3FTX A;  4UWH A;  4Y6W A;  3I3N A;  3UQ3 A;  4UQX A;  4LRZ A;  2FI7 A;  3VTX A;  3CHQ A;  4HOQ A;  4ME2 A;  4W9R A;  1JPL A;  2J08 A;  3QNK A;  4HXI A;  4UWK A;  2J49 A;  2R5S A;  3Q47 B;  3S7D A;  4DI3 A;  2FEZ A;  3HYM B;  4I1O B;  1N52 A;  3FHE A;  3FWV A;  3CLJ A;  2WMN A;  4J8S A;  2WVI A;  3GZ1 A;  4AXH A;  3IHV A;  4ILG A;  4L23 A;  5CHE E;  4FP7 A;  2QY7 A;  4GZ6 A;  3CQC B;  1HF8 A;  3FH7 A;  3SI5 A;  4FHJ A;  3ZHE B;  4A55 A;  2IJG X;  2C2L A;  3MKR A;  3CEQ A;  3SZ7 A;  2CG3 A;  3TXN A;  3LS8 A;  4G25 A;  2ZU6 B;  2KAT A;  3MYV A;  1FVH A;  4GU5 A;  3FUE A;  3S7J A;  3U4T A;  3ZHE A;  4CDR A;  4F1S A;  3PUK A;  3NZU A;  4LER A;  1OWP A;  2V5F A;  4Q96 A;  3FH8 A;  1NA3 A;  2PQN A;  5A23 A;  3ZEF A;  4N39 A;  3ENE A;  3PUJ A;  5BV1 A;  3HIZ A;  4UWG A;  4F53 A;  2J07 A;  4L2Y A;  1U3D A;  4BSX A;  4KMO A;  3P1U A;  1ELW A;  4G11 A;  1GW6 A;  3CR3 A;  1ELK A;  5EKQ D;  3FEX A;  3CV0 A;  5KJL A;  4K0R A;  3D9P A;  5T3R A;  2KCL A;  4XI0 A;  5LP0 A;  3TJP A;  4B8A A;  4EBA A;  4GZC A;  1ZU2 A;  4HOS A;  3FTY A;  3FU0 A;  3D9K A;  3U64 A;  3CSF A;  3LJ3 A;  3E4B A;  1IQU A;  1H2V C;  2WXG A;  5ANR A;  2WXJ A;  4JVS A;  3SBT B;  3HHM A;  2UWJ G;  4ANV A;  4UI9 K;  4ACK A;  3SD5 A;  3PS6 A;  2RG8 A;  2RD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...