3D9PA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVTVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 53
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9pA00
3ZYQA 5CMYA 1H0AA 4AVXA 2KM4A 1UJKA 1X5BA 3D9IA 1PY1A 3CLJA 2DIWA 5LOZA 2LO6A 5LP0A 4Q96A 2V8SE 5J08A 4NACA 3D9LA 4Q94A 2QY7A 4HFGA 3G2WA 1JPLA 1EYHA 3ZYMA 3G2SA 3G2UA 1HG2A 2L0IA 1HFAA 3ZYKA 3D9NA 3LDZA 1DVPA 2L0TB 3D9JA 1LF8A 2DCPA 3G2TA 1VDYA 1XGWA 2MOWA 1ELKA 3D9OA 1HF8A 3D9KA 3ONKA 4GZCA 3RRUA 1JWFA 1SZAA 1JWGA 2BF0X 3ONLA 1UJJA 1MHQA 3G2VA 4FLBA 3D9MA 1HX8A 1INZA 1SZ9A 3ZYLA 5CMWA 4JXTA 3D9PA 4FU3A 4GZDA 1HG5A 1EDUA 1JUQA
chains in the Genus database with same CATH superfamily
4TXQA 1N11A 4U8HA 1MYOA 3ZGQA 3PZ2A 1E8ZA 1YYHA 4G2VA 3EHQA 4K5BA 3ULYA 5EN5D 4L2LA 4M7CA 4IN3B 4AP2A 4ZFHA 4HRLA 3PZDA 4GTTA 4XIFA 2I1KA 4I9EA 3VTXA 1H2VC 2IF4A 3HXBA 2QYUA 4DX5D 5AAOA 4BX8A 2ZGDA 1RW2A 3ONKA 1K1AA 2EQXA 3PE3A 3UM2A 2CG3A 3ESKA 4GZDA 3E4BA 5KJLA 3UUXA 4EPZA 5EIDA 4BERA 3JXIA 3J5QB 2A5UA 5AJDA 2LAIA 1MHQA 3URZA 3UI2A 4FULA 3AS8A 4HI8A 3MX3A 4IULA 5KBAA 4A63B 1W3BA 3CLJA 3PZ1A 3V2OA 3ZEFA 1LF8A 3S7FA 3CR3A 3RIBA 3ESLA 3RJVA 3CKBA 2WXRA 4AIFA 4AM9A 3UXGA 5ARGA 3QK0A 2GRQB 4ANVA 4H7YA 2XENA 3LKUA 4WAFA 3TWUA 4U96D 1Q2ZA 4N5QA 2L0IA 4I6EA 4FLHA 2GGFA 5EYLA 3D9JA 5T8IA 3ABME 3PUJA 5FQ6A 5LCWC 4YDOA 3V30A 3TWVA 1TJFA 4GYWA 5HI7A 3LXUX 1WM5A 2XGSA 1NP7A 3AG3E 2KC7A 3SHFA 4DUIA 3S7DA 3RRUA 2VGXA 3G2VA 4HOSA 1S64A 3FULA 5D0QD 3BQOA 4U0SA 2FEZA 3WG7E 3LEWA 4ANXA 4Q96A 4YNDA 4CGVA 3U64A 1H2TC 5EIBE 2J8SD 5HRYA 2LAHA 2R17C 1E7UA 3SGHA 3U3WA 1SZ9A 3D9PA 4N3BA 3ZFWA 4DJAA 2P9PG 2EIJE 3FUIA 3LJNA 3G2WA 4AY5A 2BEDA 3PZ4A 3ULEG 4N3CA 2IOLA 4G1TA 3JUIA 3ZUVB 3FH7A 5EKQD 4APFA 1H6KA 4PS3A 3U66A 1IYGA 2WXMA 4TRQA 3B7UX 3G2SA 2LSVA 3T9KA 4J8EA 4UWKA 1K8KG 2WM9A 5BPPA 3IBEA 1N4RA 1JWGA 5HQ8A 3UT4A 2R2LA 2YNQA 1UOHA 3AU5A 3UT7A 1HO8A 4I17A 2XEVA 5B3SE 4FHJA 3CQCB 1OT8A 3W9GA 3N71A 4ILGA 5E75A 3QNKA 4EZKA 4GTSA 5HS0A 1ELKA 3QJZA 3AG1E 4HI9A 4RQIA 4LERA 3S7BA 4JB8P 2IQCA 4I9CA 5AENA 2CFUA 3L82A 4URKA 2NXPA 2WXLA 1IQRA 3Q7FA 4K5AB 4LNUD 3CGHA 3FU3A 4GZ6A 2ZIRA 4EZJA 1S0PA 1A5EA 1GW6A 4L9PA 1YCSB 1AP7A 2IEJA 4NIKA 2BTDA 3MKRA 1O1TA 3EDTB 4HFGA 2XCCA 5CEDB 2YHCA 3PRZA 3Q78A 4YVOA 2XEEA 3TG5A 3QOUA 3ZRHA 5T3RA 2P58C 3CEQA 5HKPA 2AWIA 5E76A 3BG0B 3UMVA 4Q94A 5FZSA 4YDWA 2VSNA 3APCA 4FP7A 2HO1A 3JXJA 5B1AE 2H6HA 3CHRA 3ONLA 2XPIA 2Y4UA 1EF1C 3KAEA 5FQ7A 4MRUA 3Q47B 3ZYMA 4YDEA 3ZVVA 3K9IA 3LY7A 4ILHB 2UY1B 2ETBA 3TJPA 2GRPB 2P9NG 1WG0A 1KLXA 3Q79A 1UJJA 3I4RB 4BTBA 1HX8A 3PZ3A 4KT6B 3SBTB 1WDYA 4DX6D 4OAVB 5D0OD 4L1BA 2Q7FA 5FQ8A 3SO8A 5BXOA 5EYPF 4UI9J 2F0YA 2FO7A 3T5XA 1Z3XA 3OXLA 3BUAA 3HG0D 3R9AB 4ANUA 4AXHA 4C9BB 1N0RA 3Q9NC 1S63A 4ABNA 1SA5A 4LRZA 2RG8A 3ENEA 4FJZA 2WXNA 3ISMC 4K5CA 1IXVA 3SI5A 4B94A 4HOTA 3UKUG 2C0LA 1H19A 4GU5A 3D9NA 1QZ2A 2IY0C 3PVLA 5FZRA 3FWVA 4AEZC 5G05C 1BD8A 2R02A 1TJCA 4TUMA 4F53A 3R9MA 3CHOA 2KZTA 3L13A 3JQ1A 3FEXA 4OVVA 2J09A 3DWLG 3DEOA 3IHYA 2ZGGA 3CVXA 4LEUA 3DPYA 3VTYA 1MX2A 3SBSA 1X5BA 4B89A 1FT1A 3FU5A 2EINE 1N4SA 1HFAA 3CHQA 2V4LA 3FUKA 3ZW3A 4JA7A 4V3IA 2ZXWE 4JD2G 2P2CP 4HLLA 3KSLA 2CHWA 5LP0A 2BUGA 4KMOA 1YMPA 2JEKA 3EHRA 3T8KA 3ZKJA 3NZSA 5FQ4A 5J90A 4CT4A 1Y6IA 2ETAA 2B6CA 5D66A 1EDUA 2QFCA 3SQVA 4UWLA 4UUCA 4ANWA 2J49A 1FVHA 3T8MA 2ILRA 1TN7A 4KVMA 3EJNA 3VLDA 4GMRA 1KT0A 3CV0A 3ZXSA 3RAUA 1HXIA 5JA4D 3UIPC 2IOSA 2LXLA 2WXHA 3LYAA 4FJYA 2YINA 3HDXA 3QWWA 3DPDA 3NZUA 3OXFA 4GCOA 5T4YA 4FA6A 4JL0A 3DSXA 1DCEA 2JABA 1A17A 1BLXB 3FUNA 1TNBA 3NF1A 4ACLA 4GTMA 4NQ0A 3ZXPA 1Z5SC 2H6FA 4WNGA 3Q4AB 1OY3D 1OWOA 5G55A 1OCZE 4WNFA 4BSXA 5A23A 4JVSA 4FU3A 4KZCA 2IO3C 4UI9K 1OUVA 5LX8A 1P5QA 4U04A 3CK8A 4HXIA 1IHGA 3I3NA 2H6IA 1QNFA 2AXZA 1N95A 3PEUB 1DCQA 2CHZA 2VGXB 2LUHA 3SNXA 2R5SA 2HM8A 2DBAA 3APFA 1MQSA 1K3ZD 2KATA 3TG4A 3L17A 2XHEA 3D9KA 3NOCD 4HRMB 4WNEA 4RG9A 4QFVA 4KXKB 4O1PA 3UM1A 3MYVA 2XQ0A 4D10C 3CSTA 5BW8C 4F6RD 1SA4A 3EU9A 3HHMA 1TEZA 3VLEA 4UWFA 4O6FA 1UW4B 3B13A 3IV0A 4J8YA 5J08A 1OCOE 3B95A 2WVIA 1JWFA 3JYSA 5CBOA 1NL4A 2VTBB 1FCHA 3TWRA 4G25A 2XCBA 2VJ8A 4GTQA 5KNHD 1IHBA 2L6BA 1U3CA 2XPYA 4G26A 4A3VA 4N3AA 4RVBA 1EYHA 5FWQA 4G23A 4BETA 3ASOE 2GRRB 2HE0A 3AU4A 4PS7A 4GMJA 2IO2C 3D9HA 4BWRA 2WPVA 2X6FA 3ZNGA 1O1SA 2XRYA 5BUZA 3NBNB 2OVBA 3R7QA 4HB5A 4F7AA 3D3MA 3FUHA 2P9SG 1LD8A 4N2QA 3AS4A 4B0ZA 2I2OA 2PQNA 3FHEA 2P9LG 5AQAA 4LG6A 2J9QA 4TUUA 5JMND 4J8SA 4TXRA 3T5VA 5KWDA 2AVPA 2VTBA 4HBDA 2X38A 2DCPA 2Y4TA 2OEVA 2J07A 1Z3YA 2DZNA 3QKYA 4CDMA 2QYJA 1LD7A 1PAQA 4G8LA 1QQEA 3FU0A 2IJGX 4JHKA 3ML8A 3ASFA 2NC9A 2L0TB 3Q7AA 4ZHBA 4PS8A 3RK6A 2UWJG 2VGYA 3UX4A 4BFRA 1MZCA 4AVXA 1N52A 3ASDA 2GRLA 4RG6A 1FVFA 5AARA 4KBQA 3IEGA 1HG2A 3Q73A 2B0OE 3PNLB 2RFMA 1DVPA 2OV8A 1OXJA 2KCVA 1TNOA 4YDYA 3CHSA 3PEVB 2PM7A 4I6JA 3CVNA 4U8YD 1JCQA 3L16A 1JUQA 2DIWA 3UM3A 4C48B 2FO1E 4EECA 4GAAA 2V4HC 5FINA 2FBNA 4NURA 4YVQC 3VLFA 2AXVA 4WWNA 1TNZA 2YQ8A 3DSUA 4GTRA 3WXXA 3RRMB 5CMYA 3ABKE 1KPSB 5JHAA 2PL2A 4R7LA 2XS8A 3MV2B 3GW4A 2XS1A 1L5JA 5BNWA 3KS2A 3CK9A 4J8FA 3V79K 3DXMG 4JPSA 3L08A 2HYZA 3KD7A 3ZYQA 4F1SA 3FTUA 4ACKA 4DK5A 3ZIMA 3APDA 2KXPC 5EILA 4XZ4A 3HVEA 3MA5A 3JCKC 3RO2A 1TNUA 2JLBA 3U9WA 5CHEE 5JJ7A 3QDNA 3QWVA 4B8AA 4JEUA 3SY2A 5AQ9A 3QB2A 1BI7B 1PC2A 3PUKA 3CVYA 4F1PA 2KZTB 1XNFA 2FULA 1H6PA 4DI4A 1H2UA 1N4PA 3F6QA 2I6HA 3LS8A 4Q69A 1TR4A 5KJNA 2OVFA 4DPRA 1OWNA 2WXJA 4MLPA 3G2UA 3NOGD 2CG2A 2WMNA 1KZOA 4GPKA 3EU5A 1Z6TA 5AQ7A 4JXTA 2AJAA 4Y6CA 3ABLE 3W9FA 5G04J 2WB2A 3UKRG 4JEHA 4JA9A 3SFYA 3C3OA 1JCRA 5BV1A 3DSTA 5EX0A 5JJ6A 4A3TA 3UINC 1DC2A 3UQ3A 3LY9A 1BI8B 1MJ0A 3GZSA 2MHKA 3TWSA 2AXUA 3NAWA 4GPMA 5B1BE 3TWXA 4UQYA 4XKBA 3G2TA 2OEWA 2Y1LE 3FY4A 4CDRA 3Q75A 2WMOA 2P9KG 2XRZA 5LFAA 5H7PA 2C2LA 3HXFA 4BX9A 2DYRE 2BKGA 1N4QA 2GRNB 5ENNA 1ZB1A 1HS6A 3C72A 3CQGB 1SZAA 4MS6A 3Q15A 2F8YA 4FLBA 4APOA 2DYSE 2AW6A 3P2BA 5ENQD 3FH8A 2E0IA 4MBGA 2VYIA 1IKND 2LSUA 5ANRA 4NACA 1SQMA 3RSEG 3SD5A 5C2YA 4UWGA 2P9UG 4H7XA 4U07A 5AQBA 1HE8A 4CCAA 4HORA 3CVLA 3RRNB 2EIME 4UQZA 4G11A 1PY1A 1DNPA 5A7DB 4XKCA 1HH8A 3AAAC 3MZLB 1KT1A 3QWPA 4GA0A 1QYMA 4U8VD 3TWQA 3RU0A 3D9OA 3ZU7B 3ZHEA 2BF0X 4P29A 3BG1B 4J0UA 4BESA 2NSZA 4KVOA 4TV3A 4GCNA 4A1GA 1HU3A 4DLQA 5BT1A 3EHMA 4O60A 3B7SA 1B89A 2GW1A 3CSFA 2A4ZA 3SZ7A 3ULQA 4IRUA 3Q49B 4UI9C 1YA0A 1ELWA 5DBKA 4X8QA 3JQ0A 4I1MA 4GTOA 3HXEA 2HR2A 2NYJA 1VDYA 2XGOA 5CEAA 1N94A 2WQHA 3DEPA 3HIZA 4DX2A 5ENTD 5ENSD 5CCMA 5ENPD 1H0AA 1NA3A 3QAQA 4IYPA 5G04C 3FUMA 3FUFA 3ASHA 1G3NB 2LXMA 2M63A 3PNTB 3QARA 5D2MC 2WQ6A 4AV7A 4JZYA 4WWOA 4LNGA 4L23A 5JJTA 4GTVA 3SFXA 4FC8A 1UN9A 2J4DA 2Y69E 3PS6A 2DVWA 2X6KA 3FU6A 3CKCA 4TXPA 3FTVA 3NB2A 5C1DA 2WXIA 1FT2A 2PNNA 1WAO1 4C0MA 1WY6A 5DIZA 2KM4A 5KJKA 3FTZA 4J6IA 4M3OA 3E30A 1ZBPA 3CVWA 2R03A 5EX3A 2VSXE 5CBNA 1S70B 3ZYKA 2KCLA 1XGWA 4XE0A 3CVVA 1MX4A 3V2XA 5KCMA 1MX6A 1OWLA 4BT8A 1RZ4A 1JPLA 4G8KA 2VSYA 1OWPA 4U63A 3SFZA 3L6AA 4RSYA 5AYWD 4PUCA 4WNDA 2WXPA 2RFAA 3LVRE 3TXNA 1TYQG 3TGOA 1JCSA 3OTNA 5AIJA 5KJMA 3C5RA 3D9IA 3EIQC 1N0QA 2J08A 2VSOE 4JW1A 3B7BA 4E6HA 3D9MA 1X81A 3E37A 1D9SA 5CCLA 4FADA 2OOEA 2WXFA 4U0UA 4I2ZA 2F8XK 2EIKE 4EHMA 3J5PA 4HQDA 3RO3A 1E8WA 3AG4E 1NI1A 5FTPA 5EDSA 3MCXA 3BEEA 3O48A 4UQXA 4QQIA 2EILE 2MRIA 1E90A 5FZQA 2WXOA 1AWCB 2IFUA 2V5QC 3CVPA 4KZ0A 5FJYA 2WXKA 3PREA 4JHJA 4K03A 5CRUA 1NA0A 2I1JA 2YHEA 1NZNA 3D9LA 3I5PA 3LPZA 3DSVA 4MKTA 4N39A 3R7RA 2VQ2A 3LCAA 3EUVA 3C3QA 4J7WA 3NQPA 3TXMA 1TN6A 2PQRA 3FUJA 4Z68A 3GYZA 3FTSA 3FTYA 5FIOA 2J4BA 3ML9A 3Q9UC 4U7EB 3HXDA 5BXUA 3UPVA 3L54A 4ATZD 4U95D 1E8YA 5ANLA 4HNAD 3TL5A 4LSZE 2CFZA 5CMWA 3TWWA 2Y3AA 1V55E 4GA2A 3HRAA 1SVXA 3DSWA 2L6JA 4CRWA 3L22A 3KEAA 3LVQE 3IHVA 2RD0A 4W9RA 3LDZA 1U3DA 4BY6A 5CERB 2ZU6B 5G05J 4K0RA 4AJWA 3P1UA 3UIOC 4GZ5A 5G2NA 3HVEB 4CEMA 5M72A 4I43A 3LY8A 2X6IA 4BSZB 3QC1A 3CK7A 2LO6A 3MKQB 3O4ZA 4OVUA 3BU8A 4BTAA 2DZOA 1ZU2A 4DX7D 2R59A 2ETCA 3HXCA 3TAXA 2FF4A 3ZN3A 3DBSA 3ZPJA 4B8CB 3E34A 2GROB 5AN8A 3FTWA 1NFIE 2PM6A 5LOZA 1BU9A 2V5FA 2V0PA 5AJLA 4ILIA 3HYMB 3FFLA 3E32A 3I4GA 4WUYA 4GZ3A 4DI3A 4HOUA 4GMLA 4I1OB 4J8DA 1UJKA 4CDNA 4CZ2D 2CHXA 3B7TA 2MYOA 3DRAA 2R05A 4F3VA 2I9CA 1K1BA 3V31A 4GB9A 3LJ3A 2H6GA 3CVQA 1QBQA 3Q5MA 2L9BA 5CRVA 1INZA 1E7VA 2X6HA 1N54A 3AG2E 5KNGA 3MKQA 2WQ7A 4BT9A 2VGEA 3JUEA 4HS2A 5CECB 1N9AA 3OXGA 4PDXA 4A1SA 4L7TA 4ME2A 4L2YA 3S2AA 3C98A 2Y0BG 4JHRA 2XZTG 4GZCA 4OYSA 5IY5E 3IXEA 4CT0A 3UM0A 4OAUC 3S7JA 4GA1A 3AS5A 3MJWA 3MGBA 4HOQA 1O1RA 3CHMA 4JC8A 1UN8A 3FUEA 2MOWA 4DLOA 4I6GA 4XI0A 5FT9A 2ONDA 1KZPA 3FEYA 2E2EA 4LUNU 1D8EA 4EBAG 4GYYA 4N5CA 3IKOB 3EIJA 3KEZA 4C0EA 1IQUA 3E33A 2KCKA 3FDHA 4ATGA 1UG3A 4NRHB 3CVUA 2F37A 4AY6A 1D8DA 4WWPA 3CHPA 3ZYLA 1ELRA 2UY1A 4LCTA 2ZISA 4EBAA 4KYOB 5A6CA 3MV3B 4I1AA 4EQFA 3FP3A 4FHKA 3ASNE 4LNBA 5ENRD 4E85A 1HF8A 4I2WA 2X3MA 3X2QE 3UT8A 1OCCE 3MEKA 2X6JA 3OAWA 2C0MA 3ZHEB 1O5MA 2IU1A 4CYMD 1TN8A 1E96B 3B7RL 3ASGA 2V8SE 3GZ1A 3FH5A 3CIAA 1OWMA 1H6OA 3DSSA 5JHBA 4N2SA 3EHNA 3GZ2A 3DXKG 4Y6WA 1EPUA 3RKVA 3FUDA 4GTPA 2P9IG 4HLEA 2XEHA 3FTXA 2DWZA 3PE4A 4DRXE 1Y8MA 4U0ZA 3SF4A 4XX5A 2QZAA 1SW6A 2FI7A 4PH4B 5LCWJ 1LTXA 3UTMA 4HVBA 2WXGA 4XI9A 4A55A 4G24A 2PZIA 5BV0A 3PDNA 5ENOD 4AOFA 4O1OA 4EZLA 2XGMA 2IONA 3AJIA 1V54E 2KBXA 3TWTA 4XEIG 1HZ4A 2XPZA 2OCCE 2RKKA 2QC9A 1U2VG 4UWHA 2WXQA 3L9TA 4GYOA 5ARFA 1OCRE 1TNYA 4HRNA 4BEPA 2A5EA 3U4TA 4DX1A 2GRMA 3KSQA 2LNIA 4RLYA 1BPOA 2BKKB 2QY7A 4CGWA 3C3RA 2XZDG 3PH0C 1E8XA 5ITZF 4B93B 1HG5A 1FPPA
chains in the Genus database with same CATH topology
5AIJA 5KJMA 5J08A 3D9IA 3EIQC 3SI5A 2DIWA 2J08A 4B94A 4U8HA 4HOTA 2C0LA 1H19A 2VSOE 4EECA 4GAAA 4JW1A 4GU5A 3ZGQA 2FBNA 3D9NA 4NURA 4YVQC 1E8ZA 3VLFA 2AXVA 1QZ2A 4WWNA 4G2VA 2YQ8A 4E6HA 3PVLA 5FZRA 3D9MA 3FWVA 4AEZC 4L2LA 5G05C 3WXXA 5CCLA 4IN3B 3RRMB 2OOEA 4FADA 1TJCA 4AP2A 5CMYA 5JHAA 2WXFA 2PL2A 4F53A 4U0UA 3CHOA 4R7LA 3PZDA 4I2ZA 2KZTA 4XIFA 3L13A 3JQ1A 3FEXA 2I1KA 4I9EA 3MV2B 3VTXA 1H2VC 2IF4A 3GW4A 4OVVA 3RO3A 1E8WA 5EDSA 5FTPA 2J09A 3MCXA 3BEEA 3O48A 4BX8A 1L5JA 3ONKA 4UQXA 2EQXA 3IHYA 3PE3A 5BNWA 2MRIA 3KS2A 3CK9A 4J8FA 1E90A 5FZQA 3CVXA 2WXOA 2CG3A 4LEUA 2IFUA 4JPSA 3L08A 2HYZA 3ESKA 3KD7A 3CVPA 4GZDA 4KZ0A 3E4BA 5FJYA 2WXKA 3VTYA 3ZYQA 4F1SA 3PREA 5KJLA 3SBSA 3FTUA 1X5BA 4JHJA 4K03A 4B89A 3UUXA 1NA0A 2I1JA 4ACKA 4EPZA 2YHEA 4DK5A 3FU5A 3ZIMA 1NZNA 3D9LA 3I5PA 3APDA 1HFAA 3LPZA 3CHQA 4MKTA 2V4LA 4N39A 2A5UA 3R7RA 4XZ4A 2VQ2A 5AJDA 3HVEA 2LAIA 3FUKA 3MA5A 3JCKC 3LCAA 1MHQA 3ZW3A 3URZA 4JA7A 3NQPA 3RO2A 2JLBA 4FULA 3AS8A 5CHEE 3TXMA 3L16A 4V3IA 3U9WA 5JJ7A 2PQRA 3FUJA 3MX3A 3QDNA 3QWVA 3GYZA 3FTSA 4IULA 4B8AA 1W3BA 3CLJA 3FTYA 2CHWA 4JEUA 2J4BA 3ML9A 5LP0A 2BUGA 3QB2A 4KMOA 1PC2A 2JEKA 3PUKA 3UPVA 3CVYA 3L54A 3ZEFA 2KZTB 1E8YA 1LF8A 5ANLA 3CR3A 3S7FA 3RIBA 1XNFA 2FULA 4DI4A 3TL5A 3ESLA 1H2UA 3NZSA 5FQ4A 5J90A 2CFZA 3RJVA 2I6HA 3CKBA 1Y6IA 3LS8A 2WXRA 4CT4A 4Q69A 5CMWA 4AIFA 4AM9A 2Y3AA 1EDUA 4GA2A 5ARGA 5KJNA 3QK0A 2OVFA 4DPRA 2QFCA 4ANVA 4H7YA 2L6JA 4CRWA 1OWNA 2WXJA 4UWLA 3L22A 3LKUA 4WAFA 3LVQE 4MLPA 3IHVA 4ANWA 2RD0A 3G2UA 4W9RA 2J49A 2L0IA 2CG2A 4I6EA 4FLHA 3LDZA 2GGFA 5T8IA 1U3DA 3D9JA 2WMNA 4GPKA 4BY6A 1FVHA 3T8MA 2ZU6B 3PUJA 2ILRA 1Z6TA 5G05J 4K0RA 4KVMA 4AJWA 3P1UA 4GZ5A 3EJNA 5FQ6A 3VLDA 4JXTA 5G2NA 5LCWC 4Y6CA 1KT0A 3CV0A 3HVEB 4CEMA 3ZXSA 5M72A 5G04J 2WB2A 4I43A 1TJFA 1HXIA 3LY8A 2X6IA 3QC1A 3CK7A 2LO6A 2IOSA 3MKQB 4JEHA 2WXHA 3O4ZA 3LYAA 3LXUX 4FJYA 4GYWA 4JA9A 2YINA 4OVUA 5HI7A 1WM5A 3HDXA 2XGSA 5BV1A 3QWWA 1NP7A 4BTAA 2KC7A 3SHFA 3DPDA 3NZUA 3OXFA 4GCOA 5EX0A 3S7DA 1ZU2A 3RRUA 2R59A 5JJ6A 4A3TA 5T4YA 2VGXA 3G2VA 3TAXA 4FA6A 4HOSA 4JL0A 3UQ3A 2FF4A 3FULA 3LY9A 5D0QD 3ZN3A 3DBSA 3ZPJA 4B8CB 3GZSA 1A17A 2MHKA 3FUNA 3NF1A 2FEZA 3FTWA 4U0SA 4ACLA 3LEWA 2PM6A 5LOZA 4ANXA 2AXUA 4Q96A 4YNDA 4CGVA 3U64A 4NQ0A 1H2TC 4UQYA 4XKBA 2V5FA 2V0PA 3G2TA 4WNGA 2LAHA 3FY4A 5AJLA 4CDRA 2R17C 1E7UA 2WMOA 4ILIA 3Q4AB 3SGHA 1OWOA 3U3WA 3HYMB 3FFLA 5G55A 4WNFA 5LFAA 2XRZA 1SZ9A 3I4GA 4WUYA 4BSXA 5A23A 3D9PA 2C2LA 4JVSA 4FU3A 4GZ3A 4HOUA 4GMLA 4N3BA 3ZFWA 4I1OB 4KZCA 4BX9A 4J8DA 4DJAA 4UI9K 1UJKA 4CDNA 2CHXA 3B7TA 3FUIA 1OUVA 5ENNA 5LX8A 1P5QA 4U04A 3G2WA 3CK8A 4HXIA 4AY5A 1IHGA 4F3VA 3I3NA 1HS6A 4N3CA 2I9CA 2IOLA 3CQGB 3JUIA 4G1TA 4GB9A 3LJ3A 3CVQA 1QNFA 1SZAA 4MS6A 3FH7A 3Q15A 2AXZA 5EKQD 3Q5MA 2L9BA 4FLBA 4APFA 4APOA 1H6KA 2AW6A 1INZA 1E7VA 3PEUB 2X6HA 1N54A 3P2BA 3FH8A 4PS3A 2E0IA 3MKQA 3U66A 2CHZA 2VGXB 2WQ7A 4BT9A 1IYGA 2VYIA 2WXMA 2LSUA 3SNXA 2R5SA 5ANRA 2HM8A 4NACA 2DBAA 3APFA 4HS2A 1SQMA 1MQSA 4TRQA 3B7UX 3G2SA 2LSVA 2KATA 3OXGA 4PDXA 3SD5A 4J8EA 5C2YA 3TG4A 4A1SA 4L7TA 4ME2A 4L2YA 4UWGA 3S2AA 3C98A 4UWKA 3L17A 2WM9A 4H7XA 5BPPA 4JHRA 4U07A 4GZCA 3IBEA 2XHEA 3D9KA 4OYSA 1JWGA 1HE8A 3UT4A 4CCAA 5HQ8A 2YNQA 3AU5A 4WNEA 4CT0A 4RG9A 3UT7A 3S7JA 4GA1A 3AS5A 3CVLA 3MGBA 1HO8A 3MJWA 4I17A 3RRNB 4HORA 4QFVA 4KXKB 2XEVA 4UQZA 4HOQA 4G11A 1PY1A 4FHJA 1DNPA 5A7DB 4XKCA 1HH8A 3MYVA 3CQCB 3CHMA 2XQ0A 3MZLB 4D10C 4JC8A 1KT1A 1UN8A 3N71A 3QWPA 4ILGA 5E75A 3QNKA 4GA0A 3CSTA 3FUEA 4EZKA 3RU0A 3D9OA 2MOWA 1ELKA 5BW8C 3QJZA 3ZHEA 4DLOA 2BF0X 4P29A 4I6GA 4LERA 3BG1B 4J0UA 4XI0A 3S7BA 5FT9A 2NSZA 2ONDA 2IQCA 3HHMA 4I9CA 4KVOA 3FEYA 2E2EA 1TEZA 4LUNU 4TV3A 4GCNA 5AENA 4EBAG 4GYYA 3VLEA 4N5CA 4O6FA 1UW4B 3IKOB 4UWFA 4A1GA 1HU3A 3B13A 3EIJA 3IV0A 2CFUA 3KEZA 4DLQA 5BT1A 4C0EA 3EHMA 1IQUA 4URKA 2KCKA 3B7SA 3FDHA 2NXPA 1B89A 4ATGA 2GW1A 2WXLA 3CSFA 1IQRA 2WVIA 1UG3A 2A4ZA 4NRHB 1JWFA 3CGHA 3JYSA 3SZ7A 3ULQA 3CVUA 3FU3A 2VTBB 4AY6A 1FCHA 3Q49B 4GZ6A 4IRUA 4G25A 2XCBA 4WWPA 2VJ8A 3CHPA 4EZJA 3ZYLA 1S0PA 1ELRA 1GW6A 2UY1A 4UI9C 1YA0A 1ELWA 4LCTA 5DBKA 4EBAA 1U3CA 2BTDA 3MKRA 4KYOB 2XPYA 3JQ0A 4G26A 4A3VA 5A6CA 3EDTB 4N3AA 3MV3B 4I1AA 4I1MA 4HFGA 4RVBA 1EYHA 2XCCA 5FWQA 4EQFA 2YHCA 4G23A 3FP3A 4FHKA 3PRZA 4YVOA 2HR2A 3AU4A 4PS7A 4E85A 1VDYA 4GMJA 1HF8A 4I2WA 2XGOA 2X3MA 3TG5A 3UT8A 3QOUA 3ZRHA 2WQHA 3HIZA 3MEKA 2X6JA 5T3RA 4BWRA 2WPVA 3OAWA 2P58C 2C0MA 2X6FA 3CEQA 3ZHEB 5CCMA 2IU1A 1H0AA 1NA3A 2AWIA 1E96B 3B7RL 3ASGA 3QAQA 5E76A 3BG0B 4IYPA 5G04C 3UMVA 2XRYA 5BUZA 2OVBA 2V8SE 4Q94A 3FUMA 3FUFA 3ASHA 3FH5A 2M63A 2VSNA 3CIAA 3GZ1A 3PNTB 3QARA 3APCA 4FP7A 5FZSA 3R7QA 4AV7A 1OWMA 4JZYA 2WQ6A 4F7AA 4WWOA 2HO1A 3D3MA 5JHBA 3FUHA 4N2SA 4L23A 3EHNA 3GZ2A 3CHRA 5JJTA 3ONLA 4N2QA 3AS4A 4Y6WA 2XPIA 4B0ZA 2Y4UA 4FC8A 1EF1C 3KAEA 1EPUA 3RKVA 2I2OA 2PQNA 3FUDA 1UN9A 2J4DA 5FQ7A 4MRUA 3PS6A 3Q47B 3ZYMA 3FHEA 4HLEA 3ZVVA 3K9IA 3LY7A 4ILHB 2UY1B 2J9QA 2X6KA 3FTXA 4TUUA 4J8SA 3FU6A 3CKCA 3PE4A 3T5VA 3FTVA 3TJPA 1KLXA 2AVPA 2VTBA 1Y8MA 2X38A 4U0ZA 3SF4A 2DCPA 5C1DA 4XX5A 2Y4TA 2WXIA 2FI7A 1UJJA 3I4RB 4PH4B 4BTBA 5LCWJ 1HX8A 4HVBA 4KT6B 3SBTB 2WXGA 1WAO1 4C0MA 1WY6A 1Z3YA 2J07A 2KM4A 5DIZA 5KJKA 3QKYA 4XI9A 5D0OD 4A55A 4G24A 4CDMA 2PZIA 5BV0A 3PDNA 3FTZA 1PAQA 4J6IA 4M3OA 1ZBPA 3CVWA 4AOFA 4EZLA 2XGMA 2IONA 4DI3A 1QQEA 5EX3A 4L1BA 3FU0A 2IJGX 2VSXE 4JHKA 3ML8A 3ASFA 3ZYKA 1HZ4A 2NC9A 2XPZA 2KCLA 2L0TB 2Q7FA 1XGWA 5FQ8A 4PS8A 3RK6A 4XE0A 2UWJG 3CVVA 2VGYA 4UI9J 3UX4A 4UWHA 4BFRA 2WXQA 4GYOA 5ARFA 2FO7A 3T5XA 4AVXA 5KCMA 3U4TA 1Z3XA 2GRMA 1N52A 2LNIA 2GRLA 3ASDA 3OXLA 1OWLA 1BPOA 4BT8A 4RG6A 1FVFA 2QY7A 1JPLA 3R9AB 4ANUA 4CGWA 2VSYA 3IEGA 4KBQA 1HG2A 1OWPA 4U63A 3SFZA 3L6AA 3PNLB 4RSYA 5AYWD 4AXHA 4PUCA 1DVPA 2OV8A 2KCVA 3PH0C 4WNDA 2WXPA 4C9BB 3TXNA 3LVRE 1E8XA 3CHSA 3PEVB 4ABNA 3TGOA 2PM7A 4LRZA 2RG8A 4I6JA 3ENEA 4FJZA 2WXNA 3CVNA 1HG5A 3OTNA 1JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYQ A;  5CMY A;  1H0A A;  4AVX A;  2KM4 A;  1UJK A;  1X5B A;  3D9I A;  1PY1 A;  3CLJ A;  2DIW A;  5LOZ A;  2LO6 A;  5LP0 A;  4Q96 A;  2V8S E;  5J08 A;  4NAC A;  3D9L A;  4Q94 A;  2QY7 A;  4HFG A;  3G2W A;  1JPL A;  1EYH A;  3ZYM A;  3G2S A;  3G2U A;  1HG2 A;  2L0I A;  1HFA A;  3ZYK A;  3D9N A;  3LDZ A;  1DVP A;  2L0T B;  3D9J A;  1LF8 A;  2DCP A;  3G2T A;  1VDY A;  1XGW A;  2MOW A;  1ELK A;  3D9O A;  1HF8 A;  3D9K A;  3ONK A;  4GZC A;  3RRU A;  1JWF A;  1SZA A;  1JWG A;  2BF0 X;  3ONL A;  1UJJ A;  1MHQ A;  3G2V A;  4FLB A;  3D9M A;  1HX8 A;  1INZ A;  1SZ9 A;  3ZYL A;  5CMW A;  4JXT A;  3D9P A;  4FU3 A;  4GZD A;  1HG5 A;  1EDU A;  1JUQ A; 
#chains in the Genus database with same CATH topology
 4TXQ A;  1N11 A;  4U8H A;  1MYO A;  3ZGQ A;  3PZ2 A;  1E8Z A;  1YYH A;  4G2V A;  3EHQ A;  4K5B A;  3ULY A;  5EN5 D;  4L2L A;  4M7C A;  4IN3 B;  4AP2 A;  4ZFH A;  4HRL A;  3PZD A;  4GTT A;  4XIF A;  2I1K A;  4I9E A;  3VTX A;  1H2V C;  2IF4 A;  3HXB A;  2QYU A;  4DX5 D;  5AAO A;  4BX8 A;  2ZGD A;  1RW2 A;  3ONK A;  1K1A A;  2EQX A;  3PE3 A;  3UM2 A;  2CG3 A;  3ESK A;  4GZD A;  3E4B A;  5KJL A;  3UUX A;  4EPZ A;  5EID A;  4BER A;  3JXI A;  3J5Q B;  2A5U A;  5AJD A;  2LAI A;  1MHQ A;  3URZ A;  3UI2 A;  4FUL A;  3AS8 A;  4HI8 A;  3MX3 A;  4IUL A;  5KBA A;  4A63 B;  1W3B A;  3CLJ A;  3PZ1 A;  3V2O A;  3ZEF A;  1LF8 A;  3S7F A;  3CR3 A;  3RIB A;  3ESL A;  3RJV A;  3CKB A;  2WXR A;  4AIF A;  4AM9 A;  3UXG A;  5ARG A;  3QK0 A;  2GRQ B;  4ANV A;  4H7Y A;  2XEN A;  3LKU A;  4WAF A;  3TWU A;  4U96 D;  1Q2Z A;  4N5Q A;  2L0I A;  4I6E A;  4FLH A;  2GGF A;  5EYL A;  3D9J A;  5T8I A;  3ABM E;  3PUJ A;  5FQ6 A;  5LCW C;  4YDO A;  3V30 A;  3TWV A;  1TJF A;  4GYW A;  5HI7 A;  3LXU X;  1WM5 A;  2XGS A;  1NP7 A;  3AG3 E;  2KC7 A;  3SHF A;  4DUI A;  3S7D A;  3RRU A;  2VGX A;  3G2V A;  4HOS A;  1S64 A;  3FUL A;  5D0Q D;  3BQO A;  4U0S A;  2FEZ A;  3WG7 E;  3LEW A;  4ANX A;  4Q96 A;  4YND A;  4CGV A;  3U64 A;  1H2T C;  5EIB E;  2J8S D;  5HRY A;  2LAH A;  2R17 C;  1E7U A;  3SGH A;  3U3W A;  1SZ9 A;  3D9P A;  4N3B A;  3ZFW A;  4DJA A;  2P9P G;  2EIJ E;  3FUI A;  3LJN A;  3G2W A;  4AY5 A;  2BED A;  3PZ4 A;  3ULE G;  4N3C A;  2IOL A;  4G1T A;  3JUI A;  3ZUV B;  3FH7 A;  5EKQ D;  4APF A;  1H6K A;  4PS3 A;  3U66 A;  1IYG A;  2WXM A;  4TRQ A;  3B7U X;  3G2S A;  2LSV A;  3T9K A;  4J8E A;  4UWK A;  1K8K G;  2WM9 A;  5BPP A;  3IBE A;  1N4R A;  1JWG A;  5HQ8 A;  3UT4 A;  2R2L A;  2YNQ A;  1UOH A;  3AU5 A;  3UT7 A;  1HO8 A;  4I17 A;  2XEV A;  5B3S E;  4FHJ A;  3CQC B;  1OT8 A;  3W9G A;  3N71 A;  4ILG A;  5E75 A;  3QNK A;  4EZK A;  4GTS A;  5HS0 A;  1ELK A;  3QJZ A;  3AG1 E;  4HI9 A;  4RQI A;  4LER A;  3S7B A;  4JB8 P;  2IQC A;  4I9C A;  5AEN A;  2CFU A;  3L82 A;  4URK A;  2NXP A;  2WXL A;  1IQR A;  3Q7F A;  4K5A B;  4LNU D;  3CGH A;  3FU3 A;  4GZ6 A;  2ZIR A;  4EZJ A;  1S0P A;  1A5E A;  1GW6 A;  4L9P A;  1YCS B;  1AP7 A;  2IEJ A;  4NIK A;  2BTD A;  3MKR A;  1O1T A;  3EDT B;  4HFG A;  2XCC A;  5CED B;  2YHC A;  3PRZ A;  3Q78 A;  4YVO A;  2XEE A;  3TG5 A;  3QOU A;  3ZRH A;  5T3R A;  2P58 C;  3CEQ A;  5HKP A;  2AWI A;  5E76 A;  3BG0 B;  3UMV A;  4Q94 A;  5FZS A;  4YDW A;  2VSN A;  3APC A;  4FP7 A;  2HO1 A;  3JXJ A;  5B1A E;  2H6H A;  3CHR A;  3ONL A;  2XPI A;  2Y4U A;  1EF1 C;  3KAE A;  5FQ7 A;  4MRU A;  3Q47 B;  3ZYM A;  4YDE A;  3ZVV A;  3K9I A;  3LY7 A;  4ILH B;  2UY1 B;  2ETB A;  3TJP A;  2GRP B;  2P9N G;  1WG0 A;  1KLX A;  3Q79 A;  1UJJ A;  3I4R B;  4BTB A;  1HX8 A;  3PZ3 A;  4KT6 B;  3SBT B;  1WDY A;  4DX6 D;  4OAV B;  5D0O D;  4L1B A;  2Q7F A;  5FQ8 A;  3SO8 A;  5BXO A;  5EYP F;  4UI9 J;  2F0Y A;  2FO7 A;  3T5X A;  1Z3X A;  3OXL A;  3BUA A;  3HG0 D;  3R9A B;  4ANU A;  4AXH A;  4C9B B;  1N0R A;  3Q9N C;  1S63 A;  4ABN A;  1SA5 A;  4LRZ A;  2RG8 A;  3ENE A;  4FJZ A;  2WXN A;  3ISM C;  4K5C A;  1IXV A;  3SI5 A;  4B94 A;  4HOT A;  3UKU G;  2C0L A;  1H19 A;  4GU5 A;  3D9N A;  1QZ2 A;  2IY0 C;  3PVL A;  5FZR A;  3FWV A;  4AEZ C;  5G05 C;  1BD8 A;  2R02 A;  1TJC A;  4TUM A;  4F53 A;  3R9M A;  3CHO A;  2KZT A;  3L13 A;  3JQ1 A;  3FEX A;  4OVV A;  2J09 A;  3DWL G;  3DEO A;  3IHY A;  2ZGG A;  3CVX A;  4LEU A;  3DPY A;  3VTY A;  1MX2 A;  3SBS A;  1X5B A;  4B89 A;  1FT1 A;  3FU5 A;  2EIN E;  1N4S A;  1HFA A;  3CHQ A;  2V4L A;  3FUK A;  3ZW3 A;  4JA7 A;  4V3I A;  2ZXW E;  4JD2 G;  2P2C P;  4HLL A;  3KSL A;  2CHW A;  5LP0 A;  2BUG A;  4KMO A;  1YMP A;  2JEK A;  3EHR A;  3T8K A;  3ZKJ A;  3NZS A;  5FQ4 A;  5J90 A;  4CT4 A;  1Y6I A;  2ETA A;  2B6C A;  5D66 A;  1EDU A;  2QFC A;  3SQV A;  4UWL A;  4UUC A;  4ANW A;  2J49 A;  1FVH A;  3T8M A;  2ILR A;  1TN7 A;  4KVM A;  3EJN A;  3VLD A;  4GMR A;  1KT0 A;  3CV0 A;  3ZXS A;  3RAU A;  1HXI A;  5JA4 D;  3UIP C;  2IOS A;  2LXL A;  2WXH A;  3LYA A;  4FJY A;  2YIN A;  3HDX A;  3QWW A;  3DPD A;  3NZU A;  3OXF A;  4GCO A;  5T4Y A;  4FA6 A;  4JL0 A;  3DSX A;  1DCE A;  2JAB A;  1A17 A;  1BLX B;  3FUN A;  1TNB A;  3NF1 A;  4ACL A;  4GTM A;  4NQ0 A;  3ZXP A;  1Z5S C;  2H6F A;  4WNG A;  3Q4A B;  1OY3 D;  1OWO A;  5G55 A;  1OCZ E;  4WNF A;  4BSX A;  5A23 A;  4JVS A;  4FU3 A;  4KZC A;  2IO3 C;  4UI9 K;  1OUV A;  5LX8 A;  1P5Q A;  4U04 A;  3CK8 A;  4HXI A;  1IHG A;  3I3N A;  2H6I A;  1QNF A;  2AXZ A;  1N95 A;  3PEU B;  1DCQ A;  2CHZ A;  2VGX B;  2LUH A;  3SNX A;  2R5S A;  2HM8 A;  2DBA A;  3APF A;  1MQS A;  1K3Z D;  2KAT A;  3TG4 A;  3L17 A;  2XHE A;  3D9K A;  3NOC D;  4HRM B;  4WNE A;  4RG9 A;  4QFV A;  4KXK B;  4O1P A;  3UM1 A;  3MYV A;  2XQ0 A;  4D10 C;  3CST A;  5BW8 C;  4F6R D;  1SA4 A;  3EU9 A;  3HHM A;  1TEZ A;  3VLE A;  4UWF A;  4O6F A;  1UW4 B;  3B13 A;  3IV0 A;  4J8Y A;  5J08 A;  1OCO E;  3B95 A;  2WVI A;  1JWF A;  3JYS A;  5CBO A;  1NL4 A;  2VTB B;  1FCH A;  3TWR A;  4G25 A;  2XCB A;  2VJ8 A;  4GTQ A;  5KNH D;  1IHB A;  2L6B A;  1U3C A;  2XPY A;  4G26 A;  4A3V A;  4N3A A;  4RVB A;  1EYH A;  5FWQ A;  4G23 A;  4BET A;  3ASO E;  2GRR B;  2HE0 A;  3AU4 A;  4PS7 A;  4GMJ A;  2IO2 C;  3D9H A;  4BWR A;  2WPV A;  2X6F A;  3ZNG A;  1O1S A;  2XRY A;  5BUZ A;  3NBN B;  2OVB A;  3R7Q A;  4HB5 A;  4F7A A;  3D3M A;  3FUH A;  2P9S G;  1LD8 A;  4N2Q A;  3AS4 A;  4B0Z A;  2I2O A;  2PQN A;  3FHE A;  2P9L G;  5AQA A;  4LG6 A;  2J9Q A;  4TUU A;  5JMN D;  4J8S A;  4TXR A;  3T5V A;  5KWD A;  2AVP A;  2VTB A;  4HBD A;  2X38 A;  2DCP A;  2Y4T A;  2OEV A;  2J07 A;  1Z3Y A;  2DZN A;  3QKY A;  4CDM A;  2QYJ A;  1LD7 A;  1PAQ A;  4G8L A;  1QQE A;  3FU0 A;  2IJG X;  4JHK A;  3ML8 A;  3ASF A;  2NC9 A;  2L0T B;  3Q7A A;  4ZHB A;  4PS8 A;  3RK6 A;  2UWJ G;  2VGY A;  3UX4 A;  4BFR A;  1MZC A;  4AVX A;  1N52 A;  3ASD A;  2GRL A;  4RG6 A;  1FVF A;  5AAR A;  4KBQ A;  3IEG A;  1HG2 A;  3Q73 A;  2B0O E;  3PNL B;  2RFM A;  1DVP A;  2OV8 A;  1OXJ A;  2KCV A;  1TNO A;  4YDY A;  3CHS A;  3PEV B;  2PM7 A;  4I6J A;  3CVN A;  4U8Y D;  1JCQ A;  3L16 A;  1JUQ A;  2DIW A;  3UM3 A;  4C48 B;  2FO1 E;  4EEC A;  4GAA A;  2V4H C;  5FIN A;  2FBN A;  4NUR A;  4YVQ C;  3VLF A;  2AXV A;  4WWN A;  1TNZ A;  2YQ8 A;  3DSU A;  4GTR A;  3WXX A;  3RRM B;  5CMY A;  3ABK E;  1KPS B;  5JHA A;  2PL2 A;  4R7L A;  2XS8 A;  3MV2 B;  3GW4 A;  2XS1 A;  1L5J A;  5BNW A;  3KS2 A;  3CK9 A;  4J8F A;  3V79 K;  3DXM G;  4JPS A;  3L08 A;  2HYZ A;  3KD7 A;  3ZYQ A;  4F1S A;  3FTU A;  4ACK A;  4DK5 A;  3ZIM A;  3APD A;  2KXP C;  5EIL A;  4XZ4 A;  3HVE A;  3MA5 A;  3JCK C;  3RO2 A;  1TNU A;  2JLB A;  3U9W A;  5CHE E;  5JJ7 A;  3QDN A;  3QWV A;  4B8A A;  4JEU A;  3SY2 A;  5AQ9 A;  3QB2 A;  1BI7 B;  1PC2 A;  3PUK A;  3CVY A;  4F1P A;  2KZT B;  1XNF A;  2FUL A;  1H6P A;  4DI4 A;  1H2U A;  1N4P A;  3F6Q A;  2I6H A;  3LS8 A;  4Q69 A;  1TR4 A;  5KJN A;  2OVF A;  4DPR A;  1OWN A;  2WXJ A;  4MLP A;  3G2U A;  3NOG D;  2CG2 A;  2WMN A;  1KZO A;  4GPK A;  3EU5 A;  1Z6T A;  5AQ7 A;  4JXT A;  2AJA A;  4Y6C A;  3ABL E;  3W9F A;  5G04 J;  2WB2 A;  3UKR G;  4JEH A;  4JA9 A;  3SFY A;  3C3O A;  1JCR A;  5BV1 A;  3DST A;  5EX0 A;  5JJ6 A;  4A3T A;  3UIN C;  1DC2 A;  3UQ3 A;  3LY9 A;  1BI8 B;  1MJ0 A;  3GZS A;  2MHK A;  3TWS A;  2AXU A;  3NAW A;  4GPM A;  5B1B E;  3TWX A;  4UQY A;  4XKB A;  3G2T A;  2OEW A;  2Y1L E;  3FY4 A;  4CDR A;  3Q75 A;  2WMO A;  2P9K G;  2XRZ A;  5LFA A;  5H7P A;  2C2L A;  3HXF A;  4BX9 A;  2DYR E;  2BKG A;  1N4Q A;  2GRN B;  5ENN A;  1ZB1 A;  1HS6 A;  3C72 A;  3CQG B;  1SZA A;  4MS6 A;  3Q15 A;  2F8Y A;  4FLB A;  4APO A;  2DYS E;  2AW6 A;  3P2B A;  5ENQ D;  3FH8 A;  2E0I A;  4MBG A;  2VYI A;  1IKN D;  2LSU A;  5ANR A;  4NAC A;  1SQM A;  3RSE G;  3SD5 A;  5C2Y A;  4UWG A;  2P9U G;  4H7X A;  4U07 A;  5AQB A;  1HE8 A;  4CCA A;  4HOR A;  3CVL A;  3RRN B;  2EIM E;  4UQZ A;  4G11 A;  1PY1 A;  1DNP A;  5A7D B;  4XKC A;  1HH8 A;  3AAA C;  3MZL B;  1KT1 A;  3QWP A;  4GA0 A;  1QYM A;  4U8V D;  3TWQ A;  3RU0 A;  3D9O A;  3ZU7 B;  3ZHE A;  2BF0 X;  4P29 A;  3BG1 B;  4J0U A;  4BES A;  2NSZ A;  4KVO A;  4TV3 A;  4GCN A;  4A1G A;  1HU3 A;  4DLQ A;  5BT1 A;  3EHM A;  4O60 A;  3B7S A;  1B89 A;  2GW1 A;  3CSF A;  2A4Z A;  3SZ7 A;  3ULQ A;  4IRU A;  3Q49 B;  4UI9 C;  1YA0 A;  1ELW A;  5DBK A;  4X8Q A;  3JQ0 A;  4I1M A;  4GTO A;  3HXE A;  2HR2 A;  2NYJ A;  1VDY A;  2XGO A;  5CEA A;  1N94 A;  2WQH A;  3DEP A;  3HIZ A;  4DX2 A;  5ENT D;  5ENS D;  5CCM A;  5ENP D;  1H0A A;  1NA3 A;  3QAQ A;  4IYP A;  5G04 C;  3FUM A;  3FUF A;  3ASH A;  1G3N B;  2LXM A;  2M63 A;  3PNT B;  3QAR A;  5D2M C;  2WQ6 A;  4AV7 A;  4JZY A;  4WWO A;  4LNG A;  4L23 A;  5JJT A;  4GTV A;  3SFX A;  4FC8 A;  1UN9 A;  2J4D A;  2Y69 E;  3PS6 A;  2DVW A;  2X6K A;  3FU6 A;  3CKC A;  4TXP A;  3FTV A;  3NB2 A;  5C1D A;  2WXI A;  1FT2 A;  2PNN A;  1WAO 1;  4C0M A;  1WY6 A;  5DIZ A;  2KM4 A;  5KJK A;  3FTZ A;  4J6I A;  4M3O A;  3E30 A;  1ZBP A;  3CVW A;  2R03 A;  5EX3 A;  2VSX E;  5CBN A;  1S70 B;  3ZYK A;  2KCL A;  1XGW A;  4XE0 A;  3CVV A;  1MX4 A;  3V2X A;  5KCM A;  1MX6 A;  1OWL A;  4BT8 A;  1RZ4 A;  1JPL A;  4G8K A;  2VSY A;  1OWP A;  4U63 A;  3SFZ A;  3L6A A;  4RSY A;  5AYW D;  4PUC A;  4WND A;  2WXP A;  2RFA A;  3LVR E;  3TXN A;  1TYQ G;  3TGO A;  1JCS A;  3OTN A;  5AIJ A;  5KJM A;  3C5R A;  3D9I A;  3EIQ C;  1N0Q A;  2J08 A;  2VSO E;  4JW1 A;  3B7B A;  4E6H A;  3D9M A;  1X81 A;  3E37 A;  1D9S A;  5CCL A;  4FAD A;  2OOE A;  2WXF A;  4U0U A;  4I2Z A;  2F8X K;  2EIK E;  4EHM A;  3J5P A;  4HQD A;  3RO3 A;  1E8W A;  3AG4 E;  1NI1 A;  5FTP A;  5EDS A;  3MCX A;  3BEE A;  3O48 A;  4UQX A;  4QQI A;  2EIL E;  2MRI A;  1E90 A;  5FZQ A;  2WXO A;  1AWC B;  2IFU A;  2V5Q C;  3CVP A;  4KZ0 A;  5FJY A;  2WXK A;  3PRE A;  4JHJ A;  4K03 A;  5CRU A;  1NA0 A;  2I1J A;  2YHE A;  1NZN A;  3D9L A;  3I5P A;  3LPZ A;  3DSV A;  4MKT A;  4N39 A;  3R7R A;  2VQ2 A;  3LCA A;  3EUV A;  3C3Q A;  4J7W A;  3NQP A;  3TXM A;  1TN6 A;  2PQR A;  3FUJ A;  4Z68 A;  3GYZ A;  3FTS A;  3FTY A;  5FIO A;  2J4B A;  3ML9 A;  3Q9U C;  4U7E B;  3HXD A;  5BXU A;  3UPV A;  3L54 A;  4ATZ D;  4U95 D;  1E8Y A;  5ANL A;  4HNA D;  3TL5 A;  4LSZ E;  2CFZ A;  5CMW A;  3TWW A;  2Y3A A;  1V55 E;  4GA2 A;  3HRA A;  1SVX A;  3DSW A;  2L6J A;  4CRW A;  3L22 A;  3KEA A;  3LVQ E;  3IHV A;  2RD0 A;  4W9R A;  3LDZ A;  1U3D A;  4BY6 A;  5CER B;  2ZU6 B;  5G05 J;  4K0R A;  4AJW A;  3P1U A;  3UIO C;  4GZ5 A;  5G2N A;  3HVE B;  4CEM A;  5M72 A;  4I43 A;  3LY8 A;  2X6I A;  4BSZ B;  3QC1 A;  3CK7 A;  2LO6 A;  3MKQ B;  3O4Z A;  4OVU A;  3BU8 A;  4BTA A;  2DZO A;  1ZU2 A;  4DX7 D;  2R59 A;  2ETC A;  3HXC A;  3TAX A;  2FF4 A;  3ZN3 A;  3DBS A;  3ZPJ A;  4B8C B;  3E34 A;  2GRO B;  5AN8 A;  3FTW A;  1NFI E;  2PM6 A;  5LOZ A;  1BU9 A;  2V5F A;  2V0P A;  5AJL A;  4ILI A;  3HYM B;  3FFL A;  3E32 A;  3I4G A;  4WUY A;  4GZ3 A;  4DI3 A;  4HOU A;  4GML A;  4I1O B;  4J8D A;  1UJK A;  4CDN A;  4CZ2 D;  2CHX A;  3B7T A;  2MYO A;  3DRA A;  2R05 A;  4F3V A;  2I9C A;  1K1B A;  3V31 A;  4GB9 A;  3LJ3 A;  2H6G A;  3CVQ A;  1QBQ A;  3Q5M A;  2L9B A;  5CRV A;  1INZ A;  1E7V A;  2X6H A;  1N54 A;  3AG2 E;  5KNG A;  3MKQ A;  2WQ7 A;  4BT9 A;  2VGE A;  3JUE A;  4HS2 A;  5CEC B;  1N9A A;  3OXG A;  4PDX A;  4A1S A;  4L7T A;  4ME2 A;  4L2Y A;  3S2A A;  3C98 A;  2Y0B G;  4JHR A;  2XZT G;  4GZC A;  4OYS A;  5IY5 E;  3IXE A;  4CT0 A;  3UM0 A;  4OAU C;  3S7J A;  4GA1 A;  3AS5 A;  3MJW A;  3MGB A;  4HOQ A;  1O1R A;  3CHM A;  4JC8 A;  1UN8 A;  3FUE A;  2MOW A;  4DLO A;  4I6G A;  4XI0 A;  5FT9 A;  2OND A;  1KZP A;  3FEY A;  2E2E A;  4LUN U;  1D8E A;  4EBA G;  4GYY A;  4N5C A;  3IKO B;  3EIJ A;  3KEZ A;  4C0E A;  1IQU A;  3E33 A;  2KCK A;  3FDH A;  4ATG A;  1UG3 A;  4NRH B;  3CVU A;  2F37 A;  4AY6 A;  1D8D A;  4WWP A;  3CHP A;  3ZYL A;  1ELR A;  2UY1 A;  4LCT A;  2ZIS A;  4EBA A;  4KYO B;  5A6C A;  3MV3 B;  4I1A A;  4EQF A;  3FP3 A;  4FHK A;  3ASN E;  4LNB A;  5ENR D;  4E85 A;  1HF8 A;  4I2W A;  2X3M A;  3X2Q E;  3UT8 A;  1OCC E;  3MEK A;  2X6J A;  3OAW A;  2C0M A;  3ZHE B;  1O5M A;  2IU1 A;  4CYM D;  1TN8 A;  1E96 B;  3B7R L;  3ASG A;  2V8S E;  3GZ1 A;  3FH5 A;  3CIA A;  1OWM A;  1H6O A;  3DSS A;  5JHB A;  4N2S A;  3EHN A;  3GZ2 A;  3DXK G;  4Y6W A;  1EPU A;  3RKV A;  3FUD A;  4GTP A;  2P9I G;  4HLE A;  2XEH A;  3FTX A;  2DWZ A;  3PE4 A;  4DRX E;  1Y8M A;  4U0Z A;  3SF4 A;  4XX5 A;  2QZA A;  1SW6 A;  2FI7 A;  4PH4 B;  5LCW J;  1LTX A;  3UTM A;  4HVB A;  2WXG A;  4XI9 A;  4A55 A;  4G24 A;  2PZI A;  5BV0 A;  3PDN A;  5ENO D;  4AOF A;  4O1O A;  4EZL A;  2XGM A;  2ION A;  3AJI A;  1V54 E;  2KBX A;  3TWT A;  4XEI G;  1HZ4 A;  2XPZ A;  2OCC E;  2RKK A;  2QC9 A;  1U2V G;  4UWH A;  2WXQ A;  3L9T A;  4GYO A;  5ARF A;  1OCR E;  1TNY A;  4HRN A;  4BEP A;  2A5E A;  3U4T A;  4DX1 A;  2GRM A;  3KSQ A;  2LNI A;  4RLY A;  1BPO A;  2BKK B;  2QY7 A;  4CGW A;  3C3R A;  2XZD G;  3PH0 C;  1E8X A;  5ITZ F;  4B93 B;  1HG5 A;  1FPP A; 
#chains in the Genus database with same CATH homology
 5AIJ A;  5KJM A;  5J08 A;  3D9I A;  3EIQ C;  3SI5 A;  2DIW A;  2J08 A;  4B94 A;  4U8H A;  4HOT A;  2C0L A;  1H19 A;  2VSO E;  4EEC A;  4GAA A;  4JW1 A;  4GU5 A;  3ZGQ A;  2FBN A;  3D9N A;  4NUR A;  4YVQ C;  1E8Z A;  3VLF A;  2AXV A;  1QZ2 A;  4WWN A;  4G2V A;  2YQ8 A;  4E6H A;  3PVL A;  5FZR A;  3D9M A;  3FWV A;  4AEZ C;  4L2L A;  5G05 C;  3WXX A;  5CCL A;  4IN3 B;  3RRM B;  2OOE A;  4FAD A;  1TJC A;  4AP2 A;  5CMY A;  5JHA A;  2WXF A;  2PL2 A;  4F53 A;  4U0U A;  3CHO A;  4R7L A;  3PZD A;  4I2Z A;  2KZT A;  4XIF A;  3L13 A;  3JQ1 A;  3FEX A;  2I1K A;  4I9E A;  3MV2 B;  3VTX A;  1H2V C;  2IF4 A;  3GW4 A;  4OVV A;  3RO3 A;  1E8W A;  5EDS A;  5FTP A;  2J09 A;  3MCX A;  3BEE A;  3O48 A;  4BX8 A;  1L5J A;  3ONK A;  4UQX A;  2EQX A;  3IHY A;  3PE3 A;  5BNW A;  2MRI A;  3KS2 A;  3CK9 A;  4J8F A;  1E90 A;  5FZQ A;  3CVX A;  2WXO A;  2CG3 A;  4LEU A;  2IFU A;  4JPS A;  3L08 A;  2HYZ A;  3ESK A;  3KD7 A;  3CVP A;  4GZD A;  4KZ0 A;  3E4B A;  5FJY A;  2WXK A;  3VTY A;  3ZYQ A;  4F1S A;  3PRE A;  5KJL A;  3SBS A;  3FTU A;  1X5B A;  4JHJ A;  4K03 A;  4B89 A;  3UUX A;  1NA0 A;  2I1J A;  4ACK A;  4EPZ A;  2YHE A;  4DK5 A;  3FU5 A;  3ZIM A;  1NZN A;  3D9L A;  3I5P A;  3APD A;  1HFA A;  3LPZ A;  3CHQ A;  4MKT A;  2V4L A;  4N39 A;  2A5U A;  3R7R A;  4XZ4 A;  2VQ2 A;  5AJD A;  3HVE A;  2LAI A;  3FUK A;  3MA5 A;  3JCK C;  3LCA A;  1MHQ A;  3ZW3 A;  3URZ A;  4JA7 A;  3NQP A;  3RO2 A;  2JLB A;  4FUL A;  3AS8 A;  5CHE E;  3TXM A;  3L16 A;  4V3I A;  3U9W A;  5JJ7 A;  2PQR A;  3FUJ A;  3MX3 A;  3QDN A;  3QWV A;  3GYZ A;  3FTS A;  4IUL A;  4B8A A;  1W3B A;  3CLJ A;  3FTY A;  2CHW A;  4JEU A;  2J4B A;  3ML9 A;  5LP0 A;  2BUG A;  3QB2 A;  4KMO A;  1PC2 A;  2JEK A;  3PUK A;  3UPV A;  3CVY A;  3L54 A;  3ZEF A;  2KZT B;  1E8Y A;  1LF8 A;  5ANL A;  3CR3 A;  3S7F A;  3RIB A;  1XNF A;  2FUL A;  4DI4 A;  3TL5 A;  3ESL A;  1H2U A;  3NZS A;  5FQ4 A;  5J90 A;  2CFZ A;  3RJV A;  2I6H A;  3CKB A;  1Y6I A;  3LS8 A;  2WXR A;  4CT4 A;  4Q69 A;  5CMW A;  4AIF A;  4AM9 A;  2Y3A A;  1EDU A;  4GA2 A;  5ARG A;  5KJN A;  3QK0 A;  2OVF A;  4DPR A;  2QFC A;  4ANV A;  4H7Y A;  2L6J A;  4CRW A;  1OWN A;  2WXJ A;  4UWL A;  3L22 A;  3LKU A;  4WAF A;  3LVQ E;  4MLP A;  3IHV A;  4ANW A;  2RD0 A;  3G2U A;  4W9R A;  2J49 A;  2L0I A;  2CG2 A;  4I6E A;  4FLH A;  3LDZ A;  2GGF A;  5T8I A;  1U3D A;  3D9J A;  2WMN A;  4GPK A;  4BY6 A;  1FVH A;  3T8M A;  2ZU6 B;  3PUJ A;  2ILR A;  1Z6T A;  5G05 J;  4K0R A;  4KVM A;  4AJW A;  3P1U A;  4GZ5 A;  3EJN A;  5FQ6 A;  3VLD A;  4JXT A;  5G2N A;  5LCW C;  4Y6C A;  1KT0 A;  3CV0 A;  3HVE B;  4CEM A;  3ZXS A;  5M72 A;  5G04 J;  2WB2 A;  4I43 A;  1TJF A;  1HXI A;  3LY8 A;  2X6I A;  3QC1 A;  3CK7 A;  2LO6 A;  2IOS A;  3MKQ B;  4JEH A;  2WXH A;  3O4Z A;  3LYA A;  3LXU X;  4FJY A;  4GYW A;  4JA9 A;  2YIN A;  4OVU A;  5HI7 A;  1WM5 A;  3HDX A;  2XGS A;  5BV1 A;  3QWW A;  1NP7 A;  4BTA A;  2KC7 A;  3SHF A;  3DPD A;  3NZU A;  3OXF A;  4GCO A;  5EX0 A;  3S7D A;  1ZU2 A;  3RRU A;  2R59 A;  5JJ6 A;  4A3T A;  5T4Y A;  2VGX A;  3G2V A;  3TAX A;  4FA6 A;  4HOS A;  4JL0 A;  3UQ3 A;  2FF4 A;  3FUL A;  3LY9 A;  5D0Q D;  3ZN3 A;  3DBS A;  3ZPJ A;  4B8C B;  3GZS A;  1A17 A;  2MHK A;  3FUN A;  3NF1 A;  2FEZ A;  3FTW A;  4U0S A;  4ACL A;  3LEW A;  2PM6 A;  5LOZ A;  4ANX A;  2AXU A;  4Q96 A;  4YND A;  4CGV A;  3U64 A;  4NQ0 A;  1H2T C;  4UQY A;  4XKB A;  2V5F A;  2V0P A;  3G2T A;  4WNG A;  2LAH A;  3FY4 A;  5AJL A;  4CDR A;  2R17 C;  1E7U A;  2WMO A;  4ILI A;  3Q4A B;  3SGH A;  1OWO A;  3U3W A;  3HYM B;  3FFL A;  5G55 A;  4WNF A;  5LFA A;  2XRZ A;  1SZ9 A;  3I4G A;  4WUY A;  4BSX A;  5A23 A;  3D9P A;  2C2L A;  4JVS A;  4FU3 A;  4GZ3 A;  4HOU A;  4GML A;  4N3B A;  3ZFW A;  4I1O B;  4KZC A;  4BX9 A;  4J8D A;  4DJA A;  4UI9 K;  1UJK A;  4CDN A;  2CHX A;  3B7T A;  3FUI A;  1OUV A;  5ENN A;  5LX8 A;  1P5Q A;  4U04 A;  3G2W A;  3CK8 A;  4HXI A;  4AY5 A;  1IHG A;  4F3V A;  3I3N A;  1HS6 A;  4N3C A;  2I9C A;  2IOL A;  3CQG B;  3JUI A;  4G1T A;  4GB9 A;  3LJ3 A;  3CVQ A;  1QNF A;  1SZA A;  4MS6 A;  3FH7 A;  3Q15 A;  2AXZ A;  5EKQ D;  3Q5M A;  2L9B A;  4FLB A;  4APF A;  4APO A;  1H6K A;  2AW6 A;  1INZ A;  1E7V A;  3PEU B;  2X6H A;  1N54 A;  3P2B A;  3FH8 A;  4PS3 A;  2E0I A;  3MKQ A;  3U66 A;  2CHZ A;  2VGX B;  2WQ7 A;  4BT9 A;  1IYG A;  2VYI A;  2WXM A;  2LSU A;  3SNX A;  2R5S A;  5ANR A;  2HM8 A;  4NAC A;  2DBA A;  3APF A;  4HS2 A;  1SQM A;  1MQS A;  4TRQ A;  3B7U X;  3G2S A;  2LSV A;  2KAT A;  3OXG A;  4PDX A;  3SD5 A;  4J8E A;  5C2Y A;  3TG4 A;  4A1S A;  4L7T A;  4ME2 A;  4L2Y A;  4UWG A;  3S2A A;  3C98 A;  4UWK A;  3L17 A;  2WM9 A;  4H7X A;  5BPP A;  4JHR A;  4U07 A;  4GZC A;  3IBE A;  2XHE A;  3D9K A;  4OYS A;  1JWG A;  1HE8 A;  3UT4 A;  4CCA A;  5HQ8 A;  2YNQ A;  3AU5 A;  4WNE A;  4CT0 A;  4RG9 A;  3UT7 A;  3S7J A;  4GA1 A;  3AS5 A;  3CVL A;  3MGB A;  1HO8 A;  3MJW A;  4I17 A;  3RRN B;  4HOR A;  4QFV A;  4KXK B;  2XEV A;  4UQZ A;  4HOQ A;  4G11 A;  1PY1 A;  4FHJ A;  1DNP A;  5A7D B;  4XKC A;  1HH8 A;  3MYV A;  3CQC B;  3CHM A;  2XQ0 A;  3MZL B;  4D10 C;  4JC8 A;  1KT1 A;  1UN8 A;  3N71 A;  3QWP A;  4ILG A;  5E75 A;  3QNK A;  4GA0 A;  3CST A;  3FUE A;  4EZK A;  3RU0 A;  3D9O A;  2MOW A;  1ELK A;  5BW8 C;  3QJZ A;  3ZHE A;  4DLO A;  2BF0 X;  4P29 A;  4I6G A;  4LER A;  3BG1 B;  4J0U A;  4XI0 A;  3S7B A;  5FT9 A;  2NSZ A;  2OND A;  2IQC A;  3HHM A;  4I9C A;  4KVO A;  3FEY A;  2E2E A;  1TEZ A;  4LUN U;  4TV3 A;  4GCN A;  5AEN A;  4EBA G;  4GYY A;  3VLE A;  4N5C A;  4O6F A;  1UW4 B;  3IKO B;  4UWF A;  4A1G A;  1HU3 A;  3B13 A;  3EIJ A;  3IV0 A;  2CFU A;  3KEZ A;  4DLQ A;  5BT1 A;  4C0E A;  3EHM A;  1IQU A;  4URK A;  2KCK A;  3B7S A;  3FDH A;  2NXP A;  1B89 A;  4ATG A;  2GW1 A;  2WXL A;  3CSF A;  1IQR A;  2WVI A;  1UG3 A;  2A4Z A;  4NRH B;  1JWF A;  3CGH A;  3JYS A;  3SZ7 A;  3ULQ A;  3CVU A;  3FU3 A;  2VTB B;  4AY6 A;  1FCH A;  3Q49 B;  4GZ6 A;  4IRU A;  4G25 A;  2XCB A;  4WWP A;  2VJ8 A;  3CHP A;  4EZJ A;  3ZYL A;  1S0P A;  1ELR A;  1GW6 A;  2UY1 A;  4UI9 C;  1YA0 A;  1ELW A;  4LCT A;  5DBK A;  4EBA A;  1U3C A;  2BTD A;  3MKR A;  4KYO B;  2XPY A;  3JQ0 A;  4G26 A;  4A3V A;  5A6C A;  3EDT B;  4N3A A;  3MV3 B;  4I1A A;  4I1M A;  4HFG A;  4RVB A;  1EYH A;  2XCC A;  5FWQ A;  4EQF A;  2YHC A;  4G23 A;  3FP3 A;  4FHK A;  3PRZ A;  4YVO A;  2HR2 A;  3AU4 A;  4PS7 A;  4E85 A;  1VDY A;  4GMJ A;  1HF8 A;  4I2W A;  2XGO A;  2X3M A;  3TG5 A;  3UT8 A;  3QOU A;  3ZRH A;  2WQH A;  3HIZ A;  3MEK A;  2X6J A;  5T3R A;  4BWR A;  2WPV A;  3OAW A;  2P58 C;  2C0M A;  2X6F A;  3CEQ A;  3ZHE B;  5CCM A;  2IU1 A;  1H0A A;  1NA3 A;  2AWI A;  1E96 B;  3B7R L;  3ASG A;  3QAQ A;  5E76 A;  3BG0 B;  4IYP A;  5G04 C;  3UMV A;  2XRY A;  5BUZ A;  2OVB A;  2V8S E;  4Q94 A;  3FUM A;  3FUF A;  3ASH A;  3FH5 A;  2M63 A;  2VSN A;  3CIA A;  3GZ1 A;  3PNT B;  3QAR A;  3APC A;  4FP7 A;  5FZS A;  3R7Q A;  4AV7 A;  1OWM A;  4JZY A;  2WQ6 A;  4F7A A;  4WWO A;  2HO1 A;  3D3M A;  5JHB A;  3FUH A;  4N2S A;  4L23 A;  3EHN A;  3GZ2 A;  3CHR A;  5JJT A;  3ONL A;  4N2Q A;  3AS4 A;  4Y6W A;  2XPI A;  4B0Z A;  2Y4U A;  4FC8 A;  1EF1 C;  3KAE A;  1EPU A;  3RKV A;  2I2O A;  2PQN A;  3FUD A;  1UN9 A;  2J4D A;  5FQ7 A;  4MRU A;  3PS6 A;  3Q47 B;  3ZYM A;  3FHE A;  4HLE A;  3ZVV A;  3K9I A;  3LY7 A;  4ILH B;  2UY1 B;  2J9Q A;  2X6K A;  3FTX A;  4TUU A;  4J8S A;  3FU6 A;  3CKC A;  3PE4 A;  3T5V A;  3FTV A;  3TJP A;  1KLX A;  2AVP A;  2VTB A;  1Y8M A;  2X38 A;  4U0Z A;  3SF4 A;  2DCP A;  5C1D A;  4XX5 A;  2Y4T A;  2WXI A;  2FI7 A;  1UJJ A;  3I4R B;  4PH4 B;  4BTB A;  5LCW J;  1HX8 A;  4HVB A;  4KT6 B;  3SBT B;  2WXG A;  1WAO 1;  4C0M A;  1WY6 A;  1Z3Y A;  2J07 A;  2KM4 A;  5DIZ A;  5KJK A;  3QKY A;  4XI9 A;  5D0O D;  4A55 A;  4G24 A;  4CDM A;  2PZI A;  5BV0 A;  3PDN A;  3FTZ A;  1PAQ A;  4J6I A;  4M3O A;  1ZBP A;  3CVW A;  4AOF A;  4EZL A;  2XGM A;  2ION A;  4DI3 A;  1QQE A;  5EX3 A;  4L1B A;  3FU0 A;  2IJG X;  2VSX E;  4JHK A;  3ML8 A;  3ASF A;  3ZYK A;  1HZ4 A;  2NC9 A;  2XPZ A;  2KCL A;  2L0T B;  2Q7F A;  1XGW A;  5FQ8 A;  4PS8 A;  3RK6 A;  4XE0 A;  2UWJ G;  3CVV A;  2VGY A;  4UI9 J;  3UX4 A;  4UWH A;  4BFR A;  2WXQ A;  4GYO A;  5ARF A;  2FO7 A;  3T5X A;  4AVX A;  5KCM A;  3U4T A;  1Z3X A;  2GRM A;  1N52 A;  2LNI A;  2GRL A;  3ASD A;  3OXL A;  1OWL A;  1BPO A;  4BT8 A;  4RG6 A;  1FVF A;  2QY7 A;  1JPL A;  3R9A B;  4ANU A;  4CGW A;  2VSY A;  3IEG A;  4KBQ A;  1HG2 A;  1OWP A;  4U63 A;  3SFZ A;  3L6A A;  3PNL B;  4RSY A;  5AYW D;  4AXH A;  4PUC A;  1DVP A;  2OV8 A;  2KCV A;  3PH0 C;  4WND A;  2WXP A;  4C9B B;  3TXN A;  3LVR E;  1E8X A;  3CHS A;  3PEV B;  4ABN A;  3TGO A;  2PM7 A;  4LRZ A;  2RG8 A;  4I6J A;  3ENE A;  4FJZ A;  2WXN A;  3CVN A;  1HG5 A;  3OTN A;  1JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...