3D9PA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVTVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 53
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9pA00
1EDUA 5J08A 1INZA 3D9KA 2KM4A 3CLJA 1HG2A 1HG5A 3D9PA 3ONLA 3LDZA 4AVXA 1JWGA 4FU3A 1HX8A 1DVPA 3ZYLA 5LOZA 1X5BA 3G2VA 2L0TB 1MHQA 1EYHA 1PY1A 3G2TA 1UJKA 4Q96A 3ZYMA 1JWFA 3D9JA 2L0IA 3D9MA 3G2UA 4GZDA 1VDYA 5CMYA 4FLBA 1UJJA 2LO6A 3D9LA 3D9OA 2MOWA 3ZYQA 3RRUA 2DCPA 2BF0X 4Q94A 3ZYKA 1HF8A 1JPLA 3D9IA 1LF8A 3D9NA 3G2SA 3ONKA 4HFGA 3G2WA 1SZAA 1ELKA 1SZ9A 4GZCA 4NACA 5CMWA 1XGWA 2V8SE 2QY7A 4JXTA 2DIWA 5LP0A 1H0AA 1JUQA 1HFAA
chains in the Genus database with same CATH superfamily
4PS3A 1TN8A 4ME2A 1OWLA 3QWPA 2WXJA 4HB5A 3QK0A 5EX0A 2YQ8A 1HE8A 4U04A 1IYGA 1E8YA 4CRWA 3PUJA 4DX7D 4A1SA 1LD8A 3FUJA 3B13A 3LXUX 2OVBA 2ZXWE 4WWOA 3SBSA 2OV8A 3ZYLA 4GTTA 4GPMA 3DRAA 4ILGA 4XI9A 1FVFA 4ATZD 3T8MA 1O1TA 3JUIA 2XRZA 4KVMA 4H7XA 5JHBA 3E4BA 2LAIA 2V8SE 5LP0A 2Y4TA 4FHKA 3UMVA 5FJYA 3D9KA 2J07A 3N71A 3JXJA 3CHQA 1H6OA 4TXPA 1YYHA 4TXRA 2VGXB 3JXIA 4FLBA 4G26A 1X81A 3C3OA 4CDNA 1ELKA 2KXPC 3EDTB 4GZCA 3CQCB 2ZU6B 5D2MC 1TNZA 4B0ZA 1KZPA 4JHJA 2MRIA 4LNBA 4LNGA 2WXNA 3FTXA 3PH0C 4N3BA 4K5BA 3MKQA 4U8VD 2GRLA 1VDYA 4RG9A 5ENTD 4LG6A 4EPZA 5ENQD 1K8KG 4CDMA 1KZOA 3DSTA 2HR2A 1WG0A 3SF4A 3DWLG 1IHBA 3KD7A 2R05A 3BU8A 1SQMA 3RRMB 3LKUA 3VTYA 3T5XA 1Z5SC 1TN6A 2RG8A 1FPPA 4A1GA 4ACLA 4UWKA 5A7DB 4C48B 3ZPJA 4UI9K 4EECA 3FTWA 1NA0A 3V30A 2OEWA 2M63A 4GZ6A 2L0TB 4HORA 2KCKA 2KBXA 3U9WA 1PC2A 4U0SA 4I9EA 2GRQB 3IHYA 4NACA 2ONDA 3FUEA 2WXGA 1W3BA 4H7YA 4BSZB 4WAFA 3VLDA 2FEZA 3TWWA 5FZQA 3QAQA 3CVYA 3ML8A 3NZSA 5AQ9A 1S64A 3D9IA 4HNAD 3ZXSA 1LD7A 5T4YA 5FWQA 2GRRB 4CZ2D 4AIFA 3UUXA 4J8FA 4KXKB 4G25A 2L6JA 4Y6WA 5ENSD 5B1AE 3DSVA 1TNYA 1JCRA 3RRUA 1Y6IA 4EZLA 5FQ6A 2I1KA 3EUVA 2P9NG 3HXBA 4E85A 1SZAA 3HRAA 3IBEA 3LY9A 4APFA 5A23A 2NYJA 1JUQA 3PZDA 3CVWA 1MZCA 2IO3C 5HQ8A 3EHQA 2LUHA 4XX5A 2KZTA 4HLEA 5JJ7A 4G1TA 2DCPA 4XEIG 5AQ7A 5ENNA 1HF8A 3ASNE 4KZ0A 4HRNA 3NB2A 2I2OA 2WXOA 3D9PA 2LNIA 4BWRA 2C0LA 4BESA 3V31A 3S2AA 4ZHBA 3ESLA 3FWVA 5AAOA 4JZYA 4CDRA 3Q4AB 5AYWD 1NA3A 1NZNA 3GZSA 1OCZE 4JW1A 3V2XA 4UWLA 5KBAA 2LO6A 2ETAA 4N5QA 3RAUA 3RO2A 3X2QE 3TXMA 2VGXA 4EHMA 2R17C 1B89A 2B6CA 3UT7A 5ARFA 3NBNB 3DPYA 3UI2A 4GU5A 2MYOA 3FH7A 3LVQE 4N3AA 2H6HA 4FULA 1BPOA 5LFAA 2DYRE 5ITZF 5CERB 5JJTA 1S70B 3L6AA 2XS8A 3PZ2A 3VTXA 3CHMA 4DX2A 4UQXA 3PZ1A 5ENRD 2L0IA 3B95A 4I43A 3AG4E 3ABLE 1P5QA 3BEEA 5C1DA 3CK8A 4YDWA 2XGMA 3FUIA 1Y8MA 3WG7E 4O6FA 2NC9A 3AS5A 4AM9A 2MHKA 2HO1A 4LEUA 3KS2A 5CCMA 1MHQA 3MKQB 4DUIA 3K9IA 1IHGA 4DLQA 5AQAA 1HU3A 3CKCA 2J4DA 4HQDA 5BW8C 3SZ7A 1AWCB 3HVEA 3ULYA 4DI3A 2LSVA 5KJLA 1HS6A 5AARA 3UINC 1BD8A 2ZISA 1N52A 3OTNA 3ZFWA 2ETBA 4MS6A 2FO7A 2IY0C 5EIDA 2P9SG 5AQBA 3I4RB 2GRMA 2WXQA 4APOA 3MZLB 4A3TA 4I2ZA 3L54A 1HG2A 3J5QB 1QZ2A 4GTSA 1MQSA 5H7PA 3SBTB 4FHJA 5FQ4A 3CHOA 1HZ4A 1KPSB 5LX8A 4NQ0A 3KAEA 1K1AA 3G2SA 2CHWA 1WAO1 3MV3B 3L08A 1O1RA 2WPVA 3JUEA 4U7EB 4JA7A 4CEMA 3UT4A 1YCSB 3ML9A 2QFCA 3LJNA 4BEPA 4V3IA 3NOCD 1N11A 3D3MA 5BV0A 1OT8A 4GTRA 4ZFHA 2XQ0A 1MYOA 4XE0A 4J8YA 4BFRA 4U63A 4B93B 2ZGDA 1TNUA 3TWXA 4I9CA 4I1AA 3FH5A 2H6GA 5AIJA 4J6IA 4LSZE 3TWQA 2VSOE 3JCKC 5G04J 3IV0A 4DK5A 4URKA 3TL5A 4G2VA 1NI1A 3UIOC 2BEDA 5D0OD 4F1SA 4KZCA 1ZU2A 4PUCA 2Y3AA 3GYZA 4O60A 2YNQA 4FP7A 3KSQA 1EPUA 4OYSA 4JVSA 2VQ2A 4F1PA 2CHZA 3LDZA 1E8ZA 4HOSA 4G24A 4GZDA 5DBKA 3EIQC 1OWNA 2WQHA 2RD0A 4WNDA 1TNOA 1E8WA 3SFYA 4TUMA 3HYMB 3FUNA 4XKCA 1HX8A 3IKOB 1X5BA 4GZ5A 5EX3A 3L16A 3ZVVA 1N0QA 2XGOA 3FY4A 5E75A 3CVVA 2ETCA 1TR4A 1SA4A 3BG1B 1MJ0A 2AJAA 2ZIRA 2C0MA 1RZ4A 2PL2A 1N95A 3APFA 2CG3A 4GYYA 3ZYMA 5BXOA 3VLEA 2YINA 3DSXA 3Q49B 4FJZA 2GGFA 1MX2A 4EZKA 2VGYA 3PNLB 5CBOA 1H2VC 3OXGA 3MKRA 3NZUA 5CMYA 4JD2G 3O4ZA 2ILRA 4IN3B 3SFXA 2WXKA 3Q15A 3APDA 5CMWA 3RO3A 1IKND 4RQIA 4PS7A 2R2LA 3WXXA 2LXLA 1JCSA 3CIAA 4YDOA 2WM9A 1U3CA 3E34A 3I5PA 1OWOA 3D9LA 5BUZA 3L22A 3FUFA 3ZHEA 5CBNA 1K3ZD 3RSEG 3I4GA 4Q94A 4B89A 3NOGD 4UWFA 4K03A 1KT0A 3CSTA 5ENOD 2LXMA 1HXIA 4GTMA 3EU9A 4GA2A 3TGOA 3B7UX 4A55A 4OAUC 4GAAA 4AP2A 2WXLA 5CECB 2PQRA 4UI9J 3ZN3A 4O1PA 3ULQA 5EYPF 1O5MA 2XPYA 4GZ3A 3PS6A 2P9LG 4U95D 1V55E 5LCWJ 3FFLA 3U4TA 2V4HC 3EIJA 3SO8A 3EHMA 3NQPA 4HLLA 3MGBA 3E32A 4CCAA 3AAAC 3L13A 4RLYA 4HOUA 3LYAA 3UTMA 5EN5D 4PH4B 4GTOA 5FT9A 3SI5A 1N4RA 1EYHA 3D9MA 4EBAA 2IF4A 2WXIA 1A17A 1FT1A 3HHMA 4GA0A 4BX9A 3BUAA 3FHEA 1UOHA 1KT1A 1U2VG 2H6IA 4B8CB 4BTAA 4UWGA 3OXFA 4GTVA 3ISMC 2VGEA 3LJ3A 5ANLA 1FCHA 3E30A 2IONA 5B1BE 3LCAA 2FBNA 5KNGA 4MLPA 5HI7A 4U0UA 2DWZA 2AXZA 1NFIE 2Q7FA 2A5EA 4ILHB 2P9IG 1MX4A 3HDXA 4YVQC 4GA1A 4HVBA 3T5VA 4RVBA 3FTUA 2IQCA 2CFUA 3G2WA 3E37A 3RU0A 3SY2A 3TWUA 3UKRG 2AVPA 3ONLA 5KWDA 2P9PG 4AVXA 1EF1C 4DPRA 4Q96A 1E7UA 3LY7A 1ELRA 2MOWA 1Q2ZA 4L23A 4G8LA 5HKPA 4GMLA 3Q5MA 4WWPA 3ZRHA 3RJVA 1HFAA 3F6QA 2XZTG 4U8HA 1Z3YA 4HRMB 3CK7A 1QQEA 1ZBPA 4UI9C 1AP7A 2R02A 2F0YA 4X8QA 4C9BB 2KATA 4DLOA 5AENA 2IOSA 3DEOA 2VJ8A 3S7DA 2KCVA 1OWMA 3GW4A 3D9JA 3ASDA 2CFZA 4J7WA 5CCLA 4F6RD 1KLXA 5BT1A 3TWTA 1SZ9A 2QY7A 4BERA 3ZKJA 4GCNA 4DX6D 3QWVA 2PM7A 4HXIA 4XI0A 4J8SA 2GRNB 2A5UA 2PZIA 3PEUB 2F8YA 2NXPA 3PREA 2X6HA 4JHKA 2JLBA 3SFZA 4QQIA 5EYLA 5AJLA 1QNFA 2KC7A 3IXEA 2PNNA 4XIFA 3ENEA 3UQ3A 4U0ZA 5J08A 1UJKA 3CHRA 4K5AB 1K1BA 4CT4A 1QYMA 3HXFA 3CVLA 4UWHA 3AU5A 4ACKA 2RKKA 3IHVA 5FZSA 5JA4D 3ZGQA 5FQ7A 3AS4A 4BT8A 3AU4A 2FULA 3PZ4A 4TV3A 4GYOA 4YVOA 3HXCA 5KJNA 4FJYA 3CVQA 4QFVA 2QYUA 2V5QC 3FULA 2XPIA 4I6GA 2VTBB 5BNWA 3R9AB 3QC1A 3CQGB 4FA6A 3Q7FA 5G04C 4XZ4A 3UM3A 1QBQA 1JWFA 2DZNA 2CHXA 3UM2A 1DCEA 4GB9A 2VYIA 3UIPC 3PEVB 1N94A 1INZA 2XPZA 4L2YA 5FIOA 5LCWC 2X6KA 4KMOA 4WNGA 1A5EA 3PVLA 1OY3D 2BKKB 2LSUA 1IQUA 3C3QA 4JB8P 3U64A 2WQ6A 1UN8A 1XGWA 4C0MA 3TAXA 4YDEA 5D66A 3TG4A 3SNXA 4I2WA 2RFAA 4N5CA 4AJWA 3UM0A 1BI7B 3ESKA 2PM6A 4Z68A 2DVWA 4JXTA 5E76A 4JA9A 2UY1B 2OOEA 3W9GA 5BXUA 4JHRA 3FDHA 3KSLA 3SQVA 1TEZA 5EKQD 3FUMA 1DNPA 2IFUA 3ABME 3ZHEB 3ZW3A 4ANXA 2XEHA 2L9BA 2UY1A 2XCBA 2AWIA 4JC8A 4FU3A 2P2CP 4G8KA 4HOTA 3HG0D 3CHPA 2X6IA 2KZTB 4AY5A 3L9TA 4LRZA 2J8SD 4L9PA 3EHRA 1N4SA 4YNDA 5JMND 3PDNA 4DRXE 1DCQA 2I6HA 4GCOA 2BUGA 2X6FA 2X6JA 2X3MA 2WXHA 3TG5A 1D8DA 2GROB 3UT8A 3O48A 2KM4A 2XRYA 1TJFA 4J8DA 2EILE 3SHFA 1Z6TA 2WXPA 3B7TA 2HE0A 1O1SA 4BTBA 2EIJE 3MX3A 2BF0X 1H6KA 4HI8A 3BG0B 3CVNA 4E6HA 4GYWA 2IO2C 3G2VA 4I1OB 5FINA 4P29A 4AOFA 4CGWA 5AN8A 3V2OA 5FZRA 3JQ1A 3Q75A 1TJCA 3B7RL 4GTQA 5G05C 2Y0BG 3FEYA 4DJAA 1UN9A 3P2BA 1OCOE 3J5PA 3FTYA 3L82A 3G2UA 2WMOA 2A4ZA 3PE4A 4JEHA 3KEZA 2ZGGA 1L5JA 4NURA 1HH8A 4J8EA 3FTVA 3QOUA 3CVPA 4CYMD 4KYOB 4MBGA 4I6JA 5FTPA 2R03A 5T8IA 4DX5D 5BV1A 2V5FA 2KCLA 4GMRA 4OVVA 4G11A 1PY1A 2IOLA 4B8AA 4K5CA 2J49A 1JPLA 3D9NA 4W9RA 3TWSA 4LUNU 3QDNA 2E0IA 4I1MA 5G55A 3MV2B 5FQ8A 2EQXA 4LNUD 5T3RA 3B7BA 3DSWA 3V79K 4AXHA 2OVFA 4OVUA 4K0RA 5AJDA 2P58C 1E8XA 2VTBA 4F53A 3DBSA 3S7BA 2J9QA 1EDUA 2WVIA 3Q7AA 5ANRA 2P9UG 1JWGA 3S7FA 5JJ6A 1V54E 2J08A 3MYVA 4U07A 3SGHA 4LCTA 4MKTA 3DEPA 2EIME 3Q73A 3ZYKA 4HBDA 3FUDA 3MA5A 1ZB1A 2IJGX 1H0AA 1OXJA 3AJIA 3ASGA 3BQOA 3R7QA 2WXMA 3Q47B 4WNFA 3HXDA 4NRHB 2J4BA 2JEKA 4UQZA 4Y6CA 2EIKE 2OEVA 4DI4A 1D8EA 5KCMA 4N39A 1ELWA 3QKYA 1UW4B 3APCA 4U8YD 4JL0A 2QYJA 1HO8A 5BPPA 1G3NB 4I17A 1UJJA 1N4PA 4ABNA 1Z3XA 4KT6B 3CHSA 1TYQG 5HRYA 3CSFA 1DVPA 4CGVA 2XHEA 2XGSA 3MEKA 2EINE 3ASFA 4XKBA 1D9SA 2FO1E 3T8KA 3L17A 2AXVA 3E33A 2F37A 3U3WA 4HS2A 4EQFA 3CR3A 3QWWA 3EU5A 4A63B 4RSYA 2XS1A 2C2LA 1H19A 1H2UA 5EILA 2WQ7A 2B0OE 3G2TA 3DXKG 4UUCA 3URZA 2AXUA 3S7JA 3CEQA 2WXFA 3U66A 1GW6A 4L1BA 4AEZC 1N9AA 3AG2E 2P9KG 3IEGA 1JCQA 2Y4UA 4JPSA 3GZ1A 3HIZA 4NIKA 3ZEFA 3R7RA 3FU3A 3AG1E 3NF1A 4PDXA 4EZJA 4F7AA 1DC2A 4U96D 1NP7A 4J0UA 4AV7A 3UM1A 4Q69A 3P1UA 2DIWA 3UXGA 3ZXPA 3HXEA 3DPDA 3FUHA 3DXMG 4BETA 3LY8A 2NSZA 2Y69E 4MRUA 5C2YA 4IULA 4FLHA 2L6BA 2H6FA 3FH8A 2BTDA 3RKVA 3FU5A 3JYSA 3PZ3A 2YHEA 1TNBA 2J09A 3UX4A 1FVHA 2LAHA 3CLJA 4BSXA 4ANVA 4AY6A 4WWNA 1BU9A 2XCCA 5G05J 3VLFA 4R7LA 2HYZA 3TWRA 4HFGA 1BLXB 4FADA 5D0QD 4I6EA 3AS8A 2DBAA 3ULEG 3OXLA 3RIBA 4M7CA 3LPZA 3CV0A 2IU1A 2CG2A 2QZAA 3TJPA 3ZYQA 3ASHA 1SVXA 3FUKA 3JQ0A 1H6PA 4GPKA 2WMNA 3C5RA 3CVXA 2XEVA 1N4QA 4WUYA 2RFMA 1N0RA 1YA0A 2I1JA 5ENPD 4KVOA 3TXNA 3SD5A 1RW2A 3C72A 3FTSA 2BKGA 5KNHD 2F8XK 3Q9UC 3UPVA 2WB2A 5CEDB 3Q78A 3TWVA 4YDYA 2XZDG 2OCCE 4GTPA 3FP3A 1WDYA 1TN7A 2QC9A 5A6CA 2DYSE 4TXQA 3C3RA 3ZUVB 4M3OA 2Y1LE 2GW1A 3W9FA 3LEWA 3RK6A 3DSSA 2R59A 3PRZA 1U3DA 5G2NA 3RRNB 3CKBA 3NAWA 1OWPA 2VSXE 4WNEA 3C98A 4HOQA 4ATGA 4B94A 1WM5A 1MX6A 4GMJA 3QNKA 3ABKE 4L7TA 3FU6A 5KJMA 2WXRA 4HRLA 1LF8A 1OUVA 5CEAA 3AG3E 3Q9NC 4LERA 3PUKA 2FI7A 5M72A 3CGHA 3UKUG 1SA5A 5J90A 3HVEB 1OCRE 1IQRA 4DX1A 3OAWA 2GRPB 4IRUA 2V4LA 3ZU7B 3CVUA 1BI8B 2DZOA 5IY5E 4C0EA 3B7SA 3PNTB 5JHAA 3DSUA 1LTXA 1HG5A 3ASOE 2IEJA 4IYPA 2R5SA 2FF4A 3ZNGA 5CRUA 4BY6A 1UG3A 1YMPA 3LVRE 3FU0A 5B3SE 4CT0A 3D9OA 4ILIA 4ANUA 2I9CA 2JABA 2AW6A 2V0PA 3LS8A 1NL4A 4F3VA 2YHCA 5KJKA 2VSNA 3EJNA 2PQNA 3T9KA 4UQYA 1WY6A 3GZ2A 4JEUA 3KEAA 3FEXA 1PAQA 4HI9A 5ARGA 3R9MA 5DIZA 4BT9A 4L2LA 5HS0A 4KBQA 4PS8A 4TUUA 2XEEA 4TRQA 3CK9A 4EBAG 1E96B 3Q79A 4N3CA 3QARA 2VSYA 2XENA 4ANWA 3QJZA 3ZIMA 4A3VA 1IXVA 5EDSA 4N2QA 4OAVB 1E90A 1FT2A 5LOZA 1S0PA 3FTZA 3MJWA 5EIBE 4BX8A 3EHNA 2HM8A 1S63A 4FC8A 3ONKA 1N54A 3I3NA 5CRVA 1SW6A 3PE3A 4D10C 4RG6A 5CHEE 3MCXA 4G23A 2E2EA 2UWJG 2X38A 4O1OA 1H2TC 3D9HA 1XNFA 1E7VA 3QB2A 4N2SA 1OCCE
chains in the Genus database with same CATH topology
4GCNA 1ELWA 3QWVA 3QKYA 4PS3A 4ME2A 2PM7A 1UW4B 4HXIA 1OWLA 3ML9A 3QWPA 3APCA 4J8SA 2WXJA 2QFCA 4XI0A 3QK0A 5EX0A 2A5UA 2PZIA 2YQ8A 3PEUB 1HE8A 4V3IA 4JL0A 1HO8A 5BPPA 2NXPA 4I17A 1UJJA 3D3MA 4U04A 3PREA 4ABNA 5BV0A 1Z3XA 2X6HA 2XQ0A 4KT6B 1IYGA 4JHKA 3CHSA 4XE0A 1E8YA 2JLBA 3SFZA 4CRWA 3PUJA 4A1SA 3CSFA 4BFRA 4U63A 3FUJA 1DVPA 3B13A 5AJLA 4CGVA 1QNFA 2XHEA 4I9CA 3LXUX 2OVBA 2XGSA 4I1AA 2KC7A 3MEKA 3ASFA 4WWOA 3FH5A 4XKBA 4XIFA 3ENEA 3SBSA 2OV8A 3ZYLA 3UQ3A 4ILGA 4XI9A 1FVFA 5AIJA 4J6IA 4U0ZA 5J08A 1UJKA 3CHRA 4CT4A 3L17A 3CVLA 4UWHA 2AXVA 3T8MA 3JUIA 3AU5A 2VSOE 4ACKA 2XRZA 4KVMA 4H7XA 3U3WA 3JCKC 5G04J 5JHBA 3IV0A 3E4BA 3IHVA 2LAIA 4HS2A 4EQFA 3CR3A 4DK5A 3QWWA 2V8SE 5FZSA 5LP0A 4URKA 3TL5A 2Y4TA 4RSYA 4FHKA 3UMVA 5FJYA 3D9KA 3ZGQA 2C2LA 2J07A 3AS4A 1H19A 4G2VA 3N71A 5FQ7A 4BT8A 3AU4A 2FULA 1H2UA 3CHQA 2WQ7A 5D0OD 4TV3A 3G2TA 3URZA 2VGXB 4F1SA 4KZCA 1ZU2A 2AXUA 4FLBA 4GYOA 4YVOA 5KJNA 4PUCA 4FJYA 3CVQA 3S7JA 2Y3AA 4QFVA 3GYZA 4G26A 3CEQA 2YNQA 4FP7A 2WXFA 4CDNA 3U66A 1ELKA 1EPUA 3EDTB 4GZCA 3FULA 2XPIA 4I6GA 1GW6A 3CQCB 4L1BA 4AEZC 2ZU6B 5BNWA 2VTBB 3R9AB 3QC1A 3CQGB 4B0ZA 4OYSA 4FA6A 4JVSA 4JHJA 2VQ2A 2CHZA 2MRIA 3LDZA 5G04C 3IEGA 2WXNA 1E8ZA 4HOSA 3FTXA 2Y4UA 3PH0C 4JPSA 4N3BA 4XZ4A 3MKQA 2GRLA 1JWFA 3GZ1A 2CHXA 4G24A 3HIZA 4GZDA 1VDYA 4RG9A 3ZEFA 5DBKA 3R7RA 3FU3A 3EIQC 3NF1A 4EPZA 1OWNA 4PDXA 4EZJA 4GB9A 4F7AA 2WQHA 2RD0A 4CDMA 1NP7A 2VYIA 4WNDA 1E8WA 4J0UA 4AV7A 2HR2A 4Q69A 3PEVB 3P1UA 3SF4A 2DIWA 3KD7A 3HYMB 1INZA 2XPZA 3DPDA 1SQMA 4L2YA 3LKUA 3FUHA 3RRMB 3FUNA 2X6KA 4XKCA 5LCWC 4KMOA 4WNGA 3VTYA 3LY8A 1HX8A 2NSZA 3IKOB 3T5XA 1X5BA 3PVLA 4GZ5A 5EX3A 4MRUA 5C2YA 4IULA 4FLHA 3L16A 3FH8A 2BTDA 2LSUA 2RG8A 1IQUA 3ZVVA 2XGOA 3RKVA 3FY4A 5E75A 3FU5A 3JYSA 4A1GA 3CVVA 3U64A 4ACLA 2WQ6A 2YHEA 1UN8A 4UWKA 2J09A 1XGWA 3UX4A 5A7DB 3TAXA 4C0MA 3BG1B 1FVHA 3ZPJA 2C0MA 4UI9K 2LAHA 3CLJA 3SNXA 3TG4A 4EECA 3FTWA 1NA0A 2PL2A 4BSXA 3APFA 4ANVA 2M63A 4GZ6A 2CG3A 2L0TB 4GYYA 4I2WA 4AY6A 4WWNA 4HORA 3ZYMA 2KCKA 3VLEA 4N5CA 2YINA 3Q49B 4FJZA 3U9WA 2XCCA 1PC2A 5G05J 3VLFA 2GGFA 4AJWA 4R7LA 2HYZA 4I9EA 4U0SA 4EZKA 3ESKA 3IHYA 4HFGA 4NACA 2ONDA 2PM6A 3FUEA 4JXTA 2WXGA 1W3BA 4FADA 5E76A 5D0QD 4H7YA 2VGYA 3PNLB 1H2VC 4I6EA 4JA9A 4WAFA 3AS8A 2DBAA 2UY1B 3VLDA 2OOEA 3OXLA 2FEZA 3OXGA 5FZQA 3RIBA 3MKRA 4JHRA 3FDHA 3LPZA 3CV0A 1TEZA 3QAQA 3CVYA 3NZUA 5CMYA 5EKQD 3FUMA 2IU1A 3O4ZA 1DNPA 2CG2A 3ML8A 3NZSA 3TJPA 3ZYQA 3ASHA 2ILRA 4IN3B 2IFUA 3ZHEB 3FUKA 3JQ0A 3ZW3A 3D9IA 2WXKA 3Q15A 3APDA 5CMWA 3ZXSA 4ANXA 2WMNA 3RO3A 4GPKA 3CVXA 5T4YA 2L9BA 2XEVA 5FWQA 2UY1A 2XCBA 2AWIA 4AIFA 4WUYA 4PS7A 3UUXA 1YA0A 4J8FA 2I1JA 4FU3A 4JC8A 4KXKB 3WXXA 4G25A 2L6JA 4HOTA 4KVOA 3CIAA 4Y6WA 2WM9A 1U3CA 3I5PA 1OWOA 3CHPA 3D9LA 3SD5A 3L22A 3TXNA 5BUZA 2X6IA 3FUFA 1Y6IA 3FTSA 3RRUA 2KZTB 3ZHEA 4EZLA 4AY5A 3I4GA 4Q94A 4B89A 5FQ6A 2I1KA 3UPVA 4E85A 2WB2A 4LRZA 4UWFA 1SZAA 3IBEA 3LY9A 4APFA 5A23A 1JUQA 3PZDA 3FP3A 4K03A 3CVWA 1KT0A 3CSTA 5A6CA 1HXIA 4YNDA 3PDNA 4M3OA 5HQ8A 2I6HA 4GA2A 4GCOA 2GW1A 3TGOA 4XX5A 3B7UX 4A55A 2KZTA 4HLEA 5JJ7A 2BUGA 2X6FA 2X6JA 3LEWA 4G1TA 4GAAA 4AP2A 2DCPA 3RK6A 5ENNA 2WXLA 1HF8A 2X3MA 2PQRA 2R59A 4KZ0A 4UI9J 2WXHA 3ZN3A 3TG5A 3UT8A 2I2OA 3PRZA 3ULQA 1U3DA 3O48A 5G2NA 2WXOA 3RRNB 2XPYA 2KM4A 2XRYA 3CKBA 3D9PA 4GZ3A 1OWPA 1TJFA 4J8DA 2VSXE 3PS6A 4WNEA 3SHFA 3C98A 1Z6TA 2LNIA 4BWRA 5LCWJ 2WXPA 4HOQA 4ATGA 3FFLA 3B7TA 2C0LA 3U4TA 4BTBA 4B94A 1WM5A 3EIJA 4GMJA 3EHMA 3QNKA 3MX3A 3NQPA 3FU6A 4L7TA 3S2AA 2BF0X 3ESLA 3FWVA 5KJMA 2WXRA 1LF8A 1OUVA 4JZYA 1H6KA 3MGBA 4CDRA 4LERA 3BG0B 4CCAA 3Q4AB 3L13A 5AYWD 3PUKA 3CVNA 4HOUA 2FI7A 3LYAA 5M72A 3CGHA 1NA3A 4E6HA 1NZNA 4GYWA 3GZSA 3HVEB 4JW1A 4PH4B 5J90A 3G2VA 4I1OB 1IQRA 5FT9A 3SI5A 4P29A 3OAWA 1EYHA 4IRUA 4AOFA 4UWLA 4CGWA 3D9MA 4EBAA 2LO6A 2V4LA 2IF4A 3CVUA 5FZRA 3JQ1A 2WXIA 1A17A 3HHMA 4GA0A 3RO2A 4BX9A 3TXMA 1TJCA 2VGXA 3B7RL 3FHEA 5G05C 4C0EA 3B7SA 2R17C 3PNTB 5JHAA 1B89A 3FEYA 4DJAA 1HG5A 1KT1A 4IYPA 1UN9A 3P2BA 3UT7A 4B8CB 4BTAA 2R5SA 5ARFA 4UWGA 2FF4A 3FTYA 4N39A 4BY6A 1UG3A 3G2UA 3LVRE 4GU5A 3FU0A 2WMOA 3OXFA 4CT0A 3D9OA 2A4ZA 4ILIA 3FH7A 3PE4A 4JEHA 3LVQE 4N3AA 4ANUA 3LJ3A 5ANLA 1FCHA 3KEZA 2IONA 2I9CA 4FULA 1L5JA 4NURA 2AW6A 1BPOA 2V0PA 1HH8A 3LCAA 3LS8A 4J8EA 3FTVA 5LFAA 3QOUA 2FBNA 3CVPA 4MLPA 5HI7A 4F3VA 4KYOB 4U0UA 5JJTA 2AXZA 3L6AA 2Q7FA 4I6JA 5FTPA 5T8IA 3VTXA 2YHCA 3CHMA 2VSNA 3EJNA 4ILHB 5KJKA 5BV1A 2V5FA 2KCLA 4CEMA 2PQNA 3HDXA 4OVVA 4UQXA 4G11A 1PY1A 4UQYA 2IOLA 1WY6A 4YVQC 4B8AA 2L0IA 4GA1A 4HVBA 4I43A 3T5VA 3GZ2A 4JEUA 1P5QA 3BEEA 3FTUA 4RVBA 5C1DA 2IQCA 3CK8A 2J49A 1JPLA 3D9NA 2CFUA 4W9RA 3G2WA 3FEXA 1PAQA 2XGMA 4LUNU 3QDNA 3RU0A 5ARGA 2E0IA 5DIZA 3FUIA 1Y8MA 4BT9A 4O6FA 2AVPA 3ONLA 2NC9A 4I1MA 3AS5A 3MV2B 4L2LA 5G55A 5FQ8A 4AM9A 4AVXA 2MHKA 2HO1A 2EQXA 4KBQA 4LEUA 1EF1C 4DPRA 5T3RA 3KS2A 4PS8A 4TUUA 1MHQA 5CCMA 3MKQB 4Q96A 4AXHA 1E7UA 3K9IA 4TRQA 1IHGA 3LY7A 3CK9A 1ELRA 2MOWA 2OVFA 4L23A 4DLQA 4OVUA 4K0RA 4EBAG 1E96B 4GMLA 4N3CA 5AJDA 3QARA 2P58C 3Q5MA 1E8XA 2VSYA 1HU3A 4WWPA 3CKCA 2J4DA 3QJZA 3ZRHA 5BW8C 3ZIMA 4ANWA 2VTBA 3SZ7A 4F53A 3HVEA 4A3VA 4DI3A 5EDSA 2LSVA 3RJVA 3DBSA 5KJLA 1HFAA 3S7BA 1HS6A 2J9QA 1EDUA 2WVIA 4N2QA 5ANRA 4U8HA 1Z3YA 3ZFWA 1N52A 3OTNA 1JWGA 1E90A 3S7FA 5JJ6A 1S0PA 2FO7A 4MS6A 5LOZA 3CK7A 3FTZA 3MJWA 2J08A 3MYVA 4U07A 3I4RB 1QQEA 4LCTA 3SGHA 2GRMA 4BX8A 1ZBPA 3EHNA 4MKTA 2HM8A 2WXQA 4UI9C 4FC8A 4APOA 3MZLB 4A3TA 3ZYKA 3ONKA 1N54A 4C9BB 2KATA 3FUDA 3MA5A 2IJGX 1H0AA 3I3NA 4I2ZA 3L54A 4DLOA 3ASGA 3R7QA 5AENA 1HG2A 2WXMA 2IOSA 1QZ2A 3PE3A 1MQSA 4D10C 4RG6A 5CHEE 3MCXA 2VJ8A 3Q47B 3SBTB 3S7DA 2KCVA 1OWMA 4FHJA 4WNFA 3GW4A 4G23A 3D9JA 4NRHB 2E2EA 5FQ4A 2UWJG 1HZ4A 3ASDA 3CHOA 2CFZA 2J4BA 2JEKA 2X38A 4NQ0A 4UQZA 4Y6CA 5CCLA 5LX8A 3KAEA 1H2TC 1XNFA 1KLXA 4DI4A 3G2SA 5BT1A 2CHWA 1SZ9A 1WAO1 5KCMA 3MV3B 3L08A 1E7VA 2QY7A 2WPVA 3QB2A 4N2SA 4JA7A 3UT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDU A;  5J08 A;  1INZ A;  3D9K A;  2KM4 A;  3CLJ A;  1HG2 A;  1HG5 A;  3D9P A;  3ONL A;  3LDZ A;  4AVX A;  1JWG A;  4FU3 A;  1HX8 A;  1DVP A;  3ZYL A;  5LOZ A;  1X5B A;  3G2V A;  2L0T B;  1MHQ A;  1EYH A;  1PY1 A;  3G2T A;  1UJK A;  4Q96 A;  3ZYM A;  1JWF A;  3D9J A;  2L0I A;  3D9M A;  3G2U A;  4GZD A;  1VDY A;  5CMY A;  4FLB A;  1UJJ A;  2LO6 A;  3D9L A;  3D9O A;  2MOW A;  3ZYQ A;  3RRU A;  2DCP A;  2BF0 X;  4Q94 A;  3ZYK A;  1HF8 A;  1JPL A;  3D9I A;  1LF8 A;  3D9N A;  3G2S A;  3ONK A;  4HFG A;  3G2W A;  1SZA A;  1ELK A;  1SZ9 A;  4GZC A;  4NAC A;  5CMW A;  1XGW A;  2V8S E;  2QY7 A;  4JXT A;  2DIW A;  5LP0 A;  1H0A A;  1JUQ A;  1HFA A; 
#chains in the Genus database with same CATH topology
 4PS3 A;  1TN8 A;  4ME2 A;  1OWL A;  3QWP A;  2WXJ A;  4HB5 A;  3QK0 A;  5EX0 A;  2YQ8 A;  1HE8 A;  4U04 A;  1IYG A;  1E8Y A;  4CRW A;  3PUJ A;  4DX7 D;  4A1S A;  1LD8 A;  3FUJ A;  3B13 A;  3LXU X;  2OVB A;  2ZXW E;  4WWO A;  3SBS A;  2OV8 A;  3ZYL A;  4GTT A;  4GPM A;  3DRA A;  4ILG A;  4XI9 A;  1FVF A;  4ATZ D;  3T8M A;  1O1T A;  3JUI A;  2XRZ A;  4KVM A;  4H7X A;  5JHB A;  3E4B A;  2LAI A;  2V8S E;  5LP0 A;  2Y4T A;  4FHK A;  3UMV A;  5FJY A;  3D9K A;  2J07 A;  3N71 A;  3JXJ A;  3CHQ A;  1H6O A;  4TXP A;  1YYH A;  4TXR A;  2VGX B;  3JXI A;  4FLB A;  4G26 A;  1X81 A;  3C3O A;  4CDN A;  1ELK A;  2KXP C;  3EDT B;  4GZC A;  3CQC B;  2ZU6 B;  5D2M C;  1TNZ A;  4B0Z A;  1KZP A;  4JHJ A;  2MRI A;  4LNB A;  4LNG A;  2WXN A;  3FTX A;  3PH0 C;  4N3B A;  4K5B A;  3MKQ A;  4U8V D;  2GRL A;  1VDY A;  4RG9 A;  5ENT D;  4LG6 A;  4EPZ A;  5ENQ D;  1K8K G;  4CDM A;  1KZO A;  3DST A;  2HR2 A;  1WG0 A;  3SF4 A;  3DWL G;  1IHB A;  3KD7 A;  2R05 A;  3BU8 A;  1SQM A;  3RRM B;  3LKU A;  3VTY A;  3T5X A;  1Z5S C;  1TN6 A;  2RG8 A;  1FPP A;  4A1G A;  4ACL A;  4UWK A;  5A7D B;  4C48 B;  3ZPJ A;  4UI9 K;  4EEC A;  3FTW A;  1NA0 A;  3V30 A;  2OEW A;  2M63 A;  4GZ6 A;  2L0T B;  4HOR A;  2KCK A;  2KBX A;  3U9W A;  1PC2 A;  4U0S A;  4I9E A;  2GRQ B;  3IHY A;  4NAC A;  2OND A;  3FUE A;  2WXG A;  1W3B A;  4H7Y A;  4BSZ B;  4WAF A;  3VLD A;  2FEZ A;  3TWW A;  5FZQ A;  3QAQ A;  3CVY A;  3ML8 A;  3NZS A;  5AQ9 A;  1S64 A;  3D9I A;  4HNA D;  3ZXS A;  1LD7 A;  5T4Y A;  5FWQ A;  2GRR B;  4CZ2 D;  4AIF A;  3UUX A;  4J8F A;  4KXK B;  4G25 A;  2L6J A;  4Y6W A;  5ENS D;  5B1A E;  3DSV A;  1TNY A;  1JCR A;  3RRU A;  1Y6I A;  4EZL A;  5FQ6 A;  2I1K A;  3EUV A;  2P9N G;  3HXB A;  4E85 A;  1SZA A;  3HRA A;  3IBE A;  3LY9 A;  4APF A;  5A23 A;  2NYJ A;  1JUQ A;  3PZD A;  3CVW A;  1MZC A;  2IO3 C;  5HQ8 A;  3EHQ A;  2LUH A;  4XX5 A;  2KZT A;  4HLE A;  5JJ7 A;  4G1T A;  2DCP A;  4XEI G;  5AQ7 A;  5ENN A;  1HF8 A;  3ASN E;  4KZ0 A;  4HRN A;  3NB2 A;  2I2O A;  2WXO A;  3D9P A;  2LNI A;  4BWR A;  2C0L A;  4BES A;  3V31 A;  3S2A A;  4ZHB A;  3ESL A;  3FWV A;  5AAO A;  4JZY A;  4CDR A;  3Q4A B;  5AYW D;  1NA3 A;  1NZN A;  3GZS A;  1OCZ E;  4JW1 A;  3V2X A;  4UWL A;  5KBA A;  2LO6 A;  2ETA A;  4N5Q A;  3RAU A;  3RO2 A;  3X2Q E;  3TXM A;  2VGX A;  4EHM A;  2R17 C;  1B89 A;  2B6C A;  3UT7 A;  5ARF A;  3NBN B;  3DPY A;  3UI2 A;  4GU5 A;  2MYO A;  3FH7 A;  3LVQ E;  4N3A A;  2H6H A;  4FUL A;  1BPO A;  5LFA A;  2DYR E;  5ITZ F;  5CER B;  5JJT A;  1S70 B;  3L6A A;  2XS8 A;  3PZ2 A;  3VTX A;  3CHM A;  4DX2 A;  4UQX A;  3PZ1 A;  5ENR D;  2L0I A;  3B95 A;  4I43 A;  3AG4 E;  3ABL E;  1P5Q A;  3BEE A;  5C1D A;  3CK8 A;  4YDW A;  2XGM A;  3FUI A;  1Y8M A;  3WG7 E;  4O6F A;  2NC9 A;  3AS5 A;  4AM9 A;  2MHK A;  2HO1 A;  4LEU A;  3KS2 A;  5CCM A;  1MHQ A;  3MKQ B;  4DUI A;  3K9I A;  1IHG A;  4DLQ A;  5AQA A;  1HU3 A;  3CKC A;  2J4D A;  4HQD A;  5BW8 C;  3SZ7 A;  1AWC B;  3HVE A;  3ULY A;  4DI3 A;  2LSV A;  5KJL A;  1HS6 A;  5AAR A;  3UIN C;  1BD8 A;  2ZIS A;  1N52 A;  3OTN A;  3ZFW A;  2ETB A;  4MS6 A;  2FO7 A;  2IY0 C;  5EID A;  2P9S G;  5AQB A;  3I4R B;  2GRM A;  2WXQ A;  4APO A;  3MZL B;  4A3T A;  4I2Z A;  3L54 A;  1HG2 A;  3J5Q B;  1QZ2 A;  4GTS A;  1MQS A;  5H7P A;  3SBT B;  4FHJ A;  5FQ4 A;  3CHO A;  1HZ4 A;  1KPS B;  5LX8 A;  4NQ0 A;  3KAE A;  1K1A A;  3G2S A;  2CHW A;  1WAO 1;  3MV3 B;  3L08 A;  1O1R A;  2WPV A;  3JUE A;  4U7E B;  4JA7 A;  4CEM A;  3UT4 A;  1YCS B;  3ML9 A;  2QFC A;  3LJN A;  4BEP A;  4V3I A;  3NOC D;  1N11 A;  3D3M A;  5BV0 A;  1OT8 A;  4GTR A;  4ZFH A;  2XQ0 A;  1MYO A;  4XE0 A;  4J8Y A;  4BFR A;  4U63 A;  4B93 B;  2ZGD A;  1TNU A;  3TWX A;  4I9C A;  4I1A A;  3FH5 A;  2H6G A;  5AIJ A;  4J6I A;  4LSZ E;  3TWQ A;  2VSO E;  3JCK C;  5G04 J;  3IV0 A;  4DK5 A;  4URK A;  3TL5 A;  4G2V A;  1NI1 A;  3UIO C;  2BED A;  5D0O D;  4F1S A;  4KZC A;  1ZU2 A;  4PUC A;  2Y3A A;  3GYZ A;  4O60 A;  2YNQ A;  4FP7 A;  3KSQ A;  1EPU A;  4OYS A;  4JVS A;  2VQ2 A;  4F1P A;  2CHZ A;  3LDZ A;  1E8Z A;  4HOS A;  4G24 A;  4GZD A;  5DBK A;  3EIQ C;  1OWN A;  2WQH A;  2RD0 A;  4WND A;  1TNO A;  1E8W A;  3SFY A;  4TUM A;  3HYM B;  3FUN A;  4XKC A;  1HX8 A;  3IKO B;  1X5B A;  4GZ5 A;  5EX3 A;  3L16 A;  3ZVV A;  1N0Q A;  2XGO A;  3FY4 A;  5E75 A;  3CVV A;  2ETC A;  1TR4 A;  1SA4 A;  3BG1 B;  1MJ0 A;  2AJA A;  2ZIR A;  2C0M A;  1RZ4 A;  2PL2 A;  1N95 A;  3APF A;  2CG3 A;  4GYY A;  3ZYM A;  5BXO A;  3VLE A;  2YIN A;  3DSX A;  3Q49 B;  4FJZ A;  2GGF A;  1MX2 A;  4EZK A;  2VGY A;  3PNL B;  5CBO A;  1H2V C;  3OXG A;  3MKR A;  3NZU A;  5CMY A;  4JD2 G;  3O4Z A;  2ILR A;  4IN3 B;  3SFX A;  2WXK A;  3Q15 A;  3APD A;  5CMW A;  3RO3 A;  1IKN D;  4RQI A;  4PS7 A;  2R2L A;  3WXX A;  2LXL A;  1JCS A;  3CIA A;  4YDO A;  2WM9 A;  1U3C A;  3E34 A;  3I5P A;  1OWO A;  3D9L A;  5BUZ A;  3L22 A;  3FUF A;  3ZHE A;  5CBN A;  1K3Z D;  3RSE G;  3I4G A;  4Q94 A;  4B89 A;  3NOG D;  4UWF A;  4K03 A;  1KT0 A;  3CST A;  5ENO D;  2LXM A;  1HXI A;  4GTM A;  3EU9 A;  4GA2 A;  3TGO A;  3B7U X;  4A55 A;  4OAU C;  4GAA A;  4AP2 A;  2WXL A;  5CEC B;  2PQR A;  4UI9 J;  3ZN3 A;  4O1P A;  3ULQ A;  5EYP F;  1O5M A;  2XPY A;  4GZ3 A;  3PS6 A;  2P9L G;  4U95 D;  1V55 E;  5LCW J;  3FFL A;  3U4T A;  2V4H C;  3EIJ A;  3SO8 A;  3EHM A;  3NQP A;  4HLL A;  3MGB A;  3E32 A;  4CCA A;  3AAA C;  3L13 A;  4RLY A;  4HOU A;  3LYA A;  3UTM A;  5EN5 D;  4PH4 B;  4GTO A;  5FT9 A;  3SI5 A;  1N4R A;  1EYH A;  3D9M A;  4EBA A;  2IF4 A;  2WXI A;  1A17 A;  1FT1 A;  3HHM A;  4GA0 A;  4BX9 A;  3BUA A;  3FHE A;  1UOH A;  1KT1 A;  1U2V G;  2H6I A;  4B8C B;  4BTA A;  4UWG A;  3OXF A;  4GTV A;  3ISM C;  2VGE A;  3LJ3 A;  5ANL A;  1FCH A;  3E30 A;  2ION A;  5B1B E;  3LCA A;  2FBN A;  5KNG A;  4MLP A;  5HI7 A;  4U0U A;  2DWZ A;  2AXZ A;  1NFI E;  2Q7F A;  2A5E A;  4ILH B;  2P9I G;  1MX4 A;  3HDX A;  4YVQ C;  4GA1 A;  4HVB A;  3T5V A;  4RVB A;  3FTU A;  2IQC A;  2CFU A;  3G2W A;  3E37 A;  3RU0 A;  3SY2 A;  3TWU A;  3UKR G;  2AVP A;  3ONL A;  5KWD A;  2P9P G;  4AVX A;  1EF1 C;  4DPR A;  4Q96 A;  1E7U A;  3LY7 A;  1ELR A;  2MOW A;  1Q2Z A;  4L23 A;  4G8L A;  5HKP A;  4GML A;  3Q5M A;  4WWP A;  3ZRH A;  3RJV A;  1HFA A;  3F6Q A;  2XZT G;  4U8H A;  1Z3Y A;  4HRM B;  3CK7 A;  1QQE A;  1ZBP A;  4UI9 C;  1AP7 A;  2R02 A;  2F0Y A;  4X8Q A;  4C9B B;  2KAT A;  4DLO A;  5AEN A;  2IOS A;  3DEO A;  2VJ8 A;  3S7D A;  2KCV A;  1OWM A;  3GW4 A;  3D9J A;  3ASD A;  2CFZ A;  4J7W A;  5CCL A;  4F6R D;  1KLX A;  5BT1 A;  3TWT A;  1SZ9 A;  2QY7 A;  4BER A;  3ZKJ A;  4GCN A;  4DX6 D;  3QWV A;  2PM7 A;  4HXI A;  4XI0 A;  4J8S A;  2GRN B;  2A5U A;  2PZI A;  3PEU B;  2F8Y A;  2NXP A;  3PRE A;  2X6H A;  4JHK A;  2JLB A;  3SFZ A;  4QQI A;  5EYL A;  5AJL A;  1QNF A;  2KC7 A;  3IXE A;  2PNN A;  4XIF A;  3ENE A;  3UQ3 A;  4U0Z A;  5J08 A;  1UJK A;  3CHR A;  4K5A B;  1K1B A;  4CT4 A;  1QYM A;  3HXF A;  3CVL A;  4UWH A;  3AU5 A;  4ACK A;  2RKK A;  3IHV A;  5FZS A;  5JA4 D;  3ZGQ A;  5FQ7 A;  3AS4 A;  4BT8 A;  3AU4 A;  2FUL A;  3PZ4 A;  4TV3 A;  4GYO A;  4YVO A;  3HXC A;  5KJN A;  4FJY A;  3CVQ A;  4QFV A;  2QYU A;  2V5Q C;  3FUL A;  2XPI A;  4I6G A;  2VTB B;  5BNW A;  3R9A B;  3QC1 A;  3CQG B;  4FA6 A;  3Q7F A;  5G04 C;  4XZ4 A;  3UM3 A;  1QBQ A;  1JWF A;  2DZN A;  2CHX A;  3UM2 A;  1DCE A;  4GB9 A;  2VYI A;  3UIP C;  3PEV B;  1N94 A;  1INZ A;  2XPZ A;  4L2Y A;  5FIO A;  5LCW C;  2X6K A;  4KMO A;  4WNG A;  1A5E A;  3PVL A;  1OY3 D;  2BKK B;  2LSU A;  1IQU A;  3C3Q A;  4JB8 P;  3U64 A;  2WQ6 A;  1UN8 A;  1XGW A;  4C0M A;  3TAX A;  4YDE A;  5D66 A;  3TG4 A;  3SNX A;  4I2W A;  2RFA A;  4N5C A;  4AJW A;  3UM0 A;  1BI7 B;  3ESK A;  2PM6 A;  4Z68 A;  2DVW A;  4JXT A;  5E76 A;  4JA9 A;  2UY1 B;  2OOE A;  3W9G A;  5BXU A;  4JHR A;  3FDH A;  3KSL A;  3SQV A;  1TEZ A;  5EKQ D;  3FUM A;  1DNP A;  2IFU A;  3ABM E;  3ZHE B;  3ZW3 A;  4ANX A;  2XEH A;  2L9B A;  2UY1 A;  2XCB A;  2AWI A;  4JC8 A;  4FU3 A;  2P2C P;  4G8K A;  4HOT A;  3HG0 D;  3CHP A;  2X6I A;  2KZT B;  4AY5 A;  3L9T A;  4LRZ A;  2J8S D;  4L9P A;  3EHR A;  1N4S A;  4YND A;  5JMN D;  3PDN A;  4DRX E;  1DCQ A;  2I6H A;  4GCO A;  2BUG A;  2X6F A;  2X6J A;  2X3M A;  2WXH A;  3TG5 A;  1D8D A;  2GRO B;  3UT8 A;  3O48 A;  2KM4 A;  2XRY A;  1TJF A;  4J8D A;  2EIL E;  3SHF A;  1Z6T A;  2WXP A;  3B7T A;  2HE0 A;  1O1S A;  4BTB A;  2EIJ E;  3MX3 A;  2BF0 X;  1H6K A;  4HI8 A;  3BG0 B;  3CVN A;  4E6H A;  4GYW A;  2IO2 C;  3G2V A;  4I1O B;  5FIN A;  4P29 A;  4AOF A;  4CGW A;  5AN8 A;  3V2O A;  5FZR A;  3JQ1 A;  3Q75 A;  1TJC A;  3B7R L;  4GTQ A;  5G05 C;  2Y0B G;  3FEY A;  4DJA A;  1UN9 A;  3P2B A;  1OCO E;  3J5P A;  3FTY A;  3L82 A;  3G2U A;  2WMO A;  2A4Z A;  3PE4 A;  4JEH A;  3KEZ A;  2ZGG A;  1L5J A;  4NUR A;  1HH8 A;  4J8E A;  3FTV A;  3QOU A;  3CVP A;  4CYM D;  4KYO B;  4MBG A;  4I6J A;  5FTP A;  2R03 A;  5T8I A;  4DX5 D;  5BV1 A;  2V5F A;  2KCL A;  4GMR A;  4OVV A;  4G11 A;  1PY1 A;  2IOL A;  4B8A A;  4K5C A;  2J49 A;  1JPL A;  3D9N A;  4W9R A;  3TWS A;  4LUN U;  3QDN A;  2E0I A;  4I1M A;  5G55 A;  3MV2 B;  5FQ8 A;  2EQX A;  4LNU D;  5T3R A;  3B7B A;  3DSW A;  3V79 K;  4AXH A;  2OVF A;  4OVU A;  4K0R A;  5AJD A;  2P58 C;  1E8X A;  2VTB A;  4F53 A;  3DBS A;  3S7B A;  2J9Q A;  1EDU A;  2WVI A;  3Q7A A;  5ANR A;  2P9U G;  1JWG A;  3S7F A;  5JJ6 A;  1V54 E;  2J08 A;  3MYV A;  4U07 A;  3SGH A;  4LCT A;  4MKT A;  3DEP A;  2EIM E;  3Q73 A;  3ZYK A;  4HBD A;  3FUD A;  3MA5 A;  1ZB1 A;  2IJG X;  1H0A A;  1OXJ A;  3AJI A;  3ASG A;  3BQO A;  3R7Q A;  2WXM A;  3Q47 B;  4WNF A;  3HXD A;  4NRH B;  2J4B A;  2JEK A;  4UQZ A;  4Y6C A;  2EIK E;  2OEV A;  4DI4 A;  1D8E A;  5KCM A;  4N39 A;  1ELW A;  3QKY A;  1UW4 B;  3APC A;  4U8Y D;  4JL0 A;  2QYJ A;  1HO8 A;  5BPP A;  1G3N B;  4I17 A;  1UJJ A;  1N4P A;  4ABN A;  1Z3X A;  4KT6 B;  3CHS A;  1TYQ G;  5HRY A;  3CSF A;  1DVP A;  4CGV A;  2XHE A;  2XGS A;  3MEK A;  2EIN E;  3ASF A;  4XKB A;  1D9S A;  2FO1 E;  3T8K A;  3L17 A;  2AXV A;  3E33 A;  2F37 A;  3U3W A;  4HS2 A;  4EQF A;  3CR3 A;  3QWW A;  3EU5 A;  4A63 B;  4RSY A;  2XS1 A;  2C2L A;  1H19 A;  1H2U A;  5EIL A;  2WQ7 A;  2B0O E;  3G2T A;  3DXK G;  4UUC A;  3URZ A;  2AXU A;  3S7J A;  3CEQ A;  2WXF A;  3U66 A;  1GW6 A;  4L1B A;  4AEZ C;  1N9A A;  3AG2 E;  2P9K G;  3IEG A;  1JCQ A;  2Y4U A;  4JPS A;  3GZ1 A;  3HIZ A;  4NIK A;  3ZEF A;  3R7R A;  3FU3 A;  3AG1 E;  3NF1 A;  4PDX A;  4EZJ A;  4F7A A;  1DC2 A;  4U96 D;  1NP7 A;  4J0U A;  4AV7 A;  3UM1 A;  4Q69 A;  3P1U A;  2DIW A;  3UXG A;  3ZXP A;  3HXE A;  3DPD A;  3FUH A;  3DXM G;  4BET A;  3LY8 A;  2NSZ A;  2Y69 E;  4MRU A;  5C2Y A;  4IUL A;  4FLH A;  2L6B A;  2H6F A;  3FH8 A;  2BTD A;  3RKV A;  3FU5 A;  3JYS A;  3PZ3 A;  2YHE A;  1TNB A;  2J09 A;  3UX4 A;  1FVH A;  2LAH A;  3CLJ A;  4BSX A;  4ANV A;  4AY6 A;  4WWN A;  1BU9 A;  2XCC A;  5G05 J;  3VLF A;  4R7L A;  2HYZ A;  3TWR A;  4HFG A;  1BLX B;  4FAD A;  5D0Q D;  4I6E A;  3AS8 A;  2DBA A;  3ULE G;  3OXL A;  3RIB A;  4M7C A;  3LPZ A;  3CV0 A;  2IU1 A;  2CG2 A;  2QZA A;  3TJP A;  3ZYQ A;  3ASH A;  1SVX A;  3FUK A;  3JQ0 A;  1H6P A;  4GPK A;  2WMN A;  3C5R A;  3CVX A;  2XEV A;  1N4Q A;  4WUY A;  2RFM A;  1N0R A;  1YA0 A;  2I1J A;  5ENP D;  4KVO A;  3TXN A;  3SD5 A;  1RW2 A;  3C72 A;  3FTS A;  2BKG A;  5KNH D;  2F8X K;  3Q9U C;  3UPV A;  2WB2 A;  5CED B;  3Q78 A;  3TWV A;  4YDY A;  2XZD G;  2OCC E;  4GTP A;  3FP3 A;  1WDY A;  1TN7 A;  2QC9 A;  5A6C A;  2DYS E;  4TXQ A;  3C3R A;  3ZUV B;  4M3O A;  2Y1L E;  2GW1 A;  3W9F A;  3LEW A;  3RK6 A;  3DSS A;  2R59 A;  3PRZ A;  1U3D A;  5G2N A;  3RRN B;  3CKB A;  3NAW A;  1OWP A;  2VSX E;  4WNE A;  3C98 A;  4HOQ A;  4ATG A;  4B94 A;  1WM5 A;  1MX6 A;  4GMJ A;  3QNK A;  3ABK E;  4L7T A;  3FU6 A;  5KJM A;  2WXR A;  4HRL A;  1LF8 A;  1OUV A;  5CEA A;  3AG3 E;  3Q9N C;  4LER A;  3PUK A;  2FI7 A;  5M72 A;  3CGH A;  3UKU G;  1SA5 A;  5J90 A;  3HVE B;  1OCR E;  1IQR A;  4DX1 A;  3OAW A;  2GRP B;  4IRU A;  2V4L A;  3ZU7 B;  3CVU A;  1BI8 B;  2DZO A;  5IY5 E;  4C0E A;  3B7S A;  3PNT B;  5JHA A;  3DSU A;  1LTX A;  1HG5 A;  3ASO E;  2IEJ A;  4IYP A;  2R5S A;  2FF4 A;  3ZNG A;  5CRU A;  4BY6 A;  1UG3 A;  1YMP A;  3LVR E;  3FU0 A;  5B3S E;  4CT0 A;  3D9O A;  4ILI A;  4ANU A;  2I9C A;  2JAB A;  2AW6 A;  2V0P A;  3LS8 A;  1NL4 A;  4F3V A;  2YHC A;  5KJK A;  2VSN A;  3EJN A;  2PQN A;  3T9K A;  4UQY A;  1WY6 A;  3GZ2 A;  4JEU A;  3KEA A;  3FEX A;  1PAQ A;  4HI9 A;  5ARG A;  3R9M A;  5DIZ A;  4BT9 A;  4L2L A;  5HS0 A;  4KBQ A;  4PS8 A;  4TUU A;  2XEE A;  4TRQ A;  3CK9 A;  4EBA G;  1E96 B;  3Q79 A;  4N3C A;  3QAR A;  2VSY A;  2XEN A;  4ANW A;  3QJZ A;  3ZIM A;  4A3V A;  1IXV A;  5EDS A;  4N2Q A;  4OAV B;  1E90 A;  1FT2 A;  5LOZ A;  1S0P A;  3FTZ A;  3MJW A;  5EIB E;  4BX8 A;  3EHN A;  2HM8 A;  1S63 A;  4FC8 A;  3ONK A;  1N54 A;  3I3N A;  5CRV A;  1SW6 A;  3PE3 A;  4D10 C;  4RG6 A;  5CHE E;  3MCX A;  4G23 A;  2E2E A;  2UWJ G;  2X38 A;  4O1O A;  1H2T C;  3D9H A;  1XNF A;  1E7V A;  3QB2 A;  4N2S A;  1OCC E; 
#chains in the Genus database with same CATH homology
 4GCN A;  1ELW A;  3QWV A;  3QKY A;  4PS3 A;  4ME2 A;  2PM7 A;  1UW4 B;  4HXI A;  1OWL A;  3ML9 A;  3QWP A;  3APC A;  4J8S A;  2WXJ A;  2QFC A;  4XI0 A;  3QK0 A;  5EX0 A;  2A5U A;  2PZI A;  2YQ8 A;  3PEU B;  1HE8 A;  4V3I A;  4JL0 A;  1HO8 A;  5BPP A;  2NXP A;  4I17 A;  1UJJ A;  3D3M A;  4U04 A;  3PRE A;  4ABN A;  5BV0 A;  1Z3X A;  2X6H A;  2XQ0 A;  4KT6 B;  1IYG A;  4JHK A;  3CHS A;  4XE0 A;  1E8Y A;  2JLB A;  3SFZ A;  4CRW A;  3PUJ A;  4A1S A;  3CSF A;  4BFR A;  4U63 A;  3FUJ A;  1DVP A;  3B13 A;  5AJL A;  4CGV A;  1QNF A;  2XHE A;  4I9C A;  3LXU X;  2OVB A;  2XGS A;  4I1A A;  2KC7 A;  3MEK A;  3ASF A;  4WWO A;  3FH5 A;  4XKB A;  4XIF A;  3ENE A;  3SBS A;  2OV8 A;  3ZYL A;  3UQ3 A;  4ILG A;  4XI9 A;  1FVF A;  5AIJ A;  4J6I A;  4U0Z A;  5J08 A;  1UJK A;  3CHR A;  4CT4 A;  3L17 A;  3CVL A;  4UWH A;  2AXV A;  3T8M A;  3JUI A;  3AU5 A;  2VSO E;  4ACK A;  2XRZ A;  4KVM A;  4H7X A;  3U3W A;  3JCK C;  5G04 J;  5JHB A;  3IV0 A;  3E4B A;  3IHV A;  2LAI A;  4HS2 A;  4EQF A;  3CR3 A;  4DK5 A;  3QWW A;  2V8S E;  5FZS A;  5LP0 A;  4URK A;  3TL5 A;  2Y4T A;  4RSY A;  4FHK A;  3UMV A;  5FJY A;  3D9K A;  3ZGQ A;  2C2L A;  2J07 A;  3AS4 A;  1H19 A;  4G2V A;  3N71 A;  5FQ7 A;  4BT8 A;  3AU4 A;  2FUL A;  1H2U A;  3CHQ A;  2WQ7 A;  5D0O D;  4TV3 A;  3G2T A;  3URZ A;  2VGX B;  4F1S A;  4KZC A;  1ZU2 A;  2AXU A;  4FLB A;  4GYO A;  4YVO A;  5KJN A;  4PUC A;  4FJY A;  3CVQ A;  3S7J A;  2Y3A A;  4QFV A;  3GYZ A;  4G26 A;  3CEQ A;  2YNQ A;  4FP7 A;  2WXF A;  4CDN A;  3U66 A;  1ELK A;  1EPU A;  3EDT B;  4GZC A;  3FUL A;  2XPI A;  4I6G A;  1GW6 A;  3CQC B;  4L1B A;  4AEZ C;  2ZU6 B;  5BNW A;  2VTB B;  3R9A B;  3QC1 A;  3CQG B;  4B0Z A;  4OYS A;  4FA6 A;  4JVS A;  4JHJ A;  2VQ2 A;  2CHZ A;  2MRI A;  3LDZ A;  5G04 C;  3IEG A;  2WXN A;  1E8Z A;  4HOS A;  3FTX A;  2Y4U A;  3PH0 C;  4JPS A;  4N3B A;  4XZ4 A;  3MKQ A;  2GRL A;  1JWF A;  3GZ1 A;  2CHX A;  4G24 A;  3HIZ A;  4GZD A;  1VDY A;  4RG9 A;  3ZEF A;  5DBK A;  3R7R A;  3FU3 A;  3EIQ C;  3NF1 A;  4EPZ A;  1OWN A;  4PDX A;  4EZJ A;  4GB9 A;  4F7A A;  2WQH A;  2RD0 A;  4CDM A;  1NP7 A;  2VYI A;  4WND A;  1E8W A;  4J0U A;  4AV7 A;  2HR2 A;  4Q69 A;  3PEV B;  3P1U A;  3SF4 A;  2DIW A;  3KD7 A;  3HYM B;  1INZ A;  2XPZ A;  3DPD A;  1SQM A;  4L2Y A;  3LKU A;  3FUH A;  3RRM B;  3FUN A;  2X6K A;  4XKC A;  5LCW C;  4KMO A;  4WNG A;  3VTY A;  3LY8 A;  1HX8 A;  2NSZ A;  3IKO B;  3T5X A;  1X5B A;  3PVL A;  4GZ5 A;  5EX3 A;  4MRU A;  5C2Y A;  4IUL A;  4FLH A;  3L16 A;  3FH8 A;  2BTD A;  2LSU A;  2RG8 A;  1IQU A;  3ZVV A;  2XGO A;  3RKV A;  3FY4 A;  5E75 A;  3FU5 A;  3JYS A;  4A1G A;  3CVV A;  3U64 A;  4ACL A;  2WQ6 A;  2YHE A;  1UN8 A;  4UWK A;  2J09 A;  1XGW A;  3UX4 A;  5A7D B;  3TAX A;  4C0M A;  3BG1 B;  1FVH A;  3ZPJ A;  2C0M A;  4UI9 K;  2LAH A;  3CLJ A;  3SNX A;  3TG4 A;  4EEC A;  3FTW A;  1NA0 A;  2PL2 A;  4BSX A;  3APF A;  4ANV A;  2M63 A;  4GZ6 A;  2CG3 A;  2L0T B;  4GYY A;  4I2W A;  4AY6 A;  4WWN A;  4HOR A;  3ZYM A;  2KCK A;  3VLE A;  4N5C A;  2YIN A;  3Q49 B;  4FJZ A;  3U9W A;  2XCC A;  1PC2 A;  5G05 J;  3VLF A;  2GGF A;  4AJW A;  4R7L A;  2HYZ A;  4I9E A;  4U0S A;  4EZK A;  3ESK A;  3IHY A;  4HFG A;  4NAC A;  2OND A;  2PM6 A;  3FUE A;  4JXT A;  2WXG A;  1W3B A;  4FAD A;  5E76 A;  5D0Q D;  4H7Y A;  2VGY A;  3PNL B;  1H2V C;  4I6E A;  4JA9 A;  4WAF A;  3AS8 A;  2DBA A;  2UY1 B;  3VLD A;  2OOE A;  3OXL A;  2FEZ A;  3OXG A;  5FZQ A;  3RIB A;  3MKR A;  4JHR A;  3FDH A;  3LPZ A;  3CV0 A;  1TEZ A;  3QAQ A;  3CVY A;  3NZU A;  5CMY A;  5EKQ D;  3FUM A;  2IU1 A;  3O4Z A;  1DNP A;  2CG2 A;  3ML8 A;  3NZS A;  3TJP A;  3ZYQ A;  3ASH A;  2ILR A;  4IN3 B;  2IFU A;  3ZHE B;  3FUK A;  3JQ0 A;  3ZW3 A;  3D9I A;  2WXK A;  3Q15 A;  3APD A;  5CMW A;  3ZXS A;  4ANX A;  2WMN A;  3RO3 A;  4GPK A;  3CVX A;  5T4Y A;  2L9B A;  2XEV A;  5FWQ A;  2UY1 A;  2XCB A;  2AWI A;  4AIF A;  4WUY A;  4PS7 A;  3UUX A;  1YA0 A;  4J8F A;  2I1J A;  4FU3 A;  4JC8 A;  4KXK B;  3WXX A;  4G25 A;  2L6J A;  4HOT A;  4KVO A;  3CIA A;  4Y6W A;  2WM9 A;  1U3C A;  3I5P A;  1OWO A;  3CHP A;  3D9L A;  3SD5 A;  3L22 A;  3TXN A;  5BUZ A;  2X6I A;  3FUF A;  1Y6I A;  3FTS A;  3RRU A;  2KZT B;  3ZHE A;  4EZL A;  4AY5 A;  3I4G A;  4Q94 A;  4B89 A;  5FQ6 A;  2I1K A;  3UPV A;  4E85 A;  2WB2 A;  4LRZ A;  4UWF A;  1SZA A;  3IBE A;  3LY9 A;  4APF A;  5A23 A;  1JUQ A;  3PZD A;  3FP3 A;  4K03 A;  3CVW A;  1KT0 A;  3CST A;  5A6C A;  1HXI A;  4YND A;  3PDN A;  4M3O A;  5HQ8 A;  2I6H A;  4GA2 A;  4GCO A;  2GW1 A;  3TGO A;  4XX5 A;  3B7U X;  4A55 A;  2KZT A;  4HLE A;  5JJ7 A;  2BUG A;  2X6F A;  2X6J A;  3LEW A;  4G1T A;  4GAA A;  4AP2 A;  2DCP A;  3RK6 A;  5ENN A;  2WXL A;  1HF8 A;  2X3M A;  2PQR A;  2R59 A;  4KZ0 A;  4UI9 J;  2WXH A;  3ZN3 A;  3TG5 A;  3UT8 A;  2I2O A;  3PRZ A;  3ULQ A;  1U3D A;  3O48 A;  5G2N A;  2WXO A;  3RRN B;  2XPY A;  2KM4 A;  2XRY A;  3CKB A;  3D9P A;  4GZ3 A;  1OWP A;  1TJF A;  4J8D A;  2VSX E;  3PS6 A;  4WNE A;  3SHF A;  3C98 A;  1Z6T A;  2LNI A;  4BWR A;  5LCW J;  2WXP A;  4HOQ A;  4ATG A;  3FFL A;  3B7T A;  2C0L A;  3U4T A;  4BTB A;  4B94 A;  1WM5 A;  3EIJ A;  4GMJ A;  3EHM A;  3QNK A;  3MX3 A;  3NQP A;  3FU6 A;  4L7T A;  3S2A A;  2BF0 X;  3ESL A;  3FWV A;  5KJM A;  2WXR A;  1LF8 A;  1OUV A;  4JZY A;  1H6K A;  3MGB A;  4CDR A;  4LER A;  3BG0 B;  4CCA A;  3Q4A B;  3L13 A;  5AYW D;  3PUK A;  3CVN A;  4HOU A;  2FI7 A;  3LYA A;  5M72 A;  3CGH A;  1NA3 A;  4E6H A;  1NZN A;  4GYW A;  3GZS A;  3HVE B;  4JW1 A;  4PH4 B;  5J90 A;  3G2V A;  4I1O B;  1IQR A;  5FT9 A;  3SI5 A;  4P29 A;  3OAW A;  1EYH A;  4IRU A;  4AOF A;  4UWL A;  4CGW A;  3D9M A;  4EBA A;  2LO6 A;  2V4L A;  2IF4 A;  3CVU A;  5FZR A;  3JQ1 A;  2WXI A;  1A17 A;  3HHM A;  4GA0 A;  3RO2 A;  4BX9 A;  3TXM A;  1TJC A;  2VGX A;  3B7R L;  3FHE A;  5G05 C;  4C0E A;  3B7S A;  2R17 C;  3PNT B;  5JHA A;  1B89 A;  3FEY A;  4DJA A;  1HG5 A;  1KT1 A;  4IYP A;  1UN9 A;  3P2B A;  3UT7 A;  4B8C B;  4BTA A;  2R5S A;  5ARF A;  4UWG A;  2FF4 A;  3FTY A;  4N39 A;  4BY6 A;  1UG3 A;  3G2U A;  3LVR E;  4GU5 A;  3FU0 A;  2WMO A;  3OXF A;  4CT0 A;  3D9O A;  2A4Z A;  4ILI A;  3FH7 A;  3PE4 A;  4JEH A;  3LVQ E;  4N3A A;  4ANU A;  3LJ3 A;  5ANL A;  1FCH A;  3KEZ A;  2ION A;  2I9C A;  4FUL A;  1L5J A;  4NUR A;  2AW6 A;  1BPO A;  2V0P A;  1HH8 A;  3LCA A;  3LS8 A;  4J8E A;  3FTV A;  5LFA A;  3QOU A;  2FBN A;  3CVP A;  4MLP A;  5HI7 A;  4F3V A;  4KYO B;  4U0U A;  5JJT A;  2AXZ A;  3L6A A;  2Q7F A;  4I6J A;  5FTP A;  5T8I A;  3VTX A;  2YHC A;  3CHM A;  2VSN A;  3EJN A;  4ILH B;  5KJK A;  5BV1 A;  2V5F A;  2KCL A;  4CEM A;  2PQN A;  3HDX A;  4OVV A;  4UQX A;  4G11 A;  1PY1 A;  4UQY A;  2IOL A;  1WY6 A;  4YVQ C;  4B8A A;  2L0I A;  4GA1 A;  4HVB A;  4I43 A;  3T5V A;  3GZ2 A;  4JEU A;  1P5Q A;  3BEE A;  3FTU A;  4RVB A;  5C1D A;  2IQC A;  3CK8 A;  2J49 A;  1JPL A;  3D9N A;  2CFU A;  4W9R A;  3G2W A;  3FEX A;  1PAQ A;  2XGM A;  4LUN U;  3QDN A;  3RU0 A;  5ARG A;  2E0I A;  5DIZ A;  3FUI A;  1Y8M A;  4BT9 A;  4O6F A;  2AVP A;  3ONL A;  2NC9 A;  4I1M A;  3AS5 A;  3MV2 B;  4L2L A;  5G55 A;  5FQ8 A;  4AM9 A;  4AVX A;  2MHK A;  2HO1 A;  2EQX A;  4KBQ A;  4LEU A;  1EF1 C;  4DPR A;  5T3R A;  3KS2 A;  4PS8 A;  4TUU A;  1MHQ A;  5CCM A;  3MKQ B;  4Q96 A;  4AXH A;  1E7U A;  3K9I A;  4TRQ A;  1IHG A;  3LY7 A;  3CK9 A;  1ELR A;  2MOW A;  2OVF A;  4L23 A;  4DLQ A;  4OVU A;  4K0R A;  4EBA G;  1E96 B;  4GML A;  4N3C A;  5AJD A;  3QAR A;  2P58 C;  3Q5M A;  1E8X A;  2VSY A;  1HU3 A;  4WWP A;  3CKC A;  2J4D A;  3QJZ A;  3ZRH A;  5BW8 C;  3ZIM A;  4ANW A;  2VTB A;  3SZ7 A;  4F53 A;  3HVE A;  4A3V A;  4DI3 A;  5EDS A;  2LSV A;  3RJV A;  3DBS A;  5KJL A;  1HFA A;  3S7B A;  1HS6 A;  2J9Q A;  1EDU A;  2WVI A;  4N2Q A;  5ANR A;  4U8H A;  1Z3Y A;  3ZFW A;  1N52 A;  3OTN A;  1JWG A;  1E90 A;  3S7F A;  5JJ6 A;  1S0P A;  2FO7 A;  4MS6 A;  5LOZ A;  3CK7 A;  3FTZ A;  3MJW A;  2J08 A;  3MYV A;  4U07 A;  3I4R B;  1QQE A;  4LCT A;  3SGH A;  2GRM A;  4BX8 A;  1ZBP A;  3EHN A;  4MKT A;  2HM8 A;  2WXQ A;  4UI9 C;  4FC8 A;  4APO A;  3MZL B;  4A3T A;  3ZYK A;  3ONK A;  1N54 A;  4C9B B;  2KAT A;  3FUD A;  3MA5 A;  2IJG X;  1H0A A;  3I3N A;  4I2Z A;  3L54 A;  4DLO A;  3ASG A;  3R7Q A;  5AEN A;  1HG2 A;  2WXM A;  2IOS A;  1QZ2 A;  3PE3 A;  1MQS A;  4D10 C;  4RG6 A;  5CHE E;  3MCX A;  2VJ8 A;  3Q47 B;  3SBT B;  3S7D A;  2KCV A;  1OWM A;  4FHJ A;  4WNF A;  3GW4 A;  4G23 A;  3D9J A;  4NRH B;  2E2E A;  5FQ4 A;  2UWJ G;  1HZ4 A;  3ASD A;  3CHO A;  2CFZ A;  2J4B A;  2JEK A;  2X38 A;  4NQ0 A;  4UQZ A;  4Y6C A;  5CCL A;  5LX8 A;  3KAE A;  1H2T C;  1XNF A;  1KLX A;  4DI4 A;  3G2S A;  5BT1 A;  2CHW A;  1SZ9 A;  1WAO 1;  5KCM A;  3MV3 B;  3L08 A;  1E7V A;  2QY7 A;  2WPV A;  3QB2 A;  4N2S A;  4JA7 A;  3UT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...