3D9PA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVTVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9pA00
3G2SA 3D9PA 1MHQA 1ELKA 1PY1A 3D9NA 2LO6A 2L0TB 4FU3A 4HFGA 1JWGA 1EDUA 3CLJA 2BF0X 3ZYKA 3D9IA 1SZ9A 4AVXA 1HF8A 2DCPA 2V8SE 4NACA 1X5BA 4JXTA 4Q96A 3ZYMA 3D9LA 2QY7A 3G2WA 3D9OA 3RRUA 1JPLA 3G2VA 4FLBA 1HFAA 4GZCA 1UJKA 1HX8A 1XGWA 3ZYLA 1JWFA 1H0AA 4Q94A 1HG5A 5CMYA 2DIWA 1LF8A 1VDYA 3G2TA 2KM4A 3G2UA 3LDZA 4GZDA 5LOZA 1HG2A 2MOWA 5J08A 1INZA 1JUQA 3D9MA 2L0IA 1SZAA 3D9KA 3ONLA 5CMWA 5LP0A 1UJJA 1DVPA 3ONKA 3ZYQA 1EYHA 3D9JA
chains in the Genus database with same CATH superfamily
2PM7A 4GTTA 4O1PA 4OVUA 3BQOA 2IONA 3Q7FA 1QZ2A 2Y0BG 3UQ3A 3PEVB 2OVBA 5ENPD 5AIJA 2DVWA 5A23A 4BSZB 3RSEG 4MLPA 4KMOA 3TWRA 4GA1A 5EKQD 5ARFA 2X38A 4DPRA 4HRLA 3FUIA 5M72A 5KNHD 4HOSA 3UIOC 5ENTD 1HO8A 1NZNA 3PVLA 4BTAA 4U96D 5LFAA 1S70B 3AS5A 5BUZA 4U04A 3ZPJA 3ASNE 3MZLB 2C0LA 2UY1A 4UQXA 2QYJA 3NAWA 1K8KG 1OXJA 2XEEA 3T9KA 2WXPA 2R02A 4JEHA 5ENQD 2X6JA 5AJLA 1OWLA 3Q75A 2LUHA 4OVVA 1U2VG 3DXMG 4GYYA 4LEUA 4CT0A 3DRAA 2XGMA 2P58C 4YDEA 3QDNA 3ZHEB 3NZUA 3U64A 4K03A 2LSVA 3OXFA 3TWVA 1SA4A 4K5CA 2KZTA 4HXIA 1DCQA 3FTZA 4FLHA 2LXMA 3K9IA 3MYVA 2CHXA 4UWKA 2WXQA 4PDXA 1UOHA 3FEXA 2P9KG 3FWVA 1N4PA 4ATZD 4ATGA 5KNGA 4JVSA 3JUIA 2JABA 4TV3A 3LY8A 4HS2A 5EX0A 2BTDA 4I1OB 4TUMA 2L6BA 4Y6CA 2WMNA 3JQ1A 4C0EA 3QWWA 2OVFA 3QB2A 4EZKA 5D0OD 3G2VA 1U3CA 2JLBA 4DI3A 3FULA 5FIOA 4P29A 3R7QA 3EJNA 1WY6A 1TNUA 5BXUA 4BESA 3AU5A 5BV0A 3DSSA 2VJ8A 3D9OA 3CQCB 3U4TA 4K0RA 5FQ7A 1MX4A 5AARA 5CRUA 5JA4D 5LCWJ 3C98A 5KWDA 3E30A 2M63A 1E8XA 3CKCA 4L2YA 1UN9A 5T4YA 3ENEA 4O6FA 3CSTA 3FUHA 4YDOA 4LG6A 2WPVA 2WXIA 1H6OA 4AY6A 4M7CA 1HXIA 4JPSA 5B3SE 4XIFA 4TXPA 3B13A 2RD0A 3J5PA 3SY2A 3E33A 3E4BA 2PQNA 4O60A 3TG4A 1IYGA 3DSVA 4BTBA 2VGXA 3VTYA 5CEDB 2A4ZA 1KLXA 4NQ0A 3CQGB 5FTPA 1L5JA 4GTPA 4PS8A 4U95D 4HRNA 4ANXA 3R7RA 4N3BA 4B89A 2IJGX 4XI0A 4U63A 3DSTA 2LXLA 4DX6D 1DCEA 4YVQC 4ILIA 5CMYA 4CZ2D 2B6CA 4ACKA 1Y6IA 2ETCA 2CFZA 4UQYA 3KEZA 2X6IA 3NOGD 3LVRE 2WXNA 4BX9A 1BLXB 4WAFA 4HI8A 1HG5A 4WNDA 3NOCD 2QZAA 2OV8A 3TWXA 2XPZA 3AS8A 1Z3XA 3ULYA 3C5RA 4I6GA 3V30A 4YDYA 4AVXA 1HF8A 2GRLA 1FT1A 3MKRA 3B7BA 3UMVA 1O1TA 4BEPA 3ZYQA 3CHPA 2YNQA 4EPZA 3UM3A 3ASOE 3X2QE 4Q96A 3BEEA 5JJ7A 1OCCE 5EIDA 4GMJA 4DX7D 2GW1A 4WNEA 4HRMB 1TNZA 4CGWA 4I6JA 4WWNA 4DRXE 3SQVA 3CVWA 4BX8A 4A63B 3ULEG 1E96B 3DBSA 4F7AA 3SD5A 1SZ9A 3CK7A 1FVHA 4N39A 3QKYA 4FADA 4APFA 5FWQA 2GRRB 2IY0C 2Y4TA 2WXFA 3UTMA 3UX4A 4NURA 4JHJA 2OOEA 3T8KA 3ZNGA 5JJTA 1E90A 4J8FA 2IOLA 2MYOA 5CBOA 5ENRD 1D8DA 3LCAA 2XQ0A 3AJIA 5B1AE 1S0PA 2BUGA 4Q69A 3UIPC 3APCA 1S63A 1AWCB 5DIZA 4FJYA 4G24A 5FQ8A 5FINA 4JA9A 3Q5MA 3OXGA 3D9IA 3PEUB 3IV0A 4GTVA 1OCZE 4RSYA 2Q7FA 4RLYA 2R17C 4XI9A 5G2NA 2Y3AA 4I43A 2XS8A 4UQZA 4CDNA 3Q79A 1Z3YA 4HOQA 4LNBA 5FZQA 2WXJA 1O5MA 4WUYA 3NBNB 3JQ0A 1DC2A 3ZHEA 3QJZA 5E75A 4RQIA 4X8QA 4IRUA 3FUKA 5D0QD 3UM1A 1ZU2A 2ZISA 4TUUA 1IQUA 3MKQB 2BKGA 4LCTA 4N2SA 3EU5A 5CERB 1OT8A 2OEWA 1H2UA 5KCMA 4U0ZA 4U8VD 4DK5A 3FUNA 1GW6A 5EIBE 5EYLA 2KCVA 3GZ1A 4JHRA 2LAHA 3J5QB 4ME2A 1N0QA 1JWFA 1IHGA 4HOTA 4AXHA 2AXVA 1WDYA 4U0UA 4HI9A 1E7VA 4GB9A 2IEJA 3MV3B 2VQ2A 3ZEFA 2HE0A 2NYJA 1Z5SC 1TJFA 2ZIRA 4GCNA 1QNFA 5EN5D 4CGVA 4UWHA 4Q94A 3DSXA 3LY9A 4F53A 3MEKA 4GTRA 2FBNA 4BT8A 4GCOA 3KS2A 2XCCA 3UKUG 4I2WA 1A17A 3LEWA 5FQ4A 3SO8A 4Y6WA 3GZ2A 4CYMD 2IO2C 3BG0B 2GRNB 5G04C 2FEZA 2WXRA 5T8IA 3JYSA 1SA5A 4G11A 1UN8A 3TXNA 2JEKA 5CCLA 2DYSE 3I4RB 3E32A 3HDXA 4GTOA 2F8XK 2CFUA 4HORA 2J49A 4U8HA 1RZ4A 3HRAA 3AG4E 5EILA 4JA7A 5IY5E 2RG8A 2IO3C 4FHJA 1AP7A 3EHRA 3OXLA 4B8AA 4FJZA 1IXVA 1NA0A 3ONKA 2VSYA 3FTWA 3ZKJA 2YHCA 3ASFA 1OWMA 3AS4A 1MX6A 4MKTA 3KD7A 3CV0A 2R5SA 4WWPA 4BETA 3CVNA 1K1AA 2DZNA 3SNXA 4B93B 4G2VA 5BW8C 3S7DA 4FC8A 1V54E 3MJWA 5A7DB 1SQMA 2V8SE 4CEMA 3FEYA 3ESKA 4GZ6A 4LSZE 4ANWA 3V2XA 4DI4A 3PE3A 4XE0A 1OUVA 3QOUA 2FO7A 4DLOA 3C72A 2DWZA 4XZ4A 3CVXA 4AOFA 4ILGA 3FH5A 2R59A 3CIAA 1QBQA 4G1TA 1NI1A 1NFIE 5CMWA 2LSUA 4KYOB 1Q2ZA 3D9JA 5CRVA 2IF4A 1KPSB 4BERA 4L23A 3IXEA 3R9AB 4UI9J 4PUCA 2XZTG 3FH8A 3Q9NC 4FULA 3RRNB 2NSZA 2DBAA 4GA2A 4DUIA 1K1BA 5JHBA 1JCQA 4RG9A 2V0PA 4XEIG 2WXKA 3SF4A 4I1AA 4YNDA 3SZ7A 2L9BA 2LO6A 3CHRA 4OAUC 2LNIA 1TYQG 4FP7A 4GU5A 1TJCA 2F8YA 3V79K 3RRUA 4U0SA 3P2BA 4G8KA 3LXUX 1FCHA 2V5FA 1YMPA 1V55E 4GTSA 5J90A 3CVLA 2L0IA 4CDMA 4UUCA 1E8YA 1EPUA 3IEGA 5G05J 1OWNA 1HFAA 1H2VC 1UJKA 4LNUD 4TXQA 1VDYA 1WG0A 1E8ZA 4XKBA 5KJMA 3AG1E 5FT9A 2I2OA 5G55A 3ONLA 5JHAA 2VTBB 5EX3A 1KT1A 5AQBA 3D9NA 3S7FA 2IU1A 4ILHB 2B0OE 4N3AA 4B0ZA 3Q47B 5FQ6A 2KBXA 2PQRA 3SGHA 2FO1E 4M3OA 4XKCA 2WM9A 3TWQA 3FUFA 4LUNU 3IBEA 4DX5D 4J8EA 2UY1B 2DYRE 4BWRA 3HXCA 5AAOA 4U8YD 3RK6A 2F37A 3CK8A 3FTUA 2RFAA 3UINC 5BPPA 3JXJA 1ELKA 1PY1A 1OCOE 4GMLA 3DEPA 3PS6A 4GTMA 3CEQA 1U3DA 2X6KA 3PH0C 4DX1A 1N52A 3PZ3A 5D66A 1IKND 1PC2A 4G26A 2H6HA 1OY3D 4FHKA 4AP2A 4L7TA 2XPIA 3ZVVA 2XCBA 4JXTA 1OWPA 2ZU6B 4ANUA 1LD8A 3GZSA 5AQ7A 2XEVA 1O1SA 4HNAD 3ZW3A 3IHYA 3EDTB 4QFVA 5AN8A 4JL0A 4GPKA 3ASGA 3MKQA 3CLJA 4EQFA 5AQAA 1W3BA 4E85A 3TJPA 2R03A 1NL4A 2KATA 2NC9A 4I9EA 1EF1C 3HXFA 3PZDA 1X81A 2J08A 3U66A 1NP7A 1N11A 3QARA 3APDA 2HR2A 1D8EA 5CCMA 3UPVA 1TEZA 1H2TC 3AU4A 3PREA 4AJWA 3DWLG 5JJ6A 5D2MC 4GAAA 2EIME 4HBDA 5AYWD 4EECA 2J09A 2XS1A 4UI9K 3Q78A 5KJKA 2MHKA 5ANLA 4JD2G 3L9TA 2E0IA 1K3ZD 3FP3A 3HHMA 3D9KA 4HLEA 3QC1A 2KC7A 2V5QC 4MS6A 4TRQA 5FZRA 4C9BB 5HI7A 3CHOA 3FU6A 3T5XA 2EIJE 3SI5A 4IYPA 5C2YA 3NQPA 1NA3A 4YVOA 1INZA 2P9SG 2VGXB 3ZFWA 4MBGA 4DLQA 4EZLA 2DCPA 2ZXWE 3B7SA 3CVQA 1SW6A 2X6HA 3R9MA 4DJAA 5LCWC 2V4LA 1B89A 4N3CA 1FT2A 4R7LA 3ASHA 2J4BA 3D9HA 3D3MA 2VGEA 3AG2E 5H7PA 3TG5A 5G05C 2Y69E 1X5BA 3ABKE 3NZSA 4GZCA 1IHBA 2EILE 3FUEA 4L2LA 3CKBA 3ML8A 2EQXA 5ANRA 5A6CA 2OEVA 1N0RA 3ABLE 4GPMA 4GMRA 2J9QA 2Y4UA 1JCSA 4IN3B 3TGOA 2WQHA 3LY7A 4JZYA 5AQ9A 3RJVA 4C0MA 3HVEB 2AVPA 5HQ8A 1A5EA 1UG3A 3S2AA 5HKPA 3OAWA 2J4DA 4HVBA 1N54A 1MZCA 3CVPA 3RAUA 1E8WA 3C3QA 1EDUA 3FU3A 4GZ3A 4J7WA 3FUDA 4V3IA 5BXOA 3ASDA 5FZSA 1TN6A 4MRUA 3HYMB 2YQ8A 4ANVA 4LNGA 2QFCA 3UKRG 3EHQA 3CHSA 3L16A 3FH7A 1UJJA 3PZ1A 3B7RL 1YCSB 5HS0A 4UWGA 4EZJA 3SHFA 4JW1A 3W9FA 3FTSA 5T3RA 5B1BE 3L82A 5DBKA 3O48A 4EHMA 2KCLA 3OTNA 3DPDA 1HU3A 3FU0A 2ETAA 5ARGA 1MQSA 4BT9A 4A3VA 3ML9A 4J0UA 5C1DA 4G25A 3ZIMA 3KEAA 3QAQA 1PAQA 2P9UG 1BI8B 1XGWA 3SFZA 5CBNA 2A5UA 4H7YA 3UT8A 2HO1A 4OAVB 5J08A 3LJ3A 5LP0A 1DVPA 4AEZC 5HRYA 2YINA 1LTXA 3I4GA 4IULA 3I3NA 3ULQA 5BNWA 2VTBA 3FFLA 3C3OA 3FUMA 4G23A 4A3TA 2GRQB 3PE4A 2R2LA 2ONDA 3EU9A 2CHZA 2GRMA 1XNFA 2XHEA 3PUJA 4W9RA 1TR4A 3CHMA 4ZFHA 2BEDA 2WQ7A 3CHQA 3BG1B 3DPYA 4CRWA 4J8YA 4B8CB 4KVMA 3WXXA 2X6FA 3KSLA 2Y1LE 2PNNA 3Q9UC 5CEAA 4N5CA 3NB2A 3O4ZA 2IQCA 1TNBA 3V31A 1KT0A 3Q7AA 1WAO1 3QWPA 2J8SD 3D9LA 2QY7A 3ZRHA 4GYOA 2WB2A 2H6GA 1QYMA 3FU5A 2P9PG 3HG0D 3PNTB 1ELRA 3FDHA 3L6AA 3EIQC 4I6EA 2HYZA 2VYIA 4EBAG 4D10C 3G2TA 2I1KA 1BU9A 3FHEA 4AY5A 2R05A 3EHNA 4QQIA 2CG3A 3AAAC 3Q4AB 4BY6A 3ZGQA 2PL2A 3U9WA 2I9CA 4KT6B 5CHEE 3F6QA 4FLBA 5EYPF 3VLEA 4OYSA 4JHKA 4PH4B 5FJYA 2RFMA 2C2LA 3KAEA 4G8LA 1FPPA 3ZUVB 4LERA 3EIJA 1JWGA 2WXHA 2QYUA 5ENSD 2WMOA 1BI7B 3Q15A 2GRPB 1S64A 2J07A 2P9NG 3RO2A 3QWVA 3ZYLA 3UM0A 4ZHBA 4KXKB 3LPZA 3UT7A 5LOZA 4JEUA 2MOWA 3JUEA 2VSOE 4I17A 4RG6A 4CCAA 4F3VA 1ZBPA 3W9GA 2AWIA 1HX8A 2P2CP 2DIWA 1N4QA 3DSWA 2I6HA 3FTVA 2PZIA 4N5QA 4K5BA 2AJAA 1KZPA 4J8DA 1IQRA 5AJDA 4AV7A 2ILRA 2WXGA 3EUVA 3B7UX 3MCXA 5LX8A 3RIBA 3C3RA 4PS3A 2WVIA 4ABNA 3PZ4A 4A1SA 3TAXA 1TNOA 3TL5A 3UUXA 2EIKE 5AENA 1MHQA 4HFGA 3UXGA 4KZCA 4KVOA 3RO3A 3B95A 4WNGA 3TWUA 4C48B 4WWOA 4JC8A 2PM6A 3G2WA 4UWFA 1JPLA 1SVXA 2EINE 3MGBA 4F1SA 2P9LG 2VSXE 1N4RA 4A55A 3DSUA 1G3NB 4BFRA 4O1OA 4FU3A 3PRZA 4K5AB 3TWSA 3QNKA 1MYOA 4I9CA 1H6KA 2FI7A 3NF1A 4GYWA 2ZGDA 3EHMA 1N94A 3DXKG 2L6JA 4YDWA 2WXLA 3CVUA 2F0YA 4KZ0A 3D9PA 2KZTB 5ENNA 3ZYKA 2OCCE 3L22A 4GA0A 2E2EA 2ZGGA 4HB5A 3UM2A 3CVYA 4Z68A 2KCKA 1N4SA 3CR3A 2AW6A 1H19A 3KSQA 3VTXA 4HOUA 2YHEA 3IKOB 1EYHA 1QQEA 4EBAA 2KXPC 3HVEA 1TN8A 3JCKC 1MX2A 1TNYA 1E7UA 2I1JA 4AM9A 2WXMA 3SBTB 3ZU7B 1YYHA 4J6IA 1LF8A 4GTQA 1D9SA 5KBAA 5G04J 4I1MA 5KJNA 4I2ZA 2ETBA 2HM8A 4RVBA 2V4HC 3T5VA 4PS7A 3CSFA 1BPOA 2BF0X 3VLFA 3ZXSA 3ZYMA 1OCRE 3PNLB 2WXOA 1Z6TA 3ZN3A 3BU8A 2XGSA 1DNPA 3LKUA 3D9MA 4DX2A 4N2QA 5E76A 2GGFA 5JMND 4CDRA 2C0MA 1HS6A 4LRZA 4NACA 3SBSA 1UW4B 4NRHB 3L54A 3LVQE 2RKKA 3MX3A 4B94A 3RRMB 2KM4A 1MJ0A 4L9PA 4L1BA 2XGOA 4NIKA 3P1UA 4GZ5A 3ZXPA 2IOSA 4UI9C 2UWJG 1N9AA 2FULA 4E6HA 3U3WA 1N95A 1HG2A 3LYAA 3TWTA 4FA6A 4U7EB 5BV1A 5BT1A 3L13A 3BUAA 4J8SA 1WM5A 2XPYA 3JXIA 4H7XA 2A5EA 3PUKA 5ENOD 5ITZF 3N71A 3S7BA 3PZ2A 2DZOA 3LDZA 3SFYA 4CT4A 5CECB 2NXPA 3VLDA 2LAIA 1SZAA 2X3MA 2XZDG 5EDSA 2VSNA 3G2SA 3Q73A 3PDNA 1OWOA 3B7TA 3V2OA 4URKA 2WQ6A 2BKKB 2VGYA 2MRIA 4AIFA 1FVFA 3HXEA 3T8MA 3QK0A 3G2UA 4GZDA 1O1RA 1KZOA 1LD7A 3IHVA 4ACLA 3UT4A 3HXDA 3DEOA 3L17A 2L0TB 3HIZA 1H6PA 5KJLA 3RU0A 2CHWA 3CVVA 3FTYA 3TXMA 2AXUA 1HH8A 3I5PA 3LJNA 4JB8P 2GROB 2AXZA 3Q49B 3S7JA 2QC9A 1HE8A 4XX5A 3AG3E 3RKVA 3ABME 1Y8MA 2FF4A 3ESLA 4UWLA 2XENA 3TWWA 2XRYA 4F1PA 1HZ4A 4F6RD 4U07A 3FTXA 1H0AA 4A1GA 2H6FA 3UI2A 1JUQA 4APOA 1BD8A 4BSXA 1YA0A 3SFXA 4TXRA 2P9IG 4WNFA 3LS8A 3URZA 3APFA 3E34A 1TN7A 4HLLA 3FY4A 2XEHA 1JCRA 3HXBA 2H6IA 1ELWA 3CK9A 3L08A 3MV2B 4HQDA 1P5QA 3MA5A 3ISMC 2XRZA 2CG2A 1ZB1A 4KBQA 3CGHA 3GW4A 3WG7E 3FUJA 3E37A 1RW2A 2IFUA 3GYZA
chains in the Genus database with same CATH topology
2PM7A 4LERA 4JA9A 4OVUA 3EIJA 3Q5MA 4FHKA 1JWGA 2IONA 2WXHA 1QZ2A 3OXGA 4L7TA 4AP2A 3D9IA 3UQ3A 2WMOA 2XPIA 3PEVB 3ZVVA 2OVBA 2XCBA 3PEUB 3IV0A 1OWPA 4JXTA 2ZU6B 3Q15A 5AIJA 4ANUA 3GZSA 5A23A 2J07A 3RO2A 3QWVA 2Q7FA 4RSYA 4MLPA 4KMOA 3ZYLA 2XEVA 4KXKB 3LPZA 3UT7A 4GA1A 5EKQD 5ARFA 2R17C 2X38A 4XI9A 5LOZA 4DPRA 3ZW3A 4JEUA 2MOWA 3FUIA 5M72A 4HOSA 5G2NA 2Y3AA 4I43A 3IHYA 3EDTB 2VSOE 4I17A 1HO8A 4QFVA 4RG6A 4UQZA 4JL0A 4GPKA 3ASGA 4CCAA 1NZNA 3PVLA 4CDNA 3MKQA 4F3VA 1Z3YA 3CLJA 4BTAA 4HOQA 4EQFA 5FZQA 1W3BA 1ZBPA 3TJPA 4E85A 2WXJA 5LFAA 4WUYA 2KATA 2AWIA 1HX8A 3AS5A 5BUZA 4U04A 3ZPJA 2DIWA 2NC9A 3JQ0A 3MZLB 4I9EA 2C0LA 1EF1C 2I6HA 3FTVA 2PZIA 3PZDA 2UY1A 4UQXA 2J08A 3ZHEA 3U66A 3QJZA 5E75A 1NP7A 4IRUA 4J8DA 1IQRA 3QARA 3FUKA 3APDA 5D0QD 5AJDA 2HR2A 4AV7A 2ILRA 2WXGA 3B7UX 5CCMA 3MCXA 2WXPA 3UPVA 1ZU2A 4JEHA 4TUUA 5LX8A 3RIBA 1IQUA 2X6JA 3MKQB 5AJLA 1TEZA 1H2TC 3AU4A 4LCTA 3PREA 4N2SA 4PS3A 4AJWA 1OWLA 2WVIA 4ABNA 5JJ6A 4OVVA 3TAXA 4A1SA 3TL5A 4GAAA 4GYYA 4LEUA 3UUXA 4CT0A 5AENA 1MHQA 1H2UA 4HFGA 4U0ZA 5KCMA 2XGMA 4KZCA 4KVOA 4DK5A 5AYWD 4EECA 3RO3A 2P58C 4WNGA 3FUNA 2J09A 3QDNA 4UI9K 3ZHEB 3NZUA 1GW6A 4JC8A 2PM6A 3G2WA 4UWFA 4WWOA 3U64A 5KJKA 1JPLA 2KCVA 3GZ1A 4K03A 4JHRA 2LAHA 2LSVA 4ME2A 2MHKA 1JWFA 3OXFA 1IHGA 3MGBA 5ANLA 2VSXE 4F1SA 4HOTA 4AXHA 4A55A 2KZTA 2AXVA 2E0IA 3FP3A 3HHMA 4HXIA 4BFRA 3D9KA 4U0UA 3FTZA 4FLHA 4HLEA 3K9IA 4Q69A 1E7VA 4GB9A 3QC1A 3MV3B 2KC7A 3MYVA 2CHXA 2VQ2A 4MS6A 4FU3A 3PRZA 2WXQA 4TRQA 4UWKA 5FZRA 3ZEFA 5HI7A 4PDXA 3CHOA 3FU6A 3T5XA 1TJFA 3QNKA 4GCNA 3FEXA 1QNFA 4CGVA 4I9CA 3SI5A 4UWHA 1H6KA 2FI7A 3FWVA 3NF1A 4GYWA 4Q94A 4IYPA 5C2YA 3EHMA 3NQPA 4ATGA 3LY9A 4JVSA 4F53A 3JUIA 3MEKA 2FBNA 4TV3A 1NA3A 3LY8A 4HS2A 4YVOA 1INZA 5EX0A 4BT8A 4GCOA 2BTDA 2L6JA 2WXLA 3CVUA 3KS2A 2XCCA 4KZ0A 3D9PA 2VGXB 3ZFWA 4I1OB 4I2WA 4Y6CA 2KZTB 5ENNA 3ZYKA 4DLQA 4EZLA 3L22A 4GA0A 2DCPA 2E2EA 2WMNA 1A17A 3JQ1A 3LEWA 5FQ4A 4C0EA 3QWWA 2OVFA 4Y6WA 3CVYA 3GZ2A 3QB2A 4EZKA 5D0OD 3G2VA 2KCKA 1U3CA 3BG0B 2JLBA 3B7SA 3CVQA 2X6HA 4DI3A 3FULA 5G04C 4DJAA 3CR3A 2AW6A 2FEZA 5LCWC 2WXRA 4P29A 2V4LA 1B89A 1H19A 3JYSA 4N3CA 4HOUA 5T8IA 3EJNA 2YHEA 3R7QA 3VTXA 1WY6A 4G11A 1UN8A 3ASHA 2JEKA 4R7LA 3TXNA 5CCLA 3IKOB 1EYHA 2J4BA 1QQEA 3I4RB 3D3MA 4EBAA 3TG5A 3HVEA 5G05C 3HDXA 2CFUA 3AU5A 2J49A 3JCKC 5BV0A 4HORA 4U8HA 1E7UA 1X5BA 2VJ8A 3D9OA 2I1JA 4JA7A 3NZSA 2RG8A 4GZCA 3CQCB 4AM9A 2WXMA 3SBTB 3FUEA 3U4TA 4J6IA 4K0RA 1LF8A 4L2LA 4FHJA 3CKBA 5FQ7A 5G04J 4I1MA 3ML8A 2EQXA 3OXLA 5ANRA 4B8AA 5A6CA 5KJNA 4I2ZA 5LCWJ 3C98A 4FJZA 2HM8A 4RVBA 3T5VA 1NA0A 2M63A 1E8XA 2J9QA 2Y4UA 3CKCA 2VSYA 3ONKA 4L2YA 3FTWA 4PS7A 1UN9A 2YHCA 3ASFA 4IN3B 1OWMA 3CSFA 1BPOA 2BF0X 3TGOA 3AS4A 3VLFA 2WQHA 3LY7A 4JZYA 5T4YA 4MKTA 3ZXSA 3ZYMA 3KD7A 3PNLB 3CV0A 3ENEA 4O6FA 3CSTA 2R5SA 3RJVA 3FUHA 4WWPA 3HVEB 4C0MA 2AVPA 2WXOA 1Z6TA 2WPVA 2WXIA 3CVNA 3ZN3A 4AY6A 5HQ8A 1UG3A 2XGSA 3S2AA 1DNPA 3LKUA 3D9MA 3OAWA 2J4DA 3SNXA 4HVBA 1HXIA 4JPSA 4N2QA 1N54A 4G2VA 4XIFA 3CVPA 5E76A 2GGFA 5BW8C 3S7DA 4CDRA 1E8WA 2C0MA 4FC8A 1HS6A 1EDUA 3B13A 4LRZA 3FU3A 3MJWA 5A7DB 1SQMA 2V8SE 2RD0A 4NACA 4CEMA 3SBSA 4GZ3A 3FUDA 4V3IA 1UW4B 4NRHB 3ASDA 3FEYA 5FZSA 3E4BA 2PQNA 3ESKA 4GZ6A 4MRUA 3HYMB 4ANWA 2YQ8A 3L54A 3TG4A 4DI4A 3LVQE 4ANVA 3PE3A 4XE0A 1IYGA 3MX3A 4B94A 4BTBA 3RRMB 2KM4A 2VGXA 2QFCA 1OUVA 3VTYA 2A4ZA 4L1BA 1KLXA 3CHSA 4NQ0A 3L16A 3QOUA 3FH7A 2XGOA 3CQGB 5FTPA 1L5JA 3P1UA 1UJJA 4GZ5A 4PS8A 2FO7A 4ANXA 4DLOA 3R7RA 4N3BA 2IOSA 3B7RL 4B89A 2IJGX 4UWGA 4EZJA 4UI9C 4XI0A 4U63A 4XZ4A 3SHFA 3CVXA 2UWJG 4JW1A 4YVQC 2FULA 3FTSA 4ILIA 4AOFA 4E6HA 4ILGA 5T3RA 3FH5A 3U3WA 2R59A 5CMYA 5DBKA 3CIAA 3O48A 2KCLA 4ACKA 1HG2A 3DPDA 3LYAA 3OTNA 4G1TA 1Y6IA 1HU3A 3FU0A 5ARGA 1MQSA 2CFZA 4FA6A 4BT9A 5CMWA 4UQYA 2LSUA 4KYOB 5BV1A 3D9JA 3KEZA 4A3VA 5BT1A 3ML9A 3L13A 2IF4A 2X6IA 4J8SA 1WM5A 4J0UA 3LVRE 2WXNA 2XPYA 5C1DA 4G25A 4L23A 3ZIMA 3QAQA 4BX9A 4H7XA 3R9AB 4UI9J 1PAQA 3PUKA 4PUCA 3FH8A 4FULA 3RRNB 2NSZA 3N71A 4WAFA 2DBAA 4GA2A 3S7BA 1XGWA 3SFZA 1HG5A 4WNDA 2A5UA 4H7YA 3UT8A 5JHBA 2HO1A 3LDZA 4CT4A 2NXPA 4RG9A 2V0PA 5J08A 2WXKA 3LJ3A 3VLDA 2OV8A 2LAIA 1SZAA 2X3MA 4I1AA 3SF4A 5EDSA 5LP0A 2VSNA 1DVPA 4YNDA 2XPZA 3G2SA 3SZ7A 3AS8A 1Z3XA 4AEZC 2L9BA 2LO6A 3PDNA 4I6GA 1OWOA 2YINA 3CHRA 3I4GA 4IULA 2LNIA 4FP7A 3B7TA 1HF8A 4AVXA 4URKA 2WQ6A 2VGYA 3I3NA 4GU5A 2MRIA 3ULQA 4AIFA 1TJCA 3RRUA 2GRLA 5BNWA 1FVFA 4U0SA 3P2BA 2VTBA 3FFLA 3LXUX 1FCHA 4C9BB 3FUMA 3T8MA 3QK0A 2V5FA 3MKRA 4G23A 4A3TA 3G2UA 3PE4A 4GZDA 3UMVA 2ONDA 5J90A 3CVLA 2L0IA 3IHVA 4CDMA 4ACLA 3UT4A 2CHZA 2GRMA 3ZYQA 3CHPA 1XNFA 1E8YA 3L17A 1EPUA 2XHEA 2L0TB 3PUJA 3HIZA 4W9RA 2YNQA 3RU0A 3IEGA 5KJLA 4EPZA 2CHWA 5G05J 3CHMA 4Q96A 3CVVA 3FTYA 3BEEA 5JJ7A 1OWNA 2WQ7A 1HFAA 1H2VC 3CHQA 3TXMA 2AXUA 1HH8A 1UJKA 3I5PA 3BG1B 4GMJA 2GW1A 4WNEA 1VDYA 4CRWA 1E8ZA 2AXZA 3Q49B 4XKBA 4B8CB 3S7JA 5KJMA 4KVMA 4CGWA 5FT9A 2I2OA 1HE8A 5G55A 3ONLA 3WXXA 2X6FA 4I6JA 5JHAA 2VTBB 4WWNA 4XX5A 5EX3A 3RKVA 3CVWA 1KT1A 4BX8A 3D9NA 3S7FA 1E96B 1Y8MA 2IU1A 3DBSA 4ILHB 4N5CA 2FF4A 3SD5A 4F7AA 3O4ZA 3ESLA 1SZ9A 4UWLA 2IQCA 3CK7A 1KT0A 4N3AA 1WAO1 4B0ZA 3QWPA 3D9LA 2QY7A 2XRYA 3Q47B 1HZ4A 1FVHA 4U07A 3FTXA 4N39A 5FQ6A 3ZRHA 3QKYA 4FADA 1H0AA 4GYOA 2PQRA 3SGHA 4A1GA 4APFA 5FWQA 2WB2A 4M3OA 1JUQA 4APOA 2Y4TA 3FU5A 4BSXA 1YA0A 4XKCA 2WXFA 3PNTB 2WM9A 1ELRA 3FDHA 3FUFA 3L6AA 3IBEA 4LUNU 3UX4A 3EIQC 4JHJA 4NURA 2OOEA 4WNFA 5JJTA 4J8EA 1E90A 2UY1B 3LS8A 3URZA 4BWRA 3APFA 4J8FA 2IOLA 4I6EA 3FY4A 2HYZA 2VYIA 4EBAG 4D10C 3G2TA 2I1KA 3LCAA 3FHEA 1ELWA 3RK6A 2XQ0A 3CK8A 3FTUA 3CK9A 3L08A 3MV2B 4AY5A 3EHNA 5BPPA 2CG3A 3Q4AB 3VLEA 4BY6A 1ELKA 1P5QA 1PY1A 3ZGQA 2PL2A 3MA5A 3U9WA 2I9CA 4GMLA 4KT6B 2XRZA 2CG2A 3PS6A 5CHEE 1S0PA 4FLBA 2BUGA 3CEQA 4KBQA 3CGHA 4OYSA 3GW4A 1U3DA 2X6KA 3APCA 3PH0C 3FUJA 4JHKA 1N52A 4PH4B 5FJYA 5DIZA 1PC2A 4FJYA 2IFUA 2C2LA 4G24A 3KAEA 4G26A 5FQ8A 3GYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2S A;  3D9P A;  1MHQ A;  1ELK A;  1PY1 A;  3D9N A;  2LO6 A;  2L0T B;  4FU3 A;  4HFG A;  1JWG A;  1EDU A;  3CLJ A;  2BF0 X;  3ZYK A;  3D9I A;  1SZ9 A;  4AVX A;  1HF8 A;  2DCP A;  2V8S E;  4NAC A;  1X5B A;  4JXT A;  4Q96 A;  3ZYM A;  3D9L A;  2QY7 A;  3G2W A;  3D9O A;  3RRU A;  1JPL A;  3G2V A;  4FLB A;  1HFA A;  4GZC A;  1UJK A;  1HX8 A;  1XGW A;  3ZYL A;  1JWF A;  1H0A A;  4Q94 A;  1HG5 A;  5CMY A;  2DIW A;  1LF8 A;  1VDY A;  3G2T A;  2KM4 A;  3G2U A;  3LDZ A;  4GZD A;  5LOZ A;  1HG2 A;  2MOW A;  5J08 A;  1INZ A;  1JUQ A;  3D9M A;  2L0I A;  1SZA A;  3D9K A;  3ONL A;  5CMW A;  5LP0 A;  1UJJ A;  1DVP A;  3ONK A;  3ZYQ A;  1EYH A;  3D9J A; 
#chains in the Genus database with same CATH topology
 2PM7 A;  4GTT A;  4O1P A;  4OVU A;  3BQO A;  2ION A;  3Q7F A;  1QZ2 A;  2Y0B G;  3UQ3 A;  3PEV B;  2OVB A;  5ENP D;  5AIJ A;  2DVW A;  5A23 A;  4BSZ B;  3RSE G;  4MLP A;  4KMO A;  3TWR A;  4GA1 A;  5EKQ D;  5ARF A;  2X38 A;  4DPR A;  4HRL A;  3FUI A;  5M72 A;  5KNH D;  4HOS A;  3UIO C;  5ENT D;  1HO8 A;  1NZN A;  3PVL A;  4BTA A;  4U96 D;  5LFA A;  1S70 B;  3AS5 A;  5BUZ A;  4U04 A;  3ZPJ A;  3ASN E;  3MZL B;  2C0L A;  2UY1 A;  4UQX A;  2QYJ A;  3NAW A;  1K8K G;  1OXJ A;  2XEE A;  3T9K A;  2WXP A;  2R02 A;  4JEH A;  5ENQ D;  2X6J A;  5AJL A;  1OWL A;  3Q75 A;  2LUH A;  4OVV A;  1U2V G;  3DXM G;  4GYY A;  4LEU A;  4CT0 A;  3DRA A;  2XGM A;  2P58 C;  4YDE A;  3QDN A;  3ZHE B;  3NZU A;  3U64 A;  4K03 A;  2LSV A;  3OXF A;  3TWV A;  1SA4 A;  4K5C A;  2KZT A;  4HXI A;  1DCQ A;  3FTZ A;  4FLH A;  2LXM A;  3K9I A;  3MYV A;  2CHX A;  4UWK A;  2WXQ A;  4PDX A;  1UOH A;  3FEX A;  2P9K G;  3FWV A;  1N4P A;  4ATZ D;  4ATG A;  5KNG A;  4JVS A;  3JUI A;  2JAB A;  4TV3 A;  3LY8 A;  4HS2 A;  5EX0 A;  2BTD A;  4I1O B;  4TUM A;  2L6B A;  4Y6C A;  2WMN A;  3JQ1 A;  4C0E A;  3QWW A;  2OVF A;  3QB2 A;  4EZK A;  5D0O D;  3G2V A;  1U3C A;  2JLB A;  4DI3 A;  3FUL A;  5FIO A;  4P29 A;  3R7Q A;  3EJN A;  1WY6 A;  1TNU A;  5BXU A;  4BES A;  3AU5 A;  5BV0 A;  3DSS A;  2VJ8 A;  3D9O A;  3CQC B;  3U4T A;  4K0R A;  5FQ7 A;  1MX4 A;  5AAR A;  5CRU A;  5JA4 D;  5LCW J;  3C98 A;  5KWD A;  3E30 A;  2M63 A;  1E8X A;  3CKC A;  4L2Y A;  1UN9 A;  5T4Y A;  3ENE A;  4O6F A;  3CST A;  3FUH A;  4YDO A;  4LG6 A;  2WPV A;  2WXI A;  1H6O A;  4AY6 A;  4M7C A;  1HXI A;  4JPS A;  5B3S E;  4XIF A;  4TXP A;  3B13 A;  2RD0 A;  3J5P A;  3SY2 A;  3E33 A;  3E4B A;  2PQN A;  4O60 A;  3TG4 A;  1IYG A;  3DSV A;  4BTB A;  2VGX A;  3VTY A;  5CED B;  2A4Z A;  1KLX A;  4NQ0 A;  3CQG B;  5FTP A;  1L5J A;  4GTP A;  4PS8 A;  4U95 D;  4HRN A;  4ANX A;  3R7R A;  4N3B A;  4B89 A;  2IJG X;  4XI0 A;  4U63 A;  3DST A;  2LXL A;  4DX6 D;  1DCE A;  4YVQ C;  4ILI A;  5CMY A;  4CZ2 D;  2B6C A;  4ACK A;  1Y6I A;  2ETC A;  2CFZ A;  4UQY A;  3KEZ A;  2X6I A;  3NOG D;  3LVR E;  2WXN A;  4BX9 A;  1BLX B;  4WAF A;  4HI8 A;  1HG5 A;  4WND A;  3NOC D;  2QZA A;  2OV8 A;  3TWX A;  2XPZ A;  3AS8 A;  1Z3X A;  3ULY A;  3C5R A;  4I6G A;  3V30 A;  4YDY A;  4AVX A;  1HF8 A;  2GRL A;  1FT1 A;  3MKR A;  3B7B A;  3UMV A;  1O1T A;  4BEP A;  3ZYQ A;  3CHP A;  2YNQ A;  4EPZ A;  3UM3 A;  3ASO E;  3X2Q E;  4Q96 A;  3BEE A;  5JJ7 A;  1OCC E;  5EID A;  4GMJ A;  4DX7 D;  2GW1 A;  4WNE A;  4HRM B;  1TNZ A;  4CGW A;  4I6J A;  4WWN A;  4DRX E;  3SQV A;  3CVW A;  4BX8 A;  4A63 B;  3ULE G;  1E96 B;  3DBS A;  4F7A A;  3SD5 A;  1SZ9 A;  3CK7 A;  1FVH A;  4N39 A;  3QKY A;  4FAD A;  4APF A;  5FWQ A;  2GRR B;  2IY0 C;  2Y4T A;  2WXF A;  3UTM A;  3UX4 A;  4NUR A;  4JHJ A;  2OOE A;  3T8K A;  3ZNG A;  5JJT A;  1E90 A;  4J8F A;  2IOL A;  2MYO A;  5CBO A;  5ENR D;  1D8D A;  3LCA A;  2XQ0 A;  3AJI A;  5B1A E;  1S0P A;  2BUG A;  4Q69 A;  3UIP C;  3APC A;  1S63 A;  1AWC B;  5DIZ A;  4FJY A;  4G24 A;  5FQ8 A;  5FIN A;  4JA9 A;  3Q5M A;  3OXG A;  3D9I A;  3PEU B;  3IV0 A;  4GTV A;  1OCZ E;  4RSY A;  2Q7F A;  4RLY A;  2R17 C;  4XI9 A;  5G2N A;  2Y3A A;  4I43 A;  2XS8 A;  4UQZ A;  4CDN A;  3Q79 A;  1Z3Y A;  4HOQ A;  4LNB A;  5FZQ A;  2WXJ A;  1O5M A;  4WUY A;  3NBN B;  3JQ0 A;  1DC2 A;  3ZHE A;  3QJZ A;  5E75 A;  4RQI A;  4X8Q A;  4IRU A;  3FUK A;  5D0Q D;  3UM1 A;  1ZU2 A;  2ZIS A;  4TUU A;  1IQU A;  3MKQ B;  2BKG A;  4LCT A;  4N2S A;  3EU5 A;  5CER B;  1OT8 A;  2OEW A;  1H2U A;  5KCM A;  4U0Z A;  4U8V D;  4DK5 A;  3FUN A;  1GW6 A;  5EIB E;  5EYL A;  2KCV A;  3GZ1 A;  4JHR A;  2LAH A;  3J5Q B;  4ME2 A;  1N0Q A;  1JWF A;  1IHG A;  4HOT A;  4AXH A;  2AXV A;  1WDY A;  4U0U A;  4HI9 A;  1E7V A;  4GB9 A;  2IEJ A;  3MV3 B;  2VQ2 A;  3ZEF A;  2HE0 A;  2NYJ A;  1Z5S C;  1TJF A;  2ZIR A;  4GCN A;  1QNF A;  5EN5 D;  4CGV A;  4UWH A;  4Q94 A;  3DSX A;  3LY9 A;  4F53 A;  3MEK A;  4GTR A;  2FBN A;  4BT8 A;  4GCO A;  3KS2 A;  2XCC A;  3UKU G;  4I2W A;  1A17 A;  3LEW A;  5FQ4 A;  3SO8 A;  4Y6W A;  3GZ2 A;  4CYM D;  2IO2 C;  3BG0 B;  2GRN B;  5G04 C;  2FEZ A;  2WXR A;  5T8I A;  3JYS A;  1SA5 A;  4G11 A;  1UN8 A;  3TXN A;  2JEK A;  5CCL A;  2DYS E;  3I4R B;  3E32 A;  3HDX A;  4GTO A;  2F8X K;  2CFU A;  4HOR A;  2J49 A;  4U8H A;  1RZ4 A;  3HRA A;  3AG4 E;  5EIL A;  4JA7 A;  5IY5 E;  2RG8 A;  2IO3 C;  4FHJ A;  1AP7 A;  3EHR A;  3OXL A;  4B8A A;  4FJZ A;  1IXV A;  1NA0 A;  3ONK A;  2VSY A;  3FTW A;  3ZKJ A;  2YHC A;  3ASF A;  1OWM A;  3AS4 A;  1MX6 A;  4MKT A;  3KD7 A;  3CV0 A;  2R5S A;  4WWP A;  4BET A;  3CVN A;  1K1A A;  2DZN A;  3SNX A;  4B93 B;  4G2V A;  5BW8 C;  3S7D A;  4FC8 A;  1V54 E;  3MJW A;  5A7D B;  1SQM A;  2V8S E;  4CEM A;  3FEY A;  3ESK A;  4GZ6 A;  4LSZ E;  4ANW A;  3V2X A;  4DI4 A;  3PE3 A;  4XE0 A;  1OUV A;  3QOU A;  2FO7 A;  4DLO A;  3C72 A;  2DWZ A;  4XZ4 A;  3CVX A;  4AOF A;  4ILG A;  3FH5 A;  2R59 A;  3CIA A;  1QBQ A;  4G1T A;  1NI1 A;  1NFI E;  5CMW A;  2LSU A;  4KYO B;  1Q2Z A;  3D9J A;  5CRV A;  2IF4 A;  1KPS B;  4BER A;  4L23 A;  3IXE A;  3R9A B;  4UI9 J;  4PUC A;  2XZT G;  3FH8 A;  3Q9N C;  4FUL A;  3RRN B;  2NSZ A;  2DBA A;  4GA2 A;  4DUI A;  1K1B A;  5JHB A;  1JCQ A;  4RG9 A;  2V0P A;  4XEI G;  2WXK A;  3SF4 A;  4I1A A;  4YND A;  3SZ7 A;  2L9B A;  2LO6 A;  3CHR A;  4OAU C;  2LNI A;  1TYQ G;  4FP7 A;  4GU5 A;  1TJC A;  2F8Y A;  3V79 K;  3RRU A;  4U0S A;  3P2B A;  4G8K A;  3LXU X;  1FCH A;  2V5F A;  1YMP A;  1V55 E;  4GTS A;  5J90 A;  3CVL A;  2L0I A;  4CDM A;  4UUC A;  1E8Y A;  1EPU A;  3IEG A;  5G05 J;  1OWN A;  1HFA A;  1H2V C;  1UJK A;  4LNU D;  4TXQ A;  1VDY A;  1WG0 A;  1E8Z A;  4XKB A;  5KJM A;  3AG1 E;  5FT9 A;  2I2O A;  5G55 A;  3ONL A;  5JHA A;  2VTB B;  5EX3 A;  1KT1 A;  5AQB A;  3D9N A;  3S7F A;  2IU1 A;  4ILH B;  2B0O E;  4N3A A;  4B0Z A;  3Q47 B;  5FQ6 A;  2KBX A;  2PQR A;  3SGH A;  2FO1 E;  4M3O A;  4XKC A;  2WM9 A;  3TWQ A;  3FUF A;  4LUN U;  3IBE A;  4DX5 D;  4J8E A;  2UY1 B;  2DYR E;  4BWR A;  3HXC A;  5AAO A;  4U8Y D;  3RK6 A;  2F37 A;  3CK8 A;  3FTU A;  2RFA A;  3UIN C;  5BPP A;  3JXJ A;  1ELK A;  1PY1 A;  1OCO E;  4GML A;  3DEP A;  3PS6 A;  4GTM A;  3CEQ A;  1U3D A;  2X6K A;  3PH0 C;  4DX1 A;  1N52 A;  3PZ3 A;  5D66 A;  1IKN D;  1PC2 A;  4G26 A;  2H6H A;  1OY3 D;  4FHK A;  4AP2 A;  4L7T A;  2XPI A;  3ZVV A;  2XCB A;  4JXT A;  1OWP A;  2ZU6 B;  4ANU A;  1LD8 A;  3GZS A;  5AQ7 A;  2XEV A;  1O1S A;  4HNA D;  3ZW3 A;  3IHY A;  3EDT B;  4QFV A;  5AN8 A;  4JL0 A;  4GPK A;  3ASG A;  3MKQ A;  3CLJ A;  4EQF A;  5AQA A;  1W3B A;  4E85 A;  3TJP A;  2R03 A;  1NL4 A;  2KAT A;  2NC9 A;  4I9E A;  1EF1 C;  3HXF A;  3PZD A;  1X81 A;  2J08 A;  3U66 A;  1NP7 A;  1N11 A;  3QAR A;  3APD A;  2HR2 A;  1D8E A;  5CCM A;  3UPV A;  1TEZ A;  1H2T C;  3AU4 A;  3PRE A;  4AJW A;  3DWL G;  5JJ6 A;  5D2M C;  4GAA A;  2EIM E;  4HBD A;  5AYW D;  4EEC A;  2J09 A;  2XS1 A;  4UI9 K;  3Q78 A;  5KJK A;  2MHK A;  5ANL A;  4JD2 G;  3L9T A;  2E0I A;  1K3Z D;  3FP3 A;  3HHM A;  3D9K A;  4HLE A;  3QC1 A;  2KC7 A;  2V5Q C;  4MS6 A;  4TRQ A;  5FZR A;  4C9B B;  5HI7 A;  3CHO A;  3FU6 A;  3T5X A;  2EIJ E;  3SI5 A;  4IYP A;  5C2Y A;  3NQP A;  1NA3 A;  4YVO A;  1INZ A;  2P9S G;  2VGX B;  3ZFW A;  4MBG A;  4DLQ A;  4EZL A;  2DCP A;  2ZXW E;  3B7S A;  3CVQ A;  1SW6 A;  2X6H A;  3R9M A;  4DJA A;  5LCW C;  2V4L A;  1B89 A;  4N3C A;  1FT2 A;  4R7L A;  3ASH A;  2J4B A;  3D9H A;  3D3M A;  2VGE A;  3AG2 E;  5H7P A;  3TG5 A;  5G05 C;  2Y69 E;  1X5B A;  3ABK E;  3NZS A;  4GZC A;  1IHB A;  2EIL E;  3FUE A;  4L2L A;  3CKB A;  3ML8 A;  2EQX A;  5ANR A;  5A6C A;  2OEV A;  1N0R A;  3ABL E;  4GPM A;  4GMR A;  2J9Q A;  2Y4U A;  1JCS A;  4IN3 B;  3TGO A;  2WQH A;  3LY7 A;  4JZY A;  5AQ9 A;  3RJV A;  4C0M A;  3HVE B;  2AVP A;  5HQ8 A;  1A5E A;  1UG3 A;  3S2A A;  5HKP A;  3OAW A;  2J4D A;  4HVB A;  1N54 A;  1MZC A;  3CVP A;  3RAU A;  1E8W A;  3C3Q A;  1EDU A;  3FU3 A;  4GZ3 A;  4J7W A;  3FUD A;  4V3I A;  5BXO A;  3ASD A;  5FZS A;  1TN6 A;  4MRU A;  3HYM B;  2YQ8 A;  4ANV A;  4LNG A;  2QFC A;  3UKR G;  3EHQ A;  3CHS A;  3L16 A;  3FH7 A;  1UJJ A;  3PZ1 A;  3B7R L;  1YCS B;  5HS0 A;  4UWG A;  4EZJ A;  3SHF A;  4JW1 A;  3W9F A;  3FTS A;  5T3R A;  5B1B E;  3L82 A;  5DBK A;  3O48 A;  4EHM A;  2KCL A;  3OTN A;  3DPD A;  1HU3 A;  3FU0 A;  2ETA A;  5ARG A;  1MQS A;  4BT9 A;  4A3V A;  3ML9 A;  4J0U A;  5C1D A;  4G25 A;  3ZIM A;  3KEA A;  3QAQ A;  1PAQ A;  2P9U G;  1BI8 B;  1XGW A;  3SFZ A;  5CBN A;  2A5U A;  4H7Y A;  3UT8 A;  2HO1 A;  4OAV B;  5J08 A;  3LJ3 A;  5LP0 A;  1DVP A;  4AEZ C;  5HRY A;  2YIN A;  1LTX A;  3I4G A;  4IUL A;  3I3N A;  3ULQ A;  5BNW A;  2VTB A;  3FFL A;  3C3O A;  3FUM A;  4G23 A;  4A3T A;  2GRQ B;  3PE4 A;  2R2L A;  2OND A;  3EU9 A;  2CHZ A;  2GRM A;  1XNF A;  2XHE A;  3PUJ A;  4W9R A;  1TR4 A;  3CHM A;  4ZFH A;  2BED A;  2WQ7 A;  3CHQ A;  3BG1 B;  3DPY A;  4CRW A;  4J8Y A;  4B8C B;  4KVM A;  3WXX A;  2X6F A;  3KSL A;  2Y1L E;  2PNN A;  3Q9U C;  5CEA A;  4N5C A;  3NB2 A;  3O4Z A;  2IQC A;  1TNB A;  3V31 A;  1KT0 A;  3Q7A A;  1WAO 1;  3QWP A;  2J8S D;  3D9L A;  2QY7 A;  3ZRH A;  4GYO A;  2WB2 A;  2H6G A;  1QYM A;  3FU5 A;  2P9P G;  3HG0 D;  3PNT B;  1ELR A;  3FDH A;  3L6A A;  3EIQ C;  4I6E A;  2HYZ A;  2VYI A;  4EBA G;  4D10 C;  3G2T A;  2I1K A;  1BU9 A;  3FHE A;  4AY5 A;  2R05 A;  3EHN A;  4QQI A;  2CG3 A;  3AAA C;  3Q4A B;  4BY6 A;  3ZGQ A;  2PL2 A;  3U9W A;  2I9C A;  4KT6 B;  5CHE E;  3F6Q A;  4FLB A;  5EYP F;  3VLE A;  4OYS A;  4JHK A;  4PH4 B;  5FJY A;  2RFM A;  2C2L A;  3KAE A;  4G8L A;  1FPP A;  3ZUV B;  4LER A;  3EIJ A;  1JWG A;  2WXH A;  2QYU A;  5ENS D;  2WMO A;  1BI7 B;  3Q15 A;  2GRP B;  1S64 A;  2J07 A;  2P9N G;  3RO2 A;  3QWV A;  3ZYL A;  3UM0 A;  4ZHB A;  4KXK B;  3LPZ A;  3UT7 A;  5LOZ A;  4JEU A;  2MOW A;  3JUE A;  2VSO E;  4I17 A;  4RG6 A;  4CCA A;  4F3V A;  1ZBP A;  3W9G A;  2AWI A;  1HX8 A;  2P2C P;  2DIW A;  1N4Q A;  3DSW A;  2I6H A;  3FTV A;  2PZI A;  4N5Q A;  4K5B A;  2AJA A;  1KZP A;  4J8D A;  1IQR A;  5AJD A;  4AV7 A;  2ILR A;  2WXG A;  3EUV A;  3B7U X;  3MCX A;  5LX8 A;  3RIB A;  3C3R A;  4PS3 A;  2WVI A;  4ABN A;  3PZ4 A;  4A1S A;  3TAX A;  1TNO A;  3TL5 A;  3UUX A;  2EIK E;  5AEN A;  1MHQ A;  4HFG A;  3UXG A;  4KZC A;  4KVO A;  3RO3 A;  3B95 A;  4WNG A;  3TWU A;  4C48 B;  4WWO A;  4JC8 A;  2PM6 A;  3G2W A;  4UWF A;  1JPL A;  1SVX A;  2EIN E;  3MGB A;  4F1S A;  2P9L G;  2VSX E;  1N4R A;  4A55 A;  3DSU A;  1G3N B;  4BFR A;  4O1O A;  4FU3 A;  3PRZ A;  4K5A B;  3TWS A;  3QNK A;  1MYO A;  4I9C A;  1H6K A;  2FI7 A;  3NF1 A;  4GYW A;  2ZGD A;  3EHM A;  1N94 A;  3DXK G;  2L6J A;  4YDW A;  2WXL A;  3CVU A;  2F0Y A;  4KZ0 A;  3D9P A;  2KZT B;  5ENN A;  3ZYK A;  2OCC E;  3L22 A;  4GA0 A;  2E2E A;  2ZGG A;  4HB5 A;  3UM2 A;  3CVY A;  4Z68 A;  2KCK A;  1N4S A;  3CR3 A;  2AW6 A;  1H19 A;  3KSQ A;  3VTX A;  4HOU A;  2YHE A;  3IKO B;  1EYH A;  1QQE A;  4EBA A;  2KXP C;  3HVE A;  1TN8 A;  3JCK C;  1MX2 A;  1TNY A;  1E7U A;  2I1J A;  4AM9 A;  2WXM A;  3SBT B;  3ZU7 B;  1YYH A;  4J6I A;  1LF8 A;  4GTQ A;  1D9S A;  5KBA A;  5G04 J;  4I1M A;  5KJN A;  4I2Z A;  2ETB A;  2HM8 A;  4RVB A;  2V4H C;  3T5V A;  4PS7 A;  3CSF A;  1BPO A;  2BF0 X;  3VLF A;  3ZXS A;  3ZYM A;  1OCR E;  3PNL B;  2WXO A;  1Z6T A;  3ZN3 A;  3BU8 A;  2XGS A;  1DNP A;  3LKU A;  3D9M A;  4DX2 A;  4N2Q A;  5E76 A;  2GGF A;  5JMN D;  4CDR A;  2C0M A;  1HS6 A;  4LRZ A;  4NAC A;  3SBS A;  1UW4 B;  4NRH B;  3L54 A;  3LVQ E;  2RKK A;  3MX3 A;  4B94 A;  3RRM B;  2KM4 A;  1MJ0 A;  4L9P A;  4L1B A;  2XGO A;  4NIK A;  3P1U A;  4GZ5 A;  3ZXP A;  2IOS A;  4UI9 C;  2UWJ G;  1N9A A;  2FUL A;  4E6H A;  3U3W A;  1N95 A;  1HG2 A;  3LYA A;  3TWT A;  4FA6 A;  4U7E B;  5BV1 A;  5BT1 A;  3L13 A;  3BUA A;  4J8S A;  1WM5 A;  2XPY A;  3JXI A;  4H7X A;  2A5E A;  3PUK A;  5ENO D;  5ITZ F;  3N71 A;  3S7B A;  3PZ2 A;  2DZO A;  3LDZ A;  3SFY A;  4CT4 A;  5CEC B;  2NXP A;  3VLD A;  2LAI A;  1SZA A;  2X3M A;  2XZD G;  5EDS A;  2VSN A;  3G2S A;  3Q73 A;  3PDN A;  1OWO A;  3B7T A;  3V2O A;  4URK A;  2WQ6 A;  2BKK B;  2VGY A;  2MRI A;  4AIF A;  1FVF A;  3HXE A;  3T8M A;  3QK0 A;  3G2U A;  4GZD A;  1O1R A;  1KZO A;  1LD7 A;  3IHV A;  4ACL A;  3UT4 A;  3HXD A;  3DEO A;  3L17 A;  2L0T B;  3HIZ A;  1H6P A;  5KJL A;  3RU0 A;  2CHW A;  3CVV A;  3FTY A;  3TXM A;  2AXU A;  1HH8 A;  3I5P A;  3LJN A;  4JB8 P;  2GRO B;  2AXZ A;  3Q49 B;  3S7J A;  2QC9 A;  1HE8 A;  4XX5 A;  3AG3 E;  3RKV A;  3ABM E;  1Y8M A;  2FF4 A;  3ESL A;  4UWL A;  2XEN A;  3TWW A;  2XRY A;  4F1P A;  1HZ4 A;  4F6R D;  4U07 A;  3FTX A;  1H0A A;  4A1G A;  2H6F A;  3UI2 A;  1JUQ A;  4APO A;  1BD8 A;  4BSX A;  1YA0 A;  3SFX A;  4TXR A;  2P9I G;  4WNF A;  3LS8 A;  3URZ A;  3APF A;  3E34 A;  1TN7 A;  4HLL A;  3FY4 A;  2XEH A;  1JCR A;  3HXB A;  2H6I A;  1ELW A;  3CK9 A;  3L08 A;  3MV2 B;  4HQD A;  1P5Q A;  3MA5 A;  3ISM C;  2XRZ A;  2CG2 A;  1ZB1 A;  4KBQ A;  3CGH A;  3GW4 A;  3WG7 E;  3FUJ A;  3E37 A;  1RW2 A;  2IFU A;  3GYZ A; 
#chains in the Genus database with same CATH homology
 2PM7 A;  4LER A;  4JA9 A;  4OVU A;  3EIJ A;  3Q5M A;  4FHK A;  1JWG A;  2ION A;  2WXH A;  1QZ2 A;  3OXG A;  4L7T A;  4AP2 A;  3D9I A;  3UQ3 A;  2WMO A;  2XPI A;  3PEV B;  3ZVV A;  2OVB A;  2XCB A;  3PEU B;  3IV0 A;  1OWP A;  4JXT A;  2ZU6 B;  3Q15 A;  5AIJ A;  4ANU A;  3GZS A;  5A23 A;  2J07 A;  3RO2 A;  3QWV A;  2Q7F A;  4RSY A;  4MLP A;  4KMO A;  3ZYL A;  2XEV A;  4KXK B;  3LPZ A;  3UT7 A;  4GA1 A;  5EKQ D;  5ARF A;  2R17 C;  2X38 A;  4XI9 A;  5LOZ A;  4DPR A;  3ZW3 A;  4JEU A;  2MOW A;  3FUI A;  5M72 A;  4HOS A;  5G2N A;  2Y3A A;  4I43 A;  3IHY A;  3EDT B;  2VSO E;  4I17 A;  1HO8 A;  4QFV A;  4RG6 A;  4UQZ A;  4JL0 A;  4GPK A;  3ASG A;  4CCA A;  1NZN A;  3PVL A;  4CDN A;  3MKQ A;  4F3V A;  1Z3Y A;  3CLJ A;  4BTA A;  4HOQ A;  4EQF A;  5FZQ A;  1W3B A;  1ZBP A;  3TJP A;  4E85 A;  2WXJ A;  5LFA A;  4WUY A;  2KAT A;  2AWI A;  1HX8 A;  3AS5 A;  5BUZ A;  4U04 A;  3ZPJ A;  2DIW A;  2NC9 A;  3JQ0 A;  3MZL B;  4I9E A;  2C0L A;  1EF1 C;  2I6H A;  3FTV A;  2PZI A;  3PZD A;  2UY1 A;  4UQX A;  2J08 A;  3ZHE A;  3U66 A;  3QJZ A;  5E75 A;  1NP7 A;  4IRU A;  4J8D A;  1IQR A;  3QAR A;  3FUK A;  3APD A;  5D0Q D;  5AJD A;  2HR2 A;  4AV7 A;  2ILR A;  2WXG A;  3B7U X;  5CCM A;  3MCX A;  2WXP A;  3UPV A;  1ZU2 A;  4JEH A;  4TUU A;  5LX8 A;  3RIB A;  1IQU A;  2X6J A;  3MKQ B;  5AJL A;  1TEZ A;  1H2T C;  3AU4 A;  4LCT A;  3PRE A;  4N2S A;  4PS3 A;  4AJW A;  1OWL A;  2WVI A;  4ABN A;  5JJ6 A;  4OVV A;  3TAX A;  4A1S A;  3TL5 A;  4GAA A;  4GYY A;  4LEU A;  3UUX A;  4CT0 A;  5AEN A;  1MHQ A;  1H2U A;  4HFG A;  4U0Z A;  5KCM A;  2XGM A;  4KZC A;  4KVO A;  4DK5 A;  5AYW D;  4EEC A;  3RO3 A;  2P58 C;  4WNG A;  3FUN A;  2J09 A;  3QDN A;  4UI9 K;  3ZHE B;  3NZU A;  1GW6 A;  4JC8 A;  2PM6 A;  3G2W A;  4UWF A;  4WWO A;  3U64 A;  5KJK A;  1JPL A;  2KCV A;  3GZ1 A;  4K03 A;  4JHR A;  2LAH A;  2LSV A;  4ME2 A;  2MHK A;  1JWF A;  3OXF A;  1IHG A;  3MGB A;  5ANL A;  2VSX E;  4F1S A;  4HOT A;  4AXH A;  4A55 A;  2KZT A;  2AXV A;  2E0I A;  3FP3 A;  3HHM A;  4HXI A;  4BFR A;  3D9K A;  4U0U A;  3FTZ A;  4FLH A;  4HLE A;  3K9I A;  4Q69 A;  1E7V A;  4GB9 A;  3QC1 A;  3MV3 B;  2KC7 A;  3MYV A;  2CHX A;  2VQ2 A;  4MS6 A;  4FU3 A;  3PRZ A;  2WXQ A;  4TRQ A;  4UWK A;  5FZR A;  3ZEF A;  5HI7 A;  4PDX A;  3CHO A;  3FU6 A;  3T5X A;  1TJF A;  3QNK A;  4GCN A;  3FEX A;  1QNF A;  4CGV A;  4I9C A;  3SI5 A;  4UWH A;  1H6K A;  2FI7 A;  3FWV A;  3NF1 A;  4GYW A;  4Q94 A;  4IYP A;  5C2Y A;  3EHM A;  3NQP A;  4ATG A;  3LY9 A;  4JVS A;  4F53 A;  3JUI A;  3MEK A;  2FBN A;  4TV3 A;  1NA3 A;  3LY8 A;  4HS2 A;  4YVO A;  1INZ A;  5EX0 A;  4BT8 A;  4GCO A;  2BTD A;  2L6J A;  2WXL A;  3CVU A;  3KS2 A;  2XCC A;  4KZ0 A;  3D9P A;  2VGX B;  3ZFW A;  4I1O B;  4I2W A;  4Y6C A;  2KZT B;  5ENN A;  3ZYK A;  4DLQ A;  4EZL A;  3L22 A;  4GA0 A;  2DCP A;  2E2E A;  2WMN A;  1A17 A;  3JQ1 A;  3LEW A;  5FQ4 A;  4C0E A;  3QWW A;  2OVF A;  4Y6W A;  3CVY A;  3GZ2 A;  3QB2 A;  4EZK A;  5D0O D;  3G2V A;  2KCK A;  1U3C A;  3BG0 B;  2JLB A;  3B7S A;  3CVQ A;  2X6H A;  4DI3 A;  3FUL A;  5G04 C;  4DJA A;  3CR3 A;  2AW6 A;  2FEZ A;  5LCW C;  2WXR A;  4P29 A;  2V4L A;  1B89 A;  1H19 A;  3JYS A;  4N3C A;  4HOU A;  5T8I A;  3EJN A;  2YHE A;  3R7Q A;  3VTX A;  1WY6 A;  4G11 A;  1UN8 A;  3ASH A;  2JEK A;  4R7L A;  3TXN A;  5CCL A;  3IKO B;  1EYH A;  2J4B A;  1QQE A;  3I4R B;  3D3M A;  4EBA A;  3TG5 A;  3HVE A;  5G05 C;  3HDX A;  2CFU A;  3AU5 A;  2J49 A;  3JCK C;  5BV0 A;  4HOR A;  4U8H A;  1E7U A;  1X5B A;  2VJ8 A;  3D9O A;  2I1J A;  4JA7 A;  3NZS A;  2RG8 A;  4GZC A;  3CQC B;  4AM9 A;  2WXM A;  3SBT B;  3FUE A;  3U4T A;  4J6I A;  4K0R A;  1LF8 A;  4L2L A;  4FHJ A;  3CKB A;  5FQ7 A;  5G04 J;  4I1M A;  3ML8 A;  2EQX A;  3OXL A;  5ANR A;  4B8A A;  5A6C A;  5KJN A;  4I2Z A;  5LCW J;  3C98 A;  4FJZ A;  2HM8 A;  4RVB A;  3T5V A;  1NA0 A;  2M63 A;  1E8X A;  2J9Q A;  2Y4U A;  3CKC A;  2VSY A;  3ONK A;  4L2Y A;  3FTW A;  4PS7 A;  1UN9 A;  2YHC A;  3ASF A;  4IN3 B;  1OWM A;  3CSF A;  1BPO A;  2BF0 X;  3TGO A;  3AS4 A;  3VLF A;  2WQH A;  3LY7 A;  4JZY A;  5T4Y A;  4MKT A;  3ZXS A;  3ZYM A;  3KD7 A;  3PNL B;  3CV0 A;  3ENE A;  4O6F A;  3CST A;  2R5S A;  3RJV A;  3FUH A;  4WWP A;  3HVE B;  4C0M A;  2AVP A;  2WXO A;  1Z6T A;  2WPV A;  2WXI A;  3CVN A;  3ZN3 A;  4AY6 A;  5HQ8 A;  1UG3 A;  2XGS A;  3S2A A;  1DNP A;  3LKU A;  3D9M A;  3OAW A;  2J4D A;  3SNX A;  4HVB A;  1HXI A;  4JPS A;  4N2Q A;  1N54 A;  4G2V A;  4XIF A;  3CVP A;  5E76 A;  2GGF A;  5BW8 C;  3S7D A;  4CDR A;  1E8W A;  2C0M A;  4FC8 A;  1HS6 A;  1EDU A;  3B13 A;  4LRZ A;  3FU3 A;  3MJW A;  5A7D B;  1SQM A;  2V8S E;  2RD0 A;  4NAC A;  4CEM A;  3SBS A;  4GZ3 A;  3FUD A;  4V3I A;  1UW4 B;  4NRH B;  3ASD A;  3FEY A;  5FZS A;  3E4B A;  2PQN A;  3ESK A;  4GZ6 A;  4MRU A;  3HYM B;  4ANW A;  2YQ8 A;  3L54 A;  3TG4 A;  4DI4 A;  3LVQ E;  4ANV A;  3PE3 A;  4XE0 A;  1IYG A;  3MX3 A;  4B94 A;  4BTB A;  3RRM B;  2KM4 A;  2VGX A;  2QFC A;  1OUV A;  3VTY A;  2A4Z A;  4L1B A;  1KLX A;  3CHS A;  4NQ0 A;  3L16 A;  3QOU A;  3FH7 A;  2XGO A;  3CQG B;  5FTP A;  1L5J A;  3P1U A;  1UJJ A;  4GZ5 A;  4PS8 A;  2FO7 A;  4ANX A;  4DLO A;  3R7R A;  4N3B A;  2IOS A;  3B7R L;  4B89 A;  2IJG X;  4UWG A;  4EZJ A;  4UI9 C;  4XI0 A;  4U63 A;  4XZ4 A;  3SHF A;  3CVX A;  2UWJ G;  4JW1 A;  4YVQ C;  2FUL A;  3FTS A;  4ILI A;  4AOF A;  4E6H A;  4ILG A;  5T3R A;  3FH5 A;  3U3W A;  2R59 A;  5CMY A;  5DBK A;  3CIA A;  3O48 A;  2KCL A;  4ACK A;  1HG2 A;  3DPD A;  3LYA A;  3OTN A;  4G1T A;  1Y6I A;  1HU3 A;  3FU0 A;  5ARG A;  1MQS A;  2CFZ A;  4FA6 A;  4BT9 A;  5CMW A;  4UQY A;  2LSU A;  4KYO B;  5BV1 A;  3D9J A;  3KEZ A;  4A3V A;  5BT1 A;  3ML9 A;  3L13 A;  2IF4 A;  2X6I A;  4J8S A;  1WM5 A;  4J0U A;  3LVR E;  2WXN A;  2XPY A;  5C1D A;  4G25 A;  4L23 A;  3ZIM A;  3QAQ A;  4BX9 A;  4H7X A;  3R9A B;  4UI9 J;  1PAQ A;  3PUK A;  4PUC A;  3FH8 A;  4FUL A;  3RRN B;  2NSZ A;  3N71 A;  4WAF A;  2DBA A;  4GA2 A;  3S7B A;  1XGW A;  3SFZ A;  1HG5 A;  4WND A;  2A5U A;  4H7Y A;  3UT8 A;  5JHB A;  2HO1 A;  3LDZ A;  4CT4 A;  2NXP A;  4RG9 A;  2V0P A;  5J08 A;  2WXK A;  3LJ3 A;  3VLD A;  2OV8 A;  2LAI A;  1SZA A;  2X3M A;  4I1A A;  3SF4 A;  5EDS A;  5LP0 A;  2VSN A;  1DVP A;  4YND A;  2XPZ A;  3G2S A;  3SZ7 A;  3AS8 A;  1Z3X A;  4AEZ C;  2L9B A;  2LO6 A;  3PDN A;  4I6G A;  1OWO A;  2YIN A;  3CHR A;  3I4G A;  4IUL A;  2LNI A;  4FP7 A;  3B7T A;  1HF8 A;  4AVX A;  4URK A;  2WQ6 A;  2VGY A;  3I3N A;  4GU5 A;  2MRI A;  3ULQ A;  4AIF A;  1TJC A;  3RRU A;  2GRL A;  5BNW A;  1FVF A;  4U0S A;  3P2B A;  2VTB A;  3FFL A;  3LXU X;  1FCH A;  4C9B B;  3FUM A;  3T8M A;  3QK0 A;  2V5F A;  3MKR A;  4G23 A;  4A3T A;  3G2U A;  3PE4 A;  4GZD A;  3UMV A;  2OND A;  5J90 A;  3CVL A;  2L0I A;  3IHV A;  4CDM A;  4ACL A;  3UT4 A;  2CHZ A;  2GRM A;  3ZYQ A;  3CHP A;  1XNF A;  1E8Y A;  3L17 A;  1EPU A;  2XHE A;  2L0T B;  3PUJ A;  3HIZ A;  4W9R A;  2YNQ A;  3RU0 A;  3IEG A;  5KJL A;  4EPZ A;  2CHW A;  5G05 J;  3CHM A;  4Q96 A;  3CVV A;  3FTY A;  3BEE A;  5JJ7 A;  1OWN A;  2WQ7 A;  1HFA A;  1H2V C;  3CHQ A;  3TXM A;  2AXU A;  1HH8 A;  1UJK A;  3I5P A;  3BG1 B;  4GMJ A;  2GW1 A;  4WNE A;  1VDY A;  4CRW A;  1E8Z A;  2AXZ A;  3Q49 B;  4XKB A;  4B8C B;  3S7J A;  5KJM A;  4KVM A;  4CGW A;  5FT9 A;  2I2O A;  1HE8 A;  5G55 A;  3ONL A;  3WXX A;  2X6F A;  4I6J A;  5JHA A;  2VTB B;  4WWN A;  4XX5 A;  5EX3 A;  3RKV A;  3CVW A;  1KT1 A;  4BX8 A;  3D9N A;  3S7F A;  1E96 B;  1Y8M A;  2IU1 A;  3DBS A;  4ILH B;  4N5C A;  2FF4 A;  3SD5 A;  4F7A A;  3O4Z A;  3ESL A;  1SZ9 A;  4UWL A;  2IQC A;  3CK7 A;  1KT0 A;  4N3A A;  1WAO 1;  4B0Z A;  3QWP A;  3D9L A;  2QY7 A;  2XRY A;  3Q47 B;  1HZ4 A;  1FVH A;  4U07 A;  3FTX A;  4N39 A;  5FQ6 A;  3ZRH A;  3QKY A;  4FAD A;  1H0A A;  4GYO A;  2PQR A;  3SGH A;  4A1G A;  4APF A;  5FWQ A;  2WB2 A;  4M3O A;  1JUQ A;  4APO A;  2Y4T A;  3FU5 A;  4BSX A;  1YA0 A;  4XKC A;  2WXF A;  3PNT B;  2WM9 A;  1ELR A;  3FDH A;  3FUF A;  3L6A A;  3IBE A;  4LUN U;  3UX4 A;  3EIQ C;  4JHJ A;  4NUR A;  2OOE A;  4WNF A;  5JJT A;  4J8E A;  1E90 A;  2UY1 B;  3LS8 A;  3URZ A;  4BWR A;  3APF A;  4J8F A;  2IOL A;  4I6E A;  3FY4 A;  2HYZ A;  2VYI A;  4EBA G;  4D10 C;  3G2T A;  2I1K A;  3LCA A;  3FHE A;  1ELW A;  3RK6 A;  2XQ0 A;  3CK8 A;  3FTU A;  3CK9 A;  3L08 A;  3MV2 B;  4AY5 A;  3EHN A;  5BPP A;  2CG3 A;  3Q4A B;  3VLE A;  4BY6 A;  1ELK A;  1P5Q A;  1PY1 A;  3ZGQ A;  2PL2 A;  3MA5 A;  3U9W A;  2I9C A;  4GML A;  4KT6 B;  2XRZ A;  2CG2 A;  3PS6 A;  5CHE E;  1S0P A;  4FLB A;  2BUG A;  3CEQ A;  4KBQ A;  3CGH A;  4OYS A;  3GW4 A;  1U3D A;  2X6K A;  3APC A;  3PH0 C;  3FUJ A;  4JHK A;  1N52 A;  4PH4 B;  5FJY A;  5DIZ A;  1PC2 A;  4FJY A;  2IFU A;  2C2L A;  4G24 A;  3KAE A;  4G26 A;  5FQ8 A;  3GYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...