3D9PA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
138
structure length
138
Chain Sequence
b'EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVTVLNLWQKNNVFKSEIIQPLLDMAAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 53
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9pA00
1HG5A 1JWGA 1VDYA 4FU3A 3G2VA 3ONLA 3D9JA 3G2UA 3CLJA 3D9IA 1EYHA 1SZAA 1INZA 4Q96A 3G2TA 4HFGA 1X5BA 1JUQA 4JXTA 3G2WA 1PY1A 1H0AA 2L0TB 2DIWA 4Q94A 3LDZA 2V8SE 1DVPA 5J08A 2KM4A 5CMWA 3D9OA 1HF8A 5LP0A 3G2SA 3RRUA 3D9KA 1JPLA 3D9MA 3ONKA 1HFAA 1EDUA 3ZYLA 1MHQA 3D9PA 2BF0X 3D9NA 3ZYKA 1ELKA 4FLBA 1SZ9A 1XGWA 4NACA 5CMYA 1LF8A 5LOZA 2QY7A 1JWFA 2LO6A 1HG2A 4GZCA 2MOWA 3ZYMA 4AVXA 1UJJA 4GZDA 3ZYQA 3D9LA 1UJKA 2DCPA 1HX8A 2L0IA
chains in the Genus database with same CATH superfamily
2XEEA 3PVLA 4EECA 2RG8A 4EZKA 2WXGA 3HVEB 5ARGA 2DVWA 4ZHBA 3TWRA 4ATGA 3TWQA 2Y3AA 3ABKE 3UIOC 3RRUA 1NL4A 3PZ2A 2OCCE 4J7WA 3AS5A 4I1AA 2PL2A 2J8SD 3EU5A 4L2LA 1VDYA 3S7DA 3NZSA 3SY2A 5LCWJ 4UI9J 2C2LA 4XX5A 5T3RA 4AOFA 2WXFA 3FUJA 3CKBA 2X6JA 2WXRA 4I1MA 4XI9A 4HOUA 4CDRA 2VGEA 3TL5A 4IULA 4ABNA 5CHEE 2ONDA 3D3MA 3PS6A 5BXOA 3L08A 4JVSA 2XS1A 2YINA 1N94A 1QYMA 2F37A 5G55A 3L9TA 4JHRA 2XRZA 4TUUA 5ARFA 5HKPA 1OWMA 2WXLA 5ANRA 2UY1B 5T8IA 4GTTA 4BFRA 3DSTA 4CT0A 3MCXA 4GTQA 2RFMA 3ENEA 1DVPA 1YMPA 2IEJA 4N3CA 5FT9A 1MHQA 2BF0X 2I1KA 2V0PA 4ATZD 3Q7FA 3AAAC 4GZCA 2PZIA 2XPIA 3EIQC 1N0QA 3CQGB 1TNBA 2FBNA 4CDNA 5CBNA 3E37A 1NZNA 4V3IA 3HXFA 4O1OA 5KJMA 1OT8A 3V30A 4HVBA 1FT1A 3L22A 4LSZE 2R02A 4M3OA 3NZUA 3SI5A 2X6FA 1V54E 3W9GA 4BERA 1BLXB 3U9WA 2HM8A 3LDZA 3L16A 4K03A 1FPPA 2KZTB 3VLDA 1N9AA 5KJKA 4ME2A 3B7TA 2VSOE 2VGXB 4IRUA 4RSYA 2P2CP 4K5AB 2V5QC 4FJYA 4HNAD 1N11A 3DXMG 3BU8A 1LD8A 4DX6D 2V5FA 1Y8MA 4K5CA 1LD7A 1KT0A 4DX5D 1FCHA 1D9SA 3NB2A 3UTMA 5FIOA 4JHKA 5CECB 3PZ3A 2CHZA 1OUVA 2ZIRA 4GZDA 1PAQA 1JCRA 3RU0A 3QWVA 4D10C 2WXQA 2LAHA 3FUNA 2RKKA 2NYJA 1BI8B 3ZVVA 3EU9A 1HF8A 2WXKA 1QNFA 4KVOA 1TN8A 5BPPA 1YA0A 2JABA 3TWTA 2YHEA 3ZYQA 4LNBA 3IBEA 3GZ1A 4JD2G 5LFAA 1TJFA 2IOSA 1WG0A 3IXEA 3FUHA 2L0TB 3FUKA 4RVBA 2R03A 3UM0A 4W9RA 4PUCA 2ETAA 5EYPF 1NI1A 2YHCA 4YDOA 3D9HA 3ML8A 2GW1A 4APFA 4EBAG 2P9IG 1UW4B 1ZBPA 5EN5D 5A6CA 1WAO1 3S7JA 4L9PA 1UN8A 3HXEA 3E33A 3BG1B 4KBQA 4DK5A 4C0EA 2KC7A 2OV8A 4BESA 4AY5A 3JXJA 2JEKA 2FI7A 1N4QA 2KCKA 1OWNA 2V4HC 4G1TA 3FUMA 4OYSA 4UQZA 3LVQE 5BUZA 1FT2A 3CHPA 1KPSB 4L23A 3ZN3A 1JWGA 1K1AA 3R7RA 3QKYA 2LAIA 3Q15A 5G05J 3CGHA 3V31A 2VYIA 5KWDA 4RQIA 4YDWA 3D9PA 5B1BE 4AP2A 4M7CA 3WG7E 2Y69E 5AENA 3U66A 3G2VA 4ANVA 2I1JA 1TNUA 1TR4A 3JQ0A 4Q96A 3ASHA 5HS0A 4X8QA 5B1AE 3B95A 4GA0A 2I2OA 4ILGA 2J07A 3DSXA 3FTYA 3CVQA 3S7BA 3G2TA 3QDNA 4APOA 4G24A 5CRUA 4UI9K 5KJLA 1YCSB 4I9EA 4EPZA 2EIKE 2M63A 3CHQA 3MJWA 4BT8A 3GW4A 2FO7A 4BX8A 2KATA 2WXJA 3IKOB 1BI7B 2XPZA 4FHJA 4GMJA 4MLPA 2P9SG 3BQOA 4PDXA 5EDSA 2DYRE 3L17A 3SFXA 3T9KA 3L6AA 3ZNGA 3GZ2A 2OVBA 3R9MA 5JHBA 2L9BA 3O48A 4N39A 2EIJE 3CK8A 4HLLA 4KXKB 3RJVA 1KZOA 4HRLA 4G25A 2R5SA 3FTWA 3MKQB 3ESKA 4CYMD 4HRNA 1QQEA 4YDYA 4HOTA 3CIAA 4CEMA 1S70B 2L0IA 3Q9UC 3S2AA 3PZDA 1IQUA 2AXUA 1AWCB 1U2VG 3PRZA 1N52A 4MBGA 5BV1A 1NA0A 2X3MA 4ILHB 3B7UX 1OXJA 4B8CB 3RAUA 4AXHA 2MOWA 5CCMA 4ZFHA 3Q9NC 4ANWA 4QFVA 3MV3B 4WUYA 2PM7A 4ANUA 5D0QD 3ULEG 4ILIA 5C2YA 1JCQA 4FA6A 3C3QA 2NSZA 5ENTD 1IHGA 3TWUA 4G8KA 2LUHA 2I6HA 1BU9A 4GYOA 5LP0A 1AP7A 3UM3A 4K0RA 1HH8A 5LOZA 1XGWA 3KSLA 4CT4A 3KS2A 3TXNA 2ZU6B 2GRMA 2XEHA 4I2WA 2XS8A 1HS6A 3I4GA 3ZPJA 3AJIA 2H6FA 1E96B 4N2SA 5AQBA 5G04J 2JLBA 2L6BA 3CEQA 3TWVA 4J8EA 4I6JA 5FZQA 2R17C 1IHBA 3JXIA 4A55A 3AU5A 3LY7A 1X5BA 2ETBA 4U04A 4E85A 3T5XA 3TAXA 5ENOD 3VTXA 5CEAA 2P9KG 2LXLA 1SVXA 3NOCD 3DSSA 1HG5A 4O60A 4KVMA 1KLXA 1UN9A 4HORA 4JXTA 3G2WA 4N5CA 2A5UA 2DZOA 5FJYA 4FULA 3V2OA 4GYWA 1B89A 1EPUA 3DSWA 2IFUA 1OWOA 3BG0B 1GW6A 3OAWA 2Y1LE 3MKRA 5KNGA 4Q69A 5KJNA 4HOSA 4JEHA 3K9IA 2QZAA 2XENA 4U63A 3CVVA 3QB2A 1E8YA 5AARA 2X6HA 3DPDA 4HI9A 2H6GA 1S0PA 3OTNA 4A3TA 3ZW3A 4GCNA 1E8WA 3CR3A 4OVUA 1UJJA 4FHKA 5FTPA 2GRRB 1W3BA 3BEEA 3FTUA 5BW8C 1H6KA 3DWLG 1KT1A 4GTVA 4UQXA 3ML9A 3URZA 3AU4A 1OWPA 1E7UA 2CHWA 3EHNA 2QYUA 1EDUA 1QBQA 1Z6TA 2EQXA 4CCAA 2XGSA 2ZISA 3DEOA 5JMND 3EJNA 1TJCA 4FC8A 2Y4UA 4JA9A 2V4LA 4OAVB 2EILE 4J6IA 4B93B 2KBXA 3B7RL 2RD0A 2IO2C 1MX6A 3P1UA 3TG4A 5CMWA 3FUIA 3G2SA 5ENNA 4HLEA 3R9AB 3APDA 4XZ4A 5ENPD 5LCWC 4UI9C 4UWLA 3ASNE 1IKND 2RFAA 2X6IA 3C3RA 4N5QA 3ZRHA 5J08A 2Y4TA 4KYOB 3ZHEB 3DRAA 4EZLA 4TXRA 2PQNA 5A7DB 3ASDA 3NAWA 3JUEA 3LPZA 2KCVA 4L1BA 4BEPA 5J90A 5CRVA 4I2ZA 1TEZA 4HFGA 4EZJA 4HXIA 2IO3C 3QAQA 5JJ7A 2FULA 3Q73A 3HXCA 3S7FA 1S63A 5DBKA 3UINC 2WXMA 3L13A 3L54A 4GCOA 4FP7A 3PUJA 4XKBA 3I4RB 3FFLA 2P58C 3FTZA 4DX7D 3HXDA 2J49A 3RK6A 4EQFA 2WXOA 4UUCA 3LY8A 4TRQA 1IYGA 4PH4B 4WNEA 3CK7A 4RG6A 3D9LA 2MRIA 3LVRE 3PZ4A 4J0UA 5JJTA 1A17A 3MYVA 3HG0D 3U4TA 3T8KA 5LX8A 2VSYA 3PE4A 1Q2ZA 1K8KG 3QOUA 3VLEA 4U96D 1U3DA 4O6FA 5ENRD 4YVOA 2E2EA 4GB9A 2XZDG 3CSFA 3TWWA 5CEDB 4B89A 5BV0A 4Q94A 1NFIE 4H7YA 2WMOA 3MX3A 1HFAA 3ZYKA 3SZ7A 2WVIA 1UOHA 4FU3A 2AJAA 3FP3A 4WWNA 3T5VA 1MZCA 3C3OA 2B0OE 1TNOA 4I1OB 2GROB 5ENSD 5EIDA 5EX3A 3DBSA 4U8VD 1TNZA 3ABLE 4A1GA 3ASFA 3EDTB 3Q47B 5AN8A 2IONA 3J5QB 2GRNB 2DBAA 3ASGA 1V55E 1N4PA 1EF1C 2BKGA 4RLYA 3W9FA 4BY6A 4KT6B 2J08A 4HI8A 3ULQA 2UY1A 3PZ1A 3ZYMA 3ZKJA 3U64A 3V79K 1OCCE 5KNHD 4DX1A 4R7LA 4JPSA 2DZNA 2LXMA 5B3SE 1MX4A 2QFCA 4G26A 2J4BA 1WM5A 2J9QA 1E8XA 3QC1A 3RSEG 2MYOA 3DSVA 4LERA 3SF4A 5CERB 3NBNB 1QZ2A 3CLJA 3KAEA 2BEDA 4CRWA 2AXZA 2CG2A 1RW2A 3LJNA 4BWRA 1D8DA 2ZXWE 3AS4A 2QYJA 4CGWA 4GTOA 4YNDA 3E32A 1N4SA 1MX2A 4BX9A 3Q4AB 1H2VC 3KSQA 4WWPA 3VTYA 2EIME 2R2LA 4N3BA 3LEWA 1MYOA 5CBOA 3FU3A 4J8DA 1K3ZD 5HI7A 4F53A 4LNUD 2VGXA 3TGOA 4TV3A 3FUDA 3QARA 3U3WA 5ANLA 4CGVA 2ILRA 1A5EA 1UG3A 2AVPA 1HO8A 2J09A 3JUIA 1SQMA 3QWPA 2XGMA 4U8YD 4DRXE 4G11A 5JA4D 2LNIA 4FJZA 3UT7A 4BT9A 4AEZC 1OCOE 2L6JA 1TN7A 2GRPB 3CHMA 5AQAA 4HQDA 3UUXA 4GTRA 3B7SA 3FHEA 4I43A 2BUGA 4ANXA 3ZYLA 1WY6A 5ENQD 4BTBA 3BUAA 3R7QA 4DLQA 5CCLA 2HO1A 4IN3B 3PEVB 2XRYA 5G05C 3AG4E 4JW1A 3ZU7B 4AV7A 4RG9A 3FH7A 1JUQA 1RZ4A 3ZXSA 3FU0A 3FTXA 4I6GA 3DXKG 4N2QA 3B7BA 5E75A 3UT8A 1DCEA 3Q5MA 5KCMA 2LO6A 3CSTA 4I6EA 3QJZA 4BSXA 3Q79A 4ACLA 3F6QA 2OEVA 2WXNA 1ZU2A 4G8LA 2E0IA 3AG1E 1ELWA 4JL0A 3UI2A 2AXVA 4DLOA 4PS3A 1TNYA 4FLBA 4AM9A 2ZGGA 1OCRE 3HIZA 3LYAA 4AVXA 3ZGQA 5EKQD 3N71A 3APCA 1X81A 5D66A 2VSXE 4BETA 1LTXA 5FZRA 3EHRA 5EILA 2BTDA 4XI0A 3CVWA 4C0MA 4F3VA 4GA1A 3D9OA 2IQCA 4MKTA 3E4BA 3Q78A 3EHMA 4UWKA 2XQ0A 3IV0A 4GU5A 1JWFA 4P29A 3C98A 3FU6A 3G2UA 2ZGDA 3UXGA 5FWQA 4OVVA 2X6KA 4B94A 1E90A 4OAUC 3AG2E 2GGFA 3ZFWA 3Q7AA 1NP7A 5EYLA 2WQ6A 3TWXA 4XIFA 2FF4A 5AJLA 4A3VA 4HOQA 3RRMB 4C48B 1DCQA 4NRHB 3PE3A 3QWWA 1E7VA 4AIFA 2GRLA 3MA5A 4TUMA 5FINA 1SW6A 1O1SA 1O5MA 2WPVA 1FVHA 2DYSE 3GZSA 3C5RA 3OXGA 3TWSA 1HX8A 1IXVA 2IF4A 4DI4A 3RO3A 4GTPA 1DNPA 5AQ7A 4F1PA 3EHQA 3OXLA 2KM4A 3DSUA 3D9KA 2B6CA 2YQ8A 2BKKB 3MGBA 3CVNA 4GYYA 3FDHA 1H6OA 1O1TA 3OXFA 4G2VA 4KZCA 4ACKA 4EHMA 4JA7A 2R59A 3LY9A 4HBDA 1HZ4A 3KEZA 5FQ4A 3SBTB 2OEWA 2A4ZA 4KZ0A 1JPLA 5G2NA 4F7AA 3PDNA 3TXMA 4U0ZA 4GMLA 1L5JA 4UWGA 2P9UG 4JC8A 2WQ7A 3SD5A 3D9IA 4J8FA 5HRYA 2MHKA 3ZIMA 2NXPA 3CK9A 3SGHA 3J5PA 4L7TA 3CKCA 1H2TC 2HYZA 3NQPA 3HHMA 3JQ1A 4UQYA 1HG2A 2CFUA 3FTSA 4BTAA 3NF1A 2F8YA 2VTBA 5G04C 2OVFA 3MKQA 2CHXA 4WNDA 1E8ZA 2XEVA 3FU5A 3SO8A 2WXPA 2QY7A 2Q7FA 2WXHA 4AY6A 1BPOA 3PUKA 2EINE 3PREA 3ESLA 2WM9A 2VQ2A 4H7XA 1N4RA 4JEUA 1SA4A 3CV0A 3KEAA 4F1SA 5AQ9A 1Z5SC 2A5EA 5CMYA 5A23A 1H2UA 1P5QA 1G3NB 2CFZA 2XCCA 4O1PA 1EYHA 3PNTB 1OCZE 4TXQA 2WMNA 1Z3XA 2V8SE 3DEPA 3CVLA 3IHVA 4NIKA 3EIJA 3HRAA 2F8XK 4PS7A 4NACA 1SZ9A 4GZ3A 4LEUA 4Y6WA 3FEXA 2CG3A 2F0YA 3E34A 1SA5A 1HE8A 2WXIA 3FUFA 4EBAA 4XKCA 3HDXA 5BXUA 2GRQB 1D8EA 1MQSA 5C1DA 2IU1A 2XZTG 4L2YA 3CQCB 4IYPA 3X2QE 4GTMA 3HVEA 2KCLA 4GA2A 4NURA 3UIPC 4LG6A 4JHJA 4LCTA 3ASOE 3RO2A 4TXPA 4GMRA 5FQ8A 3CVUA 4DPRA 5AYWD 3D9NA 2C0LA 3SFZA 3EUVA 1LF8A 1DC2A 4A1SA 4U07A 5EIBE 3CHOA 4LUNU 4UWHA 3SBSA 2QC9A 2UWJG 2KXPC 5E76A 4GPMA 5JHAA 3KD7A 1PC2A 4URKA 5M72A 3CVXA 3APFA 1K1BA 4JB8P 4U0UA 1SZAA 3UMVA 2HE0A 3UX4A 1PY1A 2AWIA 4A63B 5FQ6A 2PNNA 1FVFA 4B0ZA 1WDYA 5FZSA 4LRZA 1H19A 3ZXPA 1ELKA 2AW6A 1S64A 3FH5A 2IJGX 2PM6A 3FULA 3LCAA 1OWLA 3CHSA 2XHEA 3O4ZA 1INZA 4G23A 3CVPA 3ZEFA 1IQRA 2OOEA 3HXBA 3GYZA 3DPYA 4HB5A 2NC9A 1TYQG 3UT4A 5FQ7A 5BT1A 4NQ0A 4WAFA 1N95A 1ZB1A 3SFYA 5D0OD 2DIWA 3B13A 4U7EB 3L82A 4HRMB 3C72A 1BD8A 4FLHA 3SNXA 3TG5A 3LJ3A 3UKRG 4QQIA 3Q75A 3AG3E 5IY5E 2LSVA 4U95D 5H7PA 2IOLA 4N3AA 4I17A 4E6HA 3PEUB 3D9MA 3ISMC 3ONLA 4JZYA 1OY3D 3FTVA 3WXXA 2P9PG 1Y6IA 3LXUX 3RRNB 4CDMA 3UPVA 3CVYA 5EX0A 3MZLB 1N54A 3QK0A 4DUIA 2WB2A 5AAOA 4MS6A 3E30A 3MV2B 4LNGA 3FEYA 2C0MA 2H6IA 2HR2A 4I9CA 3Q49B 2KZTA 2XPYA 2J4DA 5KBAA 3PH0C 4GAAA 5ITZF 4KMOA 3UM1A 4Z68A 3JYSA 3LS8A 3T8MA 2Y0BG 4U8HA 4J8SA 4XE0A 5AJDA 3P2BA 2XCBA 2I9CA 1N0RA 3ZHEA 3JCKC 4WWOA 2LSUA 4WNFA 5DIZA 3ZUVB 4GZ6A 4AJWA 2H6HA 4DX2A 4UWFA 3ONKA 2DWZA 2VGYA 3NOGD 4GZ5A 2PQRA 4GPKA 4F6RD 3IEGA 3RKVA 3VLFA 4MRUA 3ULYA 5BNWA 3SQVA 2VTBB 1H6PA 1JCSA 3RIBA 3UQ3A 4BSZB 1MJ0A 3ABME 1NA3A 1TN6A 3FWVA 3CHRA 3I5PA 3MEKA 1YYHA 5D2MC 1U3CA 4FADA 3FY4A 1KZPA 4CZ2D 3FH8A 2ETCA 3PNLB 4WNGA 3IHYA 1XNFA 2XGOA 3FUEA 2IY0C 2P9LG 5AIJA 1ELRA 1UJKA 3D9JA 2FO1E 2VSNA 2FEZA 5JJ6A 3AS8A 4DI3A 2VJ8A 2R05A 4K5BA 4YVQC 3TJPA 4B8AA 3V2XA 2DCPA 2WQHA 1O1RA 4XEIG 4DJAA 1Z3YA 2YNQA 3QNKA 4PS8A 4Y6CA 2P9NG 1H0AA 4C9BB 5HQ8A 4J8YA 1HU3A 3UKUG 4HS2A 4U0SA 3UM2A 5T4YA 3LKUA 3HYMB 1HXIA 2X38A 3SHFA 4YDEA 4GTSA 3I3NA
chains in the Genus database with same CATH topology
2E2EA 2WXJA 5G04C 3PVLA 3IKOB 4GB9A 2VTBA 2OVFA 4EECA 2RG8A 4EZKA 3CSFA 2WXGA 3HVEB 3MKQA 2XPZA 5ARGA 4ATGA 2CHXA 4FHJA 4WNDA 4GMJA 4MLPA 4B89A 5BV0A 1E8ZA 4Q94A 2Y3AA 4H7YA 2XEVA 4PDXA 5EDSA 2WMOA 3RRUA 3MX3A 1HFAA 3FU5A 3L17A 3ZYKA 3L6AA 3SZ7A 2WVIA 2WXPA 3AS5A 2QY7A 3GZ2A 2OVBA 2Q7FA 4I1AA 5JHBA 2PL2A 2L9BA 4L2LA 2WXHA 3O48A 4N39A 4AY6A 1BPOA 3PUKA 1VDYA 4FU3A 3S7DA 3NZSA 3PREA 3CK8A 3FP3A 3ESLA 4WWNA 4KXKB 3RJVA 3T5VA 2WM9A 2VQ2A 4H7XA 5LCWJ 4UI9J 4JEUA 4G25A 2R5SA 3FTWA 4I1OB 3MKQB 2C2LA 3ESKA 3CV0A 4XX5A 5EX3A 4F1SA 3DBSA 5T3RA 4AOFA 1QQEA 4A1GA 5CMYA 2WXFA 3ASFA 3EDTB 5A23A 3CIAA 3Q47B 1H2UA 4CEMA 3FUJA 4HOTA 3CKBA 2X6JA 1P5QA 2L0IA 3S2AA 2CFZA 2XCCA 1EYHA 2IONA 3PNTB 3PZDA 1IQUA 2AXUA 2DBAA 2WMNA 3ASGA 1EF1C 2WXRA 4I1MA 4XI9A 1Z3XA 4HOUA 2V8SE 3PRZA 4CDRA 3TL5A 1N52A 3CVLA 5BV1A 4BY6A 3IHVA 3EIJA 1NA0A 4KT6B 2J08A 4IULA 2X3MA 4ABNA 4PS7A 4NACA 4ILHB 1SZ9A 5CHEE 3B7UX 3ULQA 2ONDA 4B8CB 3D3MA 4AXHA 3PS6A 2UY1A 2MOWA 4GZ3A 4LEUA 4Y6WA 3ZYMA 3U64A 3FEXA 2CG3A 4R7LA 4JPSA 3L08A 5CCMA 1HE8A 4ANWA 4JVSA 2WXIA 3FUFA 4EBAA 2YINA 4QFVA 4XKCA 3HDXA 2QFCA 4G26A 3MV3B 5G55A 5C1DA 1MQSA 2J4BA 1WM5A 4WUYA 2PM7A 4ANUA 2IU1A 4JHRA 2J9QA 5D0QD 1E8XA 2XRZA 4TUUA 3QC1A 4L2YA 5ARFA 3CQCB 4IYPA 4ILIA 1OWMA 2WXLA 5C2YA 4LERA 4FA6A 3HVEA 2KCLA 4GA2A 4NURA 5ANRA 3SF4A 1QZ2A 3CLJA 2UY1B 2NSZA 3KAEA 5T8IA 4JHJA 4LCTA 4CRWA 2AXZA 1IHGA 2CG2A 3RO2A 4BFRA 5FQ8A 2I6HA 4CT0A 3MCXA 3ENEA 4GYOA 1DVPA 5LP0A 3CVUA 4BWRA 4DPRA 5AYWD 4K0RA 4N3CA 5FT9A 1HH8A 1MHQA 2BF0X 2I1KA 3D9NA 2C0LA 2V0PA 3AS4A 1XGWA 5LOZA 3SFZA 4CGWA 1LF8A 4A1SA 4CT4A 4GZCA 3KS2A 3TXNA 4YNDA 2PZIA 2ZU6B 4BX9A 2XPIA 3EIQC 4U07A 3Q4AB 1H2VC 3CQGB 4WWPA 2GRMA 3CHOA 2FBNA 4I2WA 3VTYA 4LUNU 4CDNA 4UWHA 1NZNA 1HS6A 3I4GA 3LEWA 4N3BA 4V3IA 3SBSA 3ZPJA 2UWJG 1E96B 3FU3A 5E76A 4N2SA 4J8DA 5G04J 5HI7A 5KJMA 2JLBA 3CEQA 5JHAA 3KD7A 4F53A 1PC2A 4J8EA 2VGXA 4I6JA 5FZQA 4HVBA 4URKA 5M72A 4TV3A 2R17C 3L22A 3TGOA 3APFA 3CVXA 3FUDA 3QARA 3U3WA 5ANLA 4M3OA 3NZUA 4U0UA 3SI5A 4A55A 4CGVA 2X6FA 2ILRA 3AU5A 3LY7A 1SZAA 1UG3A 3UMVA 1X5BA 4U04A 4E85A 3U9WA 3T5XA 3UX4A 1PY1A 2AWIA 3TAXA 5FQ6A 2AVPA 1HO8A 2J09A 3JUIA 1FVFA 2HM8A 3LDZA 4B0ZA 3VTXA 3L16A 4K03A 1SQMA 2KZTB 3QWPA 3VLDA 5FZSA 4LRZA 2XGMA 1H19A 4AVXA 5KJKA 4ME2A 1ELKA 3B7TA 2VSOE 4G11A 2AW6A 3FH5A 2IJGX 3CVYA 2PM6A 3FULA 3LCAA 1OWLA 1HG5A 2VGXB 3CHSA 2LNIA 4FJZA 4IRUA 4KVMA 2XHEA 3O4ZA 4RSYA 3UT7A 1INZA 4G23A 3CVPA 3ZEFA 1KLXA 1IQRA 1UN9A 2OOEA 4BT9A 4HORA 4JXTA 4AEZC 3G2WA 2L6JA 3GYZA 3CHMA 4N5CA 2A5UA 3UUXA 2NC9A 3B7SA 4FJYA 3FHEA 4I43A 2BUGA 5FJYA 4ANXA 3UT4A 4FULA 5FQ7A 4GYWA 3ZYLA 5BT1A 1WY6A 4NQ0A 4WAFA 1B89A 1EPUA 3R7QA 4BTBA 4DLQA 2IFUA 5CCLA 1OWOA 2HO1A 1GW6A 3BG0B 2V5FA 3OAWA 4IN3B 3PEVB 5D0OD 1Y8MA 2DIWA 2XRYA 3MKRA 3B13A 4Q69A 5G05C 5KJNA 4JW1A 4HOSA 4JEHA 3K9IA 1KT0A 4AV7A 4RG9A 3FH7A 1FCHA 4FLHA 1JUQA 4U63A 3SNXA 3ZXSA 3CVVA 3QB2A 1E8YA 3FU0A 3TG5A 2X6HA 3DPDA 3LJ3A 3FTXA 4JHKA 1S0PA 4I6GA 2CHZA 4N2QA 2LSVA 3OTNA 4A3TA 3ZW3A 4GCNA 5E75A 3UT8A 2IOLA 4N3AA 1OUVA 1E8WA 4I17A 3Q5MA 5KCMA 2LO6A 3CR3A 4OVUA 1UJJA 3CSTA 4GZDA 1PAQA 4FHKA 5FTPA 3PEUB 4I6EA 4E6HA 3D9MA 3QJZA 4BSXA 1W3BA 4ACLA 3ONLA 3BEEA 3FTUA 4JZYA 5BW8C 2WXNA 3RU0A 1ZU2A 3FTVA 3QWVA 1H6KA 2E0IA 3WXXA 1KT1A 4D10C 1ELWA 2WXQA 4UQXA 2LAHA 3FUNA 1Y6IA 3ML9A 3ZVVA 3LXUX 3RRNB 3URZA 4JL0A 3AU4A 1OWPA 2AXVA 1E7UA 1HF8A 2WXKA 2CHWA 3EHNA 4CDMA 4DLOA 1QNFA 4KVOA 1EDUA 4PS3A 1Z6TA 2EQXA 4AM9A 4FLBA 3UPVA 5BPPA 1YA0A 3HIZA 3LYAA 4CCAA 5EX0A 2XGSA 3MZLB 3ZGQA 1N54A 2YHEA 3QK0A 3N71A 5EKQD 3ZYQA 3APCA 4MS6A 2WB2A 3MV2B 2VSXE 3IBEA 3GZ1A 3FEYA 2C0MA 3EJNA 5LFAA 1TJCA 4FC8A 2HR2A 1TJFA 4I9CA 5FZRA 2Y4UA 3Q49B 2IOSA 2KZTA 3FUHA 2L0TB 2BTDA 2XPYA 2J4DA 3FUKA 4JA9A 4RVBA 4XI0A 4C0MA 3PH0C 4F3VA 4GAAA 4GA1A 3D9OA 4KMOA 2V4LA 2IQCA 4MKTA 3E4BA 3EHMA 4W9RA 3JYSA 4PUCA 2XQ0A 3IV0A 3LS8A 4UWKA 4GU5A 3T8MA 1JWFA 4P29A 2YHCA 4U8HA 3C98A 4J8SA 4XE0A 3FU6A 4YVOA 5AJDA 3ML8A 3P2BA 4J6IA 3G2UA 2GW1A 2XCBA 4APFA 4EBAG 5FWQA 3CVWA 1UW4B 1ZBPA 4OVVA 2I9CA 3B7RL 2RD0A 3ZHEA 3JCKC 4WWOA 5A6CA 2LSUA 3P1UA 1WAO1 4WNFA 5DIZA 3TG4A 3S7JA 2X6KA 4GZ6A 4AJWA 3FUIA 4B94A 5CMWA 3G2SA 1E90A 1UN8A 4UWFA 5ENNA 3ONKA 2VGYA 2GGFA 4HLEA 3ZFWA 3R9AB 4GZ5A 3APDA 1NP7A 2PQRA 2WQ6A 4XZ4A 3BG1B 4XIFA 2FF4A 4GPKA 5LCWC 4UI9C 5AJLA 3IEGA 4KBQA 3RKVA 4UWLA 4DK5A 3VLFA 4A3VA 4HOQA 4C0EA 4MRUA 2KC7A 3RRMB 2X6IA 2OV8A 4NRHB 5BNWA 3PE3A 3QWWA 2VTBB 1E7VA 4AY5A 4AIFA 2GRLA 3MA5A 2JEKA 2FI7A 3ZRHA 5J08A 3RIBA 3UQ3A 2Y4TA 2KCKA 1OWNA 4G1TA 4KYOB 3FUMA 3ZHEB 4OYSA 4UQZA 1NA3A 3LVQE 4EZLA 2WPVA 1FVHA 2PQNA 3FWVA 3GZSA 3ASDA 5A7DB 5BUZA 3OXGA 3CHPA 4L23A 3CHRA 3I5PA 3LPZA 2KCVA 3MEKA 4L1BA 5J90A 3ZN3A 1HX8A 2IF4A 4DI4A 1JWGA 1U3CA 3RO3A 1DNPA 4FADA 4I2ZA 3R7RA 1TEZA 3QKYA 4HFGA 4EZJA 3FY4A 4HXIA 2LAIA 3FH8A 3Q15A 3QAQA 5JJ7A 2FULA 5G05J 3OXLA 3CGHA 2KM4A 3PNLB 4WNGA 2VYIA 3D9KA 2YQ8A 3IHYA 3D9PA 1XNFA 2XGOA 3S7FA 4AP2A 3FUEA 3MGBA 5DBKA 2WXMA 3L13A 3L54A 3CVNA 5AENA 4GCOA 3FDHA 4FP7A 4GYYA 5AIJA 3PUJA 1ELRA 1UJKA 4XKBA 3U66A 3OXFA 4G2VA 4KZCA 3I4RB 4ACKA 3G2VA 4ANVA 3D9JA 2I1JA 4JA7A 2R59A 3JQ0A 3FFLA 2VSNA 4Q96A 3LY9A 2P58C 1HZ4A 3FTZA 3ASHA 2FEZA 5JJ6A 3KEZA 5FQ4A 3SBTB 3AS8A 2A4ZA 4DI3A 2J49A 4KZ0A 2VJ8A 1JPLA 4GA0A 3RK6A 5G2NA 4EQFA 4F7AA 2WXOA 3LY8A 3PDNA 4TRQA 3TXMA 4YVQC 4U0ZA 1IYGA 3TJPA 4GMLA 1L5JA 4PH4B 4WNEA 3CK7A 4RG6A 4UWGA 4JC8A 3D9LA 2I2OA 2MRIA 4B8AA 4ILGA 2WQ7A 2DCPA 2WQHA 2J07A 3SD5A 4DJAA 1Z3YA 3LVRE 4J0UA 3FTYA 3CVQA 3S7BA 2YNQA 5JJTA 1A17A 3D9IA 4J8FA 3QNKA 4PS8A 3MYVA 3G2TA 2MHKA 3ZIMA 4Y6CA 2NXPA 3QDNA 4APOA 4G24A 3U4TA 1H0AA 3CK9A 4C9BB 5LX8A 4UI9K 2VSYA 3PE4A 3SGHA 4L7TA 5HQ8A 5KJLA 4I9EA 4EPZA 3CKCA 1H2TC 2HYZA 3QOUA 1HU3A 4HS2A 3NQPA 4U0SA 3HHMA 3JQ1A 4UQYA 2M63A 3CHQA 3MJWA 5T4YA 3LKUA 3HYMB 1HXIA 3GW4A 3VLEA 1HG2A 2FO7A 4BT8A 4BX8A 2CFUA 2X38A 2KATA 1U3DA 3SHFA 3FTSA 4BTAA 4O6FA 3I3NA 3NF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HG5 A;  1JWG A;  1VDY A;  4FU3 A;  3G2V A;  3ONL A;  3D9J A;  3G2U A;  3CLJ A;  3D9I A;  1EYH A;  1SZA A;  1INZ A;  4Q96 A;  3G2T A;  4HFG A;  1X5B A;  1JUQ A;  4JXT A;  3G2W A;  1PY1 A;  1H0A A;  2L0T B;  2DIW A;  4Q94 A;  3LDZ A;  2V8S E;  1DVP A;  5J08 A;  2KM4 A;  5CMW A;  3D9O A;  1HF8 A;  5LP0 A;  3G2S A;  3RRU A;  3D9K A;  1JPL A;  3D9M A;  3ONK A;  1HFA A;  1EDU A;  3ZYL A;  1MHQ A;  3D9P A;  2BF0 X;  3D9N A;  3ZYK A;  1ELK A;  4FLB A;  1SZ9 A;  1XGW A;  4NAC A;  5CMY A;  1LF8 A;  5LOZ A;  2QY7 A;  1JWF A;  2LO6 A;  1HG2 A;  4GZC A;  2MOW A;  3ZYM A;  4AVX A;  1UJJ A;  4GZD A;  3ZYQ A;  3D9L A;  1UJK A;  2DCP A;  1HX8 A;  2L0I A; 
#chains in the Genus database with same CATH topology
 2XEE A;  3PVL A;  4EEC A;  2RG8 A;  4EZK A;  2WXG A;  3HVE B;  5ARG A;  2DVW A;  4ZHB A;  3TWR A;  4ATG A;  3TWQ A;  2Y3A A;  3ABK E;  3UIO C;  3RRU A;  1NL4 A;  3PZ2 A;  2OCC E;  4J7W A;  3AS5 A;  4I1A A;  2PL2 A;  2J8S D;  3EU5 A;  4L2L A;  1VDY A;  3S7D A;  3NZS A;  3SY2 A;  5LCW J;  4UI9 J;  2C2L A;  4XX5 A;  5T3R A;  4AOF A;  2WXF A;  3FUJ A;  3CKB A;  2X6J A;  2WXR A;  4I1M A;  4XI9 A;  4HOU A;  4CDR A;  2VGE A;  3TL5 A;  4IUL A;  4ABN A;  5CHE E;  2OND A;  3D3M A;  3PS6 A;  5BXO A;  3L08 A;  4JVS A;  2XS1 A;  2YIN A;  1N94 A;  1QYM A;  2F37 A;  5G55 A;  3L9T A;  4JHR A;  2XRZ A;  4TUU A;  5ARF A;  5HKP A;  1OWM A;  2WXL A;  5ANR A;  2UY1 B;  5T8I A;  4GTT A;  4BFR A;  3DST A;  4CT0 A;  3MCX A;  4GTQ A;  2RFM A;  3ENE A;  1DVP A;  1YMP A;  2IEJ A;  4N3C A;  5FT9 A;  1MHQ A;  2BF0 X;  2I1K A;  2V0P A;  4ATZ D;  3Q7F A;  3AAA C;  4GZC A;  2PZI A;  2XPI A;  3EIQ C;  1N0Q A;  3CQG B;  1TNB A;  2FBN A;  4CDN A;  5CBN A;  3E37 A;  1NZN A;  4V3I A;  3HXF A;  4O1O A;  5KJM A;  1OT8 A;  3V30 A;  4HVB A;  1FT1 A;  3L22 A;  4LSZ E;  2R02 A;  4M3O A;  3NZU A;  3SI5 A;  2X6F A;  1V54 E;  3W9G A;  4BER A;  1BLX B;  3U9W A;  2HM8 A;  3LDZ A;  3L16 A;  4K03 A;  1FPP A;  2KZT B;  3VLD A;  1N9A A;  5KJK A;  4ME2 A;  3B7T A;  2VSO E;  2VGX B;  4IRU A;  4RSY A;  2P2C P;  4K5A B;  2V5Q C;  4FJY A;  4HNA D;  1N11 A;  3DXM G;  3BU8 A;  1LD8 A;  4DX6 D;  2V5F A;  1Y8M A;  4K5C A;  1LD7 A;  1KT0 A;  4DX5 D;  1FCH A;  1D9S A;  3NB2 A;  3UTM A;  5FIO A;  4JHK A;  5CEC B;  3PZ3 A;  2CHZ A;  1OUV A;  2ZIR A;  4GZD A;  1PAQ A;  1JCR A;  3RU0 A;  3QWV A;  4D10 C;  2WXQ A;  2LAH A;  3FUN A;  2RKK A;  2NYJ A;  1BI8 B;  3ZVV A;  3EU9 A;  1HF8 A;  2WXK A;  1QNF A;  4KVO A;  1TN8 A;  5BPP A;  1YA0 A;  2JAB A;  3TWT A;  2YHE A;  3ZYQ A;  4LNB A;  3IBE A;  3GZ1 A;  4JD2 G;  5LFA A;  1TJF A;  2IOS A;  1WG0 A;  3IXE A;  3FUH A;  2L0T B;  3FUK A;  4RVB A;  2R03 A;  3UM0 A;  4W9R A;  4PUC A;  2ETA A;  5EYP F;  1NI1 A;  2YHC A;  4YDO A;  3D9H A;  3ML8 A;  2GW1 A;  4APF A;  4EBA G;  2P9I G;  1UW4 B;  1ZBP A;  5EN5 D;  5A6C A;  1WAO 1;  3S7J A;  4L9P A;  1UN8 A;  3HXE A;  3E33 A;  3BG1 B;  4KBQ A;  4DK5 A;  4C0E A;  2KC7 A;  2OV8 A;  4BES A;  4AY5 A;  3JXJ A;  2JEK A;  2FI7 A;  1N4Q A;  2KCK A;  1OWN A;  2V4H C;  4G1T A;  3FUM A;  4OYS A;  4UQZ A;  3LVQ E;  5BUZ A;  1FT2 A;  3CHP A;  1KPS B;  4L23 A;  3ZN3 A;  1JWG A;  1K1A A;  3R7R A;  3QKY A;  2LAI A;  3Q15 A;  5G05 J;  3CGH A;  3V31 A;  2VYI A;  5KWD A;  4RQI A;  4YDW A;  3D9P A;  5B1B E;  4AP2 A;  4M7C A;  3WG7 E;  2Y69 E;  5AEN A;  3U66 A;  3G2V A;  4ANV A;  2I1J A;  1TNU A;  1TR4 A;  3JQ0 A;  4Q96 A;  3ASH A;  5HS0 A;  4X8Q A;  5B1A E;  3B95 A;  4GA0 A;  2I2O A;  4ILG A;  2J07 A;  3DSX A;  3FTY A;  3CVQ A;  3S7B A;  3G2T A;  3QDN A;  4APO A;  4G24 A;  5CRU A;  4UI9 K;  5KJL A;  1YCS B;  4I9E A;  4EPZ A;  2EIK E;  2M63 A;  3CHQ A;  3MJW A;  4BT8 A;  3GW4 A;  2FO7 A;  4BX8 A;  2KAT A;  2WXJ A;  3IKO B;  1BI7 B;  2XPZ A;  4FHJ A;  4GMJ A;  4MLP A;  2P9S G;  3BQO A;  4PDX A;  5EDS A;  2DYR E;  3L17 A;  3SFX A;  3T9K A;  3L6A A;  3ZNG A;  3GZ2 A;  2OVB A;  3R9M A;  5JHB A;  2L9B A;  3O48 A;  4N39 A;  2EIJ E;  3CK8 A;  4HLL A;  4KXK B;  3RJV A;  1KZO A;  4HRL A;  4G25 A;  2R5S A;  3FTW A;  3MKQ B;  3ESK A;  4CYM D;  4HRN A;  1QQE A;  4YDY A;  4HOT A;  3CIA A;  4CEM A;  1S70 B;  2L0I A;  3Q9U C;  3S2A A;  3PZD A;  1IQU A;  2AXU A;  1AWC B;  1U2V G;  3PRZ A;  1N52 A;  4MBG A;  5BV1 A;  1NA0 A;  2X3M A;  4ILH B;  3B7U X;  1OXJ A;  4B8C B;  3RAU A;  4AXH A;  2MOW A;  5CCM A;  4ZFH A;  3Q9N C;  4ANW A;  4QFV A;  3MV3 B;  4WUY A;  2PM7 A;  4ANU A;  5D0Q D;  3ULE G;  4ILI A;  5C2Y A;  1JCQ A;  4FA6 A;  3C3Q A;  2NSZ A;  5ENT D;  1IHG A;  3TWU A;  4G8K A;  2LUH A;  2I6H A;  1BU9 A;  4GYO A;  5LP0 A;  1AP7 A;  3UM3 A;  4K0R A;  1HH8 A;  5LOZ A;  1XGW A;  3KSL A;  4CT4 A;  3KS2 A;  3TXN A;  2ZU6 B;  2GRM A;  2XEH A;  4I2W A;  2XS8 A;  1HS6 A;  3I4G A;  3ZPJ A;  3AJI A;  2H6F A;  1E96 B;  4N2S A;  5AQB A;  5G04 J;  2JLB A;  2L6B A;  3CEQ A;  3TWV A;  4J8E A;  4I6J A;  5FZQ A;  2R17 C;  1IHB A;  3JXI A;  4A55 A;  3AU5 A;  3LY7 A;  1X5B A;  2ETB A;  4U04 A;  4E85 A;  3T5X A;  3TAX A;  5ENO D;  3VTX A;  5CEA A;  2P9K G;  2LXL A;  1SVX A;  3NOC D;  3DSS A;  1HG5 A;  4O60 A;  4KVM A;  1KLX A;  1UN9 A;  4HOR A;  4JXT A;  3G2W A;  4N5C A;  2A5U A;  2DZO A;  5FJY A;  4FUL A;  3V2O A;  4GYW A;  1B89 A;  1EPU A;  3DSW A;  2IFU A;  1OWO A;  3BG0 B;  1GW6 A;  3OAW A;  2Y1L E;  3MKR A;  5KNG A;  4Q69 A;  5KJN A;  4HOS A;  4JEH A;  3K9I A;  2QZA A;  2XEN A;  4U63 A;  3CVV A;  3QB2 A;  1E8Y A;  5AAR A;  2X6H A;  3DPD A;  4HI9 A;  2H6G A;  1S0P A;  3OTN A;  4A3T A;  3ZW3 A;  4GCN A;  1E8W A;  3CR3 A;  4OVU A;  1UJJ A;  4FHK A;  5FTP A;  2GRR B;  1W3B A;  3BEE A;  3FTU A;  5BW8 C;  1H6K A;  3DWL G;  1KT1 A;  4GTV A;  4UQX A;  3ML9 A;  3URZ A;  3AU4 A;  1OWP A;  1E7U A;  2CHW A;  3EHN A;  2QYU A;  1EDU A;  1QBQ A;  1Z6T A;  2EQX A;  4CCA A;  2XGS A;  2ZIS A;  3DEO A;  5JMN D;  3EJN A;  1TJC A;  4FC8 A;  2Y4U A;  4JA9 A;  2V4L A;  4OAV B;  2EIL E;  4J6I A;  4B93 B;  2KBX A;  3B7R L;  2RD0 A;  2IO2 C;  1MX6 A;  3P1U A;  3TG4 A;  5CMW A;  3FUI A;  3G2S A;  5ENN A;  4HLE A;  3R9A B;  3APD A;  4XZ4 A;  5ENP D;  5LCW C;  4UI9 C;  4UWL A;  3ASN E;  1IKN D;  2RFA A;  2X6I A;  3C3R A;  4N5Q A;  3ZRH A;  5J08 A;  2Y4T A;  4KYO B;  3ZHE B;  3DRA A;  4EZL A;  4TXR A;  2PQN A;  5A7D B;  3ASD A;  3NAW A;  3JUE A;  3LPZ A;  2KCV A;  4L1B A;  4BEP A;  5J90 A;  5CRV A;  4I2Z A;  1TEZ A;  4HFG A;  4EZJ A;  4HXI A;  2IO3 C;  3QAQ A;  5JJ7 A;  2FUL A;  3Q73 A;  3HXC A;  3S7F A;  1S63 A;  5DBK A;  3UIN C;  2WXM A;  3L13 A;  3L54 A;  4GCO A;  4FP7 A;  3PUJ A;  4XKB A;  3I4R B;  3FFL A;  2P58 C;  3FTZ A;  4DX7 D;  3HXD A;  2J49 A;  3RK6 A;  4EQF A;  2WXO A;  4UUC A;  3LY8 A;  4TRQ A;  1IYG A;  4PH4 B;  4WNE A;  3CK7 A;  4RG6 A;  3D9L A;  2MRI A;  3LVR E;  3PZ4 A;  4J0U A;  5JJT A;  1A17 A;  3MYV A;  3HG0 D;  3U4T A;  3T8K A;  5LX8 A;  2VSY A;  3PE4 A;  1Q2Z A;  1K8K G;  3QOU A;  3VLE A;  4U96 D;  1U3D A;  4O6F A;  5ENR D;  4YVO A;  2E2E A;  4GB9 A;  2XZD G;  3CSF A;  3TWW A;  5CED B;  4B89 A;  5BV0 A;  4Q94 A;  1NFI E;  4H7Y A;  2WMO A;  3MX3 A;  1HFA A;  3ZYK A;  3SZ7 A;  2WVI A;  1UOH A;  4FU3 A;  2AJA A;  3FP3 A;  4WWN A;  3T5V A;  1MZC A;  3C3O A;  2B0O E;  1TNO A;  4I1O B;  2GRO B;  5ENS D;  5EID A;  5EX3 A;  3DBS A;  4U8V D;  1TNZ A;  3ABL E;  4A1G A;  3ASF A;  3EDT B;  3Q47 B;  5AN8 A;  2ION A;  3J5Q B;  2GRN B;  2DBA A;  3ASG A;  1V55 E;  1N4P A;  1EF1 C;  2BKG A;  4RLY A;  3W9F A;  4BY6 A;  4KT6 B;  2J08 A;  4HI8 A;  3ULQ A;  2UY1 A;  3PZ1 A;  3ZYM A;  3ZKJ A;  3U64 A;  3V79 K;  1OCC E;  5KNH D;  4DX1 A;  4R7L A;  4JPS A;  2DZN A;  2LXM A;  5B3S E;  1MX4 A;  2QFC A;  4G26 A;  2J4B A;  1WM5 A;  2J9Q A;  1E8X A;  3QC1 A;  3RSE G;  2MYO A;  3DSV A;  4LER A;  3SF4 A;  5CER B;  3NBN B;  1QZ2 A;  3CLJ A;  3KAE A;  2BED A;  4CRW A;  2AXZ A;  2CG2 A;  1RW2 A;  3LJN A;  4BWR A;  1D8D A;  2ZXW E;  3AS4 A;  2QYJ A;  4CGW A;  4GTO A;  4YND A;  3E32 A;  1N4S A;  1MX2 A;  4BX9 A;  3Q4A B;  1H2V C;  3KSQ A;  4WWP A;  3VTY A;  2EIM E;  2R2L A;  4N3B A;  3LEW A;  1MYO A;  5CBO A;  3FU3 A;  4J8D A;  1K3Z D;  5HI7 A;  4F53 A;  4LNU D;  2VGX A;  3TGO A;  4TV3 A;  3FUD A;  3QAR A;  3U3W A;  5ANL A;  4CGV A;  2ILR A;  1A5E A;  1UG3 A;  2AVP A;  1HO8 A;  2J09 A;  3JUI A;  1SQM A;  3QWP A;  2XGM A;  4U8Y D;  4DRX E;  4G11 A;  5JA4 D;  2LNI A;  4FJZ A;  3UT7 A;  4BT9 A;  4AEZ C;  1OCO E;  2L6J A;  1TN7 A;  2GRP B;  3CHM A;  5AQA A;  4HQD A;  3UUX A;  4GTR A;  3B7S A;  3FHE A;  4I43 A;  2BUG A;  4ANX A;  3ZYL A;  1WY6 A;  5ENQ D;  4BTB A;  3BUA A;  3R7Q A;  4DLQ A;  5CCL A;  2HO1 A;  4IN3 B;  3PEV B;  2XRY A;  5G05 C;  3AG4 E;  4JW1 A;  3ZU7 B;  4AV7 A;  4RG9 A;  3FH7 A;  1JUQ A;  1RZ4 A;  3ZXS A;  3FU0 A;  3FTX A;  4I6G A;  3DXK G;  4N2Q A;  3B7B A;  5E75 A;  3UT8 A;  1DCE A;  3Q5M A;  5KCM A;  2LO6 A;  3CST A;  4I6E A;  3QJZ A;  4BSX A;  3Q79 A;  4ACL A;  3F6Q A;  2OEV A;  2WXN A;  1ZU2 A;  4G8L A;  2E0I A;  3AG1 E;  1ELW A;  4JL0 A;  3UI2 A;  2AXV A;  4DLO A;  4PS3 A;  1TNY A;  4FLB A;  4AM9 A;  2ZGG A;  1OCR E;  3HIZ A;  3LYA A;  4AVX A;  3ZGQ A;  5EKQ D;  3N71 A;  3APC A;  1X81 A;  5D66 A;  2VSX E;  4BET A;  1LTX A;  5FZR A;  3EHR A;  5EIL A;  2BTD A;  4XI0 A;  3CVW A;  4C0M A;  4F3V A;  4GA1 A;  3D9O A;  2IQC A;  4MKT A;  3E4B A;  3Q78 A;  3EHM A;  4UWK A;  2XQ0 A;  3IV0 A;  4GU5 A;  1JWF A;  4P29 A;  3C98 A;  3FU6 A;  3G2U A;  2ZGD A;  3UXG A;  5FWQ A;  4OVV A;  2X6K A;  4B94 A;  1E90 A;  4OAU C;  3AG2 E;  2GGF A;  3ZFW A;  3Q7A A;  1NP7 A;  5EYL A;  2WQ6 A;  3TWX A;  4XIF A;  2FF4 A;  5AJL A;  4A3V A;  4HOQ A;  3RRM B;  4C48 B;  1DCQ A;  4NRH B;  3PE3 A;  3QWW A;  1E7V A;  4AIF A;  2GRL A;  3MA5 A;  4TUM A;  5FIN A;  1SW6 A;  1O1S A;  1O5M A;  2WPV A;  1FVH A;  2DYS E;  3GZS A;  3C5R A;  3OXG A;  3TWS A;  1HX8 A;  1IXV A;  2IF4 A;  4DI4 A;  3RO3 A;  4GTP A;  1DNP A;  5AQ7 A;  4F1P A;  3EHQ A;  3OXL A;  2KM4 A;  3DSU A;  3D9K A;  2B6C A;  2YQ8 A;  2BKK B;  3MGB A;  3CVN A;  4GYY A;  3FDH A;  1H6O A;  1O1T A;  3OXF A;  4G2V A;  4KZC A;  4ACK A;  4EHM A;  4JA7 A;  2R59 A;  3LY9 A;  4HBD A;  1HZ4 A;  3KEZ A;  5FQ4 A;  3SBT B;  2OEW A;  2A4Z A;  4KZ0 A;  1JPL A;  5G2N A;  4F7A A;  3PDN A;  3TXM A;  4U0Z A;  4GML A;  1L5J A;  4UWG A;  2P9U G;  4JC8 A;  2WQ7 A;  3SD5 A;  3D9I A;  4J8F A;  5HRY A;  2MHK A;  3ZIM A;  2NXP A;  3CK9 A;  3SGH A;  3J5P A;  4L7T A;  3CKC A;  1H2T C;  2HYZ A;  3NQP A;  3HHM A;  3JQ1 A;  4UQY A;  1HG2 A;  2CFU A;  3FTS A;  4BTA A;  3NF1 A;  2F8Y A;  2VTB A;  5G04 C;  2OVF A;  3MKQ A;  2CHX A;  4WND A;  1E8Z A;  2XEV A;  3FU5 A;  3SO8 A;  2WXP A;  2QY7 A;  2Q7F A;  2WXH A;  4AY6 A;  1BPO A;  3PUK A;  2EIN E;  3PRE A;  3ESL A;  2WM9 A;  2VQ2 A;  4H7X A;  1N4R A;  4JEU A;  1SA4 A;  3CV0 A;  3KEA A;  4F1S A;  5AQ9 A;  1Z5S C;  2A5E A;  5CMY A;  5A23 A;  1H2U A;  1P5Q A;  1G3N B;  2CFZ A;  2XCC A;  4O1P A;  1EYH A;  3PNT B;  1OCZ E;  4TXQ A;  2WMN A;  1Z3X A;  2V8S E;  3DEP A;  3CVL A;  3IHV A;  4NIK A;  3EIJ A;  3HRA A;  2F8X K;  4PS7 A;  4NAC A;  1SZ9 A;  4GZ3 A;  4LEU A;  4Y6W A;  3FEX A;  2CG3 A;  2F0Y A;  3E34 A;  1SA5 A;  1HE8 A;  2WXI A;  3FUF A;  4EBA A;  4XKC A;  3HDX A;  5BXU A;  2GRQ B;  1D8E A;  1MQS A;  5C1D A;  2IU1 A;  2XZT G;  4L2Y A;  3CQC B;  4IYP A;  3X2Q E;  4GTM A;  3HVE A;  2KCL A;  4GA2 A;  4NUR A;  3UIP C;  4LG6 A;  4JHJ A;  4LCT A;  3ASO E;  3RO2 A;  4TXP A;  4GMR A;  5FQ8 A;  3CVU A;  4DPR A;  5AYW D;  3D9N A;  2C0L A;  3SFZ A;  3EUV A;  1LF8 A;  1DC2 A;  4A1S A;  4U07 A;  5EIB E;  3CHO A;  4LUN U;  4UWH A;  3SBS A;  2QC9 A;  2UWJ G;  2KXP C;  5E76 A;  4GPM A;  5JHA A;  3KD7 A;  1PC2 A;  4URK A;  5M72 A;  3CVX A;  3APF A;  1K1B A;  4JB8 P;  4U0U A;  1SZA A;  3UMV A;  2HE0 A;  3UX4 A;  1PY1 A;  2AWI A;  4A63 B;  5FQ6 A;  2PNN A;  1FVF A;  4B0Z A;  1WDY A;  5FZS A;  4LRZ A;  1H19 A;  3ZXP A;  1ELK A;  2AW6 A;  1S64 A;  3FH5 A;  2IJG X;  2PM6 A;  3FUL A;  3LCA A;  1OWL A;  3CHS A;  2XHE A;  3O4Z A;  1INZ A;  4G23 A;  3CVP A;  3ZEF A;  1IQR A;  2OOE A;  3HXB A;  3GYZ A;  3DPY A;  4HB5 A;  2NC9 A;  1TYQ G;  3UT4 A;  5FQ7 A;  5BT1 A;  4NQ0 A;  4WAF A;  1N95 A;  1ZB1 A;  3SFY A;  5D0O D;  2DIW A;  3B13 A;  4U7E B;  3L82 A;  4HRM B;  3C72 A;  1BD8 A;  4FLH A;  3SNX A;  3TG5 A;  3LJ3 A;  3UKR G;  4QQI A;  3Q75 A;  3AG3 E;  5IY5 E;  2LSV A;  4U95 D;  5H7P A;  2IOL A;  4N3A A;  4I17 A;  4E6H A;  3PEU B;  3D9M A;  3ISM C;  3ONL A;  4JZY A;  1OY3 D;  3FTV A;  3WXX A;  2P9P G;  1Y6I A;  3LXU X;  3RRN B;  4CDM A;  3UPV A;  3CVY A;  5EX0 A;  3MZL B;  1N54 A;  3QK0 A;  4DUI A;  2WB2 A;  5AAO A;  4MS6 A;  3E30 A;  3MV2 B;  4LNG A;  3FEY A;  2C0M A;  2H6I A;  2HR2 A;  4I9C A;  3Q49 B;  2KZT A;  2XPY A;  2J4D A;  5KBA A;  3PH0 C;  4GAA A;  5ITZ F;  4KMO A;  3UM1 A;  4Z68 A;  3JYS A;  3LS8 A;  3T8M A;  2Y0B G;  4U8H A;  4J8S A;  4XE0 A;  5AJD A;  3P2B A;  2XCB A;  2I9C A;  1N0R A;  3ZHE A;  3JCK C;  4WWO A;  2LSU A;  4WNF A;  5DIZ A;  3ZUV B;  4GZ6 A;  4AJW A;  2H6H A;  4DX2 A;  4UWF A;  3ONK A;  2DWZ A;  2VGY A;  3NOG D;  4GZ5 A;  2PQR A;  4GPK A;  4F6R D;  3IEG A;  3RKV A;  3VLF A;  4MRU A;  3ULY A;  5BNW A;  3SQV A;  2VTB B;  1H6P A;  1JCS A;  3RIB A;  3UQ3 A;  4BSZ B;  1MJ0 A;  3ABM E;  1NA3 A;  1TN6 A;  3FWV A;  3CHR A;  3I5P A;  3MEK A;  1YYH A;  5D2M C;  1U3C A;  4FAD A;  3FY4 A;  1KZP A;  4CZ2 D;  3FH8 A;  2ETC A;  3PNL B;  4WNG A;  3IHY A;  1XNF A;  2XGO A;  3FUE A;  2IY0 C;  2P9L G;  5AIJ A;  1ELR A;  1UJK A;  3D9J A;  2FO1 E;  2VSN A;  2FEZ A;  5JJ6 A;  3AS8 A;  4DI3 A;  2VJ8 A;  2R05 A;  4K5B A;  4YVQ C;  3TJP A;  4B8A A;  3V2X A;  2DCP A;  2WQH A;  1O1R A;  4XEI G;  4DJA A;  1Z3Y A;  2YNQ A;  3QNK A;  4PS8 A;  4Y6C A;  2P9N G;  1H0A A;  4C9B B;  5HQ8 A;  4J8Y A;  1HU3 A;  3UKU G;  4HS2 A;  4U0S A;  3UM2 A;  5T4Y A;  3LKU A;  3HYM B;  1HXI A;  2X38 A;  3SHF A;  4YDE A;  4GTS A;  3I3N A; 
#chains in the Genus database with same CATH homology
 2E2E A;  2WXJ A;  5G04 C;  3PVL A;  3IKO B;  4GB9 A;  2VTB A;  2OVF A;  4EEC A;  2RG8 A;  4EZK A;  3CSF A;  2WXG A;  3HVE B;  3MKQ A;  2XPZ A;  5ARG A;  4ATG A;  2CHX A;  4FHJ A;  4WND A;  4GMJ A;  4MLP A;  4B89 A;  5BV0 A;  1E8Z A;  4Q94 A;  2Y3A A;  4H7Y A;  2XEV A;  4PDX A;  5EDS A;  2WMO A;  3RRU A;  3MX3 A;  1HFA A;  3FU5 A;  3L17 A;  3ZYK A;  3L6A A;  3SZ7 A;  2WVI A;  2WXP A;  3AS5 A;  2QY7 A;  3GZ2 A;  2OVB A;  2Q7F A;  4I1A A;  5JHB A;  2PL2 A;  2L9B A;  4L2L A;  2WXH A;  3O48 A;  4N39 A;  4AY6 A;  1BPO A;  3PUK A;  1VDY A;  4FU3 A;  3S7D A;  3NZS A;  3PRE A;  3CK8 A;  3FP3 A;  3ESL A;  4WWN A;  4KXK B;  3RJV A;  3T5V A;  2WM9 A;  2VQ2 A;  4H7X A;  5LCW J;  4UI9 J;  4JEU A;  4G25 A;  2R5S A;  3FTW A;  4I1O B;  3MKQ B;  2C2L A;  3ESK A;  3CV0 A;  4XX5 A;  5EX3 A;  4F1S A;  3DBS A;  5T3R A;  4AOF A;  1QQE A;  4A1G A;  5CMY A;  2WXF A;  3ASF A;  3EDT B;  5A23 A;  3CIA A;  3Q47 B;  1H2U A;  4CEM A;  3FUJ A;  4HOT A;  3CKB A;  2X6J A;  1P5Q A;  2L0I A;  3S2A A;  2CFZ A;  2XCC A;  1EYH A;  2ION A;  3PNT B;  3PZD A;  1IQU A;  2AXU A;  2DBA A;  2WMN A;  3ASG A;  1EF1 C;  2WXR A;  4I1M A;  4XI9 A;  1Z3X A;  4HOU A;  2V8S E;  3PRZ A;  4CDR A;  3TL5 A;  1N52 A;  3CVL A;  5BV1 A;  4BY6 A;  3IHV A;  3EIJ A;  1NA0 A;  4KT6 B;  2J08 A;  4IUL A;  2X3M A;  4ABN A;  4PS7 A;  4NAC A;  4ILH B;  1SZ9 A;  5CHE E;  3B7U X;  3ULQ A;  2OND A;  4B8C B;  3D3M A;  4AXH A;  3PS6 A;  2UY1 A;  2MOW A;  4GZ3 A;  4LEU A;  4Y6W A;  3ZYM A;  3U64 A;  3FEX A;  2CG3 A;  4R7L A;  4JPS A;  3L08 A;  5CCM A;  1HE8 A;  4ANW A;  4JVS A;  2WXI A;  3FUF A;  4EBA A;  2YIN A;  4QFV A;  4XKC A;  3HDX A;  2QFC A;  4G26 A;  3MV3 B;  5G55 A;  5C1D A;  1MQS A;  2J4B A;  1WM5 A;  4WUY A;  2PM7 A;  4ANU A;  2IU1 A;  4JHR A;  2J9Q A;  5D0Q D;  1E8X A;  2XRZ A;  4TUU A;  3QC1 A;  4L2Y A;  5ARF A;  3CQC B;  4IYP A;  4ILI A;  1OWM A;  2WXL A;  5C2Y A;  4LER A;  4FA6 A;  3HVE A;  2KCL A;  4GA2 A;  4NUR A;  5ANR A;  3SF4 A;  1QZ2 A;  3CLJ A;  2UY1 B;  2NSZ A;  3KAE A;  5T8I A;  4JHJ A;  4LCT A;  4CRW A;  2AXZ A;  1IHG A;  2CG2 A;  3RO2 A;  4BFR A;  5FQ8 A;  2I6H A;  4CT0 A;  3MCX A;  3ENE A;  4GYO A;  1DVP A;  5LP0 A;  3CVU A;  4BWR A;  4DPR A;  5AYW D;  4K0R A;  4N3C A;  5FT9 A;  1HH8 A;  1MHQ A;  2BF0 X;  2I1K A;  3D9N A;  2C0L A;  2V0P A;  3AS4 A;  1XGW A;  5LOZ A;  3SFZ A;  4CGW A;  1LF8 A;  4A1S A;  4CT4 A;  4GZC A;  3KS2 A;  3TXN A;  4YND A;  2PZI A;  2ZU6 B;  4BX9 A;  2XPI A;  3EIQ C;  4U07 A;  3Q4A B;  1H2V C;  3CQG B;  4WWP A;  2GRM A;  3CHO A;  2FBN A;  4I2W A;  3VTY A;  4LUN U;  4CDN A;  4UWH A;  1NZN A;  1HS6 A;  3I4G A;  3LEW A;  4N3B A;  4V3I A;  3SBS A;  3ZPJ A;  2UWJ G;  1E96 B;  3FU3 A;  5E76 A;  4N2S A;  4J8D A;  5G04 J;  5HI7 A;  5KJM A;  2JLB A;  3CEQ A;  5JHA A;  3KD7 A;  4F53 A;  1PC2 A;  4J8E A;  2VGX A;  4I6J A;  5FZQ A;  4HVB A;  4URK A;  5M72 A;  4TV3 A;  2R17 C;  3L22 A;  3TGO A;  3APF A;  3CVX A;  3FUD A;  3QAR A;  3U3W A;  5ANL A;  4M3O A;  3NZU A;  4U0U A;  3SI5 A;  4A55 A;  4CGV A;  2X6F A;  2ILR A;  3AU5 A;  3LY7 A;  1SZA A;  1UG3 A;  3UMV A;  1X5B A;  4U04 A;  4E85 A;  3U9W A;  3T5X A;  3UX4 A;  1PY1 A;  2AWI A;  3TAX A;  5FQ6 A;  2AVP A;  1HO8 A;  2J09 A;  3JUI A;  1FVF A;  2HM8 A;  3LDZ A;  4B0Z A;  3VTX A;  3L16 A;  4K03 A;  1SQM A;  2KZT B;  3QWP A;  3VLD A;  5FZS A;  4LRZ A;  2XGM A;  1H19 A;  4AVX A;  5KJK A;  4ME2 A;  1ELK A;  3B7T A;  2VSO E;  4G11 A;  2AW6 A;  3FH5 A;  2IJG X;  3CVY A;  2PM6 A;  3FUL A;  3LCA A;  1OWL A;  1HG5 A;  2VGX B;  3CHS A;  2LNI A;  4FJZ A;  4IRU A;  4KVM A;  2XHE A;  3O4Z A;  4RSY A;  3UT7 A;  1INZ A;  4G23 A;  3CVP A;  3ZEF A;  1KLX A;  1IQR A;  1UN9 A;  2OOE A;  4BT9 A;  4HOR A;  4JXT A;  4AEZ C;  3G2W A;  2L6J A;  3GYZ A;  3CHM A;  4N5C A;  2A5U A;  3UUX A;  2NC9 A;  3B7S A;  4FJY A;  3FHE A;  4I43 A;  2BUG A;  5FJY A;  4ANX A;  3UT4 A;  4FUL A;  5FQ7 A;  4GYW A;  3ZYL A;  5BT1 A;  1WY6 A;  4NQ0 A;  4WAF A;  1B89 A;  1EPU A;  3R7Q A;  4BTB A;  4DLQ A;  2IFU A;  5CCL A;  1OWO A;  2HO1 A;  1GW6 A;  3BG0 B;  2V5F A;  3OAW A;  4IN3 B;  3PEV B;  5D0O D;  1Y8M A;  2DIW A;  2XRY A;  3MKR A;  3B13 A;  4Q69 A;  5G05 C;  5KJN A;  4JW1 A;  4HOS A;  4JEH A;  3K9I A;  1KT0 A;  4AV7 A;  4RG9 A;  3FH7 A;  1FCH A;  4FLH A;  1JUQ A;  4U63 A;  3SNX A;  3ZXS A;  3CVV A;  3QB2 A;  1E8Y A;  3FU0 A;  3TG5 A;  2X6H A;  3DPD A;  3LJ3 A;  3FTX A;  4JHK A;  1S0P A;  4I6G A;  2CHZ A;  4N2Q A;  2LSV A;  3OTN A;  4A3T A;  3ZW3 A;  4GCN A;  5E75 A;  3UT8 A;  2IOL A;  4N3A A;  1OUV A;  1E8W A;  4I17 A;  3Q5M A;  5KCM A;  2LO6 A;  3CR3 A;  4OVU A;  1UJJ A;  3CST A;  4GZD A;  1PAQ A;  4FHK A;  5FTP A;  3PEU B;  4I6E A;  4E6H A;  3D9M A;  3QJZ A;  4BSX A;  1W3B A;  4ACL A;  3ONL A;  3BEE A;  3FTU A;  4JZY A;  5BW8 C;  2WXN A;  3RU0 A;  1ZU2 A;  3FTV A;  3QWV A;  1H6K A;  2E0I A;  3WXX A;  1KT1 A;  4D10 C;  1ELW A;  2WXQ A;  4UQX A;  2LAH A;  3FUN A;  1Y6I A;  3ML9 A;  3ZVV A;  3LXU X;  3RRN B;  3URZ A;  4JL0 A;  3AU4 A;  1OWP A;  2AXV A;  1E7U A;  1HF8 A;  2WXK A;  2CHW A;  3EHN A;  4CDM A;  4DLO A;  1QNF A;  4KVO A;  1EDU A;  4PS3 A;  1Z6T A;  2EQX A;  4AM9 A;  4FLB A;  3UPV A;  5BPP A;  1YA0 A;  3HIZ A;  3LYA A;  4CCA A;  5EX0 A;  2XGS A;  3MZL B;  3ZGQ A;  1N54 A;  2YHE A;  3QK0 A;  3N71 A;  5EKQ D;  3ZYQ A;  3APC A;  4MS6 A;  2WB2 A;  3MV2 B;  2VSX E;  3IBE A;  3GZ1 A;  3FEY A;  2C0M A;  3EJN A;  5LFA A;  1TJC A;  4FC8 A;  2HR2 A;  1TJF A;  4I9C A;  5FZR A;  2Y4U A;  3Q49 B;  2IOS A;  2KZT A;  3FUH A;  2L0T B;  2BTD A;  2XPY A;  2J4D A;  3FUK A;  4JA9 A;  4RVB A;  4XI0 A;  4C0M A;  3PH0 C;  4F3V A;  4GAA A;  4GA1 A;  3D9O A;  4KMO A;  2V4L A;  2IQC A;  4MKT A;  3E4B A;  3EHM A;  4W9R A;  3JYS A;  4PUC A;  2XQ0 A;  3IV0 A;  3LS8 A;  4UWK A;  4GU5 A;  3T8M A;  1JWF A;  4P29 A;  2YHC A;  4U8H A;  3C98 A;  4J8S A;  4XE0 A;  3FU6 A;  4YVO A;  5AJD A;  3ML8 A;  3P2B A;  4J6I A;  3G2U A;  2GW1 A;  2XCB A;  4APF A;  4EBA G;  5FWQ A;  3CVW A;  1UW4 B;  1ZBP A;  4OVV A;  2I9C A;  3B7R L;  2RD0 A;  3ZHE A;  3JCK C;  4WWO A;  5A6C A;  2LSU A;  3P1U A;  1WAO 1;  4WNF A;  5DIZ A;  3TG4 A;  3S7J A;  2X6K A;  4GZ6 A;  4AJW A;  3FUI A;  4B94 A;  5CMW A;  3G2S A;  1E90 A;  1UN8 A;  4UWF A;  5ENN A;  3ONK A;  2VGY A;  2GGF A;  4HLE A;  3ZFW A;  3R9A B;  4GZ5 A;  3APD A;  1NP7 A;  2PQR A;  2WQ6 A;  4XZ4 A;  3BG1 B;  4XIF A;  2FF4 A;  4GPK A;  5LCW C;  4UI9 C;  5AJL A;  3IEG A;  4KBQ A;  3RKV A;  4UWL A;  4DK5 A;  3VLF A;  4A3V A;  4HOQ A;  4C0E A;  4MRU A;  2KC7 A;  3RRM B;  2X6I A;  2OV8 A;  4NRH B;  5BNW A;  3PE3 A;  3QWW A;  2VTB B;  1E7V A;  4AY5 A;  4AIF A;  2GRL A;  3MA5 A;  2JEK A;  2FI7 A;  3ZRH A;  5J08 A;  3RIB A;  3UQ3 A;  2Y4T A;  2KCK A;  1OWN A;  4G1T A;  4KYO B;  3FUM A;  3ZHE B;  4OYS A;  4UQZ A;  1NA3 A;  3LVQ E;  4EZL A;  2WPV A;  1FVH A;  2PQN A;  3FWV A;  3GZS A;  3ASD A;  5A7D B;  5BUZ A;  3OXG A;  3CHP A;  4L23 A;  3CHR A;  3I5P A;  3LPZ A;  2KCV A;  3MEK A;  4L1B A;  5J90 A;  3ZN3 A;  1HX8 A;  2IF4 A;  4DI4 A;  1JWG A;  1U3C A;  3RO3 A;  1DNP A;  4FAD A;  4I2Z A;  3R7R A;  1TEZ A;  3QKY A;  4HFG A;  4EZJ A;  3FY4 A;  4HXI A;  2LAI A;  3FH8 A;  3Q15 A;  3QAQ A;  5JJ7 A;  2FUL A;  5G05 J;  3OXL A;  3CGH A;  2KM4 A;  3PNL B;  4WNG A;  2VYI A;  3D9K A;  2YQ8 A;  3IHY A;  3D9P A;  1XNF A;  2XGO A;  3S7F A;  4AP2 A;  3FUE A;  3MGB A;  5DBK A;  2WXM A;  3L13 A;  3L54 A;  3CVN A;  5AEN A;  4GCO A;  3FDH A;  4FP7 A;  4GYY A;  5AIJ A;  3PUJ A;  1ELR A;  1UJK A;  4XKB A;  3U66 A;  3OXF A;  4G2V A;  4KZC A;  3I4R B;  4ACK A;  3G2V A;  4ANV A;  3D9J A;  2I1J A;  4JA7 A;  2R59 A;  3JQ0 A;  3FFL A;  2VSN A;  4Q96 A;  3LY9 A;  2P58 C;  1HZ4 A;  3FTZ A;  3ASH A;  2FEZ A;  5JJ6 A;  3KEZ A;  5FQ4 A;  3SBT B;  3AS8 A;  2A4Z A;  4DI3 A;  2J49 A;  4KZ0 A;  2VJ8 A;  1JPL A;  4GA0 A;  3RK6 A;  5G2N A;  4EQF A;  4F7A A;  2WXO A;  3LY8 A;  3PDN A;  4TRQ A;  3TXM A;  4YVQ C;  4U0Z A;  1IYG A;  3TJP A;  4GML A;  1L5J A;  4PH4 B;  4WNE A;  3CK7 A;  4RG6 A;  4UWG A;  4JC8 A;  3D9L A;  2I2O A;  2MRI A;  4B8A A;  4ILG A;  2WQ7 A;  2DCP A;  2WQH A;  2J07 A;  3SD5 A;  4DJA A;  1Z3Y A;  3LVR E;  4J0U A;  3FTY A;  3CVQ A;  3S7B A;  2YNQ A;  5JJT A;  1A17 A;  3D9I A;  4J8F A;  3QNK A;  4PS8 A;  3MYV A;  3G2T A;  2MHK A;  3ZIM A;  4Y6C A;  2NXP A;  3QDN A;  4APO A;  4G24 A;  3U4T A;  1H0A A;  3CK9 A;  4C9B B;  5LX8 A;  4UI9 K;  2VSY A;  3PE4 A;  3SGH A;  4L7T A;  5HQ8 A;  5KJL A;  4I9E A;  4EPZ A;  3CKC A;  1H2T C;  2HYZ A;  3QOU A;  1HU3 A;  4HS2 A;  3NQP A;  4U0S A;  3HHM A;  3JQ1 A;  4UQY A;  2M63 A;  3CHQ A;  3MJW A;  5T4Y A;  3LKU A;  3HYM B;  1HXI A;  3GW4 A;  3VLE A;  1HG2 A;  2FO7 A;  4BT8 A;  4BX8 A;  2CFU A;  2X38 A;  2KAT A;  1U3D A;  3SHF A;  3FTS A;  4BTA A;  4O6F A;  3I3N A;  3NF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...