3D9PA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVTVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 53
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9pA00
3CLJA 3ZYLA 2L0TB 1SZ9A 3ZYMA 1HG5A 1UJKA 5LP0A 2KM4A 1DVPA 1VDYA 1INZA 1JPLA 3LDZA 4HFGA 3ONKA 1SZAA 3D9NA 3G2VA 3ZYKA 1JUQA 1H0AA 2BF0X 5CMWA 3G2SA 4FLBA 1X5BA 1ELKA 4Q94A 5LOZA 3D9JA 4NACA 3D9KA 1JWGA 1HX8A 2V8SE 3D9MA 3D9IA 3D9PA 3G2WA 1HF8A 4JXTA 3ZYQA 4FU3A 1EDUA 1HG2A 1HFAA 2MOWA 5CMYA 2L0IA 2QY7A 3G2UA 4GZDA 4Q96A 2LO6A 1JWFA 1LF8A 1MHQA 1EYHA 1PY1A 2DCPA 1UJJA 2DIWA 1XGWA 3ONLA 3D9OA 4GZCA 3RRUA 4AVXA 3D9LA 3G2TA 5J08A
chains in the Genus database with same CATH superfamily
2HO1A 1OCOE 3BUAA 4BWRA 1BLXB 5E76A 5BNWA 3LEWA 3TJPA 2AXZA 4CEMA 2WXRA 3UT8A 2ILRA 4ILGA 2XPZA 4WWNA 2GRLA 2XS8A 2X6FA 3UT4A 4O1PA 4DLOA 3OXLA 4GB9A 2JEKA 3G2TA 4XX5A 1SA4A 3CK9A 4HVBA 4JEHA 4WNEA 3CR3A 2VSNA 1Z3YA 3JYSA 3D9NA 3DSVA 2BF0X 2WPVA 2EILE 4B89A 4F1SA 4Q94A 1NA3A 5G2NA 4AEZC 3AG2E 3Q5MA 2Y3AA 4J8SA 2FULA 4FP7A 1H2UA 1IQRA 4MS6A 5BV1A 1KT1A 3VTYA 4YDYA 2R2LA 3CQGB 3LXUX 4W9RA 1D8EA 4IRUA 1A17A 2WXOA 2KC7A 3CHQA 3EIJA 1FT1A 4CDMA 4IYPA 3O4ZA 4J8DA 1FPPA 3ASFA 3EUVA 4I6GA 2AWIA 5EYLA 4OAUC 3C98A 4GTSA 4NACA 3FTVA 4J8EA 2R17C 3ABKE 4LEUA 1JWFA 2DWZA 2BUGA 3NF1A 4F1PA 1N0RA 5JHBA 5JJ7A 3ULEG 5T3RA 3G2SA 4PH4B 3ENEA 2VYIA 1OXJA 3UM1A 2C2LA 5D0OD 1K1BA 4FA6A 1MYOA 3E33A 2HE0A 2F0YA 3MV3B 3QNKA 3UPVA 3ML8A 1AP7A 4H7XA 4GTRA 5T4YA 3LKUA 1LTXA 2R59A 4GPKA 3CVYA 3Q7FA 3HXDA 1ELRA 4UI9J 2LUHA 3EJNA 2X6JA 1IHBA 4HRNA 3R7RA 2PZIA 1N95A 2KCLA 2V5QC 4BSZB 4J6IA 4RVBA 3FEYA 1H2VC 4F6RD 4JXTA 2R05A 3FUIA 3QWWA 2M63A 2X6IA 4HI8A 4GZ6A 5BV0A 4ZFHA 3RRUA 3Q49B 2YQ8A 3SD5A 1D8DA 1IQUA 1Q2ZA 4GA2A 5B1AE 1HXIA 1UN9A 5FZQA 2ETBA 4JHJA 3Q78A 3OXGA 3E30A 4AP2A 4BTAA 2DCPA 5ENSD 4BESA 5LCWC 3D9LA 2J07A 1E8YA 4UQXA 3TGOA 4D10C 1NFIE 3D9KA 3ZNGA 4DX7D 3Q75A 3FH7A 3ZYQA 4I9EA 4EZKA 2FBNA 3BEEA 3VLDA 1SZ9A 4HLEA 2KM4A 4AIFA 4UQYA 4ATZD 1N4PA 2GGFA 1BI8B 1JWGA 5G04C 2GRQB 5ENPD 5ENNA 5AQAA 2VGEA 4PS3A 3LVRE 2PM7A 2AXUA 2LSUA 2MRIA 4I17A 2KBXA 5KNHD 4PUCA 3MA5A 3L22A 1HU3A 4G26A 4O1OA 4CGWA 1N11A 3E32A 2LAIA 1IYGA 1OWPA 2IO3C 4NIKA 4XZ4A 2GRRB 4G24A 3FUFA 2V0PA 2IEJA 2XEEA 3EHNA 5AN8A 5EX0A 2ETAA 1TNUA 2KZTB 2Q7FA 3HXCA 2V4HC 3B7TA 3ZUVB 3VLEA 4TUUA 5JJ6A 1TNOA 3KEAA 3C3OA 5KWDA 1MJ0A 4HNAD 4URKA 4GCNA 2WVIA 3V31A 5FIOA 4I2ZA 4C0EA 2RFAA 1HO8A 3KSLA 3LDZA 3IBEA 4U7EB 1JUQA 2VQ2A 3DSXA 1W3BA 3UXGA 4Y6WA 3PH0C 1MHQA 3KEZA 3U64A 5KJLA 4BEPA 5CCMA 3ZU7B 2VJ8A 4LG6A 2P9UG 2LXMA 4JD2G 3TL5A 3ULYA 5FINA 1WDYA 2Y1LE 4JL0A 3PS6A 4HOUA 4GA1A 5CBNA 1TR4A 2X6HA 3PZ2A 4XKCA 2J09A 2V5FA 3CVLA 3V30A 3RJVA 2AJAA 1OCCE 3MGBA 5CCLA 5DIZA 4N3CA 3D9IA 4WNGA 1E96B 3Q9UC 4X8QA 3ZKJA 4PS8A 4A3TA 1TEZA 1KPSB 3HXFA 1GW6A 2WXJA 5EN5D 2GROB 3PE4A 3B7RL 4CRWA 3V2OA 1Z3XA 3UM2A 2DZOA 4G1TA 4M7CA 4J8YA 4KT6B 2JLBA 2QYJA 2CFUA 3TXNA 3HXEA 1P5QA 3I4RB 5CMWA 1SVXA 4E85A 3N71A 2ZGDA 3F6QA 2I6HA 2P9KG 2BTDA 3W9FA 3JXIA 5CRUA 1H2TC 3ISMC 1JPLA 3LY9A 3QAQA 5JHAA 3KS2A 3ESKA 4U0ZA 2C0MA 2VSXE 3LVQE 4TRQA 2NC9A 3D9PA 4B94A 1HG2A 2P9SG 5FQ6A 1OT8A 1E8XA 1YYHA 4LERA 4EZJA 1BU9A 1N4RA 4QFVA 2E2EA 2YHEA 1LD7A 1OWMA 3RIBA 1N4QA 4YVOA 2FEZA 3LJNA 1BD8A 4KZ0A 3Q15A 4N2SA 1ZB1A 2AXVA 3AS4A 2WQ6A 2J4DA 2PL2A 2H6IA 2XS1A 4JPSA 3PNLB 1UG3A 2RKKA 3LYAA 3LY8A 3I3NA 4RSYA 4XEIG 1MX6A 3EIQC 1OCRE 2WXHA 4MLPA 2ZGGA 1E8WA 3ZYMA 4EQFA 4GYOA 3DXMG 3HVEA 4GTMA 3ZN3A 4RQIA 5CMYA 4C9BB 4GZCA 4GTVA 3K9IA 5AIJA 4N2QA 4ANUA 4I1OB 3MYVA 4A3VA 5AJDA 3SI5A 5B3SE 3VLFA 1JCRA 2VGXB 3EU5A 1OCZE 3GZ2A 4J8FA 3DSTA 3EHRA 3CVWA 5A6CA 3JQ1A 3UIPC 2H6GA 3CLJA 5E75A 2WXGA 4LUNU 4BX8A 5EX3A 2P9NG 3RO2A 4KVMA 3LPZA 3JXJA 3AU5A 4RG9A 3GYZA 3FULA 4K5AB 3ASNE 3BG1B 4Z68A 3MKQB 2KATA 1JCSA 3ESLA 3PEVB 4MBGA 3CHPA 3ASGA 2NSZA 4OAVB 5B1BE 3SBSA 2NYJA 1K8KG 3APDA 5KBAA 3UINC 4XE0A 2LSVA 4AJWA 4E6HA 3JQ0A 3FH8A 3R9AB 3CIAA 4ME2A 3LS8A 2Y0BG 5C1DA 1E7UA 4EPZA 3QJZA 3EU9A 2CG3A 1H19A 3FUEA 4JW1A 5BXUA 3B7UX 2WQ7A 3FU5A 2QZAA 4UWKA 3PZ4A 3HVEB 3FY4A 1HFAA 4C48B 1TJCA 5ENTD 1UJJA 1NZNA 3DRAA 4UWHA 4ATGA 2FO1E 1D9SA 2YNQA 3CK7A 2L6BA 5HI7A 3FTUA 3T5VA 5KJNA 3D9MA 4AOFA 4DX1A 3ABLE 5ITZF 4HQDA 3RAUA 3IHVA 2PNNA 3ZYLA 3PRZA 3FUMA 1TYQG 3D3MA 5A23A 3BU8A 3IKOB 3RRNB 2XGSA 1FVHA 1O1RA 4L2LA 5EIBE 4U95D 1HX8A 1H6KA 3CGHA 3ZPJA 3R7QA 3CSTA 1JCQA 4TXQA 1EYHA 3D9HA 4CCAA 3L13A 3MEKA 3TWSA 1EPUA 1HE8A 2I2OA 4TXPA 4GCOA 3UKUG 4KBQA 5KJMA 3DXKG 4KVOA 3RKVA 1HS6A 4O6FA 4WNFA 4OVUA 4U8VD 5EIDA 2XRYA 1PAQA 2ETCA 2I1KA 1E7VA 4N3BA 3FP3A 4PDXA 3TXMA 4GYYA 2F37A 2AVPA 4TXRA 2RG8A 3NQPA 1UOHA 3BG0B 2FO7A 2R5SA 2Y69E 4EBAA 2J08A 3CSFA 3ZVVA 2UY1A 4I43A 2KCVA 4FJZA 4YDEA 4N39A 3Q79A 2OVFA 2JABA 2ZIRA 3TWRA 2ZXWE 5AQBA 2FI7A 1XNFA 2CHXA 1ELKA 5LFAA 4UWFA 2IOLA 3MV2B 3QC1A 3SQVA 4L23A 4I6JA 4GTQA 3C3QA 4LNBA 3MZLB 3QB2A 1N0QA 2IFUA 4JC8A 2A4ZA 5BW8C 3X2QE 5FJYA 4YNDA 2IJGX 3DBSA 3KSQA 1H6PA 3CVPA 1OUVA 3W9GA 3ZXSA 2V8SE 1YMPA 2HR2A 3B7SA 3UQ3A 4RLYA 5AQ9A 4B8CB 2KZTA 2EIKE 3UX4A 3DPYA 3DSUA 3UT7A 2WM9A 3IEGA 5AAOA 2QYUA 4U63A 3AJIA 3RU0A 2R03A 3CHSA 4HORA 5FQ7A 4AV7A 3V2XA 3Q73A 3JUEA 1OWLA 4AY5A 4HXIA 4DJAA 5D2MC 2V4LA 3TWTA 4DI3A 3UMVA 4L2YA 4HOQA 4DLQA 3CKCA 5AARA 3S7JA 4FJYA 3RO3A 2YHCA 2LO6A 3CVNA 4CT4A 1XGWA 3UM0A 5ENRD 3PE3A 2IF4A 3AG3E 2J8SD 3FDHA 3FTYA 4FHKA 4IULA 3ZHEB 3Q47B 3DSWA 4JB8P 3DWLG 1TJFA 1U3CA 1VDYA 3SFXA 1HH8A 2P9PG 3CVVA 3S7BA 3MKRA 3Q7AA 5EKQD 2PM6A 4G25A 1EF1C 3G2UA 3NAWA 4G2VA 2WXLA 4GTPA 3VTXA 1NP7A 4DI4A 3D9OA 4B93B 5D0QD 4EBAG 4WNDA 4GZ5A 3FFLA 3CHOA 5KJKA 4UWLA 1S63A 3OTNA 2GRNB 4BY6A 1WM5A 3J5QB 1QQEA 4HLLA 4L7TA 1ELWA 2WMOA 3PEUB 3I5PA 4HS2A 2XGOA 4J7WA 4M3OA 4TUMA 1WG0A 4AM9A 3JCKC 3NOGD 2HM8A 2XZDG 2J9QA 3SHFA 1NI1A 4V3IA 1TNZA 3WXXA 3CHMA 3AS8A 3NZUA 4G8KA 3ULQA 2WXNA 3Q4AB 4JEUA 3ZFWA 3PVLA 1S64A 3ZYKA 5A7DB 2I1JA 5LOZA 4ILHB 1TN8A 4GMLA 5CECB 4Q96A 5G05J 1DC2A 1UN8A 4ILIA 3T9KA 2KXPC 4N3AA 3ABME 1U2VG 1LD8A 3QOUA 3L17A 4TV3A 5C2YA 3PREA 3L9TA 4CDRA 4WUYA 4KZCA 4H7YA 4GPMA 1KT0A 4XKBA 4FULA 4MKTA 3BQOA 5H7PA 2MYOA 4GTTA 3IXEA 2XRZA 1BPOA 1OY3D 3KAEA 2CG2A 2J49A 3ZW3A 3CVXA 2F8YA 1UJKA 1RW2A 4YDOA 3AG1E 3AAAC 4U8YD 2WXMA 3FWVA 4K5BA 1N4SA 4QQIA 1LF8A 3ML9A 3FUKA 3ONLA 2IO2C 4G23A 4HRLA 5EDSA 4APOA 3NOCD 2LAHA 5BXOA 4LNUD 2QC9A 3D9JA 4WAFA 4YVQC 5G05C 1DCQA 4UQZA 5D66A 5CEAA 3GZ1A 2UWJG 3FUHA 3UUXA 4IN3B 2C0LA 2WXPA 4UWGA 4LSZE 2A5UA 4EZLA 4AXHA 1FVFA 2ZU6B 2AW6A 4LNGA 1TN7A 2GW1A 1O5MA 3L54A 4G11A 4N5QA 4CDNA 5KNGA 1QZ2A 3ONKA 3JUIA 4BT8A 1PC2A 3ASOE 2X38A 2X3MA 5CERB 3S7DA 2DVWA 2X6KA 3B95A 3CKBA 4PS7A 5IY5E 2Y4TA 1SW6A 4KXKB 2WMNA 4Q69A 5BUZA 4CYMD 3HHMA 4C0MA 2XEHA 3NBNB 3HXBA 3U3WA 3FHEA 2XPYA 4FLBA 3T5XA 1SA5A 4NQ0A 5AJLA 3U66A 3UTMA 4UUCA 1DCEA 2MOWA 4JA9A 4WWOA 2DZNA 1MX4A 3FU0A 3ZRHA 3UI2A 5ENQD 4DUIA 3FH5A 3CV0A 4DX6D 1Y8MA 3MKQA 2VGXA 1TN6A 4RG6A 4ANXA 2P9IG 3LJ3A 3QKYA 5HRYA 5CEDB 3SFZA 4XI9A 3SFYA 2QFCA 3E4BA 3S7FA 4A63B 2H6FA 1O1TA 3DPDA 4N5CA 4U0UA 3CVQA 4NURA 1B89A 3T8MA 5G04J 4UI9C 2VTBA 4ANVA 3SO8A 3QARA 3NB2A 3AU4A 2OEVA 4ABNA 4GMRA 3TWVA 4DK5A 4I9CA 2IOSA 4Y6CA 1YA0A 3RSEG 2VSOE 2IU1A 2BKGA 2WXQA 3TWXA 3QDNA 1AWCB 3L82A 1IHGA 2OEWA 3LY7A 4ACLA 1N52A 5AQ7A 2I9CA 2XHEA 4HI9A 3AS5A 2ONDA 1N9AA 3CEQA 3RK6A 5FWQA 3PUJA 1FCHA 4LCTA 2WQHA 4K5CA 4O60A 2F8XK 3MJWA 5FQ8A 4CZ2D 3G2WA 3C3RA 4A1GA 3HDXA 3O48A 4A55A 1K1AA 5BPPA 1OWNA 2KCKA 1HG5A 1V54E 4B8AA 5ANRA 2PQRA 3CQCB 4NRHB 5ANLA 5ARFA 5JA4D 3QWPA 4YDWA 2XQ0A 2CHZA 3FTXA 3U4TA 4EECA 4I1AA 2B0OE 1OWOA 4KMOA 1MZCA 2EIJE 5HKPA 4MRUA 1H0AA 3DSSA 5JJTA 3E37A 4JVSA 3DEOA 1ZU2A 3B7BA 2EINE 4U07A 3L16A 4GZDA 4GYWA 5ARGA 4JHKA 2EQXA 4CGVA 3P1UA 4HFGA 3Q9NC 4GU5A 1UW4B 1KZOA 5EILA 2L0TB 1QBQA 4FHJA 2IONA 3PZDA 2XGMA 5FZRA 1IKND 3GZSA 4P29A 4GAAA 1K3ZD 2XZTG 3FU6A 4CT0A 2QY7A 5BT1A 3TWUA 1N94A 1MX2A 3CK8A 3UM3A 1N54A 1Z6TA 1NA0A 2GRMA 2XCCA 4EHMA 1DNPA 5AENA 4APFA 5G55A 2WB2A 4DPRA 1TNYA 2IQCA 2WXFA 1E90A 5LP0A 2DYRE 1QYMA 3PUKA 4BFRA 2A5EA 4L1BA 2J4BA 3PNTB 1G3NB 3C72A 4OYSA 3PDNA 3P2BA 1H6OA 4WWPA 2DIWA 4I6EA 4U8HA 1HZ4A 2NXPA 3ZXPA 1SQMA 3IV0A 2DBAA 2YINA 1QNFA 4JA7A 3G2VA 2IY0C 3R9MA 4F3VA 3GW4A 1Y6IA 4K03A 3AG4E 4HOSA 3E34A 1E8ZA 5FQ4A 4DRXE 3ZIMA 2XCBA 1PY1A 4BX9A 4I2WA 3RRMB 3FUJA 3TAXA 5J90A 4ZHBA 2PQNA 4GTOA 2VGYA 4B0ZA 4HRMB 3TG5A 3OXFA 4FC8A 2OVBA 3T8KA 2WXKA 2RFMA 3KD7A 1TNBA 4A1SA 2GRPB 4KYOB 4ANWA 3SY2A 3PZ3A 4F7AA 3DEPA 3WG7E 3I4GA 2E0IA 1INZA 5ENOD 3FU3A 2L6JA 1L5JA 3CVUA 3HIZA 2CFZA 2WXIA 1DVPA 2RD0A 3S2AA 3C5RA 1O1SA 1S0PA 5LCWJ 4U04A 2OV8A 5CHEE 3SZ7A 3HG0D 1IXVA 3FTZA 1EDUA 4GMJA 5DBKA 1RZ4A 3L6AA 3SNXA 1NL4A 3IHYA 3L08A 3TG4A 4FLHA 1X81A 3TWQA 3MCXA 3NZSA 3FUDA 4GA0A 1U3DA 3URZA 2BEDA 3QK0A 2OCCE 2UY1B 2Y4UA 1Z5SC 3FTSA 2VTBB 4F53A 2XPIA 3FTWA 4XI0A 4AVXA 4G8LA 1S70B 4XIFA 3HYMB 5FZSA 4UI9K 4BTBA 3EHQA 4ACKA 3ZGQA 3LCAA 5FTPA 1X5BA 2R02A 3U9WA 4FADA 1YCSB 2B6CA 3EDTB 2L0IA 5AYWD 5HS0A 4GZ3A 2CHWA 4OVVA 3UKRG 4JZYA 4L9PA 4BSXA 3SBTB 2FF4A 5CRVA 2H6HA 2VSYA 1FT2A 2XENA 2XEVA 2LXLA 5M72A 2DYSE 3HRAA 1A5EA 2BKKB 3J5PA 4HBDA 3EHMA 4BETA 3APFA 3ASDA 1WY6A 4AY6A 5KCMA 5CBOA 2OOEA 5LX8A 3QWVA 1KZPA 3CHRA 1BI7B 3ZHEA 1MQSA 2L9BA 4K0RA 4U0SA 3SF4A 2P58C 3APCA 3FEXA 4U96D 3V79K 4HOTA 3B13A 2EIME 5HQ8A 4R7LA 3PZ1A 2MHKA 4J0UA 4FU3A 3FUNA 3SGHA 3ZEFA 2P2CP 4BT9A 5J08A 2ZISA 1V55E 4HB5A 3UIOC 2P9LG 3OAWA 1SZAA 1KLXA 5EYPF 5T8IA 3TWWA 4DX5D 4I1MA 4LRZA 1ZBPA 1WAO1 3MX3A 4DX2A 3ASHA 5JMND 4JHRA 1HF8A 4BERA 2LNIA 5FT9A 2HYZA
chains in the Genus database with same CATH topology
2WM9A 2HO1A 2I9CA 2XHEA 3IEGA 4KT6B 3AS5A 2ONDA 2JLBA 3CEQA 4BWRA 2CFUA 3RK6A 5FWQA 3TXNA 3PUJA 1FCHA 4U63A 4LCTA 5E76A 5BNWA 3LEWA 3RU0A 1P5QA 3I4RB 2AXZA 3CHSA 2WQHA 3TJPA 4CEMA 5CMWA 4HORA 2WXRA 3UT8A 2ILRA 5FQ7A 3MJWA 5FQ8A 4ILGA 4AV7A 4E85A 2XPZA 3N71A 4WWNA 3G2WA 2GRLA 4A1GA 2X6FA 2I6HA 3UT4A 3HDXA 3O48A 4DLOA 4A55A 2BTDA 1OWLA 3OXLA 4AY5A 4HXIA 4GB9A 4DJAA 2JEKA 3G2TA 4XX5A 3CK9A 5BPPA 2V4LA 4HVBA 4JEHA 1OWNA 4WNEA 2KCKA 3CR3A 1HG5A 1H2TC 2VSNA 1Z3YA 4DI3A 3UMVA 1JPLA 4L2YA 3JYSA 4HOQA 4B8AA 5ANRA 3LY9A 3QAQA 3D9NA 4DLQA 5JHAA 2PQRA 2BF0X 2WPVA 3CKCA 3CQCB 4B89A 4NRHB 3KS2A 3S7JA 3ESKA 4Q94A 4U0ZA 4F1SA 5ANLA 1NA3A 2C0MA 5G2NA 4FJYA 2VSXE 3LVQE 4TRQA 2NC9A 5ARFA 4AEZC 3D9PA 4B94A 3QWPA 3RO3A 3Q5MA 2Y3AA 1HG2A 2XQ0A 4J8SA 2FULA 2CHZA 4FP7A 5FQ6A 2YHCA 2LO6A 3CVNA 3FTXA 1H2UA 3U4TA 4EECA 1IQRA 4CT4A 1E8XA 1XGWA 4I1AA 4LERA 4EZJA 4MS6A 5BV1A 1OWOA 1KT1A 3VTYA 4QFVA 2E2EA 2YHEA 4KMOA 3PE3A 2IF4A 1OWMA 3RIBA 3CQGB 3LXUX 4W9RA 4YVOA 4MRUA 1H0AA 5JJTA 4IRUA 2FEZA 1A17A 2WXOA 2KC7A 3CHQA 3FDHA 4JVSA 3FTYA 3EIJA 4FHKA 1ZU2A 4IULA 4KZ0A 4CDMA 3Q15A 4IYPA 4U07A 3L16A 4GZDA 3ZHEB 4GYWA 5ARGA 3Q47B 4N2SA 4JHKA 2EQXA 4CGVA 3O4ZA 3P1UA 4HFGA 4GU5A 4J8DA 1UW4B 2L0TB 2AXVA 1TJFA 1U3CA 4FHJA 3AS4A 2IONA 2WQ6A 1VDYA 2J4DA 3ASFA 1HH8A 3CVVA 2PL2A 3S7BA 3PZDA 4I6GA 2AWIA 2XGMA 5FZRA 3GZSA 3C98A 4JPSA 3PNLB 4GAAA 4NACA 3MKRA 4P29A 1UG3A 3LYAA 5EKQD 2PM6A 3LY8A 3FTVA 3FU6A 4G25A 4CT0A 1EF1C 4J8EA 2QY7A 2R17C 3G2UA 2WXLA 3I3NA 4G2VA 4LEUA 5BT1A 4RSYA 1JWFA 3VTXA 1NP7A 4DI4A 3EIQC 3D9OA 2WXHA 4MLPA 2BUGA 1E8WA 3NF1A 5D0QD 4EBAG 3ZYMA 3CK8A 1N54A 1Z6TA 1NA0A 2GRMA 2XCCA 4WNDA 5JHBA 1DNPA 5AENA 5JJ7A 4GZ5A 5G55A 3FFLA 5T3RA 4APFA 4EQFA 4GYOA 3G2SA 2WB2A 3CHOA 3ENEA 4PH4B 2VYIA 3HVEA 4DPRA 5KJKA 2C2LA 4UWLA 3OTNA 5D0OD 3ZN3A 4BY6A 1WM5A 1QQEA 4L7TA 5CMYA 4FA6A 4C9BB 1ELWA 3UT7A 2IQCA 2WMOA 4GZCA 2WXFA 3MV3B 3QNKA 3UPVA 1E90A 3ML8A 3K9IA 3PEUB 3I5PA 5AIJA 4N2QA 4HS2A 4ANUA 5LP0A 2XGOA 4H7XA 4I1OB 3MYVA 4M3OA 5T4YA 5AJDA 3PUKA 4A3VA 4AM9A 3JCKC 3SI5A 4BFRA 3LKUA 2HM8A 2R59A 3VLFA 2J9QA 3SHFA 4L1BA 2VGXB 2J4BA 4GPKA 3PNTB 3CVYA 4V3IA 3WXXA 3CHMA 1ELRA 4OYSA 3GZ2A 3PDNA 3P2BA 4WWPA 4J8FA 3CVWA 2DIWA 3AS8A 3JQ1A 3NZUA 4UI9J 3ULQA 4I6EA 5A6CA 2WXNA 4U8HA 3Q4AB 3CLJA 3EJNA 4JEUA 1HZ4A 2X6JA 2NXPA 5E75A 3ZFWA 1SQMA 3R7RA 3IV0A 2DBAA 2PZIA 2WXGA 4LUNU 2YINA 1QNFA 4JA7A 4BX8A 2KCLA 5EX3A 3G2VA 3PVLA 3RO2A 3ZYKA 5A7DB 4KVMA 4J6IA 2I1JA 4RVBA 3LPZA 5LOZA 3GW4A 4F3VA 3AU5A 4ILHB 3FEYA 4RG9A 1Y6IA 1H2VC 4K03A 3GYZA 4GMLA 4HOSA 3FULA 4JXTA 1E8ZA 5FQ4A 3FUIA 3BG1B 3QWWA 4Q96A 2M63A 2X6IA 3ZIMA 2XCBA 4GZ6A 5G05J 1PY1A 4BX9A 3MKQB 5BV0A 2KATA 3RRUA 3ESLA 1UN8A 3PEVB 4I2WA 3RRMB 3Q49B 2YQ8A 3FUJA 3SD5A 3CHPA 3TAXA 5J90A 4ILIA 3ASGA 2NSZA 1IQUA 3SBSA 2PQNA 4GA2A 4N3AA 3APDA 4XE0A 2LSVA 4AJWA 4E6HA 1HXIA 2VGYA 3JQ0A 3FH8A 3L17A 3QOUA 4TV3A 3R9AB 1UN9A 5FZQA 3CIAA 4B0ZA 5C2YA 3PREA 4JHJA 3OXFA 4ME2A 3TG5A 3OXGA 3LS8A 4AP2A 4BTAA 2DCPA 5C1DA 5LCWC 4FC8A 1E7UA 4CDRA 2OVBA 4EPZA 4WUYA 3D9LA 4KZCA 3QJZA 4H7YA 2CG3A 2J07A 1E8YA 2WXKA 4UQXA 3TGOA 3KD7A 1KT0A 4XKBA 4FULA 4D10C 1H19A 3FUEA 4A1SA 4JW1A 4MKTA 3B7UX 2WQ7A 3FU5A 4KYOB 4UWKA 3D9KA 4ANWA 3FH7A 3HVEB 3ZYQA 4F7AA 3FY4A 2XRZA 1HFAA 4I9EA 1BPOA 3I4GA 4EZKA 1TJCA 3KAEA 2CG2A 2E0IA 2J49A 1UJJA 1NZNA 2FBNA 1INZA 3ZW3A 3CVXA 3BEEA 3FU3A 4UWHA 4ATGA 2L6JA 1L5JA 2YNQA 3VLDA 3CVUA 3HIZA 1SZ9A 1UJKA 3CK7A 4HLEA 2CFZA 2WXIA 2KM4A 1DVPA 4AIFA 2RD0A 4UQYA 3S2AA 5HI7A 2WXMA 3FTUA 3T5VA 1S0PA 2GGFA 5LCWJ 1JWGA 4U04A 3FWVA 5ENNA 3D9MA 2OV8A 5CHEE 5G04C 5KJNA 4AOFA 3SZ7A 4PS3A 3LVRE 3FTZA 2PM7A 1EDUA 2AXUA 2LSUA 4GMJA 2MRIA 4I17A 5DBKA 1LF8A 4PUCA 3L6AA 3ML9A 3FUKA 3ONLA 3SNXA 3MA5A 3IHYA 3IHVA 3ZYLA 3PRZA 3L08A 3TG4A 3L22A 4FLHA 1HU3A 3FUMA 4G23A 4G26A 5EDSA 4APOA 4CGWA 3D3MA 2LAHA 5A23A 3MCXA 3NZSA 3IKOB 3RRNB 2XGSA 1FVHA 3FUDA 4GA0A 4L2LA 3D9JA 4WAFA 4YVQC 1U3DA 2LAIA 1HX8A 3URZA 5G05C 1IYGA 1OWPA 3QK0A 4UQZA 3GZ1A 2UWJG 4XZ4A 3FUHA 3UUXA 2UY1B 1H6KA 2Y4UA 4IN3B 4G24A 3FUFA 2C0LA 3FTSA 2V0PA 3CGHA 2WXPA 3ZPJA 4UWGA 3CSTA 3R7QA 4F53A 2VTBB 2A5UA 2XPIA 1EYHA 3FTWA 4XI0A 4AVXA 4EZLA 4CCAA 4AXHA 3L13A 1FVFA 3EHNA 2ZU6B 5EX0A 4XIFA 2AW6A 3HYMB 3MEKA 2GW1A 2KZTB 2Q7FA 5FZSA 1EPUA 3L54A 4G11A 4UI9K 1HE8A 4BTBA 4CDNA 2I2OA 3B7TA 1QZ2A 3ONKA 4ACKA 3VLEA 3JUIA 4GCOA 1PC2A 4TUUA 2X38A 5JJ6A 3LCAA 3ZGQA 5FTPA 4BT8A 1X5BA 4KBQA 2X3MA 3U9WA 4FADA 5KJMA 3S7DA 2X6KA 4KVOA 3RKVA 4URKA 4GCNA 3EDTB 3CKBA 1HS6A 2WVIA 4PS7A 4O6FA 2L0IA 4OVUA 4WNFA 2Y4TA 4I2ZA 4KXKB 5AYWD 2WMNA 2XRYA 4Q69A 5BUZA 1PAQA 4C0EA 2I1KA 3HHMA 1E7VA 4C0MA 4GZ3A 2CHWA 4OVVA 1HO8A 3LDZA 3FP3A 4N3BA 3U3WA 3IBEA 3FHEA 1JUQA 4PDXA 2XPYA 4FLBA 4JZYA 2VQ2A 3T5XA 3TXMA 4BSXA 1W3BA 3SBTB 4NQ0A 2FF4A 5AJLA 4GYYA 3U66A 4Y6WA 2VSYA 2MOWA 2AVPA 4JA9A 3PH0C 4WWOA 1MHQA 2RG8A 3NQPA 3KEZA 3U64A 3BG0B 2FO7A 2XEVA 2R5SA 3FU0A 5M72A 4EBAA 5KJLA 2J08A 5CCMA 2VJ8A 3ZRHA 3CSFA 3EHMA 3TL5A 3ZVVA 3FH5A 3APFA 3CV0A 3ASDA 1WY6A 1Y8MA 3MKQA 4AY6A 2UY1A 5KCMA 2VGXA 4JL0A 2OOEA 3PS6A 4RG6A 4ANXA 3LJ3A 3QWVA 3QKYA 4I43A 2KCVA 4FJZA 5LX8A 4HOUA 3SFZA 4XI9A 3CHRA 4GA1A 2QFCA 4N39A 3ZHEA 1MQSA 2L9BA 4K0RA 4U0SA 3E4BA 2OVFA 2P58C 3S7FA 3SF4A 3APCA 2X6HA 4XKCA 3FEXA 2FI7A 2J09A 4HOTA 3DPDA 1XNFA 2V5FA 3B13A 3CVLA 2CHXA 3CVQA 4N5CA 4NURA 4U0UA 1B89A 3T8MA 1ELKA 3RJVA 5HQ8A 4UWFA 5G04J 2IOLA 3MV2B 3QC1A 4UI9C 5LFAA 3MGBA 4L23A 4I6JA 4R7LA 5CCLA 5DIZA 4N3CA 3D9IA 4J0UA 2MHKA 4WNGA 1E96B 4FU3A 3FUNA 4ANVA 2VTBA 3QARA 3SGHA 3ZEFA 3MZLB 3QB2A 4JC8A 2IFUA 4PS8A 2A4ZA 3AU4A 4A3TA 5BW8C 4BT9A 5J08A 1TEZA 5FJYA 1GW6A 4ABNA 4YNDA 4DK5A 4I9CA 2WXJA 2IJGX 3DBSA 3OAWA 3CVPA 1SZAA 1KLXA 5T8IA 2IOSA 4Y6CA 1YA0A 3B7RL 3PE4A 4CRWA 2VSOE 1OUVA 2IU1A 4I1MA 4LRZA 2WXQA 3ZXSA 1ZBPA 2V8SE 1WAO1 3MX3A 1Z3XA 2HR2A 3ASHA 3B7SA 4JHRA 3UQ3A 3QDNA 1HF8A 1IHGA 3LY7A 2LNIA 4ACLA 4B8CB 2KZTA 5FT9A 3UX4A 4G1TA 2HYZA 1N52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLJ A;  3ZYL A;  2L0T B;  1SZ9 A;  3ZYM A;  1HG5 A;  1UJK A;  5LP0 A;  2KM4 A;  1DVP A;  1VDY A;  1INZ A;  1JPL A;  3LDZ A;  4HFG A;  3ONK A;  1SZA A;  3D9N A;  3G2V A;  3ZYK A;  1JUQ A;  1H0A A;  2BF0 X;  5CMW A;  3G2S A;  4FLB A;  1X5B A;  1ELK A;  4Q94 A;  5LOZ A;  3D9J A;  4NAC A;  3D9K A;  1JWG A;  1HX8 A;  2V8S E;  3D9M A;  3D9I A;  3D9P A;  3G2W A;  1HF8 A;  4JXT A;  3ZYQ A;  4FU3 A;  1EDU A;  1HG2 A;  1HFA A;  2MOW A;  5CMY A;  2L0I A;  2QY7 A;  3G2U A;  4GZD A;  4Q96 A;  2LO6 A;  1JWF A;  1LF8 A;  1MHQ A;  1EYH A;  1PY1 A;  2DCP A;  1UJJ A;  2DIW A;  1XGW A;  3ONL A;  3D9O A;  4GZC A;  3RRU A;  4AVX A;  3D9L A;  3G2T A;  5J08 A; 
#chains in the Genus database with same CATH topology
 2HO1 A;  1OCO E;  3BUA A;  4BWR A;  1BLX B;  5E76 A;  5BNW A;  3LEW A;  3TJP A;  2AXZ A;  4CEM A;  2WXR A;  3UT8 A;  2ILR A;  4ILG A;  2XPZ A;  4WWN A;  2GRL A;  2XS8 A;  2X6F A;  3UT4 A;  4O1P A;  4DLO A;  3OXL A;  4GB9 A;  2JEK A;  3G2T A;  4XX5 A;  1SA4 A;  3CK9 A;  4HVB A;  4JEH A;  4WNE A;  3CR3 A;  2VSN A;  1Z3Y A;  3JYS A;  3D9N A;  3DSV A;  2BF0 X;  2WPV A;  2EIL E;  4B89 A;  4F1S A;  4Q94 A;  1NA3 A;  5G2N A;  4AEZ C;  3AG2 E;  3Q5M A;  2Y3A A;  4J8S A;  2FUL A;  4FP7 A;  1H2U A;  1IQR A;  4MS6 A;  5BV1 A;  1KT1 A;  3VTY A;  4YDY A;  2R2L A;  3CQG B;  3LXU X;  4W9R A;  1D8E A;  4IRU A;  1A17 A;  2WXO A;  2KC7 A;  3CHQ A;  3EIJ A;  1FT1 A;  4CDM A;  4IYP A;  3O4Z A;  4J8D A;  1FPP A;  3ASF A;  3EUV A;  4I6G A;  2AWI A;  5EYL A;  4OAU C;  3C98 A;  4GTS A;  4NAC A;  3FTV A;  4J8E A;  2R17 C;  3ABK E;  4LEU A;  1JWF A;  2DWZ A;  2BUG A;  3NF1 A;  4F1P A;  1N0R A;  5JHB A;  5JJ7 A;  3ULE G;  5T3R A;  3G2S A;  4PH4 B;  3ENE A;  2VYI A;  1OXJ A;  3UM1 A;  2C2L A;  5D0O D;  1K1B A;  4FA6 A;  1MYO A;  3E33 A;  2HE0 A;  2F0Y A;  3MV3 B;  3QNK A;  3UPV A;  3ML8 A;  1AP7 A;  4H7X A;  4GTR A;  5T4Y A;  3LKU A;  1LTX A;  2R59 A;  4GPK A;  3CVY A;  3Q7F A;  3HXD A;  1ELR A;  4UI9 J;  2LUH A;  3EJN A;  2X6J A;  1IHB A;  4HRN A;  3R7R A;  2PZI A;  1N95 A;  2KCL A;  2V5Q C;  4BSZ B;  4J6I A;  4RVB A;  3FEY A;  1H2V C;  4F6R D;  4JXT A;  2R05 A;  3FUI A;  3QWW A;  2M63 A;  2X6I A;  4HI8 A;  4GZ6 A;  5BV0 A;  4ZFH A;  3RRU A;  3Q49 B;  2YQ8 A;  3SD5 A;  1D8D A;  1IQU A;  1Q2Z A;  4GA2 A;  5B1A E;  1HXI A;  1UN9 A;  5FZQ A;  2ETB A;  4JHJ A;  3Q78 A;  3OXG A;  3E30 A;  4AP2 A;  4BTA A;  2DCP A;  5ENS D;  4BES A;  5LCW C;  3D9L A;  2J07 A;  1E8Y A;  4UQX A;  3TGO A;  4D10 C;  1NFI E;  3D9K A;  3ZNG A;  4DX7 D;  3Q75 A;  3FH7 A;  3ZYQ A;  4I9E A;  4EZK A;  2FBN A;  3BEE A;  3VLD A;  1SZ9 A;  4HLE A;  2KM4 A;  4AIF A;  4UQY A;  4ATZ D;  1N4P A;  2GGF A;  1BI8 B;  1JWG A;  5G04 C;  2GRQ B;  5ENP D;  5ENN A;  5AQA A;  2VGE A;  4PS3 A;  3LVR E;  2PM7 A;  2AXU A;  2LSU A;  2MRI A;  4I17 A;  2KBX A;  5KNH D;  4PUC A;  3MA5 A;  3L22 A;  1HU3 A;  4G26 A;  4O1O A;  4CGW A;  1N11 A;  3E32 A;  2LAI A;  1IYG A;  1OWP A;  2IO3 C;  4NIK A;  4XZ4 A;  2GRR B;  4G24 A;  3FUF A;  2V0P A;  2IEJ A;  2XEE A;  3EHN A;  5AN8 A;  5EX0 A;  2ETA A;  1TNU A;  2KZT B;  2Q7F A;  3HXC A;  2V4H C;  3B7T A;  3ZUV B;  3VLE A;  4TUU A;  5JJ6 A;  1TNO A;  3KEA A;  3C3O A;  5KWD A;  1MJ0 A;  4HNA D;  4URK A;  4GCN A;  2WVI A;  3V31 A;  5FIO A;  4I2Z A;  4C0E A;  2RFA A;  1HO8 A;  3KSL A;  3LDZ A;  3IBE A;  4U7E B;  1JUQ A;  2VQ2 A;  3DSX A;  1W3B A;  3UXG A;  4Y6W A;  3PH0 C;  1MHQ A;  3KEZ A;  3U64 A;  5KJL A;  4BEP A;  5CCM A;  3ZU7 B;  2VJ8 A;  4LG6 A;  2P9U G;  2LXM A;  4JD2 G;  3TL5 A;  3ULY A;  5FIN A;  1WDY A;  2Y1L E;  4JL0 A;  3PS6 A;  4HOU A;  4GA1 A;  5CBN A;  1TR4 A;  2X6H A;  3PZ2 A;  4XKC A;  2J09 A;  2V5F A;  3CVL A;  3V30 A;  3RJV A;  2AJA A;  1OCC E;  3MGB A;  5CCL A;  5DIZ A;  4N3C A;  3D9I A;  4WNG A;  1E96 B;  3Q9U C;  4X8Q A;  3ZKJ A;  4PS8 A;  4A3T A;  1TEZ A;  1KPS B;  3HXF A;  1GW6 A;  2WXJ A;  5EN5 D;  2GRO B;  3PE4 A;  3B7R L;  4CRW A;  3V2O A;  1Z3X A;  3UM2 A;  2DZO A;  4G1T A;  4M7C A;  4J8Y A;  4KT6 B;  2JLB A;  2QYJ A;  2CFU A;  3TXN A;  3HXE A;  1P5Q A;  3I4R B;  5CMW A;  1SVX A;  4E85 A;  3N71 A;  2ZGD A;  3F6Q A;  2I6H A;  2P9K G;  2BTD A;  3W9F A;  3JXI A;  5CRU A;  1H2T C;  3ISM C;  1JPL A;  3LY9 A;  3QAQ A;  5JHA A;  3KS2 A;  3ESK A;  4U0Z A;  2C0M A;  2VSX E;  3LVQ E;  4TRQ A;  2NC9 A;  3D9P A;  4B94 A;  1HG2 A;  2P9S G;  5FQ6 A;  1OT8 A;  1E8X A;  1YYH A;  4LER A;  4EZJ A;  1BU9 A;  1N4R A;  4QFV A;  2E2E A;  2YHE A;  1LD7 A;  1OWM A;  3RIB A;  1N4Q A;  4YVO A;  2FEZ A;  3LJN A;  1BD8 A;  4KZ0 A;  3Q15 A;  4N2S A;  1ZB1 A;  2AXV A;  3AS4 A;  2WQ6 A;  2J4D A;  2PL2 A;  2H6I A;  2XS1 A;  4JPS A;  3PNL B;  1UG3 A;  2RKK A;  3LYA A;  3LY8 A;  3I3N A;  4RSY A;  4XEI G;  1MX6 A;  3EIQ C;  1OCR E;  2WXH A;  4MLP A;  2ZGG A;  1E8W A;  3ZYM A;  4EQF A;  4GYO A;  3DXM G;  3HVE A;  4GTM A;  3ZN3 A;  4RQI A;  5CMY A;  4C9B B;  4GZC A;  4GTV A;  3K9I A;  5AIJ A;  4N2Q A;  4ANU A;  4I1O B;  3MYV A;  4A3V A;  5AJD A;  3SI5 A;  5B3S E;  3VLF A;  1JCR A;  2VGX B;  3EU5 A;  1OCZ E;  3GZ2 A;  4J8F A;  3DST A;  3EHR A;  3CVW A;  5A6C A;  3JQ1 A;  3UIP C;  2H6G A;  3CLJ A;  5E75 A;  2WXG A;  4LUN U;  4BX8 A;  5EX3 A;  2P9N G;  3RO2 A;  4KVM A;  3LPZ A;  3JXJ A;  3AU5 A;  4RG9 A;  3GYZ A;  3FUL A;  4K5A B;  3ASN E;  3BG1 B;  4Z68 A;  3MKQ B;  2KAT A;  1JCS A;  3ESL A;  3PEV B;  4MBG A;  3CHP A;  3ASG A;  2NSZ A;  4OAV B;  5B1B E;  3SBS A;  2NYJ A;  1K8K G;  3APD A;  5KBA A;  3UIN C;  4XE0 A;  2LSV A;  4AJW A;  4E6H A;  3JQ0 A;  3FH8 A;  3R9A B;  3CIA A;  4ME2 A;  3LS8 A;  2Y0B G;  5C1D A;  1E7U A;  4EPZ A;  3QJZ A;  3EU9 A;  2CG3 A;  1H19 A;  3FUE A;  4JW1 A;  5BXU A;  3B7U X;  2WQ7 A;  3FU5 A;  2QZA A;  4UWK A;  3PZ4 A;  3HVE B;  3FY4 A;  1HFA A;  4C48 B;  1TJC A;  5ENT D;  1UJJ A;  1NZN A;  3DRA A;  4UWH A;  4ATG A;  2FO1 E;  1D9S A;  2YNQ A;  3CK7 A;  2L6B A;  5HI7 A;  3FTU A;  3T5V A;  5KJN A;  3D9M A;  4AOF A;  4DX1 A;  3ABL E;  5ITZ F;  4HQD A;  3RAU A;  3IHV A;  2PNN A;  3ZYL A;  3PRZ A;  3FUM A;  1TYQ G;  3D3M A;  5A23 A;  3BU8 A;  3IKO B;  3RRN B;  2XGS A;  1FVH A;  1O1R A;  4L2L A;  5EIB E;  4U95 D;  1HX8 A;  1H6K A;  3CGH A;  3ZPJ A;  3R7Q A;  3CST A;  1JCQ A;  4TXQ A;  1EYH A;  3D9H A;  4CCA A;  3L13 A;  3MEK A;  3TWS A;  1EPU A;  1HE8 A;  2I2O A;  4TXP A;  4GCO A;  3UKU G;  4KBQ A;  5KJM A;  3DXK G;  4KVO A;  3RKV A;  1HS6 A;  4O6F A;  4WNF A;  4OVU A;  4U8V D;  5EID A;  2XRY A;  1PAQ A;  2ETC A;  2I1K A;  1E7V A;  4N3B A;  3FP3 A;  4PDX A;  3TXM A;  4GYY A;  2F37 A;  2AVP A;  4TXR A;  2RG8 A;  3NQP A;  1UOH A;  3BG0 B;  2FO7 A;  2R5S A;  2Y69 E;  4EBA A;  2J08 A;  3CSF A;  3ZVV A;  2UY1 A;  4I43 A;  2KCV A;  4FJZ A;  4YDE A;  4N39 A;  3Q79 A;  2OVF A;  2JAB A;  2ZIR A;  3TWR A;  2ZXW E;  5AQB A;  2FI7 A;  1XNF A;  2CHX A;  1ELK A;  5LFA A;  4UWF A;  2IOL A;  3MV2 B;  3QC1 A;  3SQV A;  4L23 A;  4I6J A;  4GTQ A;  3C3Q A;  4LNB A;  3MZL B;  3QB2 A;  1N0Q A;  2IFU A;  4JC8 A;  2A4Z A;  5BW8 C;  3X2Q E;  5FJY A;  4YND A;  2IJG X;  3DBS A;  3KSQ A;  1H6P A;  3CVP A;  1OUV A;  3W9G A;  3ZXS A;  2V8S E;  1YMP A;  2HR2 A;  3B7S A;  3UQ3 A;  4RLY A;  5AQ9 A;  4B8C B;  2KZT A;  2EIK E;  3UX4 A;  3DPY A;  3DSU A;  3UT7 A;  2WM9 A;  3IEG A;  5AAO A;  2QYU A;  4U63 A;  3AJI A;  3RU0 A;  2R03 A;  3CHS A;  4HOR A;  5FQ7 A;  4AV7 A;  3V2X A;  3Q73 A;  3JUE A;  1OWL A;  4AY5 A;  4HXI A;  4DJA A;  5D2M C;  2V4L A;  3TWT A;  4DI3 A;  3UMV A;  4L2Y A;  4HOQ A;  4DLQ A;  3CKC A;  5AAR A;  3S7J A;  4FJY A;  3RO3 A;  2YHC A;  2LO6 A;  3CVN A;  4CT4 A;  1XGW A;  3UM0 A;  5ENR D;  3PE3 A;  2IF4 A;  3AG3 E;  2J8S D;  3FDH A;  3FTY A;  4FHK A;  4IUL A;  3ZHE B;  3Q47 B;  3DSW A;  4JB8 P;  3DWL G;  1TJF A;  1U3C A;  1VDY A;  3SFX A;  1HH8 A;  2P9P G;  3CVV A;  3S7B A;  3MKR A;  3Q7A A;  5EKQ D;  2PM6 A;  4G25 A;  1EF1 C;  3G2U A;  3NAW A;  4G2V A;  2WXL A;  4GTP A;  3VTX A;  1NP7 A;  4DI4 A;  3D9O A;  4B93 B;  5D0Q D;  4EBA G;  4WND A;  4GZ5 A;  3FFL A;  3CHO A;  5KJK A;  4UWL A;  1S63 A;  3OTN A;  2GRN B;  4BY6 A;  1WM5 A;  3J5Q B;  1QQE A;  4HLL A;  4L7T A;  1ELW A;  2WMO A;  3PEU B;  3I5P A;  4HS2 A;  2XGO A;  4J7W A;  4M3O A;  4TUM A;  1WG0 A;  4AM9 A;  3JCK C;  3NOG D;  2HM8 A;  2XZD G;  2J9Q A;  3SHF A;  1NI1 A;  4V3I A;  1TNZ A;  3WXX A;  3CHM A;  3AS8 A;  3NZU A;  4G8K A;  3ULQ A;  2WXN A;  3Q4A B;  4JEU A;  3ZFW A;  3PVL A;  1S64 A;  3ZYK A;  5A7D B;  2I1J A;  5LOZ A;  4ILH B;  1TN8 A;  4GML A;  5CEC B;  4Q96 A;  5G05 J;  1DC2 A;  1UN8 A;  4ILI A;  3T9K A;  2KXP C;  4N3A A;  3ABM E;  1U2V G;  1LD8 A;  3QOU A;  3L17 A;  4TV3 A;  5C2Y A;  3PRE A;  3L9T A;  4CDR A;  4WUY A;  4KZC A;  4H7Y A;  4GPM A;  1KT0 A;  4XKB A;  4FUL A;  4MKT A;  3BQO A;  5H7P A;  2MYO A;  4GTT A;  3IXE A;  2XRZ A;  1BPO A;  1OY3 D;  3KAE A;  2CG2 A;  2J49 A;  3ZW3 A;  3CVX A;  2F8Y A;  1UJK A;  1RW2 A;  4YDO A;  3AG1 E;  3AAA C;  4U8Y D;  2WXM A;  3FWV A;  4K5B A;  1N4S A;  4QQI A;  1LF8 A;  3ML9 A;  3FUK A;  3ONL A;  2IO2 C;  4G23 A;  4HRL A;  5EDS A;  4APO A;  3NOC D;  2LAH A;  5BXO A;  4LNU D;  2QC9 A;  3D9J A;  4WAF A;  4YVQ C;  5G05 C;  1DCQ A;  4UQZ A;  5D66 A;  5CEA A;  3GZ1 A;  2UWJ G;  3FUH A;  3UUX A;  4IN3 B;  2C0L A;  2WXP A;  4UWG A;  4LSZ E;  2A5U A;  4EZL A;  4AXH A;  1FVF A;  2ZU6 B;  2AW6 A;  4LNG A;  1TN7 A;  2GW1 A;  1O5M A;  3L54 A;  4G11 A;  4N5Q A;  4CDN A;  5KNG A;  1QZ2 A;  3ONK A;  3JUI A;  4BT8 A;  1PC2 A;  3ASO E;  2X38 A;  2X3M A;  5CER B;  3S7D A;  2DVW A;  2X6K A;  3B95 A;  3CKB A;  4PS7 A;  5IY5 E;  2Y4T A;  1SW6 A;  4KXK B;  2WMN A;  4Q69 A;  5BUZ A;  4CYM D;  3HHM A;  4C0M A;  2XEH A;  3NBN B;  3HXB A;  3U3W A;  3FHE A;  2XPY A;  4FLB A;  3T5X A;  1SA5 A;  4NQ0 A;  5AJL A;  3U66 A;  3UTM A;  4UUC A;  1DCE A;  2MOW A;  4JA9 A;  4WWO A;  2DZN A;  1MX4 A;  3FU0 A;  3ZRH A;  3UI2 A;  5ENQ D;  4DUI A;  3FH5 A;  3CV0 A;  4DX6 D;  1Y8M A;  3MKQ A;  2VGX A;  1TN6 A;  4RG6 A;  4ANX A;  2P9I G;  3LJ3 A;  3QKY A;  5HRY A;  5CED B;  3SFZ A;  4XI9 A;  3SFY A;  2QFC A;  3E4B A;  3S7F A;  4A63 B;  2H6F A;  1O1T A;  3DPD A;  4N5C A;  4U0U A;  3CVQ A;  4NUR A;  1B89 A;  3T8M A;  5G04 J;  4UI9 C;  2VTB A;  4ANV A;  3SO8 A;  3QAR A;  3NB2 A;  3AU4 A;  2OEV A;  4ABN A;  4GMR A;  3TWV A;  4DK5 A;  4I9C A;  2IOS A;  4Y6C A;  1YA0 A;  3RSE G;  2VSO E;  2IU1 A;  2BKG A;  2WXQ A;  3TWX A;  3QDN A;  1AWC B;  3L82 A;  1IHG A;  2OEW A;  3LY7 A;  4ACL A;  1N52 A;  5AQ7 A;  2I9C A;  2XHE A;  4HI9 A;  3AS5 A;  2OND A;  1N9A A;  3CEQ A;  3RK6 A;  5FWQ A;  3PUJ A;  1FCH A;  4LCT A;  2WQH A;  4K5C A;  4O60 A;  2F8X K;  3MJW A;  5FQ8 A;  4CZ2 D;  3G2W A;  3C3R A;  4A1G A;  3HDX A;  3O48 A;  4A55 A;  1K1A A;  5BPP A;  1OWN A;  2KCK A;  1HG5 A;  1V54 E;  4B8A A;  5ANR A;  2PQR A;  3CQC B;  4NRH B;  5ANL A;  5ARF A;  5JA4 D;  3QWP A;  4YDW A;  2XQ0 A;  2CHZ A;  3FTX A;  3U4T A;  4EEC A;  4I1A A;  2B0O E;  1OWO A;  4KMO A;  1MZC A;  2EIJ E;  5HKP A;  4MRU A;  1H0A A;  3DSS A;  5JJT A;  3E37 A;  4JVS A;  3DEO A;  1ZU2 A;  3B7B A;  2EIN E;  4U07 A;  3L16 A;  4GZD A;  4GYW A;  5ARG A;  4JHK A;  2EQX A;  4CGV A;  3P1U A;  4HFG A;  3Q9N C;  4GU5 A;  1UW4 B;  1KZO A;  5EIL A;  2L0T B;  1QBQ A;  4FHJ A;  2ION A;  3PZD A;  2XGM A;  5FZR A;  1IKN D;  3GZS A;  4P29 A;  4GAA A;  1K3Z D;  2XZT G;  3FU6 A;  4CT0 A;  2QY7 A;  5BT1 A;  3TWU A;  1N94 A;  1MX2 A;  3CK8 A;  3UM3 A;  1N54 A;  1Z6T A;  1NA0 A;  2GRM A;  2XCC A;  4EHM A;  1DNP A;  5AEN A;  4APF A;  5G55 A;  2WB2 A;  4DPR A;  1TNY A;  2IQC A;  2WXF A;  1E90 A;  5LP0 A;  2DYR E;  1QYM A;  3PUK A;  4BFR A;  2A5E A;  4L1B A;  2J4B A;  3PNT B;  1G3N B;  3C72 A;  4OYS A;  3PDN A;  3P2B A;  1H6O A;  4WWP A;  2DIW A;  4I6E A;  4U8H A;  1HZ4 A;  2NXP A;  3ZXP A;  1SQM A;  3IV0 A;  2DBA A;  2YIN A;  1QNF A;  4JA7 A;  3G2V A;  2IY0 C;  3R9M A;  4F3V A;  3GW4 A;  1Y6I A;  4K03 A;  3AG4 E;  4HOS A;  3E34 A;  1E8Z A;  5FQ4 A;  4DRX E;  3ZIM A;  2XCB A;  1PY1 A;  4BX9 A;  4I2W A;  3RRM B;  3FUJ A;  3TAX A;  5J90 A;  4ZHB A;  2PQN A;  4GTO A;  2VGY A;  4B0Z A;  4HRM B;  3TG5 A;  3OXF A;  4FC8 A;  2OVB A;  3T8K A;  2WXK A;  2RFM A;  3KD7 A;  1TNB A;  4A1S A;  2GRP B;  4KYO B;  4ANW A;  3SY2 A;  3PZ3 A;  4F7A A;  3DEP A;  3WG7 E;  3I4G A;  2E0I A;  1INZ A;  5ENO D;  3FU3 A;  2L6J A;  1L5J A;  3CVU A;  3HIZ A;  2CFZ A;  2WXI A;  1DVP A;  2RD0 A;  3S2A A;  3C5R A;  1O1S A;  1S0P A;  5LCW J;  4U04 A;  2OV8 A;  5CHE E;  3SZ7 A;  3HG0 D;  1IXV A;  3FTZ A;  1EDU A;  4GMJ A;  5DBK A;  1RZ4 A;  3L6A A;  3SNX A;  1NL4 A;  3IHY A;  3L08 A;  3TG4 A;  4FLH A;  1X81 A;  3TWQ A;  3MCX A;  3NZS A;  3FUD A;  4GA0 A;  1U3D A;  3URZ A;  2BED A;  3QK0 A;  2OCC E;  2UY1 B;  2Y4U A;  1Z5S C;  3FTS A;  2VTB B;  4F53 A;  2XPI A;  3FTW A;  4XI0 A;  4AVX A;  4G8L A;  1S70 B;  4XIF A;  3HYM B;  5FZS A;  4UI9 K;  4BTB A;  3EHQ A;  4ACK A;  3ZGQ A;  3LCA A;  5FTP A;  1X5B A;  2R02 A;  3U9W A;  4FAD A;  1YCS B;  2B6C A;  3EDT B;  2L0I A;  5AYW D;  5HS0 A;  4GZ3 A;  2CHW A;  4OVV A;  3UKR G;  4JZY A;  4L9P A;  4BSX A;  3SBT B;  2FF4 A;  5CRV A;  2H6H A;  2VSY A;  1FT2 A;  2XEN A;  2XEV A;  2LXL A;  5M72 A;  2DYS E;  3HRA A;  1A5E A;  2BKK B;  3J5P A;  4HBD A;  3EHM A;  4BET A;  3APF A;  3ASD A;  1WY6 A;  4AY6 A;  5KCM A;  5CBO A;  2OOE A;  5LX8 A;  3QWV A;  1KZP A;  3CHR A;  1BI7 B;  3ZHE A;  1MQS A;  2L9B A;  4K0R A;  4U0S A;  3SF4 A;  2P58 C;  3APC A;  3FEX A;  4U96 D;  3V79 K;  4HOT A;  3B13 A;  2EIM E;  5HQ8 A;  4R7L A;  3PZ1 A;  2MHK A;  4J0U A;  4FU3 A;  3FUN A;  3SGH A;  3ZEF A;  2P2C P;  4BT9 A;  5J08 A;  2ZIS A;  1V55 E;  4HB5 A;  3UIO C;  2P9L G;  3OAW A;  1SZA A;  1KLX A;  5EYP F;  5T8I A;  3TWW A;  4DX5 D;  4I1M A;  4LRZ A;  1ZBP A;  1WAO 1;  3MX3 A;  4DX2 A;  3ASH A;  5JMN D;  4JHR A;  1HF8 A;  4BER A;  2LNI A;  5FT9 A;  2HYZ A; 
#chains in the Genus database with same CATH homology
 2WM9 A;  2HO1 A;  2I9C A;  2XHE A;  3IEG A;  4KT6 B;  3AS5 A;  2OND A;  2JLB A;  3CEQ A;  4BWR A;  2CFU A;  3RK6 A;  5FWQ A;  3TXN A;  3PUJ A;  1FCH A;  4U63 A;  4LCT A;  5E76 A;  5BNW A;  3LEW A;  3RU0 A;  1P5Q A;  3I4R B;  2AXZ A;  3CHS A;  2WQH A;  3TJP A;  4CEM A;  5CMW A;  4HOR A;  2WXR A;  3UT8 A;  2ILR A;  5FQ7 A;  3MJW A;  5FQ8 A;  4ILG A;  4AV7 A;  4E85 A;  2XPZ A;  3N71 A;  4WWN A;  3G2W A;  2GRL A;  4A1G A;  2X6F A;  2I6H A;  3UT4 A;  3HDX A;  3O48 A;  4DLO A;  4A55 A;  2BTD A;  1OWL A;  3OXL A;  4AY5 A;  4HXI A;  4GB9 A;  4DJA A;  2JEK A;  3G2T A;  4XX5 A;  3CK9 A;  5BPP A;  2V4L A;  4HVB A;  4JEH A;  1OWN A;  4WNE A;  2KCK A;  3CR3 A;  1HG5 A;  1H2T C;  2VSN A;  1Z3Y A;  4DI3 A;  3UMV A;  1JPL A;  4L2Y A;  3JYS A;  4HOQ A;  4B8A A;  5ANR A;  3LY9 A;  3QAQ A;  3D9N A;  4DLQ A;  5JHA A;  2PQR A;  2BF0 X;  2WPV A;  3CKC A;  3CQC B;  4B89 A;  4NRH B;  3KS2 A;  3S7J A;  3ESK A;  4Q94 A;  4U0Z A;  4F1S A;  5ANL A;  1NA3 A;  2C0M A;  5G2N A;  4FJY A;  2VSX E;  3LVQ E;  4TRQ A;  2NC9 A;  5ARF A;  4AEZ C;  3D9P A;  4B94 A;  3QWP A;  3RO3 A;  3Q5M A;  2Y3A A;  1HG2 A;  2XQ0 A;  4J8S A;  2FUL A;  2CHZ A;  4FP7 A;  5FQ6 A;  2YHC A;  2LO6 A;  3CVN A;  3FTX A;  1H2U A;  3U4T A;  4EEC A;  1IQR A;  4CT4 A;  1E8X A;  1XGW A;  4I1A A;  4LER A;  4EZJ A;  4MS6 A;  5BV1 A;  1OWO A;  1KT1 A;  3VTY A;  4QFV A;  2E2E A;  2YHE A;  4KMO A;  3PE3 A;  2IF4 A;  1OWM A;  3RIB A;  3CQG B;  3LXU X;  4W9R A;  4YVO A;  4MRU A;  1H0A A;  5JJT A;  4IRU A;  2FEZ A;  1A17 A;  2WXO A;  2KC7 A;  3CHQ A;  3FDH A;  4JVS A;  3FTY A;  3EIJ A;  4FHK A;  1ZU2 A;  4IUL A;  4KZ0 A;  4CDM A;  3Q15 A;  4IYP A;  4U07 A;  3L16 A;  4GZD A;  3ZHE B;  4GYW A;  5ARG A;  3Q47 B;  4N2S A;  4JHK A;  2EQX A;  4CGV A;  3O4Z A;  3P1U A;  4HFG A;  4GU5 A;  4J8D A;  1UW4 B;  2L0T B;  2AXV A;  1TJF A;  1U3C A;  4FHJ A;  3AS4 A;  2ION A;  2WQ6 A;  1VDY A;  2J4D A;  3ASF A;  1HH8 A;  3CVV A;  2PL2 A;  3S7B A;  3PZD A;  4I6G A;  2AWI A;  2XGM A;  5FZR A;  3GZS A;  3C98 A;  4JPS A;  3PNL B;  4GAA A;  4NAC A;  3MKR A;  4P29 A;  1UG3 A;  3LYA A;  5EKQ D;  2PM6 A;  3LY8 A;  3FTV A;  3FU6 A;  4G25 A;  4CT0 A;  1EF1 C;  4J8E A;  2QY7 A;  2R17 C;  3G2U A;  2WXL A;  3I3N A;  4G2V A;  4LEU A;  5BT1 A;  4RSY A;  1JWF A;  3VTX A;  1NP7 A;  4DI4 A;  3EIQ C;  3D9O A;  2WXH A;  4MLP A;  2BUG A;  1E8W A;  3NF1 A;  5D0Q D;  4EBA G;  3ZYM A;  3CK8 A;  1N54 A;  1Z6T A;  1NA0 A;  2GRM A;  2XCC A;  4WND A;  5JHB A;  1DNP A;  5AEN A;  5JJ7 A;  4GZ5 A;  5G55 A;  3FFL A;  5T3R A;  4APF A;  4EQF A;  4GYO A;  3G2S A;  2WB2 A;  3CHO A;  3ENE A;  4PH4 B;  2VYI A;  3HVE A;  4DPR A;  5KJK A;  2C2L A;  4UWL A;  3OTN A;  5D0O D;  3ZN3 A;  4BY6 A;  1WM5 A;  1QQE A;  4L7T A;  5CMY A;  4FA6 A;  4C9B B;  1ELW A;  3UT7 A;  2IQC A;  2WMO A;  4GZC A;  2WXF A;  3MV3 B;  3QNK A;  3UPV A;  1E90 A;  3ML8 A;  3K9I A;  3PEU B;  3I5P A;  5AIJ A;  4N2Q A;  4HS2 A;  4ANU A;  5LP0 A;  2XGO A;  4H7X A;  4I1O B;  3MYV A;  4M3O A;  5T4Y A;  5AJD A;  3PUK A;  4A3V A;  4AM9 A;  3JCK C;  3SI5 A;  4BFR A;  3LKU A;  2HM8 A;  2R59 A;  3VLF A;  2J9Q A;  3SHF A;  4L1B A;  2VGX B;  2J4B A;  4GPK A;  3PNT B;  3CVY A;  4V3I A;  3WXX A;  3CHM A;  1ELR A;  4OYS A;  3GZ2 A;  3PDN A;  3P2B A;  4WWP A;  4J8F A;  3CVW A;  2DIW A;  3AS8 A;  3JQ1 A;  3NZU A;  4UI9 J;  3ULQ A;  4I6E A;  5A6C A;  2WXN A;  4U8H A;  3Q4A B;  3CLJ A;  3EJN A;  4JEU A;  1HZ4 A;  2X6J A;  2NXP A;  5E75 A;  3ZFW A;  1SQM A;  3R7R A;  3IV0 A;  2DBA A;  2PZI A;  2WXG A;  4LUN U;  2YIN A;  1QNF A;  4JA7 A;  4BX8 A;  2KCL A;  5EX3 A;  3G2V A;  3PVL A;  3RO2 A;  3ZYK A;  5A7D B;  4KVM A;  4J6I A;  2I1J A;  4RVB A;  3LPZ A;  5LOZ A;  3GW4 A;  4F3V A;  3AU5 A;  4ILH B;  3FEY A;  4RG9 A;  1Y6I A;  1H2V C;  4K03 A;  3GYZ A;  4GML A;  4HOS A;  3FUL A;  4JXT A;  1E8Z A;  5FQ4 A;  3FUI A;  3BG1 B;  3QWW A;  4Q96 A;  2M63 A;  2X6I A;  3ZIM A;  2XCB A;  4GZ6 A;  5G05 J;  1PY1 A;  4BX9 A;  3MKQ B;  5BV0 A;  2KAT A;  3RRU A;  3ESL A;  1UN8 A;  3PEV B;  4I2W A;  3RRM B;  3Q49 B;  2YQ8 A;  3FUJ A;  3SD5 A;  3CHP A;  3TAX A;  5J90 A;  4ILI A;  3ASG A;  2NSZ A;  1IQU A;  3SBS A;  2PQN A;  4GA2 A;  4N3A A;  3APD A;  4XE0 A;  2LSV A;  4AJW A;  4E6H A;  1HXI A;  2VGY A;  3JQ0 A;  3FH8 A;  3L17 A;  3QOU A;  4TV3 A;  3R9A B;  1UN9 A;  5FZQ A;  3CIA A;  4B0Z A;  5C2Y A;  3PRE A;  4JHJ A;  3OXF A;  4ME2 A;  3TG5 A;  3OXG A;  3LS8 A;  4AP2 A;  4BTA A;  2DCP A;  5C1D A;  5LCW C;  4FC8 A;  1E7U A;  4CDR A;  2OVB A;  4EPZ A;  4WUY A;  3D9L A;  4KZC A;  3QJZ A;  4H7Y A;  2CG3 A;  2J07 A;  1E8Y A;  2WXK A;  4UQX A;  3TGO A;  3KD7 A;  1KT0 A;  4XKB A;  4FUL A;  4D10 C;  1H19 A;  3FUE A;  4A1S A;  4JW1 A;  4MKT A;  3B7U X;  2WQ7 A;  3FU5 A;  4KYO B;  4UWK A;  3D9K A;  4ANW A;  3FH7 A;  3HVE B;  3ZYQ A;  4F7A A;  3FY4 A;  2XRZ A;  1HFA A;  4I9E A;  1BPO A;  3I4G A;  4EZK A;  1TJC A;  3KAE A;  2CG2 A;  2E0I A;  2J49 A;  1UJJ A;  1NZN A;  2FBN A;  1INZ A;  3ZW3 A;  3CVX A;  3BEE A;  3FU3 A;  4UWH A;  4ATG A;  2L6J A;  1L5J A;  2YNQ A;  3VLD A;  3CVU A;  3HIZ A;  1SZ9 A;  1UJK A;  3CK7 A;  4HLE A;  2CFZ A;  2WXI A;  2KM4 A;  1DVP A;  4AIF A;  2RD0 A;  4UQY A;  3S2A A;  5HI7 A;  2WXM A;  3FTU A;  3T5V A;  1S0P A;  2GGF A;  5LCW J;  1JWG A;  4U04 A;  3FWV A;  5ENN A;  3D9M A;  2OV8 A;  5CHE E;  5G04 C;  5KJN A;  4AOF A;  3SZ7 A;  4PS3 A;  3LVR E;  3FTZ A;  2PM7 A;  1EDU A;  2AXU A;  2LSU A;  4GMJ A;  2MRI A;  4I17 A;  5DBK A;  1LF8 A;  4PUC A;  3L6A A;  3ML9 A;  3FUK A;  3ONL A;  3SNX A;  3MA5 A;  3IHY A;  3IHV A;  3ZYL A;  3PRZ A;  3L08 A;  3TG4 A;  3L22 A;  4FLH A;  1HU3 A;  3FUM A;  4G23 A;  4G26 A;  5EDS A;  4APO A;  4CGW A;  3D3M A;  2LAH A;  5A23 A;  3MCX A;  3NZS A;  3IKO B;  3RRN B;  2XGS A;  1FVH A;  3FUD A;  4GA0 A;  4L2L A;  3D9J A;  4WAF A;  4YVQ C;  1U3D A;  2LAI A;  1HX8 A;  3URZ A;  5G05 C;  1IYG A;  1OWP A;  3QK0 A;  4UQZ A;  3GZ1 A;  2UWJ G;  4XZ4 A;  3FUH A;  3UUX A;  2UY1 B;  1H6K A;  2Y4U A;  4IN3 B;  4G24 A;  3FUF A;  2C0L A;  3FTS A;  2V0P A;  3CGH A;  2WXP A;  3ZPJ A;  4UWG A;  3CST A;  3R7Q A;  4F53 A;  2VTB B;  2A5U A;  2XPI A;  1EYH A;  3FTW A;  4XI0 A;  4AVX A;  4EZL A;  4CCA A;  4AXH A;  3L13 A;  1FVF A;  3EHN A;  2ZU6 B;  5EX0 A;  4XIF A;  2AW6 A;  3HYM B;  3MEK A;  2GW1 A;  2KZT B;  2Q7F A;  5FZS A;  1EPU A;  3L54 A;  4G11 A;  4UI9 K;  1HE8 A;  4BTB A;  4CDN A;  2I2O A;  3B7T A;  1QZ2 A;  3ONK A;  4ACK A;  3VLE A;  3JUI A;  4GCO A;  1PC2 A;  4TUU A;  2X38 A;  5JJ6 A;  3LCA A;  3ZGQ A;  5FTP A;  4BT8 A;  1X5B A;  4KBQ A;  2X3M A;  3U9W A;  4FAD A;  5KJM A;  3S7D A;  2X6K A;  4KVO A;  3RKV A;  4URK A;  4GCN A;  3EDT B;  3CKB A;  1HS6 A;  2WVI A;  4PS7 A;  4O6F A;  2L0I A;  4OVU A;  4WNF A;  2Y4T A;  4I2Z A;  4KXK B;  5AYW D;  2WMN A;  2XRY A;  4Q69 A;  5BUZ A;  1PAQ A;  4C0E A;  2I1K A;  3HHM A;  1E7V A;  4C0M A;  4GZ3 A;  2CHW A;  4OVV A;  1HO8 A;  3LDZ A;  3FP3 A;  4N3B A;  3U3W A;  3IBE A;  3FHE A;  1JUQ A;  4PDX A;  2XPY A;  4FLB A;  4JZY A;  2VQ2 A;  3T5X A;  3TXM A;  4BSX A;  1W3B A;  3SBT B;  4NQ0 A;  2FF4 A;  5AJL A;  4GYY A;  3U66 A;  4Y6W A;  2VSY A;  2MOW A;  2AVP A;  4JA9 A;  3PH0 C;  4WWO A;  1MHQ A;  2RG8 A;  3NQP A;  3KEZ A;  3U64 A;  3BG0 B;  2FO7 A;  2XEV A;  2R5S A;  3FU0 A;  5M72 A;  4EBA A;  5KJL A;  2J08 A;  5CCM A;  2VJ8 A;  3ZRH A;  3CSF A;  3EHM A;  3TL5 A;  3ZVV A;  3FH5 A;  3APF A;  3CV0 A;  3ASD A;  1WY6 A;  1Y8M A;  3MKQ A;  4AY6 A;  2UY1 A;  5KCM A;  2VGX A;  4JL0 A;  2OOE A;  3PS6 A;  4RG6 A;  4ANX A;  3LJ3 A;  3QWV A;  3QKY A;  4I43 A;  2KCV A;  4FJZ A;  5LX8 A;  4HOU A;  3SFZ A;  4XI9 A;  3CHR A;  4GA1 A;  2QFC A;  4N39 A;  3ZHE A;  1MQS A;  2L9B A;  4K0R A;  4U0S A;  3E4B A;  2OVF A;  2P58 C;  3S7F A;  3SF4 A;  3APC A;  2X6H A;  4XKC A;  3FEX A;  2FI7 A;  2J09 A;  4HOT A;  3DPD A;  1XNF A;  2V5F A;  3B13 A;  3CVL A;  2CHX A;  3CVQ A;  4N5C A;  4NUR A;  4U0U A;  1B89 A;  3T8M A;  1ELK A;  3RJV A;  5HQ8 A;  4UWF A;  5G04 J;  2IOL A;  3MV2 B;  3QC1 A;  4UI9 C;  5LFA A;  3MGB A;  4L23 A;  4I6J A;  4R7L A;  5CCL A;  5DIZ A;  4N3C A;  3D9I A;  4J0U A;  2MHK A;  4WNG A;  1E96 B;  4FU3 A;  3FUN A;  4ANV A;  2VTB A;  3QAR A;  3SGH A;  3ZEF A;  3MZL B;  3QB2 A;  4JC8 A;  2IFU A;  4PS8 A;  2A4Z A;  3AU4 A;  4A3T A;  5BW8 C;  4BT9 A;  5J08 A;  1TEZ A;  5FJY A;  1GW6 A;  4ABN A;  4YND A;  4DK5 A;  4I9C A;  2WXJ A;  2IJG X;  3DBS A;  3OAW A;  3CVP A;  1SZA A;  1KLX A;  5T8I A;  2IOS A;  4Y6C A;  1YA0 A;  3B7R L;  3PE4 A;  4CRW A;  2VSO E;  1OUV A;  2IU1 A;  4I1M A;  4LRZ A;  2WXQ A;  3ZXS A;  1ZBP A;  2V8S E;  1WAO 1;  3MX3 A;  1Z3X A;  2HR2 A;  3ASH A;  3B7S A;  4JHR A;  3UQ3 A;  3QDN A;  1HF8 A;  1IHG A;  3LY7 A;  2LNI A;  4ACL A;  4B8C B;  2KZT A;  5FT9 A;  3UX4 A;  4G1T A;  2HYZ A;  1N52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...