3CQGB

Nucleoporin nup107/nup133 interaction complex, delta finger mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
184
Chain Sequence
LSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDENINDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADFEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
total genus 59
structure length 184
sequence length 222
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqgB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqgB02
3CQCB 3I4RB 3CQGB
chains in the Genus database with same CATH superfamily
2XAQB 1NENA 4XAXB 4IE0A 3LK2B 3ZXPA 2X51A 4K5CA 1H6OA 5L2LA 2CBJA 4GKKT 2V4HC 5AQGB 2W4XA 2N2NA 2NW9A 2WDRA 4UVBB 4NUUA 2K48A 1K1BA 5EIDA 1T72A 5LXTE 2C0LA 3CHRA 2QYUA 5TAOA 4DV3T 1B7TA 5AQSB 2YNQA 2QY7A 1X79A 4UIGA 5AQIB 3LJ3A 2NR4A 4MBGA 4ZOLE 2M6IA 4QFVA 5AQ9A 3CVVA 4HLEA 5ITZF 3D0TA 4ZZBA 5ENSD 3AA0B 5HEJA 5CBOA 3L82A 1Y64B 5ENOD 3MJXA 2XTLA 1Y6IA 2V7IA 2BKKB 3R9MA 4PUCA 3D9NA 5AQAA 4U2ZA 4F6RC 3P4PA 5EK3A 3AEAA 3UXGA 4YDEA 4TV9E 5HKPA 3T9KA 4MLKA 4I43B 1IQUA 2DIWA 1OXZA 3CKDA 2BF0X 4LNGA 3AE8A 4BETA 4YSYA 4CI1B 3K3OA 2DBAA 3CHQA 4UF0A 4XEIG 2K9AA 2XEHA 2WCAA 4JEUA 2DYSE 3CEQA 1MZCA 4HTEA 4YXDA 4EBAG 5JRCA 4PK5A 4CYMD 4OFZA 4H9OC 4XBFB 3E30A 2BVLA 1QBQA 2GRNB 3KSQA 3QJZA 3LEWA 2FJBA 2LSYA 4UXNB 1JCRA 4OYKA 4HOUA 2LT3A 3NWIA 3Q9NC 2ZM6T 1QLBA 4ILHB 4JI8T 5IUXA 1OEDB 2ZM2A 3VTXA 2IDOB 1LD8A 3LYAA 3O1HA 5CRVA 5HWXA 3UUXB 4I6JA 4CRWA 4GA1A 4HGAA 4TRQA 2WWVA 4X20E 2Q9QC 3L39A 2JQKA 5C3JA 2DYRE 5CB4E 3V2XA 3Q73A 4DX1A 3FEXA 2EIJE 2MOWA 2R5SA 3AE6A 4GTRA 3P7IA 1NZNA 5LMNT 4PS7A 1VRBA 4GPMA 4YHJA 5JR9B 3PEUB 3FBLA 1BLXB 2VGXA 2UUBT 3G2SA 1HNZT 2IIUA 2GW1A 4L7TA 1HG2A 4NRHB 4YLHA 3JAFA 1S64A 2WXKA 4X1YE 1IQRA 1NEKA 3D9OA 3KBTA 4P0AA 2XQ3A 3CHSA 1JCSA 4WWPA 5HCMA 3ZW3A 1OCCE 2VQET 1N54A 4COFA 4QQIA 2HYZA 1UGOA 1N32T 3LKUA 5EZYE 3RRCA 2XY8B 3ZHEA 2ACZA 4A3VA 4KVOA 5D0QD 4HXIA 5HEHA 4EOZB 2BKOA 4AXHA 3VLFA 1INZA 5BW8C 2R6GF 3C51A 5H6QB 4GIWA 3MV2B 3AAAB 4IIJE 4GZ6A 3I0QA 2V7JA 4WZXA 4GTTA 2VVSA 4A1GA 4H9RC 1NI1A 4F7AA 3M65A 1V9DA 3RC8A 2YINA 4GU5A 4JYAT 1NWMX 3GZ2A 3L08A 2IO3C 3ABVA 3ESLA 4HFEA 2JRKA 4GKJT 5HEUA 1FVFA 4ME2A 2WXOA 5G04C 3SGHA 3PE0A 2UXNB 3RO3A 4EQFA 4HBDA 2YHEA 4KXKB 5ABEA 2CFZA 5G05J 5KCMA 1HH8A 1PAQA 3AU5A 2V5FA 4NXMT 1U5PA 1LVKA 3QDNA 3SFXA 4AISA 3HYMB 1OUVA 1D1CA 1EDUA 4AKLA 1J5WA 1JNRA 3EHMA 2ZMAA 4CN6A 1E90A 4HRMB 4I9EA 3ABME 3F6QA 1WDYA 3CX8B 3PUYF 4IREA 3TLWA 2V0PA 1JCQA 2JQ9A 1NFIE 3S2AA 3HHMA 4OHFA 1T8BA 2X0LB 3VR9A 1TN8A 3NBXX 2DZNA 2HE0A 4U7YA 3MACA 1WG0A 3K9IA 3LVRE 4DV6T 5JDFA 2I59A 2P9SG 4GOUA 5JDGA 1QZ2A 4WNGA 4AIUA 4HORA 4OVVA 2BTDA 1W09A 2A2FX 3LSVA 3SBSA 4GZDA 4L2YA 3RQWA 2ODUA 1UK5A 5HEGA 2E9XD 1HS6A 3J7Yq 3T8KA 2LSJA 4HWFA 4APOA 3CVXA 2CG2A 3CWZB 3Q47B 4QWNB 3S7JA 3UU8A 2EIKE 4HVBA 4AEZC 5A6CA 3GWHA 1UOHA 3ASDA 4ZXLA 4FA6A 1A5EA 1HCIA 3DPYA 4FHJA 3ZEFB 1TYQG 3UI2A 4EB6E 1BR2A 4YJ3E 3UU4A 2RFAA 3PS6A 2IEJA 1MIWA 3W9GA 3U3WA 2CBIA 4QXBB 4N3CA 5BV1A 3T8MA 3UQ3A 3D9LA 3HKBE 4YDOA 4L23A 2GRQB 3UU5A 2DWKA 3ZSTA 4E7ZA 3LG7A 3LDQB 1FPPA 3AA6B 4U2YA 2LJLA 2KWHA 3APFA 3BQOA 2CFUA 2WVIA 4JEHA 3O1IA 4WYVA 2XPYA 4H7XA 3U66A 2KCVA 5ENTD 4EGWA 2HPJA 3B57A 2FEZA 4JI5T 2EHOA 3HVEA 2C5IT 3VRAA 3UTMA 4WBOA 3AS4A 3B7TA 4J6IA 4B3ST 3EVYA 5FL1A 3T8OA 5AQRB 1UG3A 5JDQA 4EZJA 3OYXA 1IYGA 3F31A 3VHLA 2CHZA 3H3AA 2C2LA 4PK6A 1U4QA 3ZGQA 2KZ7B 3RRMB 2BS4A 4N2QA 1UN9A 4F1PA 5L3FB 3FH5A 4EZLA 1US7B 3B7RL 3QK0A 1MNDA 3PNTB 4UV9B 2ONDA 5CCLA 4ATZD 4HWIB 2WXPA 4P0BA 4FJOA 3MJWA 1TR4A 3IBPA 3ZJ2A 2J49A 2LM2A 2W61A 4KHZF 5AJDA 4BT9A 4NQ0A 4HE8A 4I9CA 4FLHA 5KJLA 1WM5A 4HNAD 5C2TA 2C5JA 2L9QA 2CM0A 2DL1A 4CDRA 3I1AA 1S94A 5J08A 4IDNA 1TNBA 3LCAA 4DUZT 3MA5A 2WZHA 3URZA 3PUSA 4GMRA 4J0UA 3UT7A 2LAIA 3W15B 4M7CA 3PTRB 4G1TA 3IEGA 4RLYA 4AQYT 5L3BB 3SZ7A 2WXMA 3C4XA 2ACXA 4LMLA 1TJCA 2XGOA 2I0MA 3HL6A 1EYHA 3VTYA 3Q78A 2X6FA 4LNBA 5F3JA 2HHHT 1O5MA 3AE9A 2RPAA 1IZNB 2CE7A 3UMVA 3SFDA 3AS8A 1X9BA 1H2TC 3UM1A 5FTPA 3PURA 1D1BA 1VCTA 1O1TA 3EDTB 3FEYA 3PUGA 5BV0A 2Y8DA 5FZQA 3LVQE 4NURA 2VKHA 1KT0A 2ES0A 2XRZA 4JD2G 1HX1B 4FADA 4YFSA 2IC6A 2YK0A 3V5UA 4LF4T 2WXGA 3NVOA 2HN1A 4B94A 3ZYLA 4A55A 2ZIRA 1ZP0A 1AWCB 5HXRA 1P5QA 3RGLA 1MIVA 4JEHB 2UUCT 2QZAA 3L17A 4L0RA 3ZN3A 2P9PG 1JNZA 4X8QA 3RAUA 3ZMVB 1E8YA 2FJEA 2CWYA 3O4ZA 4MKTA 4AM9A 2IOSA 3KV9A 4NIKA 1KNZA 2DVWA 4WNDA 4ABNA 3FWVA 5ABFA 3Q5DA 5FY7A 2VTBA 4BSXA 1SA5A 2WXFA 3ISMC 5EILA 2BKNA 4TWDA 2X9WA 3CX7B 1NA3A 3CKBA 3FUJA 3PRZA 2UXDT 4LUNU 4LF9T 3OPCA 5ABGA 4B6XA 4OX9T 1WR6A 3DJBA 1RZ4A 1CUNA 4IDQA 3N5LA 5KNHD 2V7MA 3CQCB 3QB5K 3AE4A 3UT5E 2XZTG 3GZ1A 2FULA 4O2AE 3HG0D 5LBMA 4CXWA 4HN9A 5LFAA 3EI0A 3TL5A 2BKPA 5AQ7A 2K24A 1BR4A 4O2BE 4MS6A 4DV1T 2V26A 2EIME 3ZVVA 2WDQA 3UM2A 4DPRA 1LTXA 3N71A 1K3ZD 4WWNA 5HRYA 4IULA 2WXQA 3RHWA 4FP7A 2FBWA 3AE3A 3CVRA 1BR1A 4YDWA 3ENEA 3E34A 3Q15A 2XCBA 5HS0A 3PDNA 2Y0BG 4U8HA 5EK4A 5LCWJ 4M1PA 4PAGA 5HCJA 3DSTA 2R03A 1OCOE 1PC2A 2LXMA 3ML9A 5ABHA 4NPPA 2DNXA 3AEFA 1UX4A 2RKKA 2IY0C 2QA7A 4GMLA 2XQ5A 1OWLA 4AQFC 5FZSA 2CCQA 2V5CA 3JAEA 3V31A 5JVDE 1YXRA 4DMWA 4ZI3C 5BPPA 5D66A 2JQHA 4U0SA 5AQVB 1JPLA 5HXSA 1E7UA 2YU2A 3DEPA 3LS8A 2XHEB 3CK6A 2OVBA 2I1KA 3N9QA 4I43A 3DEOA 5FY1A 2FJDA 1QNFA 2IFUA 2JJ9A 4DX7D 1D8DA 1FMWA 4AXPA 1BD8A 1OCRE 3A5XA 5LGTB 2W62A 1HTJF 4ZI2C 2IUBA 4H9SE 4Z8XA 5FNVE 3C4ZA 5G05C 2WU5A 3EUHA 4KZ0A 2LKGA 3Q49B 4Q96A 5JTGA 4LFAT 2KATA 1HNWT 4TXQA 3D9MA 2PG8A 4KP3C 4AP2A 3FFLA 3ZN1B 4ILGA 2MYOA 4OK0A 2XZEA 3LK3B 2PBIA 2A3DA 3FU5A 4BERA 5BXOA 4DBQA 5FINA 4QHOA 1CHUA 1UURA 3UIOC 3ZKJA 2Y3AA 4TUMA 1FCHA 4UQXA 3CK9A 4AY6A 2BBHA 5C8YE 3J5PA 4RVBA 1E7PA 5HEOA 3P2BA 1HG5A 4J8FA 4AKIA 4MLPA 2V6YA 4F8HA 3CVWA 2MPKA 3GA8A 2WBLA 4R7LA 4XI0A 4ISTA 1A17A 1TJFA 5CERB 3CV0A 2UY1B 3KVAA 2J1DG 3RIBA 1YA0A 4XIFA 5H7PA 1UUSA 2CEAA 3QOFA 4EXTA 3UINC 1HZ4A 3KAEA 1ZEEA 4A5XA 2JPFA 3PJAA 4ASKA 3EHQA 4Y6CA 4BWRA 5ARFA 4FJYA 2WQHA 4GA0A 4HFBA 4AY5A 3HRAA 3TWQA 2P9LG 4CZ2D 4TWFA 4IHJE 3MCXA 2E9XA 4TN7B 2WQYA 3EHZA 3GN5A 1IBMT 3JUIA 2IAKA 4GZCA 5AFUL 4F3VA 5AENA 2GGFA 3K8PC 4X1KE 4GK0E 1E2AA 4CQIA 3ABLE 3UKUG 1N33T 3T5XA 2WXLA 3I4RB 5AQQB 3RK6A 4O4HE 4GYOA 5B3SE 3ZC1A 2VSYA 2HR2A 4ERRA 2NC9A 4OVUA 5KDMC 2ZU6B 1IKND 3RKOA 4ILIA 5CRUA 2BKGA 3C4WA 3ZEFA 2QC9A 3DRAA 4BA9A 3RYIE 3UUBA 4IYPA 3C98A 4UV8B 4J8EA 2UWJG 1D0ZA 4EYUA 5G04J 3FTVA 3WG7E 5EX0A 3SF4A 3P1UA 1L0VA 2J4BA 3TWWA 4TUUA 4WUYA 3O9XA 3FUNA 4G11A 4GZ3A 4YVOA 3D9JA 3E33A 1MMGA 4X66T 5CJ5A 1ZBPA 4L9IA 3VRBA 3SFYA 3TG5A 2VSOE 2H6HA 1Z3XA 2JMKA 4DI4A 2LSIA 3RPUA 5ENQD 3F57A 3OTNA 2VSNA 3PVLA 5JJ6A 2P9KG 5EX3A 4LRZA 4UVCB 3UTKA 1I6ZA 3OVUA 1W9RA 2IU1A 4X64T 3FUFA 3UU3A 3OXGA 3N9LA 4V3IA 2CXFA 1MJ0A 2QFCA 1AJ3A 4N2SA 2X9XA 3RF1A 4OYJA 4YNDA 1G3NB 2H89A 5ABFB 2BVMA 1OEDC 4H9NC 4HQDA 4L5GA 3X2QE 2QGSA 1ELKA 3PV0F 3ZXSA 1ZOYA 3EHNA 3TXMA 3RIAA 1W0AA 1HFAA 3JQ1A 2WM9A 3JCKC 3WXXA 5AQFB 3PZ4A 1FIOA 1Z8UA 4EZ4A 4UWKA 2E2AA 2LKHA 2Q9QA 4UELA 2KCLA 3MGBA 1HO8A 5CMYA 5JMND 4JI6T 4GTQA 2AVPA 4JZYA 3RLFF 3ULEG 5JR9C 3Q7AA 2ZLYA 3HXBA 3B95A 4O60A 3MXZA 2J08A 3BG0B 5LBQB 4DBRA 3AEDA 4YJ2E 3QWVA 2XCCA 3LY9A 1FMVA 2LUHA 1XNFA 2UUAT 4RG9A 1YQ4A 4WNKA 2EHOC 3ONLA 2PTFA 4XZCA 2F8YA 4LMKA 4I2ZA 4ILCA 2JQQA 4PJNA 2DCPA 5KMGP 2FF4A 3ZU7B 3QNKA 2K5BB 5LMUT 1L5JA 3Q9DA 2XS1A 1N34T 3ZHEB 1HU3A 1LKXA 1U3DA 4DR1T 2YU1A 2B0OE 3O4XE 4DR5T 4B8AA 4DLOA 1YKHB 3KVBA 5LGUB 3ZSSA 5B1BE 4WW0A 4KMCA 5HYAA 3LY7A 2A9UA 1XMQT 5L3GB 4QH1A 4C91A 4KT6B 3WAKA 3U4TA 3SOLA 3PDYA 1XNRT 3C5RA 2R17C 3SNXA 4LF7T 4PJJA 5J1GA 4W9RA 4A98A 1FJGT 3TLUA 4EYYR 2H3RA 2F4VT 5LGNB 3VLDA 1DVPA 1IJ5A 4D10C 3IHYA 3E0ZA 1SVXA 2WSSV 4JEUB 3NB2A 2WB2A 4GYYA 3ZNGA 5FVLA 4EV6A 4ANJA 4C90A 5FMNA 2P2CP 2F0YA 3HKDE 1NL4A 1N95A 4JA7A 5JJ7A 3P8CD 1U3CA 2XQ7A 3UIPC 3MK7C 4ZI2D 2CLYB 3UPVA 3KV4A 1FVHA 2KXPC 3D9HA 2P9IG 4YVQC 3QC1A 4JVSA 4GYRA 4G8LA 3V79K 4UEMA 3J9X1 5DJQC 1TN7A 4ACLA 4ILBA 2IW5B 4Q69A 1ZV4X 3AE7A 2VQFT 4LF5T 4O6FA 4L1BA 1T98A 2VURA 4Z90A 4E6HA 1WCRA 4PS8A 3FZKB 4BAYB 2WXJA 5ANRA 1K1AA 4EZHA 3PUWF 5FXVA 4A56A 3FU6A 4H7YA 4IDZA 5IYZE 3FU3A 1SUMB 1W0BA 5JDHA 3L13A 4H63H 2B6CA 5HXEA 4A97A 5JR9A 4NIQA 1QQEA 1IHBA 4AKGA 2MOZA 3HKCE 3RC3A 5HXCA 4HB5A 2X66A 3L9TA 1V54E 2FBNA 1N4PA 4KX6A 1UCUA 4JW1A 3AU4A 1Y01A 5T8IA 3ZC0A 4GMJA 3N9PA 3UUNA 4FHKA 1I94T 3ZJ1A 4IDOA 3GN5B 3PUZF 5AQMB 2YEVC 1OCZE 4FLBA 2UXCT 4G63A 2NSZA 4MFRA 2OEWA 3O48A 4RSYA 4B3MT 5DQWA 1SHZC 4QH4A 3Q9UC 5CBNA 3AAIA 2X6JA 2G0UA 2BBJA 3V5SA 2E8IA 2CXDA 3Q2MA 3ZYMA 5C2YA 2IMLA 2D0TA 1HNXT 4I2WA 2MRIA 2P9BA 2NYJA 1D0XA 1JUQA 4U72A 4DV2T 1JWFA 3CHPA 2XSAA 2L0IA 2HM8A 4J8SA 2LHNA 4TV3A 2AW6A 1NAFA 3OYZA 2D5UA 3SO8A 5FZRA 3BG1B 3TAXA 5HQ8A 4K0UA 5EYPF 4UVAB 1S0PA 3ONXA 4HOQA 3CR3A 5LG3A 4GTOA 1G73A 3SWHA 3BQIA 3A8YC 1XDPA 3L6AA 3CVQA 2MHKA 3TLTA 2EHOD 2JMHA 2V7LA 3ZCIA 3LJNA 5LCYA 4L2LA 4U0UA 3MYVA 4DNDA 3B7UX 3ZT5A 4HFGA 1YQ3A 2BZBA 3N2GE 4DR3T 3KBUA 2XZDG 3N9OA 1N52A 5JDMA 5JH7E 3E37A 3ZRHA 4CDMA 5LG4A 3TWRA 2LSVA 2W67A 1SW6A 3UU6A 4KBQA 4UWHA 1HE8A 4O4IE 2L6BA 1SA4A 3TLVA 3LJCA 2LE8A 3CHOA 2ZISA 5AQKB 5JDLA 3PNLB 4EECA 5EDSA 4WNFA 2Y4TA 4DIDB 2FI7A 4ATGA 2KWIB 2CG3A 1Z0PA 2LHRA 3CVYA 3Q5EA 3Q5MA 3ZMSB 4A63B 3DSSA 2XGMA 4PK4A 4N3AA 4B93B 5L3EB 3ZKRA 5T3RA 4U74A 4Z68A 2LRLA 2LM9A 3P4WA 3ASGA 4B3TT 3U9WA 4N5QA 2VGYA 3C3QA 4U7IA 1ELWA 4GZ5A 1YW0A 4CT0A 2GRMA 3B7BA 4TXRA 3LBXB 3VU7H 1H6PA 2NOXA 2H7OA 3ASFA 1N9AA 4B0ZA 1TN6A 1TEZA 2FJAA 3RIUC 4CXYA 1OWAA 2H7VC 3C72A 3BEEA 2OCCE 5T4YA 1SQMA 3CMLA 3FZMB 1IBKT 2VQ2A 3U78A 4DK5A 3RYFE 2DWGA 3KEAA 2KMFA 5CHEE 4PFPA 4U31A 3D9KA 2J47A 2J4GA 5FQ6A 2DCFA 2JEKA 5CFBA 4MBQA 2V5QC 5LOZA 1BI7B 4APFA 1WYBA 3QKYA 3BQKA 3ETVA 4ZS3A 2Q7FA 2X68A 4FULA 2CLYC 2L0TB 3FHNA 1M62A 2IONA 5LYJE 1SZ9A 4O4JE 4JBWF 5ANLA 3OKQA 4BJMA 3MX3A 2E9XC 2WU2A 1KZOA 1ZU2A 5BT1A 2J09A 2LOSA 3FUIA 4BJNA 4EPZA 3G2VA 3NOCD 2R59A 3G2TA 3MA9A 3DPDA 4LSZE 2Y1LE 4XE0A 3KDSE 4TZ4C 5HXHA 4L9PA 3HDXA 3RYCE 4ADZA 1ZB1A 1X5BA 4CGWA 1NA0A 4FI5A 4NUVA 3FU0A 2AWIA 3FXDB 4GTMA 5LB7B 3AXJB 5A1LA 5BR8T 4YTMA 4X65T 1MX4A 4ZZCA 2WDVA 5AAOA 2Q9QB 3TWSA 3RRUA 2XGSA 2PL2A 4PH4B 2VGEA 4K0KT 1IHGA 4U3CA 3RI5A 3JC6D 4MALA 2UXBT 3QARA 1JWGA 2X0HA 3B13A 4P09A 2WS3A 4HI8A 3JQ0A 4DO0A 2VK9A 4IRUA 4N3BA 5E76A 5FQ7A 4BX8A 3RU0A 4DX5D 5FY0A 3NKZA 3P50A 2Y4UA 2VJ8A 4J8YA 3Q5WA 2DLRA 1HXIA 5L3CB 3IHRA 3AE1A 2D9DA 1XZYA 1RW2A 5FQ8A 4AQGA 4U33A 3MZLB 4X62T 5JQGE 3MKQB 5AQBA 3SRZA 2IC9A 1TNOA 3UFGA 4LFBT 5A7DB 3ULQA 3AS5A 3NQPA 1H0AA 2R05A 2XASB 3G06A 1N4RA 5AN8A 5FT9A 1DC2A 5KBAA 5KNGA 2RA1A 2YDQA 3P4RA 1KFYA 1MX2A 4I1MA 5AIJA 5HAXA 1FEWA 5LP6E 2BEDA 4DR6T 5EKQD 2Y6XA 2XAJB 1YYHA 2KZTA 1LVFA 3FBZA 2XM2A 2CMRA 4QKNA 2JIWA 1WR0A 3FUMA 2VKJA 5KXJA 5CEDB 5LP0A 3N9NA 4UF0B 5GONE 2XQYA 5EYLA 1S35A 1V55E 3UM0A 3DTOA 4O1OA 3R7QA 1OT8A 3QB5A 1OWOA 3C50A 4XKCA 4PJMA 4YT0A 1MIYA 1H6KA 3ETUA 1T7SA 3UT4A 4LFCT 3ASOE 4P29A 4U63A 2BG9E 5CA0E 3VR8A 4WAFA 4WWOA 4XZ4A 3AEGA 3AA7B 4JB8P 4KI0F 3WI3A 4I1OB 4XX5A 2YDSA 3MKRA 4JI0T 2NTXA 2GRPB 2LXLA 4HRNA 4AQFA 2LRKA 3EJNA 3TJPA 3PJAJ 4HS2A 1DU2A 2GRLA 4UQZA 5AQNB 3HR0A 1FT1A 4H9PC 3CVLA 3D3MA 1U2VG 3RQUA 5D2MC 4JI2T 2MBGA 1OY3D 5EIBE 5AQJB 2ETAA 3AG1E 1Y8MA 3I9YA 5BXUA 3AG2E 3EDUA 3FTUA 3RX6A 1WLXA 4AKRB 1HR0T 3V2OA 1N36T 2HO1A 4IDPA 2E9XB 2N1GA 2XQAA 5FXZA 3C64A 4DJAA 3FB2A 4HFDA 3FTXA 3NRXA 2D0UA 3LXUX 2JLBA 3K3QC 4ZI7E 4ZI3D 2V6XA 3KEZA 3FXEB 4Y6WA 2XQ6A 3Q75A 3N2KE 5CEAA 3SFZA 1Z6TA 5J2TE 2I1JA 3ZYKA 4G2AA 4UR9A 2RFMA 3EHRA 4O8SA 2AXZA 2L9BA 5FQ4A 2PJQA 3CSTA 3FUKA 4I6GA 5D0OD 1MMNA 3PUAA 1KPSB 1YCSB 4ANUA 3ONJA 5IWAT 2ZM0A 4DV0T 4URKA 3Q5XA 4HFVA 5F5WA 4P1NA 4AI6A 4JHJA 4LEUA 4DR7T 1TNZA 2WZIA 2RD0A 4ZFHA 2L3LA 2LSGA 1J1JA 5AQPB 2X6IA 3NZPA 2OOEA 3W9FA 5L4HA 4F6RD 1EPUA 3CX6B 3CVUA 2XENA 3MV3B 2LOPA 2J4DA 4LNUD 3WAJA 1HS7A 3ZMTB 4HI9A 4ANWA 4ZHQE 4IL9A 3DSVA 1BPOA 3FH7A 3RKGA 4JI3T 2R02A 4I17A 3FZFB 2XPIA 2ETBA 3T1HT 2XPZA 4E85A 2J62A 1EZ3A 4G26A 2A4ZA 4DUYT 4KHPT 1YMPA 5DIZA 1S63A 4LMJA 2H88A 4DX6D 3CPZA 3NZQA 3L09A 3I3NA 1IAPA 3APCA 5EN5D 4DR4T 2P9NG 2WPVA 3ZT7A 4TWHA 3NBNB 4CI3B 5AQLB 3PU8A 1N0QA 2YN6A 3AB3B 2A72A 3LK42 5CMWA 3CVPA 3PUXF 5B1AE 3KS2A 4CT4A 3L8RA 2YOEA 2XAHB 1D8EA 4WNEA 4G8KA 3ASHA 4BESA 5H6RB 4TNWA 1KT1A 3JADA 4CEMA 4N39A 3QWPA 2PQRA 4BY6A 4CXXA 3LFMA 2VGXB 3NZSA 3TWUA 3ZMUB 2XAFB 3ZUVB 2W63A 4JUYA 3B7SA 2NW8A 2XRYA 4FU3A 1KF6A 3JC6C 2E5LT 4OYSA 3ONLC 2BS2A 4GYSA 1W3BA 5LX8A 3FH8A 3QWWA 3LPZA 3S7BA 3L16A 4HOSA 4HOTA 3GZSA 3SQVA 4O4LE 1UN8A 1Z3YA 3EIQC 2ZGGA 4AKHA 3PZDA 2Y69E 3G2WA 5ENRD 5FP3A 3FDHA 4XI9A 1KZPA 3PZ1A 2W2UA 1H2VC 4C0EA 3RKVA 1MYOA 4LF8T 3GMIA 3EU9A 1Z5SC 3R84B 2PM6A 3LDZA 4PS3A 4F1SA 3TWVA 4KUMB 2B1EA 4ILUA 3KV6A 2KNDA 2OVFA 2XSBA 3C98B 2NWBA 2KINB 3TGOA 2PM7A 4K5BA 5HWYA 5AARA 2XQ8A 4DRXE 2CHWA 1WRDA 4Q25A 4K5AB 3NF1A 5LA6E 1OXJA 2C5KT 1UX5A 2WXIA 1E8XA 3KSLA 3SHFA 1KEYA 2LSUA 1N4QA 2XAGB 2AXVA 2KC7A 3FTZA 5JDNA 2VKOA 1H19A 5KJMA 2L6JA 3EU5A 4JLEA 3TXNA 2X0YA 1UJJA 5AQTB 5KWDA 4HWDA 2KCKA 3B5MA 1O1SA 3TWTA 2AE9A 2BG9A 3OAWA 4GTSA 4PJLA 3BU8A 1HF8A 1GW6A 4U07A 3ZN0B 5LNKA 1EF1C 2BG9B 4HWHA 5A23A 2KM4A 4DV7T 4UI9K 3FUHA 4QX7B 3C3OA 2WQ6A 4IE4A 4CCAA 5ENPD 1N11A 5G55A 2LAHA 5FKYA 3UFEA 4ISSA 3DXKG 4HLLA 5CCMA 2A5EA 3RIFA 2UXXB 5JA4D 1N4SA 4YY3T 4C0MA 2CWOA 4XKBA 4NXNT 1TNYA 4KMOA 2SPCA 1J5ET 4QH5A 3D9IA 3ANWB 2V4LA 4IL4A 4JXTA 4DUIA 3CGHA 2FO7A 4QXCB 2GK9A 5L4EA 2A5UA 3KINB 3RRWA 4CI2B 2OA5A 4E7SA 4GPKA 2BDEA 4H63V 4C9BB 5KJKA 5AJLA 2UU9T 3QB2A 3BQLA 1LF8A 3VKHA 5AQOB 3DSWA 4I55E 3ABKE 3PUQA 3RSEG 2VL0A 2ZXWE 3I5PA 1H2UA 4UWLA 2E2EA 3UQ4A 4DMVA 3PUKA 3QK6A 2M67A 4HKAA 1XDOA 4BTAA 3DWLG 2MYSA 2MAWA 2XHEA 2VYIA 4TNVA 1KNPA 3QNUA 1SA0E 4JA9A 4HWCA 1BR0A 2KZTB 3AAAC 4UI9C 3TWXA 2L8KA 1GQEA 5FL0A 1PY1A 3IBEA 4X1IE 4QX8B 4IN3B 3VLEA 3ZCJA 3RYHE 2C0MA 4YTPA 2KXPB 4PW8A 4JI7T 2DI4A 4GK5E 2X3MA 4EZKA 3SBTB 3E32A 4TV8E 2YDRA 5LOVE 3SI5A 3FUEA 1R8IA 4U8YD 3AVRA 1XMOT 2WP9A 1O3XA 4J2CA 2E0IA 3QAQA 4JHKA 5M4YA 4OAUC 3AEBA 5JREA 3S4UA 3Q7FA 3AA1B 5AQHB 4BEPA 4LF6T 5DABA 3ZPOA 4ILAA 5FYMA 4AVXA 1OWPA 1IJ6A 4BT8A 3JXIA 3T5VA 3EIJA 5JJTA 3UT8A 5CGMA 2IF4A 1ZKEA 4A3TA 2P9UG 2IHR1 5L47A 3SY2A 2WY2A 1OEDA 3OXFA 2XPKA 3ZFWA 1WFDA 3U64A 3X1DA 3AE2A 4V1Av 4IT4A 4DI3A 2J07A 4K0RA 1SZAA 4I1AA 3AJIA 3FZLB 2X9HA 4HFCA 1YD8G 4O1PA 4BTBA 1VOMA 4JI4T 3TG4A 5DBKA 2PQNA 1XGWA 4WBNE 4GCNA 3UM3A 3K1SA 1E8WA 1MX6A 5FWQA 4BX9A 1S70B 2DHRA 1HX8A 4BSZB 3HKEE 3RRNB 3L22A 2C0SA 2PFVA 2NTYA 2V1DB 3DBSA 3CIAA 2FO1E 3LBXA 4DX2A 3CIRA 4RG6A 4MRUA 3HXDA 1UW4B 1ZHCA 1BU9A 3FUDA 3ML8A 1H7CA 3CKCA 4C48B 2D2SA 4I4TE 3IA3A 3IV0A 3Q79A 3EABA 1E96B 5KJNA 2LSKA 4PFOA 4AOFA 4HRLA 4CN1A 5BNWA 3P4QA 1G8XA 3UX4A 4JPSA 4YSXA 1D9SA 2H6IA 3HXFA 5C1DA 3SFEA 3OBVE 3L3PA 4G24A 2B76A 2EILE 4TXPA 3D9PA 3UUMA 4I6EA 2KLQA 3PUVF 2VL8A 4ZEYA 3A7MA 4HFHA 3ZMZB 2CPTA 2E5VA 5J2UE 1WAO1 4IGUA 3R6NA 3K3NA 3AG3E 3AAEB 4EIWA 2GRRB 5LHGB 2XQ0A 4A1SA 3CSFA 4EAHA 3UKRG 4EBAA 2M6BA 3CHMA 5JRCB 3M3ZB 1MMDA 2WXHA 4GTPA 4K03A 4IE7A 4OAVB 3FULA 3PZ3A 2AJAA 5ARGA 4UWFA 3UQ7A 2DZOA 4G23A 4U8VD 3RO2A 1OWMA 2I2OA 4EHMA 5FIOA 4KYOB 3RH3A 2ODVA 4G25A 2VKDA 3ZT6A 2EQXA 3J5QB 3IHVA 5CA1E 3DSXA 1IBLT 4KBMB 4J8DA 3PREA 5AYWD 3DXMG 2HH7A 3AEEA 1WYCA 3KD7A 3CQXC 3ZPJA 2ETCA 3ESKA 3KV5A 3E22E 4DR2T 2XUEA 5IY5E 3E08A 2XQ4A 2VVNA 1ELRA 4ANXA 5J90A 4TUYE 2BUGA 2WAUA 3H3MA 2W00A 4U0ZA 4DLQA 1LD7A 2OLTA 2OV9A 2XQ9A 4KZCA 1D1AA 4B8CB 3ANWA 3IEEA 1IXVA 3GW4A 2KSRA 1E8ZA 1MQSA 3JXJA 1WY6A 4G2VA 4YHHT 3U3IA 2HPLA 2IJGX 2WXRA 1QUUA 4PDXA 5M72A 3L54A 2YHCA 2YKSA 2CXLA 4HEAA 3QOUA 5ETWA 2NP9A 2H6FA 3C3RA 4IE6A 5E0OA 3E4BA 4NACA 3JCFA 2LO6A 4JI1T 4DVDA 3PUJA 4F53A 2DWZA 2BG9C 5KX5E 5BMVE 3ZIMA 2CHOA 4GTVA 2IOLA 1O1RA 3PE4A 2X6HA 4AJWA 5LJNA 4JHRA 3T1YT 4N5CA 2X67A 1QYMA 1DCQA 3IKOB 3EAMA 4MHCA 2MTQA 1SE7A 2GROB 3DP7A 2WMOA 3NZUA 2X9YA 4B3RT 4U96D 2IQCA 2K3WA 3PEVB 4DV5T 2QRXA 3ZLIA 3IF8B 4HFIA 3ULYA 5DQVA 3MZKB 3ONKA 1NP7A 3NOGD 3V30A 3NRYA 2LEHA 2XS8A 4FC8A 2RP4A 5FXXA 4EEBA 2ZGDA 3G2UA 5AQUB 5LHHB 2RG8A 3H37A 3FTSA 3JUEA 2VTBB 4FJZA 3SD5A 3NAWA 2Z6EA 2CHNA 3IXEA 1E7VA 5IHYA 2XM1A 4CGVA 2PNNA 3I0OA 1KK7A 1AP7A 3PZ2A 4AV7A 5L3DB 3O1JA 3QC9A 3VKGA 1DCEA 5FXWA 1UJKA 3BUAA 2QVAA 3AECA 4EEDA 3MEKA 3HIZA 4I50E 2W0GA 3FTYA 2AXDS 2X6KA 4U04A 1M7KA 3UUXA 2XJ7A 4UQYA 1MMAA 3MKDA 4UUCA 2W66A 4N78D 3AG4E 4GA2A 3LY8A 5FVKA 4B89A 2V6YB 1Q2ZA 3CVNA 3N2OA 5JHBA 3Q4AB 2OEVA 3FP3A 4LCTA 3F2EA 3QUJA 3FHEA 2ILRA 2Y48B 2VASA 2H6GA 4J7WA 4JL0A 3DSUA 1D0YA 2N9DA 3OJAA 2XEVA 2PZIA 2I9CA 2NW7A 3UULA 3APDA 4CN4A 2VSXE 4LERA 4U7EB 4GYWA 4UWGA 4I0UA 3HA4A 5JHAA 1XNQT 3MKQA 3TLSA 1OWNA 4BFRA 1MNEA 1TNUA 2P58C 1B89A 2V7KA 4YDYA 3HI2A 2BS3A 4PNIA 3PH0C 3S7FA 4CDNA 4QXHB 3OXLA 2QYJA 3HXCA 3P4SA 3CK7A 4TX5A 5EK2A 2WB5A 3AE5A 5F8PA 4ZHBA 2YQ8A 3RIUA 4ACKA 2LNIA 4LG6A 2R2LA 5FJYA 2CA5A 3PE3A 3SS1A 2Q9QD 3R7RA 4UI9J 1OEDE 5CECB 2F37A 2NXPA 2XEEA 2WXNA 2CHXA 2WQ7A 3OTOT 3I4GA 4Q94A 4X5TA 3CLJA 5ENNA 3ASNE 3PU3A 2ZM8A 2JABA 3EUVA 3FTWA 4KVMA 1XWMA 2M63A 5ADXL 4RQIA 3HXEA 4GAAA 5J0ZA 2OV8A 3CK8A 1N0RA 4ZS2A 2QYWA 2EHOB 3HVEB 2HN2A 2EINE 1X81A 5LCWC 5BUZA 1YKEB 3R9AB 3TKLB 4CZZB 1QSDA 2IO2C 1K8KG 3FY4A 4YSZA 1N94A 2I6HA 4ANVA 2FUPA 2LLYA 3S7DA 3GYZA 1KNRA 2V5DA 1MHQA 3BK9A 3AXJA 3AVSA 1VCSA 3FZHB 3N9MA 2WMNA 3I9WA 4H9QC 3CQGB 3JYSA 5E75A 2F8XK 4GCOA 4JV5T 1LRZA 5HI7A 3RJVA 1FT2A 2V8SV 4JC8A 2J8SD 2KT9A 3KFWX 2CRBA 2UY1A 4GB9A 3ZYQA 5LHIB 1DNPA 5G2NA 4M3OA 3EDVA 2AXUA 2V8SE 2VWAA 4YTNA 4U95D 4IE5A 1E1HB 2VB6A 1KLXA 1VDYA 2J9QA 4DV4T 2KBXA 2WWUA 5LJMA 4AIFA 4Z91A 2X38A 1BI8B
chains in the Genus database with same CATH topology
2XAQB 4XAXB 4IE0A 3LK2B 2X51A 5L2LA 2N2NA 2NW9A 4UVBB 4NUUA 2K48A 5LXTE 3CHRA 2C0LA 5TAOA 1B7TA 2YNQA 2QY7A 1X79A 4UIGA 3LJ3A 4ZOLE 4QFVA 3CVVA 4HLEA 3D0TA 3AA0B 1Y64B 3MJXA 2XTLA 1Y6IA 2V7IA 4PUCA 3D9NA 4F6RC 5EK3A 4TV9E 4MLKA 4I43B 1IQUA 2DIWA 1OXZA 3CKDA 2BF0X 2DBAA 4CI1B 3K3OA 3CHQA 4UF0A 2K9AA 4JEUA 3CEQA 4HTEA 4EBAG 5JRCA 4PK5A 4OFZA 4H9OC 4XBFB 3QJZA 2BVLA 3LEWA 2LSYA 4UXNB 4OYKA 4HOUA 2LT3A 4ILHB 2ZM2A 3VTXA 3LYAA 3O1HA 5HWXA 3UUXB 4I6JA 4CRWA 4GA1A 4HGAA 4TRQA 4X20E 2Q9QC 5CB4E 3FEXA 2MOWA 2R5SA 3P7IA 1NZNA 4PS7A 1VRBA 4YHJA 5JR9B 3PEUB 3FBLA 2VGXA 3G2SA 2GW1A 4L7TA 1HG2A 4NRHB 4YLHA 2WXKA 4X1YE 1IQRA 3D9OA 3KBTA 4P0AA 3CHSA 4WWPA 3ZW3A 1N54A 2HYZA 3LKUA 5EZYE 3RRCA 3ZHEA 4A3VA 4KVOA 5D0QD 4HXIA 4EOZB 4AXHA 3VLFA 1INZA 5BW8C 3C51A 5H6QB 4GIWA 3MV2B 3AAAB 4IIJE 4GZ6A 3I0QA 2V7JA 4A1GA 4H9RC 4F7AA 3M65A 1V9DA 3RC8A 4GU5A 2YINA 1NWMX 3GZ2A 3L08A 3ESLA 2JRKA 1FVFA 4ME2A 5G04C 2WXOA 3SGHA 3PE0A 2UXNB 3RO3A 4EQFA 2YHEA 4KXKB 2CFZA 5G05J 5KCMA 1HH8A 1PAQA 3AU5A 2V5FA 1U5PA 1LVKA 3QDNA 3HYMB 1OUVA 1D1CA 1EDUA 4AKLA 3EHMA 2ZMAA 1E90A 4I9EA 3CX8B 2V0PA 3S2AA 3HHMA 4OHFA 2X0LB 3NBXX 3MACA 3K9IA 3LVRE 5JDFA 2I59A 4GOUA 5JDGA 1QZ2A 4WNGA 4HORA 4OVVA 2BTDA 2A2FX 3SBSA 4GZDA 4L2YA 2ODUA 2E9XD 1HS6A 3J7Yq 2LSJA 4APOA 3CVXA 2CG2A 3CWZB 3Q47B 4QWNB 3S7JA 4HVBA 4AEZC 5A6CA 3GWHA 3ASDA 4FA6A 1HCIA 4FHJA 3ZEFB 4EB6E 1BR2A 4YJ3E 3PS6A 1MIWA 3U3WA 4QXBB 4N3CA 5BV1A 3T8MA 3UQ3A 3D9LA 3HKBE 4L23A 2DWKA 4E7ZA 3LG7A 3AA6B 2LJLA 2KWHA 3APFA 2CFUA 2WVIA 4JEHA 3O1IA 2XPYA 4H7XA 3U66A 2KCVA 2HPJA 3B57A 2FEZA 2EHOA 3HVEA 2C5IT 4WBOA 3AS4A 3B7TA 4J6IA 3EVYA 3T8OA 1UG3A 5JDQA 4EZJA 3OYXA 1IYGA 3F31A 3VHLA 2CHZA 3H3AA 2C2LA 4PK6A 1U4QA 3ZGQA 2KZ7B 3RRMB 4N2QA 1UN9A 5L3FB 3FH5A 4EZLA 1US7B 3B7RL 3QK0A 1MNDA 3PNTB 4UV9B 2ONDA 5CCLA 2WXPA 4P0BA 4FJOA 3MJWA 3IBPA 3ZJ2A 2J49A 2W61A 5AJDA 4BT9A 4NQ0A 4HE8A 4I9CA 4FLHA 5KJLA 1WM5A 2C5JA 2L9QA 2CM0A 4CDRA 3I1AA 1S94A 5J08A 3LCAA 3MA5A 3URZA 3PUSA 4J0UA 3UT7A 2LAIA 3W15B 3PTRB 4G1TA 3IEGA 5L3BB 3SZ7A 2WXMA 3C4XA 2ACXA 1TJCA 2XGOA 3HL6A 1EYHA 3VTYA 2X6FA 5F3JA 1IZNB 2CE7A 3UMVA 3AS8A 1H2TC 5FTPA 3PURA 1D1BA 3EDTB 3FEYA 3PUGA 5BV0A 2Y8DA 5FZQA 3LVQE 4NURA 2VKHA 1KT0A 2ES0A 2XRZA 4FADA 4YFSA 2IC6A 2YK0A 3V5UA 2WXGA 4B94A 3ZYLA 4A55A 5HXRA 1P5QA 1MIVA 4JEHB 3L17A 4L0RA 3ZN3A 3ZMVB 1E8YA 2CWYA 3O4ZA 4MKTA 4AM9A 2IOSA 3KV9A 1KNZA 4WNDA 4ABNA 3FWVA 5FY7A 2VTBA 4BSXA 2WXFA 2X9WA 3CX7B 1NA3A 3CKBA 3FUJA 3PRZA 4LUNU 4B6XA 1WR6A 3DJBA 1CUNA 3N5LA 2V7MA 3CQCB 3UT5E 3GZ1A 2FULA 4O2AE 5LBMA 4CXWA 4HN9A 5LFAA 3TL5A 2K24A 1BR4A 4O2BE 4MS6A 2V26A 3ZVVA 4DPRA 3N71A 4WWNA 4IULA 2WXQA 4FP7A 3CVRA 1BR1A 3ENEA 3Q15A 2XCBA 3PDNA 4U8HA 5EK4A 5LCWJ 4M1PA 4PAGA 1PC2A 3ML9A 2DNXA 1UX4A 2QA7A 4GMLA 1OWLA 4AQFC 5FZSA 2CCQA 5JVDE 4DMWA 4ZI3C 5BPPA 4U0SA 1JPLA 5HXSA 1E7UA 2YU2A 3LS8A 2XHEB 2OVBA 4I43A 2I1KA 3N9QA 5FY1A 1QNFA 2IFUA 2JJ9A 1FMWA 4AXPA 3A5XA 5LGTB 2W62A 1HTJF 4ZI2C 4H9SE 4Z8XA 5FNVE 3C4ZA 5G05C 3EUHA 4KZ0A 3Q49B 4Q96A 2KATA 3D9MA 2PG8A 4KP3C 4AP2A 3FFLA 3ZN1B 4ILGA 4OK0A 3LK3B 2PBIA 2A3DA 3FU5A 4DBQA 4QHOA 2Y3AA 1FCHA 4UQXA 3CK9A 4AY6A 5C8YE 4RVBA 3P2BA 1HG5A 4J8FA 4AKIA 4MLPA 3CVWA 3GA8A 2WBLA 4R7LA 4XI0A 4ISTA 1A17A 1TJFA 3CV0A 2UY1B 3KVAA 2J1DG 3RIBA 1YA0A 4XIFA 2CEAA 4EXTA 1HZ4A 3KAEA 1ZEEA 2JPFA 4ASKA 4Y6CA 4BWRA 5ARFA 4FJYA 2WQHA 4GA0A 4AY5A 4IHJE 3MCXA 2E9XA 4TN7B 3GN5A 3JUIA 2IAKA 4GZCA 5AFUL 4F3VA 5AENA 2GGFA 3K8PC 4X1KE 4GK0E 4CQIA 3T5XA 2WXLA 3I4RB 3RK6A 4O4HE 4GYOA 3ZC1A 2VSYA 2HR2A 4ERRA 2NC9A 4OVUA 5KDMC 2ZU6B 3RKOA 4ILIA 3C4WA 3ZEFA 4BA9A 3RYIE 4IYPA 3C98A 4UV8B 4J8EA 2UWJG 1D0ZA 4EYUA 5G04J 3FTVA 5EX0A 3SF4A 3P1UA 2J4BA 4TUUA 4WUYA 3O9XA 3FUNA 4G11A 4GZ3A 4YVOA 3D9JA 1MMGA 1ZBPA 4L9IA 3TG5A 2VSOE 1Z3XA 2JMKA 4DI4A 2LSIA 3RPUA 3F57A 3OTNA 2VSNA 3PVLA 5JJ6A 5EX3A 4LRZA 4UVCB 3UTKA 2IU1A 3FUFA 3OXGA 3N9LA 4V3IA 2CXFA 2QFCA 1AJ3A 4N2SA 2X9XA 4OYJA 4YNDA 2BVMA 4H9NC 4L5GA 2QGSA 1ELKA 3ZXSA 3EHNA 3TXMA 1HFAA 3JQ1A 2WM9A 3JCKC 3WXXA 1FIOA 4EZ4A 4UWKA 2Q9QA 4UELA 2KCLA 3MGBA 1HO8A 5CMYA 2AVPA 4JZYA 5JR9C 2ZLYA 3MXZA 2J08A 3BG0B 5LBQB 4DBRA 3QWVA 4YJ2E 2XCCA 3LY9A 1FMVA 1XNFA 4RG9A 4WNKA 2EHOC 3ONLA 4XZCA 4I2ZA 2JQQA 4PJNA 2DCPA 5KMGP 2FF4A 3QNKA 2K5BB 1L5JA 3Q9DA 3ZHEB 1HU3A 1LKXA 1U3DA 2YU1A 4DLOA 3O4XE 4B8AA 1YKHB 3KVBA 5LGUB 4WW0A 4KMCA 5HYAA 3LY7A 5L3GB 4C91A 4KT6B 3WAKA 3U4TA 3SOLA 3PDYA 2R17C 3SNXA 4PJJA 5J1GA 4W9RA 4EYYR 2H3RA 5LGNB 3VLDA 1DVPA 1IJ5A 4D10C 3IHYA 3E0ZA 2WSSV 4JEUB 2WB2A 4GYYA 4ANJA 4C90A 5FMNA 3HKDE 4JA7A 5JJ7A 3P8CD 1U3CA 3MK7C 4ZI2D 2CLYB 3UPVA 3KV4A 1FVHA 4YVQC 3QC1A 4JVSA 4GYRA 4UEMA 3J9X1 5DJQC 4ACLA 2IW5B 4Q69A 1ZV4X 4O6FA 4L1BA 1T98A 4E6HA 4PS8A 4BAYB 2WXJA 5ANRA 4EZHA 5FXVA 4A56A 3FU6A 4H7YA 4IDZA 5IYZE 3FU3A 5JDHA 3L13A 4H63H 5HXEA 5JR9A 1QQEA 4AKGA 2MOZA 3HKCE 3RC3A 5HXCA 2X66A 2FBNA 4JW1A 1UCUA 3AU4A 5T8IA 3ZC0A 4GMJA 3N9PA 3UUNA 4FHKA 3ZJ1A 3GN5B 2YEVC 4FLBA 4G63A 2NSZA 3O48A 4MFRA 4RSYA 5DQWA 1SHZC 3AAIA 2X6JA 2G0UA 3V5SA 2E8IA 2CXDA 3Q2MA 3ZYMA 5C2YA 2D0TA 4I2WA 2MRIA 2P9BA 1D0XA 1JUQA 4U72A 1JWFA 3CHPA 2L0IA 2HM8A 4J8SA 2LHNA 4TV3A 2AW6A 1NAFA 3OYZA 2D5UA 5FZRA 3BG1B 3TAXA 5HQ8A 4K0UA 4UVAB 1S0PA 3ONXA 4HOQA 3CR3A 1G73A 3SWHA 3BQIA 3L6AA 3CVQA 2MHKA 2EHOD 2JMHA 2V7LA 3ZCIA 5LCYA 4L2LA 4U0UA 3MYVA 4DNDA 3B7UX 4HFGA 2BZBA 3N2GE 3KBUA 3N9OA 1N52A 5JDMA 5JH7E 3ZRHA 4CDMA 5LG4A 2LSVA 4KBQA 4UWHA 1HE8A 4O4IE 3LJCA 2LE8A 3CHOA 5JDLA 3PNLB 4EECA 5EDSA 4WNFA 2Y4TA 4ATGA 2FI7A 2KWIB 2CG3A 1Z0PA 2LHRA 3CVYA 3Q5MA 3ZMSB 2XGMA 4PK4A 4N3AA 5L3EB 5T3RA 4U74A 2LM9A 3ASGA 3U9WA 2VGYA 1ELWA 4GZ5A 1YW0A 4CT0A 2GRMA 3LBXB 3VU7H 2NOXA 2H7OA 3ASFA 4B0ZA 1TEZA 4CXYA 1OWAA 2H7VC 3BEEA 5T4YA 1SQMA 3CMLA 2VQ2A 3U78A 4DK5A 3RYFE 2DWGA 2KMFA 5CHEE 4PFPA 3D9KA 5FQ6A 2DCFA 2JEKA 4MBQA 5LOZA 4APFA 1WYBA 3QKYA 3BQKA 3ETVA 4ZS3A 2Q7FA 2X68A 4FULA 2CLYC 2L0TB 3FHNA 2IONA 5LYJE 1SZ9A 4O4JE 5ANLA 3OKQA 4BJMA 3MX3A 2E9XC 1ZU2A 5BT1A 2J09A 2LOSA 3FUIA 4BJNA 4EPZA 3G2VA 2R59A 3G2TA 3MA9A 3DPDA 4XE0A 3KDSE 4TZ4C 5HXHA 3HDXA 3RYCE 4ADZA 1X5BA 4CGWA 1NA0A 4FI5A 4NUVA 3FU0A 2AWIA 3FXDB 5A1LA 2Q9QB 3RRUA 2XGSA 2PL2A 4PH4B 1IHGA 3JC6D 4MALA 3QARA 1JWGA 3B13A 4P09A 3JQ0A 4DO0A 2VK9A 4IRUA 4N3BA 5E76A 5FQ7A 4BX8A 3RU0A 5FY0A 2Y4UA 2VJ8A 3Q5WA 2DLRA 1HXIA 5L3CB 3IHRA 5FQ8A 4AQGA 3MZLB 5JQGE 3MKQB 3SRZA 2IC9A 5A7DB 3ULQA 3AS5A 3NQPA 1H0AA 2XASB 5FT9A 2RA1A 4I1MA 5AIJA 5HAXA 1FEWA 5LP6E 5EKQD 2Y6XA 2XAJB 2KZTA 1LVFA 3FBZA 2CMRA 4QKNA 3FUMA 2VKJA 5LP0A 3N9NA 4UF0B 5GONE 2XQYA 1S35A 3DTOA 3R7QA 1OWOA 3C50A 4XKCA 4PJMA 1MIYA 1H6KA 3ETUA 3UT4A 4P29A 4U63A 5CA0E 4WAFA 4WWOA 4XZ4A 3AA7B 3WI3A 4I1OB 4XX5A 3MKRA 2NTXA 4AQFA 3EJNA 3TJPA 4HS2A 2GRLA 4UQZA 3HR0A 4H9PC 3CVLA 3D3MA 2MBGA 1Y8MA 3I9YA 3FTUA 3EDUA 3RX6A 1WLXA 4AKRB 2HO1A 2E9XB 2N1GA 5FXZA 3C64A 4DJAA 3FB2A 3FTXA 3NRXA 2D0UA 3LXUX 2JLBA 3K3QC 4ZI7E 4ZI3D 3KEZA 3FXEB 4Y6WA 3N2KE 3SFZA 1Z6TA 5J2TE 2I1JA 3ZYKA 4G2AA 4O8SA 2AXZA 2L9BA 5FQ4A 2PJQA 3CSTA 3FUKA 4I6GA 5D0OD 1MMNA 3PUAA 4ANUA 2ZM0A 4URKA 3Q5XA 4HFVA 4AI6A 4JHJA 4LEUA 2RD0A 2L3LA 2LSGA 2X6IA 3NZPA 2OOEA 1EPUA 3CX6B 3CVUA 3MV3B 2LOPA 2J4DA 3WAJA 1HS7A 3ZMTB 4ANWA 4ZHQE 1BPOA 3FH7A 4I17A 2XPIA 2XPZA 4E85A 1EZ3A 4G26A 2A4ZA 5DIZA 3CPZA 3NZQA 3L09A 3I3NA 1IAPA 3APCA 2WPVA 4CI3B 3PU8A 3AB3B 2A72A 3LK42 5CMWA 3CVPA 3KS2A 4CT4A 2XAHB 4WNEA 3ASHA 5H6RB 1KT1A 4CEMA 4N39A 3QWPA 2PQRA 4BY6A 4CXXA 2VGXB 3LFMA 3NZSA 3ZMUB 2XAFB 2W63A 4JUYA 3B7SA 2NW8A 2XRYA 4FU3A 3JC6C 4OYSA 1W3BA 4GYSA 5LX8A 3FH8A 3QWWA 3LPZA 3S7BA 3L16A 4HOSA 4HOTA 3GZSA 4O4LE 1UN8A 1Z3YA 3EIQC 4AKHA 3PZDA 3G2WA 5FP3A 3FDHA 4XI9A 1H2VC 4C0EA 3RKVA 3GMIA 3R84B 2PM6A 3LDZA 4PS3A 4F1SA 4KUMB 2B1EA 4ILUA 3KV6A 2KNDA 2OVFA 3C98B 2NWBA 2KINB 3TGOA 2PM7A 5HWYA 2CHWA 1WRDA 3NF1A 5LA6E 2C5KT 1UX5A 2WXIA 1E8XA 3SHFA 2LSUA 2XAGB 2AXVA 2KC7A 3FTZA 5JDNA 2VKOA 1H19A 5KJMA 2L6JA 4JLEA 3TXNA 1UJJA 2KCKA 3OAWA 4PJLA 1HF8A 1GW6A 4U07A 3ZN0B 5LNKA 1EF1C 5A23A 2KM4A 4UI9K 3FUHA 4QX7B 2WQ6A 4IE4A 4CCAA 5G55A 2LAHA 3UFEA 4ISSA 5CCMA 2UXXB 4C0MA 2CWOA 4XKBA 4KMOA 2SPCA 3D9IA 3ANWB 4JXTA 2V4LA 3CGHA 2FO7A 4QXCB 2GK9A 2A5UA 3KINB 3RRWA 4CI2B 2OA5A 4E7SA 4GPKA 2BDEA 4H63V 4C9BB 5KJKA 5AJLA 3QB2A 3BQLA 1LF8A 3VKHA 4I55E 3PUQA 3I5PA 1H2UA 4UWLA 2E2EA 4DMVA 3PUKA 3QK6A 2M67A 4HKAA 4BTAA 2MYSA 2XHEA 2VYIA 1SA0E 4JA9A 4UI9C 1BR0A 2KZTB 2L8KA 1PY1A 3IBEA 4X1IE 4QX8B 4IN3B 3VLEA 3ZCJA 3RYHE 2C0MA 2KXPB 4PW8A 2DI4A 4GK5E 2X3MA 4EZKA 3SBTB 4TV8E 5LOVE 3SI5A 3FUEA 3AVRA 4J2CA 1O3XA 2E0IA 3QAQA 4JHKA 5M4YA 5JREA 3S4UA 3AA1B 5DABA 3ZPOA 5FYMA 4AVXA 1OWPA 1IJ6A 4BT8A 3T5VA 3EIJA 5JJTA 3UT8A 2IF4A 1ZKEA 4A3TA 3OXFA 3ZFWA 3U64A 4V1Av 4DI3A 2J07A 4K0RA 1SZAA 4I1AA 2X9HA 4BTBA 1YD8G 1VOMA 3TG4A 5DBKA 2PQNA 1XGWA 4WBNE 4GCNA 1E8WA 5FWQA 4BX9A 2DHRA 1HX8A 3HKEE 3RRNB 3L22A 2C0SA 2PFVA 2NTYA 2V1DB 3DBSA 3CIAA 3LBXA 4RG6A 4MRUA 1UW4B 1ZHCA 3FUDA 3ML8A 1H7CA 3CKCA 2D2SA 4I4TE 3IV0A 1E96B 5KJNA 2LSKA 4PFOA 4AOFA 5BNWA 1G8XA 3UX4A 4JPSA 5C1DA 3OBVE 3L3PA 4G24A 3D9PA 3UUMA 4I6EA 2KLQA 2VL8A 3ZMZB 5J2UE 1WAO1 4IGUA 3R6NA 3K3NA 3AAEB 4EIWA 5LHGB 2XQ0A 4A1SA 3CSFA 4EAHA 4EBAA 3CHMA 5JRCB 4K03A 1MMDA 2WXHA 4IE7A 3FULA 5ARGA 4UWFA 4G23A 3RO2A 1OWMA 2I2OA 4KYOB 3RH3A 2ODVA 4G25A 2VKDA 2EQXA 3IHVA 5CA1E 4KBMB 4J8DA 3PREA 5AYWD 2HH7A 1WYCA 3KD7A 3CQXC 3ZPJA 3ESKA 3KV5A 3E22E 2XUEA 3E08A 1ELRA 4ANXA 5J90A 4TUYE 2BUGA 2WAUA 2W00A 4U0ZA 4DLQA 4KZCA 1D1AA 4B8CB 3ANWA 3IEEA 3GW4A 1E8ZA 1MQSA 1WY6A 4G2VA 3U3IA 2HPLA 2IJGX 2WXRA 1QUUA 4PDXA 5M72A 3L54A 2YHCA 3QOUA 2CXLA 4HEAA 5ETWA 2NP9A 4IE6A 5E0OA 3E4BA 4NACA 2LO6A 4DVDA 3PUJA 4F53A 5KX5E 5BMVE 3ZIMA 2IOLA 3PE4A 2X6HA 4AJWA 5LJNA 4JHRA 4N5CA 2X67A 3IKOB 4MHCA 2MTQA 3DP7A 2WMOA 3NZUA 2X9YA 2IQCA 3PEVB 3ZLIA 3IF8B 5DQVA 3MZKB 3ONKA 1NP7A 3NRYA 2LEHA 4FC8A 2RP4A 5FXXA 3G2UA 5LHHB 2RG8A 3H37A 3FTSA 2VTBB 4FJZA 3SD5A 2Z6EA 1E7VA 5IHYA 4CGVA 3I0OA 1KK7A 4AV7A 5L3DB 3O1JA 3QC9A 3VKGA 5FXWA 1UJKA 3MEKA 3HIZA 4I50E 2W0GA 3FTYA 2X6KA 4U04A 3UUXA 4UQYA 1MMAA 3MKDA 4N78D 4GA2A 3LY8A 4B89A 3CVNA 5JHBA 3N2OA 3Q4AB 3FP3A 4LCTA 3F2EA 3FHEA 3QUJA 2ILRA 2Y48B 2VASA 4JL0A 1D0YA 2N9DA 3OJAA 2XEVA 2PZIA 2I9CA 2NW7A 3UULA 3APDA 2VSXE 4LERA 4GYWA 4UWGA 3HA4A 5JHAA 3MKQA 1OWNA 4BFRA 1MNEA 2P58C 1B89A 2V7KA 3HI2A 4PNIA 3PH0C 3S7FA 4CDNA 4QXHB 3OXLA 3CK7A 4TX5A 5EK2A 5F8PA 2YQ8A 4ACKA 2LNIA 5FJYA 2CA5A 3PE3A 3SS1A 2Q9QD 3R7RA 4UI9J 2NXPA 2WXNA 2CHXA 2WQ7A 3I4GA 4Q94A 3CLJA 5ENNA 3PU3A 2ZM8A 3FTWA 4KVMA 2M63A 5ADXL 4GAAA 2OV8A 3CK8A 4ZS2A 2EHOB 3HVEB 5LCWC 5BUZA 1YKEB 3R9AB 3TKLB 4CZZB 1QSDA 3FY4A 2I6HA 4ANVA 3S7DA 3GYZA 1MHQA 3BK9A 3AVSA 3N9MA 2WMNA 3I9WA 4H9QC 3CQGB 3JYSA 5E75A 4GCOA 1LRZA 5HI7A 3RJVA 4JC8A 2KT9A 3KFWX 2UY1A 4GB9A 3ZYQA 5LHIB 1DNPA 5G2NA 4M3OA 3EDVA 2AXUA 2V8SE 2VWAA 4IE5A 1E1HB 2VB6A 1KLXA 1VDYA 2J9QA 2WWUA 5LJMA 4AIFA 2X38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQC B;  3I4R B;  3CQG B; 
#chains in the Genus database with same CATH topology
 2XAQ B;  1NEN A;  4XAX B;  4IE0 A;  3LK2 B;  3ZXP A;  2X51 A;  4K5C A;  1H6O A;  5L2L A;  2CBJ A;  4GKK T;  2V4H C;  5AQG B;  2W4X A;  2N2N A;  2NW9 A;  2WDR A;  4UVB B;  4NUU A;  2K48 A;  1K1B A;  5EID A;  1T72 A;  5LXT E;  2C0L A;  3CHR A;  2QYU A;  5TAO A;  4DV3 T;  1B7T A;  5AQS B;  2YNQ A;  2QY7 A;  1X79 A;  4UIG A;  5AQI B;  3LJ3 A;  2NR4 A;  4MBG A;  4ZOL E;  2M6I A;  4QFV A;  5AQ9 A;  3CVV A;  4HLE A;  5ITZ F;  3D0T A;  4ZZB A;  5ENS D;  3AA0 B;  5HEJ A;  5CBO A;  3L82 A;  1Y64 B;  5ENO D;  3MJX A;  2XTL A;  1Y6I A;  2V7I A;  2BKK B;  3R9M A;  4PUC A;  3D9N A;  5AQA A;  4U2Z A;  4F6R C;  3P4P A;  5EK3 A;  3AEA A;  3UXG A;  4YDE A;  4TV9 E;  5HKP A;  3T9K A;  4MLK A;  4I43 B;  1IQU A;  2DIW A;  1OXZ A;  3CKD A;  2BF0 X;  4LNG A;  3AE8 A;  4BET A;  4YSY A;  4CI1 B;  3K3O A;  2DBA A;  3CHQ A;  4UF0 A;  4XEI G;  2K9A A;  2XEH A;  2WCA A;  4JEU A;  2DYS E;  3CEQ A;  1MZC A;  4HTE A;  4YXD A;  4EBA G;  5JRC A;  4PK5 A;  4CYM D;  4OFZ A;  4H9O C;  4XBF B;  3E30 A;  2BVL A;  1QBQ A;  2GRN B;  3KSQ A;  3QJZ A;  3LEW A;  2FJB A;  2LSY A;  4UXN B;  1JCR A;  4OYK A;  4HOU A;  2LT3 A;  3NWI A;  3Q9N C;  2ZM6 T;  1QLB A;  4ILH B;  4JI8 T;  5IUX A;  1OED B;  2ZM2 A;  3VTX A;  2IDO B;  1LD8 A;  3LYA A;  3O1H A;  5CRV A;  5HWX A;  3UUX B;  4I6J A;  4CRW A;  4GA1 A;  4HGA A;  4TRQ A;  2WWV A;  4X20 E;  2Q9Q C;  3L39 A;  2JQK A;  5C3J A;  2DYR E;  5CB4 E;  3V2X A;  3Q73 A;  4DX1 A;  3FEX A;  2EIJ E;  2MOW A;  2R5S A;  3AE6 A;  4GTR A;  3P7I A;  1NZN A;  5LMN T;  4PS7 A;  1VRB A;  4GPM A;  4YHJ A;  5JR9 B;  3PEU B;  3FBL A;  1BLX B;  2VGX A;  2UUB T;  3G2S A;  1HNZ T;  2IIU A;  2GW1 A;  4L7T A;  1HG2 A;  4NRH B;  4YLH A;  3JAF A;  1S64 A;  2WXK A;  4X1Y E;  1IQR A;  1NEK A;  3D9O A;  3KBT A;  4P0A A;  2XQ3 A;  3CHS A;  1JCS A;  4WWP A;  5HCM A;  3ZW3 A;  1OCC E;  2VQE T;  1N54 A;  4COF A;  4QQI A;  2HYZ A;  1UGO A;  1N32 T;  3LKU A;  5EZY E;  3RRC A;  2XY8 B;  3ZHE A;  2ACZ A;  4A3V A;  4KVO A;  5D0Q D;  4HXI A;  5HEH A;  4EOZ B;  2BKO A;  4AXH A;  3VLF A;  1INZ A;  5BW8 C;  2R6G F;  3C51 A;  5H6Q B;  4GIW A;  3MV2 B;  3AAA B;  4IIJ E;  4GZ6 A;  3I0Q A;  2V7J A;  4WZX A;  4GTT A;  2VVS A;  4A1G A;  4H9R C;  1NI1 A;  4F7A A;  3M65 A;  1V9D A;  3RC8 A;  2YIN A;  4GU5 A;  4JYA T;  1NWM X;  3GZ2 A;  3L08 A;  2IO3 C;  3ABV A;  3ESL A;  4HFE A;  2JRK A;  4GKJ T;  5HEU A;  1FVF A;  4ME2 A;  2WXO A;  5G04 C;  3SGH A;  3PE0 A;  2UXN B;  3RO3 A;  4EQF A;  4HBD A;  2YHE A;  4KXK B;  5ABE A;  2CFZ A;  5G05 J;  5KCM A;  1HH8 A;  1PAQ A;  3AU5 A;  2V5F A;  4NXM T;  1U5P A;  1LVK A;  3QDN A;  3SFX A;  4AIS A;  3HYM B;  1OUV A;  1D1C A;  1EDU A;  4AKL A;  1J5W A;  1JNR A;  3EHM A;  2ZMA A;  4CN6 A;  1E90 A;  4HRM B;  4I9E A;  3ABM E;  3F6Q A;  1WDY A;  3CX8 B;  3PUY F;  4IRE A;  3TLW A;  2V0P A;  1JCQ A;  2JQ9 A;  1NFI E;  3S2A A;  3HHM A;  4OHF A;  1T8B A;  2X0L B;  3VR9 A;  1TN8 A;  3NBX X;  2DZN A;  2HE0 A;  4U7Y A;  3MAC A;  1WG0 A;  3K9I A;  3LVR E;  4DV6 T;  5JDF A;  2I59 A;  2P9S G;  4GOU A;  5JDG A;  1QZ2 A;  4WNG A;  4AIU A;  4HOR A;  4OVV A;  2BTD A;  1W09 A;  2A2F X;  3LSV A;  3SBS A;  4GZD A;  4L2Y A;  3RQW A;  2ODU A;  1UK5 A;  5HEG A;  2E9X D;  1HS6 A;  3J7Y q;  3T8K A;  2LSJ A;  4HWF A;  4APO A;  3CVX A;  2CG2 A;  3CWZ B;  3Q47 B;  4QWN B;  3S7J A;  3UU8 A;  2EIK E;  4HVB A;  4AEZ C;  5A6C A;  3GWH A;  1UOH A;  3ASD A;  4ZXL A;  4FA6 A;  1A5E A;  1HCI A;  3DPY A;  4FHJ A;  3ZEF B;  1TYQ G;  3UI2 A;  4EB6 E;  1BR2 A;  4YJ3 E;  3UU4 A;  2RFA A;  3PS6 A;  2IEJ A;  1MIW A;  3W9G A;  3U3W A;  2CBI A;  4QXB B;  4N3C A;  5BV1 A;  3T8M A;  3UQ3 A;  3D9L A;  3HKB E;  4YDO A;  4L23 A;  2GRQ B;  3UU5 A;  2DWK A;  3ZST A;  4E7Z A;  3LG7 A;  3LDQ B;  1FPP A;  3AA6 B;  4U2Y A;  2LJL A;  2KWH A;  3APF A;  3BQO A;  2CFU A;  2WVI A;  4JEH A;  3O1I A;  4WYV A;  2XPY A;  4H7X A;  3U66 A;  2KCV A;  5ENT D;  4EGW A;  2HPJ A;  3B57 A;  2FEZ A;  4JI5 T;  2EHO A;  3HVE A;  2C5I T;  3VRA A;  3UTM A;  4WBO A;  3AS4 A;  3B7T A;  4J6I A;  4B3S T;  3EVY A;  5FL1 A;  3T8O A;  5AQR B;  1UG3 A;  5JDQ A;  4EZJ A;  3OYX A;  1IYG A;  3F31 A;  3VHL A;  2CHZ A;  3H3A A;  2C2L A;  4PK6 A;  1U4Q A;  3ZGQ A;  2KZ7 B;  3RRM B;  2BS4 A;  4N2Q A;  1UN9 A;  4F1P A;  5L3F B;  3FH5 A;  4EZL A;  1US7 B;  3B7R L;  3QK0 A;  1MND A;  3PNT B;  4UV9 B;  2OND A;  5CCL A;  4ATZ D;  4HWI B;  2WXP A;  4P0B A;  4FJO A;  3MJW A;  1TR4 A;  3IBP A;  3ZJ2 A;  2J49 A;  2LM2 A;  2W61 A;  4KHZ F;  5AJD A;  4BT9 A;  4NQ0 A;  4HE8 A;  4I9C A;  4FLH A;  5KJL A;  1WM5 A;  4HNA D;  5C2T A;  2C5J A;  2L9Q A;  2CM0 A;  2DL1 A;  4CDR A;  3I1A A;  1S94 A;  5J08 A;  4IDN A;  1TNB A;  3LCA A;  4DUZ T;  3MA5 A;  2WZH A;  3URZ A;  3PUS A;  4GMR A;  4J0U A;  3UT7 A;  2LAI A;  3W15 B;  4M7C A;  3PTR B;  4G1T A;  3IEG A;  4RLY A;  4AQY T;  5L3B B;  3SZ7 A;  2WXM A;  3C4X A;  2ACX A;  4LML A;  1TJC A;  2XGO A;  2I0M A;  3HL6 A;  1EYH A;  3VTY A;  3Q78 A;  2X6F A;  4LNB A;  5F3J A;  2HHH T;  1O5M A;  3AE9 A;  2RPA A;  1IZN B;  2CE7 A;  3UMV A;  3SFD A;  3AS8 A;  1X9B A;  1H2T C;  3UM1 A;  5FTP A;  3PUR A;  1D1B A;  1VCT A;  1O1T A;  3EDT B;  3FEY A;  3PUG A;  5BV0 A;  2Y8D A;  5FZQ A;  3LVQ E;  4NUR A;  2VKH A;  1KT0 A;  2ES0 A;  2XRZ A;  4JD2 G;  1HX1 B;  4FAD A;  4YFS A;  2IC6 A;  2YK0 A;  3V5U A;  4LF4 T;  2WXG A;  3NVO A;  2HN1 A;  4B94 A;  3ZYL A;  4A55 A;  2ZIR A;  1ZP0 A;  1AWC B;  5HXR A;  1P5Q A;  3RGL A;  1MIV A;  4JEH B;  2UUC T;  2QZA A;  3L17 A;  4L0R A;  3ZN3 A;  2P9P G;  1JNZ A;  4X8Q A;  3RAU A;  3ZMV B;  1E8Y A;  2FJE A;  2CWY A;  3O4Z A;  4MKT A;  4AM9 A;  2IOS A;  3KV9 A;  4NIK A;  1KNZ A;  2DVW A;  4WND A;  4ABN A;  3FWV A;  5ABF A;  3Q5D A;  5FY7 A;  2VTB A;  4BSX A;  1SA5 A;  2WXF A;  3ISM C;  5EIL A;  2BKN A;  4TWD A;  2X9W A;  3CX7 B;  1NA3 A;  3CKB A;  3FUJ A;  3PRZ A;  2UXD T;  4LUN U;  4LF9 T;  3OPC A;  5ABG A;  4B6X A;  4OX9 T;  1WR6 A;  3DJB A;  1RZ4 A;  1CUN A;  4IDQ A;  3N5L A;  5KNH D;  2V7M A;  3CQC B;  3QB5 K;  3AE4 A;  3UT5 E;  2XZT G;  3GZ1 A;  2FUL A;  4O2A E;  3HG0 D;  5LBM A;  4CXW A;  4HN9 A;  5LFA A;  3EI0 A;  3TL5 A;  2BKP A;  5AQ7 A;  2K24 A;  1BR4 A;  4O2B E;  4MS6 A;  4DV1 T;  2V26 A;  2EIM E;  3ZVV A;  2WDQ A;  3UM2 A;  4DPR A;  1LTX A;  3N71 A;  1K3Z D;  4WWN A;  5HRY A;  4IUL A;  2WXQ A;  3RHW A;  4FP7 A;  2FBW A;  3AE3 A;  3CVR A;  1BR1 A;  4YDW A;  3ENE A;  3E34 A;  3Q15 A;  2XCB A;  5HS0 A;  3PDN A;  2Y0B G;  4U8H A;  5EK4 A;  5LCW J;  4M1P A;  4PAG A;  5HCJ A;  3DST A;  2R03 A;  1OCO E;  1PC2 A;  2LXM A;  3ML9 A;  5ABH A;  4NPP A;  2DNX A;  3AEF A;  1UX4 A;  2RKK A;  2IY0 C;  2QA7 A;  4GML A;  2XQ5 A;  1OWL A;  4AQF C;  5FZS A;  2CCQ A;  2V5C A;  3JAE A;  3V31 A;  5JVD E;  1YXR A;  4DMW A;  4ZI3 C;  5BPP A;  5D66 A;  2JQH A;  4U0S A;  5AQV B;  1JPL A;  5HXS A;  1E7U A;  2YU2 A;  3DEP A;  3LS8 A;  2XHE B;  3CK6 A;  2OVB A;  2I1K A;  3N9Q A;  4I43 A;  3DEO A;  5FY1 A;  2FJD A;  1QNF A;  2IFU A;  2JJ9 A;  4DX7 D;  1D8D A;  1FMW A;  4AXP A;  1BD8 A;  1OCR E;  3A5X A;  5LGT B;  2W62 A;  1HTJ F;  4ZI2 C;  2IUB A;  4H9S E;  4Z8X A;  5FNV E;  3C4Z A;  5G05 C;  2WU5 A;  3EUH A;  4KZ0 A;  2LKG A;  3Q49 B;  4Q96 A;  5JTG A;  4LFA T;  2KAT A;  1HNW T;  4TXQ A;  3D9M A;  2PG8 A;  4KP3 C;  4AP2 A;  3FFL A;  3ZN1 B;  4ILG A;  2MYO A;  4OK0 A;  2XZE A;  3LK3 B;  2PBI A;  2A3D A;  3FU5 A;  4BER A;  5BXO A;  4DBQ A;  5FIN A;  4QHO A;  1CHU A;  1UUR A;  3UIO C;  3ZKJ A;  2Y3A A;  4TUM A;  1FCH A;  4UQX A;  3CK9 A;  4AY6 A;  2BBH A;  5C8Y E;  3J5P A;  4RVB A;  1E7P A;  5HEO A;  3P2B A;  1HG5 A;  4J8F A;  4AKI A;  4MLP A;  2V6Y A;  4F8H A;  3CVW A;  2MPK A;  3GA8 A;  2WBL A;  4R7L A;  4XI0 A;  4IST A;  1A17 A;  1TJF A;  5CER B;  3CV0 A;  2UY1 B;  3KVA A;  2J1D G;  3RIB A;  1YA0 A;  4XIF A;  5H7P A;  1UUS A;  2CEA A;  3QOF A;  4EXT A;  3UIN C;  1HZ4 A;  3KAE A;  1ZEE A;  4A5X A;  2JPF A;  3PJA A;  4ASK A;  3EHQ A;  4Y6C A;  4BWR A;  5ARF A;  4FJY A;  2WQH A;  4GA0 A;  4HFB A;  4AY5 A;  3HRA A;  3TWQ A;  2P9L G;  4CZ2 D;  4TWF A;  4IHJ E;  3MCX A;  2E9X A;  4TN7 B;  2WQY A;  3EHZ A;  3GN5 A;  1IBM T;  3JUI A;  2IAK A;  4GZC A;  5AFU L;  4F3V A;  5AEN A;  2GGF A;  3K8P C;  4X1K E;  4GK0 E;  1E2A A;  4CQI A;  3ABL E;  3UKU G;  1N33 T;  3T5X A;  2WXL A;  3I4R B;  5AQQ B;  3RK6 A;  4O4H E;  4GYO A;  5B3S E;  3ZC1 A;  2VSY A;  2HR2 A;  4ERR A;  2NC9 A;  4OVU A;  5KDM C;  2ZU6 B;  1IKN D;  3RKO A;  4ILI A;  5CRU A;  2BKG A;  3C4W A;  3ZEF A;  2QC9 A;  3DRA A;  4BA9 A;  3RYI E;  3UUB A;  4IYP A;  3C98 A;  4UV8 B;  4J8E A;  2UWJ G;  1D0Z A;  4EYU A;  5G04 J;  3FTV A;  3WG7 E;  5EX0 A;  3SF4 A;  3P1U A;  1L0V A;  2J4B A;  3TWW A;  4TUU A;  4WUY A;  3O9X A;  3FUN A;  4G11 A;  4GZ3 A;  4YVO A;  3D9J A;  3E33 A;  1MMG A;  4X66 T;  5CJ5 A;  1ZBP A;  4L9I A;  3VRB A;  3SFY A;  3TG5 A;  2VSO E;  2H6H A;  1Z3X A;  2JMK A;  4DI4 A;  2LSI A;  3RPU A;  5ENQ D;  3F57 A;  3OTN A;  2VSN A;  3PVL A;  5JJ6 A;  2P9K G;  5EX3 A;  4LRZ A;  4UVC B;  3UTK A;  1I6Z A;  3OVU A;  1W9R A;  2IU1 A;  4X64 T;  3FUF A;  3UU3 A;  3OXG A;  3N9L A;  4V3I A;  2CXF A;  1MJ0 A;  2QFC A;  1AJ3 A;  4N2S A;  2X9X A;  3RF1 A;  4OYJ A;  4YND A;  1G3N B;  2H89 A;  5ABF B;  2BVM A;  1OED C;  4H9N C;  4HQD A;  4L5G A;  3X2Q E;  2QGS A;  1ELK A;  3PV0 F;  3ZXS A;  1ZOY A;  3EHN A;  3TXM A;  3RIA A;  1W0A A;  1HFA A;  3JQ1 A;  2WM9 A;  3JCK C;  3WXX A;  5AQF B;  3PZ4 A;  1FIO A;  1Z8U A;  4EZ4 A;  4UWK A;  2E2A A;  2LKH A;  2Q9Q A;  4UEL A;  2KCL A;  3MGB A;  1HO8 A;  5CMY A;  5JMN D;  4JI6 T;  4GTQ A;  2AVP A;  4JZY A;  3RLF F;  3ULE G;  5JR9 C;  3Q7A A;  2ZLY A;  3HXB A;  3B95 A;  4O60 A;  3MXZ A;  2J08 A;  3BG0 B;  5LBQ B;  4DBR A;  3AED A;  4YJ2 E;  3QWV A;  2XCC A;  3LY9 A;  1FMV A;  2LUH A;  1XNF A;  2UUA T;  4RG9 A;  1YQ4 A;  4WNK A;  2EHO C;  3ONL A;  2PTF A;  4XZC A;  2F8Y A;  4LMK A;  4I2Z A;  4ILC A;  2JQQ A;  4PJN A;  2DCP A;  5KMG P;  2FF4 A;  3ZU7 B;  3QNK A;  2K5B B;  5LMU T;  1L5J A;  3Q9D A;  2XS1 A;  1N34 T;  3ZHE B;  1HU3 A;  1LKX A;  1U3D A;  4DR1 T;  2YU1 A;  2B0O E;  3O4X E;  4DR5 T;  4B8A A;  4DLO A;  1YKH B;  3KVB A;  5LGU B;  3ZSS A;  5B1B E;  4WW0 A;  4KMC A;  5HYA A;  3LY7 A;  2A9U A;  1XMQ T;  5L3G B;  4QH1 A;  4C91 A;  4KT6 B;  3WAK A;  3U4T A;  3SOL A;  3PDY A;  1XNR T;  3C5R A;  2R17 C;  3SNX A;  4LF7 T;  4PJJ A;  5J1G A;  4W9R A;  4A98 A;  1FJG T;  3TLU A;  4EYY R;  2H3R A;  2F4V T;  5LGN B;  3VLD A;  1DVP A;  1IJ5 A;  4D10 C;  3IHY A;  3E0Z A;  1SVX A;  2WSS V;  4JEU B;  3NB2 A;  2WB2 A;  4GYY A;  3ZNG A;  5FVL A;  4EV6 A;  4ANJ A;  4C90 A;  5FMN A;  2P2C P;  2F0Y A;  3HKD E;  1NL4 A;  1N95 A;  4JA7 A;  5JJ7 A;  3P8C D;  1U3C A;  2XQ7 A;  3UIP C;  3MK7 C;  4ZI2 D;  2CLY B;  3UPV A;  3KV4 A;  1FVH A;  2KXP C;  3D9H A;  2P9I G;  4YVQ C;  3QC1 A;  4JVS A;  4GYR A;  4G8L A;  3V79 K;  4UEM A;  3J9X 1;  5DJQ C;  1TN7 A;  4ACL A;  4ILB A;  2IW5 B;  4Q69 A;  1ZV4 X;  3AE7 A;  2VQF T;  4LF5 T;  4O6F A;  4L1B A;  1T98 A;  2VUR A;  4Z90 A;  4E6H A;  1WCR A;  4PS8 A;  3FZK B;  4BAY B;  2WXJ A;  5ANR A;  1K1A A;  4EZH A;  3PUW F;  5FXV A;  4A56 A;  3FU6 A;  4H7Y A;  4IDZ A;  5IYZ E;  3FU3 A;  1SUM B;  1W0B A;  5JDH A;  3L13 A;  4H63 H;  2B6C A;  5HXE A;  4A97 A;  5JR9 A;  4NIQ A;  1QQE A;  1IHB A;  4AKG A;  2MOZ A;  3HKC E;  3RC3 A;  5HXC A;  4HB5 A;  2X66 A;  3L9T A;  1V54 E;  2FBN A;  1N4P A;  4KX6 A;  1UCU A;  4JW1 A;  3AU4 A;  1Y01 A;  5T8I A;  3ZC0 A;  4GMJ A;  3N9P A;  3UUN A;  4FHK A;  1I94 T;  3ZJ1 A;  4IDO A;  3GN5 B;  3PUZ F;  5AQM B;  2YEV C;  1OCZ E;  4FLB A;  2UXC T;  4G63 A;  2NSZ A;  4MFR A;  2OEW A;  3O48 A;  4RSY A;  4B3M T;  5DQW A;  1SHZ C;  4QH4 A;  3Q9U C;  5CBN A;  3AAI A;  2X6J A;  2G0U A;  2BBJ A;  3V5S A;  2E8I A;  2CXD A;  3Q2M A;  3ZYM A;  5C2Y A;  2IML A;  2D0T A;  1HNX T;  4I2W A;  2MRI A;  2P9B A;  2NYJ A;  1D0X A;  1JUQ A;  4U72 A;  4DV2 T;  1JWF A;  3CHP A;  2XSA A;  2L0I A;  2HM8 A;  4J8S A;  2LHN A;  4TV3 A;  2AW6 A;  1NAF A;  3OYZ A;  2D5U A;  3SO8 A;  5FZR A;  3BG1 B;  3TAX A;  5HQ8 A;  4K0U A;  5EYP F;  4UVA B;  1S0P A;  3ONX A;  4HOQ A;  3CR3 A;  5LG3 A;  4GTO A;  1G73 A;  3SWH A;  3BQI A;  3A8Y C;  1XDP A;  3L6A A;  3CVQ A;  2MHK A;  3TLT A;  2EHO D;  2JMH A;  2V7L A;  3ZCI A;  3LJN A;  5LCY A;  4L2L A;  4U0U A;  3MYV A;  4DND A;  3B7U X;  3ZT5 A;  4HFG A;  1YQ3 A;  2BZB A;  3N2G E;  4DR3 T;  3KBU A;  2XZD G;  3N9O A;  1N52 A;  5JDM A;  5JH7 E;  3E37 A;  3ZRH A;  4CDM A;  5LG4 A;  3TWR A;  2LSV A;  2W67 A;  1SW6 A;  3UU6 A;  4KBQ A;  4UWH A;  1HE8 A;  4O4I E;  2L6B A;  1SA4 A;  3TLV A;  3LJC A;  2LE8 A;  3CHO A;  2ZIS A;  5AQK B;  5JDL A;  3PNL B;  4EEC A;  5EDS A;  4WNF A;  2Y4T A;  4DID B;  2FI7 A;  4ATG A;  2KWI B;  2CG3 A;  1Z0P A;  2LHR A;  3CVY A;  3Q5E A;  3Q5M A;  3ZMS B;  4A63 B;  3DSS A;  2XGM A;  4PK4 A;  4N3A A;  4B93 B;  5L3E B;  3ZKR A;  5T3R A;  4U74 A;  4Z68 A;  2LRL A;  2LM9 A;  3P4W A;  3ASG A;  4B3T T;  3U9W A;  4N5Q A;  2VGY A;  3C3Q A;  4U7I A;  1ELW A;  4GZ5 A;  1YW0 A;  4CT0 A;  2GRM A;  3B7B A;  4TXR A;  3LBX B;  3VU7 H;  1H6P A;  2NOX A;  2H7O A;  3ASF A;  1N9A A;  4B0Z A;  1TN6 A;  1TEZ A;  2FJA A;  3RIU C;  4CXY A;  1OWA A;  2H7V C;  3C72 A;  3BEE A;  2OCC E;  5T4Y A;  1SQM A;  3CML A;  3FZM B;  1IBK T;  2VQ2 A;  3U78 A;  4DK5 A;  3RYF E;  2DWG A;  3KEA A;  2KMF A;  5CHE E;  4PFP A;  4U31 A;  3D9K A;  2J47 A;  2J4G A;  5FQ6 A;  2DCF A;  2JEK A;  5CFB A;  4MBQ A;  2V5Q C;  5LOZ A;  1BI7 B;  4APF A;  1WYB A;  3QKY A;  3BQK A;  3ETV A;  4ZS3 A;  2Q7F A;  2X68 A;  4FUL A;  2CLY C;  2L0T B;  3FHN A;  1M62 A;  2ION A;  5LYJ E;  1SZ9 A;  4O4J E;  4JBW F;  5ANL A;  3OKQ A;  4BJM A;  3MX3 A;  2E9X C;  2WU2 A;  1KZO A;  1ZU2 A;  5BT1 A;  2J09 A;  2LOS A;  3FUI A;  4BJN A;  4EPZ A;  3G2V A;  3NOC D;  2R59 A;  3G2T A;  3MA9 A;  3DPD A;  4LSZ E;  2Y1L E;  4XE0 A;  3KDS E;  4TZ4 C;  5HXH A;  4L9P A;  3HDX A;  3RYC E;  4ADZ A;  1ZB1 A;  1X5B A;  4CGW A;  1NA0 A;  4FI5 A;  4NUV A;  3FU0 A;  2AWI A;  3FXD B;  4GTM A;  5LB7 B;  3AXJ B;  5A1L A;  5BR8 T;  4YTM A;  4X65 T;  1MX4 A;  4ZZC A;  2WDV A;  5AAO A;  2Q9Q B;  3TWS A;  3RRU A;  2XGS A;  2PL2 A;  4PH4 B;  2VGE A;  4K0K T;  1IHG A;  4U3C A;  3RI5 A;  3JC6 D;  4MAL A;  2UXB T;  3QAR A;  1JWG A;  2X0H A;  3B13 A;  4P09 A;  2WS3 A;  4HI8 A;  3JQ0 A;  4DO0 A;  2VK9 A;  4IRU A;  4N3B A;  5E76 A;  5FQ7 A;  4BX8 A;  3RU0 A;  4DX5 D;  5FY0 A;  3NKZ A;  3P50 A;  2Y4U A;  2VJ8 A;  4J8Y A;  3Q5W A;  2DLR A;  1HXI A;  5L3C B;  3IHR A;  3AE1 A;  2D9D A;  1XZY A;  1RW2 A;  5FQ8 A;  4AQG A;  4U33 A;  3MZL B;  4X62 T;  5JQG E;  3MKQ B;  5AQB A;  3SRZ A;  2IC9 A;  1TNO A;  3UFG A;  4LFB T;  5A7D B;  3ULQ A;  3AS5 A;  3NQP A;  1H0A A;  2R05 A;  2XAS B;  3G06 A;  1N4R A;  5AN8 A;  5FT9 A;  1DC2 A;  5KBA A;  5KNG A;  2RA1 A;  2YDQ A;  3P4R A;  1KFY A;  1MX2 A;  4I1M A;  5AIJ A;  5HAX A;  1FEW A;  5LP6 E;  2BED A;  4DR6 T;  5EKQ D;  2Y6X A;  2XAJ B;  1YYH A;  2KZT A;  1LVF A;  3FBZ A;  2XM2 A;  2CMR A;  4QKN A;  2JIW A;  1WR0 A;  3FUM A;  2VKJ A;  5KXJ A;  5CED B;  5LP0 A;  3N9N A;  4UF0 B;  5GON E;  2XQY A;  5EYL A;  1S35 A;  1V55 E;  3UM0 A;  3DTO A;  4O1O A;  3R7Q A;  1OT8 A;  3QB5 A;  1OWO A;  3C50 A;  4XKC A;  4PJM A;  4YT0 A;  1MIY A;  1H6K A;  3ETU A;  1T7S A;  3UT4 A;  4LFC T;  3ASO E;  4P29 A;  4U63 A;  2BG9 E;  5CA0 E;  3VR8 A;  4WAF A;  4WWO A;  4XZ4 A;  3AEG A;  3AA7 B;  4JB8 P;  4KI0 F;  3WI3 A;  4I1O B;  4XX5 A;  2YDS A;  3MKR A;  4JI0 T;  2NTX A;  2GRP B;  2LXL A;  4HRN A;  4AQF A;  2LRK A;  3EJN A;  3TJP A;  3PJA J;  4HS2 A;  1DU2 A;  2GRL A;  4UQZ A;  5AQN B;  3HR0 A;  1FT1 A;  4H9P C;  3CVL A;  3D3M A;  1U2V G;  3RQU A;  5D2M C;  4JI2 T;  2MBG A;  1OY3 D;  5EIB E;  5AQJ B;  2ETA A;  3AG1 E;  1Y8M A;  3I9Y A;  5BXU A;  3AG2 E;  3EDU A;  3FTU A;  3RX6 A;  1WLX A;  4AKR B;  1HR0 T;  3V2O A;  1N36 T;  2HO1 A;  4IDP A;  2E9X B;  2N1G A;  2XQA A;  5FXZ A;  3C64 A;  4DJA A;  3FB2 A;  4HFD A;  3FTX A;  3NRX A;  2D0U A;  3LXU X;  2JLB A;  3K3Q C;  4ZI7 E;  4ZI3 D;  2V6X A;  3KEZ A;  3FXE B;  4Y6W A;  2XQ6 A;  3Q75 A;  3N2K E;  5CEA A;  3SFZ A;  1Z6T A;  5J2T E;  2I1J A;  3ZYK A;  4G2A A;  4UR9 A;  2RFM A;  3EHR A;  4O8S A;  2AXZ A;  2L9B A;  5FQ4 A;  2PJQ A;  3CST A;  3FUK A;  4I6G A;  5D0O D;  1MMN A;  3PUA A;  1KPS B;  1YCS B;  4ANU A;  3ONJ A;  5IWA T;  2ZM0 A;  4DV0 T;  4URK A;  3Q5X A;  4HFV A;  5F5W A;  4P1N A;  4AI6 A;  4JHJ A;  4LEU A;  4DR7 T;  1TNZ A;  2WZI A;  2RD0 A;  4ZFH A;  2L3L A;  2LSG A;  1J1J A;  5AQP B;  2X6I A;  3NZP A;  2OOE A;  3W9F A;  5L4H A;  4F6R D;  1EPU A;  3CX6 B;  3CVU A;  2XEN A;  3MV3 B;  2LOP A;  2J4D A;  4LNU D;  3WAJ A;  1HS7 A;  3ZMT B;  4HI9 A;  4ANW A;  4ZHQ E;  4IL9 A;  3DSV A;  1BPO A;  3FH7 A;  3RKG A;  4JI3 T;  2R02 A;  4I17 A;  3FZF B;  2XPI A;  2ETB A;  3T1H T;  2XPZ A;  4E85 A;  2J62 A;  1EZ3 A;  4G26 A;  2A4Z A;  4DUY T;  4KHP T;  1YMP A;  5DIZ A;  1S63 A;  4LMJ A;  2H88 A;  4DX6 D;  3CPZ A;  3NZQ A;  3L09 A;  3I3N A;  1IAP A;  3APC A;  5EN5 D;  4DR4 T;  2P9N G;  2WPV A;  3ZT7 A;  4TWH A;  3NBN B;  4CI3 B;  5AQL B;  3PU8 A;  1N0Q A;  2YN6 A;  3AB3 B;  2A72 A;  3LK4 2;  5CMW A;  3CVP A;  3PUX F;  5B1A E;  3KS2 A;  4CT4 A;  3L8R A;  2YOE A;  2XAH B;  1D8E A;  4WNE A;  4G8K A;  3ASH A;  4BES A;  5H6R B;  4TNW A;  1KT1 A;  3JAD A;  4CEM A;  4N39 A;  3QWP A;  2PQR A;  4BY6 A;  4CXX A;  3LFM A;  2VGX B;  3NZS A;  3TWU A;  3ZMU B;  2XAF B;  3ZUV B;  2W63 A;  4JUY A;  3B7S A;  2NW8 A;  2XRY A;  4FU3 A;  1KF6 A;  3JC6 C;  2E5L T;  4OYS A;  3ONL C;  2BS2 A;  4GYS A;  1W3B A;  5LX8 A;  3FH8 A;  3QWW A;  3LPZ A;  3S7B A;  3L16 A;  4HOS A;  4HOT A;  3GZS A;  3SQV A;  4O4L E;  1UN8 A;  1Z3Y A;  3EIQ C;  2ZGG A;  4AKH A;  3PZD A;  2Y69 E;  3G2W A;  5ENR D;  5FP3 A;  3FDH A;  4XI9 A;  1KZP A;  3PZ1 A;  2W2U A;  1H2V C;  4C0E A;  3RKV A;  1MYO A;  4LF8 T;  3GMI A;  3EU9 A;  1Z5S C;  3R84 B;  2PM6 A;  3LDZ A;  4PS3 A;  4F1S A;  3TWV A;  4KUM B;  2B1E A;  4ILU A;  3KV6 A;  2KND A;  2OVF A;  2XSB A;  3C98 B;  2NWB A;  2KIN B;  3TGO A;  2PM7 A;  4K5B A;  5HWY A;  5AAR A;  2XQ8 A;  4DRX E;  2CHW A;  1WRD A;  4Q25 A;  4K5A B;  3NF1 A;  5LA6 E;  1OXJ A;  2C5K T;  1UX5 A;  2WXI A;  1E8X A;  3KSL A;  3SHF A;  1KEY A;  2LSU A;  1N4Q A;  2XAG B;  2AXV A;  2KC7 A;  3FTZ A;  5JDN A;  2VKO A;  1H19 A;  5KJM A;  2L6J A;  3EU5 A;  4JLE A;  3TXN A;  2X0Y A;  1UJJ A;  5AQT B;  5KWD A;  4HWD A;  2KCK A;  3B5M A;  1O1S A;  3TWT A;  2AE9 A;  2BG9 A;  3OAW A;  4GTS A;  4PJL A;  3BU8 A;  1HF8 A;  1GW6 A;  4U07 A;  3ZN0 B;  5LNK A;  1EF1 C;  2BG9 B;  4HWH A;  5A23 A;  2KM4 A;  4DV7 T;  4UI9 K;  3FUH A;  4QX7 B;  3C3O A;  2WQ6 A;  4IE4 A;  4CCA A;  5ENP D;  1N11 A;  5G55 A;  2LAH A;  5FKY A;  3UFE A;  4ISS A;  3DXK G;  4HLL A;  5CCM A;  2A5E A;  3RIF A;  2UXX B;  5JA4 D;  1N4S A;  4YY3 T;  4C0M A;  2CWO A;  4XKB A;  4NXN T;  1TNY A;  4KMO A;  2SPC A;  1J5E T;  4QH5 A;  3D9I A;  3ANW B;  2V4L A;  4IL4 A;  4JXT A;  4DUI A;  3CGH A;  2FO7 A;  4QXC B;  2GK9 A;  5L4E A;  2A5U A;  3KIN B;  3RRW A;  4CI2 B;  2OA5 A;  4E7S A;  4GPK A;  2BDE A;  4H63 V;  4C9B B;  5KJK A;  5AJL A;  2UU9 T;  3QB2 A;  3BQL A;  1LF8 A;  3VKH A;  5AQO B;  3DSW A;  4I55 E;  3ABK E;  3PUQ A;  3RSE G;  2VL0 A;  2ZXW E;  3I5P A;  1H2U A;  4UWL A;  2E2E A;  3UQ4 A;  4DMV A;  3PUK A;  3QK6 A;  2M67 A;  4HKA A;  1XDO A;  4BTA A;  3DWL G;  2MYS A;  2MAW A;  2XHE A;  2VYI A;  4TNV A;  1KNP A;  3QNU A;  1SA0 E;  4JA9 A;  4HWC A;  1BR0 A;  2KZT B;  3AAA C;  4UI9 C;  3TWX A;  2L8K A;  1GQE A;  5FL0 A;  1PY1 A;  3IBE A;  4X1I E;  4QX8 B;  4IN3 B;  3VLE A;  3ZCJ A;  3RYH E;  2C0M A;  4YTP A;  2KXP B;  4PW8 A;  4JI7 T;  2DI4 A;  4GK5 E;  2X3M A;  4EZK A;  3SBT B;  3E32 A;  4TV8 E;  2YDR A;  5LOV E;  3SI5 A;  3FUE A;  1R8I A;  4U8Y D;  3AVR A;  1XMO T;  2WP9 A;  1O3X A;  4J2C A;  2E0I A;  3QAQ A;  4JHK A;  5M4Y A;  4OAU C;  3AEB A;  5JRE A;  3S4U A;  3Q7F A;  3AA1 B;  5AQH B;  4BEP A;  4LF6 T;  5DAB A;  3ZPO A;  4ILA A;  5FYM A;  4AVX A;  1OWP A;  1IJ6 A;  4BT8 A;  3JXI A;  3T5V A;  3EIJ A;  5JJT A;  3UT8 A;  5CGM A;  2IF4 A;  1ZKE A;  4A3T A;  2P9U G;  2IHR 1;  5L47 A;  3SY2 A;  2WY2 A;  1OED A;  3OXF A;  2XPK A;  3ZFW A;  1WFD A;  3U64 A;  3X1D A;  3AE2 A;  4V1A v;  4IT4 A;  4DI3 A;  2J07 A;  4K0R A;  1SZA A;  4I1A A;  3AJI A;  3FZL B;  2X9H A;  4HFC A;  1YD8 G;  4O1P A;  4BTB A;  1VOM A;  4JI4 T;  3TG4 A;  5DBK A;  2PQN A;  1XGW A;  4WBN E;  4GCN A;  3UM3 A;  3K1S A;  1E8W A;  1MX6 A;  5FWQ A;  4BX9 A;  1S70 B;  2DHR A;  1HX8 A;  4BSZ B;  3HKE E;  3RRN B;  3L22 A;  2C0S A;  2PFV A;  2NTY A;  2V1D B;  3DBS A;  3CIA A;  2FO1 E;  3LBX A;  4DX2 A;  3CIR A;  4RG6 A;  4MRU A;  3HXD A;  1UW4 B;  1ZHC A;  1BU9 A;  3FUD A;  3ML8 A;  1H7C A;  3CKC A;  4C48 B;  2D2S A;  4I4T E;  3IA3 A;  3IV0 A;  3Q79 A;  3EAB A;  1E96 B;  5KJN A;  2LSK A;  4PFO A;  4AOF A;  4HRL A;  4CN1 A;  5BNW A;  3P4Q A;  1G8X A;  3UX4 A;  4JPS A;  4YSX A;  1D9S A;  2H6I A;  3HXF A;  5C1D A;  3SFE A;  3OBV E;  3L3P A;  4G24 A;  2B76 A;  2EIL E;  4TXP A;  3D9P A;  3UUM A;  4I6E A;  2KLQ A;  3PUV F;  2VL8 A;  4ZEY A;  3A7M A;  4HFH A;  3ZMZ B;  2CPT A;  2E5V A;  5J2U E;  1WAO 1;  4IGU A;  3R6N A;  3K3N A;  3AG3 E;  3AAE B;  4EIW A;  2GRR B;  5LHG B;  2XQ0 A;  4A1S A;  3CSF A;  4EAH A;  3UKR G;  4EBA A;  2M6B A;  3CHM A;  5JRC B;  3M3Z B;  1MMD A;  2WXH A;  4GTP A;  4K03 A;  4IE7 A;  4OAV B;  3FUL A;  3PZ3 A;  2AJA A;  5ARG A;  4UWF A;  3UQ7 A;  2DZO A;  4G23 A;  4U8V D;  3RO2 A;  1OWM A;  2I2O A;  4EHM A;  5FIO A;  4KYO B;  3RH3 A;  2ODV A;  4G25 A;  2VKD A;  3ZT6 A;  2EQX A;  3J5Q B;  3IHV A;  5CA1 E;  3DSX A;  1IBL T;  4KBM B;  4J8D A;  3PRE A;  5AYW D;  3DXM G;  2HH7 A;  3AEE A;  1WYC A;  3KD7 A;  3CQX C;  3ZPJ A;  2ETC A;  3ESK A;  3KV5 A;  3E22 E;  4DR2 T;  2XUE A;  5IY5 E;  3E08 A;  2XQ4 A;  2VVN A;  1ELR A;  4ANX A;  5J90 A;  4TUY E;  2BUG A;  2WAU A;  3H3M A;  2W00 A;  4U0Z A;  4DLQ A;  1LD7 A;  2OLT A;  2OV9 A;  2XQ9 A;  4KZC A;  1D1A A;  4B8C B;  3ANW A;  3IEE A;  1IXV A;  3GW4 A;  2KSR A;  1E8Z A;  1MQS A;  3JXJ A;  1WY6 A;  4G2V A;  4YHH T;  3U3I A;  2HPL A;  2IJG X;  2WXR A;  1QUU A;  4PDX A;  5M72 A;  3L54 A;  2YHC A;  2YKS A;  2CXL A;  4HEA A;  3QOU A;  5ETW A;  2NP9 A;  2H6F A;  3C3R A;  4IE6 A;  5E0O A;  3E4B A;  4NAC A;  3JCF A;  2LO6 A;  4JI1 T;  4DVD A;  3PUJ A;  4F53 A;  2DWZ A;  2BG9 C;  5KX5 E;  5BMV E;  3ZIM A;  2CHO A;  4GTV A;  2IOL A;  1O1R A;  3PE4 A;  2X6H A;  4AJW A;  5LJN A;  4JHR A;  3T1Y T;  4N5C A;  2X67 A;  1QYM A;  1DCQ A;  3IKO B;  3EAM A;  4MHC A;  2MTQ A;  1SE7 A;  2GRO B;  3DP7 A;  2WMO A;  3NZU A;  2X9Y A;  4B3R T;  4U96 D;  2IQC A;  2K3W A;  3PEV B;  4DV5 T;  2QRX A;  3ZLI A;  3IF8 B;  4HFI A;  3ULY A;  5DQV A;  3MZK B;  3ONK A;  1NP7 A;  3NOG D;  3V30 A;  3NRY A;  2LEH A;  2XS8 A;  4FC8 A;  2RP4 A;  5FXX A;  4EEB A;  2ZGD A;  3G2U A;  5AQU B;  5LHH B;  2RG8 A;  3H37 A;  3FTS A;  3JUE A;  2VTB B;  4FJZ A;  3SD5 A;  3NAW A;  2Z6E A;  2CHN A;  3IXE A;  1E7V A;  5IHY A;  2XM1 A;  4CGV A;  2PNN A;  3I0O A;  1KK7 A;  1AP7 A;  3PZ2 A;  4AV7 A;  5L3D B;  3O1J A;  3QC9 A;  3VKG A;  1DCE A;  5FXW A;  1UJK A;  3BUA A;  2QVA A;  3AEC A;  4EED A;  3MEK A;  3HIZ A;  4I50 E;  2W0G A;  3FTY A;  2AXD S;  2X6K A;  4U04 A;  1M7K A;  3UUX A;  2XJ7 A;  4UQY A;  1MMA A;  3MKD A;  4UUC A;  2W66 A;  4N78 D;  3AG4 E;  4GA2 A;  3LY8 A;  5FVK A;  4B89 A;  2V6Y B;  1Q2Z A;  3CVN A;  3N2O A;  5JHB A;  3Q4A B;  2OEV A;  3FP3 A;  4LCT A;  3F2E A;  3QUJ A;  3FHE A;  2ILR A;  2Y48 B;  2VAS A;  2H6G A;  4J7W A;  4JL0 A;  3DSU A;  1D0Y A;  2N9D A;  3OJA A;  2XEV A;  2PZI A;  2I9C A;  2NW7 A;  3UUL A;  3APD A;  4CN4 A;  2VSX E;  4LER A;  4U7E B;  4GYW A;  4UWG A;  4I0U A;  3HA4 A;  5JHA A;  1XNQ T;  3MKQ A;  3TLS A;  1OWN A;  4BFR A;  1MNE A;  1TNU A;  2P58 C;  1B89 A;  2V7K A;  4YDY A;  3HI2 A;  2BS3 A;  4PNI A;  3PH0 C;  3S7F A;  4CDN A;  4QXH B;  3OXL A;  2QYJ A;  3HXC A;  3P4S A;  3CK7 A;  4TX5 A;  5EK2 A;  2WB5 A;  3AE5 A;  5F8P A;  4ZHB A;  2YQ8 A;  3RIU A;  4ACK A;  2LNI A;  4LG6 A;  2R2L A;  5FJY A;  2CA5 A;  3PE3 A;  3SS1 A;  2Q9Q D;  3R7R A;  4UI9 J;  1OED E;  5CEC B;  2F37 A;  2NXP A;  2XEE A;  2WXN A;  2CHX A;  2WQ7 A;  3OTO T;  3I4G A;  4Q94 A;  4X5T A;  3CLJ A;  5ENN A;  3ASN E;  3PU3 A;  2ZM8 A;  2JAB A;  3EUV A;  3FTW A;  4KVM A;  1XWM A;  2M63 A;  5ADX L;  4RQI A;  3HXE A;  4GAA A;  5J0Z A;  2OV8 A;  3CK8 A;  1N0R A;  4ZS2 A;  2QYW A;  2EHO B;  3HVE B;  2HN2 A;  2EIN E;  1X81 A;  5LCW C;  5BUZ A;  1YKE B;  3R9A B;  3TKL B;  4CZZ B;  1QSD A;  2IO2 C;  1K8K G;  3FY4 A;  4YSZ A;  1N94 A;  2I6H A;  4ANV A;  2FUP A;  2LLY A;  3S7D A;  3GYZ A;  1KNR A;  2V5D A;  1MHQ A;  3BK9 A;  3AXJ A;  3AVS A;  1VCS A;  3FZH B;  3N9M A;  2WMN A;  3I9W A;  4H9Q C;  3CQG B;  3JYS A;  5E75 A;  2F8X K;  4GCO A;  4JV5 T;  1LRZ A;  5HI7 A;  3RJV A;  1FT2 A;  2V8S V;  4JC8 A;  2J8S D;  2KT9 A;  3KFW X;  2CRB A;  2UY1 A;  4GB9 A;  3ZYQ A;  5LHI B;  1DNP A;  5G2N A;  4M3O A;  3EDV A;  2AXU A;  2V8S E;  2VWA A;  4YTN A;  4U95 D;  4IE5 A;  1E1H B;  2VB6 A;  1KLX A;  1VDY A;  2J9Q A;  4DV4 T;  2KBX A;  2WWU A;  5LJM A;  4AIF A;  4Z91 A;  2X38 A;  1BI8 B; 
#chains in the Genus database with same CATH homology
 2XAQ B;  4XAX B;  4IE0 A;  3LK2 B;  2X51 A;  5L2L A;  2N2N A;  2NW9 A;  4UVB B;  4NUU A;  2K48 A;  5LXT E;  3CHR A;  2C0L A;  5TAO A;  1B7T A;  2YNQ A;  2QY7 A;  1X79 A;  4UIG A;  3LJ3 A;  4ZOL E;  4QFV A;  3CVV A;  4HLE A;  3D0T A;  3AA0 B;  1Y64 B;  3MJX A;  2XTL A;  1Y6I A;  2V7I A;  4PUC A;  3D9N A;  4F6R C;  5EK3 A;  4TV9 E;  4MLK A;  4I43 B;  1IQU A;  2DIW A;  1OXZ A;  3CKD A;  2BF0 X;  2DBA A;  4CI1 B;  3K3O A;  3CHQ A;  4UF0 A;  2K9A A;  4JEU A;  3CEQ A;  4HTE A;  4EBA G;  5JRC A;  4PK5 A;  4OFZ A;  4H9O C;  4XBF B;  3QJZ A;  2BVL A;  3LEW A;  2LSY A;  4UXN B;  4OYK A;  4HOU A;  2LT3 A;  4ILH B;  2ZM2 A;  3VTX A;  3LYA A;  3O1H A;  5HWX A;  3UUX B;  4I6J A;  4CRW A;  4GA1 A;  4HGA A;  4TRQ A;  4X20 E;  2Q9Q C;  5CB4 E;  3FEX A;  2MOW A;  2R5S A;  3P7I A;  1NZN A;  4PS7 A;  1VRB A;  4YHJ A;  5JR9 B;  3PEU B;  3FBL A;  2VGX A;  3G2S A;  2GW1 A;  4L7T A;  1HG2 A;  4NRH B;  4YLH A;  2WXK A;  4X1Y E;  1IQR A;  3D9O A;  3KBT A;  4P0A A;  3CHS A;  4WWP A;  3ZW3 A;  1N54 A;  2HYZ A;  3LKU A;  5EZY E;  3RRC A;  3ZHE A;  4A3V A;  4KVO A;  5D0Q D;  4HXI A;  4EOZ B;  4AXH A;  3VLF A;  1INZ A;  5BW8 C;  3C51 A;  5H6Q B;  4GIW A;  3MV2 B;  3AAA B;  4IIJ E;  4GZ6 A;  3I0Q A;  2V7J A;  4A1G A;  4H9R C;  4F7A A;  3M65 A;  1V9D A;  3RC8 A;  4GU5 A;  2YIN A;  1NWM X;  3GZ2 A;  3L08 A;  3ESL A;  2JRK A;  1FVF A;  4ME2 A;  5G04 C;  2WXO A;  3SGH A;  3PE0 A;  2UXN B;  3RO3 A;  4EQF A;  2YHE A;  4KXK B;  2CFZ A;  5G05 J;  5KCM A;  1HH8 A;  1PAQ A;  3AU5 A;  2V5F A;  1U5P A;  1LVK A;  3QDN A;  3HYM B;  1OUV A;  1D1C A;  1EDU A;  4AKL A;  3EHM A;  2ZMA A;  1E90 A;  4I9E A;  3CX8 B;  2V0P A;  3S2A A;  3HHM A;  4OHF A;  2X0L B;  3NBX X;  3MAC A;  3K9I A;  3LVR E;  5JDF A;  2I59 A;  4GOU A;  5JDG A;  1QZ2 A;  4WNG A;  4HOR A;  4OVV A;  2BTD A;  2A2F X;  3SBS A;  4GZD A;  4L2Y A;  2ODU A;  2E9X D;  1HS6 A;  3J7Y q;  2LSJ A;  4APO A;  3CVX A;  2CG2 A;  3CWZ B;  3Q47 B;  4QWN B;  3S7J A;  4HVB A;  4AEZ C;  5A6C A;  3GWH A;  3ASD A;  4FA6 A;  1HCI A;  4FHJ A;  3ZEF B;  4EB6 E;  1BR2 A;  4YJ3 E;  3PS6 A;  1MIW A;  3U3W A;  4QXB B;  4N3C A;  5BV1 A;  3T8M A;  3UQ3 A;  3D9L A;  3HKB E;  4L23 A;  2DWK A;  4E7Z A;  3LG7 A;  3AA6 B;  2LJL A;  2KWH A;  3APF A;  2CFU A;  2WVI A;  4JEH A;  3O1I A;  2XPY A;  4H7X A;  3U66 A;  2KCV A;  2HPJ A;  3B57 A;  2FEZ A;  2EHO A;  3HVE A;  2C5I T;  4WBO A;  3AS4 A;  3B7T A;  4J6I A;  3EVY A;  3T8O A;  1UG3 A;  5JDQ A;  4EZJ A;  3OYX A;  1IYG A;  3F31 A;  3VHL A;  2CHZ A;  3H3A A;  2C2L A;  4PK6 A;  1U4Q A;  3ZGQ A;  2KZ7 B;  3RRM B;  4N2Q A;  1UN9 A;  5L3F B;  3FH5 A;  4EZL A;  1US7 B;  3B7R L;  3QK0 A;  1MND A;  3PNT B;  4UV9 B;  2OND A;  5CCL A;  2WXP A;  4P0B A;  4FJO A;  3MJW A;  3IBP A;  3ZJ2 A;  2J49 A;  2W61 A;  5AJD A;  4BT9 A;  4NQ0 A;  4HE8 A;  4I9C A;  4FLH A;  5KJL A;  1WM5 A;  2C5J A;  2L9Q A;  2CM0 A;  4CDR A;  3I1A A;  1S94 A;  5J08 A;  3LCA A;  3MA5 A;  3URZ A;  3PUS A;  4J0U A;  3UT7 A;  2LAI A;  3W15 B;  3PTR B;  4G1T A;  3IEG A;  5L3B B;  3SZ7 A;  2WXM A;  3C4X A;  2ACX A;  1TJC A;  2XGO A;  3HL6 A;  1EYH A;  3VTY A;  2X6F A;  5F3J A;  1IZN B;  2CE7 A;  3UMV A;  3AS8 A;  1H2T C;  5FTP A;  3PUR A;  1D1B A;  3EDT B;  3FEY A;  3PUG A;  5BV0 A;  2Y8D A;  5FZQ A;  3LVQ E;  4NUR A;  2VKH A;  1KT0 A;  2ES0 A;  2XRZ A;  4FAD A;  4YFS A;  2IC6 A;  2YK0 A;  3V5U A;  2WXG A;  4B94 A;  3ZYL A;  4A55 A;  5HXR A;  1P5Q A;  1MIV A;  4JEH B;  3L17 A;  4L0R A;  3ZN3 A;  3ZMV B;  1E8Y A;  2CWY A;  3O4Z A;  4MKT A;  4AM9 A;  2IOS A;  3KV9 A;  1KNZ A;  4WND A;  4ABN A;  3FWV A;  5FY7 A;  2VTB A;  4BSX A;  2WXF A;  2X9W A;  3CX7 B;  1NA3 A;  3CKB A;  3FUJ A;  3PRZ A;  4LUN U;  4B6X A;  1WR6 A;  3DJB A;  1CUN A;  3N5L A;  2V7M A;  3CQC B;  3UT5 E;  3GZ1 A;  2FUL A;  4O2A E;  5LBM A;  4CXW A;  4HN9 A;  5LFA A;  3TL5 A;  2K24 A;  1BR4 A;  4O2B E;  4MS6 A;  2V26 A;  3ZVV A;  4DPR A;  3N71 A;  4WWN A;  4IUL A;  2WXQ A;  4FP7 A;  3CVR A;  1BR1 A;  3ENE A;  3Q15 A;  2XCB A;  3PDN A;  4U8H A;  5EK4 A;  5LCW J;  4M1P A;  4PAG A;  1PC2 A;  3ML9 A;  2DNX A;  1UX4 A;  2QA7 A;  4GML A;  1OWL A;  4AQF C;  5FZS A;  2CCQ A;  5JVD E;  4DMW A;  4ZI3 C;  5BPP A;  4U0S A;  1JPL A;  5HXS A;  1E7U A;  2YU2 A;  3LS8 A;  2XHE B;  2OVB A;  4I43 A;  2I1K A;  3N9Q A;  5FY1 A;  1QNF A;  2IFU A;  2JJ9 A;  1FMW A;  4AXP A;  3A5X A;  5LGT B;  2W62 A;  1HTJ F;  4ZI2 C;  4H9S E;  4Z8X A;  5FNV E;  3C4Z A;  5G05 C;  3EUH A;  4KZ0 A;  3Q49 B;  4Q96 A;  2KAT A;  3D9M A;  2PG8 A;  4KP3 C;  4AP2 A;  3FFL A;  3ZN1 B;  4ILG A;  4OK0 A;  3LK3 B;  2PBI A;  2A3D A;  3FU5 A;  4DBQ A;  4QHO A;  2Y3A A;  1FCH A;  4UQX A;  3CK9 A;  4AY6 A;  5C8Y E;  4RVB A;  3P2B A;  1HG5 A;  4J8F A;  4AKI A;  4MLP A;  3CVW A;  3GA8 A;  2WBL A;  4R7L A;  4XI0 A;  4IST A;  1A17 A;  1TJF A;  3CV0 A;  2UY1 B;  3KVA A;  2J1D G;  3RIB A;  1YA0 A;  4XIF A;  2CEA A;  4EXT A;  1HZ4 A;  3KAE A;  1ZEE A;  2JPF A;  4ASK A;  4Y6C A;  4BWR A;  5ARF A;  4FJY A;  2WQH A;  4GA0 A;  4AY5 A;  4IHJ E;  3MCX A;  2E9X A;  4TN7 B;  3GN5 A;  3JUI A;  2IAK A;  4GZC A;  5AFU L;  4F3V A;  5AEN A;  2GGF A;  3K8P C;  4X1K E;  4GK0 E;  4CQI A;  3T5X A;  2WXL A;  3I4R B;  3RK6 A;  4O4H E;  4GYO A;  3ZC1 A;  2VSY A;  2HR2 A;  4ERR A;  2NC9 A;  4OVU A;  5KDM C;  2ZU6 B;  3RKO A;  4ILI A;  3C4W A;  3ZEF A;  4BA9 A;  3RYI E;  4IYP A;  3C98 A;  4UV8 B;  4J8E A;  2UWJ G;  1D0Z A;  4EYU A;  5G04 J;  3FTV A;  5EX0 A;  3SF4 A;  3P1U A;  2J4B A;  4TUU A;  4WUY A;  3O9X A;  3FUN A;  4G11 A;  4GZ3 A;  4YVO A;  3D9J A;  1MMG A;  1ZBP A;  4L9I A;  3TG5 A;  2VSO E;  1Z3X A;  2JMK A;  4DI4 A;  2LSI A;  3RPU A;  3F57 A;  3OTN A;  2VSN A;  3PVL A;  5JJ6 A;  5EX3 A;  4LRZ A;  4UVC B;  3UTK A;  2IU1 A;  3FUF A;  3OXG A;  3N9L A;  4V3I A;  2CXF A;  2QFC A;  1AJ3 A;  4N2S A;  2X9X A;  4OYJ A;  4YND A;  2BVM A;  4H9N C;  4L5G A;  2QGS A;  1ELK A;  3ZXS A;  3EHN A;  3TXM A;  1HFA A;  3JQ1 A;  2WM9 A;  3JCK C;  3WXX A;  1FIO A;  4EZ4 A;  4UWK A;  2Q9Q A;  4UEL A;  2KCL A;  3MGB A;  1HO8 A;  5CMY A;  2AVP A;  4JZY A;  5JR9 C;  2ZLY A;  3MXZ A;  2J08 A;  3BG0 B;  5LBQ B;  4DBR A;  3QWV A;  4YJ2 E;  2XCC A;  3LY9 A;  1FMV A;  1XNF A;  4RG9 A;  4WNK A;  2EHO C;  3ONL A;  4XZC A;  4I2Z A;  2JQQ A;  4PJN A;  2DCP A;  5KMG P;  2FF4 A;  3QNK A;  2K5B B;  1L5J A;  3Q9D A;  3ZHE B;  1HU3 A;  1LKX A;  1U3D A;  2YU1 A;  4DLO A;  3O4X E;  4B8A A;  1YKH B;  3KVB A;  5LGU B;  4WW0 A;  4KMC A;  5HYA A;  3LY7 A;  5L3G B;  4C91 A;  4KT6 B;  3WAK A;  3U4T A;  3SOL A;  3PDY A;  2R17 C;  3SNX A;  4PJJ A;  5J1G A;  4W9R A;  4EYY R;  2H3R A;  5LGN B;  3VLD A;  1DVP A;  1IJ5 A;  4D10 C;  3IHY A;  3E0Z A;  2WSS V;  4JEU B;  2WB2 A;  4GYY A;  4ANJ A;  4C90 A;  5FMN A;  3HKD E;  4JA7 A;  5JJ7 A;  3P8C D;  1U3C A;  3MK7 C;  4ZI2 D;  2CLY B;  3UPV A;  3KV4 A;  1FVH A;  4YVQ C;  3QC1 A;  4JVS A;  4GYR A;  4UEM A;  3J9X 1;  5DJQ C;  4ACL A;  2IW5 B;  4Q69 A;  1ZV4 X;  4O6F A;  4L1B A;  1T98 A;  4E6H A;  4PS8 A;  4BAY B;  2WXJ A;  5ANR A;  4EZH A;  5FXV A;  4A56 A;  3FU6 A;  4H7Y A;  4IDZ A;  5IYZ E;  3FU3 A;  5JDH A;  3L13 A;  4H63 H;  5HXE A;  5JR9 A;  1QQE A;  4AKG A;  2MOZ A;  3HKC E;  3RC3 A;  5HXC A;  2X66 A;  2FBN A;  4JW1 A;  1UCU A;  3AU4 A;  5T8I A;  3ZC0 A;  4GMJ A;  3N9P A;  3UUN A;  4FHK A;  3ZJ1 A;  3GN5 B;  2YEV C;  4FLB A;  4G63 A;  2NSZ A;  3O48 A;  4MFR A;  4RSY A;  5DQW A;  1SHZ C;  3AAI A;  2X6J A;  2G0U A;  3V5S A;  2E8I A;  2CXD A;  3Q2M A;  3ZYM A;  5C2Y A;  2D0T A;  4I2W A;  2MRI A;  2P9B A;  1D0X A;  1JUQ A;  4U72 A;  1JWF A;  3CHP A;  2L0I A;  2HM8 A;  4J8S A;  2LHN A;  4TV3 A;  2AW6 A;  1NAF A;  3OYZ A;  2D5U A;  5FZR A;  3BG1 B;  3TAX A;  5HQ8 A;  4K0U A;  4UVA B;  1S0P A;  3ONX A;  4HOQ A;  3CR3 A;  1G73 A;  3SWH A;  3BQI A;  3L6A A;  3CVQ A;  2MHK A;  2EHO D;  2JMH A;  2V7L A;  3ZCI A;  5LCY A;  4L2L A;  4U0U A;  3MYV A;  4DND A;  3B7U X;  4HFG A;  2BZB A;  3N2G E;  3KBU A;  3N9O A;  1N52 A;  5JDM A;  5JH7 E;  3ZRH A;  4CDM A;  5LG4 A;  2LSV A;  4KBQ A;  4UWH A;  1HE8 A;  4O4I E;  3LJC A;  2LE8 A;  3CHO A;  5JDL A;  3PNL B;  4EEC A;  5EDS A;  4WNF A;  2Y4T A;  4ATG A;  2FI7 A;  2KWI B;  2CG3 A;  1Z0P A;  2LHR A;  3CVY A;  3Q5M A;  3ZMS B;  2XGM A;  4PK4 A;  4N3A A;  5L3E B;  5T3R A;  4U74 A;  2LM9 A;  3ASG A;  3U9W A;  2VGY A;  1ELW A;  4GZ5 A;  1YW0 A;  4CT0 A;  2GRM A;  3LBX B;  3VU7 H;  2NOX A;  2H7O A;  3ASF A;  4B0Z A;  1TEZ A;  4CXY A;  1OWA A;  2H7V C;  3BEE A;  5T4Y A;  1SQM A;  3CML A;  2VQ2 A;  3U78 A;  4DK5 A;  3RYF E;  2DWG A;  2KMF A;  5CHE E;  4PFP A;  3D9K A;  5FQ6 A;  2DCF A;  2JEK A;  4MBQ A;  5LOZ A;  4APF A;  1WYB A;  3QKY A;  3BQK A;  3ETV A;  4ZS3 A;  2Q7F A;  2X68 A;  4FUL A;  2CLY C;  2L0T B;  3FHN A;  2ION A;  5LYJ E;  1SZ9 A;  4O4J E;  5ANL A;  3OKQ A;  4BJM A;  3MX3 A;  2E9X C;  1ZU2 A;  5BT1 A;  2J09 A;  2LOS A;  3FUI A;  4BJN A;  4EPZ A;  3G2V A;  2R59 A;  3G2T A;  3MA9 A;  3DPD A;  4XE0 A;  3KDS E;  4TZ4 C;  5HXH A;  3HDX A;  3RYC E;  4ADZ A;  1X5B A;  4CGW A;  1NA0 A;  4FI5 A;  4NUV A;  3FU0 A;  2AWI A;  3FXD B;  5A1L A;  2Q9Q B;  3RRU A;  2XGS A;  2PL2 A;  4PH4 B;  1IHG A;  3JC6 D;  4MAL A;  3QAR A;  1JWG A;  3B13 A;  4P09 A;  3JQ0 A;  4DO0 A;  2VK9 A;  4IRU A;  4N3B A;  5E76 A;  5FQ7 A;  4BX8 A;  3RU0 A;  5FY0 A;  2Y4U A;  2VJ8 A;  3Q5W A;  2DLR A;  1HXI A;  5L3C B;  3IHR A;  5FQ8 A;  4AQG A;  3MZL B;  5JQG E;  3MKQ B;  3SRZ A;  2IC9 A;  5A7D B;  3ULQ A;  3AS5 A;  3NQP A;  1H0A A;  2XAS B;  5FT9 A;  2RA1 A;  4I1M A;  5AIJ A;  5HAX A;  1FEW A;  5LP6 E;  5EKQ D;  2Y6X A;  2XAJ B;  2KZT A;  1LVF A;  3FBZ A;  2CMR A;  4QKN A;  3FUM A;  2VKJ A;  5LP0 A;  3N9N A;  4UF0 B;  5GON E;  2XQY A;  1S35 A;  3DTO A;  3R7Q A;  1OWO A;  3C50 A;  4XKC A;  4PJM A;  1MIY A;  1H6K A;  3ETU A;  3UT4 A;  4P29 A;  4U63 A;  5CA0 E;  4WAF A;  4WWO A;  4XZ4 A;  3AA7 B;  3WI3 A;  4I1O B;  4XX5 A;  3MKR A;  2NTX A;  4AQF A;  3EJN A;  3TJP A;  4HS2 A;  2GRL A;  4UQZ A;  3HR0 A;  4H9P C;  3CVL A;  3D3M A;  2MBG A;  1Y8M A;  3I9Y A;  3FTU A;  3EDU A;  3RX6 A;  1WLX A;  4AKR B;  2HO1 A;  2E9X B;  2N1G A;  5FXZ A;  3C64 A;  4DJA A;  3FB2 A;  3FTX A;  3NRX A;  2D0U A;  3LXU X;  2JLB A;  3K3Q C;  4ZI7 E;  4ZI3 D;  3KEZ A;  3FXE B;  4Y6W A;  3N2K E;  3SFZ A;  1Z6T A;  5J2T E;  2I1J A;  3ZYK A;  4G2A A;  4O8S A;  2AXZ A;  2L9B A;  5FQ4 A;  2PJQ A;  3CST A;  3FUK A;  4I6G A;  5D0O D;  1MMN A;  3PUA A;  4ANU A;  2ZM0 A;  4URK A;  3Q5X A;  4HFV A;  4AI6 A;  4JHJ A;  4LEU A;  2RD0 A;  2L3L A;  2LSG A;  2X6I A;  3NZP A;  2OOE A;  1EPU A;  3CX6 B;  3CVU A;  3MV3 B;  2LOP A;  2J4D A;  3WAJ A;  1HS7 A;  3ZMT B;  4ANW A;  4ZHQ E;  1BPO A;  3FH7 A;  4I17 A;  2XPI A;  2XPZ A;  4E85 A;  1EZ3 A;  4G26 A;  2A4Z A;  5DIZ A;  3CPZ A;  3NZQ A;  3L09 A;  3I3N A;  1IAP A;  3APC A;  2WPV A;  4CI3 B;  3PU8 A;  3AB3 B;  2A72 A;  3LK4 2;  5CMW A;  3CVP A;  3KS2 A;  4CT4 A;  2XAH B;  4WNE A;  3ASH A;  5H6R B;  1KT1 A;  4CEM A;  4N39 A;  3QWP A;  2PQR A;  4BY6 A;  4CXX A;  2VGX B;  3LFM A;  3NZS A;  3ZMU B;  2XAF B;  2W63 A;  4JUY A;  3B7S A;  2NW8 A;  2XRY A;  4FU3 A;  3JC6 C;  4OYS A;  1W3B A;  4GYS A;  5LX8 A;  3FH8 A;  3QWW A;  3LPZ A;  3S7B A;  3L16 A;  4HOS A;  4HOT A;  3GZS A;  4O4L E;  1UN8 A;  1Z3Y A;  3EIQ C;  4AKH A;  3PZD A;  3G2W A;  5FP3 A;  3FDH A;  4XI9 A;  1H2V C;  4C0E A;  3RKV A;  3GMI A;  3R84 B;  2PM6 A;  3LDZ A;  4PS3 A;  4F1S A;  4KUM B;  2B1E A;  4ILU A;  3KV6 A;  2KND A;  2OVF A;  3C98 B;  2NWB A;  2KIN B;  3TGO A;  2PM7 A;  5HWY A;  2CHW A;  1WRD A;  3NF1 A;  5LA6 E;  2C5K T;  1UX5 A;  2WXI A;  1E8X A;  3SHF A;  2LSU A;  2XAG B;  2AXV A;  2KC7 A;  3FTZ A;  5JDN A;  2VKO A;  1H19 A;  5KJM A;  2L6J A;  4JLE A;  3TXN A;  1UJJ A;  2KCK A;  3OAW A;  4PJL A;  1HF8 A;  1GW6 A;  4U07 A;  3ZN0 B;  5LNK A;  1EF1 C;  5A23 A;  2KM4 A;  4UI9 K;  3FUH A;  4QX7 B;  2WQ6 A;  4IE4 A;  4CCA A;  5G55 A;  2LAH A;  3UFE A;  4ISS A;  5CCM A;  2UXX B;  4C0M A;  2CWO A;  4XKB A;  4KMO A;  2SPC A;  3D9I A;  3ANW B;  4JXT A;  2V4L A;  3CGH A;  2FO7 A;  4QXC B;  2GK9 A;  2A5U A;  3KIN B;  3RRW A;  4CI2 B;  2OA5 A;  4E7S A;  4GPK A;  2BDE A;  4H63 V;  4C9B B;  5KJK A;  5AJL A;  3QB2 A;  3BQL A;  1LF8 A;  3VKH A;  4I55 E;  3PUQ A;  3I5P A;  1H2U A;  4UWL A;  2E2E A;  4DMV A;  3PUK A;  3QK6 A;  2M67 A;  4HKA A;  4BTA A;  2MYS A;  2XHE A;  2VYI A;  1SA0 E;  4JA9 A;  4UI9 C;  1BR0 A;  2KZT B;  2L8K A;  1PY1 A;  3IBE A;  4X1I E;  4QX8 B;  4IN3 B;  3VLE A;  3ZCJ A;  3RYH E;  2C0M A;  2KXP B;  4PW8 A;  2DI4 A;  4GK5 E;  2X3M A;  4EZK A;  3SBT B;  4TV8 E;  5LOV E;  3SI5 A;  3FUE A;  3AVR A;  4J2C A;  1O3X A;  2E0I A;  3QAQ A;  4JHK A;  5M4Y A;  5JRE A;  3S4U A;  3AA1 B;  5DAB A;  3ZPO A;  5FYM A;  4AVX A;  1OWP A;  1IJ6 A;  4BT8 A;  3T5V A;  3EIJ A;  5JJT A;  3UT8 A;  2IF4 A;  1ZKE A;  4A3T A;  3OXF A;  3ZFW A;  3U64 A;  4V1A v;  4DI3 A;  2J07 A;  4K0R A;  1SZA A;  4I1A A;  2X9H A;  4BTB A;  1YD8 G;  1VOM A;  3TG4 A;  5DBK A;  2PQN A;  1XGW A;  4WBN E;  4GCN A;  1E8W A;  5FWQ A;  4BX9 A;  2DHR A;  1HX8 A;  3HKE E;  3RRN B;  3L22 A;  2C0S A;  2PFV A;  2NTY A;  2V1D B;  3DBS A;  3CIA A;  3LBX A;  4RG6 A;  4MRU A;  1UW4 B;  1ZHC A;  3FUD A;  3ML8 A;  1H7C A;  3CKC A;  2D2S A;  4I4T E;  3IV0 A;  1E96 B;  5KJN A;  2LSK A;  4PFO A;  4AOF A;  5BNW A;  1G8X A;  3UX4 A;  4JPS A;  5C1D A;  3OBV E;  3L3P A;  4G24 A;  3D9P A;  3UUM A;  4I6E A;  2KLQ A;  2VL8 A;  3ZMZ B;  5J2U E;  1WAO 1;  4IGU A;  3R6N A;  3K3N A;  3AAE B;  4EIW A;  5LHG B;  2XQ0 A;  4A1S A;  3CSF A;  4EAH A;  4EBA A;  3CHM A;  5JRC B;  4K03 A;  1MMD A;  2WXH A;  4IE7 A;  3FUL A;  5ARG A;  4UWF A;  4G23 A;  3RO2 A;  1OWM A;  2I2O A;  4KYO B;  3RH3 A;  2ODV A;  4G25 A;  2VKD A;  2EQX A;  3IHV A;  5CA1 E;  4KBM B;  4J8D A;  3PRE A;  5AYW D;  2HH7 A;  1WYC A;  3KD7 A;  3CQX C;  3ZPJ A;  3ESK A;  3KV5 A;  3E22 E;  2XUE A;  3E08 A;  1ELR A;  4ANX A;  5J90 A;  4TUY E;  2BUG A;  2WAU A;  2W00 A;  4U0Z A;  4DLQ A;  4KZC A;  1D1A A;  4B8C B;  3ANW A;  3IEE A;  3GW4 A;  1E8Z A;  1MQS A;  1WY6 A;  4G2V A;  3U3I A;  2HPL A;  2IJG X;  2WXR A;  1QUU A;  4PDX A;  5M72 A;  3L54 A;  2YHC A;  3QOU A;  2CXL A;  4HEA A;  5ETW A;  2NP9 A;  4IE6 A;  5E0O A;  3E4B A;  4NAC A;  2LO6 A;  4DVD A;  3PUJ A;  4F53 A;  5KX5 E;  5BMV E;  3ZIM A;  2IOL A;  3PE4 A;  2X6H A;  4AJW A;  5LJN A;  4JHR A;  4N5C A;  2X67 A;  3IKO B;  4MHC A;  2MTQ A;  3DP7 A;  2WMO A;  3NZU A;  2X9Y A;  2IQC A;  3PEV B;  3ZLI A;  3IF8 B;  5DQV A;  3MZK B;  3ONK A;  1NP7 A;  3NRY A;  2LEH A;  4FC8 A;  2RP4 A;  5FXX A;  3G2U A;  5LHH B;  2RG8 A;  3H37 A;  3FTS A;  2VTB B;  4FJZ A;  3SD5 A;  2Z6E A;  1E7V A;  5IHY A;  4CGV A;  3I0O A;  1KK7 A;  4AV7 A;  5L3D B;  3O1J A;  3QC9 A;  3VKG A;  5FXW A;  1UJK A;  3MEK A;  3HIZ A;  4I50 E;  2W0G A;  3FTY A;  2X6K A;  4U04 A;  3UUX A;  4UQY A;  1MMA A;  3MKD A;  4N78 D;  4GA2 A;  3LY8 A;  4B89 A;  3CVN A;  5JHB A;  3N2O A;  3Q4A B;  3FP3 A;  4LCT A;  3F2E A;  3FHE A;  3QUJ A;  2ILR A;  2Y48 B;  2VAS A;  4JL0 A;  1D0Y A;  2N9D A;  3OJA A;  2XEV A;  2PZI A;  2I9C A;  2NW7 A;  3UUL A;  3APD A;  2VSX E;  4LER A;  4GYW A;  4UWG A;  3HA4 A;  5JHA A;  3MKQ A;  1OWN A;  4BFR A;  1MNE A;  2P58 C;  1B89 A;  2V7K A;  3HI2 A;  4PNI A;  3PH0 C;  3S7F A;  4CDN A;  4QXH B;  3OXL A;  3CK7 A;  4TX5 A;  5EK2 A;  5F8P A;  2YQ8 A;  4ACK A;  2LNI A;  5FJY A;  2CA5 A;  3PE3 A;  3SS1 A;  2Q9Q D;  3R7R A;  4UI9 J;  2NXP A;  2WXN A;  2CHX A;  2WQ7 A;  3I4G A;  4Q94 A;  3CLJ A;  5ENN A;  3PU3 A;  2ZM8 A;  3FTW A;  4KVM A;  2M63 A;  5ADX L;  4GAA A;  2OV8 A;  3CK8 A;  4ZS2 A;  2EHO B;  3HVE B;  5LCW C;  5BUZ A;  1YKE B;  3R9A B;  3TKL B;  4CZZ B;  1QSD A;  3FY4 A;  2I6H A;  4ANV A;  3S7D A;  3GYZ A;  1MHQ A;  3BK9 A;  3AVS A;  3N9M A;  2WMN A;  3I9W A;  4H9Q C;  3CQG B;  3JYS A;  5E75 A;  4GCO A;  1LRZ A;  5HI7 A;  3RJV A;  4JC8 A;  2KT9 A;  3KFW X;  2UY1 A;  4GB9 A;  3ZYQ A;  5LHI B;  1DNP A;  5G2N A;  4M3O A;  3EDV A;  2AXU A;  2V8S E;  2VWA A;  4IE5 A;  1E1H B;  2VB6 A;  1KLX A;  1VDY A;  2J9Q A;  2WWU A;  5LJM A;  4AIF A;  2X38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...