3CQGB

Nucleoporin nup107/nup133 interaction complex, delta finger mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
184
Chain Sequence
LSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDENINDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADFEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
total genus 59
structure length 184
sequence length 222
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqgB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqgB02
3CQCB 3CQGB 3I4RB
chains in the Genus database with same CATH superfamily
4EZLA 3Q2MA 3D9IA 4MBQA 4YLHA 4U96D 2XAJB 5JREA 2YN6A 4HEAA 5E75A 4OAUC 4DV3T 1U3DA 2Q9QC 3AS4A 5JQGE 2Q9QD 1OCRE 3P8CD 3U64A 5ENNA 4DPRA 2AJAA 1G8XA 1HS6A 3AS8A 1IAPA 2VSOE 2X6KA 4XI0A 4HFEA 1LVFA 2HO1A 3RYCE 1AWCB 4UUCA 4K0KT 4U0UA 4CDRA 4CEMA 5EK4A 2GRNB 1OWPA 4UIGA 5KWDA 2Y3AA 3EIQC 4HOQA 4GTRA 4I6EA 2RPAA 5HXEA 4ERRA 2WDQA 2P9PG 3ZCJA 3VU7H 3KFWX 4EAHA 3GW4A 4U74A 4CDMA 4TUYE 2IOSA 2W63A 4EB6E 3MK7C 5FIOA 5E76A 4WWPA 4IE4A 5FZSA 4FC8A 3V79K 3LCAA 2KC7A 2J08A 1TN6A 3UINC 1D0YA 1T98A 4I1OB 4C90A 1Z3YA 4DLOA 2VKOA 3LBXB 3FZMB 5FL0A 1EYHA 2I59A 3QB5A 5AENA 2KXPC 3C3OA 3KD7A 4LNUD 1YW0A 5AQOB 1BI8B 2OA5A 3AXJA 1B89A 3AAAC 4J6IA 4AI6A 1Z8UA 3FUHA 3U3WA 4GOUA 2HN2A 3RRUA 2E0IA 3P4RA 4GK0E 4DR3T 5LHGB 3UU3A 3MKQA 2K48A 4FJOA 2F4VT 2YHCA 4DI3A 4JHJA 1S63A 1FIOA 4ZI2C 1UCUA 3QB5K 4O2AE 3GA8A 2YQ8A 2FO7A 4UWKA 3E08A 4OYJA 4I43B 5HEGA 3K3NA 1Q2ZA 3AAAB 1NENA 3HR0A 5HAXA 4F6RD 1J1JA 4HRNA 1I6ZA 3JXJA 4H9RC 5D0QD 5LMUT 4XI9A 1KZOA 3JC6D 5CA1E 1E8ZA 3ZCIA 5H6QB 4N39A 4HTEA 3ETUA 5HEHA 5G2NA 4DBQA 4N3CA 1W3BA 4MHCA 1O3XA 2WWUA 3TAXA 3RRMB 3Q7AA 4IE6A 5CA0E 3QDNA 3S4UA 2VWAA 3RKOA 4U95D 4F1SA 3C50A 3D9OA 1MQSA 4NIQA 3CVNA 4I17A 2X68A 3FP3A 3UX4A 3PUWF 3BG1B 3GZ2A 1OXZA 5FY0A 4CZ2D 2HYZA 3LVRE 5KJNA 4HFVA 2DZNA 1BPOA 4JC8A 4UI9J 4GB9A 3LKUA 4TXQA 4Q96A 4BX8A 4GKKT 1N52A 3CIAA 4AKRB 2WY2A 5M72A 4BAYB 4COFA 5EK2A 2XM2A 5HCMA 3UULA 1MX4A 3AEEA 1INZA 3Q9DA 5M4YA 2FF4A 4JEHA 5BT1A 1A17A 2UXXB 2BG9A 1OEDE 3MXZA 4I0UA 4P0AA 4BTAA 3AAIA 4KVOA 1KEYA 3L09A 3CX8B 3APDA 2DWKA 2WQHA 3BQOA 3CVPA 2E8IA 1CHUA 4KMOA 2H89A 2L6JA 2ZGDA 4N3AA 3OPCA 5HEJA 4XBFB 3MYVA 4OFZA 3P1UA 5ENTD 2LEHA 1D9SA 3RLFF 3AJIA 3IF8B 3GN5A 3V30A 4KT6B 3Q73A 1SE7A 3TWRA 2YK0A 1TN7A 5AQTB 4AQGA 5LHHB 1TJFA 1D8DA 2ZMAA 2VL8A 4UVAB 4TRQA 5ANRA 1MMGA 3NB2A 1V55E 1TYQG 3NRXA 2JQKA 2EHOB 2F0YA 3KAEA 3VKGA 3AE9A 3ASFA 1N4PA 4C91A 4F3VA 4HRLA 5G04C 2UXNB 3I4GA 5B3SE 2JPFA 2A72A 5DQWA 1HO8A 2H6FA 3CMLA 1SUMB 2XQ0A 2XQ5A 4B94A 3F2EA 4A1SA 4CCAA 4FA6A 2V6YB 4NRHB 2WXKA 3S7FA 5KMGP 1H2TC 5LG4A 3KBTA 2C0SA 3FH8A 4A63B 4MRUA 3CQGB 4B8CB 4BFRA 2D9DA 4ME2A 3RYHE 5EX3A 5CCLA 4JYAT 4JI2T 2VQ2A 3NZQA 4YDWA 4I55E 3RC8A 1OEDC 3MA5A 4X5TA 1BI7B 1HX8A 5JR9C 3AU5A 4A3VA 4QH4A 3TWQA 3AE8A 3FU3A 2E9XB 2GROB 1MIYA 4Z90A 3NOGD 2VL0A 2X3MA 4WAFA 4JEUA 4TUUA 4NACA 3TWTA 3L17A 3OTNA 4H9QC 2VQFT 1DNPA 1D0XA 5JVDE 4GAAA 1UN8A 4JI3T 1HU3A 5EILA 4IREA 1OCZE 3CHQA 2LKGA 3HKCE 3KSLA 1N94A 1KPSB 5FTPA 5JRCA 2V5DA 1SVXA 2EQXA 3N2OA 3ASNE 1WR0A 4AQFA 3IKOB 5AQQB 2MPKA 2OVFA 4GTTA 3ZJ1A 3PREA 3B7SA 3ONLA 3QJZA 1W09A 3NZPA 3B57A 1T8BA 1X79A 3EABA 4IL4A 2C0LA 4ZXLA 4HQDA 5KXJA 2WXIA 1UW4B 4AKGA 4G24A 3AG4E 3FXDB 1A5EA 3N9QA 2VQET 4EBAG 4N2QA 4PJMA 3Q5DA 1S70B 5LHIB 4O4HE 5FXZA 2XQ9A 5B1AE 2GRRB 1E7PA 1U5PA 5AQNB 3RGLA 3D3MA 2BKKB 3P4WA 1AJ3A 1Y64B 3E32A 3OXGA 3SBTB 4U3CA 2KXPB 2LSYA 2WVIA 4YJ3E 1TNUA 2EHOC 4WNDA 5FJYA 3CSFA 3I1AA 2VSNA 2CLYC 4WNGA 3UIOC 2ODVA 3QOFA 1E1HB 3RX6A 2B76A 4H7XA 5BPPA 1FEWA 2C5IT 4BJMA 2L3LA 3IA3A 1OWOA 5HRYA 2V5QC 4JHRA 4GU5A 2NR4A 1I94T 4DBRA 3E0ZA 3IEEA 3C51A 2HE0A 5JMND 3N9LA 4ZI3D 2WSSV 5LFAA 2Y8DA 3PU8A 3JUIA 2XEEA 4MBGA 2WU5A 3CHOA 4HB5A 2PQNA 2YU2A 2P9LG 5L3BB 2IU1A 4AY6A 2PTFA 5LMNT 3ENEA 2LSJA 4GMJA 3S7DA 3Q7FA 4JZYA 3QC1A 1KT1A 4E85A 3FUIA 3CVQA 2FEZA 3P4QA 2XQ4A 4TWFA 5C3JA 4U07A 4CXWA 2A9UA 1IJ5A 3PUZF 2A4ZA 3Q9UC 5JR9A 3PE0A 3CVVA 3IHRA 3B7TA 3CEQA 2NOXA 3LBXA 3TJPA 1SHZC 1ELKA 3UFGA 2PFVA 2OEWA 3I3NA 4O8SA 3RIUC 2WZIA 2KCLA 1H6PA 3VR8A 3LDQB 2KBXA 2DNXA 3D9HA 4J8EA 4J8DA 4WNFA 4TNVA 3FUNA 1M62A 3UT8A 2PM6A 2PZIA 3PUKA 5HKPA 1YCSB 5HYAA 4AKLA 1QZ2A 2XQAA 1MYOA 4KI0F 1MNEA 1H19A 5AYWD 2EINE 1MMDA 1FVHA 3C4WA 4IRUA 4TV3A 3FTSA 2LE8A 3MGBA 4OVUA 2FJAA 4HS2A 1DVPA 2LO6A 2Q7FA 1LD7A 2XPKA 3AE2A 2Y0BG 3FTXA 4HWHA 1GW6A 2DI4A 3W9FA 2BS3A 2N1GA 3QC9A 2EHOA 3OYZA 4IYPA 1WYBA 3KVBA 2KZTB 4YHHT 3S2AA 1ZBPA 3WG7E 4U2ZA 4WNEA 2A5EA 3CK7A 4ANXA 4DUYT 3BK9A 3O9XA 3B7UX 1IHGA 4DX2A 3EVYA 2GRQB 4GA1A 5IYZE 1TNOA 2X0HA 3QWVA 3JAEA 4DIDB 3X1DA 5AQRB 2L6BA 3HXEA 4QXHB 3AXJB 1LTXA 5AQHB 2E9XA 4FLHA 2CM0A 4RLYA 3AB3B 3HIZA 5C2YA 3RI5A 4DR2T 1JNRA 2V8SE 4PS3A 2KM4A 2WCAA 2BG9B 2KCVA 2ETAA 5T8IA 3UMVA 5CBOA 5CGMA 3ZIMA 2J09A 3D9NA 3SFYA 5LG3A 1H6OA 3AA1B 4U7EB 5AQUB 3AEGA 5ARGA 4L5GA 4EIWA 3F57A 2IMLA 4I2ZA 3L39A 5F8PA 4H9OC 4X8QA 4DR5T 3OVUA 4XE0A 1HXIA 2V4LA 1V54E 2ZGGA 4I2WA 2RA1A 2AXUA 2MTQA 4QX7B 2YHEA 4C48B 5AQIB 4CI3B 4BA9A 4DI4A 2LSVA 5J2TE 4JLEA 1H2UA 3NBXX 3DSSA 4DR1T 4HFGA 4EZKA 4GYRA 4ISTA 3JYSA 3RK6A 2X6IA 2LSGA 1HG5A 1ZU2A 4P0BA 5FP3A 3RIAA 5EK3A 4HWIB 5HXHA 3QNKA 2V7IA 2R05A 1E7UA 4QQIA 3Q47B 4UWHA 1Z5SC 1KLXA 4BEPA 5CERB 3SFDA 1IJ6A 3HHMA 4GYOA 2WS3A 3KINB 1WAO1 3D9PA 5CRUA 3RPUA 2XY8B 1ZV4X 3T8MA 3OTOT 4GTPA 1KF6A 3RIBA 4L1BA 4FP7A 1UGOA 1MIWA 3URZA 2CEAA 2OCCE 3MZKB 2LT3A 4V1Av 1E8XA 4GCNA 3F6QA 5AJLA 2QVAA 3ABKE 1QNFA 1SA5A 1O1TA 3ZJ2A 3FY4A 3ZT5A 4ILGA 2YDQA 4ISSA 5DQVA 2R03A 4HFCA 5AQKB 3DEPA 4IE7A 2UU9T 5AJDA 4U2YA 3FU0A 3PURA 3G06A 5KX5E 2WXOA 4Q69A 2OLTA 3O48A 2WDVA 1UK5A 2MRIA 4AQYT 3G2VA 4I1AA 3DSWA 1OWAA 2BS4A 5AQLB 1NA0A 2AXVA 2VGEA 3CQCB 3SD5A 3ZN3A 3ASDA 3MKDA 4FHKA 3C5RA 2LOPA 2DHRA 4WBOA 3C4XA 4DK5A 3G2WA 2WBLA 2CPTA 4HFDA 3MKRA 1ZKEA 5FXXA 2YKSA 3ZRHA 1TNBA 1PC2A 4WWNA 3C3QA 1OCOE 1U2VG 2CHWA 5JJ7A 4U7IA 2A2FX 4UWFA 1WR6A 3ZMUB 1JWFA 2E2AA 4KXKB 3N9PA 4TWDA 3WAJA 1VDYA 3ABME 4Y6CA 4K0RA 1SA4A 2WM9A 2BS2A 2CXFA 3EHMA 3JXIA 4AVXA 2ZM0A 2HH7A 4ILUA 4IDOA 3ONKA 2YNQA 4DR7T 4LMJA 2JABA 3SBSA 2RFAA 2V6XA 4PNIA 4F7AA 5AQJB 3J5PA 3SOLA 5AQFB 2LSUA 2XCCA 4U0ZA 5A1LA 4O1PA 2H6GA 2VJ8A 3OAWA 3QK0A 4CI2B 2YOEA 2GGFA 4MS6A 4CT4A 4IIJE 4HOUA 3P4PA 1W0AA 1BR0A 4JI7T 4GZDA 1UX4A 1MZCA 2D0TA 2WMOA 1N34T 2XEHA 3DXKG 3AE1A 1Z0PA 2GRLA 2MBGA 4BT8A 4IULA 1N95A 2J1DG 3O1HA 4B8AA 2G0UA 2ZISA 4PFOA 2IFUA 2GRMA 3TWWA 3H3MA 1LF8A 4DJAA 4EEDA 3L8RA 3Q49B 2V1DB 4YSXA 3LPZA 2LHRA 3CKBA 3EHNA 4A1GA 2ZLYA 5BV1A 5LCWJ 3PJAJ 2A3DA 3ONJA 4I9CA 2XS8A 4U7YA 1MHQA 2SPCA 4HI8A 5ENPD 1L0VA 2BVMA 4BX9A 2LNIA 2K9AA 2IF4A 3QNUA 5FINA 5EYLA 4A56A 4P1NA 2VURA 2JLBA 3IBEA 1O5MA 2VGXA 5JDGA 3ZYKA 4A98A 5JHAA 4L2LA 4DUIA 4FJYA 2FBWA 4TNWA 4G26A 2HPLA 3A8YC 5FL1A 4ZOLE 3AA7B 3CSTA 2BEDA 1NA3A 5HWYA 4JA9A 4NXNT 1IHBA 2W62A 3TLVA 3DPDA 3QARA 2XUEA 3ZEFB 4AXHA 3ANWB 5FZQA 2LJLA 3ABVA 5AQPB 4QX8B 4Z91A 1UG3A 3UUMA 2L9QA 1G3NB 2XCBA 1X9BA 4MALA 3R84B 4HWDA 2NXPA 3UTKA 2VGYA 4ANUA 5LNKA 1UUSA 2WU2A 4EZHA 3K3OA 1WG0A 1P5QA 2P9UG 1WYCA 2F8XK 4QH1A 4FLBA 2OOEA 2UUCT 3I0OA 3NVOA 4JVSA 1ZOYA 4UVBB 2LRLA 4H9SE 5ABEA 4UVCB 4YDOA 4IE0A 4TWHA 1YKHB 3Q79A 2IY0C 2AWIA 4ZHBA 3IXEA 4DVDA 5IY5E 3MX3A 5J2UE 3NZUA 4Q25A 5J0ZA 3CKDA 1BU9A 5J08A 2OEVA 3ZEFA 2IC9A 1BLXB 3CIRA 2V5CA 3CX6B 3FHEA 4PH4B 3SGHA 4Z68A 4HFHA 1KNRA 2YEVC 4N5CA 2E9XD 1K8KG 3ISMC 4O4JE 4J2CA 2KWIB 3RH3A 2XAFB 2Y6XA 4IN3B 2F8YA 4H63H 3MACA 3FUEA 3SF4A 3JC6C 3MV2B 4TXPA 4LEUA 3EDTB 1IXVA 3UUNA 2A5UA 5CHEE 5DBKA 3IV0A 4O1OA 2QYWA 2J47A 4GTMA 2D2SA 4PAGA 3BQLA 4EHMA 1IZNB 5JDQA 4DV5T 1SQMA 5H7PA 4EECA 3H37A 3ZGQA 1XZYA 4GTOA 3RO3A 4KBMB 2X9WA 4AKIA 4X64T 4GMLA 2BUGA 3ZYLA 2VVSA 4AISA 2LM2A 3PH0C 2R2LA 3SO8A 2K3WA 2P58C 3B7BA 4ACLA 2ES0A 4KZ0A 1QSDA 3FEYA 2RFMA 3V5SA 4YSZA 3LJCA 4CXYA 1HH8A 2IJGX 2WXHA 4KBQA 1D1CA 3ZMVB 4FU3A 4JXTA 2UY1A 2MHKA 2RG8A 3VLDA 2N9DA 3LEWA 3ZVVA 2BVLA 1YXRA 1YQ4A 2X9HA 4B0ZA 2GK9A 5LX8A 3ULEG 2L9BA 2DIWA 1N54A 1FJGT 1DC2A 1QQEA 3TXMA 2V5FA 3RO2A 4GPKA 2NP9A 2X67A 3MV3B 3UTMA 3TWSA 3FHNA 4QKNA 1XDPA 1UX5A 1N9AA 3AE4A 4ZEYA 2BZBA 4WNKA 1N4SA 3DEOA 2UXDT 3RQUA 4B3TT 2J9QA 1US7B 2OV8A 1OY3D 4UV9B 3RRWA 2ACZA 3RQWA 1N36T 4OVVA 1MMAA 3RYIE 3GMIA 3JCKC 3N9OA 4BSXA 1LKXA 2ZM6T 2FO1E 3JCFA 1H7CA 4JI6T 4X65T 2XRZA 2CHXA 4NPPA 1IBKT 4Y6WA 2Y69E 1TEZA 2WXJA 4LF7T 2PJQA 3IBPA 4DUZT 3SFEA 3U3IA 2CBIA 2XAQB 2VASA 4JHKA 3CVWA 4LF9T 4K03A 3CKCA 2LSIA 5HXRA 3TLWA 4LFAT 3ZC0A 3EHZA 2ZXWE 2C0MA 4J7WA 4HN9A 4B93B 4DNDA 5CRVA 3TWXA 4X1KE 4DV4T 4IHJE 2NSZA 3L13A 3SFZA 2Y1LE 4EPZA 2ZM8A 5BMVE 3HG0D 4YT0A 3PUQA 4LNGA 4I43A 2EIJE 1N4QA 2E5LT 4CT0A 4DRXE 2VSXE 4A97A 2CE7A 3HKBE 1N11A 3FUKA 3LDZA 3EHRA 2WWVA 3G2SA 3U4TA 3PEUB 3QK6A 3KDSE 4CZZB 2V7LA 4CXXA 5LXTE 3JUEA 2BKPA 3KBUA 4EZ4A 3RKGA 3ZXPA 1OXJA 3L82A 3FULA 4WW0A 2BKNA 1WFDA 3JADA 4G8KA 3JAFA 5L3FB 3PZDA 2BBJA 2B0OE 3FTUA 1YA0A 4LF8T 1K1AA 2OV9A 2Q9QB 4F8HA 3E33A 3HVEB 5LGUB 3IHYA 3PUYF 3UU5A 5L4EA 2FUPA 3FBLA 1HS7A 3ABLE 3ML8A 5KJKA 3EAMA 1IQRA 5L3DB 2L0IA 5EDSA 5HCJA 4LG6A 2DYSE 4GZCA 2NW9A 1WM5A 3LYAA 4GA2A 4J8YA 2DVWA 3AEFA 4X62T 1KNPA 5LJNA 3CHMA 5B1BE 2XQ8A 3Q78A 3TWVA 2KINB 3U66A 3EHQA 5T4YA 2LAHA 3PV0F 4Q94A 4LFCT 2IUBA 2XAGB 3HL6A 1S94A 1ZHCA 3MJXA 4TN7B 4EBAA 1NWMX 5IUXA 2I9CA 4DMWA 5LJMA 3FFLA 5FQ8A 5L4HA 3LG7A 4EYUA 4RG9A 1KFYA 1VCSA 5C1DA 3KS2A 5D2MC 4PS8A 2ONDA 3JQ1A 1NFIE 2JEKA 3ZYQA 3GZSA 3I9YA 2W00A 3RIFA 4AOFA 5J1GA 4GPMA 3RRNB 4ZI3C 2XJ7A 3APCA 2WPVA 5CMYA 2E5VA 5LOVE 1ZB1A 2CHZA 3FEXA 2PL2A 5AARA 3ASGA 3UFEA 4AV7A 4DLQA 3CHSA 3FB2A 4TXRA 3KSQA 3I4RB 1DCEA 1TN8A 4L23A 2XSBA 2FJEA 5CBNA 3K9IA 3HDXA 3E4BA 1FPPA 4JB8P 4YJ2E 3P50A 3ONXA 3ZN0B 5AQGB 5AQVB 2WXPA 2CHOA 3PUXF 2XENA 4JI5T 4UQZA 3VHLA 4L7TA 3MA9A 4RQIA 3ZHEB 4UR9A 4EOZB 4G25A 1YD8G 4W9RA 5ENRD 4UF0B 4YDEA 5IWAT 4UQXA 5ANLA 3T5XA 2IIUA 3LY7A 5EX0A 1O1RA 3DSUA 5FVKA 3SI5A 3AEDA 1XGWA 4JI0T 3UXGA 2M63A 1OWLA 3LVQE 5JA4D 1XNQT 1IKND 5CCMA 3Q5WA 3VRBA 4LCTA 2HM8A 1CUNA 3HRAA 3WAKA 3Q5MA 5C8YE 2RP4A 2LOSA 4V3IA 2V7MA 5LYJE 2DBAA 3CHPA 5G05C 5CEAA 3LY9A 2X6HA 3N71A 3IEGA 3SFXA 5AQ9A 1R8IA 3WXXA 1AP7A 3DTOA 4KHZF 3R7RA 2XHEB 3FBZA 5CB4E 5A23A 4U33A 2LHNA 4IDQA 2CLYB 4IE5A 3RKVA 3D9KA 4FHJA 2P2CP 3CVXA 2MYOA 3G2TA 3R9MA 3UM2A 2QRXA 1QLBA 3KV6A 3W9GA 3L22A 4AXPA 4NUUA 1UN9A 5JJ6A 5L3EB 4GCOA 3SS1A 1N4RA 2XZEA 2CBJA 3UKUG 5ABGA 2XGSA 3LK42 1OWNA 4OX9T 5C2TA 4XZ4A 2KWHA 4GYWA 2CXLA 4A5XA 4QXBB 3ZU7B 2CWYA 3MKQB 4B3ST 3VR9A 2QFCA 5AQ7A 3TLTA 5AAOA 2IHR1 1N33T 5JJTA 4PJJA 3UT5E 3HKDE 4UEMA 1VCTA 4XAXB 3OXLA 2XQ3A 5EN5D 5L3CB 4OAVB 4IDZA 2WXLA 2X0LB 2ETBA 3QUJA 2XM1A 3DP7A 2ZU6B 4DMVA 1D1AA 2LKHA 3ETVA 2DCFA 3D9LA 2Y4UA 2WXNA 1KZPA 4LSZE 3KEZA 2ZM2A 3T9KA 3TGOA 3L16A 2YDRA 3UKRG 3PTRB 4QH5A 1W9RA 2DZOA 4ANVA 1HE8A 3RC3A 4CN4A 2PBIA 3HI2A 1UJKA 2XQ6A 2J4BA 3M65A 1E96B 4HVBA 4HLEA 4AY5A 4HFBA 3NZSA 4IGUA 3HYMB 3NOCD 5FXWA 3DWLG 3FUJA 4U31A 2P9BA 4ANWA 3CVRA 1G73A 4HORA 4YY3T 2XS1A 1SW6A 3U9WA 2CXDA 2NW7A 1NL4A 4G1TA 5BNWA 5LP0A 4CDNA 3K1SA 1BR2A 4LF6T 3G2UA 4CRWA 5A6CA 3TG4A 2YINA 3CV0A 4DV1T 4G2VA 5T3RA 4B89A 3UIPC 1VRBA 4A3TA 5FVLA 3QWWA 2DL1A 3UU4A 2MOZA 1PY1A 2JQHA 4GZ5A 5KNGA 2IW5B 2K24A 2JMHA 4PK4A 3PU3A 5LGTB 3PUVF 5FY7A 4MKTA 3J7Yq 3CGHA 4UXNB 4XKCA 1X81A 4KZCA 3ASHA 4U8VD 4BT9A 3N2KE 4BETA 1K1BA 2C2LA 5EIBE 2WXQA 5G05J 1HG2A 4CGVA 2J8SD 3ZT7A 4ZHQE 4HOTA 3VLEA 2V8SV 3AU4A 3L9TA 3MJWA 5AQSB 1HCIA 1E8WA 3PUGA 2NTXA 2KNDA 3D9MA 5TAOA 4YVQC 1E7VA 3MZLB 3CLJA 3DRAA 2GRPB 3ZXSA 2EILE 3OXFA 2AXDS 4IT4A 2LXMA 4ANJA 2X9YA 1WRDA 2XPZA 5FYMA 3ZC1A 4MLKA 2X0YA 4DX1A 4DX5D 3Q15A 1OEDB 2KCKA 4K0UA 2UUBT 2WQ6A 4ZI7E 3FXEB 5JDLA 4JPSA 4L0RA 3ZKJA 4HOSA 1Y8MA 4UWGA 4JW1A 3OYXA 1XNFA 5CEDB 3RRCA 4C0MA 2UXCT 3LK3B 2X6FA 3IHVA 2P9SG 2UWJG 3B95A 5JH7E 4K5BA 3RU0A 2J62A 4LMLA 2XGMA 4HGAA 4HRMB 4E7ZA 2VKJA 2CRBA 3ML9A 1J5WA 5KJMA 3B7RL 4ZZCA 4PK5A 3E37A 5GONE 2WXGA 2KT9A 2EIME 3LFMA 2GW1A 4LUNU 5DABA 2WXRA 4U63A 1YKEB 2UUAT 3UU8A 5LBMA 1HFAA 3FTWA 1MNDA 3C4ZA 5EYPF 4XEIG 1MIVA 2W2UA 4I4TE 2CFZA 5LGNB 2UY1B 5ABHA 3CR3A 3PDYA 3DSXA 4L9PA 3UI2A 2WB2A 3TXNA 3NBNB 1NZNA 1FT2A 1PAQA 3L08A 2ILRA 2XZTG 4WBNE 5HEUA 3LK2B 1Z6TA 2IEJA 2XPIA 4GTQA 2V7JA 4J8FA 1OCCE 3ONLC 4UQYA 3O1IA 4IL9A 3Q9NC 3AVSA 3S7JA 3ESKA 2C5JA 5BXOA 3FWVA 2VKHA 4QHOA 4GYSA 4YTNA 2IO2C 2IONA 4YDYA 3AE5A 2BKGA 5JRCB 5D66A 3BUAA 4PS7A 1KT0A 3PE3A 3CQXC 1XDOA 2R5SA 3Q4AB 2CG2A 2CFUA 1YYHA 4BWRA 3CVYA 5H6RB 2AW6A 3DSVA 2LRKA 4O4LE 1J5ET 1X5BA 4JA7A 4JEUB 2VYIA 3EU9A 4LF5T 1WDYA 5KNHD 4DR6T 2NWBA 3UM0A 2QA7A 3QAQA 3ZLIA 1U3CA 5JTGA 4UF0A 3AVRA 1HTJF 2LUHA 4EYYR 3PUSA 2FULA 1Y6IA 2RD0A 2Y4TA 3V2OA 5ETWA 1IBLT 1S35A 3P7IA 5FT9A 3RAUA 5BXUA 2JQ9A 3MCXA 2CA5A 2HHHT 5IHYA 3WI3A 1UJJA 3EI0A 3T1YT 4BY6A 4ZS2A 4NXMT 4Z8XA 2X9XA 3EDVA 3CVLA 4HE8A 2LLYA 4ZZBA 4NURA 1TNYA 3HKEE 2NYJA 3B5MA 2EHOD 4DR4T 3ANWA 4FI5A 5D0OD 1XMQT 2JMKA 2XEVA 3OJAA 1WLXA 2R6GF 2FJDA 3KVAA 3ZPJA 4WUYA 3A5XA 2J4GA 4ZI2D 4JV5T 5FQ7A 2AXZA 4UI9K 1N0RA 1YMPA 2FI7A 5ENSD 1FCHA 1NAFA 1Y01A 2HPJA 2WQYA 3H3AA 4QWNB 5J90A 1HNXT 4DV6T 2D5UA 1MJ0A 4CI1B 1MX2A 3JQ0A 2I1KA 1IQUA 4R7LA 4HWFA 1WCRA 1JCQA 3R6NA 2DCPA 2YU1A 4B3MT 2BBHA 3SNXA 2XTLA 4ILCA 2KMFA 3ESLA 4X1YE 5FNVE 3KV9A 3NAWA 5G55A 1E90A 2PNNA 3PRZA 3ZHEA 2MYSA 4WZXA 2CG3A 2Z6EA 3FH7A 3PUAA 4U8YD 3UQ7A 4JEHB 5EIDA 4GKJT 3ZT6A 4YVOA 3L3PA 4LF4T 1JWGA 2H6IA 3S7BA 4N2SA 3ZSTA 2N2NA 3L54A 4TV9E 4O60A 3TLUA 4ILHB 4ATZD 3C98B 5LBQB 2HR2A 4LNBA 1S0PA 2LXLA 5AQMB 1FMVA 4O2BE 3QOUA 4D10C 1ELRA 3SWHA 4B6XA 4F53A 4L2YA 3DXMG 4P09A 3T8OA 4APOA 3L6AA 4KX6A 4N3BA 4K5CA 2M67A 1NEKA 4GZ3A 2J4DA 2B1EA 1OUVA 3LJ3A 4BESA 4EV6A 2IO3C 3N2GE 3VKHA 3F31A 4IDNA 1LRZA 1YQ3A 2PG8A 3CX7B 3NKZA 3PJAA 5HEOA 3ZSSA 4X66T 4AM9A 3QWPA 4DV7T 2CMRA 3N9MA 1TJCA 1L5JA 3EJNA 1K3ZD 2LM9A 1JPLA 3ZUVB 3LXUX 2H7OA 1T72A 1OWMA 4FULA 2VKDA 3R9AB 3PDNA 4M1PA 4CGWA 3ZPOA 1W0BA 3C98A 1UURA 3BG0B 5AN8A 3ZMTB 1JUQA 3HXFA 4IDPA 2WZHA 4X20E 3I9WA 5FWQA 2PQRA 2VSYA 4ATGA 3HXDA 2XQYA 5JR9B 1OT8A 4XIFA 1JCSA 4JBWF 2VTBB 1IBMT 2BF0X 4FJZA 4YXDA 3C72A 3N5LA 2DWGA 1ELWA 1M7KA 2L0TB 5BV0A 3KV5A 2VK9A 1EPUA 2H6HA 2QYUA 2IC6A 1HX1B 1E2AA 4I6GA 2W0GA 3CPZA 3TLSA 3PVLA 1MX6A 5L3GB 2XASB 4J8SA 1VOMA 4JI4T 3O4XE 3OBVE 3UQ4A 2F37A 5LCWC 3M3ZB 3K3QC 4UV8B 3UUBA 1HNWT 5BW8C 5HWXA 5FKYA 4E6HA 4EEBA 4PFPA 3FU5A 4ZFHA 4H63V 5HS0A 3D9JA 3PS6A 4G8LA 1D1BA 2WP9A 4H9PC 4G23A 5FZRA 4EZJA 2NTYA 4C9BB 4CN1A 4U8HA 4PUCA 5JDHA 3HXBA 4AP2A 3CK6A 5BUZA 3FZLB 5HQ8A 2M6BA 4BERA 3ULQA 5FQ4A 3GN5B 3HA4A 3MEKA 3P4SA 1LD8A 3V31A 2L8KA 5L2LA 5BR8T 3ZYMA 5LCYA 2HN1A 3J9X1 2P9KG 2H88A 3RF1A 2V26A 5ENOD 4YTMA 2VB6A 1LVKA 5LP6E 3UM1A 2MAWA 5LA6E 3FU6A 3ZMSB 4N5QA 2K5BB 3UUXA 4NQ0A 1SZ9A 4GMRA 4MLPA 3TWUA 4ABNA 4HI9A 3CVUA 3U78A 4JD2G 3RSEG 4JL0A 3AE7A 4UELA 3R7QA 4OHFA 4XZCA 2I0MA 3RJVA 3AS5A 4F6RC 2WB5A 2QZAA 4AEZC 1DU2A 4LERA 3N9NA 2W66A 2E2EA 5FXVA 5EZYE 3CK8A 5AIJA 2XSAA 4OK0A 2AVPA 5JHBA 3AE6A 4B3RT 3B13A 1H2VC 5KJLA 1ZP0A 5L47A 1KK7A 4KYOB 2WXFA 2QYJA 4ZS3A 5HI7A 3PZ2A 3V5UA 4EGWA 2NW8A 2WDRA 2OVBA 3BU8A 3W15B 3I5PA 3AG1E 4ILAA 1E8YA 3AEAA 4DV2T 1TR4A 2CHNA 3T5VA 2CCQA 2R59A 3EUVA 2X66A 3UT7A 4P29A 2JJ9A 4L9IA 4GTSA 5CJ5A 1QUUA 4NIKA 3GYZA 4H7YA 2QGSA 3ZKRA 4HWCA 4PK6A 4X1IE 3UQ3A 4MFRA 1OEDA 3E34A 4KUMB 4URKA 2BDEA 1DCQA 1U4QA 4AIUA 2UXBT 4G11A 4K5AB 5E0OA 4C0EA 1GQEA 2WMNA 4JUYA 2R02A 2R17C 4OYKA 5DJQC 5LOZA 5FY1A 2KATA 2W61A 4KMCA 2P9NG 4RG6A 4UI9C 1S64A 3UM3A 3NRYA 3EIJA 3DPYA 5KCMA 2VTBA 3BQKA 3E22E 4JI1T 5A7DB 1HR0T 1WY6A 3T8KA 2KLQA 1QBQA 4NUVA 3V2XA 4AJWA 1ZEEA 4RSYA 2PM7A 2JRKA 1SZAA 2MOWA 4WWOA 4I1MA 2CWOA 5ADXL 3DSTA 2YDSA 4PJNA 3BEEA 2E9XC 3KV4A 5EKQD 3ZNGA 1Z3XA 4YFSA 5JDMA 4KVMA 3K8PC 1TNZA 2VGXB 2X51A 3SZ7A 3LY8A 1BR1A 1UOHA 4GTVA 4BTBA 3J5QB 2B6CA 3X2QE 5CECB 1SA0E 3SQVA 2ZIRA 1NP7A 3RHWA 3FUFA 3KEAA 1RW2A 3O1JA 3EU5A 3AA0B 2FBNA 4N78D 5CMWA 2BG9C 2RKKA 5CFBA 4HFIA 3APFA 4PDXA 3ZFWA 4HKAA 1HNZT 4JI8T 4I9EA 2BKOA 3LSVA 3NWIA 5HXCA 2W67A 4U72A 4ADZA 3FH5A 2ODUA 4YTPA 2XZDG 3VTXA 3PZ3A 3FZKB 3I0QA 3HXCA 4ILIA 3GZ1A 3E30A 3LJNA 1N32T 2FJBA 3FTZA 4TX5A 1MMNA 3C64A 2XRYA 1H0AA 2ACXA 5AFUL 4PJLA 2LSKA 4QXCB 2C5KT 1B7TA 3ZW3A 3RIUA 3EDUA 5G04J 4HBDA 3AAEB 4J0UA 4HNAD 2X38A 3D0TA 1IYGA 2LAIA 4UWLA 4GA0A 3TG5A 2XAHB 4YHJA 3AECA 4DV0T 3SHFA 4F1PA 4TZ4C 4YSYA 4O6FA 2AE9A 2Q9QA 1JCRA 3FTYA 3HVEA 2IDOB 2IQCA 2DLRA 3UU6A 4G63A 2X6JA 1NI1A 4BJNA 3OKQA 1KNZA 4DO0A 4EQFA 4LRZA 4ILBA 4KP3C 3PZ4A 3UT4A 3VLFA 5JDNA 3CK9A 3NF1A 4FADA 4I50E 1O1SA 2WAUA 4TUMA 4GK5E 4XX5A 1JNZA 4G2AA 1EZ3A 4GYYA 3Q75A 5JDFA 4U0SA 1HF8A 2Y48B 2DWZA 3ZMZB 5ENQD 1BR4A 3PZ1A 2H3RA 3AA6B 4YNDA 3Q5EA 2V4HC 1EDUA 4M3OA 2WXMA 2XPYA 4DX6D 1XMOT 4QFVA 2KSRA 4A55A 2I6HA 4WYVA 2BG9E 3AEBA 3FZFB 2IAKA 2J07A 5KBAA 2H7VC 2P9IG 5HXSA 4EXTA 2JIWA 4CQIA 4AQFC 3FUMA 4CYMD 5ITZF 3DBSA 1N0QA 5ARFA 3DJBA 5DIZA 1H6KA 3VRAA 3LS8A 3AE3A 2EIKE 1XNRT 3CWZB 4HXIA 2V6YA 5F5WA 1BD8A 4TV8E 3FUDA 3GWHA 3P2BA 3EUHA 2V0PA 2V7KA 2NC9A 5F3JA 5AQAA 4O4IE 5AQBA 3BQIA 1EF1C 2WQ7A 2IOLA 5ABFA 3T1HT 2XHEA 4AIFA 3SRZA 3A7MA 2I1JA 3C3RA 4KHPT 3PNLB 3AG2E 3AG3E 2DYRE 3UPVA 3PUJA 3PE4A 4GZ6A 2KZTA 5FQ6A 3CHRA 5LB7B 4ASKA 4U04A 3QB2A 1D8EA 3ZN1B 2J49A 4XKBA 5ABFB 4DX7D 2W4XA 5KDMC 2BTDA 4PW8A 5FMNA 2QC9A 3NQPA 3TL5A 4ACKA 2QY7A 3FDHA 4APFA 4HLLA 4RVBA 4AKHA 4I6JA 1XWMA 2XGOA 3QKYA 3O4ZA 2D0UA 2JQQA 4GIWA 2ETCA 3PEVB 4E7SA 1V9DA 3Q5XA 4CN6A 3ASOE 4LMKA 2M6IA 3UUXB 3SY2A 4LFBT 3VTYA 1D0ZA 1T7SA 1FT1A 4BSZB 2KZ7B 3PNTB 2VVNA 3FZHB 2XQ7A 3TKLB 1FVFA 1QYMA 4H9NC 3FTVA 4OYSA 3ULYA 2I2OA 4M7CA 1FMWA 3RYFE 1HZ4A 1RZ4A
chains in the Genus database with same CATH topology
4EZLA 3Q2MA 3D9IA 4MBQA 4YLHA 2XAJB 5JREA 5E75A 4HEAA 1U3DA 2Q9QC 3AS4A 5JQGE 2Q9QD 3P8CD 3U64A 5ENNA 4DPRA 1G8XA 1HS6A 3AS8A 1IAPA 2VSOE 2X6KA 4XI0A 1LVFA 2HO1A 3RYCE 4U0UA 4CDRA 4CEMA 5EK4A 1OWPA 4UIGA 2Y3AA 3EIQC 4HOQA 4I6EA 5HXEA 4ERRA 3ZCJA 3VU7H 3KFWX 4EAHA 3GW4A 4U74A 4CDMA 4TUYE 2IOSA 2W63A 4EB6E 3MK7C 5E76A 4WWPA 4IE4A 5FZSA 4FC8A 3LCAA 2KC7A 2J08A 1D0YA 1T98A 4I1OB 4C90A 1Z3YA 4DLOA 2VKOA 3LBXB 1EYHA 2I59A 5AENA 3KD7A 1YW0A 2OA5A 1B89A 4J6IA 4AI6A 3FUHA 3U3WA 4GOUA 3RRUA 2E0IA 4GK0E 5LHGB 3MKQA 2K48A 4FJOA 2YHCA 4DI3A 4JHJA 1FIOA 4ZI2C 1UCUA 4O2AE 3GA8A 2YQ8A 2FO7A 4UWKA 3E08A 4OYJA 4I43B 3K3NA 3AAAB 3HR0A 5HAXA 4H9RC 5D0QD 4XI9A 3JC6D 5CA1E 1E8ZA 3ZCIA 5H6QB 4N39A 4HTEA 3ETUA 5G2NA 4DBQA 4N3CA 1W3BA 4MHCA 1O3XA 2WWUA 3TAXA 3RRMB 4IE6A 5CA0E 3QDNA 3S4UA 2VWAA 3RKOA 4F1SA 3C50A 3D9OA 1MQSA 3CVNA 4I17A 2X68A 3FP3A 3UX4A 3BG1B 3GZ2A 1OXZA 5FY0A 2HYZA 3LVRE 5KJNA 4HFVA 1BPOA 4JC8A 4UI9J 4GB9A 3LKUA 4Q96A 4BX8A 1N52A 3CIAA 4AKRB 5M72A 4BAYB 5EK2A 3UULA 1INZA 3Q9DA 5M4YA 2FF4A 4JEHA 5BT1A 1A17A 2UXXB 3MXZA 4P0AA 4BTAA 3AAIA 4KVOA 3L09A 3CX8B 3APDA 2DWKA 2WQHA 3CVPA 2E8IA 4KMOA 2L6JA 4N3AA 3MYVA 4XBFB 4OFZA 3P1UA 2LEHA 3IF8B 3GN5A 4KT6B 2YK0A 4AQGA 5LHHB 1TJFA 2ZMAA 2VL8A 4UVAB 4TRQA 5ANRA 1MMGA 3NRXA 2EHOB 3KAEA 3VKGA 3ASFA 4C91A 4F3VA 5G04C 2UXNB 3I4GA 2JPFA 2A72A 5DQWA 1HO8A 3CMLA 2XQ0A 4B94A 3F2EA 4A1SA 4CCAA 4FA6A 4NRHB 2WXKA 3S7FA 5KMGP 1H2TC 5LG4A 3KBTA 2C0SA 3FH8A 4MRUA 3CQGB 4B8CB 4BFRA 4ME2A 3RYHE 5EX3A 5CCLA 2VQ2A 3NZQA 4I55E 3RC8A 3MA5A 1HX8A 5JR9C 3AU5A 4A3VA 3FU3A 2E9XB 1MIYA 2X3MA 4WAFA 4JEUA 4TUUA 4NACA 3L17A 3OTNA 4GAAA 4H9QC 1DNPA 1D0XA 5JVDE 1UN8A 1HU3A 3CHQA 3HKCE 5FTPA 5JRCA 2EQXA 3N2OA 4AQFA 3IKOB 2OVFA 3ZJ1A 3PREA 3B7SA 3ONLA 3QJZA 3NZPA 3B57A 1X79A 2C0LA 2WXIA 1UW4B 4AKGA 4G24A 3FXDB 3N9QA 4EBAG 4N2QA 4PJMA 5LHIB 4O4HE 5FXZA 1U5PA 3D3MA 1AJ3A 1Y64B 3OXGA 3SBTB 2KXPB 2LSYA 2WVIA 4YJ3E 2EHOC 4WNDA 5FJYA 3CSFA 3I1AA 2VSNA 2CLYC 4WNGA 2ODVA 1E1HB 3RX6A 4H7XA 5BPPA 1FEWA 2C5IT 4BJMA 2L3LA 1OWOA 4JHRA 4GU5A 4DBRA 3E0ZA 3IEEA 3C51A 3N9LA 4ZI3D 2WSSV 5LFAA 2Y8DA 3PU8A 3JUIA 3CHOA 2PQNA 2YU2A 5L3BB 2IU1A 4AY6A 3ENEA 2LSJA 4GMJA 3S7DA 4JZYA 3QC1A 1KT1A 4E85A 3FUIA 3CVQA 2FEZA 4U07A 4CXWA 1IJ5A 2A4ZA 5JR9A 3PE0A 3CVVA 3IHRA 3B7TA 3CEQA 2NOXA 3LBXA 3TJPA 1SHZC 1ELKA 2PFVA 3I3NA 4O8SA 2KCLA 2DNXA 4J8EA 4J8DA 4WNFA 3FUNA 3UT8A 2PM6A 2PZIA 3PUKA 5HYAA 4AKLA 1QZ2A 1MNEA 1H19A 5AYWD 1MMDA 1FVHA 3C4WA 4IRUA 4TV3A 3FTSA 2LE8A 3MGBA 4OVUA 4HS2A 1DVPA 2LO6A 2Q7FA 3FTXA 1GW6A 2DI4A 2N1GA 3QC9A 2EHOA 3OYZA 4IYPA 1WYBA 3KVBA 2KZTB 3S2AA 1ZBPA 4WNEA 3CK7A 4ANXA 3BK9A 3O9XA 3B7UX 1IHGA 3EVYA 4GA1A 5IYZE 3QWVA 4QXHB 2E9XA 4FLHA 2CM0A 3AB3B 3HIZA 5C2YA 2V8SE 4PS3A 2KM4A 2KCVA 5T8IA 3UMVA 3ZIMA 2J09A 3D9NA 3AA1B 5ARGA 4L5GA 4EIWA 3F57A 4I2ZA 5F8PA 4H9OC 4XE0A 1HXIA 2V4LA 4I2WA 2RA1A 2AXUA 2MTQA 4QX7B 2YHEA 4CI3B 4BA9A 4DI4A 2LSVA 5J2TE 4JLEA 1H2UA 3NBXX 4HFGA 4EZKA 4GYRA 4ISTA 3JYSA 3RK6A 2X6IA 2LSGA 1HG5A 1ZU2A 4P0BA 5FP3A 5EK3A 5HXHA 3QNKA 2V7IA 1E7UA 3Q47B 4UWHA 1KLXA 1IJ6A 3HHMA 4GYOA 3KINB 1WAO1 3D9PA 3RPUA 1ZV4X 3T8MA 3RIBA 4L1BA 4FP7A 1MIWA 3URZA 2CEAA 3MZKB 2LT3A 4V1Av 1E8XA 4GCNA 5AJLA 1QNFA 3ZJ2A 3FY4A 4ILGA 4ISSA 5DQVA 4IE7A 5AJDA 3FU0A 3PURA 5KX5E 2WXOA 4Q69A 3O48A 2MRIA 3G2VA 4I1AA 1OWAA 1NA0A 2AXVA 3ZN3A 3CQCB 3SD5A 3ASDA 3MKDA 4FHKA 2LOPA 2DHRA 4WBOA 3C4XA 4DK5A 3G2WA 2WBLA 3MKRA 1ZKEA 5FXXA 3ZRHA 4WWNA 1PC2A 2CHWA 5JJ7A 2A2FX 4UWFA 1WR6A 3ZMUB 1JWFA 4KXKB 3N9PA 3WAJA 1VDYA 4Y6CA 4K0RA 2WM9A 2CXFA 3EHMA 4AVXA 2ZM0A 2HH7A 4ILUA 3ONKA 2YNQA 3SBSA 4PNIA 4F7AA 3SOLA 2LSUA 2XCCA 4U0ZA 5A1LA 2VJ8A 3OAWA 3QK0A 4CI2B 2GGFA 4MS6A 4CT4A 4IIJE 4HOUA 1BR0A 4GZDA 1UX4A 2D0TA 2WMOA 1Z0PA 2GRLA 2MBGA 4BT8A 4IULA 2J1DG 3O1HA 4B8AA 2G0UA 4PFOA 2IFUA 2GRMA 1LF8A 4DJAA 3Q49B 2V1DB 3LPZA 2LHRA 3CKBA 3EHNA 4A1GA 2ZLYA 5BV1A 5LCWJ 2A3DA 4I9CA 1MHQA 2SPCA 2BVMA 4BX9A 2LNIA 2K9AA 2IF4A 4A56A 2JLBA 3IBEA 2VGXA 5JDGA 3ZYKA 5JHAA 4L2LA 4FJYA 4G26A 2HPLA 4ZOLE 3AA7B 3CSTA 1NA3A 5HWYA 4JA9A 2W62A 3DPDA 3QARA 2XUEA 3ZEFB 4AXHA 3ANWB 5FZQA 2LJLA 4QX8B 1UG3A 3UUMA 2L9QA 2XCBA 4MALA 3R84B 2NXPA 3UTKA 2VGYA 4ANUA 5LNKA 4EZHA 3K3OA 1P5QA 1WYCA 4FLBA 2OOEA 3I0OA 4JVSA 4UVBB 4H9SE 4UVCB 4IE0A 1YKHB 2AWIA 4DVDA 3MX3A 5J2UE 3NZUA 3CKDA 5J08A 3ZEFA 2IC9A 3CX6B 3FHEA 4PH4B 3SGHA 4N5CA 2YEVC 2E9XD 4O4JE 4J2CA 2KWIB 3RH3A 2XAFB 2Y6XA 4IN3B 4H63H 3MACA 3FUEA 3SF4A 3JC6C 3MV2B 4LEUA 3EDTB 3UUNA 2A5UA 5CHEE 5DBKA 3IV0A 2D2SA 4PAGA 3BQLA 1IZNB 1SQMA 5JDQA 4EECA 3H37A 3ZGQA 3RO3A 4KBMB 2X9WA 4AKIA 4GMLA 2BUGA 3ZYLA 3PH0C 2P58C 4ACLA 2ES0A 4KZ0A 1QSDA 3FEYA 3V5SA 3LJCA 4CXYA 1HH8A 2WXHA 2IJGX 4KBQA 4FU3A 1D1CA 3ZMVB 4JXTA 2UY1A 2MHKA 2RG8A 3VLDA 2N9DA 3LEWA 3ZVVA 2BVLA 2X9HA 5LX8A 4B0ZA 2GK9A 2L9BA 2DIWA 1N54A 1QQEA 3TXMA 2V5FA 3RO2A 4GPKA 2NP9A 2X67A 3MV3B 3FHNA 4QKNA 1UX5A 2BZBA 4WNKA 2J9QA 2OV8A 1US7B 4UV9B 3RRWA 4OVVA 1MMAA 3RYIE 3GMIA 3JCKC 3N9OA 4BSXA 1LKXA 1H7CA 2XRZA 2CHXA 4Y6WA 1TEZA 2WXJA 2PJQA 3IBPA 3U3IA 2XAQB 2VASA 4JHKA 3CVWA 4K03A 3CKCA 2LSIA 5HXRA 3ZC0A 2C0MA 4HN9A 4DNDA 4X1KE 4IHJE 2NSZA 3L13A 3SFZA 4EPZA 2ZM8A 5BMVE 3PUQA 4I43A 4CT0A 2VSXE 2CE7A 3HKBE 3FUKA 3LDZA 3G2SA 3U4TA 3PEUB 3QK6A 3KDSE 4CZZB 2V7LA 4CXXA 5LXTE 3KBUA 4EZ4A 3FULA 4WW0A 5L3FB 3PZDA 3FTUA 1YA0A 2Q9QB 3HVEB 5LGUB 3IHYA 3FBLA 3ML8A 1HS7A 5KJKA 1IQRA 5L3DB 2L0IA 5EDSA 4GZCA 2NW9A 1WM5A 3LYAA 4GA2A 3CHMA 5LJNA 2KINB 3U66A 5T4YA 2LAHA 4Q94A 2XAGB 3HL6A 1S94A 1ZHCA 3MJXA 4TN7B 4EBAA 1NWMX 2I9CA 4DMWA 5LJMA 3FFLA 5FQ8A 3LG7A 4EYUA 4RG9A 5C1DA 3KS2A 4PS8A 2ONDA 3JQ1A 2JEKA 3ZYQA 3GZSA 3I9YA 2W00A 4AOFA 5J1GA 3RRNB 4ZI3C 3APCA 2WPVA 5CMYA 5LOVE 2CHZA 3FEXA 2PL2A 3ASGA 3UFEA 4AV7A 4DLQA 3CHSA 3FB2A 3I4RB 4L23A 3K9IA 3HDXA 3E4BA 4YJ2E 3ONXA 3ZN0B 2WXPA 4UQZA 3VHLA 4L7TA 3MA9A 3ZHEB 4EOZB 4G25A 1YD8G 4W9RA 4UF0B 4UQXA 5ANLA 3T5XA 3LY7A 5EX0A 3SI5A 1XGWA 2M63A 1OWLA 3LVQE 5CCMA 3Q5WA 4LCTA 2HM8A 1CUNA 3WAKA 3Q5MA 5C8YE 2RP4A 2LOSA 4V3IA 2V7MA 5LYJE 2DBAA 3CHPA 5G05C 3LY9A 2X6HA 3N71A 3IEGA 3WXXA 3DTOA 3R7RA 2XHEB 3FBZA 5CB4E 5A23A 2LHNA 4IE5A 2CLYB 3RKVA 3D9KA 4FHJA 3CVXA 3G2TA 3KV6A 3L22A 4AXPA 4NUUA 1UN9A 5JJ6A 5L3EB 4GCOA 3SS1A 2XGSA 3LK42 1OWNA 4XZ4A 2KWHA 4GYWA 2CXLA 4QXBB 2CWYA 3MKQB 2QFCA 5JJTA 4PJJA 3UT5E 3HKDE 4UEMA 3OXLA 4XAXB 5L3CB 4IDZA 2WXLA 2X0LB 3QUJA 2ZU6B 3DP7A 4DMVA 1D1AA 3ETVA 2DCFA 3D9LA 2Y4UA 2WXNA 3KEZA 2ZM2A 3TGOA 3L16A 3PTRB 4ANVA 1HE8A 3RC3A 2PBIA 3HI2A 1UJKA 2J4BA 3M65A 1E96B 4HVBA 4HLEA 4AY5A 3NZSA 4IGUA 3HYMB 5FXWA 3FUJA 2P9BA 4ANWA 3CVRA 1G73A 4HORA 3U9WA 2CXDA 2NW7A 4G1TA 5BNWA 5LP0A 4CDNA 1BR2A 4CRWA 3G2UA 5A6CA 3TG4A 2YINA 3CV0A 4G2VA 5T3RA 4B89A 4A3TA 1VRBA 3QWWA 2MOZA 1PY1A 4GZ5A 2IW5B 2K24A 2JMHA 4PK4A 3PU3A 5LGTB 4MKTA 5FY7A 3J7Yq 3CGHA 4UXNB 4XKCA 4KZCA 3ASHA 4BT9A 3N2KE 2C2LA 2WXQA 5G05J 1HG2A 4CGVA 4ZHQE 4HOTA 3VLEA 3AU4A 3MJWA 1HCIA 1E8WA 3PUGA 2NTXA 2KNDA 3D9MA 5TAOA 4YVQC 1E7VA 3MZLB 3CLJA 3ZXSA 3OXFA 4ANJA 2X9YA 1WRDA 2XPZA 5FYMA 3ZC1A 4MLKA 3Q15A 2KCKA 4K0UA 2WQ6A 4ZI7E 3FXEB 5JDLA 4JPSA 4L0RA 4HOSA 1Y8MA 4UWGA 4JW1A 3OYXA 1XNFA 3RRCA 4C0MA 3LK3B 2X6FA 3IHVA 2UWJG 5JH7E 3RU0A 2XGMA 4HGAA 4E7ZA 2VKJA 3ML9A 5KJMA 3B7RL 4PK5A 5GONE 2WXGA 2KT9A 3LFMA 2GW1A 4LUNU 5DABA 2WXRA 4U63A 1YKEB 5LBMA 1HFAA 3FTWA 1MNDA 3C4ZA 1MIVA 4I4TE 2CFZA 5LGNB 2UY1B 3CR3A 2WB2A 3PDYA 3TXNA 1NZNA 1PAQA 3L08A 2ILRA 4WBNE 2XPIA 3LK2B 1Z6TA 2V7JA 4J8FA 4UQYA 3O1IA 3AVSA 3S7JA 3ESKA 2C5JA 3FWVA 2VKHA 4QHOA 4GYSA 2IONA 5JRCB 4PS7A 1KT0A 3PE3A 3CQXC 2R5SA 3Q4AB 2CG2A 2CFUA 4BWRA 3CVYA 4JA7A 5H6RB 2AW6A 4O4LE 1X5BA 4JEUB 2VYIA 2NWBA 2QA7A 3QAQA 3ZLIA 1U3CA 4UF0A 3AVRA 1HTJF 4EYYR 3PUSA 2FULA 1Y6IA 2RD0A 2Y4TA 5ETWA 1S35A 3P7IA 5FT9A 3MCXA 2CA5A 5IHYA 3WI3A 1UJJA 4BY6A 4ZS2A 4Z8XA 2X9XA 3EDVA 3CVLA 4HE8A 4NURA 3HKEE 2EHOD 3ANWA 4FI5A 5D0OD 2JMKA 2XEVA 3OJAA 1WLXA 3KVAA 3ZPJA 4WUYA 3A5XA 4ZI2D 5FQ7A 2AXZA 4UI9K 2FI7A 1FCHA 1NAFA 2HPJA 3H3AA 4QWNB 5J90A 2D5UA 4CI1B 3JQ0A 2I1KA 1IQUA 4R7LA 3R6NA 2DCPA 2YU1A 3SNXA 2XTLA 2KMFA 3ESLA 4X1YE 5FNVE 3KV9A 5G55A 1E90A 3PRZA 3ZHEA 2MYSA 2CG3A 3FH7A 2Z6EA 3PUAA 4JEHB 4YVOA 3L3PA 1JWGA 3S7BA 4N2SA 2N2NA 3L54A 4TV9E 4ILHB 3C98B 5LBQB 2HR2A 1S0PA 1FMVA 4O2BE 3QOUA 4D10C 1ELRA 3SWHA 4B6XA 4F53A 4L2YA 4P09A 3T8OA 4APOA 3L6AA 4N3BA 2M67A 4GZ3A 2J4DA 2B1EA 1OUVA 3LJ3A 3N2GE 3VKHA 3F31A 1LRZA 2PG8A 3CX7B 4AM9A 3QWPA 2CMRA 3N9MA 1TJCA 1L5JA 3EJNA 2LM9A 1JPLA 3LXUX 2H7OA 1OWMA 4FULA 2VKDA 3R9AB 3PDNA 4M1PA 4CGWA 3ZPOA 3C98A 3BG0B 3ZMTB 1JUQA 4X20E 3I9WA 5FWQA 2PQRA 2VSYA 4ATGA 2XQYA 5JR9B 4XIFA 2VTBB 2BF0X 4FJZA 3N5LA 2DWGA 1ELWA 2L0TB 5BV0A 3KV5A 2VK9A 1EPUA 2IC6A 4I6GA 2W0GA 3CPZA 3PVLA 5L3GB 2XASB 4J8SA 1VOMA 5LCWC 3O4XE 3OBVE 3K3QC 4UV8B 5BW8C 5HWXA 4E6HA 4PFPA 3FU5A 4H63V 3D9JA 3PS6A 1D1BA 4H9PC 4G23A 5FZRA 4EZJA 2NTYA 4C9BB 4U8HA 4PUCA 5JDHA 4AP2A 5BUZA 5HQ8A 3ULQA 5FQ4A 3GN5B 3HA4A 3MEKA 2L8KA 5L2LA 3ZYMA 5LCYA 3J9X1 2V26A 2VB6A 1LVKA 5LP6E 5LA6E 3FU6A 3ZMSB 2K5BB 3UUXA 4NQ0A 1SZ9A 4MLPA 4ABNA 3CVUA 3U78A 4JL0A 4UELA 3R7QA 4OHFA 4XZCA 3RJVA 3AS5A 4F6RC 4AEZC 4LERA 3N9NA 2E2EA 5FXVA 5EZYE 3CK8A 5AIJA 4OK0A 2AVPA 5JHBA 1H2VC 5KJLA 3B13A 1KK7A 4KYOB 2WXFA 4ZS3A 5HI7A 3V5UA 2NW8A 2OVBA 3W15B 3I5PA 1E8YA 3T5VA 2CCQA 2R59A 2X66A 3UT7A 4P29A 2JJ9A 4L9IA 1QUUA 3GYZA 4H7YA 2QGSA 4PK6A 4X1IE 3UQ3A 4MFRA 4KUMB 4URKA 2BDEA 1U4QA 4G11A 5E0OA 4C0EA 2WMNA 4JUYA 2R17C 4OYKA 5DJQC 5LOZA 5FY1A 2KATA 2W61A 4KMCA 4RG6A 4UI9C 3NRYA 3EIJA 5KCMA 2VTBA 3BQKA 3E22E 5A7DB 1WY6A 2KLQA 4NUVA 4AJWA 1ZEEA 4RSYA 2PM7A 2JRKA 1SZAA 2MOWA 4WWOA 4I1MA 2CWOA 5ADXL 4PJNA 3BEEA 2E9XC 3KV4A 5EKQD 1Z3XA 4YFSA 5JDMA 4KVMA 3K8PC 2VGXB 2X51A 3SZ7A 3LY8A 1BR1A 4BTBA 1SA0E 1NP7A 3FUFA 3O1JA 3AA0B 2FBNA 4N78D 5CMWA 3APFA 4PDXA 3ZFWA 4HKAA 4I9EA 5HXCA 4U72A 4ADZA 3FH5A 2ODUA 3VTXA 3I0QA 4ILIA 3GZ1A 3FTZA 4TX5A 1MMNA 3C64A 2XRYA 1H0AA 2ACXA 5AFUL 4PJLA 2LSKA 4QXCB 2C5KT 1B7TA 3ZW3A 3EDUA 5G04J 3AAEB 4J0UA 2X38A 3D0TA 1IYGA 2LAIA 4UWLA 4GA0A 3TG5A 2XAHB 4YHJA 3SHFA 4TZ4C 4O6FA 2Q9QA 3HVEA 3FTYA 2IQCA 2DLRA 4G63A 2X6JA 4BJNA 3OKQA 1KNZA 4DO0A 4EQFA 4LRZA 4KP3C 3UT4A 3VLFA 5JDNA 3CK9A 3NF1A 4FADA 4I50E 2WAUA 4GK5E 4XX5A 4G2AA 1EZ3A 4GYYA 5JDFA 4U0SA 1HF8A 2Y48B 3ZMZB 1BR4A 2H3RA 3AA6B 4YNDA 1EDUA 4M3OA 2WXMA 2XPYA 4QFVA 4A55A 2I6HA 2IAKA 2J07A 2H7VC 5HXSA 4EXTA 4CQIA 4AQFC 3FUMA 3DBSA 5ARFA 3DJBA 5DIZA 1H6KA 3LS8A 3CWZB 4HXIA 3FUDA 4TV8E 3GWHA 3P2BA 3EUHA 2V0PA 2V7KA 2NC9A 5F3JA 4O4IE 2WQ7A 3BQIA 1EF1C 2IOLA 2XHEA 4AIFA 3SRZA 2I1JA 3PNLB 3UPVA 3PUJA 3PE4A 4GZ6A 2KZTA 5FQ6A 3CHRA 4ASKA 4U04A 3QB2A 3ZN1B 2J49A 4XKBA 5KDMC 2BTDA 4PW8A 5FMNA 3NQPA 3TL5A 4ACKA 2QY7A 3FDHA 4APFA 4RVBA 4AKHA 4I6JA 2XGOA 3QKYA 3O4ZA 2D0UA 2JQQA 4GIWA 3PEVB 4E7SA 1V9DA 3Q5XA 3VTYA 3UUXB 1D0ZA 2KZ7B 3PNTB 3FTVA 3TKLB 1FVFA 4OYSA 4H9NC 2I2OA 1FMWA 3RYFE 1HZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQC B;  3CQG B;  3I4R B; 
#chains in the Genus database with same CATH topology
 4EZL A;  3Q2M A;  3D9I A;  4MBQ A;  4YLH A;  4U96 D;  2XAJ B;  5JRE A;  2YN6 A;  4HEA A;  5E75 A;  4OAU C;  4DV3 T;  1U3D A;  2Q9Q C;  3AS4 A;  5JQG E;  2Q9Q D;  1OCR E;  3P8C D;  3U64 A;  5ENN A;  4DPR A;  2AJA A;  1G8X A;  1HS6 A;  3AS8 A;  1IAP A;  2VSO E;  2X6K A;  4XI0 A;  4HFE A;  1LVF A;  2HO1 A;  3RYC E;  1AWC B;  4UUC A;  4K0K T;  4U0U A;  4CDR A;  4CEM A;  5EK4 A;  2GRN B;  1OWP A;  4UIG A;  5KWD A;  2Y3A A;  3EIQ C;  4HOQ A;  4GTR A;  4I6E A;  2RPA A;  5HXE A;  4ERR A;  2WDQ A;  2P9P G;  3ZCJ A;  3VU7 H;  3KFW X;  4EAH A;  3GW4 A;  4U74 A;  4CDM A;  4TUY E;  2IOS A;  2W63 A;  4EB6 E;  3MK7 C;  5FIO A;  5E76 A;  4WWP A;  4IE4 A;  5FZS A;  4FC8 A;  3V79 K;  3LCA A;  2KC7 A;  2J08 A;  1TN6 A;  3UIN C;  1D0Y A;  1T98 A;  4I1O B;  4C90 A;  1Z3Y A;  4DLO A;  2VKO A;  3LBX B;  3FZM B;  5FL0 A;  1EYH A;  2I59 A;  3QB5 A;  5AEN A;  2KXP C;  3C3O A;  3KD7 A;  4LNU D;  1YW0 A;  5AQO B;  1BI8 B;  2OA5 A;  3AXJ A;  1B89 A;  3AAA C;  4J6I A;  4AI6 A;  1Z8U A;  3FUH A;  3U3W A;  4GOU A;  2HN2 A;  3RRU A;  2E0I A;  3P4R A;  4GK0 E;  4DR3 T;  5LHG B;  3UU3 A;  3MKQ A;  2K48 A;  4FJO A;  2F4V T;  2YHC A;  4DI3 A;  4JHJ A;  1S63 A;  1FIO A;  4ZI2 C;  1UCU A;  3QB5 K;  4O2A E;  3GA8 A;  2YQ8 A;  2FO7 A;  4UWK A;  3E08 A;  4OYJ A;  4I43 B;  5HEG A;  3K3N A;  1Q2Z A;  3AAA B;  1NEN A;  3HR0 A;  5HAX A;  4F6R D;  1J1J A;  4HRN A;  1I6Z A;  3JXJ A;  4H9R C;  5D0Q D;  5LMU T;  4XI9 A;  1KZO A;  3JC6 D;  5CA1 E;  1E8Z A;  3ZCI A;  5H6Q B;  4N39 A;  4HTE A;  3ETU A;  5HEH A;  5G2N A;  4DBQ A;  4N3C A;  1W3B A;  4MHC A;  1O3X A;  2WWU A;  3TAX A;  3RRM B;  3Q7A A;  4IE6 A;  5CA0 E;  3QDN A;  3S4U A;  2VWA A;  3RKO A;  4U95 D;  4F1S A;  3C50 A;  3D9O A;  1MQS A;  4NIQ A;  3CVN A;  4I17 A;  2X68 A;  3FP3 A;  3UX4 A;  3PUW F;  3BG1 B;  3GZ2 A;  1OXZ A;  5FY0 A;  4CZ2 D;  2HYZ A;  3LVR E;  5KJN A;  4HFV A;  2DZN A;  1BPO A;  4JC8 A;  4UI9 J;  4GB9 A;  3LKU A;  4TXQ A;  4Q96 A;  4BX8 A;  4GKK T;  1N52 A;  3CIA A;  4AKR B;  2WY2 A;  5M72 A;  4BAY B;  4COF A;  5EK2 A;  2XM2 A;  5HCM A;  3UUL A;  1MX4 A;  3AEE A;  1INZ A;  3Q9D A;  5M4Y A;  2FF4 A;  4JEH A;  5BT1 A;  1A17 A;  2UXX B;  2BG9 A;  1OED E;  3MXZ A;  4I0U A;  4P0A A;  4BTA A;  3AAI A;  4KVO A;  1KEY A;  3L09 A;  3CX8 B;  3APD A;  2DWK A;  2WQH A;  3BQO A;  3CVP A;  2E8I A;  1CHU A;  4KMO A;  2H89 A;  2L6J A;  2ZGD A;  4N3A A;  3OPC A;  5HEJ A;  4XBF B;  3MYV A;  4OFZ A;  3P1U A;  5ENT D;  2LEH A;  1D9S A;  3RLF F;  3AJI A;  3IF8 B;  3GN5 A;  3V30 A;  4KT6 B;  3Q73 A;  1SE7 A;  3TWR A;  2YK0 A;  1TN7 A;  5AQT B;  4AQG A;  5LHH B;  1TJF A;  1D8D A;  2ZMA A;  2VL8 A;  4UVA B;  4TRQ A;  5ANR A;  1MMG A;  3NB2 A;  1V55 E;  1TYQ G;  3NRX A;  2JQK A;  2EHO B;  2F0Y A;  3KAE A;  3VKG A;  3AE9 A;  3ASF A;  1N4P A;  4C91 A;  4F3V A;  4HRL A;  5G04 C;  2UXN B;  3I4G A;  5B3S E;  2JPF A;  2A72 A;  5DQW A;  1HO8 A;  2H6F A;  3CML A;  1SUM B;  2XQ0 A;  2XQ5 A;  4B94 A;  3F2E A;  4A1S A;  4CCA A;  4FA6 A;  2V6Y B;  4NRH B;  2WXK A;  3S7F A;  5KMG P;  1H2T C;  5LG4 A;  3KBT A;  2C0S A;  3FH8 A;  4A63 B;  4MRU A;  3CQG B;  4B8C B;  4BFR A;  2D9D A;  4ME2 A;  3RYH E;  5EX3 A;  5CCL A;  4JYA T;  4JI2 T;  2VQ2 A;  3NZQ A;  4YDW A;  4I55 E;  3RC8 A;  1OED C;  3MA5 A;  4X5T A;  1BI7 B;  1HX8 A;  5JR9 C;  3AU5 A;  4A3V A;  4QH4 A;  3TWQ A;  3AE8 A;  3FU3 A;  2E9X B;  2GRO B;  1MIY A;  4Z90 A;  3NOG D;  2VL0 A;  2X3M A;  4WAF A;  4JEU A;  4TUU A;  4NAC A;  3TWT A;  3L17 A;  3OTN A;  4H9Q C;  2VQF T;  1DNP A;  1D0X A;  5JVD E;  4GAA A;  1UN8 A;  4JI3 T;  1HU3 A;  5EIL A;  4IRE A;  1OCZ E;  3CHQ A;  2LKG A;  3HKC E;  3KSL A;  1N94 A;  1KPS B;  5FTP A;  5JRC A;  2V5D A;  1SVX A;  2EQX A;  3N2O A;  3ASN E;  1WR0 A;  4AQF A;  3IKO B;  5AQQ B;  2MPK A;  2OVF A;  4GTT A;  3ZJ1 A;  3PRE A;  3B7S A;  3ONL A;  3QJZ A;  1W09 A;  3NZP A;  3B57 A;  1T8B A;  1X79 A;  3EAB A;  4IL4 A;  2C0L A;  4ZXL A;  4HQD A;  5KXJ A;  2WXI A;  1UW4 B;  4AKG A;  4G24 A;  3AG4 E;  3FXD B;  1A5E A;  3N9Q A;  2VQE T;  4EBA G;  4N2Q A;  4PJM A;  3Q5D A;  1S70 B;  5LHI B;  4O4H E;  5FXZ A;  2XQ9 A;  5B1A E;  2GRR B;  1E7P A;  1U5P A;  5AQN B;  3RGL A;  3D3M A;  2BKK B;  3P4W A;  1AJ3 A;  1Y64 B;  3E32 A;  3OXG A;  3SBT B;  4U3C A;  2KXP B;  2LSY A;  2WVI A;  4YJ3 E;  1TNU A;  2EHO C;  4WND A;  5FJY A;  3CSF A;  3I1A A;  2VSN A;  2CLY C;  4WNG A;  3UIO C;  2ODV A;  3QOF A;  1E1H B;  3RX6 A;  2B76 A;  4H7X A;  5BPP A;  1FEW A;  2C5I T;  4BJM A;  2L3L A;  3IA3 A;  1OWO A;  5HRY A;  2V5Q C;  4JHR A;  4GU5 A;  2NR4 A;  1I94 T;  4DBR A;  3E0Z A;  3IEE A;  3C51 A;  2HE0 A;  5JMN D;  3N9L A;  4ZI3 D;  2WSS V;  5LFA A;  2Y8D A;  3PU8 A;  3JUI A;  2XEE A;  4MBG A;  2WU5 A;  3CHO A;  4HB5 A;  2PQN A;  2YU2 A;  2P9L G;  5L3B B;  2IU1 A;  4AY6 A;  2PTF A;  5LMN T;  3ENE A;  2LSJ A;  4GMJ A;  3S7D A;  3Q7F A;  4JZY A;  3QC1 A;  1KT1 A;  4E85 A;  3FUI A;  3CVQ A;  2FEZ A;  3P4Q A;  2XQ4 A;  4TWF A;  5C3J A;  4U07 A;  4CXW A;  2A9U A;  1IJ5 A;  3PUZ F;  2A4Z A;  3Q9U C;  5JR9 A;  3PE0 A;  3CVV A;  3IHR A;  3B7T A;  3CEQ A;  2NOX A;  3LBX A;  3TJP A;  1SHZ C;  1ELK A;  3UFG A;  2PFV A;  2OEW A;  3I3N A;  4O8S A;  3RIU C;  2WZI A;  2KCL A;  1H6P A;  3VR8 A;  3LDQ B;  2KBX A;  2DNX A;  3D9H A;  4J8E A;  4J8D A;  4WNF A;  4TNV A;  3FUN A;  1M62 A;  3UT8 A;  2PM6 A;  2PZI A;  3PUK A;  5HKP A;  1YCS B;  5HYA A;  4AKL A;  1QZ2 A;  2XQA A;  1MYO A;  4KI0 F;  1MNE A;  1H19 A;  5AYW D;  2EIN E;  1MMD A;  1FVH A;  3C4W A;  4IRU A;  4TV3 A;  3FTS A;  2LE8 A;  3MGB A;  4OVU A;  2FJA A;  4HS2 A;  1DVP A;  2LO6 A;  2Q7F A;  1LD7 A;  2XPK A;  3AE2 A;  2Y0B G;  3FTX A;  4HWH A;  1GW6 A;  2DI4 A;  3W9F A;  2BS3 A;  2N1G A;  3QC9 A;  2EHO A;  3OYZ A;  4IYP A;  1WYB A;  3KVB A;  2KZT B;  4YHH T;  3S2A A;  1ZBP A;  3WG7 E;  4U2Z A;  4WNE A;  2A5E A;  3CK7 A;  4ANX A;  4DUY T;  3BK9 A;  3O9X A;  3B7U X;  1IHG A;  4DX2 A;  3EVY A;  2GRQ B;  4GA1 A;  5IYZ E;  1TNO A;  2X0H A;  3QWV A;  3JAE A;  4DID B;  3X1D A;  5AQR B;  2L6B A;  3HXE A;  4QXH B;  3AXJ B;  1LTX A;  5AQH B;  2E9X A;  4FLH A;  2CM0 A;  4RLY A;  3AB3 B;  3HIZ A;  5C2Y A;  3RI5 A;  4DR2 T;  1JNR A;  2V8S E;  4PS3 A;  2KM4 A;  2WCA A;  2BG9 B;  2KCV A;  2ETA A;  5T8I A;  3UMV A;  5CBO A;  5CGM A;  3ZIM A;  2J09 A;  3D9N A;  3SFY A;  5LG3 A;  1H6O A;  3AA1 B;  4U7E B;  5AQU B;  3AEG A;  5ARG A;  4L5G A;  4EIW A;  3F57 A;  2IML A;  4I2Z A;  3L39 A;  5F8P A;  4H9O C;  4X8Q A;  4DR5 T;  3OVU A;  4XE0 A;  1HXI A;  2V4L A;  1V54 E;  2ZGG A;  4I2W A;  2RA1 A;  2AXU A;  2MTQ A;  4QX7 B;  2YHE A;  4C48 B;  5AQI B;  4CI3 B;  4BA9 A;  4DI4 A;  2LSV A;  5J2T E;  4JLE A;  1H2U A;  3NBX X;  3DSS A;  4DR1 T;  4HFG A;  4EZK A;  4GYR A;  4IST A;  3JYS A;  3RK6 A;  2X6I A;  2LSG A;  1HG5 A;  1ZU2 A;  4P0B A;  5FP3 A;  3RIA A;  5EK3 A;  4HWI B;  5HXH A;  3QNK A;  2V7I A;  2R05 A;  1E7U A;  4QQI A;  3Q47 B;  4UWH A;  1Z5S C;  1KLX A;  4BEP A;  5CER B;  3SFD A;  1IJ6 A;  3HHM A;  4GYO A;  2WS3 A;  3KIN B;  1WAO 1;  3D9P A;  5CRU A;  3RPU A;  2XY8 B;  1ZV4 X;  3T8M A;  3OTO T;  4GTP A;  1KF6 A;  3RIB A;  4L1B A;  4FP7 A;  1UGO A;  1MIW A;  3URZ A;  2CEA A;  2OCC E;  3MZK B;  2LT3 A;  4V1A v;  1E8X A;  4GCN A;  3F6Q A;  5AJL A;  2QVA A;  3ABK E;  1QNF A;  1SA5 A;  1O1T A;  3ZJ2 A;  3FY4 A;  3ZT5 A;  4ILG A;  2YDQ A;  4ISS A;  5DQV A;  2R03 A;  4HFC A;  5AQK B;  3DEP A;  4IE7 A;  2UU9 T;  5AJD A;  4U2Y A;  3FU0 A;  3PUR A;  3G06 A;  5KX5 E;  2WXO A;  4Q69 A;  2OLT A;  3O48 A;  2WDV A;  1UK5 A;  2MRI A;  4AQY T;  3G2V A;  4I1A A;  3DSW A;  1OWA A;  2BS4 A;  5AQL B;  1NA0 A;  2AXV A;  2VGE A;  3CQC B;  3SD5 A;  3ZN3 A;  3ASD A;  3MKD A;  4FHK A;  3C5R A;  2LOP A;  2DHR A;  4WBO A;  3C4X A;  4DK5 A;  3G2W A;  2WBL A;  2CPT A;  4HFD A;  3MKR A;  1ZKE A;  5FXX A;  2YKS A;  3ZRH A;  1TNB A;  1PC2 A;  4WWN A;  3C3Q A;  1OCO E;  1U2V G;  2CHW A;  5JJ7 A;  4U7I A;  2A2F X;  4UWF A;  1WR6 A;  3ZMU B;  1JWF A;  2E2A A;  4KXK B;  3N9P A;  4TWD A;  3WAJ A;  1VDY A;  3ABM E;  4Y6C A;  4K0R A;  1SA4 A;  2WM9 A;  2BS2 A;  2CXF A;  3EHM A;  3JXI A;  4AVX A;  2ZM0 A;  2HH7 A;  4ILU A;  4IDO A;  3ONK A;  2YNQ A;  4DR7 T;  4LMJ A;  2JAB A;  3SBS A;  2RFA A;  2V6X A;  4PNI A;  4F7A A;  5AQJ B;  3J5P A;  3SOL A;  5AQF B;  2LSU A;  2XCC A;  4U0Z A;  5A1L A;  4O1P A;  2H6G A;  2VJ8 A;  3OAW A;  3QK0 A;  4CI2 B;  2YOE A;  2GGF A;  4MS6 A;  4CT4 A;  4IIJ E;  4HOU A;  3P4P A;  1W0A A;  1BR0 A;  4JI7 T;  4GZD A;  1UX4 A;  1MZC A;  2D0T A;  2WMO A;  1N34 T;  2XEH A;  3DXK G;  3AE1 A;  1Z0P A;  2GRL A;  2MBG A;  4BT8 A;  4IUL A;  1N95 A;  2J1D G;  3O1H A;  4B8A A;  2G0U A;  2ZIS A;  4PFO A;  2IFU A;  2GRM A;  3TWW A;  3H3M A;  1LF8 A;  4DJA A;  4EED A;  3L8R A;  3Q49 B;  2V1D B;  4YSX A;  3LPZ A;  2LHR A;  3CKB A;  3EHN A;  4A1G A;  2ZLY A;  5BV1 A;  5LCW J;  3PJA J;  2A3D A;  3ONJ A;  4I9C A;  2XS8 A;  4U7Y A;  1MHQ A;  2SPC A;  4HI8 A;  5ENP D;  1L0V A;  2BVM A;  4BX9 A;  2LNI A;  2K9A A;  2IF4 A;  3QNU A;  5FIN A;  5EYL A;  4A56 A;  4P1N A;  2VUR A;  2JLB A;  3IBE A;  1O5M A;  2VGX A;  5JDG A;  3ZYK A;  4A98 A;  5JHA A;  4L2L A;  4DUI A;  4FJY A;  2FBW A;  4TNW A;  4G26 A;  2HPL A;  3A8Y C;  5FL1 A;  4ZOL E;  3AA7 B;  3CST A;  2BED A;  1NA3 A;  5HWY A;  4JA9 A;  4NXN T;  1IHB A;  2W62 A;  3TLV A;  3DPD A;  3QAR A;  2XUE A;  3ZEF B;  4AXH A;  3ANW B;  5FZQ A;  2LJL A;  3ABV A;  5AQP B;  4QX8 B;  4Z91 A;  1UG3 A;  3UUM A;  2L9Q A;  1G3N B;  2XCB A;  1X9B A;  4MAL A;  3R84 B;  4HWD A;  2NXP A;  3UTK A;  2VGY A;  4ANU A;  5LNK A;  1UUS A;  2WU2 A;  4EZH A;  3K3O A;  1WG0 A;  1P5Q A;  2P9U G;  1WYC A;  2F8X K;  4QH1 A;  4FLB A;  2OOE A;  2UUC T;  3I0O A;  3NVO A;  4JVS A;  1ZOY A;  4UVB B;  2LRL A;  4H9S E;  5ABE A;  4UVC B;  4YDO A;  4IE0 A;  4TWH A;  1YKH B;  3Q79 A;  2IY0 C;  2AWI A;  4ZHB A;  3IXE A;  4DVD A;  5IY5 E;  3MX3 A;  5J2U E;  3NZU A;  4Q25 A;  5J0Z A;  3CKD A;  1BU9 A;  5J08 A;  2OEV A;  3ZEF A;  2IC9 A;  1BLX B;  3CIR A;  2V5C A;  3CX6 B;  3FHE A;  4PH4 B;  3SGH A;  4Z68 A;  4HFH A;  1KNR A;  2YEV C;  4N5C A;  2E9X D;  1K8K G;  3ISM C;  4O4J E;  4J2C A;  2KWI B;  3RH3 A;  2XAF B;  2Y6X A;  4IN3 B;  2F8Y A;  4H63 H;  3MAC A;  3FUE A;  3SF4 A;  3JC6 C;  3MV2 B;  4TXP A;  4LEU A;  3EDT B;  1IXV A;  3UUN A;  2A5U A;  5CHE E;  5DBK A;  3IV0 A;  4O1O A;  2QYW A;  2J47 A;  4GTM A;  2D2S A;  4PAG A;  3BQL A;  4EHM A;  1IZN B;  5JDQ A;  4DV5 T;  1SQM A;  5H7P A;  4EEC A;  3H37 A;  3ZGQ A;  1XZY A;  4GTO A;  3RO3 A;  4KBM B;  2X9W A;  4AKI A;  4X64 T;  4GML A;  2BUG A;  3ZYL A;  2VVS A;  4AIS A;  2LM2 A;  3PH0 C;  2R2L A;  3SO8 A;  2K3W A;  2P58 C;  3B7B A;  4ACL A;  2ES0 A;  4KZ0 A;  1QSD A;  3FEY A;  2RFM A;  3V5S A;  4YSZ A;  3LJC A;  4CXY A;  1HH8 A;  2IJG X;  2WXH A;  4KBQ A;  1D1C A;  3ZMV B;  4FU3 A;  4JXT A;  2UY1 A;  2MHK A;  2RG8 A;  3VLD A;  2N9D A;  3LEW A;  3ZVV A;  2BVL A;  1YXR A;  1YQ4 A;  2X9H A;  4B0Z A;  2GK9 A;  5LX8 A;  3ULE G;  2L9B A;  2DIW A;  1N54 A;  1FJG T;  1DC2 A;  1QQE A;  3TXM A;  2V5F A;  3RO2 A;  4GPK A;  2NP9 A;  2X67 A;  3MV3 B;  3UTM A;  3TWS A;  3FHN A;  4QKN A;  1XDP A;  1UX5 A;  1N9A A;  3AE4 A;  4ZEY A;  2BZB A;  4WNK A;  1N4S A;  3DEO A;  2UXD T;  3RQU A;  4B3T T;  2J9Q A;  1US7 B;  2OV8 A;  1OY3 D;  4UV9 B;  3RRW A;  2ACZ A;  3RQW A;  1N36 T;  4OVV A;  1MMA A;  3RYI E;  3GMI A;  3JCK C;  3N9O A;  4BSX A;  1LKX A;  2ZM6 T;  2FO1 E;  3JCF A;  1H7C A;  4JI6 T;  4X65 T;  2XRZ A;  2CHX A;  4NPP A;  1IBK T;  4Y6W A;  2Y69 E;  1TEZ A;  2WXJ A;  4LF7 T;  2PJQ A;  3IBP A;  4DUZ T;  3SFE A;  3U3I A;  2CBI A;  2XAQ B;  2VAS A;  4JHK A;  3CVW A;  4LF9 T;  4K03 A;  3CKC A;  2LSI A;  5HXR A;  3TLW A;  4LFA T;  3ZC0 A;  3EHZ A;  2ZXW E;  2C0M A;  4J7W A;  4HN9 A;  4B93 B;  4DND A;  5CRV A;  3TWX A;  4X1K E;  4DV4 T;  4IHJ E;  2NSZ A;  3L13 A;  3SFZ A;  2Y1L E;  4EPZ A;  2ZM8 A;  5BMV E;  3HG0 D;  4YT0 A;  3PUQ A;  4LNG A;  4I43 A;  2EIJ E;  1N4Q A;  2E5L T;  4CT0 A;  4DRX E;  2VSX E;  4A97 A;  2CE7 A;  3HKB E;  1N11 A;  3FUK A;  3LDZ A;  3EHR A;  2WWV A;  3G2S A;  3U4T A;  3PEU B;  3QK6 A;  3KDS E;  4CZZ B;  2V7L A;  4CXX A;  5LXT E;  3JUE A;  2BKP A;  3KBU A;  4EZ4 A;  3RKG A;  3ZXP A;  1OXJ A;  3L82 A;  3FUL A;  4WW0 A;  2BKN A;  1WFD A;  3JAD A;  4G8K A;  3JAF A;  5L3F B;  3PZD A;  2BBJ A;  2B0O E;  3FTU A;  1YA0 A;  4LF8 T;  1K1A A;  2OV9 A;  2Q9Q B;  4F8H A;  3E33 A;  3HVE B;  5LGU B;  3IHY A;  3PUY F;  3UU5 A;  5L4E A;  2FUP A;  3FBL A;  1HS7 A;  3ABL E;  3ML8 A;  5KJK A;  3EAM A;  1IQR A;  5L3D B;  2L0I A;  5EDS A;  5HCJ A;  4LG6 A;  2DYS E;  4GZC A;  2NW9 A;  1WM5 A;  3LYA A;  4GA2 A;  4J8Y A;  2DVW A;  3AEF A;  4X62 T;  1KNP A;  5LJN A;  3CHM A;  5B1B E;  2XQ8 A;  3Q78 A;  3TWV A;  2KIN B;  3U66 A;  3EHQ A;  5T4Y A;  2LAH A;  3PV0 F;  4Q94 A;  4LFC T;  2IUB A;  2XAG B;  3HL6 A;  1S94 A;  1ZHC A;  3MJX A;  4TN7 B;  4EBA A;  1NWM X;  5IUX A;  2I9C A;  4DMW A;  5LJM A;  3FFL A;  5FQ8 A;  5L4H A;  3LG7 A;  4EYU A;  4RG9 A;  1KFY A;  1VCS A;  5C1D A;  3KS2 A;  5D2M C;  4PS8 A;  2OND A;  3JQ1 A;  1NFI E;  2JEK A;  3ZYQ A;  3GZS A;  3I9Y A;  2W00 A;  3RIF A;  4AOF A;  5J1G A;  4GPM A;  3RRN B;  4ZI3 C;  2XJ7 A;  3APC A;  2WPV A;  5CMY A;  2E5V A;  5LOV E;  1ZB1 A;  2CHZ A;  3FEX A;  2PL2 A;  5AAR A;  3ASG A;  3UFE A;  4AV7 A;  4DLQ A;  3CHS A;  3FB2 A;  4TXR A;  3KSQ A;  3I4R B;  1DCE A;  1TN8 A;  4L23 A;  2XSB A;  2FJE A;  5CBN A;  3K9I A;  3HDX A;  3E4B A;  1FPP A;  4JB8 P;  4YJ2 E;  3P50 A;  3ONX A;  3ZN0 B;  5AQG B;  5AQV B;  2WXP A;  2CHO A;  3PUX F;  2XEN A;  4JI5 T;  4UQZ A;  3VHL A;  4L7T A;  3MA9 A;  4RQI A;  3ZHE B;  4UR9 A;  4EOZ B;  4G25 A;  1YD8 G;  4W9R A;  5ENR D;  4UF0 B;  4YDE A;  5IWA T;  4UQX A;  5ANL A;  3T5X A;  2IIU A;  3LY7 A;  5EX0 A;  1O1R A;  3DSU A;  5FVK A;  3SI5 A;  3AED A;  1XGW A;  4JI0 T;  3UXG A;  2M63 A;  1OWL A;  3LVQ E;  5JA4 D;  1XNQ T;  1IKN D;  5CCM A;  3Q5W A;  3VRB A;  4LCT A;  2HM8 A;  1CUN A;  3HRA A;  3WAK A;  3Q5M A;  5C8Y E;  2RP4 A;  2LOS A;  4V3I A;  2V7M A;  5LYJ E;  2DBA A;  3CHP A;  5G05 C;  5CEA A;  3LY9 A;  2X6H A;  3N71 A;  3IEG A;  3SFX A;  5AQ9 A;  1R8I A;  3WXX A;  1AP7 A;  3DTO A;  4KHZ F;  3R7R A;  2XHE B;  3FBZ A;  5CB4 E;  5A23 A;  4U33 A;  2LHN A;  4IDQ A;  2CLY B;  4IE5 A;  3RKV A;  3D9K A;  4FHJ A;  2P2C P;  3CVX A;  2MYO A;  3G2T A;  3R9M A;  3UM2 A;  2QRX A;  1QLB A;  3KV6 A;  3W9G A;  3L22 A;  4AXP A;  4NUU A;  1UN9 A;  5JJ6 A;  5L3E B;  4GCO A;  3SS1 A;  1N4R A;  2XZE A;  2CBJ A;  3UKU G;  5ABG A;  2XGS A;  3LK4 2;  1OWN A;  4OX9 T;  5C2T A;  4XZ4 A;  2KWH A;  4GYW A;  2CXL A;  4A5X A;  4QXB B;  3ZU7 B;  2CWY A;  3MKQ B;  4B3S T;  3VR9 A;  2QFC A;  5AQ7 A;  3TLT A;  5AAO A;  2IHR 1;  1N33 T;  5JJT A;  4PJJ A;  3UT5 E;  3HKD E;  4UEM A;  1VCT A;  4XAX B;  3OXL A;  2XQ3 A;  5EN5 D;  5L3C B;  4OAV B;  4IDZ A;  2WXL A;  2X0L B;  2ETB A;  3QUJ A;  2XM1 A;  3DP7 A;  2ZU6 B;  4DMV A;  1D1A A;  2LKH A;  3ETV A;  2DCF A;  3D9L A;  2Y4U A;  2WXN A;  1KZP A;  4LSZ E;  3KEZ A;  2ZM2 A;  3T9K A;  3TGO A;  3L16 A;  2YDR A;  3UKR G;  3PTR B;  4QH5 A;  1W9R A;  2DZO A;  4ANV A;  1HE8 A;  3RC3 A;  4CN4 A;  2PBI A;  3HI2 A;  1UJK A;  2XQ6 A;  2J4B A;  3M65 A;  1E96 B;  4HVB A;  4HLE A;  4AY5 A;  4HFB A;  3NZS A;  4IGU A;  3HYM B;  3NOC D;  5FXW A;  3DWL G;  3FUJ A;  4U31 A;  2P9B A;  4ANW A;  3CVR A;  1G73 A;  4HOR A;  4YY3 T;  2XS1 A;  1SW6 A;  3U9W A;  2CXD A;  2NW7 A;  1NL4 A;  4G1T A;  5BNW A;  5LP0 A;  4CDN A;  3K1S A;  1BR2 A;  4LF6 T;  3G2U A;  4CRW A;  5A6C A;  3TG4 A;  2YIN A;  3CV0 A;  4DV1 T;  4G2V A;  5T3R A;  4B89 A;  3UIP C;  1VRB A;  4A3T A;  5FVL A;  3QWW A;  2DL1 A;  3UU4 A;  2MOZ A;  1PY1 A;  2JQH A;  4GZ5 A;  5KNG A;  2IW5 B;  2K24 A;  2JMH A;  4PK4 A;  3PU3 A;  5LGT B;  3PUV F;  5FY7 A;  4MKT A;  3J7Y q;  3CGH A;  4UXN B;  4XKC A;  1X81 A;  4KZC A;  3ASH A;  4U8V D;  4BT9 A;  3N2K E;  4BET A;  1K1B A;  2C2L A;  5EIB E;  2WXQ A;  5G05 J;  1HG2 A;  4CGV A;  2J8S D;  3ZT7 A;  4ZHQ E;  4HOT A;  3VLE A;  2V8S V;  3AU4 A;  3L9T A;  3MJW A;  5AQS B;  1HCI A;  1E8W A;  3PUG A;  2NTX A;  2KND A;  3D9M A;  5TAO A;  4YVQ C;  1E7V A;  3MZL B;  3CLJ A;  3DRA A;  2GRP B;  3ZXS A;  2EIL E;  3OXF A;  2AXD S;  4IT4 A;  2LXM A;  4ANJ A;  2X9Y A;  1WRD A;  2XPZ A;  5FYM A;  3ZC1 A;  4MLK A;  2X0Y A;  4DX1 A;  4DX5 D;  3Q15 A;  1OED B;  2KCK A;  4K0U A;  2UUB T;  2WQ6 A;  4ZI7 E;  3FXE B;  5JDL A;  4JPS A;  4L0R A;  3ZKJ A;  4HOS A;  1Y8M A;  4UWG A;  4JW1 A;  3OYX A;  1XNF A;  5CED B;  3RRC A;  4C0M A;  2UXC T;  3LK3 B;  2X6F A;  3IHV A;  2P9S G;  2UWJ G;  3B95 A;  5JH7 E;  4K5B A;  3RU0 A;  2J62 A;  4LML A;  2XGM A;  4HGA A;  4HRM B;  4E7Z A;  2VKJ A;  2CRB A;  3ML9 A;  1J5W A;  5KJM A;  3B7R L;  4ZZC A;  4PK5 A;  3E37 A;  5GON E;  2WXG A;  2KT9 A;  2EIM E;  3LFM A;  2GW1 A;  4LUN U;  5DAB A;  2WXR A;  4U63 A;  1YKE B;  2UUA T;  3UU8 A;  5LBM A;  1HFA A;  3FTW A;  1MND A;  3C4Z A;  5EYP F;  4XEI G;  1MIV A;  2W2U A;  4I4T E;  2CFZ A;  5LGN B;  2UY1 B;  5ABH A;  3CR3 A;  3PDY A;  3DSX A;  4L9P A;  3UI2 A;  2WB2 A;  3TXN A;  3NBN B;  1NZN A;  1FT2 A;  1PAQ A;  3L08 A;  2ILR A;  2XZT G;  4WBN E;  5HEU A;  3LK2 B;  1Z6T A;  2IEJ A;  2XPI A;  4GTQ A;  2V7J A;  4J8F A;  1OCC E;  3ONL C;  4UQY A;  3O1I A;  4IL9 A;  3Q9N C;  3AVS A;  3S7J A;  3ESK A;  2C5J A;  5BXO A;  3FWV A;  2VKH A;  4QHO A;  4GYS A;  4YTN A;  2IO2 C;  2ION A;  4YDY A;  3AE5 A;  2BKG A;  5JRC B;  5D66 A;  3BUA A;  4PS7 A;  1KT0 A;  3PE3 A;  3CQX C;  1XDO A;  2R5S A;  3Q4A B;  2CG2 A;  2CFU A;  1YYH A;  4BWR A;  3CVY A;  5H6R B;  2AW6 A;  3DSV A;  2LRK A;  4O4L E;  1J5E T;  1X5B A;  4JA7 A;  4JEU B;  2VYI A;  3EU9 A;  4LF5 T;  1WDY A;  5KNH D;  4DR6 T;  2NWB A;  3UM0 A;  2QA7 A;  3QAQ A;  3ZLI A;  1U3C A;  5JTG A;  4UF0 A;  3AVR A;  1HTJ F;  2LUH A;  4EYY R;  3PUS A;  2FUL A;  1Y6I A;  2RD0 A;  2Y4T A;  3V2O A;  5ETW A;  1IBL T;  1S35 A;  3P7I A;  5FT9 A;  3RAU A;  5BXU A;  2JQ9 A;  3MCX A;  2CA5 A;  2HHH T;  5IHY A;  3WI3 A;  1UJJ A;  3EI0 A;  3T1Y T;  4BY6 A;  4ZS2 A;  4NXM T;  4Z8X A;  2X9X A;  3EDV A;  3CVL A;  4HE8 A;  2LLY A;  4ZZB A;  4NUR A;  1TNY A;  3HKE E;  2NYJ A;  3B5M A;  2EHO D;  4DR4 T;  3ANW A;  4FI5 A;  5D0O D;  1XMQ T;  2JMK A;  2XEV A;  3OJA A;  1WLX A;  2R6G F;  2FJD A;  3KVA A;  3ZPJ A;  4WUY A;  3A5X A;  2J4G A;  4ZI2 D;  4JV5 T;  5FQ7 A;  2AXZ A;  4UI9 K;  1N0R A;  1YMP A;  2FI7 A;  5ENS D;  1FCH A;  1NAF A;  1Y01 A;  2HPJ A;  2WQY A;  3H3A A;  4QWN B;  5J90 A;  1HNX T;  4DV6 T;  2D5U A;  1MJ0 A;  4CI1 B;  1MX2 A;  3JQ0 A;  2I1K A;  1IQU A;  4R7L A;  4HWF A;  1WCR A;  1JCQ A;  3R6N A;  2DCP A;  2YU1 A;  4B3M T;  2BBH A;  3SNX A;  2XTL A;  4ILC A;  2KMF A;  3ESL A;  4X1Y E;  5FNV E;  3KV9 A;  3NAW A;  5G55 A;  1E90 A;  2PNN A;  3PRZ A;  3ZHE A;  2MYS A;  4WZX A;  2CG3 A;  2Z6E A;  3FH7 A;  3PUA A;  4U8Y D;  3UQ7 A;  4JEH B;  5EID A;  4GKJ T;  3ZT6 A;  4YVO A;  3L3P A;  4LF4 T;  1JWG A;  2H6I A;  3S7B A;  4N2S A;  3ZST A;  2N2N A;  3L54 A;  4TV9 E;  4O60 A;  3TLU A;  4ILH B;  4ATZ D;  3C98 B;  5LBQ B;  2HR2 A;  4LNB A;  1S0P A;  2LXL A;  5AQM B;  1FMV A;  4O2B E;  3QOU A;  4D10 C;  1ELR A;  3SWH A;  4B6X A;  4F53 A;  4L2Y A;  3DXM G;  4P09 A;  3T8O A;  4APO A;  3L6A A;  4KX6 A;  4N3B A;  4K5C A;  2M67 A;  1NEK A;  4GZ3 A;  2J4D A;  2B1E A;  1OUV A;  3LJ3 A;  4BES A;  4EV6 A;  2IO3 C;  3N2G E;  3VKH A;  3F31 A;  4IDN A;  1LRZ A;  1YQ3 A;  2PG8 A;  3CX7 B;  3NKZ A;  3PJA A;  5HEO A;  3ZSS A;  4X66 T;  4AM9 A;  3QWP A;  4DV7 T;  2CMR A;  3N9M A;  1TJC A;  1L5J A;  3EJN A;  1K3Z D;  2LM9 A;  1JPL A;  3ZUV B;  3LXU X;  2H7O A;  1T72 A;  1OWM A;  4FUL A;  2VKD A;  3R9A B;  3PDN A;  4M1P A;  4CGW A;  3ZPO A;  1W0B A;  3C98 A;  1UUR A;  3BG0 B;  5AN8 A;  3ZMT B;  1JUQ A;  3HXF A;  4IDP A;  2WZH A;  4X20 E;  3I9W A;  5FWQ A;  2PQR A;  2VSY A;  4ATG A;  3HXD A;  2XQY A;  5JR9 B;  1OT8 A;  4XIF A;  1JCS A;  4JBW F;  2VTB B;  1IBM T;  2BF0 X;  4FJZ A;  4YXD A;  3C72 A;  3N5L A;  2DWG A;  1ELW A;  1M7K A;  2L0T B;  5BV0 A;  3KV5 A;  2VK9 A;  1EPU A;  2H6H A;  2QYU A;  2IC6 A;  1HX1 B;  1E2A A;  4I6G A;  2W0G A;  3CPZ A;  3TLS A;  3PVL A;  1MX6 A;  5L3G B;  2XAS B;  4J8S A;  1VOM A;  4JI4 T;  3O4X E;  3OBV E;  3UQ4 A;  2F37 A;  5LCW C;  3M3Z B;  3K3Q C;  4UV8 B;  3UUB A;  1HNW T;  5BW8 C;  5HWX A;  5FKY A;  4E6H A;  4EEB A;  4PFP A;  3FU5 A;  4ZFH A;  4H63 V;  5HS0 A;  3D9J A;  3PS6 A;  4G8L A;  1D1B A;  2WP9 A;  4H9P C;  4G23 A;  5FZR A;  4EZJ A;  2NTY A;  4C9B B;  4CN1 A;  4U8H A;  4PUC A;  5JDH A;  3HXB A;  4AP2 A;  3CK6 A;  5BUZ A;  3FZL B;  5HQ8 A;  2M6B A;  4BER A;  3ULQ A;  5FQ4 A;  3GN5 B;  3HA4 A;  3MEK A;  3P4S A;  1LD8 A;  3V31 A;  2L8K A;  5L2L A;  5BR8 T;  3ZYM A;  5LCY A;  2HN1 A;  3J9X 1;  2P9K G;  2H88 A;  3RF1 A;  2V26 A;  5ENO D;  4YTM A;  2VB6 A;  1LVK A;  5LP6 E;  3UM1 A;  2MAW A;  5LA6 E;  3FU6 A;  3ZMS B;  4N5Q A;  2K5B B;  3UUX A;  4NQ0 A;  1SZ9 A;  4GMR A;  4MLP A;  3TWU A;  4ABN A;  4HI9 A;  3CVU A;  3U78 A;  4JD2 G;  3RSE G;  4JL0 A;  3AE7 A;  4UEL A;  3R7Q A;  4OHF A;  4XZC A;  2I0M A;  3RJV A;  3AS5 A;  4F6R C;  2WB5 A;  2QZA A;  4AEZ C;  1DU2 A;  4LER A;  3N9N A;  2W66 A;  2E2E A;  5FXV A;  5EZY E;  3CK8 A;  5AIJ A;  2XSA A;  4OK0 A;  2AVP A;  5JHB A;  3AE6 A;  4B3R T;  3B13 A;  1H2V C;  5KJL A;  1ZP0 A;  5L47 A;  1KK7 A;  4KYO B;  2WXF A;  2QYJ A;  4ZS3 A;  5HI7 A;  3PZ2 A;  3V5U A;  4EGW A;  2NW8 A;  2WDR A;  2OVB A;  3BU8 A;  3W15 B;  3I5P A;  3AG1 E;  4ILA A;  1E8Y A;  3AEA A;  4DV2 T;  1TR4 A;  2CHN A;  3T5V A;  2CCQ A;  2R59 A;  3EUV A;  2X66 A;  3UT7 A;  4P29 A;  2JJ9 A;  4L9I A;  4GTS A;  5CJ5 A;  1QUU A;  4NIK A;  3GYZ A;  4H7Y A;  2QGS A;  3ZKR A;  4HWC A;  4PK6 A;  4X1I E;  3UQ3 A;  4MFR A;  1OED A;  3E34 A;  4KUM B;  4URK A;  2BDE A;  1DCQ A;  1U4Q A;  4AIU A;  2UXB T;  4G11 A;  4K5A B;  5E0O A;  4C0E A;  1GQE A;  2WMN A;  4JUY A;  2R02 A;  2R17 C;  4OYK A;  5DJQ C;  5LOZ A;  5FY1 A;  2KAT A;  2W61 A;  4KMC A;  2P9N G;  4RG6 A;  4UI9 C;  1S64 A;  3UM3 A;  3NRY A;  3EIJ A;  3DPY A;  5KCM A;  2VTB A;  3BQK A;  3E22 E;  4JI1 T;  5A7D B;  1HR0 T;  1WY6 A;  3T8K A;  2KLQ A;  1QBQ A;  4NUV A;  3V2X A;  4AJW A;  1ZEE A;  4RSY A;  2PM7 A;  2JRK A;  1SZA A;  2MOW A;  4WWO A;  4I1M A;  2CWO A;  5ADX L;  3DST A;  2YDS A;  4PJN A;  3BEE A;  2E9X C;  3KV4 A;  5EKQ D;  3ZNG A;  1Z3X A;  4YFS A;  5JDM A;  4KVM A;  3K8P C;  1TNZ A;  2VGX B;  2X51 A;  3SZ7 A;  3LY8 A;  1BR1 A;  1UOH A;  4GTV A;  4BTB A;  3J5Q B;  2B6C A;  3X2Q E;  5CEC B;  1SA0 E;  3SQV A;  2ZIR A;  1NP7 A;  3RHW A;  3FUF A;  3KEA A;  1RW2 A;  3O1J A;  3EU5 A;  3AA0 B;  2FBN A;  4N78 D;  5CMW A;  2BG9 C;  2RKK A;  5CFB A;  4HFI A;  3APF A;  4PDX A;  3ZFW A;  4HKA A;  1HNZ T;  4JI8 T;  4I9E A;  2BKO A;  3LSV A;  3NWI A;  5HXC A;  2W67 A;  4U72 A;  4ADZ A;  3FH5 A;  2ODU A;  4YTP A;  2XZD G;  3VTX A;  3PZ3 A;  3FZK B;  3I0Q A;  3HXC A;  4ILI A;  3GZ1 A;  3E30 A;  3LJN A;  1N32 T;  2FJB A;  3FTZ A;  4TX5 A;  1MMN A;  3C64 A;  2XRY A;  1H0A A;  2ACX A;  5AFU L;  4PJL A;  2LSK A;  4QXC B;  2C5K T;  1B7T A;  3ZW3 A;  3RIU A;  3EDU A;  5G04 J;  4HBD A;  3AAE B;  4J0U A;  4HNA D;  2X38 A;  3D0T A;  1IYG A;  2LAI A;  4UWL A;  4GA0 A;  3TG5 A;  2XAH B;  4YHJ A;  3AEC A;  4DV0 T;  3SHF A;  4F1P A;  4TZ4 C;  4YSY A;  4O6F A;  2AE9 A;  2Q9Q A;  1JCR A;  3FTY A;  3HVE A;  2IDO B;  2IQC A;  2DLR A;  3UU6 A;  4G63 A;  2X6J A;  1NI1 A;  4BJN A;  3OKQ A;  1KNZ A;  4DO0 A;  4EQF A;  4LRZ A;  4ILB A;  4KP3 C;  3PZ4 A;  3UT4 A;  3VLF A;  5JDN A;  3CK9 A;  3NF1 A;  4FAD A;  4I50 E;  1O1S A;  2WAU A;  4TUM A;  4GK5 E;  4XX5 A;  1JNZ A;  4G2A A;  1EZ3 A;  4GYY A;  3Q75 A;  5JDF A;  4U0S A;  1HF8 A;  2Y48 B;  2DWZ A;  3ZMZ B;  5ENQ D;  1BR4 A;  3PZ1 A;  2H3R A;  3AA6 B;  4YND A;  3Q5E A;  2V4H C;  1EDU A;  4M3O A;  2WXM A;  2XPY A;  4DX6 D;  1XMO T;  4QFV A;  2KSR A;  4A55 A;  2I6H A;  4WYV A;  2BG9 E;  3AEB A;  3FZF B;  2IAK A;  2J07 A;  5KBA A;  2H7V C;  2P9I G;  5HXS A;  4EXT A;  2JIW A;  4CQI A;  4AQF C;  3FUM A;  4CYM D;  5ITZ F;  3DBS A;  1N0Q A;  5ARF A;  3DJB A;  5DIZ A;  1H6K A;  3VRA A;  3LS8 A;  3AE3 A;  2EIK E;  1XNR T;  3CWZ B;  4HXI A;  2V6Y A;  5F5W A;  1BD8 A;  4TV8 E;  3FUD A;  3GWH A;  3P2B A;  3EUH A;  2V0P A;  2V7K A;  2NC9 A;  5F3J A;  5AQA A;  4O4I E;  5AQB A;  3BQI A;  1EF1 C;  2WQ7 A;  2IOL A;  5ABF A;  3T1H T;  2XHE A;  4AIF A;  3SRZ A;  3A7M A;  2I1J A;  3C3R A;  4KHP T;  3PNL B;  3AG2 E;  3AG3 E;  2DYR E;  3UPV A;  3PUJ A;  3PE4 A;  4GZ6 A;  2KZT A;  5FQ6 A;  3CHR A;  5LB7 B;  4ASK A;  4U04 A;  3QB2 A;  1D8E A;  3ZN1 B;  2J49 A;  4XKB A;  5ABF B;  4DX7 D;  2W4X A;  5KDM C;  2BTD A;  4PW8 A;  5FMN A;  2QC9 A;  3NQP A;  3TL5 A;  4ACK A;  2QY7 A;  3FDH A;  4APF A;  4HLL A;  4RVB A;  4AKH A;  4I6J A;  1XWM A;  2XGO A;  3QKY A;  3O4Z A;  2D0U A;  2JQQ A;  4GIW A;  2ETC A;  3PEV B;  4E7S A;  1V9D A;  3Q5X A;  4CN6 A;  3ASO E;  4LMK A;  2M6I A;  3UUX B;  3SY2 A;  4LFB T;  3VTY A;  1D0Z A;  1T7S A;  1FT1 A;  4BSZ B;  2KZ7 B;  3PNT B;  2VVN A;  3FZH B;  2XQ7 A;  3TKL B;  1FVF A;  1QYM A;  4H9N C;  3FTV A;  4OYS A;  3ULY A;  2I2O A;  4M7C A;  1FMW A;  3RYF E;  1HZ4 A;  1RZ4 A; 
#chains in the Genus database with same CATH homology
 4EZL A;  3Q2M A;  3D9I A;  4MBQ A;  4YLH A;  2XAJ B;  5JRE A;  5E75 A;  4HEA A;  1U3D A;  2Q9Q C;  3AS4 A;  5JQG E;  2Q9Q D;  3P8C D;  3U64 A;  5ENN A;  4DPR A;  1G8X A;  1HS6 A;  3AS8 A;  1IAP A;  2VSO E;  2X6K A;  4XI0 A;  1LVF A;  2HO1 A;  3RYC E;  4U0U A;  4CDR A;  4CEM A;  5EK4 A;  1OWP A;  4UIG A;  2Y3A A;  3EIQ C;  4HOQ A;  4I6E A;  5HXE A;  4ERR A;  3ZCJ A;  3VU7 H;  3KFW X;  4EAH A;  3GW4 A;  4U74 A;  4CDM A;  4TUY E;  2IOS A;  2W63 A;  4EB6 E;  3MK7 C;  5E76 A;  4WWP A;  4IE4 A;  5FZS A;  4FC8 A;  3LCA A;  2KC7 A;  2J08 A;  1D0Y A;  1T98 A;  4I1O B;  4C90 A;  1Z3Y A;  4DLO A;  2VKO A;  3LBX B;  1EYH A;  2I59 A;  5AEN A;  3KD7 A;  1YW0 A;  2OA5 A;  1B89 A;  4J6I A;  4AI6 A;  3FUH A;  3U3W A;  4GOU A;  3RRU A;  2E0I A;  4GK0 E;  5LHG B;  3MKQ A;  2K48 A;  4FJO A;  2YHC A;  4DI3 A;  4JHJ A;  1FIO A;  4ZI2 C;  1UCU A;  4O2A E;  3GA8 A;  2YQ8 A;  2FO7 A;  4UWK A;  3E08 A;  4OYJ A;  4I43 B;  3K3N A;  3AAA B;  3HR0 A;  5HAX A;  4H9R C;  5D0Q D;  4XI9 A;  3JC6 D;  5CA1 E;  1E8Z A;  3ZCI A;  5H6Q B;  4N39 A;  4HTE A;  3ETU A;  5G2N A;  4DBQ A;  4N3C A;  1W3B A;  4MHC A;  1O3X A;  2WWU A;  3TAX A;  3RRM B;  4IE6 A;  5CA0 E;  3QDN A;  3S4U A;  2VWA A;  3RKO A;  4F1S A;  3C50 A;  3D9O A;  1MQS A;  3CVN A;  4I17 A;  2X68 A;  3FP3 A;  3UX4 A;  3BG1 B;  3GZ2 A;  1OXZ A;  5FY0 A;  2HYZ A;  3LVR E;  5KJN A;  4HFV A;  1BPO A;  4JC8 A;  4UI9 J;  4GB9 A;  3LKU A;  4Q96 A;  4BX8 A;  1N52 A;  3CIA A;  4AKR B;  5M72 A;  4BAY B;  5EK2 A;  3UUL A;  1INZ A;  3Q9D A;  5M4Y A;  2FF4 A;  4JEH A;  5BT1 A;  1A17 A;  2UXX B;  3MXZ A;  4P0A A;  4BTA A;  3AAI A;  4KVO A;  3L09 A;  3CX8 B;  3APD A;  2DWK A;  2WQH A;  3CVP A;  2E8I A;  4KMO A;  2L6J A;  4N3A A;  3MYV A;  4XBF B;  4OFZ A;  3P1U A;  2LEH A;  3IF8 B;  3GN5 A;  4KT6 B;  2YK0 A;  4AQG A;  5LHH B;  1TJF A;  2ZMA A;  2VL8 A;  4UVA B;  4TRQ A;  5ANR A;  1MMG A;  3NRX A;  2EHO B;  3KAE A;  3VKG A;  3ASF A;  4C91 A;  4F3V A;  5G04 C;  2UXN B;  3I4G A;  2JPF A;  2A72 A;  5DQW A;  1HO8 A;  3CML A;  2XQ0 A;  4B94 A;  3F2E A;  4A1S A;  4CCA A;  4FA6 A;  4NRH B;  2WXK A;  3S7F A;  5KMG P;  1H2T C;  5LG4 A;  3KBT A;  2C0S A;  3FH8 A;  4MRU A;  3CQG B;  4B8C B;  4BFR A;  4ME2 A;  3RYH E;  5EX3 A;  5CCL A;  2VQ2 A;  3NZQ A;  4I55 E;  3RC8 A;  3MA5 A;  1HX8 A;  5JR9 C;  3AU5 A;  4A3V A;  3FU3 A;  2E9X B;  1MIY A;  2X3M A;  4WAF A;  4JEU A;  4TUU A;  4NAC A;  3L17 A;  3OTN A;  4GAA A;  4H9Q C;  1DNP A;  1D0X A;  5JVD E;  1UN8 A;  1HU3 A;  3CHQ A;  3HKC E;  5FTP A;  5JRC A;  2EQX A;  3N2O A;  4AQF A;  3IKO B;  2OVF A;  3ZJ1 A;  3PRE A;  3B7S A;  3ONL A;  3QJZ A;  3NZP A;  3B57 A;  1X79 A;  2C0L A;  2WXI A;  1UW4 B;  4AKG A;  4G24 A;  3FXD B;  3N9Q A;  4EBA G;  4N2Q A;  4PJM A;  5LHI B;  4O4H E;  5FXZ A;  1U5P A;  3D3M A;  1AJ3 A;  1Y64 B;  3OXG A;  3SBT B;  2KXP B;  2LSY A;  2WVI A;  4YJ3 E;  2EHO C;  4WND A;  5FJY A;  3CSF A;  3I1A A;  2VSN A;  2CLY C;  4WNG A;  2ODV A;  1E1H B;  3RX6 A;  4H7X A;  5BPP A;  1FEW A;  2C5I T;  4BJM A;  2L3L A;  1OWO A;  4JHR A;  4GU5 A;  4DBR A;  3E0Z A;  3IEE A;  3C51 A;  3N9L A;  4ZI3 D;  2WSS V;  5LFA A;  2Y8D A;  3PU8 A;  3JUI A;  3CHO A;  2PQN A;  2YU2 A;  5L3B B;  2IU1 A;  4AY6 A;  3ENE A;  2LSJ A;  4GMJ A;  3S7D A;  4JZY A;  3QC1 A;  1KT1 A;  4E85 A;  3FUI A;  3CVQ A;  2FEZ A;  4U07 A;  4CXW A;  1IJ5 A;  2A4Z A;  5JR9 A;  3PE0 A;  3CVV A;  3IHR A;  3B7T A;  3CEQ A;  2NOX A;  3LBX A;  3TJP A;  1SHZ C;  1ELK A;  2PFV A;  3I3N A;  4O8S A;  2KCL A;  2DNX A;  4J8E A;  4J8D A;  4WNF A;  3FUN A;  3UT8 A;  2PM6 A;  2PZI A;  3PUK A;  5HYA A;  4AKL A;  1QZ2 A;  1MNE A;  1H19 A;  5AYW D;  1MMD A;  1FVH A;  3C4W A;  4IRU A;  4TV3 A;  3FTS A;  2LE8 A;  3MGB A;  4OVU A;  4HS2 A;  1DVP A;  2LO6 A;  2Q7F A;  3FTX A;  1GW6 A;  2DI4 A;  2N1G A;  3QC9 A;  2EHO A;  3OYZ A;  4IYP A;  1WYB A;  3KVB A;  2KZT B;  3S2A A;  1ZBP A;  4WNE A;  3CK7 A;  4ANX A;  3BK9 A;  3O9X A;  3B7U X;  1IHG A;  3EVY A;  4GA1 A;  5IYZ E;  3QWV A;  4QXH B;  2E9X A;  4FLH A;  2CM0 A;  3AB3 B;  3HIZ A;  5C2Y A;  2V8S E;  4PS3 A;  2KM4 A;  2KCV A;  5T8I A;  3UMV A;  3ZIM A;  2J09 A;  3D9N A;  3AA1 B;  5ARG A;  4L5G A;  4EIW A;  3F57 A;  4I2Z A;  5F8P A;  4H9O C;  4XE0 A;  1HXI A;  2V4L A;  4I2W A;  2RA1 A;  2AXU A;  2MTQ A;  4QX7 B;  2YHE A;  4CI3 B;  4BA9 A;  4DI4 A;  2LSV A;  5J2T E;  4JLE A;  1H2U A;  3NBX X;  4HFG A;  4EZK A;  4GYR A;  4IST A;  3JYS A;  3RK6 A;  2X6I A;  2LSG A;  1HG5 A;  1ZU2 A;  4P0B A;  5FP3 A;  5EK3 A;  5HXH A;  3QNK A;  2V7I A;  1E7U A;  3Q47 B;  4UWH A;  1KLX A;  1IJ6 A;  3HHM A;  4GYO A;  3KIN B;  1WAO 1;  3D9P A;  3RPU A;  1ZV4 X;  3T8M A;  3RIB A;  4L1B A;  4FP7 A;  1MIW A;  3URZ A;  2CEA A;  3MZK B;  2LT3 A;  4V1A v;  1E8X A;  4GCN A;  5AJL A;  1QNF A;  3ZJ2 A;  3FY4 A;  4ILG A;  4ISS A;  5DQV A;  4IE7 A;  5AJD A;  3FU0 A;  3PUR A;  5KX5 E;  2WXO A;  4Q69 A;  3O48 A;  2MRI A;  3G2V A;  4I1A A;  1OWA A;  1NA0 A;  2AXV A;  3ZN3 A;  3CQC B;  3SD5 A;  3ASD A;  3MKD A;  4FHK A;  2LOP A;  2DHR A;  4WBO A;  3C4X A;  4DK5 A;  3G2W A;  2WBL A;  3MKR A;  1ZKE A;  5FXX A;  3ZRH A;  4WWN A;  1PC2 A;  2CHW A;  5JJ7 A;  2A2F X;  4UWF A;  1WR6 A;  3ZMU B;  1JWF A;  4KXK B;  3N9P A;  3WAJ A;  1VDY A;  4Y6C A;  4K0R A;  2WM9 A;  2CXF A;  3EHM A;  4AVX A;  2ZM0 A;  2HH7 A;  4ILU A;  3ONK A;  2YNQ A;  3SBS A;  4PNI A;  4F7A A;  3SOL A;  2LSU A;  2XCC A;  4U0Z A;  5A1L A;  2VJ8 A;  3OAW A;  3QK0 A;  4CI2 B;  2GGF A;  4MS6 A;  4CT4 A;  4IIJ E;  4HOU A;  1BR0 A;  4GZD A;  1UX4 A;  2D0T A;  2WMO A;  1Z0P A;  2GRL A;  2MBG A;  4BT8 A;  4IUL A;  2J1D G;  3O1H A;  4B8A A;  2G0U A;  4PFO A;  2IFU A;  2GRM A;  1LF8 A;  4DJA A;  3Q49 B;  2V1D B;  3LPZ A;  2LHR A;  3CKB A;  3EHN A;  4A1G A;  2ZLY A;  5BV1 A;  5LCW J;  2A3D A;  4I9C A;  1MHQ A;  2SPC A;  2BVM A;  4BX9 A;  2LNI A;  2K9A A;  2IF4 A;  4A56 A;  2JLB A;  3IBE A;  2VGX A;  5JDG A;  3ZYK A;  5JHA A;  4L2L A;  4FJY A;  4G26 A;  2HPL A;  4ZOL E;  3AA7 B;  3CST A;  1NA3 A;  5HWY A;  4JA9 A;  2W62 A;  3DPD A;  3QAR A;  2XUE A;  3ZEF B;  4AXH A;  3ANW B;  5FZQ A;  2LJL A;  4QX8 B;  1UG3 A;  3UUM A;  2L9Q A;  2XCB A;  4MAL A;  3R84 B;  2NXP A;  3UTK A;  2VGY A;  4ANU A;  5LNK A;  4EZH A;  3K3O A;  1P5Q A;  1WYC A;  4FLB A;  2OOE A;  3I0O A;  4JVS A;  4UVB B;  4H9S E;  4UVC B;  4IE0 A;  1YKH B;  2AWI A;  4DVD A;  3MX3 A;  5J2U E;  3NZU A;  3CKD A;  5J08 A;  3ZEF A;  2IC9 A;  3CX6 B;  3FHE A;  4PH4 B;  3SGH A;  4N5C A;  2YEV C;  2E9X D;  4O4J E;  4J2C A;  2KWI B;  3RH3 A;  2XAF B;  2Y6X A;  4IN3 B;  4H63 H;  3MAC A;  3FUE A;  3SF4 A;  3JC6 C;  3MV2 B;  4LEU A;  3EDT B;  3UUN A;  2A5U A;  5CHE E;  5DBK A;  3IV0 A;  2D2S A;  4PAG A;  3BQL A;  1IZN B;  1SQM A;  5JDQ A;  4EEC A;  3H37 A;  3ZGQ A;  3RO3 A;  4KBM B;  2X9W A;  4AKI A;  4GML A;  2BUG A;  3ZYL A;  3PH0 C;  2P58 C;  4ACL A;  2ES0 A;  4KZ0 A;  1QSD A;  3FEY A;  3V5S A;  3LJC A;  4CXY A;  1HH8 A;  2WXH A;  2IJG X;  4KBQ A;  4FU3 A;  1D1C A;  3ZMV B;  4JXT A;  2UY1 A;  2MHK A;  2RG8 A;  3VLD A;  2N9D A;  3LEW A;  3ZVV A;  2BVL A;  2X9H A;  5LX8 A;  4B0Z A;  2GK9 A;  2L9B A;  2DIW A;  1N54 A;  1QQE A;  3TXM A;  2V5F A;  3RO2 A;  4GPK A;  2NP9 A;  2X67 A;  3MV3 B;  3FHN A;  4QKN A;  1UX5 A;  2BZB A;  4WNK A;  2J9Q A;  2OV8 A;  1US7 B;  4UV9 B;  3RRW A;  4OVV A;  1MMA A;  3RYI E;  3GMI A;  3JCK C;  3N9O A;  4BSX A;  1LKX A;  1H7C A;  2XRZ A;  2CHX A;  4Y6W A;  1TEZ A;  2WXJ A;  2PJQ A;  3IBP A;  3U3I A;  2XAQ B;  2VAS A;  4JHK A;  3CVW A;  4K03 A;  3CKC A;  2LSI A;  5HXR A;  3ZC0 A;  2C0M A;  4HN9 A;  4DND A;  4X1K E;  4IHJ E;  2NSZ A;  3L13 A;  3SFZ A;  4EPZ A;  2ZM8 A;  5BMV E;  3PUQ A;  4I43 A;  4CT0 A;  2VSX E;  2CE7 A;  3HKB E;  3FUK A;  3LDZ A;  3G2S A;  3U4T A;  3PEU B;  3QK6 A;  3KDS E;  4CZZ B;  2V7L A;  4CXX A;  5LXT E;  3KBU A;  4EZ4 A;  3FUL A;  4WW0 A;  5L3F B;  3PZD A;  3FTU A;  1YA0 A;  2Q9Q B;  3HVE B;  5LGU B;  3IHY A;  3FBL A;  3ML8 A;  1HS7 A;  5KJK A;  1IQR A;  5L3D B;  2L0I A;  5EDS A;  4GZC A;  2NW9 A;  1WM5 A;  3LYA A;  4GA2 A;  3CHM A;  5LJN A;  2KIN B;  3U66 A;  5T4Y A;  2LAH A;  4Q94 A;  2XAG B;  3HL6 A;  1S94 A;  1ZHC A;  3MJX A;  4TN7 B;  4EBA A;  1NWM X;  2I9C A;  4DMW A;  5LJM A;  3FFL A;  5FQ8 A;  3LG7 A;  4EYU A;  4RG9 A;  5C1D A;  3KS2 A;  4PS8 A;  2OND A;  3JQ1 A;  2JEK A;  3ZYQ A;  3GZS A;  3I9Y A;  2W00 A;  4AOF A;  5J1G A;  3RRN B;  4ZI3 C;  3APC A;  2WPV A;  5CMY A;  5LOV E;  2CHZ A;  3FEX A;  2PL2 A;  3ASG A;  3UFE A;  4AV7 A;  4DLQ A;  3CHS A;  3FB2 A;  3I4R B;  4L23 A;  3K9I A;  3HDX A;  3E4B A;  4YJ2 E;  3ONX A;  3ZN0 B;  2WXP A;  4UQZ A;  3VHL A;  4L7T A;  3MA9 A;  3ZHE B;  4EOZ B;  4G25 A;  1YD8 G;  4W9R A;  4UF0 B;  4UQX A;  5ANL A;  3T5X A;  3LY7 A;  5EX0 A;  3SI5 A;  1XGW A;  2M63 A;  1OWL A;  3LVQ E;  5CCM A;  3Q5W A;  4LCT A;  2HM8 A;  1CUN A;  3WAK A;  3Q5M A;  5C8Y E;  2RP4 A;  2LOS A;  4V3I A;  2V7M A;  5LYJ E;  2DBA A;  3CHP A;  5G05 C;  3LY9 A;  2X6H A;  3N71 A;  3IEG A;  3WXX A;  3DTO A;  3R7R A;  2XHE B;  3FBZ A;  5CB4 E;  5A23 A;  2LHN A;  4IE5 A;  2CLY B;  3RKV A;  3D9K A;  4FHJ A;  3CVX A;  3G2T A;  3KV6 A;  3L22 A;  4AXP A;  4NUU A;  1UN9 A;  5JJ6 A;  5L3E B;  4GCO A;  3SS1 A;  2XGS A;  3LK4 2;  1OWN A;  4XZ4 A;  2KWH A;  4GYW A;  2CXL A;  4QXB B;  2CWY A;  3MKQ B;  2QFC A;  5JJT A;  4PJJ A;  3UT5 E;  3HKD E;  4UEM A;  3OXL A;  4XAX B;  5L3C B;  4IDZ A;  2WXL A;  2X0L B;  3QUJ A;  2ZU6 B;  3DP7 A;  4DMV A;  1D1A A;  3ETV A;  2DCF A;  3D9L A;  2Y4U A;  2WXN A;  3KEZ A;  2ZM2 A;  3TGO A;  3L16 A;  3PTR B;  4ANV A;  1HE8 A;  3RC3 A;  2PBI A;  3HI2 A;  1UJK A;  2J4B A;  3M65 A;  1E96 B;  4HVB A;  4HLE A;  4AY5 A;  3NZS A;  4IGU A;  3HYM B;  5FXW A;  3FUJ A;  2P9B A;  4ANW A;  3CVR A;  1G73 A;  4HOR A;  3U9W A;  2CXD A;  2NW7 A;  4G1T A;  5BNW A;  5LP0 A;  4CDN A;  1BR2 A;  4CRW A;  3G2U A;  5A6C A;  3TG4 A;  2YIN A;  3CV0 A;  4G2V A;  5T3R A;  4B89 A;  4A3T A;  1VRB A;  3QWW A;  2MOZ A;  1PY1 A;  4GZ5 A;  2IW5 B;  2K24 A;  2JMH A;  4PK4 A;  3PU3 A;  5LGT B;  4MKT A;  5FY7 A;  3J7Y q;  3CGH A;  4UXN B;  4XKC A;  4KZC A;  3ASH A;  4BT9 A;  3N2K E;  2C2L A;  2WXQ A;  5G05 J;  1HG2 A;  4CGV A;  4ZHQ E;  4HOT A;  3VLE A;  3AU4 A;  3MJW A;  1HCI A;  1E8W A;  3PUG A;  2NTX A;  2KND A;  3D9M A;  5TAO A;  4YVQ C;  1E7V A;  3MZL B;  3CLJ A;  3ZXS A;  3OXF A;  4ANJ A;  2X9Y A;  1WRD A;  2XPZ A;  5FYM A;  3ZC1 A;  4MLK A;  3Q15 A;  2KCK A;  4K0U A;  2WQ6 A;  4ZI7 E;  3FXE B;  5JDL A;  4JPS A;  4L0R A;  4HOS A;  1Y8M A;  4UWG A;  4JW1 A;  3OYX A;  1XNF A;  3RRC A;  4C0M A;  3LK3 B;  2X6F A;  3IHV A;  2UWJ G;  5JH7 E;  3RU0 A;  2XGM A;  4HGA A;  4E7Z A;  2VKJ A;  3ML9 A;  5KJM A;  3B7R L;  4PK5 A;  5GON E;  2WXG A;  2KT9 A;  3LFM A;  2GW1 A;  4LUN U;  5DAB A;  2WXR A;  4U63 A;  1YKE B;  5LBM A;  1HFA A;  3FTW A;  1MND A;  3C4Z A;  1MIV A;  4I4T E;  2CFZ A;  5LGN B;  2UY1 B;  3CR3 A;  2WB2 A;  3PDY A;  3TXN A;  1NZN A;  1PAQ A;  3L08 A;  2ILR A;  4WBN E;  2XPI A;  3LK2 B;  1Z6T A;  2V7J A;  4J8F A;  4UQY A;  3O1I A;  3AVS A;  3S7J A;  3ESK A;  2C5J A;  3FWV A;  2VKH A;  4QHO A;  4GYS A;  2ION A;  5JRC B;  4PS7 A;  1KT0 A;  3PE3 A;  3CQX C;  2R5S A;  3Q4A B;  2CG2 A;  2CFU A;  4BWR A;  3CVY A;  4JA7 A;  5H6R B;  2AW6 A;  4O4L E;  1X5B A;  4JEU B;  2VYI A;  2NWB A;  2QA7 A;  3QAQ A;  3ZLI A;  1U3C A;  4UF0 A;  3AVR A;  1HTJ F;  4EYY R;  3PUS A;  2FUL A;  1Y6I A;  2RD0 A;  2Y4T A;  5ETW A;  1S35 A;  3P7I A;  5FT9 A;  3MCX A;  2CA5 A;  5IHY A;  3WI3 A;  1UJJ A;  4BY6 A;  4ZS2 A;  4Z8X A;  2X9X A;  3EDV A;  3CVL A;  4HE8 A;  4NUR A;  3HKE E;  2EHO D;  3ANW A;  4FI5 A;  5D0O D;  2JMK A;  2XEV A;  3OJA A;  1WLX A;  3KVA A;  3ZPJ A;  4WUY A;  3A5X A;  4ZI2 D;  5FQ7 A;  2AXZ A;  4UI9 K;  2FI7 A;  1FCH A;  1NAF A;  2HPJ A;  3H3A A;  4QWN B;  5J90 A;  2D5U A;  4CI1 B;  3JQ0 A;  2I1K A;  1IQU A;  4R7L A;  3R6N A;  2DCP A;  2YU1 A;  3SNX A;  2XTL A;  2KMF A;  3ESL A;  4X1Y E;  5FNV E;  3KV9 A;  5G55 A;  1E90 A;  3PRZ A;  3ZHE A;  2MYS A;  2CG3 A;  3FH7 A;  2Z6E A;  3PUA A;  4JEH B;  4YVO A;  3L3P A;  1JWG A;  3S7B A;  4N2S A;  2N2N A;  3L54 A;  4TV9 E;  4ILH B;  3C98 B;  5LBQ B;  2HR2 A;  1S0P A;  1FMV A;  4O2B E;  3QOU A;  4D10 C;  1ELR A;  3SWH A;  4B6X A;  4F53 A;  4L2Y A;  4P09 A;  3T8O A;  4APO A;  3L6A A;  4N3B A;  2M67 A;  4GZ3 A;  2J4D A;  2B1E A;  1OUV A;  3LJ3 A;  3N2G E;  3VKH A;  3F31 A;  1LRZ A;  2PG8 A;  3CX7 B;  4AM9 A;  3QWP A;  2CMR A;  3N9M A;  1TJC A;  1L5J A;  3EJN A;  2LM9 A;  1JPL A;  3LXU X;  2H7O A;  1OWM A;  4FUL A;  2VKD A;  3R9A B;  3PDN A;  4M1P A;  4CGW A;  3ZPO A;  3C98 A;  3BG0 B;  3ZMT B;  1JUQ A;  4X20 E;  3I9W A;  5FWQ A;  2PQR A;  2VSY A;  4ATG A;  2XQY A;  5JR9 B;  4XIF A;  2VTB B;  2BF0 X;  4FJZ A;  3N5L A;  2DWG A;  1ELW A;  2L0T B;  5BV0 A;  3KV5 A;  2VK9 A;  1EPU A;  2IC6 A;  4I6G A;  2W0G A;  3CPZ A;  3PVL A;  5L3G B;  2XAS B;  4J8S A;  1VOM A;  5LCW C;  3O4X E;  3OBV E;  3K3Q C;  4UV8 B;  5BW8 C;  5HWX A;  4E6H A;  4PFP A;  3FU5 A;  4H63 V;  3D9J A;  3PS6 A;  1D1B A;  4H9P C;  4G23 A;  5FZR A;  4EZJ A;  2NTY A;  4C9B B;  4U8H A;  4PUC A;  5JDH A;  4AP2 A;  5BUZ A;  5HQ8 A;  3ULQ A;  5FQ4 A;  3GN5 B;  3HA4 A;  3MEK A;  2L8K A;  5L2L A;  3ZYM A;  5LCY A;  3J9X 1;  2V26 A;  2VB6 A;  1LVK A;  5LP6 E;  5LA6 E;  3FU6 A;  3ZMS B;  2K5B B;  3UUX A;  4NQ0 A;  1SZ9 A;  4MLP A;  4ABN A;  3CVU A;  3U78 A;  4JL0 A;  4UEL A;  3R7Q A;  4OHF A;  4XZC A;  3RJV A;  3AS5 A;  4F6R C;  4AEZ C;  4LER A;  3N9N A;  2E2E A;  5FXV A;  5EZY E;  3CK8 A;  5AIJ A;  4OK0 A;  2AVP A;  5JHB A;  1H2V C;  5KJL A;  3B13 A;  1KK7 A;  4KYO B;  2WXF A;  4ZS3 A;  5HI7 A;  3V5U A;  2NW8 A;  2OVB A;  3W15 B;  3I5P A;  1E8Y A;  3T5V A;  2CCQ A;  2R59 A;  2X66 A;  3UT7 A;  4P29 A;  2JJ9 A;  4L9I A;  1QUU A;  3GYZ A;  4H7Y A;  2QGS A;  4PK6 A;  4X1I E;  3UQ3 A;  4MFR A;  4KUM B;  4URK A;  2BDE A;  1U4Q A;  4G11 A;  5E0O A;  4C0E A;  2WMN A;  4JUY A;  2R17 C;  4OYK A;  5DJQ C;  5LOZ A;  5FY1 A;  2KAT A;  2W61 A;  4KMC A;  4RG6 A;  4UI9 C;  3NRY A;  3EIJ A;  5KCM A;  2VTB A;  3BQK A;  3E22 E;  5A7D B;  1WY6 A;  2KLQ A;  4NUV A;  4AJW A;  1ZEE A;  4RSY A;  2PM7 A;  2JRK A;  1SZA A;  2MOW A;  4WWO A;  4I1M A;  2CWO A;  5ADX L;  4PJN A;  3BEE A;  2E9X C;  3KV4 A;  5EKQ D;  1Z3X A;  4YFS A;  5JDM A;  4KVM A;  3K8P C;  2VGX B;  2X51 A;  3SZ7 A;  3LY8 A;  1BR1 A;  4BTB A;  1SA0 E;  1NP7 A;  3FUF A;  3O1J A;  3AA0 B;  2FBN A;  4N78 D;  5CMW A;  3APF A;  4PDX A;  3ZFW A;  4HKA A;  4I9E A;  5HXC A;  4U72 A;  4ADZ A;  3FH5 A;  2ODU A;  3VTX A;  3I0Q A;  4ILI A;  3GZ1 A;  3FTZ A;  4TX5 A;  1MMN A;  3C64 A;  2XRY A;  1H0A A;  2ACX A;  5AFU L;  4PJL A;  2LSK A;  4QXC B;  2C5K T;  1B7T A;  3ZW3 A;  3EDU A;  5G04 J;  3AAE B;  4J0U A;  2X38 A;  3D0T A;  1IYG A;  2LAI A;  4UWL A;  4GA0 A;  3TG5 A;  2XAH B;  4YHJ A;  3SHF A;  4TZ4 C;  4O6F A;  2Q9Q A;  3HVE A;  3FTY A;  2IQC A;  2DLR A;  4G63 A;  2X6J A;  4BJN A;  3OKQ A;  1KNZ A;  4DO0 A;  4EQF A;  4LRZ A;  4KP3 C;  3UT4 A;  3VLF A;  5JDN A;  3CK9 A;  3NF1 A;  4FAD A;  4I50 E;  2WAU A;  4GK5 E;  4XX5 A;  4G2A A;  1EZ3 A;  4GYY A;  5JDF A;  4U0S A;  1HF8 A;  2Y48 B;  3ZMZ B;  1BR4 A;  2H3R A;  3AA6 B;  4YND A;  1EDU A;  4M3O A;  2WXM A;  2XPY A;  4QFV A;  4A55 A;  2I6H A;  2IAK A;  2J07 A;  2H7V C;  5HXS A;  4EXT A;  4CQI A;  4AQF C;  3FUM A;  3DBS A;  5ARF A;  3DJB A;  5DIZ A;  1H6K A;  3LS8 A;  3CWZ B;  4HXI A;  3FUD A;  4TV8 E;  3GWH A;  3P2B A;  3EUH A;  2V0P A;  2V7K A;  2NC9 A;  5F3J A;  4O4I E;  2WQ7 A;  3BQI A;  1EF1 C;  2IOL A;  2XHE A;  4AIF A;  3SRZ A;  2I1J A;  3PNL B;  3UPV A;  3PUJ A;  3PE4 A;  4GZ6 A;  2KZT A;  5FQ6 A;  3CHR A;  4ASK A;  4U04 A;  3QB2 A;  3ZN1 B;  2J49 A;  4XKB A;  5KDM C;  2BTD A;  4PW8 A;  5FMN A;  3NQP A;  3TL5 A;  4ACK A;  2QY7 A;  3FDH A;  4APF A;  4RVB A;  4AKH A;  4I6J A;  2XGO A;  3QKY A;  3O4Z A;  2D0U A;  2JQQ A;  4GIW A;  3PEV B;  4E7S A;  1V9D A;  3Q5X A;  3VTY A;  3UUX B;  1D0Z A;  2KZ7 B;  3PNT B;  3FTV A;  3TKL B;  1FVF A;  4OYS A;  4H9N C;  2I2O A;  1FMW A;  3RYF E;  1HZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...