3CQGB

Nucleoporin nup107/nup133 interaction complex, delta finger mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
184
Chain Sequence
b'LSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDENINDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADFEFVLKANYEYYVQGQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear pore complex protein Nup107
publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 59
structure length 184
sequence length 222
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqgB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqgB02
3CQGB 3I4RB 3CQCB
chains in the Genus database with same CATH superfamily
2E9XC 2ETAA 3LK3B 5CBOA 1WAO1 3B95A 4HOSA 3ZPJA 3WI3A 3GW4A 3SZ7A 1DNPA 1JUQA 2IFUA 3GYZA 5D2MC 3UXGA 3FHEA 3S7BA 2XTLA 5HS0A 3JAFA 1ELWA 1XNFA 2AXZA 4FC8A 3AEBA 3ANWA 4U95D 5FQ6A 2CLYB 2DL1A 4HFBA 4URKA 2XEEA 3RK6A 5LCWJ 4PK5A 4JZYA 2OVFA 4U8YD 5G05C 1N4PA 4WWPA 2E9XD 3R7RA 5L4EA 4WWOA 2BS4A 4MHCA 4G8KA 2HN2A 3CV0A 5JVDE 4U2YA 4GYRA 3RKOA 3PZDA 5FY0A 3ZKJA 5KJNA 4JI1T 5L47A 3EHZA 2ODUA 3R9MA 1HF8A 5AQOB 3TWXA 4ILGA 4O2BE 3LXUX 2WQ7A 1IJ6A 2IU1A 4CEMA 4P0AA 2EQXA 2X66A 3I0QA 4I6EA 3LK2B 4QXHB 3IHYA 3LEWA 2YN6A 2V7IA 2PJQA 4J0UA 5FQ4A 3R7QA 5L3BB 2UXCT 4JA7A 3C4WA 4U72A 3O48A 3PU8A 1W0BA 2WB5A 5BXUA 3L8RA 2VYIA 3N9NA 2IQCA 2IY0C 3UU8A 2JMHA 4DR1T 4GTMA 4HFGA 4ZHBA 3C98B 1W3BA 4Q25A 3HIZA 1WYBA 2Y6XA 2MOZA 4K0UA 3ABME 2QGSA 2WXFA 2NTYA 3PEUB 1N11A 5KNHD 3CX7B 4BSZB 1HO8A 2PG8A 3HVEB 1JCQA 3FUFA 3RRNB 2LXLA 2XQ7A 3HRAA 1WG0A 3QDNA 4LFCT 2JQHA 3FDHA 4EHMA 4E6HA 4B6XA 3B7UX 4C90A 1OCRE 3A8YC 4IIJE 2B1EA 4IE7A 4YXDA 3FEYA 5AAOA 2BUGA 3PDYA 4BA9A 1I94T 4EV6A 3CGHA 4B93B 3TWUA 4YLHA 3LY7A 2CHZA 3CVQA 1IJ5A 2L6JA 3JC6C 1SE7A 5LMUT 3G2WA 1OWNA 3T5VA 3BQKA 3KDSE 5EK4A 5JR9C 5E76A 1QBQA 1US7B 3F57A 3ZEFB 4YSXA 3TWSA 5A6CA 1OEDB 3ZNGA 1J5ET 3VTYA 2K24A 1UGOA 2H7OA 2WXIA 4A97A 3ASFA 3EHNA 4UVCB 5LHHB 5ABHA 1MNDA 4OK0A 4YDOA 3D9MA 3UTMA 5ABFB 3CQXC 3EVYA 3SFXA 2MOWA 3EUVA 4YSZA 4EBAG 2OEVA 3BUAA 3LJNA 3MEKA 3SBSA 4DVDA 1S94A 1OWMA 5AYWD 3CVUA 3A7MA 3HKDE 2J8SD 4QXBB 3SGHA 5AJDA 2E5LT 4TNVA 4GMLA 3FUJA 2CG3A 3IXEA 4V1Av 4DX2A 1HXIA 4FULA 5JDQA 3DSXA 2LXMA 5D0QD 5JHAA 4HEAA 3UUNA 1MX6A 3UUBA 4ISTA 1HG5A 5EILA 2CEAA 4O4HE 5HWYA 5AQBA 3ONJA 4GTQA 4CDMA 3CHQA 2VKJA 4P1NA 2EINE 4GIWA 2NXPA 2A4ZA 2ZXWE 3QKYA 1LKXA 4C9BB 5ABEA 2Q9QA 5AQPB 4Y6CA 1HNZT 3L09A 4KZ0A 4ZHQE 2YU1A 5HYAA 4AIFA 4N39A 3AA0B 3N2OA 3N9OA 2YHCA 4ZI2C 2J4BA 1WDYA 4WBOA 4ZZBA 1PC2A 3ANWB 4B3RT 4O4LE 1H19A 2EIJE 2VJ8A 3L6AA 4U0SA 4U96D 1NENA 5LB7B 3RO2A 1IBMT 2RFMA 1AWCB 5EKQD 3C3QA 2GK9A 2I59A 5DJQC 5AQGB 3NWIA 3N9PA 1D0ZA 4CZ2D 3TXNA 5JJTA 3FBZA 1XMOT 1OT8A 1CUNA 3PUQA 3ZC1A 4GPMA 1INZA 4CT4A 2VQFT 4LRZA 1MIYA 3HHMA 3KVBA 4MLKA 4PJMA 2WXHA 4HXIA 2WMOA 3IBPA 3IV0A 4DR3T 3TWVA 3EAMA 4UELA 3J7Yq 2PM7A 2ETBA 5ENSD 2P58C 4ZI2D 2XPKA 2LKHA 2LOSA 2XAJB 5LGUB 2P9NG 5FP3A 5JDMA 4C91A 3RAUA 3Q7AA 2RA1A 2DNXA 2J07A 4JHRA 1Z3XA 1S70B 3CIAA 3ESKA 5CECB 3VTXA 3HR0A 3LJCA 4EZLA 5HXRA 2LE8A 1KZOA 2J4DA 3T8OA 3G2TA 4PJLA 4EB6E 3UMVA 2NYJA 4U8VD 1N33T 4RG9A 3SS1A 5H6QB 3VLDA 1QNFA 2FJEA 5FL1A 4DRXE 1BD8A 1KLXA 4QH4A 2W0GA 5CGMA 2CE7A 1SZAA 1KZPA 3FZHB 5CA1E 2XS8A 4E7SA 5DABA 3HXDA 3PE0A 2LAHA 2ACXA 4YJ3E 3LG7A 3G2VA 2PFVA 4I9CA 1WRDA 3WAKA 5FL0A 3C5RA 1WLXA 2XQ5A 4GYYA 4JUYA 5EX3A 1IBKT 2LUHA 4GKJT 2XSBA 1TYQG 2JLBA 5CMYA 4FADA 4FJZA 2F8XK 3B57A 4DO0A 2CFUA 3FTWA 3N9LA 1YYHA 4GAAA 3ZMVB 5AQ7A 2R5SA 2KT9A 1OCCE 4PW8A 3D3MA 5LHIB 4B3TT 2K3WA 4JEHA 2XQ9A 2IC9A 3HXBA 3ZN1B 2LNIA 4HTEA 4ANVA 3MXZA 5BV0A 2J08A 5BNWA 5KJLA 1UJJA 2HO1A 4NXMT 4O4IE 2LJLA 2VK9A 3JQ1A 3Q5EA 3D9OA 4YSYA 3PUYF 4IULA 4CCAA 2VQ2A 4MALA 2KNDA 1JPLA 3EUHA 4ATGA 5HEJA 1HS6A 2P9IG 2BVLA 1KEYA 1OWPA 4GZ3A 2NWBA 3ZXPA 1TNOA 5KXJA 3MKQA 4ZS2A 3OXFA 4GTOA 5D0OD 5EK3A 2QY7A 5H6RB 5HKPA 4I6JA 4I4TE 4I55E 4PFPA 3AE8A 3HI2A 1MIWA 4N3CA 1KNRA 2FULA 3LKUA 4IT4A 2WDQA 3SOLA 4DV3T 1K1BA 5HAXA 4OAUC 5AQJB 4OYJA 5EYLA 3EDVA 2VTBA 4IYPA 2EIME 3QJZA 4OHFA 4DR2T 4ASKA 2XM2A 4LSZE 3K3NA 3VR8A 4HI9A 4Z8XA 2B76A 5CHEE 4EEBA 1H6KA 4A1SA 1TN7A 2VL0A 4BTBA 2V26A 2PQNA 2DYRE 4KT6B 4UQXA 5BXOA 4OVUA 3RHWA 2Q9QB 4NXNT 1XMQT 4UIGA 2J47A 1MMDA 4AVXA 2V6YA 1VCTA 2BS2A 4QHOA 4MS6A 4BTAA 4WYVA 2OA5A 2OOEA 4GZCA 3SRZA 5J08A 3FXDB 3FY4A 5FZRA 4A3VA 4IL9A 3EHMA 2UUAT 3QK0A 2YK0A 2BEDA 2NW9A 3RYIE 4NIQA 2UU9T 3V5UA 5AJLA 3DSVA 3L13A 3KEAA 1QSDA 2XHEA 4EXTA 5M4YA 1V9DA 4BERA 4WNGA 2KZ7B 4DIDB 5M72A 3RSEG 3ONLA 3SFEA 3QOUA 1T98A 4X1KE 4Q94A 4XE0A 3CHRA 1BR0A 3CKCA 3CVVA 2NTXA 1MHQA 2NOXA 3QNKA 4UI9K 1D1AA 3UT5E 4PS7A 4JBWF 4L0RA 5ABGA 2ZGGA 3MZKB 1DVPA 2X6HA 3E32A 2F0YA 2KCLA 2C5JA 5B1AE 2X6FA 4N2SA 4JI4T 3PV0F 2GW1A 2BF0X 3AG3E 2WXMA 2CHWA 3ONKA 5FNVE 3CWZB 3D9NA 3AAEB 4KHPT 3NBNB 4PJNA 4X66T 5G05J 2C0MA 2WMNA 1S0PA 2XAGB 2YEVC 2L6BA 2CCQA 3AAIA 1W09A 4FHKA 2LM9A 4TV9E 1E90A 2HYZA 1VOMA 5LG3A 2C5IT 2YKSA 3PUKA 2SPCA 1KF6A 4KUMB 3Q49B 3BU8A 3V31A 1NAFA 5J2TE 5FVKA 3C3OA 4WAFA 2IONA 2XQ4A 3ZMSB 2DYSE 4UWFA 1OXJA 1N34T 2Y8DA 4HFIA 5J0ZA 2KINB 4N3BA 3CSTA 1H7CA 2XZEA 2UXNB 2HN1A 4IE4A 2P9KG 4COFA 4MFRA 3N9QA 5AQFB 4JEHB 4U74A 4HWHA 4HWFA 1N95A 2H6GA 2V7JA 2LAIA 3LS8A 3UKUG 4ADZA 4UWGA 1HS7A 1VDYA 2ILRA 2DWZA 1XDPA 3RI5A 2HPLA 3TLVA 3SWHA 3T1YT 1MNEA 3FP3A 3FZKB 3Q15A 3L17A 3AXJA 4LF7T 3CK8A 4QH5A 2YINA 3NBXX 2PTFA 5AQMB 2WQHA 3FU3A 5ANLA 5HI7A 2L0TB 4GTSA 2Y3AA 4F53A 3AE7A 3RPUA 1ZKEA 1NP7A 3TWWA 1UURA 2HM8A 3MKQB 4YVQC 4BWRA 4V3IA 3T5XA 4OVVA 2OCCE 5HCMA 5FJYA 3L39A 4ZZCA 2VGYA 4U0UA 4B0ZA 1IZNB 2MAWA 5FZSA 3W9GA 1E7PA 2ETCA 3Q75A 2WQ6A 4X65T 2E2EA 3IBEA 3QAQA 3H3MA 1IQRA 1P5QA 2X6KA 4B8CB 1AJ3A 3IA3A 3QWPA 4TUMA 4U2ZA 1FJGT 2VTBB 1HCIA 4IRUA 2BBHA 3D9JA 3GZ2A 4MBQA 3PEVB 2CWOA 3ZT6A 3FTVA 4AKGA 2MYSA 3ZHEA 2CHXA 2CXLA 1U3DA 4JI5T 3K9IA 5F3JA 3APCA 3FUMA 1FPPA 2IOSA 5HRYA 3PZ1A 3SFYA 1W0AA 3NZUA 3I3NA 4FJOA 3EU5A 4WUYA 1N4RA 2R03A 3EDTB 3BG1B 3DXKG 2VKDA 2M6BA 2LLYA 3AE9A 1MMGA 2V7LA 5LJNA 2L9BA 4YFSA 2ODVA 2HE0A 4XEIG 1K1AA 3B7SA 3UKRG 3WXXA 5KNGA 5AQQB 4HOQA 4LF6T 4NIKA 3E4BA 3GZSA 5KJKA 2V6YB 4ZXLA 4GPKA 4X5TA 4APFA 4KBQA 2P9UG 4WZXA 3RJVA 2ACZA 4IE5A 2IC6A 2QYWA 2BKGA 3P4PA 4DR4T 2MYOA 2KXPB 3D0TA 1ZEEA 2CA5A 4HE8A 1ZP0A 1N94A 4P09A 2R02A 3PJAA 2VKOA 3UM0A 5LOZA 1M62A 2LEHA 3GN5A 3OVUA 2XHEB 4N2QA 3CK9A 4JI0T 2J1DG 3PUXF 5G04C 1B89A 3S4UA 3ZSTA 1LTXA 4L1BA 2GRMA 3J5QB 2WXJA 3PUVF 2FUPA 3IHRA 4HS2A 3TXMA 2UUBT 4DX7D 2N1GA 2YDRA 1EF1C 4GA0A 5FINA 3LVRE 2X67A 1FVFA 3E30A 1MYOA 2VKHA 2I2OA 2Q9QC 2E8IA 2VGEA 5AQNB 3UINC 4R7LA 5CRVA 3E34A 2L0IA 3B5MA 2I6HA 3P4RA 4TV8E 1TNUA 3JYSA 5B1BE 2X9HA 3Q78A 3DSTA 1PY1A 3CPZA 4AQGA 3CR3A 2GGFA 5JQGE 4O8SA 3N71A 4JXTA 3EIJA 4ABNA 3ISMC 2ZM8A 5AQVB 3VKGA 1SVXA 2Q9QD 3F2EA 1SUMB 2PZIA 4JEUA 5ENTD 3U3WA 2FO1E 4UR9A 4DNDA 3JCKC 4LFAT 5BMVE 1NL4A 2RD0A 2YNQA 3APDA 4GTVA 3ASDA 4HNAD 2WU5A 5ENPD 2L9QA 3R9AB 4GCNA 4KMOA 2AW6A 3E33A 5BUZA 4G23A 4AOFA 4EECA 5FWQA 4DX1A 4CYMD 1FEWA 2IEJA 3FFLA 2ONDA 1UN9A 1V54E 1H0AA 1XGWA 4JL0A 2X6IA 4HKAA 2NW8A 4XI0A 3FB2A 3ZCIA 2F37A 4DV0T 3O4ZA 3AEDA 5EK2A 3AEGA 4HN9A 2XAQB 4H7XA 4LNGA 1X5BA 2VSOE 2Y1LE 2D9DA 3AXJB 4Z91A 2X9WA 2IO2C 4J8EA 3S7DA 3DSWA 3PE3A 3RQUA 3O9XA 2M6IA 1J5WA 2LSIA 1YKHB 4ILBA 3Q4AB 2FI7A 4I1AA 4PNIA 3ZN3A 3HG0D 3FZMB 3HXFA 3CQGB 2WS3A 4CDNA 5FZQA 3FUIA 1QZ2A 4O2AE 5C8YE 4YY3T 3MA9A 3EHRA 4YDWA 2QYUA 3LSVA 2M67A 2FJDA 3TKLB 3C51A 4IDNA 4P0BA 1TNBA 2XCCA 3ZHEB 1HG2A 3SO8A 3ABVA 3E22E 3ZYLA 2EIKE 2LOPA 4CDRA 3CMLA 3EU9A 1XWMA 2VB6A 4B89A 4F7AA 4U04A 3NVOA 3LY9A 4A5XA 3ZSSA 3QB5K 3QNUA 5CEDB 4M1PA 5FQ8A 1SA5A 2YDSA 5LMNT 3JC6D 3ABKE 1XNQT 3C72A 3DEOA 3KV5A 5LG4A 1HNWT 4I0UA 3Q2MA 4EZ4A 3RGLA 4HWCA 1TN6A 2XCBA 4LFBT 3RRWA 4AXPA 5ENNA 2DZNA 3P4SA 2I1KA 5LGTB 4G26A 1ZHCA 3P8CD 5IYZE 4FHJA 2WXLA 3PUAA 4XX5A 5EDSA 5CMWA 4AQYT 4L7TA 2WBLA 1OCOE 2RP4A 4JHJA 3UQ3A 1IYGA 5L3DB 4UI9C 3UM3A 4EIWA 4IREA 4IHJE 1E7VA 4BETA 3UM2A 2W62A 5L2LA 2A72A 4DR7T 3P50A 3RYHE 4XAXB 4L23A 2R05A 3PDNA 3KV4A 1D0XA 5KMGP 4X64T 3GN5B 1UX5A 3K8PC 3PUJA 1ELKA 2M63A 2CWYA 3CKDA 3OKQA 3FTUA 4PFOA 3KINB 4EAHA 3JADA 1OXZA 3JUIA 3AVRA 5JDHA 2J9QA 4IE6A 1VCSA 4DUZT 1H2VC 4E7ZA 5L4HA 5ENOD 3V30A 3RQWA 3F6QA 2V4HC 2D0UA 1A17A 4QFVA 4AKRB 4PK4A 5ANRA 4LMKA 4AQFA 3URZA 3DBSA 4GB9A 2IOLA 3KSLA 3RIFA 1N54A 2VL8A 2RPAA 1E8YA 3OAWA 1NFIE 1G8XA 3NZPA 2A5EA 1N4QA 2C0LA 4KXKB 4NACA 5JRCA 2KXPC 4AY5A 4LMJA 4LMLA 3UTKA 4I6GA 5C2TA 2JMKA 3PUGA 1L5JA 4CI2B 1OY3D 4AKLA 4F1PA 2H6FA 3OTOT 3CVXA 4PK6A 2VWAA 4JEUB 3CSFA 4IN3B 4ZEYA 2K5BB 3ONLC 3EJNA 2FO7A 3ZXSA 5CCMA 2HR2A 3Q5XA 2BKKB 3Q5WA 3ZYKA 4CZZB 1SW6A 3DP7A 3JQ0A 2V8SE 5FIOA 1BR1A 4NURA 4APOA 3IEEA 2FF4A 4HFHA 4GOUA 4J7WA 5LFAA 5FTPA 2BBJA 2DIWA 4AP2A 2L3LA 4KHZF 5FXWA 3GZ1A 5J90A 3NRYA 1Y8MA 3BG0B 4DLOA 2LSGA 3CK7A 2WY2A 4L2LA 3VLEA 3HKEE 5E0OA 4EGWA 4HFVA 3AA1B 1UJKA 5CERB 4X1IE 2CXFA 1KK7A 2KM4A 1IXVA 4MLPA 3C4ZA 3ZYMA 4DV2T 2AXDS 1LD8A 3S2AA 3SHFA 3HKCE 4HORA 4G25A 3AS4A 3G2SA 1G73A 5LXTE 3TJPA 3LK42 2GRPB 4GMRA 2A5UA 2V4LA 5HWXA 2WAUA 4ANXA 2HH7A 2QRXA 3MA5A 4B8AA 4DI3A 3TGOA 2DHRA 3L54A 4U33A 4G1TA 3NKZA 3H37A 4QQIA 3FU0A 4IDQA 3N2KE 2AXVA 2W61A 1KNPA 2P9PG 3I0OA 1H2UA 4RLYA 1NZNA 3RRCA 3CHOA 3FTYA 4K5CA 5KWDA 2LSYA 4JI3T 1SA4A 3RRUA 1ZB1A 4BFRA 3ZT5A 4QXCB 2NR4A 5AQAA 2WXGA 3ZN0B 4AISA 4C0EA 2BG9A 3N5LA 1FT1A 2E0IA 2UY1A 2X9YA 4FLHA 2IIUA 2J4GA 4G8LA 2VQET 2XGMA 3W15B 4FU3A 4IDPA 3RYCE 3D9LA 4ANUA 3AECA 2W2UA 3TG5A 2V5DA 5KCMA 4AIUA 4DI4A 3AAAB 1NA0A 5CEAA 3AEFA 4PS8A 5AQUB 1UG3A 3OYZA 5FXZA 4J8SA 4GA2A 4BSXA 3NQPA 1S64A 3KEZA 5C1DA 4U31A 4H63V 3EABA 3RKGA 1GW6A 4KI0F 4DK5A 1HZ4A 4AKHA 4AV7A 4LF4T 3U66A 2V5CA 1QYMA 3C50A 5JREA 4IGUA 1UK5A 1Y6IA 1WR6A 2YU2A 4H7YA 4H9RC 4IDZA 5HXEA 4K5AB 2C2LA 2XQ8A 3AE1A 5BPPA 4XZCA 3NB2A 2CBJA 5AQSB 1KT1A 5ARGA 4FP7A 5T4YA 3AE6A 3MKDA 2OEWA 5DQWA 2XUEA 4NPPA 3ULYA 3AG1E 2VSNA 2PQRA 3V79K 4DX6D 2JQ9A 4HWIB 1NEKA 4EOZB 1IHGA 2W67A 2XM1A 1OWAA 4JV5T 2R59A 4HQDA 4BY6A 1HE8A 2XQ3A 2MHKA 3UX4A 3EDUA 4NRHB 2HHHT 4I43A 2J09A 3WAJA 1MMAA 4X20E 1QUUA 1MMNA 3LBXA 2IO3C 2IF4A 2NP9A 4CI1B 1D8EA 2BKOA 4I1MA 4DPRA 5G04J 5JA4D 4DV1T 3I1AA 3AA7B 5HXCA 1T7SA 2A3DA 4UEMA 3DJBA 5C2YA 4I2WA 1A5EA 4BESA 4ACLA 4LG6A 3ZLIA 3ZCJA 2KMFA 3PUZF 5IUXA 1HH8A 3TWRA 5BT1A 2DZOA 2DWGA 2XQAA 4J8DA 4OFZA 5AFUL 3U64A 3B13A 5AQHB 4Q96A 5HEGA 4HOTA 2WQYA 3FEXA 3NOCD 4TUUA 3PVLA 1E1HB 3R84B 2D0TA 3TG4A 2DLRA 4N5QA 4HB5A 2Y69E 1MQSA 3ASOE 2WVIA 3ULQA 2EHOA 4YJ2E 3UU4A 2FBNA 3NF1A 2OLTA 1SZ9A 4TXQA 3PNLB 3V2OA 3UQ7A 1WFDA 2L8KA 2XGSA 4KBMB 4PDXA 3KV6A 3M3ZB 3O1JA 1ZOYA 2YQ8A 2H7VC 2W00A 2WM9A 5AQIB 1Y01A 4LNUD 2VSYA 5A7DB 2AE9A 1BLXB 3UUXA 4GTTA 1MZCA 4BJMA 3RIAA 3APFA 4HRLA 3UT7A 2J49A 1BU9A 3OXLA 5AQRB 3DXMG 2RKKA 1FCHA 4H9PC 3KV9A 3JUEA 3MX3A 2KC7A 2I1JA 3AJIA 1T72A 3SFZA 2V1DB 3PE4A 2JQQA 3B7TA 4UUCA 3MZLB 3K1SA 4CXXA 3Q5DA 4AEZC 3SD5A 2XAFB 1N36T 3B7BA 3T8KA 3ZW3A 2IMLA 2E2AA 4TZ4C 1PAQA 3FH8A 3CVYA 4WWNA 4IL4A 5AQTB 4QWNB 4U3CA 2JPFA 4DV4T 4JYAT 1H6OA 2B0OE 1OWOA 3AU5A 1FMVA 2WDRA 3IEGA 1HFAA 4NQ0A 4BT9A 2LSVA 5CCLA 2XRZA 3MV3B 3MJXA 1H6PA 2FJAA 4O1PA 5CRUA 2H88A 4JB8P 5GONE 5HXHA 2V5FA 4GMJA 3CIRA 4H9SE 5LP6E 2FJBA 4GYOA 2D5UA 3H3AA 3ENEA 3QWVA 4A1GA 1TJFA 1IBLT 5LGNB 3GWHA 2MTQA 4DJAA 4MBGA 1U5PA 4L2YA 2BG9B 2GRLA 4K0KT 3P2BA 2NSZA 5JDFA 4HVBA 4ZI7E 2UY1B 3BK9A 5FXVA 2IUBA 4E85A 4OYKA 4I2ZA 4TXRA 2JQKA 1IQUA 2GRRB 3L08A 4TWHA 5CB4E 1YCSB 1U4QA 1SHZC 5LP0A 3DEPA 3UFGA 1O5MA 1KNZA 3P4WA 4GTPA 4Z68A 4K0RA 4ERRA 3MK7C 3BQIA 5JHBA 5HXSA 3N9MA 1EZ3A 4KYOB 3E37A 2CMRA 1WCRA 1OEDA 2LSJA 1MX2A 3LJ3A 1NWMX 1XDOA 4L9PA 2WXNA 2WU2A 3P4QA 1OWLA 5FMNA 2WXPA 1DU2A 4HOUA 2PL2A 4GZ5A 3ZMZB 5BW8C 3SF4A 4A98A 3TLTA 4K5BA 4TN7B 4YNDA 3DSUA 4ANWA 2AWIA 4CGVA 3ASGA 4CN6A 4BJNA 3VU7H 4NUUA 4XBFB 4PS3A 2JRKA 3R6NA 4TRQA 4YT0A 2KCVA 2X6JA 1D1CA 1HU3A 4UWKA 2NW7A 4G2AA 3AU4A 4EYYR 3KD7A 1SQMA 3MV2B 3FUNA 2DI4A 4UI9J 4N5CA 3N2GE 2CHOA 4O6FA 2XASB 3DTOA 5CFBA 4I43B 4CXYA 3SBTB 2BVMA 2X0LB 2GRNB 1VRBA 4U0ZA 2IHR1 2ZM0A 3K3QC 3AAAC 4DX5D 3LBXB 4HI8A 4MRUA 2P9LG 4JI6T 3G2UA 5AQLB 3KS2A 2LO6A 4CT0A 1EYHA 2BG9E 5KJMA 3AA6B 5FYMA 3MCXA 2JEKA 3VR9A 2XRYA 3OJAA 4H9NC 4CXWA 4ILIA 5JH7E 3RF1A 4J8FA 4K03A 1FIOA 1S35A 3JXJA 4DUIA 4YDYA 4ZS3A 2WXRA 5B3SE 3B7RL 3ONXA 4QX7B 2PM6A 3UPVA 2YOEA 2JJ9A 3OBVE 3PURA 2V8SV 1Z3YA 2XPYA 3V2XA 4TV3A 4OAVB 2HPJA 3ETVA 4LF5T 1HTJF 4RG6A 3A5XA 3BEEA 4L5GA 4U7YA 1Y64B 3ZMUB 4GU5A 2CG2A 2ZISA 3QB5A 2OV9A 2LRLA 2JABA 5LBQB 4YVOA 2EHOB 5J1GA 1TN8A 5KX5E 2KATA 4BEPA 2P9BA 4QH1A 5DQVA 5LYJE 4DR5T 4AQFC 3FUDA 2X0YA 2CRBA 3IF8B 5L3GB 2DBAA 4TWDA 4YTMA 1X81A 4TXPA 3FH5A 4IE0A 3RU0A 2ZMAA 4LEUA 5FVLA 4H9QC 3AS8A 4HWDA 3UUXB 2W63A 2CFZA 1YQ4A 3QARA 1N0QA 1BR4A 2A2FX 4UWHA 3BQOA 2LM2A 5J2UE 3M65A 2XEHA 4EZKA 2WXQA 4LNBA 3NOGD 4RVBA 2K9AA 3AG2E 2X0HA 5FXXA 3E0ZA 2LKGA 2WZIA 2VURA 4UXNB 4DBQA 3RKVA 5ADXL 1XZYA 4J2CA 3CX6B 3RIUA 2Y4TA 3ASNE 4G24A 2RFAA 2LT3A 3QC1A 4TNWA 5FQ7A 3NZSA 5CJ5A 1V55E 1WM5A 3LPZA 1LF8A 1HNXT 4F3VA 3P7IA 5AENA 3NAWA 5KDMC 2H89A 4AKIA 3VRAA 2V5QC 5HQ8A 3TWQA 4LF9T 4GCOA 4HFCA 1Z5SC 3S7JA 2Q7FA 3UU3A 4FJYA 1LVKA 5EX0A 1N32T 4ACKA 2X68A 2BTDA 3ETUA 4XZ4A 1R8IA 2YHEA 2LSKA 5AARA 1UW4B 3CHMA 1LRZA 3ESLA 2VGXA 2C5KT 3ZT7A 2KBXA 3CHPA 2LHNA 4U07A 2FBWA 1UUSA 3K3OA 3QOFA 5LBMA 4DR6T 4KZCA 3LVQE 4WNEA 3ZPOA 4U7EB 3O1HA 2KZTA 4M3OA 4JPSA 2UWJG 5CBNA 4DV7T 4XIFA 2X38A 3FWVA 5AN8A 3LY8A 3PUSA 4HBDA 1O1SA 1E2AA 1H2TC 4XKCA 3RRMB 4GK0E 3CVLA 1N52A 3SQVA 3TL5A 1GQEA 1DC2A 4JI2T 3HYMB 3T8MA 4DMVA 3MKRA 4XKBA 3G06A 5L3FB 4U8HA 3ZJ2A 2KLQA 2XSAA 3PTRB 5KBAA 2E9XA 4WNKA 1IAPA 4YDEA 2DWKA 5JJ6A 5CA0E 1FVHA 2P2CP 3PUWF 3X2QE 4LERA 4G11A 3DSSA 2BG9C 4ILAA 4ISSA 4J6IA 1X79A 4QKNA 3AE3A 4EQFA 4NUVA 3LDQB 4TX5A 1E8XA 1IHBA 4CGWA 4CQIA 5G55A 5LCYA 4D10C 2WXKA 1TJCA 2KWIB 3RO3A 1TNYA 4DUYT 2MPKA 5LX8A 3CVNA 3JAEA 3KVAA 3KAEA 4GTRA 5HEUA 2AJAA 3O4XE 1Q2ZA 2I9CA 1SA0E 2KCKA 3P1UA 1YKEB 4G63A 3EHQA 4ZOLE 4M7CA 3FULA 3I4RB 3OTNA 2XZTG 3VKHA 5G2NA 3FU5A 1E8ZA 4J8YA 2XQ0A 3DPYA 1FMWA 3C64A 3HKBE 5LCWC 2Y0BG 3D9HA 4RQIA 3ZGQA 5AIJA 1RZ4A 3RYFE 5AQ9A 2V7KA 1E96B 3AEEA 5EIDA 4ILHB 1UOHA 3U9WA 3HA4A 5TAOA 1LVFA 3L3PA 2A9UA 5ENQD 4HFDA 1TEZA 1OEDE 1ZU2A 4FI5A 2WP9A 4F8HA 5IY5E 4OYSA 1IKND 1BPOA 2BKNA 3L9TA 2DVWA 4WNDA 4C48B 1HX8A 4TUYE 3Q73A 3SFDA 1YD8G 2R17C 3EI0A 1QLBA 2CXDA 3AVSA 4JW1A 2XPIA 3JXIA 3KFWX 1TNZA 4DV6T 5JMND 3PJAJ 1T8BA 4OX9T 4O1OA 3TLWA 4CN4A 1UN8A 3CEQA 4WW0A 3VHLA 4JLEA 5ETWA 5T8IA 4CN1A 4O60A 2RG8A 3S7FA 4X8QA 5FY1A 5IWAT 2ES0A 4PAGA 3ULEG 3VLFA 3QK6A 3C3RA 1KFYA 1K8KG 3SNXA 2G0UA 2XGOA 3GA8A 3EIQC 3AE5A 1FT2A 5EZYE 3QUJA 4YTPA 3CX8B 5FKYA 4F6RC 5L3EB 3MACA 2V7MA 2XS1A 2Z6EA 3UULA 4U7IA 3RC3A 4EPZA 2CLYC 4KX6A 1JNZA 2AVPA 3UT8A 1D9SA 1N4SA 5C3JA 3Q9UC 4JA9A 2XZDG 4YHJA 2EHOC 1U3CA 5L3CB 4BAYB 5T3RA 2LHRA 2CHNA 5JR9A 2PBIA 2CPTA 2D2SA 3ZFWA 1O1RA 1HX1B 4HRNA 1OCZE 2X9XA 4JI7T 4F6RD 2KSRA 3UIOC 1WYCA 5ITZF 3MGBA 2QC9A 2QA7A 4Q69A 2VGXB 3QWWA 5LHGB 3UM1A 3ZMTB 5JDLA 2WB2A 4CI3B 4EZHA 3ASHA 1D8DA 3O1IA 2V6XA 3FZLB 3FXEB 4B3MT 3OXGA 5AQKB 4PH4B 4A3TA 2EHOD 3MYVA 3OYXA 2KZTB 1JNRA 2H6IA 4ZI3C 3AB3B 2XPZA 1Z0PA 2QVAA 2F4VT 3X1DA 3AS5A 3FBLA 1J1JA 1N9AA 1X9BA 2VVNA 1MJ0A 3FU6A 4GZDA 3FTZA 3L16A 1ZV4X 2I0MA 2R2LA 3V5SA 2XEVA 3PREA 5EN5D 4UF0A 1JCRA 4UVBB 2UXBT 2PNNA 3ZKRA 2BDEA 4YTNA 2ZM6T 4I1OB 3FUEA 2R6GF 2VASA 1NI1A 2N9DA 2MRIA 3LFMA 3VRBA 4JVSA 1EDUA 2E9XB 2Y48B 1S63A 4HLEA 4ZI3D 3FZFB 5BV1A 5HEOA 2W66A 3ZJ1A 2WZHA 5HCJA 3L22A 3CK6A 4H9OC 2WCAA 5EIBE 2BKPA 3KSQA 1Z6TA 2ZU6B 2XQYA 3W9FA 3AEAA 2XY8B 3RIBA 1JWFA 3DRAA 3MJWA 2IDOB 4IDOA 1WY6A 4PUCA 5JTGA 3UFEA 3FTSA 4UQZA 3Q7FA 4Y6WA 3NZQA 4ILCA 3PZ2A 1ELRA 5FY7A 4DV5T 3LCAA 5A23A 2WXOA 2ZM2A 3Q47B 1JCSA 2QFCA 1OEDC 3QC9A 5LJMA 4GYWA 5H7PA 4GK5E 4JD2G 2H6HA 3D9PA 4WNFA 4G2VA 1E7UA 4A63B 2DCPA 2B6CA 3SI5A 1M7KA 5F8PA 2VSXE 4EBAA 1U2VG 1MX4A 1L0VA 4LCTA 2WSSV 3HL6A 4X1YE 2YDQA 4X62T 4B3ST 3U4TA 5JRCB 3ZU7B 3ZVVA 3HXEA 3AE2A 1DCEA 2OVBA 3I4GA 3PNTB 4FA6A 3PU3A 4CRWA 5IHYA 1OUVA 4I17A 5D66A 1N0RA 3QB2A 3TWTA 3PZ4A 3T9KA 2Y4UA 3CHSA 1YW0A 4GZ6A 4KVMA 3ML8A 3UU5A 4A55A 5A1LA 3WG7E 4H63H 3T1HT 4UQYA 4LUNU 1YXRA 4QX8B 2XJ7A 2BZBA 5F5WA 3DPDA 4P29A 3C4XA 2F8YA 4KVOA 4F1SA 3CLJA 2EILE 3I9YA 2H3RA 1KPSB 1AP7A 1D0YA 4I50E 3ZC0A 4N3AA 3AE4A 4UVAB 3KBUA 3RLFF 3LDZA 4ANJA 4DBRA 3FUKA 4ILUA 4ZFHA 4A56A 1QQEA 5ARFA 2P9SG 3L82A 3FHNA 4TWFA 2UUCT 4N78D 3UUMA 4YHHT 4WBNE 3TLUA 2NC9A 3I5PA 2MBGA 2GROB 2LSUA 1EPUA 1YQ3A 5ENRD 4HRMB 5BR8T 4UV9B 1ZBPA 3IHVA 3JCFA 1BI7B 4EZJA 4ME2A 2X51A 5JR9B 4FLBA 3TLSA 2ZGDA 4AI6A 2XAHB 4JI8T 4KMCA 3RC8A 3UIPC 1TR4A 2XENA 3TAXA 1LD7A 3GMIA 3C98A 4U63A 4UWLA 1NA3A 4W9RA 2IJGX 2CBIA 5DBKA 1HR0T 2WWVA 1CHUA 3U3IA 2QZAA 3PH0C 4JC8A 1E8WA 3ZUVB 3D9KA 4GA1A 2VVSA 3HVEA 4JHKA 2AXUA 4BX8A 1MIVA 3Q5MA 2ZIRA 3Q9DA 5JDGA 4AY6A 2WDVA 1K3ZD 2N2NA 2K48A 2BS3A 4O4JE 3ML9A 2CM0A 2J62A 1JWGA 3CQCB 3RIUC 5LA6E 2V0PA 3ABLE 4UF0B 3E08A 3NRXA 5LOVE 3PRZA 5HEHA 4AJWA 4B94A 1B7TA 3CVPA 3FH7A 4AXHA 4UV8B 1XNRT 3IKOB 2UXDT 1G3NB 2QYJA 5DIZA 2X3MA 3BQLA 1I6ZA 3SY2A 3KBTA 4HLLA 4DMWA 3DWLG 4EEDA 5JJ7A 2W4XA 2UXXB 1O3XA 3CVRA 3HDXA 3ZEFA 3J9X1 4L9IA 4LF8T 3CKBA 2IAKA 3FTXA 3I9WA 1YMPA 2WWUA 2KWHA 4BX9A 3ZIMA 3UQ4A 1YA0A 5LNKA 4I9EA 2GRQB 2FEZA 4DLQA 2IW5B 3HXCA 2ZLYA 5JDNA 5ABFA 4MKTA 4GYSA 3AG4E 2DCFA 1UCUA 4HGAA 3U78A 3UU6A 5E75A 1BI8B 1KT0A 4GKKT 3J5PA 4HFEA 4KP3C 4ATZD 5EYPF 4AM9A 3ZRHA 1Z8UA 1W9RA 4XI9A 4RSYA 2E5VA 4Z90A 3FUHA 3PZ3A 3RX6A 3OPCA 3Q9NC 5FT9A 3Q79A 2WPVA 1RW2A 1WR0A 4BT8A 3RH3A 4EYUA 3UT4A 3ZYQA 4PJJA 2C0SA 2JIWA 3PS6A 4C0MA 1BR2A 3LYAA 2XQ6A 1D1BA 1UX4A 3D9IA 3CVWA 2LRKA 1O1TA 2OV8A 3UI2A 1DCQA 3F31A
chains in the Genus database with same CATH topology
2E9XC 3LK3B 1WAO1 4HOSA 3ZPJA 3WI3A 3GW4A 3SZ7A 1DNPA 1JUQA 2IFUA 3GYZA 3FHEA 3S7BA 2XTLA 1ELWA 1XNFA 2AXZA 4FC8A 3ANWA 5FQ6A 2CLYB 4URKA 3RK6A 5LCWJ 4PK5A 4JZYA 2OVFA 5G05C 4WWPA 2E9XD 3R7RA 4WWOA 4MHCA 3CV0A 5JVDE 3RKOA 4GYRA 3PZDA 5KJNA 5FY0A 2ODUA 1HF8A 4ILGA 4O2BE 3LXUX 2WQ7A 1IJ6A 2IU1A 4CEMA 4P0AA 2EQXA 2X66A 3I0QA 4I6EA 3LK2B 4QXHB 3IHYA 3LEWA 2V7IA 2PJQA 4J0UA 5FQ4A 3R7QA 5L3BB 4JA7A 3C4WA 4U72A 3O48A 3PU8A 2VYIA 3N9NA 2IQCA 4HFGA 2JMHA 3C98B 1W3BA 3HIZA 1WYBA 2Y6XA 2MOZA 4K0UA 2QGSA 2WXFA 2NTYA 3PEUB 3CX7B 1HO8A 2PG8A 3HVEB 3FUFA 3RRNB 3QDNA 3FDHA 4E6HA 4B6XA 3B7UX 4C90A 4IIJE 2B1EA 4IE7A 3FEYA 2BUGA 3PDYA 4BA9A 3CGHA 4YLHA 3LY7A 2CHZA 3CVQA 1IJ5A 2L6JA 3JC6C 3G2WA 1OWNA 3T5VA 3BQKA 3KDSE 5EK4A 5JR9C 5E76A 1US7B 3F57A 3ZEFB 5A6CA 3VTYA 2K24A 2H7OA 3ASFA 2WXIA 3EHNA 4UVCB 5LHHB 1MNDA 4OK0A 3D9MA 3CQXC 3EVYA 2MOWA 4EBAG 3MEKA 3SBSA 4DVDA 1S94A 1OWMA 5AYWD 3CVUA 3HKDE 4QXBB 3SGHA 5AJDA 4GMLA 3FUJA 2CG3A 4V1Av 1HXIA 4FULA 5JDQA 5D0QD 5JHAA 4HEAA 3UUNA 4ISTA 1HG5A 2CEAA 4O4HE 5HWYA 4CDMA 3CHQA 2VKJA 4GIWA 2NXPA 2A4ZA 3QKYA 1LKXA 4C9BB 2Q9QA 4Y6CA 3L09A 4KZ0A 4ZHQE 2YU1A 5HYAA 4AIFA 4N39A 3AA0B 3N2OA 3N9OA 2YHCA 4ZI2C 2J4BA 4WBOA 1PC2A 3ANWB 1H19A 4O4LE 2VJ8A 3L6AA 4U0SA 3RO2A 5EKQD 2GK9A 2I59A 5DJQC 3N9PA 1D0ZA 3TXNA 5JJTA 3FBZA 1CUNA 3PUQA 3ZC1A 1INZA 4CT4A 4LRZA 1MIYA 3HHMA 3KVBA 4MLKA 4PJMA 2WXHA 4HXIA 2WMOA 3IBPA 3IV0A 4UELA 3J7Yq 2PM7A 2P58C 4ZI2D 2LOSA 2XAJB 5LGUB 5FP3A 5JDMA 4C91A 2RA1A 2DNXA 2J07A 4JHRA 1Z3XA 3CIAA 3ESKA 3VTXA 3HR0A 3LJCA 4EZLA 5HXRA 2LE8A 2J4DA 3T8OA 3G2TA 4PJLA 4EB6E 3UMVA 4RG9A 3SS1A 5H6QB 3VLDA 1QNFA 1KLXA 2W0GA 2CE7A 1SZAA 5CA1E 4E7SA 5DABA 3PE0A 2LAHA 2ACXA 4YJ3E 3LG7A 3G2VA 2PFVA 4I9CA 1WRDA 3WAKA 1WLXA 4GYYA 4JUYA 5EX3A 5CMYA 2JLBA 4FADA 4FJZA 3B57A 4DO0A 2CFUA 3FTWA 3N9LA 4GAAA 3ZMVB 2R5SA 2KT9A 4PW8A 3D3MA 5LHIB 4JEHA 2IC9A 3ZN1B 2LNIA 4HTEA 4ANVA 3MXZA 5BV0A 2J08A 5BNWA 5KJLA 1UJJA 2HO1A 4O4IE 2LJLA 2VK9A 3JQ1A 3D9OA 4IULA 4CCAA 2VQ2A 4MALA 2KNDA 1JPLA 3EUHA 4ATGA 1HS6A 2BVLA 1OWPA 4GZ3A 2NWBA 3MKQA 4ZS2A 3OXFA 5D0OD 5EK3A 2QY7A 5H6RB 4I6JA 4I4TE 4I55E 4PFPA 3HI2A 1MIWA 4N3CA 2FULA 3LKUA 3SOLA 5HAXA 4OYJA 3EDVA 2VTBA 4IYPA 3QJZA 4OHFA 4ASKA 3K3NA 4Z8XA 5CHEE 1H6KA 4A1SA 4BTBA 2V26A 2PQNA 4KT6B 4UQXA 4OVUA 2Q9QB 4UIGA 1MMDA 4AVXA 4QHOA 4MS6A 4BTAA 2OA5A 2OOEA 4GZCA 3SRZA 5J08A 3FXDB 3FY4A 5FZRA 4A3VA 3EHMA 3QK0A 2YK0A 2NW9A 3RYIE 3V5UA 5AJLA 3L13A 1QSDA 2XHEA 4EXTA 5M4YA 1V9DA 4WNGA 2KZ7B 5M72A 3ONLA 3QOUA 1T98A 4X1KE 4Q94A 4XE0A 3CHRA 1BR0A 3CKCA 3CVVA 2NTXA 1MHQA 2NOXA 3QNKA 4UI9K 1D1AA 3UT5E 4PS7A 4L0RA 3MZKB 1DVPA 2X6HA 2KCLA 2C5JA 2X6FA 4N2SA 2GW1A 2BF0X 2WXMA 2CHWA 3ONKA 5FNVE 3CWZB 3D9NA 3AAEB 4PJNA 5G05J 2C0MA 2WMNA 1S0PA 2XAGB 2YEVC 2CCQA 3AAIA 4FHKA 2LM9A 4TV9E 1E90A 2HYZA 1VOMA 2C5IT 3PUKA 2SPCA 4KUMB 3Q49B 1NAFA 5J2TE 4WAFA 2IONA 3ZMSB 4UWFA 2Y8DA 2KINB 4N3BA 3CSTA 1H7CA 2UXNB 4IE4A 4MFRA 3N9QA 4JEHB 4U74A 3LS8A 2LAIA 2V7JA 4ADZA 4UWGA 1HS7A 1VDYA 2ILRA 2HPLA 3SWHA 1MNEA 3FP3A 3Q15A 3L17A 3CK8A 2YINA 3NBXX 2WQHA 3FU3A 4F53A 5ANLA 5HI7A 2L0TB 2Y3AA 3RPUA 1ZKEA 1NP7A 2HM8A 3MKQB 4YVQC 4BWRA 4V3IA 3T5XA 4OVVA 5FJYA 2VGYA 4U0UA 4B0ZA 1IZNB 5FZSA 2WQ6A 2E2EA 3IBEA 3QAQA 1IQRA 1P5QA 2X6KA 4B8CB 1AJ3A 3QWPA 2VTBB 1HCIA 4IRUA 3D9JA 3GZ2A 4MBQA 3PEVB 2CWOA 3FTVA 4AKGA 2MYSA 3ZHEA 2CHXA 2CXLA 1U3DA 3K9IA 5F3JA 3APCA 3FUMA 2IOSA 3NZUA 3I3NA 4FJOA 4WUYA 3EDTB 3BG1B 2VKDA 1MMGA 2V7LA 5LJNA 2L9BA 4YFSA 2ODVA 3B7SA 3WXXA 4HOQA 3E4BA 3GZSA 5KJKA 4GPKA 4APFA 4KBQA 3RJVA 4IE5A 2IC6A 2KXPB 3D0TA 1ZEEA 2CA5A 4HE8A 4P09A 2VKOA 5LOZA 2LEHA 3GN5A 2XHEB 4N2QA 3CK9A 2J1DG 5G04C 1B89A 3S4UA 4L1BA 2GRMA 2WXJA 3IHRA 4HS2A 3TXMA 2N1GA 1EF1C 4GA0A 3LVRE 2X67A 1FVFA 2VKHA 2I2OA 2Q9QC 2E8IA 4R7LA 2L0IA 2I6HA 3JYSA 4TV8E 2X9HA 1PY1A 3CPZA 4AQGA 3CR3A 2GGFA 5JQGE 4O8SA 3N71A 4JXTA 3EIJA 4ABNA 2ZM8A 3VKGA 2Q9QD 3F2EA 2PZIA 4JEUA 3U3WA 4DNDA 3JCKC 5BMVE 2YNQA 2RD0A 3APDA 3ASDA 2L9QA 3R9AB 4GCNA 4KMOA 2AW6A 5BUZA 4G23A 4AOFA 4EECA 5FWQA 1FEWA 3FFLA 2ONDA 1UN9A 4JL0A 1H0AA 1XGWA 2X6IA 4HKAA 2NW8A 4XI0A 3FB2A 3ZCIA 3O4ZA 5EK2A 4HN9A 2XAQB 4H7XA 1X5BA 2VSOE 2X9WA 4J8EA 3S7DA 3PE3A 3O9XA 2LSIA 1YKHB 3Q4AB 2FI7A 4I1AA 4PNIA 3ZN3A 3CQGB 4CDNA 5FZQA 3FUIA 1QZ2A 4O2AE 5C8YE 3MA9A 2M67A 3TKLB 3C51A 4P0BA 2XCCA 3ZHEB 1HG2A 3E22E 3ZYLA 2LOPA 4CDRA 3CMLA 2VB6A 4B89A 4F7AA 4U04A 3LY9A 4M1PA 5FQ8A 3JC6D 3KV5A 5LG4A 3Q2MA 4EZ4A 2XCBA 3RRWA 4AXPA 5ENNA 2I1KA 5LGTB 4G26A 1ZHCA 3P8CD 5IYZE 4FHJA 2WXLA 3PUAA 4XX5A 5EDSA 5CMWA 4L7TA 2WBLA 2RP4A 4JHJA 3UQ3A 1IYGA 5L3DB 4UI9C 4EIWA 4IHJE 1E7VA 2W62A 5L2LA 2A72A 3RYHE 4L23A 4XAXB 3PDNA 3KV4A 1D0XA 5KMGP 3GN5B 1UX5A 3K8PC 3PUJA 1ELKA 2M63A 2CWYA 3CKDA 3OKQA 3FTUA 4PFOA 3KINB 4EAHA 1OXZA 3JUIA 3AVRA 5JDHA 2J9QA 4IE6A 1H2VC 4E7ZA 2D0UA 1A17A 4QFVA 4AKRB 4PK4A 5ANRA 4AQFA 3URZA 3DBSA 4GB9A 2IOLA 1N54A 2VL8A 3OAWA 1E8YA 1G8XA 3NZPA 2C0LA 4KXKB 4NACA 5JRCA 4AY5A 3UTKA 4I6GA 2JMKA 3PUGA 1L5JA 4CI2B 4AKLA 3CVXA 4PK6A 2VWAA 4JEUB 3CSFA 4IN3B 2K5BB 3EJNA 2FO7A 3ZXSA 5CCMA 2HR2A 3Q5XA 3Q5WA 3ZYKA 4CZZB 3DP7A 3JQ0A 2V8SE 1BR1A 4NURA 4APOA 3IEEA 2FF4A 4GOUA 5LFAA 5FTPA 2DIWA 4AP2A 2L3LA 5FXWA 3GZ1A 5J90A 3NRYA 1Y8MA 3BG0B 4DLOA 2LSGA 3CK7A 4L2LA 3VLEA 3HKEE 5E0OA 4HFVA 3AA1B 1UJKA 4X1IE 2CXFA 1KK7A 2KM4A 4MLPA 3C4ZA 3ZYMA 3S2AA 3SHFA 3HKCE 4HORA 4G25A 3AS4A 3G2SA 1G73A 5LXTE 3TJPA 3LK42 2A5UA 2V4LA 5HWXA 2WAUA 4ANXA 2HH7A 3MA5A 4B8AA 4DI3A 3TGOA 2DHRA 3L54A 4G1TA 3H37A 3FU0A 3N2KE 2AXVA 2W61A 3I0OA 1H2UA 1NZNA 3RRCA 3CHOA 3FTYA 2LSYA 3RRUA 4BFRA 4QXCB 2WXGA 3ZN0B 4C0EA 3N5LA 2E0IA 2UY1A 2X9YA 4FLHA 2XGMA 3W15B 4FU3A 3RYCE 3D9LA 4ANUA 3TG5A 5KCMA 4DI4A 3AAAB 1NA0A 4PS8A 1UG3A 3OYZA 5FXZA 4J8SA 4GA2A 4BSXA 3NQPA 3KEZA 5C1DA 4H63V 1GW6A 4DK5A 1HZ4A 4AKHA 4AV7A 3U66A 3C50A 5JREA 4IGUA 1Y6IA 1WR6A 2YU2A 4H7YA 4H9RC 4IDZA 5HXEA 2C2LA 5BPPA 4XZCA 1KT1A 5ARGA 4FP7A 5T4YA 3MKDA 5DQWA 2XUEA 2VSNA 2PQRA 4EOZB 1IHGA 1OWAA 2R59A 4BY6A 1HE8A 2MHKA 3UX4A 3EDUA 4NRHB 4I43A 2J09A 3WAJA 1MMAA 4X20E 1QUUA 1MMNA 3LBXA 2IF4A 2NP9A 4CI1B 4I1MA 4DPRA 5G04J 3I1AA 3AA7B 5HXCA 2A3DA 4UEMA 3DJBA 5C2YA 4I2WA 4ACLA 3ZLIA 3ZCJA 2KMFA 1HH8A 5BT1A 2DWGA 4J8DA 4OFZA 5AFUL 3U64A 3B13A 4Q96A 4HOTA 3FEXA 4TUUA 3PVLA 1E1HB 3R84B 2D0TA 3TG4A 2DLRA 1MQSA 2WVIA 3ULQA 2EHOA 4YJ2E 2FBNA 3NF1A 1SZ9A 3PNLB 2L8KA 2XGSA 4KBMB 4PDXA 3KV6A 3O1JA 2YQ8A 2H7VC 2W00A 2WM9A 2VSYA 5A7DB 3UUXA 4BJMA 3APFA 3UT7A 2J49A 3OXLA 1FCHA 4H9PC 3KV9A 3MX3A 2KC7A 2I1JA 3SFZA 2V1DB 3PE4A 2JQQA 3B7TA 3MZLB 4CXXA 4AEZC 3SD5A 2XAFB 3ZW3A 4TZ4C 1PAQA 3FH8A 3CVYA 4WWNA 4QWNB 2JPFA 3IEGA 4DJAA 3AU5A 4NQ0A 1OWOA 4BT9A 1FMVA 5CCLA 2XRZA 1HFAA 2LSVA 3MV3B 3MJXA 5GONE 5HXHA 2V5FA 4GMJA 4H9SE 5LP6E 4GYOA 2D5UA 3H3AA 3ENEA 3QWVA 4A1GA 1TJFA 5LGNB 3GWHA 2MTQA 1U5PA 4L2YA 2GRLA 3P2BA 2NSZA 5JDFA 4HVBA 4ZI7E 2UY1B 3BK9A 5FXVA 4E85A 4OYKA 4I2ZA 3L08A 1IQUA 5CB4E 1U4QA 1SHZC 5LP0A 1KNZA 4K0RA 4ERRA 3MK7C 3BQIA 5JHBA 5HXSA 3N9MA 1EZ3A 4KYOB 2CMRA 2LSJA 3LJ3A 1NWMX 2WXNA 1OWLA 5FMNA 2WXPA 4HOUA 2PL2A 4GZ5A 3ZMZB 5BW8C 3SF4A 4TN7B 4YNDA 4ANWA 2AWIA 4CGVA 3ASGA 4BJNA 3VU7H 4NUUA 4XBFB 4PS3A 2JRKA 3R6NA 4TRQA 2KCVA 2X6JA 1D1CA 1HU3A 4UWKA 2NW7A 4G2AA 3AU4A 4EYYR 3KD7A 1SQMA 3MV2B 3FUNA 2DI4A 4UI9J 4N5CA 3N2GE 4O6FA 2XASB 3DTOA 4I43B 4CXYA 3SBTB 2BVMA 2X0LB 4U0ZA 1VRBA 2ZM0A 3K3QC 3LBXB 4MRUA 3G2UA 3KS2A 2LO6A 4CT0A 1EYHA 5KJMA 3AA6B 5FYMA 3MCXA 2JEKA 2XRYA 3OJAA 4H9NC 4CXWA 4ILIA 5JH7E 4J8FA 4K03A 1FIOA 1S35A 4ZS3A 2WXRA 3B7RL 3ONXA 4QX7B 2PM6A 3UPVA 2JJ9A 3OBVE 3PURA 1Z3YA 2XPYA 4TV3A 2HPJA 3ETVA 4RG6A 1HTJF 3A5XA 3BEEA 4L5GA 1Y64B 3ZMUB 4GU5A 2CG2A 5LBQB 4YVOA 2EHOB 5J1GA 5KX5E 2KATA 2P9BA 5DQVA 5LYJE 4AQFC 3FUDA 3IF8B 5L3GB 2DBAA 3FH5A 4IE0A 3RU0A 2ZMAA 4LEUA 4H9QC 3AS8A 3UUXB 2W63A 2CFZA 3QARA 1BR4A 2A2FX 4UWHA 5J2UE 4EZKA 3M65A 2WXQA 4RVBA 2K9AA 5FXXA 3E0ZA 4DBQA 4UXNB 3RKVA 5ADXL 4J2CA 3CX6B 2Y4TA 4G24A 2LT3A 3QC1A 5FQ7A 3NZSA 1WM5A 3LPZA 1LF8A 4F3VA 5AENA 3P7IA 5KDMC 4AKIA 5HQ8A 4GCOA 3S7JA 2Q7FA 4FJYA 1LVKA 5EX0A 4ACKA 2X68A 2BTDA 3ETUA 4XZ4A 2YHEA 2LSKA 1UW4B 3CHMA 1LRZA 3ESLA 2VGXA 2C5KT 3CHPA 2LHNA 4U07A 3K3OA 5LBMA 4KZCA 3LVQE 4WNEA 3ZPOA 3O1HA 2KZTA 4M3OA 4JPSA 2UWJG 4XIFA 2X38A 3FWVA 3LY8A 3PUSA 1H2TC 3RRMB 4XKCA 4GK0E 3CVLA 1N52A 3TL5A 3HYMB 3T8MA 4DMVA 3MKRA 4XKBA 5L3FB 4U8HA 3ZJ2A 2KLQA 3PTRB 2E9XA 4WNKA 1IAPA 2DWKA 5JJ6A 5CA0E 1FVHA 4LERA 4G11A 4ISSA 4J6IA 1X79A 4QKNA 4EQFA 4NUVA 4TX5A 1E8XA 4CGWA 4CQIA 5G55A 5LCYA 4D10C 2WXKA 1TJCA 2KWIB 3RO3A 5LX8A 3CVNA 3KAEA 3KVAA 3O4XE 2I9CA 1SA0E 2KCKA 3P1UA 1YKEB 4G63A 4ZOLE 3FULA 3I4RB 3OTNA 3VKHA 5G2NA 3FU5A 1E8ZA 2XQ0A 1FMWA 3C64A 3HKBE 5LCWC 3ZGQA 5AIJA 3RYFE 2V7KA 1E96B 4ILHB 3U9WA 3HA4A 5TAOA 1LVFA 3L3PA 1TEZA 1ZU2A 4FI5A 4OYSA 1BPOA 4WNDA 1HX8A 4TUYE 1YD8G 2R17C 2CXDA 3AVSA 4JW1A 2XPIA 3KFWX 3CEQA 1UN8A 4WW0A 3VHLA 4JLEA 5ETWA 5T8IA 2RG8A 3S7FA 5FY1A 2ES0A 4PAGA 3VLFA 3QK6A 3SNXA 2G0UA 2XGOA 3GA8A 3EIQC 5EZYE 3QUJA 3CX8B 4F6RC 5L3EB 3MACA 2V7MA 2Z6EA 3UULA 3RC3A 4EPZA 2CLYC 2AVPA 3UT8A 4JA9A 4YHJA 2EHOC 1U3CA 5L3CB 4BAYB 5T3RA 2LHRA 5JR9A 2PBIA 2D2SA 3ZFWA 2X9XA 1WYCA 3MGBA 2QA7A 4Q69A 2VGXB 3QWWA 5LHGB 3ZMTB 5JDLA 2WB2A 4CI3B 4EZHA 3ASHA 3O1IA 3FXEB 3OXGA 4PH4B 4A3TA 2EHOD 3MYVA 3OYXA 2KZTB 4ZI3C 3AB3B 2XPZA 1Z0PA 3AS5A 3FBLA 3FU6A 4GZDA 3FTZA 3L16A 1ZV4X 2XEVA 3V5SA 3PREA 4UF0A 4UVBB 2BDEA 4I1OB 3FUEA 2VASA 2N9DA 2MRIA 3LFMA 4JVSA 1EDUA 2E9XB 2Y48B 4HLEA 4ZI3D 5BV1A 3ZJ1A 3L22A 4H9OC 1Z6TA 2ZU6B 2XQYA 3RIBA 1JWFA 3MJWA 1WY6A 4PUCA 3UFEA 3FTSA 4UQZA 4Y6WA 3NZQA 1ELRA 5FY7A 3LCAA 5A23A 2WXOA 2ZM2A 3Q47B 2QFCA 3QC9A 5LJMA 4GYWA 4GK5E 3D9PA 4WNFA 4G2VA 1E7UA 2DCPA 3SI5A 5F8PA 2VSXE 4EBAA 4LCTA 2WSSV 3HL6A 4X1YE 3U4TA 5JRCB 3ZVVA 2OVBA 3I4GA 3PNTB 4FA6A 3PU3A 4CRWA 5IHYA 1OUVA 4I17A 3QB2A 2Y4UA 3CHSA 1YW0A 4GZ6A 4KVMA 3ML8A 4A55A 5A1LA 4H63H 4UQYA 4LUNU 4QX8B 2BZBA 3DPDA 4P29A 3C4XA 4KVOA 4F1SA 3CLJA 3I9YA 2H3RA 1D0YA 4I50E 3ZC0A 4N3AA 4UVAB 3KBUA 3LDZA 4ANJA 4DBRA 3FUKA 4ILUA 4A56A 1QQEA 5ARFA 3FHNA 4N78D 3UUMA 4WBNE 2NC9A 3I5PA 2MBGA 2LSUA 1EPUA 4UV9B 1ZBPA 3IHVA 4EZJA 4ME2A 2X51A 5JR9B 4FLBA 4AI6A 2XAHB 4KMCA 3RC8A 3TAXA 3GMIA 3C98A 4U63A 4UWLA 1NA3A 4W9RA 2IJGX 5DBKA 3U3IA 3PH0C 4JC8A 1E8WA 3D9KA 4GA1A 3HVEA 4JHKA 2AXUA 4BX8A 1MIVA 3Q5MA 3Q9DA 5JDGA 4AY6A 2N2NA 2K48A 4O4JE 3ML9A 2CM0A 1JWGA 3CQCB 5LA6E 2V0PA 4UF0B 3E08A 3NRXA 5LOVE 3PRZA 4AJWA 4B94A 1B7TA 3CVPA 3FH7A 4AXHA 4UV8B 3IKOB 5DIZA 2X3MA 3BQLA 3KBTA 4DMWA 5JJ7A 2UXXB 1O3XA 3CVRA 3HDXA 3ZEFA 3J9X1 4L9IA 3CKBA 2IAKA 3FTXA 3I9WA 2WWUA 2KWHA 4BX9A 3ZIMA 1YA0A 5LNKA 4I9EA 2FEZA 4DLQA 2IW5B 2ZLYA 5JDNA 4MKTA 4GYSA 2DCFA 1UCUA 4HGAA 3U78A 5E75A 1KT0A 4KP3C 4AM9A 3ZRHA 4XI9A 4RSYA 3FUHA 3RX6A 5FT9A 2WPVA 4BT8A 3RH3A 4EYUA 3UT4A 3ZYQA 4PJJA 2C0SA 3PS6A 4C0MA 1BR2A 3LYAA 1D1BA 1UX4A 3D9IA 3CVWA 2OV8A 3F31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQG B;  3I4R B;  3CQC B; 
#chains in the Genus database with same CATH topology
 2E9X C;  2ETA A;  3LK3 B;  5CBO A;  1WAO 1;  3B95 A;  4HOS A;  3ZPJ A;  3WI3 A;  3GW4 A;  3SZ7 A;  1DNP A;  1JUQ A;  2IFU A;  3GYZ A;  5D2M C;  3UXG A;  3FHE A;  3S7B A;  2XTL A;  5HS0 A;  3JAF A;  1ELW A;  1XNF A;  2AXZ A;  4FC8 A;  3AEB A;  3ANW A;  4U95 D;  5FQ6 A;  2CLY B;  2DL1 A;  4HFB A;  4URK A;  2XEE A;  3RK6 A;  5LCW J;  4PK5 A;  4JZY A;  2OVF A;  4U8Y D;  5G05 C;  1N4P A;  4WWP A;  2E9X D;  3R7R A;  5L4E A;  4WWO A;  2BS4 A;  4MHC A;  4G8K A;  2HN2 A;  3CV0 A;  5JVD E;  4U2Y A;  4GYR A;  3RKO A;  3PZD A;  5FY0 A;  3ZKJ A;  5KJN A;  4JI1 T;  5L47 A;  3EHZ A;  2ODU A;  3R9M A;  1HF8 A;  5AQO B;  3TWX A;  4ILG A;  4O2B E;  3LXU X;  2WQ7 A;  1IJ6 A;  2IU1 A;  4CEM A;  4P0A A;  2EQX A;  2X66 A;  3I0Q A;  4I6E A;  3LK2 B;  4QXH B;  3IHY A;  3LEW A;  2YN6 A;  2V7I A;  2PJQ A;  4J0U A;  5FQ4 A;  3R7Q A;  5L3B B;  2UXC T;  4JA7 A;  3C4W A;  4U72 A;  3O48 A;  3PU8 A;  1W0B A;  2WB5 A;  5BXU A;  3L8R A;  2VYI A;  3N9N A;  2IQC A;  2IY0 C;  3UU8 A;  2JMH A;  4DR1 T;  4GTM A;  4HFG A;  4ZHB A;  3C98 B;  1W3B A;  4Q25 A;  3HIZ A;  1WYB A;  2Y6X A;  2MOZ A;  4K0U A;  3ABM E;  2QGS A;  2WXF A;  2NTY A;  3PEU B;  1N11 A;  5KNH D;  3CX7 B;  4BSZ B;  1HO8 A;  2PG8 A;  3HVE B;  1JCQ A;  3FUF A;  3RRN B;  2LXL A;  2XQ7 A;  3HRA A;  1WG0 A;  3QDN A;  4LFC T;  2JQH A;  3FDH A;  4EHM A;  4E6H A;  4B6X A;  3B7U X;  4C90 A;  1OCR E;  3A8Y C;  4IIJ E;  2B1E A;  4IE7 A;  4YXD A;  3FEY A;  5AAO A;  2BUG A;  3PDY A;  4BA9 A;  1I94 T;  4EV6 A;  3CGH A;  4B93 B;  3TWU A;  4YLH A;  3LY7 A;  2CHZ A;  3CVQ A;  1IJ5 A;  2L6J A;  3JC6 C;  1SE7 A;  5LMU T;  3G2W A;  1OWN A;  3T5V A;  3BQK A;  3KDS E;  5EK4 A;  5JR9 C;  5E76 A;  1QBQ A;  1US7 B;  3F57 A;  3ZEF B;  4YSX A;  3TWS A;  5A6C A;  1OED B;  3ZNG A;  1J5E T;  3VTY A;  2K24 A;  1UGO A;  2H7O A;  2WXI A;  4A97 A;  3ASF A;  3EHN A;  4UVC B;  5LHH B;  5ABH A;  1MND A;  4OK0 A;  4YDO A;  3D9M A;  3UTM A;  5ABF B;  3CQX C;  3EVY A;  3SFX A;  2MOW A;  3EUV A;  4YSZ A;  4EBA G;  2OEV A;  3BUA A;  3LJN A;  3MEK A;  3SBS A;  4DVD A;  1S94 A;  1OWM A;  5AYW D;  3CVU A;  3A7M A;  3HKD E;  2J8S D;  4QXB B;  3SGH A;  5AJD A;  2E5L T;  4TNV A;  4GML A;  3FUJ A;  2CG3 A;  3IXE A;  4V1A v;  4DX2 A;  1HXI A;  4FUL A;  5JDQ A;  3DSX A;  2LXM A;  5D0Q D;  5JHA A;  4HEA A;  3UUN A;  1MX6 A;  3UUB A;  4IST A;  1HG5 A;  5EIL A;  2CEA A;  4O4H E;  5HWY A;  5AQB A;  3ONJ A;  4GTQ A;  4CDM A;  3CHQ A;  2VKJ A;  4P1N A;  2EIN E;  4GIW A;  2NXP A;  2A4Z A;  2ZXW E;  3QKY A;  1LKX A;  4C9B B;  5ABE A;  2Q9Q A;  5AQP B;  4Y6C A;  1HNZ T;  3L09 A;  4KZ0 A;  4ZHQ E;  2YU1 A;  5HYA A;  4AIF A;  4N39 A;  3AA0 B;  3N2O A;  3N9O A;  2YHC A;  4ZI2 C;  2J4B A;  1WDY A;  4WBO A;  4ZZB A;  1PC2 A;  3ANW B;  4B3R T;  4O4L E;  1H19 A;  2EIJ E;  2VJ8 A;  3L6A A;  4U0S A;  4U96 D;  1NEN A;  5LB7 B;  3RO2 A;  1IBM T;  2RFM A;  1AWC B;  5EKQ D;  3C3Q A;  2GK9 A;  2I59 A;  5DJQ C;  5AQG B;  3NWI A;  3N9P A;  1D0Z A;  4CZ2 D;  3TXN A;  5JJT A;  3FBZ A;  1XMO T;  1OT8 A;  1CUN A;  3PUQ A;  3ZC1 A;  4GPM A;  1INZ A;  4CT4 A;  2VQF T;  4LRZ A;  1MIY A;  3HHM A;  3KVB A;  4MLK A;  4PJM A;  2WXH A;  4HXI A;  2WMO A;  3IBP A;  3IV0 A;  4DR3 T;  3TWV A;  3EAM A;  4UEL A;  3J7Y q;  2PM7 A;  2ETB A;  5ENS D;  2P58 C;  4ZI2 D;  2XPK A;  2LKH A;  2LOS A;  2XAJ B;  5LGU B;  2P9N G;  5FP3 A;  5JDM A;  4C91 A;  3RAU A;  3Q7A A;  2RA1 A;  2DNX A;  2J07 A;  4JHR A;  1Z3X A;  1S70 B;  3CIA A;  3ESK A;  5CEC B;  3VTX A;  3HR0 A;  3LJC A;  4EZL A;  5HXR A;  2LE8 A;  1KZO A;  2J4D A;  3T8O A;  3G2T A;  4PJL A;  4EB6 E;  3UMV A;  2NYJ A;  4U8V D;  1N33 T;  4RG9 A;  3SS1 A;  5H6Q B;  3VLD A;  1QNF A;  2FJE A;  5FL1 A;  4DRX E;  1BD8 A;  1KLX A;  4QH4 A;  2W0G A;  5CGM A;  2CE7 A;  1SZA A;  1KZP A;  3FZH B;  5CA1 E;  2XS8 A;  4E7S A;  5DAB A;  3HXD A;  3PE0 A;  2LAH A;  2ACX A;  4YJ3 E;  3LG7 A;  3G2V A;  2PFV A;  4I9C A;  1WRD A;  3WAK A;  5FL0 A;  3C5R A;  1WLX A;  2XQ5 A;  4GYY A;  4JUY A;  5EX3 A;  1IBK T;  2LUH A;  4GKJ T;  2XSB A;  1TYQ G;  2JLB A;  5CMY A;  4FAD A;  4FJZ A;  2F8X K;  3B57 A;  4DO0 A;  2CFU A;  3FTW A;  3N9L A;  1YYH A;  4GAA A;  3ZMV B;  5AQ7 A;  2R5S A;  2KT9 A;  1OCC E;  4PW8 A;  3D3M A;  5LHI B;  4B3T T;  2K3W A;  4JEH A;  2XQ9 A;  2IC9 A;  3HXB A;  3ZN1 B;  2LNI A;  4HTE A;  4ANV A;  3MXZ A;  5BV0 A;  2J08 A;  5BNW A;  5KJL A;  1UJJ A;  2HO1 A;  4NXM T;  4O4I E;  2LJL A;  2VK9 A;  3JQ1 A;  3Q5E A;  3D9O A;  4YSY A;  3PUY F;  4IUL A;  4CCA A;  2VQ2 A;  4MAL A;  2KND A;  1JPL A;  3EUH A;  4ATG A;  5HEJ A;  1HS6 A;  2P9I G;  2BVL A;  1KEY A;  1OWP A;  4GZ3 A;  2NWB A;  3ZXP A;  1TNO A;  5KXJ A;  3MKQ A;  4ZS2 A;  3OXF A;  4GTO A;  5D0O D;  5EK3 A;  2QY7 A;  5H6R B;  5HKP A;  4I6J A;  4I4T E;  4I55 E;  4PFP A;  3AE8 A;  3HI2 A;  1MIW A;  4N3C A;  1KNR A;  2FUL A;  3LKU A;  4IT4 A;  2WDQ A;  3SOL A;  4DV3 T;  1K1B A;  5HAX A;  4OAU C;  5AQJ B;  4OYJ A;  5EYL A;  3EDV A;  2VTB A;  4IYP A;  2EIM E;  3QJZ A;  4OHF A;  4DR2 T;  4ASK A;  2XM2 A;  4LSZ E;  3K3N A;  3VR8 A;  4HI9 A;  4Z8X A;  2B76 A;  5CHE E;  4EEB A;  1H6K A;  4A1S A;  1TN7 A;  2VL0 A;  4BTB A;  2V26 A;  2PQN A;  2DYR E;  4KT6 B;  4UQX A;  5BXO A;  4OVU A;  3RHW A;  2Q9Q B;  4NXN T;  1XMQ T;  4UIG A;  2J47 A;  1MMD A;  4AVX A;  2V6Y A;  1VCT A;  2BS2 A;  4QHO A;  4MS6 A;  4BTA A;  4WYV A;  2OA5 A;  2OOE A;  4GZC A;  3SRZ A;  5J08 A;  3FXD B;  3FY4 A;  5FZR A;  4A3V A;  4IL9 A;  3EHM A;  2UUA T;  3QK0 A;  2YK0 A;  2BED A;  2NW9 A;  3RYI E;  4NIQ A;  2UU9 T;  3V5U A;  5AJL A;  3DSV A;  3L13 A;  3KEA A;  1QSD A;  2XHE A;  4EXT A;  5M4Y A;  1V9D A;  4BER A;  4WNG A;  2KZ7 B;  4DID B;  5M72 A;  3RSE G;  3ONL A;  3SFE A;  3QOU A;  1T98 A;  4X1K E;  4Q94 A;  4XE0 A;  3CHR A;  1BR0 A;  3CKC A;  3CVV A;  2NTX A;  1MHQ A;  2NOX A;  3QNK A;  4UI9 K;  1D1A A;  3UT5 E;  4PS7 A;  4JBW F;  4L0R A;  5ABG A;  2ZGG A;  3MZK B;  1DVP A;  2X6H A;  3E32 A;  2F0Y A;  2KCL A;  2C5J A;  5B1A E;  2X6F A;  4N2S A;  4JI4 T;  3PV0 F;  2GW1 A;  2BF0 X;  3AG3 E;  2WXM A;  2CHW A;  3ONK A;  5FNV E;  3CWZ B;  3D9N A;  3AAE B;  4KHP T;  3NBN B;  4PJN A;  4X66 T;  5G05 J;  2C0M A;  2WMN A;  1S0P A;  2XAG B;  2YEV C;  2L6B A;  2CCQ A;  3AAI A;  1W09 A;  4FHK A;  2LM9 A;  4TV9 E;  1E90 A;  2HYZ A;  1VOM A;  5LG3 A;  2C5I T;  2YKS A;  3PUK A;  2SPC A;  1KF6 A;  4KUM B;  3Q49 B;  3BU8 A;  3V31 A;  1NAF A;  5J2T E;  5FVK A;  3C3O A;  4WAF A;  2ION A;  2XQ4 A;  3ZMS B;  2DYS E;  4UWF A;  1OXJ A;  1N34 T;  2Y8D A;  4HFI A;  5J0Z A;  2KIN B;  4N3B A;  3CST A;  1H7C A;  2XZE A;  2UXN B;  2HN1 A;  4IE4 A;  2P9K G;  4COF A;  4MFR A;  3N9Q A;  5AQF B;  4JEH B;  4U74 A;  4HWH A;  4HWF A;  1N95 A;  2H6G A;  2V7J A;  2LAI A;  3LS8 A;  3UKU G;  4ADZ A;  4UWG A;  1HS7 A;  1VDY A;  2ILR A;  2DWZ A;  1XDP A;  3RI5 A;  2HPL A;  3TLV A;  3SWH A;  3T1Y T;  1MNE A;  3FP3 A;  3FZK B;  3Q15 A;  3L17 A;  3AXJ A;  4LF7 T;  3CK8 A;  4QH5 A;  2YIN A;  3NBX X;  2PTF A;  5AQM B;  2WQH A;  3FU3 A;  5ANL A;  5HI7 A;  2L0T B;  4GTS A;  2Y3A A;  4F53 A;  3AE7 A;  3RPU A;  1ZKE A;  1NP7 A;  3TWW A;  1UUR A;  2HM8 A;  3MKQ B;  4YVQ C;  4BWR A;  4V3I A;  3T5X A;  4OVV A;  2OCC E;  5HCM A;  5FJY A;  3L39 A;  4ZZC A;  2VGY A;  4U0U A;  4B0Z A;  1IZN B;  2MAW A;  5FZS A;  3W9G A;  1E7P A;  2ETC A;  3Q75 A;  2WQ6 A;  4X65 T;  2E2E A;  3IBE A;  3QAQ A;  3H3M A;  1IQR A;  1P5Q A;  2X6K A;  4B8C B;  1AJ3 A;  3IA3 A;  3QWP A;  4TUM A;  4U2Z A;  1FJG T;  2VTB B;  1HCI A;  4IRU A;  2BBH A;  3D9J A;  3GZ2 A;  4MBQ A;  3PEV B;  2CWO A;  3ZT6 A;  3FTV A;  4AKG A;  2MYS A;  3ZHE A;  2CHX A;  2CXL A;  1U3D A;  4JI5 T;  3K9I A;  5F3J A;  3APC A;  3FUM A;  1FPP A;  2IOS A;  5HRY A;  3PZ1 A;  3SFY A;  1W0A A;  3NZU A;  3I3N A;  4FJO A;  3EU5 A;  4WUY A;  1N4R A;  2R03 A;  3EDT B;  3BG1 B;  3DXK G;  2VKD A;  2M6B A;  2LLY A;  3AE9 A;  1MMG A;  2V7L A;  5LJN A;  2L9B A;  4YFS A;  2ODV A;  2HE0 A;  4XEI G;  1K1A A;  3B7S A;  3UKR G;  3WXX A;  5KNG A;  5AQQ B;  4HOQ A;  4LF6 T;  4NIK A;  3E4B A;  3GZS A;  5KJK A;  2V6Y B;  4ZXL A;  4GPK A;  4X5T A;  4APF A;  4KBQ A;  2P9U G;  4WZX A;  3RJV A;  2ACZ A;  4IE5 A;  2IC6 A;  2QYW A;  2BKG A;  3P4P A;  4DR4 T;  2MYO A;  2KXP B;  3D0T A;  1ZEE A;  2CA5 A;  4HE8 A;  1ZP0 A;  1N94 A;  4P09 A;  2R02 A;  3PJA A;  2VKO A;  3UM0 A;  5LOZ A;  1M62 A;  2LEH A;  3GN5 A;  3OVU A;  2XHE B;  4N2Q A;  3CK9 A;  4JI0 T;  2J1D G;  3PUX F;  5G04 C;  1B89 A;  3S4U A;  3ZST A;  1LTX A;  4L1B A;  2GRM A;  3J5Q B;  2WXJ A;  3PUV F;  2FUP A;  3IHR A;  4HS2 A;  3TXM A;  2UUB T;  4DX7 D;  2N1G A;  2YDR A;  1EF1 C;  4GA0 A;  5FIN A;  3LVR E;  2X67 A;  1FVF A;  3E30 A;  1MYO A;  2VKH A;  2I2O A;  2Q9Q C;  2E8I A;  2VGE A;  5AQN B;  3UIN C;  4R7L A;  5CRV A;  3E34 A;  2L0I A;  3B5M A;  2I6H A;  3P4R A;  4TV8 E;  1TNU A;  3JYS A;  5B1B E;  2X9H A;  3Q78 A;  3DST A;  1PY1 A;  3CPZ A;  4AQG A;  3CR3 A;  2GGF A;  5JQG E;  4O8S A;  3N71 A;  4JXT A;  3EIJ A;  4ABN A;  3ISM C;  2ZM8 A;  5AQV B;  3VKG A;  1SVX A;  2Q9Q D;  3F2E A;  1SUM B;  2PZI A;  4JEU A;  5ENT D;  3U3W A;  2FO1 E;  4UR9 A;  4DND A;  3JCK C;  4LFA T;  5BMV E;  1NL4 A;  2RD0 A;  2YNQ A;  3APD A;  4GTV A;  3ASD A;  4HNA D;  2WU5 A;  5ENP D;  2L9Q A;  3R9A B;  4GCN A;  4KMO A;  2AW6 A;  3E33 A;  5BUZ A;  4G23 A;  4AOF A;  4EEC A;  5FWQ A;  4DX1 A;  4CYM D;  1FEW A;  2IEJ A;  3FFL A;  2OND A;  1UN9 A;  1V54 E;  1H0A A;  1XGW A;  4JL0 A;  2X6I A;  4HKA A;  2NW8 A;  4XI0 A;  3FB2 A;  3ZCI A;  2F37 A;  4DV0 T;  3O4Z A;  3AED A;  5EK2 A;  3AEG A;  4HN9 A;  2XAQ B;  4H7X A;  4LNG A;  1X5B A;  2VSO E;  2Y1L E;  2D9D A;  3AXJ B;  4Z91 A;  2X9W A;  2IO2 C;  4J8E A;  3S7D A;  3DSW A;  3PE3 A;  3RQU A;  3O9X A;  2M6I A;  1J5W A;  2LSI A;  1YKH B;  4ILB A;  3Q4A B;  2FI7 A;  4I1A A;  4PNI A;  3ZN3 A;  3HG0 D;  3FZM B;  3HXF A;  3CQG B;  2WS3 A;  4CDN A;  5FZQ A;  3FUI A;  1QZ2 A;  4O2A E;  5C8Y E;  4YY3 T;  3MA9 A;  3EHR A;  4YDW A;  2QYU A;  3LSV A;  2M67 A;  2FJD A;  3TKL B;  3C51 A;  4IDN A;  4P0B A;  1TNB A;  2XCC A;  3ZHE B;  1HG2 A;  3SO8 A;  3ABV A;  3E22 E;  3ZYL A;  2EIK E;  2LOP A;  4CDR A;  3CML A;  3EU9 A;  1XWM A;  2VB6 A;  4B89 A;  4F7A A;  4U04 A;  3NVO A;  3LY9 A;  4A5X A;  3ZSS A;  3QB5 K;  3QNU A;  5CED B;  4M1P A;  5FQ8 A;  1SA5 A;  2YDS A;  5LMN T;  3JC6 D;  3ABK E;  1XNQ T;  3C72 A;  3DEO A;  3KV5 A;  5LG4 A;  1HNW T;  4I0U A;  3Q2M A;  4EZ4 A;  3RGL A;  4HWC A;  1TN6 A;  2XCB A;  4LFB T;  3RRW A;  4AXP A;  5ENN A;  2DZN A;  3P4S A;  2I1K A;  5LGT B;  4G26 A;  1ZHC A;  3P8C D;  5IYZ E;  4FHJ A;  2WXL A;  3PUA A;  4XX5 A;  5EDS A;  5CMW A;  4AQY T;  4L7T A;  2WBL A;  1OCO E;  2RP4 A;  4JHJ A;  3UQ3 A;  1IYG A;  5L3D B;  4UI9 C;  3UM3 A;  4EIW A;  4IRE A;  4IHJ E;  1E7V A;  4BET A;  3UM2 A;  2W62 A;  5L2L A;  2A72 A;  4DR7 T;  3P50 A;  3RYH E;  4XAX B;  4L23 A;  2R05 A;  3PDN A;  3KV4 A;  1D0X A;  5KMG P;  4X64 T;  3GN5 B;  1UX5 A;  3K8P C;  3PUJ A;  1ELK A;  2M63 A;  2CWY A;  3CKD A;  3OKQ A;  3FTU A;  4PFO A;  3KIN B;  4EAH A;  3JAD A;  1OXZ A;  3JUI A;  3AVR A;  5JDH A;  2J9Q A;  4IE6 A;  1VCS A;  4DUZ T;  1H2V C;  4E7Z A;  5L4H A;  5ENO D;  3V30 A;  3RQW A;  3F6Q A;  2V4H C;  2D0U A;  1A17 A;  4QFV A;  4AKR B;  4PK4 A;  5ANR A;  4LMK A;  4AQF A;  3URZ A;  3DBS A;  4GB9 A;  2IOL A;  3KSL A;  3RIF A;  1N54 A;  2VL8 A;  2RPA A;  1E8Y A;  3OAW A;  1NFI E;  1G8X A;  3NZP A;  2A5E A;  1N4Q A;  2C0L A;  4KXK B;  4NAC A;  5JRC A;  2KXP C;  4AY5 A;  4LMJ A;  4LML A;  3UTK A;  4I6G A;  5C2T A;  2JMK A;  3PUG A;  1L5J A;  4CI2 B;  1OY3 D;  4AKL A;  4F1P A;  2H6F A;  3OTO T;  3CVX A;  4PK6 A;  2VWA A;  4JEU B;  3CSF A;  4IN3 B;  4ZEY A;  2K5B B;  3ONL C;  3EJN A;  2FO7 A;  3ZXS A;  5CCM A;  2HR2 A;  3Q5X A;  2BKK B;  3Q5W A;  3ZYK A;  4CZZ B;  1SW6 A;  3DP7 A;  3JQ0 A;  2V8S E;  5FIO A;  1BR1 A;  4NUR A;  4APO A;  3IEE A;  2FF4 A;  4HFH A;  4GOU A;  4J7W A;  5LFA A;  5FTP A;  2BBJ A;  2DIW A;  4AP2 A;  2L3L A;  4KHZ F;  5FXW A;  3GZ1 A;  5J90 A;  3NRY A;  1Y8M A;  3BG0 B;  4DLO A;  2LSG A;  3CK7 A;  2WY2 A;  4L2L A;  3VLE A;  3HKE E;  5E0O A;  4EGW A;  4HFV A;  3AA1 B;  1UJK A;  5CER B;  4X1I E;  2CXF A;  1KK7 A;  2KM4 A;  1IXV A;  4MLP A;  3C4Z A;  3ZYM A;  4DV2 T;  2AXD S;  1LD8 A;  3S2A A;  3SHF A;  3HKC E;  4HOR A;  4G25 A;  3AS4 A;  3G2S A;  1G73 A;  5LXT E;  3TJP A;  3LK4 2;  2GRP B;  4GMR A;  2A5U A;  2V4L A;  5HWX A;  2WAU A;  4ANX A;  2HH7 A;  2QRX A;  3MA5 A;  4B8A A;  4DI3 A;  3TGO A;  2DHR A;  3L54 A;  4U33 A;  4G1T A;  3NKZ A;  3H37 A;  4QQI A;  3FU0 A;  4IDQ A;  3N2K E;  2AXV A;  2W61 A;  1KNP A;  2P9P G;  3I0O A;  1H2U A;  4RLY A;  1NZN A;  3RRC A;  3CHO A;  3FTY A;  4K5C A;  5KWD A;  2LSY A;  4JI3 T;  1SA4 A;  3RRU A;  1ZB1 A;  4BFR A;  3ZT5 A;  4QXC B;  2NR4 A;  5AQA A;  2WXG A;  3ZN0 B;  4AIS A;  4C0E A;  2BG9 A;  3N5L A;  1FT1 A;  2E0I A;  2UY1 A;  2X9Y A;  4FLH A;  2IIU A;  2J4G A;  4G8L A;  2VQE T;  2XGM A;  3W15 B;  4FU3 A;  4IDP A;  3RYC E;  3D9L A;  4ANU A;  3AEC A;  2W2U A;  3TG5 A;  2V5D A;  5KCM A;  4AIU A;  4DI4 A;  3AAA B;  1NA0 A;  5CEA A;  3AEF A;  4PS8 A;  5AQU B;  1UG3 A;  3OYZ A;  5FXZ A;  4J8S A;  4GA2 A;  4BSX A;  3NQP A;  1S64 A;  3KEZ A;  5C1D A;  4U31 A;  4H63 V;  3EAB A;  3RKG A;  1GW6 A;  4KI0 F;  4DK5 A;  1HZ4 A;  4AKH A;  4AV7 A;  4LF4 T;  3U66 A;  2V5C A;  1QYM A;  3C50 A;  5JRE A;  4IGU A;  1UK5 A;  1Y6I A;  1WR6 A;  2YU2 A;  4H7Y A;  4H9R C;  4IDZ A;  5HXE A;  4K5A B;  2C2L A;  2XQ8 A;  3AE1 A;  5BPP A;  4XZC A;  3NB2 A;  2CBJ A;  5AQS B;  1KT1 A;  5ARG A;  4FP7 A;  5T4Y A;  3AE6 A;  3MKD A;  2OEW A;  5DQW A;  2XUE A;  4NPP A;  3ULY A;  3AG1 E;  2VSN A;  2PQR A;  3V79 K;  4DX6 D;  2JQ9 A;  4HWI B;  1NEK A;  4EOZ B;  1IHG A;  2W67 A;  2XM1 A;  1OWA A;  4JV5 T;  2R59 A;  4HQD A;  4BY6 A;  1HE8 A;  2XQ3 A;  2MHK A;  3UX4 A;  3EDU A;  4NRH B;  2HHH T;  4I43 A;  2J09 A;  3WAJ A;  1MMA A;  4X20 E;  1QUU A;  1MMN A;  3LBX A;  2IO3 C;  2IF4 A;  2NP9 A;  4CI1 B;  1D8E A;  2BKO A;  4I1M A;  4DPR A;  5G04 J;  5JA4 D;  4DV1 T;  3I1A A;  3AA7 B;  5HXC A;  1T7S A;  2A3D A;  4UEM A;  3DJB A;  5C2Y A;  4I2W A;  1A5E A;  4BES A;  4ACL A;  4LG6 A;  3ZLI A;  3ZCJ A;  2KMF A;  3PUZ F;  5IUX A;  1HH8 A;  3TWR A;  5BT1 A;  2DZO A;  2DWG A;  2XQA A;  4J8D A;  4OFZ A;  5AFU L;  3U64 A;  3B13 A;  5AQH B;  4Q96 A;  5HEG A;  4HOT A;  2WQY A;  3FEX A;  3NOC D;  4TUU A;  3PVL A;  1E1H B;  3R84 B;  2D0T A;  3TG4 A;  2DLR A;  4N5Q A;  4HB5 A;  2Y69 E;  1MQS A;  3ASO E;  2WVI A;  3ULQ A;  2EHO A;  4YJ2 E;  3UU4 A;  2FBN A;  3NF1 A;  2OLT A;  1SZ9 A;  4TXQ A;  3PNL B;  3V2O A;  3UQ7 A;  1WFD A;  2L8K A;  2XGS A;  4KBM B;  4PDX A;  3KV6 A;  3M3Z B;  3O1J A;  1ZOY A;  2YQ8 A;  2H7V C;  2W00 A;  2WM9 A;  5AQI B;  1Y01 A;  4LNU D;  2VSY A;  5A7D B;  2AE9 A;  1BLX B;  3UUX A;  4GTT A;  1MZC A;  4BJM A;  3RIA A;  3APF A;  4HRL A;  3UT7 A;  2J49 A;  1BU9 A;  3OXL A;  5AQR B;  3DXM G;  2RKK A;  1FCH A;  4H9P C;  3KV9 A;  3JUE A;  3MX3 A;  2KC7 A;  2I1J A;  3AJI A;  1T72 A;  3SFZ A;  2V1D B;  3PE4 A;  2JQQ A;  3B7T A;  4UUC A;  3MZL B;  3K1S A;  4CXX A;  3Q5D A;  4AEZ C;  3SD5 A;  2XAF B;  1N36 T;  3B7B A;  3T8K A;  3ZW3 A;  2IML A;  2E2A A;  4TZ4 C;  1PAQ A;  3FH8 A;  3CVY A;  4WWN A;  4IL4 A;  5AQT B;  4QWN B;  4U3C A;  2JPF A;  4DV4 T;  4JYA T;  1H6O A;  2B0O E;  1OWO A;  3AU5 A;  1FMV A;  2WDR A;  3IEG A;  1HFA A;  4NQ0 A;  4BT9 A;  2LSV A;  5CCL A;  2XRZ A;  3MV3 B;  3MJX A;  1H6P A;  2FJA A;  4O1P A;  5CRU A;  2H88 A;  4JB8 P;  5GON E;  5HXH A;  2V5F A;  4GMJ A;  3CIR A;  4H9S E;  5LP6 E;  2FJB A;  4GYO A;  2D5U A;  3H3A A;  3ENE A;  3QWV A;  4A1G A;  1TJF A;  1IBL T;  5LGN B;  3GWH A;  2MTQ A;  4DJA A;  4MBG A;  1U5P A;  4L2Y A;  2BG9 B;  2GRL A;  4K0K T;  3P2B A;  2NSZ A;  5JDF A;  4HVB A;  4ZI7 E;  2UY1 B;  3BK9 A;  5FXV A;  2IUB A;  4E85 A;  4OYK A;  4I2Z A;  4TXR A;  2JQK A;  1IQU A;  2GRR B;  3L08 A;  4TWH A;  5CB4 E;  1YCS B;  1U4Q A;  1SHZ C;  5LP0 A;  3DEP A;  3UFG A;  1O5M A;  1KNZ A;  3P4W A;  4GTP A;  4Z68 A;  4K0R A;  4ERR A;  3MK7 C;  3BQI A;  5JHB A;  5HXS A;  3N9M A;  1EZ3 A;  4KYO B;  3E37 A;  2CMR A;  1WCR A;  1OED A;  2LSJ A;  1MX2 A;  3LJ3 A;  1NWM X;  1XDO A;  4L9P A;  2WXN A;  2WU2 A;  3P4Q A;  1OWL A;  5FMN A;  2WXP A;  1DU2 A;  4HOU A;  2PL2 A;  4GZ5 A;  3ZMZ B;  5BW8 C;  3SF4 A;  4A98 A;  3TLT A;  4K5B A;  4TN7 B;  4YND A;  3DSU A;  4ANW A;  2AWI A;  4CGV A;  3ASG A;  4CN6 A;  4BJN A;  3VU7 H;  4NUU A;  4XBF B;  4PS3 A;  2JRK A;  3R6N A;  4TRQ A;  4YT0 A;  2KCV A;  2X6J A;  1D1C A;  1HU3 A;  4UWK A;  2NW7 A;  4G2A A;  3AU4 A;  4EYY R;  3KD7 A;  1SQM A;  3MV2 B;  3FUN A;  2DI4 A;  4UI9 J;  4N5C A;  3N2G E;  2CHO A;  4O6F A;  2XAS B;  3DTO A;  5CFB A;  4I43 B;  4CXY A;  3SBT B;  2BVM A;  2X0L B;  2GRN B;  1VRB A;  4U0Z A;  2IHR 1;  2ZM0 A;  3K3Q C;  3AAA C;  4DX5 D;  3LBX B;  4HI8 A;  4MRU A;  2P9L G;  4JI6 T;  3G2U A;  5AQL B;  3KS2 A;  2LO6 A;  4CT0 A;  1EYH A;  2BG9 E;  5KJM A;  3AA6 B;  5FYM A;  3MCX A;  2JEK A;  3VR9 A;  2XRY A;  3OJA A;  4H9N C;  4CXW A;  4ILI A;  5JH7 E;  3RF1 A;  4J8F A;  4K03 A;  1FIO A;  1S35 A;  3JXJ A;  4DUI A;  4YDY A;  4ZS3 A;  2WXR A;  5B3S E;  3B7R L;  3ONX A;  4QX7 B;  2PM6 A;  3UPV A;  2YOE A;  2JJ9 A;  3OBV E;  3PUR A;  2V8S V;  1Z3Y A;  2XPY A;  3V2X A;  4TV3 A;  4OAV B;  2HPJ A;  3ETV A;  4LF5 T;  1HTJ F;  4RG6 A;  3A5X A;  3BEE A;  4L5G A;  4U7Y A;  1Y64 B;  3ZMU B;  4GU5 A;  2CG2 A;  2ZIS A;  3QB5 A;  2OV9 A;  2LRL A;  2JAB A;  5LBQ B;  4YVO A;  2EHO B;  5J1G A;  1TN8 A;  5KX5 E;  2KAT A;  4BEP A;  2P9B A;  4QH1 A;  5DQV A;  5LYJ E;  4DR5 T;  4AQF C;  3FUD A;  2X0Y A;  2CRB A;  3IF8 B;  5L3G B;  2DBA A;  4TWD A;  4YTM A;  1X81 A;  4TXP A;  3FH5 A;  4IE0 A;  3RU0 A;  2ZMA A;  4LEU A;  5FVL A;  4H9Q C;  3AS8 A;  4HWD A;  3UUX B;  2W63 A;  2CFZ A;  1YQ4 A;  3QAR A;  1N0Q A;  1BR4 A;  2A2F X;  4UWH A;  3BQO A;  2LM2 A;  5J2U E;  3M65 A;  2XEH A;  4EZK A;  2WXQ A;  4LNB A;  3NOG D;  4RVB A;  2K9A A;  3AG2 E;  2X0H A;  5FXX A;  3E0Z A;  2LKG A;  2WZI A;  2VUR A;  4UXN B;  4DBQ A;  3RKV A;  5ADX L;  1XZY A;  4J2C A;  3CX6 B;  3RIU A;  2Y4T A;  3ASN E;  4G24 A;  2RFA A;  2LT3 A;  3QC1 A;  4TNW A;  5FQ7 A;  3NZS A;  5CJ5 A;  1V55 E;  1WM5 A;  3LPZ A;  1LF8 A;  1HNX T;  4F3V A;  3P7I A;  5AEN A;  3NAW A;  5KDM C;  2H89 A;  4AKI A;  3VRA A;  2V5Q C;  5HQ8 A;  3TWQ A;  4LF9 T;  4GCO A;  4HFC A;  1Z5S C;  3S7J A;  2Q7F A;  3UU3 A;  4FJY A;  1LVK A;  5EX0 A;  1N32 T;  4ACK A;  2X68 A;  2BTD A;  3ETU A;  4XZ4 A;  1R8I A;  2YHE A;  2LSK A;  5AAR A;  1UW4 B;  3CHM A;  1LRZ A;  3ESL A;  2VGX A;  2C5K T;  3ZT7 A;  2KBX A;  3CHP A;  2LHN A;  4U07 A;  2FBW A;  1UUS A;  3K3O A;  3QOF A;  5LBM A;  4DR6 T;  4KZC A;  3LVQ E;  4WNE A;  3ZPO A;  4U7E B;  3O1H A;  2KZT A;  4M3O A;  4JPS A;  2UWJ G;  5CBN A;  4DV7 T;  4XIF A;  2X38 A;  3FWV A;  5AN8 A;  3LY8 A;  3PUS A;  4HBD A;  1O1S A;  1E2A A;  1H2T C;  4XKC A;  3RRM B;  4GK0 E;  3CVL A;  1N52 A;  3SQV A;  3TL5 A;  1GQE A;  1DC2 A;  4JI2 T;  3HYM B;  3T8M A;  4DMV A;  3MKR A;  4XKB A;  3G06 A;  5L3F B;  4U8H A;  3ZJ2 A;  2KLQ A;  2XSA A;  3PTR B;  5KBA A;  2E9X A;  4WNK A;  1IAP A;  4YDE A;  2DWK A;  5JJ6 A;  5CA0 E;  1FVH A;  2P2C P;  3PUW F;  3X2Q E;  4LER A;  4G11 A;  3DSS A;  2BG9 C;  4ILA A;  4ISS A;  4J6I A;  1X79 A;  4QKN A;  3AE3 A;  4EQF A;  4NUV A;  3LDQ B;  4TX5 A;  1E8X A;  1IHB A;  4CGW A;  4CQI A;  5G55 A;  5LCY A;  4D10 C;  2WXK A;  1TJC A;  2KWI B;  3RO3 A;  1TNY A;  4DUY T;  2MPK A;  5LX8 A;  3CVN A;  3JAE A;  3KVA A;  3KAE A;  4GTR A;  5HEU A;  2AJA A;  3O4X E;  1Q2Z A;  2I9C A;  1SA0 E;  2KCK A;  3P1U A;  1YKE B;  4G63 A;  3EHQ A;  4ZOL E;  4M7C A;  3FUL A;  3I4R B;  3OTN A;  2XZT G;  3VKH A;  5G2N A;  3FU5 A;  1E8Z A;  4J8Y A;  2XQ0 A;  3DPY A;  1FMW A;  3C64 A;  3HKB E;  5LCW C;  2Y0B G;  3D9H A;  4RQI A;  3ZGQ A;  5AIJ A;  1RZ4 A;  3RYF E;  5AQ9 A;  2V7K A;  1E96 B;  3AEE A;  5EID A;  4ILH B;  1UOH A;  3U9W A;  3HA4 A;  5TAO A;  1LVF A;  3L3P A;  2A9U A;  5ENQ D;  4HFD A;  1TEZ A;  1OED E;  1ZU2 A;  4FI5 A;  2WP9 A;  4F8H A;  5IY5 E;  4OYS A;  1IKN D;  1BPO A;  2BKN A;  3L9T A;  2DVW A;  4WND A;  4C48 B;  1HX8 A;  4TUY E;  3Q73 A;  3SFD A;  1YD8 G;  2R17 C;  3EI0 A;  1QLB A;  2CXD A;  3AVS A;  4JW1 A;  2XPI A;  3JXI A;  3KFW X;  1TNZ A;  4DV6 T;  5JMN D;  3PJA J;  1T8B A;  4OX9 T;  4O1O A;  3TLW A;  4CN4 A;  1UN8 A;  3CEQ A;  4WW0 A;  3VHL A;  4JLE A;  5ETW A;  5T8I A;  4CN1 A;  4O60 A;  2RG8 A;  3S7F A;  4X8Q A;  5FY1 A;  5IWA T;  2ES0 A;  4PAG A;  3ULE G;  3VLF A;  3QK6 A;  3C3R A;  1KFY A;  1K8K G;  3SNX A;  2G0U A;  2XGO A;  3GA8 A;  3EIQ C;  3AE5 A;  1FT2 A;  5EZY E;  3QUJ A;  4YTP A;  3CX8 B;  5FKY A;  4F6R C;  5L3E B;  3MAC A;  2V7M A;  2XS1 A;  2Z6E A;  3UUL A;  4U7I A;  3RC3 A;  4EPZ A;  2CLY C;  4KX6 A;  1JNZ A;  2AVP A;  3UT8 A;  1D9S A;  1N4S A;  5C3J A;  3Q9U C;  4JA9 A;  2XZD G;  4YHJ A;  2EHO C;  1U3C A;  5L3C B;  4BAY B;  5T3R A;  2LHR A;  2CHN A;  5JR9 A;  2PBI A;  2CPT A;  2D2S A;  3ZFW A;  1O1R A;  1HX1 B;  4HRN A;  1OCZ E;  2X9X A;  4JI7 T;  4F6R D;  2KSR A;  3UIO C;  1WYC A;  5ITZ F;  3MGB A;  2QC9 A;  2QA7 A;  4Q69 A;  2VGX B;  3QWW A;  5LHG B;  3UM1 A;  3ZMT B;  5JDL A;  2WB2 A;  4CI3 B;  4EZH A;  3ASH A;  1D8D A;  3O1I A;  2V6X A;  3FZL B;  3FXE B;  4B3M T;  3OXG A;  5AQK B;  4PH4 B;  4A3T A;  2EHO D;  3MYV A;  3OYX A;  2KZT B;  1JNR A;  2H6I A;  4ZI3 C;  3AB3 B;  2XPZ A;  1Z0P A;  2QVA A;  2F4V T;  3X1D A;  3AS5 A;  3FBL A;  1J1J A;  1N9A A;  1X9B A;  2VVN A;  1MJ0 A;  3FU6 A;  4GZD A;  3FTZ A;  3L16 A;  1ZV4 X;  2I0M A;  2R2L A;  3V5S A;  2XEV A;  3PRE A;  5EN5 D;  4UF0 A;  1JCR A;  4UVB B;  2UXB T;  2PNN A;  3ZKR A;  2BDE A;  4YTN A;  2ZM6 T;  4I1O B;  3FUE A;  2R6G F;  2VAS A;  1NI1 A;  2N9D A;  2MRI A;  3LFM A;  3VRB A;  4JVS A;  1EDU A;  2E9X B;  2Y48 B;  1S63 A;  4HLE A;  4ZI3 D;  3FZF B;  5BV1 A;  5HEO A;  2W66 A;  3ZJ1 A;  2WZH A;  5HCJ A;  3L22 A;  3CK6 A;  4H9O C;  2WCA A;  5EIB E;  2BKP A;  3KSQ A;  1Z6T A;  2ZU6 B;  2XQY A;  3W9F A;  3AEA A;  2XY8 B;  3RIB A;  1JWF A;  3DRA A;  3MJW A;  2IDO B;  4IDO A;  1WY6 A;  4PUC A;  5JTG A;  3UFE A;  3FTS A;  4UQZ A;  3Q7F A;  4Y6W A;  3NZQ A;  4ILC A;  3PZ2 A;  1ELR A;  5FY7 A;  4DV5 T;  3LCA A;  5A23 A;  2WXO A;  2ZM2 A;  3Q47 B;  1JCS A;  2QFC A;  1OED C;  3QC9 A;  5LJM A;  4GYW A;  5H7P A;  4GK5 E;  4JD2 G;  2H6H A;  3D9P A;  4WNF A;  4G2V A;  1E7U A;  4A63 B;  2DCP A;  2B6C A;  3SI5 A;  1M7K A;  5F8P A;  2VSX E;  4EBA A;  1U2V G;  1MX4 A;  1L0V A;  4LCT A;  2WSS V;  3HL6 A;  4X1Y E;  2YDQ A;  4X62 T;  4B3S T;  3U4T A;  5JRC B;  3ZU7 B;  3ZVV A;  3HXE A;  3AE2 A;  1DCE A;  2OVB A;  3I4G A;  3PNT B;  4FA6 A;  3PU3 A;  4CRW A;  5IHY A;  1OUV A;  4I17 A;  5D66 A;  1N0R A;  3QB2 A;  3TWT A;  3PZ4 A;  3T9K A;  2Y4U A;  3CHS A;  1YW0 A;  4GZ6 A;  4KVM A;  3ML8 A;  3UU5 A;  4A55 A;  5A1L A;  3WG7 E;  4H63 H;  3T1H T;  4UQY A;  4LUN U;  1YXR A;  4QX8 B;  2XJ7 A;  2BZB A;  5F5W A;  3DPD A;  4P29 A;  3C4X A;  2F8Y A;  4KVO A;  4F1S A;  3CLJ A;  2EIL E;  3I9Y A;  2H3R A;  1KPS B;  1AP7 A;  1D0Y A;  4I50 E;  3ZC0 A;  4N3A A;  3AE4 A;  4UVA B;  3KBU A;  3RLF F;  3LDZ A;  4ANJ A;  4DBR A;  3FUK A;  4ILU A;  4ZFH A;  4A56 A;  1QQE A;  5ARF A;  2P9S G;  3L82 A;  3FHN A;  4TWF A;  2UUC T;  4N78 D;  3UUM A;  4YHH T;  4WBN E;  3TLU A;  2NC9 A;  3I5P A;  2MBG A;  2GRO B;  2LSU A;  1EPU A;  1YQ3 A;  5ENR D;  4HRM B;  5BR8 T;  4UV9 B;  1ZBP A;  3IHV A;  3JCF A;  1BI7 B;  4EZJ A;  4ME2 A;  2X51 A;  5JR9 B;  4FLB A;  3TLS A;  2ZGD A;  4AI6 A;  2XAH B;  4JI8 T;  4KMC A;  3RC8 A;  3UIP C;  1TR4 A;  2XEN A;  3TAX A;  1LD7 A;  3GMI A;  3C98 A;  4U63 A;  4UWL A;  1NA3 A;  4W9R A;  2IJG X;  2CBI A;  5DBK A;  1HR0 T;  2WWV A;  1CHU A;  3U3I A;  2QZA A;  3PH0 C;  4JC8 A;  1E8W A;  3ZUV B;  3D9K A;  4GA1 A;  2VVS A;  3HVE A;  4JHK A;  2AXU A;  4BX8 A;  1MIV A;  3Q5M A;  2ZIR A;  3Q9D A;  5JDG A;  4AY6 A;  2WDV A;  1K3Z D;  2N2N A;  2K48 A;  2BS3 A;  4O4J E;  3ML9 A;  2CM0 A;  2J62 A;  1JWG A;  3CQC B;  3RIU C;  5LA6 E;  2V0P A;  3ABL E;  4UF0 B;  3E08 A;  3NRX A;  5LOV E;  3PRZ A;  5HEH A;  4AJW A;  4B94 A;  1B7T A;  3CVP A;  3FH7 A;  4AXH A;  4UV8 B;  1XNR T;  3IKO B;  2UXD T;  1G3N B;  2QYJ A;  5DIZ A;  2X3M A;  3BQL A;  1I6Z A;  3SY2 A;  3KBT A;  4HLL A;  4DMW A;  3DWL G;  4EED A;  5JJ7 A;  2W4X A;  2UXX B;  1O3X A;  3CVR A;  3HDX A;  3ZEF A;  3J9X 1;  4L9I A;  4LF8 T;  3CKB A;  2IAK A;  3FTX A;  3I9W A;  1YMP A;  2WWU A;  2KWH A;  4BX9 A;  3ZIM A;  3UQ4 A;  1YA0 A;  5LNK A;  4I9E A;  2GRQ B;  2FEZ A;  4DLQ A;  2IW5 B;  3HXC A;  2ZLY A;  5JDN A;  5ABF A;  4MKT A;  4GYS A;  3AG4 E;  2DCF A;  1UCU A;  4HGA A;  3U78 A;  3UU6 A;  5E75 A;  1BI8 B;  1KT0 A;  4GKK T;  3J5P A;  4HFE A;  4KP3 C;  4ATZ D;  5EYP F;  4AM9 A;  3ZRH A;  1Z8U A;  1W9R A;  4XI9 A;  4RSY A;  2E5V A;  4Z90 A;  3FUH A;  3PZ3 A;  3RX6 A;  3OPC A;  3Q9N C;  5FT9 A;  3Q79 A;  2WPV A;  1RW2 A;  1WR0 A;  4BT8 A;  3RH3 A;  4EYU A;  3UT4 A;  3ZYQ A;  4PJJ A;  2C0S A;  2JIW A;  3PS6 A;  4C0M A;  1BR2 A;  3LYA A;  2XQ6 A;  1D1B A;  1UX4 A;  3D9I A;  3CVW A;  2LRK A;  1O1T A;  2OV8 A;  3UI2 A;  1DCQ A;  3F31 A; 
#chains in the Genus database with same CATH homology
 2E9X C;  3LK3 B;  1WAO 1;  4HOS A;  3ZPJ A;  3WI3 A;  3GW4 A;  3SZ7 A;  1DNP A;  1JUQ A;  2IFU A;  3GYZ A;  3FHE A;  3S7B A;  2XTL A;  1ELW A;  1XNF A;  2AXZ A;  4FC8 A;  3ANW A;  5FQ6 A;  2CLY B;  4URK A;  3RK6 A;  5LCW J;  4PK5 A;  4JZY A;  2OVF A;  5G05 C;  4WWP A;  2E9X D;  3R7R A;  4WWO A;  4MHC A;  3CV0 A;  5JVD E;  3RKO A;  4GYR A;  3PZD A;  5KJN A;  5FY0 A;  2ODU A;  1HF8 A;  4ILG A;  4O2B E;  3LXU X;  2WQ7 A;  1IJ6 A;  2IU1 A;  4CEM A;  4P0A A;  2EQX A;  2X66 A;  3I0Q A;  4I6E A;  3LK2 B;  4QXH B;  3IHY A;  3LEW A;  2V7I A;  2PJQ A;  4J0U A;  5FQ4 A;  3R7Q A;  5L3B B;  4JA7 A;  3C4W A;  4U72 A;  3O48 A;  3PU8 A;  2VYI A;  3N9N A;  2IQC A;  4HFG A;  2JMH A;  3C98 B;  1W3B A;  3HIZ A;  1WYB A;  2Y6X A;  2MOZ A;  4K0U A;  2QGS A;  2WXF A;  2NTY A;  3PEU B;  3CX7 B;  1HO8 A;  2PG8 A;  3HVE B;  3FUF A;  3RRN B;  3QDN A;  3FDH A;  4E6H A;  4B6X A;  3B7U X;  4C90 A;  4IIJ E;  2B1E A;  4IE7 A;  3FEY A;  2BUG A;  3PDY A;  4BA9 A;  3CGH A;  4YLH A;  3LY7 A;  2CHZ A;  3CVQ A;  1IJ5 A;  2L6J A;  3JC6 C;  3G2W A;  1OWN A;  3T5V A;  3BQK A;  3KDS E;  5EK4 A;  5JR9 C;  5E76 A;  1US7 B;  3F57 A;  3ZEF B;  5A6C A;  3VTY A;  2K24 A;  2H7O A;  3ASF A;  2WXI A;  3EHN A;  4UVC B;  5LHH B;  1MND A;  4OK0 A;  3D9M A;  3CQX C;  3EVY A;  2MOW A;  4EBA G;  3MEK A;  3SBS A;  4DVD A;  1S94 A;  1OWM A;  5AYW D;  3CVU A;  3HKD E;  4QXB B;  3SGH A;  5AJD A;  4GML A;  3FUJ A;  2CG3 A;  4V1A v;  1HXI A;  4FUL A;  5JDQ A;  5D0Q D;  5JHA A;  4HEA A;  3UUN A;  4IST A;  1HG5 A;  2CEA A;  4O4H E;  5HWY A;  4CDM A;  3CHQ A;  2VKJ A;  4GIW A;  2NXP A;  2A4Z A;  3QKY A;  1LKX A;  4C9B B;  2Q9Q A;  4Y6C A;  3L09 A;  4KZ0 A;  4ZHQ E;  2YU1 A;  5HYA A;  4AIF A;  4N39 A;  3AA0 B;  3N2O A;  3N9O A;  2YHC A;  4ZI2 C;  2J4B A;  4WBO A;  1PC2 A;  3ANW B;  1H19 A;  4O4L E;  2VJ8 A;  3L6A A;  4U0S A;  3RO2 A;  5EKQ D;  2GK9 A;  2I59 A;  5DJQ C;  3N9P A;  1D0Z A;  3TXN A;  5JJT A;  3FBZ A;  1CUN A;  3PUQ A;  3ZC1 A;  1INZ A;  4CT4 A;  4LRZ A;  1MIY A;  3HHM A;  3KVB A;  4MLK A;  4PJM A;  2WXH A;  4HXI A;  2WMO A;  3IBP A;  3IV0 A;  4UEL A;  3J7Y q;  2PM7 A;  2P58 C;  4ZI2 D;  2LOS A;  2XAJ B;  5LGU B;  5FP3 A;  5JDM A;  4C91 A;  2RA1 A;  2DNX A;  2J07 A;  4JHR A;  1Z3X A;  3CIA A;  3ESK A;  3VTX A;  3HR0 A;  3LJC A;  4EZL A;  5HXR A;  2LE8 A;  2J4D A;  3T8O A;  3G2T A;  4PJL A;  4EB6 E;  3UMV A;  4RG9 A;  3SS1 A;  5H6Q B;  3VLD A;  1QNF A;  1KLX A;  2W0G A;  2CE7 A;  1SZA A;  5CA1 E;  4E7S A;  5DAB A;  3PE0 A;  2LAH A;  2ACX A;  4YJ3 E;  3LG7 A;  3G2V A;  2PFV A;  4I9C A;  1WRD A;  3WAK A;  1WLX A;  4GYY A;  4JUY A;  5EX3 A;  5CMY A;  2JLB A;  4FAD A;  4FJZ A;  3B57 A;  4DO0 A;  2CFU A;  3FTW A;  3N9L A;  4GAA A;  3ZMV B;  2R5S A;  2KT9 A;  4PW8 A;  3D3M A;  5LHI B;  4JEH A;  2IC9 A;  3ZN1 B;  2LNI A;  4HTE A;  4ANV A;  3MXZ A;  5BV0 A;  2J08 A;  5BNW A;  5KJL A;  1UJJ A;  2HO1 A;  4O4I E;  2LJL A;  2VK9 A;  3JQ1 A;  3D9O A;  4IUL A;  4CCA A;  2VQ2 A;  4MAL A;  2KND A;  1JPL A;  3EUH A;  4ATG A;  1HS6 A;  2BVL A;  1OWP A;  4GZ3 A;  2NWB A;  3MKQ A;  4ZS2 A;  3OXF A;  5D0O D;  5EK3 A;  2QY7 A;  5H6R B;  4I6J A;  4I4T E;  4I55 E;  4PFP A;  3HI2 A;  1MIW A;  4N3C A;  2FUL A;  3LKU A;  3SOL A;  5HAX A;  4OYJ A;  3EDV A;  2VTB A;  4IYP A;  3QJZ A;  4OHF A;  4ASK A;  3K3N A;  4Z8X A;  5CHE E;  1H6K A;  4A1S A;  4BTB A;  2V26 A;  2PQN A;  4KT6 B;  4UQX A;  4OVU A;  2Q9Q B;  4UIG A;  1MMD A;  4AVX A;  4QHO A;  4MS6 A;  4BTA A;  2OA5 A;  2OOE A;  4GZC A;  3SRZ A;  5J08 A;  3FXD B;  3FY4 A;  5FZR A;  4A3V A;  3EHM A;  3QK0 A;  2YK0 A;  2NW9 A;  3RYI E;  3V5U A;  5AJL A;  3L13 A;  1QSD A;  2XHE A;  4EXT A;  5M4Y A;  1V9D A;  4WNG A;  2KZ7 B;  5M72 A;  3ONL A;  3QOU A;  1T98 A;  4X1K E;  4Q94 A;  4XE0 A;  3CHR A;  1BR0 A;  3CKC A;  3CVV A;  2NTX A;  1MHQ A;  2NOX A;  3QNK A;  4UI9 K;  1D1A A;  3UT5 E;  4PS7 A;  4L0R A;  3MZK B;  1DVP A;  2X6H A;  2KCL A;  2C5J A;  2X6F A;  4N2S A;  2GW1 A;  2BF0 X;  2WXM A;  2CHW A;  3ONK A;  5FNV E;  3CWZ B;  3D9N A;  3AAE B;  4PJN A;  5G05 J;  2C0M A;  2WMN A;  1S0P A;  2XAG B;  2YEV C;  2CCQ A;  3AAI A;  4FHK A;  2LM9 A;  4TV9 E;  1E90 A;  2HYZ A;  1VOM A;  2C5I T;  3PUK A;  2SPC A;  4KUM B;  3Q49 B;  1NAF A;  5J2T E;  4WAF A;  2ION A;  3ZMS B;  4UWF A;  2Y8D A;  2KIN B;  4N3B A;  3CST A;  1H7C A;  2UXN B;  4IE4 A;  4MFR A;  3N9Q A;  4JEH B;  4U74 A;  3LS8 A;  2LAI A;  2V7J A;  4ADZ A;  4UWG A;  1HS7 A;  1VDY A;  2ILR A;  2HPL A;  3SWH A;  1MNE A;  3FP3 A;  3Q15 A;  3L17 A;  3CK8 A;  2YIN A;  3NBX X;  2WQH A;  3FU3 A;  4F53 A;  5ANL A;  5HI7 A;  2L0T B;  2Y3A A;  3RPU A;  1ZKE A;  1NP7 A;  2HM8 A;  3MKQ B;  4YVQ C;  4BWR A;  4V3I A;  3T5X A;  4OVV A;  5FJY A;  2VGY A;  4U0U A;  4B0Z A;  1IZN B;  5FZS A;  2WQ6 A;  2E2E A;  3IBE A;  3QAQ A;  1IQR A;  1P5Q A;  2X6K A;  4B8C B;  1AJ3 A;  3QWP A;  2VTB B;  1HCI A;  4IRU A;  3D9J A;  3GZ2 A;  4MBQ A;  3PEV B;  2CWO A;  3FTV A;  4AKG A;  2MYS A;  3ZHE A;  2CHX A;  2CXL A;  1U3D A;  3K9I A;  5F3J A;  3APC A;  3FUM A;  2IOS A;  3NZU A;  3I3N A;  4FJO A;  4WUY A;  3EDT B;  3BG1 B;  2VKD A;  1MMG A;  2V7L A;  5LJN A;  2L9B A;  4YFS A;  2ODV A;  3B7S A;  3WXX A;  4HOQ A;  3E4B A;  3GZS A;  5KJK A;  4GPK A;  4APF A;  4KBQ A;  3RJV A;  4IE5 A;  2IC6 A;  2KXP B;  3D0T A;  1ZEE A;  2CA5 A;  4HE8 A;  4P09 A;  2VKO A;  5LOZ A;  2LEH A;  3GN5 A;  2XHE B;  4N2Q A;  3CK9 A;  2J1D G;  5G04 C;  1B89 A;  3S4U A;  4L1B A;  2GRM A;  2WXJ A;  3IHR A;  4HS2 A;  3TXM A;  2N1G A;  1EF1 C;  4GA0 A;  3LVR E;  2X67 A;  1FVF A;  2VKH A;  2I2O A;  2Q9Q C;  2E8I A;  4R7L A;  2L0I A;  2I6H A;  3JYS A;  4TV8 E;  2X9H A;  1PY1 A;  3CPZ A;  4AQG A;  3CR3 A;  2GGF A;  5JQG E;  4O8S A;  3N71 A;  4JXT A;  3EIJ A;  4ABN A;  2ZM8 A;  3VKG A;  2Q9Q D;  3F2E A;  2PZI A;  4JEU A;  3U3W A;  4DND A;  3JCK C;  5BMV E;  2YNQ A;  2RD0 A;  3APD A;  3ASD A;  2L9Q A;  3R9A B;  4GCN A;  4KMO A;  2AW6 A;  5BUZ A;  4G23 A;  4AOF A;  4EEC A;  5FWQ A;  1FEW A;  3FFL A;  2OND A;  1UN9 A;  4JL0 A;  1H0A A;  1XGW A;  2X6I A;  4HKA A;  2NW8 A;  4XI0 A;  3FB2 A;  3ZCI A;  3O4Z A;  5EK2 A;  4HN9 A;  2XAQ B;  4H7X A;  1X5B A;  2VSO E;  2X9W A;  4J8E A;  3S7D A;  3PE3 A;  3O9X A;  2LSI A;  1YKH B;  3Q4A B;  2FI7 A;  4I1A A;  4PNI A;  3ZN3 A;  3CQG B;  4CDN A;  5FZQ A;  3FUI A;  1QZ2 A;  4O2A E;  5C8Y E;  3MA9 A;  2M67 A;  3TKL B;  3C51 A;  4P0B A;  2XCC A;  3ZHE B;  1HG2 A;  3E22 E;  3ZYL A;  2LOP A;  4CDR A;  3CML A;  2VB6 A;  4B89 A;  4F7A A;  4U04 A;  3LY9 A;  4M1P A;  5FQ8 A;  3JC6 D;  3KV5 A;  5LG4 A;  3Q2M A;  4EZ4 A;  2XCB A;  3RRW A;  4AXP A;  5ENN A;  2I1K A;  5LGT B;  4G26 A;  1ZHC A;  3P8C D;  5IYZ E;  4FHJ A;  2WXL A;  3PUA A;  4XX5 A;  5EDS A;  5CMW A;  4L7T A;  2WBL A;  2RP4 A;  4JHJ A;  3UQ3 A;  1IYG A;  5L3D B;  4UI9 C;  4EIW A;  4IHJ E;  1E7V A;  2W62 A;  5L2L A;  2A72 A;  3RYH E;  4L23 A;  4XAX B;  3PDN A;  3KV4 A;  1D0X A;  5KMG P;  3GN5 B;  1UX5 A;  3K8P C;  3PUJ A;  1ELK A;  2M63 A;  2CWY A;  3CKD A;  3OKQ A;  3FTU A;  4PFO A;  3KIN B;  4EAH A;  1OXZ A;  3JUI A;  3AVR A;  5JDH A;  2J9Q A;  4IE6 A;  1H2V C;  4E7Z A;  2D0U A;  1A17 A;  4QFV A;  4AKR B;  4PK4 A;  5ANR A;  4AQF A;  3URZ A;  3DBS A;  4GB9 A;  2IOL A;  1N54 A;  2VL8 A;  3OAW A;  1E8Y A;  1G8X A;  3NZP A;  2C0L A;  4KXK B;  4NAC A;  5JRC A;  4AY5 A;  3UTK A;  4I6G A;  2JMK A;  3PUG A;  1L5J A;  4CI2 B;  4AKL A;  3CVX A;  4PK6 A;  2VWA A;  4JEU B;  3CSF A;  4IN3 B;  2K5B B;  3EJN A;  2FO7 A;  3ZXS A;  5CCM A;  2HR2 A;  3Q5X A;  3Q5W A;  3ZYK A;  4CZZ B;  3DP7 A;  3JQ0 A;  2V8S E;  1BR1 A;  4NUR A;  4APO A;  3IEE A;  2FF4 A;  4GOU A;  5LFA A;  5FTP A;  2DIW A;  4AP2 A;  2L3L A;  5FXW A;  3GZ1 A;  5J90 A;  3NRY A;  1Y8M A;  3BG0 B;  4DLO A;  2LSG A;  3CK7 A;  4L2L A;  3VLE A;  3HKE E;  5E0O A;  4HFV A;  3AA1 B;  1UJK A;  4X1I E;  2CXF A;  1KK7 A;  2KM4 A;  4MLP A;  3C4Z A;  3ZYM A;  3S2A A;  3SHF A;  3HKC E;  4HOR A;  4G25 A;  3AS4 A;  3G2S A;  1G73 A;  5LXT E;  3TJP A;  3LK4 2;  2A5U A;  2V4L A;  5HWX A;  2WAU A;  4ANX A;  2HH7 A;  3MA5 A;  4B8A A;  4DI3 A;  3TGO A;  2DHR A;  3L54 A;  4G1T A;  3H37 A;  3FU0 A;  3N2K E;  2AXV A;  2W61 A;  3I0O A;  1H2U A;  1NZN A;  3RRC A;  3CHO A;  3FTY A;  2LSY A;  3RRU A;  4BFR A;  4QXC B;  2WXG A;  3ZN0 B;  4C0E A;  3N5L A;  2E0I A;  2UY1 A;  2X9Y A;  4FLH A;  2XGM A;  3W15 B;  4FU3 A;  3RYC E;  3D9L A;  4ANU A;  3TG5 A;  5KCM A;  4DI4 A;  3AAA B;  1NA0 A;  4PS8 A;  1UG3 A;  3OYZ A;  5FXZ A;  4J8S A;  4GA2 A;  4BSX A;  3NQP A;  3KEZ A;  5C1D A;  4H63 V;  1GW6 A;  4DK5 A;  1HZ4 A;  4AKH A;  4AV7 A;  3U66 A;  3C50 A;  5JRE A;  4IGU A;  1Y6I A;  1WR6 A;  2YU2 A;  4H7Y A;  4H9R C;  4IDZ A;  5HXE A;  2C2L A;  5BPP A;  4XZC A;  1KT1 A;  5ARG A;  4FP7 A;  5T4Y A;  3MKD A;  5DQW A;  2XUE A;  2VSN A;  2PQR A;  4EOZ B;  1IHG A;  1OWA A;  2R59 A;  4BY6 A;  1HE8 A;  2MHK A;  3UX4 A;  3EDU A;  4NRH B;  4I43 A;  2J09 A;  3WAJ A;  1MMA A;  4X20 E;  1QUU A;  1MMN A;  3LBX A;  2IF4 A;  2NP9 A;  4CI1 B;  4I1M A;  4DPR A;  5G04 J;  3I1A A;  3AA7 B;  5HXC A;  2A3D A;  4UEM A;  3DJB A;  5C2Y A;  4I2W A;  4ACL A;  3ZLI A;  3ZCJ A;  2KMF A;  1HH8 A;  5BT1 A;  2DWG A;  4J8D A;  4OFZ A;  5AFU L;  3U64 A;  3B13 A;  4Q96 A;  4HOT A;  3FEX A;  4TUU A;  3PVL A;  1E1H B;  3R84 B;  2D0T A;  3TG4 A;  2DLR A;  1MQS A;  2WVI A;  3ULQ A;  2EHO A;  4YJ2 E;  2FBN A;  3NF1 A;  1SZ9 A;  3PNL B;  2L8K A;  2XGS A;  4KBM B;  4PDX A;  3KV6 A;  3O1J A;  2YQ8 A;  2H7V C;  2W00 A;  2WM9 A;  2VSY A;  5A7D B;  3UUX A;  4BJM A;  3APF A;  3UT7 A;  2J49 A;  3OXL A;  1FCH A;  4H9P C;  3KV9 A;  3MX3 A;  2KC7 A;  2I1J A;  3SFZ A;  2V1D B;  3PE4 A;  2JQQ A;  3B7T A;  3MZL B;  4CXX A;  4AEZ C;  3SD5 A;  2XAF B;  3ZW3 A;  4TZ4 C;  1PAQ A;  3FH8 A;  3CVY A;  4WWN A;  4QWN B;  2JPF A;  3IEG A;  4DJA A;  3AU5 A;  4NQ0 A;  1OWO A;  4BT9 A;  1FMV A;  5CCL A;  2XRZ A;  1HFA A;  2LSV A;  3MV3 B;  3MJX A;  5GON E;  5HXH A;  2V5F A;  4GMJ A;  4H9S E;  5LP6 E;  4GYO A;  2D5U A;  3H3A A;  3ENE A;  3QWV A;  4A1G A;  1TJF A;  5LGN B;  3GWH A;  2MTQ A;  1U5P A;  4L2Y A;  2GRL A;  3P2B A;  2NSZ A;  5JDF A;  4HVB A;  4ZI7 E;  2UY1 B;  3BK9 A;  5FXV A;  4E85 A;  4OYK A;  4I2Z A;  3L08 A;  1IQU A;  5CB4 E;  1U4Q A;  1SHZ C;  5LP0 A;  1KNZ A;  4K0R A;  4ERR A;  3MK7 C;  3BQI A;  5JHB A;  5HXS A;  3N9M A;  1EZ3 A;  4KYO B;  2CMR A;  2LSJ A;  3LJ3 A;  1NWM X;  2WXN A;  1OWL A;  5FMN A;  2WXP A;  4HOU A;  2PL2 A;  4GZ5 A;  3ZMZ B;  5BW8 C;  3SF4 A;  4TN7 B;  4YND A;  4ANW A;  2AWI A;  4CGV A;  3ASG A;  4BJN A;  3VU7 H;  4NUU A;  4XBF B;  4PS3 A;  2JRK A;  3R6N A;  4TRQ A;  2KCV A;  2X6J A;  1D1C A;  1HU3 A;  4UWK A;  2NW7 A;  4G2A A;  3AU4 A;  4EYY R;  3KD7 A;  1SQM A;  3MV2 B;  3FUN A;  2DI4 A;  4UI9 J;  4N5C A;  3N2G E;  4O6F A;  2XAS B;  3DTO A;  4I43 B;  4CXY A;  3SBT B;  2BVM A;  2X0L B;  4U0Z A;  1VRB A;  2ZM0 A;  3K3Q C;  3LBX B;  4MRU A;  3G2U A;  3KS2 A;  2LO6 A;  4CT0 A;  1EYH A;  5KJM A;  3AA6 B;  5FYM A;  3MCX A;  2JEK A;  2XRY A;  3OJA A;  4H9N C;  4CXW A;  4ILI A;  5JH7 E;  4J8F A;  4K03 A;  1FIO A;  1S35 A;  4ZS3 A;  2WXR A;  3B7R L;  3ONX A;  4QX7 B;  2PM6 A;  3UPV A;  2JJ9 A;  3OBV E;  3PUR A;  1Z3Y A;  2XPY A;  4TV3 A;  2HPJ A;  3ETV A;  4RG6 A;  1HTJ F;  3A5X A;  3BEE A;  4L5G A;  1Y64 B;  3ZMU B;  4GU5 A;  2CG2 A;  5LBQ B;  4YVO A;  2EHO B;  5J1G A;  5KX5 E;  2KAT A;  2P9B A;  5DQV A;  5LYJ E;  4AQF C;  3FUD A;  3IF8 B;  5L3G B;  2DBA A;  3FH5 A;  4IE0 A;  3RU0 A;  2ZMA A;  4LEU A;  4H9Q C;  3AS8 A;  3UUX B;  2W63 A;  2CFZ A;  3QAR A;  1BR4 A;  2A2F X;  4UWH A;  5J2U E;  4EZK A;  3M65 A;  2WXQ A;  4RVB A;  2K9A A;  5FXX A;  3E0Z A;  4DBQ A;  4UXN B;  3RKV A;  5ADX L;  4J2C A;  3CX6 B;  2Y4T A;  4G24 A;  2LT3 A;  3QC1 A;  5FQ7 A;  3NZS A;  1WM5 A;  3LPZ A;  1LF8 A;  4F3V A;  5AEN A;  3P7I A;  5KDM C;  4AKI A;  5HQ8 A;  4GCO A;  3S7J A;  2Q7F A;  4FJY A;  1LVK A;  5EX0 A;  4ACK A;  2X68 A;  2BTD A;  3ETU A;  4XZ4 A;  2YHE A;  2LSK A;  1UW4 B;  3CHM A;  1LRZ A;  3ESL A;  2VGX A;  2C5K T;  3CHP A;  2LHN A;  4U07 A;  3K3O A;  5LBM A;  4KZC A;  3LVQ E;  4WNE A;  3ZPO A;  3O1H A;  2KZT A;  4M3O A;  4JPS A;  2UWJ G;  4XIF A;  2X38 A;  3FWV A;  3LY8 A;  3PUS A;  1H2T C;  3RRM B;  4XKC A;  4GK0 E;  3CVL A;  1N52 A;  3TL5 A;  3HYM B;  3T8M A;  4DMV A;  3MKR A;  4XKB A;  5L3F B;  4U8H A;  3ZJ2 A;  2KLQ A;  3PTR B;  2E9X A;  4WNK A;  1IAP A;  2DWK A;  5JJ6 A;  5CA0 E;  1FVH A;  4LER A;  4G11 A;  4ISS A;  4J6I A;  1X79 A;  4QKN A;  4EQF A;  4NUV A;  4TX5 A;  1E8X A;  4CGW A;  4CQI A;  5G55 A;  5LCY A;  4D10 C;  2WXK A;  1TJC A;  2KWI B;  3RO3 A;  5LX8 A;  3CVN A;  3KAE A;  3KVA A;  3O4X E;  2I9C A;  1SA0 E;  2KCK A;  3P1U A;  1YKE B;  4G63 A;  4ZOL E;  3FUL A;  3I4R B;  3OTN A;  3VKH A;  5G2N A;  3FU5 A;  1E8Z A;  2XQ0 A;  1FMW A;  3C64 A;  3HKB E;  5LCW C;  3ZGQ A;  5AIJ A;  3RYF E;  2V7K A;  1E96 B;  4ILH B;  3U9W A;  3HA4 A;  5TAO A;  1LVF A;  3L3P A;  1TEZ A;  1ZU2 A;  4FI5 A;  4OYS A;  1BPO A;  4WND A;  1HX8 A;  4TUY E;  1YD8 G;  2R17 C;  2CXD A;  3AVS A;  4JW1 A;  2XPI A;  3KFW X;  3CEQ A;  1UN8 A;  4WW0 A;  3VHL A;  4JLE A;  5ETW A;  5T8I A;  2RG8 A;  3S7F A;  5FY1 A;  2ES0 A;  4PAG A;  3VLF A;  3QK6 A;  3SNX A;  2G0U A;  2XGO A;  3GA8 A;  3EIQ C;  5EZY E;  3QUJ A;  3CX8 B;  4F6R C;  5L3E B;  3MAC A;  2V7M A;  2Z6E A;  3UUL A;  3RC3 A;  4EPZ A;  2CLY C;  2AVP A;  3UT8 A;  4JA9 A;  4YHJ A;  2EHO C;  1U3C A;  5L3C B;  4BAY B;  5T3R A;  2LHR A;  5JR9 A;  2PBI A;  2D2S A;  3ZFW A;  2X9X A;  1WYC A;  3MGB A;  2QA7 A;  4Q69 A;  2VGX B;  3QWW A;  5LHG B;  3ZMT B;  5JDL A;  2WB2 A;  4CI3 B;  4EZH A;  3ASH A;  3O1I A;  3FXE B;  3OXG A;  4PH4 B;  4A3T A;  2EHO D;  3MYV A;  3OYX A;  2KZT B;  4ZI3 C;  3AB3 B;  2XPZ A;  1Z0P A;  3AS5 A;  3FBL A;  3FU6 A;  4GZD A;  3FTZ A;  3L16 A;  1ZV4 X;  2XEV A;  3V5S A;  3PRE A;  4UF0 A;  4UVB B;  2BDE A;  4I1O B;  3FUE A;  2VAS A;  2N9D A;  2MRI A;  3LFM A;  4JVS A;  1EDU A;  2E9X B;  2Y48 B;  4HLE A;  4ZI3 D;  5BV1 A;  3ZJ1 A;  3L22 A;  4H9O C;  1Z6T A;  2ZU6 B;  2XQY A;  3RIB A;  1JWF A;  3MJW A;  1WY6 A;  4PUC A;  3UFE A;  3FTS A;  4UQZ A;  4Y6W A;  3NZQ A;  1ELR A;  5FY7 A;  3LCA A;  5A23 A;  2WXO A;  2ZM2 A;  3Q47 B;  2QFC A;  3QC9 A;  5LJM A;  4GYW A;  4GK5 E;  3D9P A;  4WNF A;  4G2V A;  1E7U A;  2DCP A;  3SI5 A;  5F8P A;  2VSX E;  4EBA A;  4LCT A;  2WSS V;  3HL6 A;  4X1Y E;  3U4T A;  5JRC B;  3ZVV A;  2OVB A;  3I4G A;  3PNT B;  4FA6 A;  3PU3 A;  4CRW A;  5IHY A;  1OUV A;  4I17 A;  3QB2 A;  2Y4U A;  3CHS A;  1YW0 A;  4GZ6 A;  4KVM A;  3ML8 A;  4A55 A;  5A1L A;  4H63 H;  4UQY A;  4LUN U;  4QX8 B;  2BZB A;  3DPD A;  4P29 A;  3C4X A;  4KVO A;  4F1S A;  3CLJ A;  3I9Y A;  2H3R A;  1D0Y A;  4I50 E;  3ZC0 A;  4N3A A;  4UVA B;  3KBU A;  3LDZ A;  4ANJ A;  4DBR A;  3FUK A;  4ILU A;  4A56 A;  1QQE A;  5ARF A;  3FHN A;  4N78 D;  3UUM A;  4WBN E;  2NC9 A;  3I5P A;  2MBG A;  2LSU A;  1EPU A;  4UV9 B;  1ZBP A;  3IHV A;  4EZJ A;  4ME2 A;  2X51 A;  5JR9 B;  4FLB A;  4AI6 A;  2XAH B;  4KMC A;  3RC8 A;  3TAX A;  3GMI A;  3C98 A;  4U63 A;  4UWL A;  1NA3 A;  4W9R A;  2IJG X;  5DBK A;  3U3I A;  3PH0 C;  4JC8 A;  1E8W A;  3D9K A;  4GA1 A;  3HVE A;  4JHK A;  2AXU A;  4BX8 A;  1MIV A;  3Q5M A;  3Q9D A;  5JDG A;  4AY6 A;  2N2N A;  2K48 A;  4O4J E;  3ML9 A;  2CM0 A;  1JWG A;  3CQC B;  5LA6 E;  2V0P A;  4UF0 B;  3E08 A;  3NRX A;  5LOV E;  3PRZ A;  4AJW A;  4B94 A;  1B7T A;  3CVP A;  3FH7 A;  4AXH A;  4UV8 B;  3IKO B;  5DIZ A;  2X3M A;  3BQL A;  3KBT A;  4DMW A;  5JJ7 A;  2UXX B;  1O3X A;  3CVR A;  3HDX A;  3ZEF A;  3J9X 1;  4L9I A;  3CKB A;  2IAK A;  3FTX A;  3I9W A;  2WWU A;  2KWH A;  4BX9 A;  3ZIM A;  1YA0 A;  5LNK A;  4I9E A;  2FEZ A;  4DLQ A;  2IW5 B;  2ZLY A;  5JDN A;  4MKT A;  4GYS A;  2DCF A;  1UCU A;  4HGA A;  3U78 A;  5E75 A;  1KT0 A;  4KP3 C;  4AM9 A;  3ZRH A;  4XI9 A;  4RSY A;  3FUH A;  3RX6 A;  5FT9 A;  2WPV A;  4BT8 A;  3RH3 A;  4EYU A;  3UT4 A;  3ZYQ A;  4PJJ A;  2C0S A;  3PS6 A;  4C0M A;  1BR2 A;  3LYA A;  1D1B A;  1UX4 A;  3D9I A;  3CVW A;  2OV8 A;  3F31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...