3CQGB

Nucleoporin nup107/nup133 interaction complex, delta finger mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
184
Chain Sequence
LSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDENINDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADFEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
total genus 59
structure length 184
sequence length 222
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqgB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqgB02
3I4RB 3CQGB 3CQCB
chains in the Genus database with same CATH superfamily
2RFMA 3DPDA 2YDRA 4WZXA 2LEHA 3W9GA 4WNKA 2VVSA 3EJNA 1MNDA 1N94A 4UI9C 4H63V 1S35A 5FP3A 4F7AA 1MX2A 4H9NC 1KEYA 3IXEA 4DRXE 5JR9B 4IDPA 2N9DA 4U0UA 4QHOA 2GRPB 2PQNA 4OAVB 4PFPA 3AS8A 2AXDS 5LGTB 2UXBT 4EHMA 1WFDA 4XKBA 5CHEE 3L39A 2XQ7A 5L3DB 2XM1A 1JCRA 2VSOE 3VKGA 4GU5A 1AWCB 1OUVA 5FWQA 2FF4A 5EYPF 4WBOA 1CUNA 1HNZT 3MX3A 4AXHA 3FZFB 1XMOT 3BG0B 3CKBA 3FU3A 3WXXA 4HOUA 3ONXA 4EECA 4AQFA 4YTPA 3FUEA 3U4TA 1HG5A 2XM2A 2Y0BG 4BX9A 3GMIA 1JWGA 2Z6EA 1TYQG 2I2OA 3K1SA 3WG7E 4GTRA 1UCUA 2DWKA 4MFRA 1DNPA 3DSUA 1UGOA 5L2LA 3V2XA 5CECB 2KCLA 3DEOA 2A2FX 3RYCE 3EHQA 5JDLA 3PUYF 4HWDA 5LFAA 5E75A 3DSSA 4UWLA 2W61A 4M1PA 4X66T 5CGMA 3ZMZB 1L5JA 4RVBA 5ENRD 1SHZC 4TXRA 4X65T 1ZP0A 3PUWF 3ZN0B 5HAXA 1INZA 4GOUA 1OWOA 2JQQA 5BT1A 1PY1A 3CHRA 3LY8A 4F1PA 4J6IA 3OKQA 2J9QA 3EUVA 3AS5A 3TWRA 2W2UA 3OAWA 1Z8UA 1XGWA 2WXIA 5LGUB 2J08A 1UX5A 3RRWA 3N9QA 5KNHD 1FPPA 4LG6A 3ZC0A 3Q15A 5EILA 2Y69E 3PEUB 2ODVA 2X9HA 3ZPJA 2XZDG 1LVFA 3TKLB 2MTQA 2YK0A 3GYZA 2CLYC 2WAUA 4JYAT 3SQVA 4ZS3A 4OHFA 2IHR1 3OTNA 4WNDA 3T5XA 2FJEA 5L47A 3IHRA 4GTVA 5BUZA 2XTLA 5T4YA 1XNQT 5LGNB 2BS4A 5T3RA 3RO3A 4HGAA 3RPUA 4CI2B 1PC2A 3PH0C 5AQFB 5LMUT 3L16A 3TWQA 1WYCA 4YDWA 4AISA 2OV9A 3DEPA 5AJDA 2FO1E 3HA4A 3TWXA 1XNFA 2IMLA 2UUCT 1T98A 3FY4A 4JLEA 4HWIB 3CGHA 2X3MA 3B7SA 5G55A 4BSZB 2PL2A 3L17A 1UOHA 4XI0A 1GW6A 2WXPA 5B1AE 5LB7B 4AI6A 5FL0A 4GPKA 1WYBA 5F5WA 3C50A 1WRDA 4GZ5A 3HRAA 2VB6A 4B8AA 2LUHA 2JQKA 5LJNA 3J5QB 1OCCE 4E7SA 4TRQA 3RC3A 4YY3T 1N52A 3LK3B 3J7Yq 2WZIA 4ERRA 4YSYA 1D8DA 1EYHA 1BR4A 3E22E 4TNVA 2AXVA 1ZKEA 3ZN1B 2WXMA 3TLSA 4JI7T 3CVRA 2IC9A 4HRMB 3JUIA 4UI9J 5FQ8A 3GN5A 1TEZA 3CVNA 2A5UA 2VKJA 2MBGA 4LFCT 2ONDA 2R17C 3C4XA 4I1AA 1WG0A 4JI0T 4E6HA 1UUSA 3EDTB 5CERB 3PUSA 4ZHQE 1TNZA 4IULA 4U07A 1OEDC 5ITZF 4G63A 3ASDA 4ZI2D 1JPLA 4GK5E 2C2LA 4KP3C 1FMWA 2GRMA 2DNXA 1NL4A 5HEHA 3CQGB 3ML8A 3TLWA 2ACZA 4U8VD 2IIUA 4HFGA 4KZCA 4HWCA 3UTMA 4CGVA 3FU5A 4WW0A 1XMQT 3ZJ1A 2E5VA 4HOQA 5BV1A 2J07A 2WXFA 3D9NA 4Z91A 3UU6A 2P9KG 3PRZA 3CVYA 3APCA 4IE5A 3RSEG 5HXHA 2WCAA 5EK2A 3AE2A 5E76A 2X66A 1MMNA 3N2OA 4PFOA 2BG9E 1WR0A 4CN6A 3RRUA 1WLXA 1MJ0A 4UF0B 3PVLA 3CIAA 2XRYA 3MA5A 2L9QA 4DR3T 3ZYMA 5FNVE 1N32T 3RIAA 3FHEA 1KNRA 4DBRA 1S94A 1G3NB 1BR1A 3TLUA 1TN6A 1XWMA 2D9DA 4MBQA 1QSDA 5J1GA 4JEUA 3SFDA 4EAHA 4HOSA 2CG2A 2EHOD 4UVBB 2LM9A 1H2UA 5FY7A 2BKOA 3FTXA 2C0SA 2WMNA 3IKOB 2DZNA 3TL5A 5BPPA 3JQ1A 4DV7T 4TZ4C 2V5FA 2KZTA 1IBLT 4O1PA 2LRKA 3CHMA 5HRYA 2W00A 5C2YA 4FLHA 3BK9A 1HH8A 3HXFA 3L6AA 2KWHA 4N5QA 4JI4T 3AA1B 4A56A 4UEMA 1FVFA 4XI9A 1MIVA 4J8DA 2VURA 3OVUA 4GTSA 1HCIA 2MRIA 2PZIA 3NOGD 2JABA 2EHOB 5ARFA 5KBAA 3ETUA 1YQ4A 2MYOA 1NZNA 3RJVA 2GRNB 4OAUC 3O48A 1TN8A 4LERA 3NBNB 3FZLB 4NUVA 3TAXA 3JC6C 2JRKA 4AQGA 3ZMSB 5L4EA 3T8KA 3CSFA 2G0UA 4UF0A 3FUIA 4ANUA 4PUCA 4LF9T 3HKCE 4ZI3C 2ZM6T 3HXCA 3Q7AA 3N71A 1FMVA 5FVLA 5CB4E 3SFZA 2GRLA 4DX2A 3PJAJ 2XAHB 4K0KT 4YDEA 4HQDA 2V5QC 1UJJA 3PZ2A 2F37A 5FKYA 4FADA 4GYYA 4PS7A 2BVLA 2XJ7A 2M6IA 3ML9A 1JWFA 3ZT7A 3ZLIA 3RHWA 5JRCB 3NOCD 3TG5A 2LT3A 1O1TA 4N78D 4WUYA 4B3TT 3U66A 5JDFA 3KVBA 4IL4A 4YT0A 5JDGA 4GTOA 4A97A 2RA1A 2WXKA 3HR0A 2Y48B 4JUYA 2IO2C 5JMND 4HORA 3FTVA 1WM5A 4DR2T 2IDOB 4H63H 1Z5SC 2DLRA 3Q2MA 4KVOA 5EZYE 3PUZF 4DV4T 2E5LT 1CHUA 1ZOYA 3SY2A 2B0OE 1YMPA 2LSIA 2CHZA 4AIFA 2XPZA 3AA0B 3R6NA 2R02A 3PV0F 2L0IA 1H6PA 2KC7A 2MOZA 3UU5A 4YJ2E 4JL0A 5FIOA 4R7LA 2Q9QD 3UQ7A 1J1JA 3C72A 4KBQA 2VASA 3M65A 2NC9A 4GCNA 4W9RA 4WNEA 1IBKT 1YQ3A 3AVSA 2X51A 4EQFA 3DSWA 3MKDA 1S63A 3UULA 3ASHA 4G24A 2XGOA 4NIKA 2WP9A 3LDZA 3AE6A 2RD0A 1O3XA 2RPAA 3SHFA 4AKLA 4K0RA 3EVYA 3HIZA 2Y1LE 2R05A 2UY1B 2VVNA 2W63A 4ANVA 2BF0X 2X9XA 3RKVA 4AJWA 4L9IA 3MYVA 3CK9A 4NXNT 1QYMA 1BU9A 1ZHCA 2KINB 3DJBA 2WXRA 5EK4A 3RYIE 2CPTA 1Y64B 2WWUA 3AB3B 4EZ4A 4ZI3D 3RKOA 3ZYKA 3FUFA 5LOVE 3EABA 4K0UA 3P1UA 2LM2A 2W0GA 1IAPA 3SOLA 4C0EA 2J09A 4N3BA 5AQSB 3NZSA 1Z0PA 4GZ6A 2A3DA 3RIUA 5JQGE 2OVFA 4ANXA 2ZM8A 3QC9A 3E08A 2AWIA 2XZTG 4TUMA 1IQRA 3CIRA 2IFUA 5CA1E 2ODUA 4TNWA 2UXNB 1SUMB 4KBMB 1E8XA 3FU6A 5KJMA 3R7QA 5ENOD 4NUUA 2DCFA 2KCVA 3QB2A 3QWVA 4HKAA 3EU9A 2X6KA 5EYLA 1IXVA 4X1YE 4YDYA 2CWOA 2FUPA 2J1DG 2ZISA 3LJNA 2X0YA 3UKRG 4CDMA 4MLKA 1HS7A 4CT4A 2DIWA 1ELKA 4MS6A 3TWVA 4WWPA 2QFCA 4Z68A 3L22A 3QJZA 3S7DA 5LYJE 4ATZD 1Y8MA 3LJCA 3L8RA 2A4ZA 2XHEA 3ASFA 4HEAA 3JC6D 3S7BA 4GYOA 2J47A 5C1DA 3R84B 1YYHA 2BKGA 2ZXWE 3F57A 4HI8A 3EHMA 1OXJA 4X8QA 1LKXA 5JJTA 3KEAA 3Q9UC 3RX6A 3C3OA 4HLEA 3I0QA 3ABVA 5ABGA 3FWVA 3TG4A 4YSXA 1N0QA 4N3AA 2C0LA 3FUMA 3IEGA 3DSVA 2B6CA 5DBKA 3CK8A 2V26A 4U95D 2I59A 1M62A 3N9LA 4DR1T 1N11A 5L3GB 3V79K 1N9AA 4WNFA 3G2WA 3VRBA 1Z6TA 4UQXA 5FY1A 2GGFA 4DX7D 5KJLA 4AY6A 2YKSA 4U0SA 4OVUA 4PDXA 2X38A 5F8PA 4P29A 4TUUA 4A98A 2VL8A 3H3MA 2J8SD 3UI2A 3D3MA 4UV8B 4GIWA 4IL9A 2CBJA 4H7YA 4I2ZA 2CFUA 4U7IA 1NI1A 3MKQB 5LX8A 3JYSA 2H6HA 5CEDB 2CWYA 4JZYA 4DVDA 4ACKA 2RP4A 3AEDA 3U3IA 4C90A 4IYPA 3Q78A 3AS4A 3ABME 3CVPA 2I1KA 4DV6T 2V1DB 4KXKB 2K24A 1R8IA 2IU1A 4V1Av 4CZ2D 4EEDA 3LK42 3HKEE 2JPFA 3MKQA 1NENA 2VKOA 2AJAA 4C0MA 3P7IA 4QWNB 3T1HT 2KMFA 1W0AA 2V7IA 2FO7A 4KVMA 4H7XA 4GA0A 5E0OA 3PJAA 5ETWA 2CFZA 3LEWA 3ASGA 3E32A 4XKCA 3AAEB 2QY7A 3FUJA 4LNGA 4RSYA 3D9OA 2JMHA 3FB2A 2V5CA 3PREA 4J8YA 3TWUA 3EI0A 3PTRB 4CI3B 4I6GA 3I9WA 4APOA 4BX8A 3HL6A 4URKA 2V4HC 3MXZA 3CVXA 3ONLC 4AIUA 5JDNA 4IREA 3ZMVB 3B7TA 2ES0A 3AJIA 4DK5A 4PJMA 2LSVA 4N2QA 3SF4A 5CRUA 4NACA 3ZFWA 4O4JE 4ABNA 4ILUA 4KHPT 2I1JA 5G04C 3JAEA 1A17A 1G8XA 3N9OA 5IWAT 2P9BA 4O8SA 1WY6A 5H7PA 4APFA 3C64A 4DO0A 5JTGA 5LHGB 2NP9A 2WQ7A 3NRYA 5D66A 5LP0A 5HWYA 3IBPA 3ANWA 2XQ5A 1W3BA 4EOZB 4LFBT 2DHRA 4GYRA 4ZS2A 3PZ3A 1KNZA 5FQ7A 4HWHA 3ONJA 2EINE 2IAKA 3P4RA 4QKNA 3FZKB 5ABEA 1JCQA 3MZKB 4LF8T 2ILRA 4AY5A 4DLQA 3APDA 5CFBA 1OWPA 1S70B 4WAFA 1E7VA 2PM7A 2KM4A 3MV2B 1N95A 3A5XA 2LSUA 1IKND 5H6QB 3JAFA 4N5CA 1E90A 4HXIA 3RQUA 2IOLA 3AE8A 3N5LA 5EX3A 3PUXF 2QC9A 3JCKC 3G2TA 1N36T 5H6RB 4DNDA 4L1BA 4QQIA 1ELRA 5D0OD 1PAQA 1HR0T 1V54E 2V0PA 1EF1C 3NZQA 1U5PA 1Q2ZA 3PS6A 1DU2A 3AE9A 2LKHA 5LG4A 4A3TA 4HFBA 2NSZA 3VR9A 2Y4UA 4LSZE 3PUQA 1HU3A 5CMYA 4HVBA 3AG1E 2UU9T 4OK0A 3HXDA 4KI0F 4DR4T 2HR2A 1TJCA 4HRNA 3V31A 5ANRA 5CBNA 3HKDE 3Q5DA 4LMLA 4GTQA 2VKDA 3C98B 2BZBA 3N2GE 2V4LA 4H9QC 4F3VA 2LSJA 3PDNA 1O1SA 1HNXT 4FP7A 3ZU7B 5LCYA 3FUKA 5L3CB 3RKGA 4AKHA 1SA4A 1IHBA 1FT1A 5BR8T 5DQVA 3UPVA 5IY5E 3ZT6A 2KXPC 4NPPA 5C3JA 4JI8T 2BG9C 4BEPA 2OVBA 3FHNA 3ZHEB 2D5UA 3PZDA 3ZIMA 5BXUA 2JQ9A 4JEHB 5AQBA 2HH7A 3CSTA 5HXCA 2P9SG 4XIFA 1LTXA 5G04J 4BJMA 1E8WA 2X68A 4HFHA 1YW0A 4F8HA 1HX8A 3KSLA 1T8BA 2H6FA 4I6EA 5JHAA 4BTBA 3F31A 4ZEYA 3ZRHA 5FQ6A 4IDNA 3EAMA 1TNYA 5JA4D 5ANLA 5DIZA 2V6YB 2BDEA 4CYMD 3EDVA 3PNTB 3GZ2A 4GZDA 4J7WA 5FINA 4I9CA 3CX7B 2P9NG 4NIQA 2K9AA 3UU3A 2I0MA 5AQHB 3URZA 3CHPA 1NFIE 3W15B 1N4QA 5AQ7A 5ABFA 2IW5B 3PE4A 4LF6T 3PEVB 1G73A 3BUAA 3E33A 3QAQA 4KT6B 3EIQC 2X6HA 4KX6A 3LPZA 4A1SA 2XQYA 2XAFB 2XQ4A 4IDQA 3C51A 2QYJA 3FDHA 3KBUA 3QB5K 2WBLA 3TXNA 5HCJA 4F6RC 4NRHB 3VKHA 1UURA 2CXLA 3ZN3A 2E9XA 2C5IT 5AFUL 3P4PA 4KMOA 2BKNA 3RYFE 2AXUA 1E1HB 5EDSA 3RO2A 4UQZA 1N34T 4H9SE 4DMWA 1UG3A 5FVKA 2LXMA 2PBIA 4HFEA 5KWDA 2XCBA 4I4TE 4AQYT 2WXGA 4IIJE 2LJLA 3KV5A 3AU4A 4I43B 4N2SA 2LOSA 1LRZA 4MHCA 2EIJE 2XS8A 2LKGA 2IUBA 4FI5A 2J4GA 3LVRE 3AE4A 4A1GA 2VGXA 3UIOC 5HEJA 5FJYA 4AP2A 1SZ9A 3OYZA 3K8PC 4J2CA 3LFMA 3ZC1A 2XQ6A 4I1MA 3UM1A 4F1SA 5FXXA 2IJGX 4XAXB 4J8SA 3ZYQA 2UUAT 5G05C 3VTYA 5LBMA 1KT1A 2KZTB 1H7CA 4YXDA 4B8CB 3QUJA 3LBXA 4JI5T 3LG7A 4HLLA 3DP7A 3B7RL 1DCEA 3B13A 1EZ3A 2Q9QB 2HE0A 2MPKA 1IZNB 4U04A 1W09A 1AJ3A 4I6JA 4JHRA 2PG8A 3ZEFB 3ZVVA 2KSRA 4GB9A 3QK6A 3CVWA 4UWGA 1SQMA 3PUVF 3UXGA 2NOXA 4DV0T 2WVIA 2XQ3A 4PS3A 4X20E 2P9LG 3MV3B 2OOEA 5KMGP 2XZEA 4U2ZA 3UKUG 3ZHEA 3ASOE 3R7RA 4BY6A 3ZW3A 2FBWA 1KLXA 4JA9A 5JHBA 2VGEA 4B93B 2CCQA 2DL1A 3ZCJA 2V7MA 4CZZB 4E85A 3Q9NC 1ZBPA 3UUXB 2XSAA 5LJMA 3EU5A 2YHEA 3ZPOA 3SBSA 2E8IA 4I55E 3FTSA 2NW9A 5BNWA 4DLOA 3RLFF 4I1OB 2LXLA 3VTXA 5EKQD 3CX6B 5FTPA 3CWZB 3QB5A 3SZ7A 5J0ZA 4O2AE 3CKCA 2KWIB 2N2NA 2V6YA 5IHYA 2LNIA 5FZSA 4O4HE 5JDHA 4CEMA 2BS2A 3JXIA 5AQTB 3LJ3A 2Y3AA 4UELA 1LD8A 2WXHA 2H7OA 4O6FA 1D8EA 4FJOA 2I9CA 4IGUA 4WWNA 1V55E 3PUGA 4FULA 4COFA 4CI1B 3AAIA 3K3QC 5IYZE 4GZCA 2YEVC 1NAFA 4RLYA 2LLYA 3DXMG 4G1TA 4KUMB 1OWMA 3SD5A 4AM9A 3T9KA 1MIWA 1D1CA 4LMKA 3FUDA 4DIDB 5FYMA 2UXCT 3B7BA 3CHOA 3EIJA 3Q47B 1W9RA 2X67A 2HM8A 3UMVA 2H6IA 2V8SV 2XEHA 1UN9A 4O2BE 1VCTA 2MOWA 5CBOA 3AEGA 1VCSA 2KT9A 4FHJA 3IHYA 4JI6T 2QZAA 4ANJA 4PW8A 2WXLA 4TXQA 4Q96A 4ZHBA 3FU0A 2E2EA 3CVVA 2PQRA 5HXSA 1IHGA 5LXTE 4JBWF 4G8LA 3MCXA 4UWHA 5FQ4A 2H6GA 2VJ8A 3HXBA 3W9FA 3RRCA 3LY9A 2DWGA 4UXNB 4P09A 4EYYR 2V7LA 2VYIA 1E2AA 3S2AA 1BD8A 4DI4A 1HX1B 3FXEB 5HXEA 2YU1A 4A63B 1VOMA 4PJNA 2IY0C 1TR4A 4WWOA 2HO1A 2ETAA 1FIOA 2VKHA 1OXZA 4GTPA 1OWNA 2A5EA 1JNZA 1E96B 4U2YA 3U78A 5JDMA 4CDRA 3NQPA 4L9PA 2BS3A 3B7UX 3NZUA 1Z3YA 2VSYA 1X5BA 1D1BA 4B3MT 1VRBA 3MGBA 5ENQD 4HBDA 1MX4A 2YN6A 3LXUX 1WAO1 5ADXL 4IE4A 4KHZF 3GWHA 1AP7A 3SI5A 4B6XA 4LF4T 2F4VT 2AXZA 3B95A 2L3LA 3KEZA 4PK5A 4PNIA 3SRZA 4QXHB 5JVDE 2Q7FA 4KYOB 4AVXA 2WB2A 2WB5A 4U33A 2BKPA 3MZLB 1B89A 2XCCA 3N9PA 4FHKA 3QARA 4GCOA 4JHKA 5AN8A 3KS2A 5AAOA 4AOFA 1ZU2A 2LHNA 3JCFA 4YHHT 3ENEA 2XS1A 2W67A 5ABHA 3BQKA 4JA7A 2W66A 1YXRA 3X2QE 4AKGA 3AXJA 5KJNA 1W0BA 5A7DB 4A55A 2XQ9A 2RG8A 3KSQA 5EIDA 4LFAT 4BETA 3AECA 5D2MC 4EZHA 2FI7A 3L82A 1QNFA 2X6JA 5AQAA 4JV5T 2J62A 2JQHA 1VDYA 4AXPA 4JI1T 4HN9A 4TWHA 3AAAC 3AVRA 3IV0A 1IJ6A 2M63A 2P2CP 5CA0E 1OWLA 1U3DA 2F0YA 4DX6D 3JUEA 3O4ZA 4U74A 4ZI2C 5KXJA 2WMOA 2XAQB 4HRLA 1SA5A 4G23A 3ASNE 5LCWJ 2IF4A 2WQYA 2LAHA 3ZJ2A 3RIBA 1NA0A 4CGWA 4M7CA 3AA6B 1E8YA 3S4UA 4DV3T 2A72A 3LBXB 2X9YA 2R5SA 4CQIA 2QYWA 5AQIB 3ZMTB 3OXFA 5TAOA 1KPSB 2IC6A 1JCSA 5AIJA 2VK9A 3HI2A 4EXTA 2XENA 1JNRA 4EEBA 2WPVA 3CVUA 2FJBA 3UQ3A 1X81A 3Q5XA 3GN5B 3KINB 5AJLA 3VLDA 2Q9QC 3HYMB 2UUBT 2OA5A 3DRAA 3SFEA 5JREA 4I2WA 4K03A 5KX5E 1HS6A 2ETCA 3S7JA 3ZNGA 4YNDA 3QOUA 4C48B 3KBTA 2HHHT 4FLBA 4CDNA 3SWHA 5C2TA 5CCLA 2LHRA 4YVQC 3QWWA 2V8SE 2GRQB 4HTEA 4LF5T 1E8ZA 3OTOT 1ZEEA 4QX7B 2QGSA 3BQOA 3P4SA 5AQNB 5GONE 2CM0A 4QXCB 2HPLA 1D0XA 3BQIA 1RW2A 4K5CA 3RC8A 5J2UE 3AEEA 5JJ6A 1SVXA 4HFVA 1YD8G 4I50E 3PE3A 3GA8A 2NW8A 3MACA 4DI3A 4LEUA 1K1BA 4K5AB 3GW4A 4BESA 5FXZA 1M7KA 4YHJA 2AE9A 2BEDA 4L5GA 3TWTA 4N3CA 2CRBA 4BA9A 1SA0E 2H89A 3V5UA 4KZ0A 3GZSA 4N39A 5EN5D 3D9LA 4J8EA 5L4HA 4U0ZA 4JC8A 3ONLA 1EDUA 4DV5T 3H3AA 3UUXA 1QZ2A 4TWFA 3AG2E 2NTYA 3ZSTA 1OY3D 1EPUA 4TUYE 1S64A 3CEQA 4IE0A 4Q69A 3G2SA 1XZYA 4NQ0A 4CXXA 2ZM0A 2J49A 3IA3A 4G2VA 3EHRA 3N9NA 1I94T 3ZMUB 4HB5A 3EUHA 2KLQA 3FZHB 1NWMX 2KCKA 1D9SA 3TWSA 3AU5A 4E7ZA 2WY2A 5HCMA 3HG0D 3ESLA 3P50A 2UWJG 2VSNA 3HVEB 3UM3A 3OYXA 2D0TA 4ZZCA 4YLHA 3RRMB 4J0UA 5AQUB 4P0BA 3Q75A 3NRXA 5JR9A 3C4WA 5ENSD 2EIKE 1DC2A 3ZUVB 2NXPA 5KCMA 4U31A 2LOPA 2FEZA 5AQLB 1KT0A 4ZOLE 4U8YD 4QH1A 2R03A 4XEIG 5HKPA 4UVAB 2LSGA 5AENA 2EHOA 1XDOA 1OEDB 1MX6A 3FH8A 4JI3T 2AVPA 2UXDT 1SZAA 4XX5A 3MEKA 2VTBB 3UQ4A 1MMGA 2VQFT 3LS8A 4GAAA 5HQ8A 3P8CD 1Y6IA 2RKKA 4PJJA 2ZU6B 4XE0A 2WU5A 3T8OA 3TWWA 4BWRA 4GKJT 2CBIA 3PU3A 5AQJB 2WXOA 3D9KA 3GZ1A 3PUJA 1KF6A 2V5DA 1BR0A 2X6IA 4YTNA 3DSXA 3ZEFA 1WR6A 2JEKA 4YJ3E 1D0YA 2LSYA 2YU2A 5AQ9A 4X62T 2J4BA 4F6RD 3P2BA 3UIPC 3AE1A 1TNOA 2BUGA 3U64A 4EZLA 4EGWA 3FBZA 4EPZA 2R2LA 3FP3A 4UR9A 2BG9B 3WI3A 4I9EA 2KXPB 2XPIA 5ARGA 5AQQB 2XHEB 2WU2A 2I6HA 4L0RA 4CN1A 2VGYA 5CEAA 3HHMA 4JW1A 4OYKA 4GYSA 4BSXA 4JEUB 1ZB1A 5ENPD 4MKTA 4PK4A 3S7FA 4FJZA 4B89A 3RQWA 1BPOA 2KZ7B 3RH3A 1OCOE 4YVOA 4LMJA 3SFXA 2E0IA 3ZKJA 2BBHA 3C3RA 3ISMC 4MRUA 3VHLA 3I9YA 5HWXA 2XQ0A 2CLYB 5LMNT 1TJFA 1IBMT 5G2NA 2KATA 4K5BA 3TLTA 4TV3A 2CHOA 1I6ZA 3HDXA 2L8KA 3V2OA 1YKHB 2OEVA 2ZLYA 3KD7A 4TV8E 1KZPA 2E9XB 3UT4A 5HI7A 5KDMC 4ME2A 3PUAA 1U2VG 3I0OA 5AQVB 1IYGA 4UIGA 4IN3B 3F6QA 1LVKA 2WSSV 3FBLA 4HWFA 3C3QA 3FUHA 5A1LA 1H2TC 4G25A 2CG3A 3RK6A 3DPYA 5JJ7A 5ABFB 3UX4A 1ZV4X 4P1NA 2CXDA 2ETBA 3PDYA 2JIWA 3LDQB 1SE7A 2IOSA 2H88A 2XAGB 3CK7A 1H2VC 3PZ4A 5T8IA 3RGLA 4GMLA 3CVLA 3UU4A 2GW1A 5HEOA 1FCHA 1YCSB 2UY1A 3NF1A 4CN4A 2EILE 5LBQB 2X9WA 4L23A 4TXPA 2VL0A 2FJDA 3VLFA 2UXXB 3CX8B 2BVMA 3HKBE 3NKZA 2J4DA 3CK6A 1BI7B 4FU3A 4D10C 4PAGA 3PNLB 2YQ8A 4G2AA 2DCPA 2VQ2A 3L54A 4FA6A 3D0TA 2DVWA 2XQAA 3Q5WA 3CLJA 3LY7A 4JB8P 3P4WA 1BI8B 2GROB 4PH4B 4EBAG 3CHQA 3ABLE 4B94A 3MJWA 1UN8A 5J2TE 4EV6A 3FFLA 5CMWA 4EZKA 4ACLA 2CXFA 5L3EB 2YDSA 3ZCIA 4HI9A 3O4XE 3AA7B 3RF1A 4L7TA 3SBTB 3RU0A 3ETVA 3NAWA 5KNGA 4ILBA 4QH4A 4Q25A 5AQGB 1FVHA 3FZMB 4LF7T 4BT9A 3FTUA 4ZZBA 2K48A 4ZI7E 3G2VA 2XRZA 1TN7A 3FEYA 1MQSA 4HNAD 3SS1A 4BAYB 4AEZC 3E4BA 4B0ZA 3NB2A 2MAWA 3SGHA 4IE7A 4GKKT 3I3NA 1H19A 2NTXA 3KV6A 1N0RA 3D9MA 4WNGA 1WCRA 4JD2G 5AARA 5JR9C 1Y01A 3RYHE 2BBJA 4ATGA 2Q9QA 4GMRA 3A7MA 5EK3A 5J08A 3Q5EA 3ZXPA 2FULA 3RIUC 1MMAA 2JMKA 2HN1A 3LSVA 4DUYT 1MHQA 2DYRE 1FT2A 1WDYA 3KVAA 2VSXE 3QWPA 2R6GF 3ZSSA 2RFAA 3PU8A 5FY0A 1E7UA 2WXNA 3IF8B 3FTYA 4GPMA 4WYVA 2PNNA 2L0TB 4O4LE 2V6XA 2YOEA 4X64T 2XEVA 4TV9E 3BEEA 5M72A 3JXJA 4A3VA 3SO8A 4EZJA 2C5JA 1OCZE 3J5PA 3L13A 3AE3A 2ZMAA 2VWAA 2PFVA 4CRWA 1OT8A 5FMNA 2DBAA 2V7JA 2CE7A 2WDVA 2X0LB 3MK7C 2C5KT 2CHXA 1U3CA 1V9DA 4LRZA 5ENNA 2B1EA 1N4PA 3D9JA 2WQHA 2L6BA 4U72A 5AYWD 5FZQA 1RZ4A 2YNQA 1E7PA 4X1KE 3UUBA 3O9XA 4L2LA 3WAJA 4X5TA 3V5SA 2LSKA 3I1AA 3PZ1A 3O1JA 4B3RT 2DZOA 3E34A 1MIYA 5BV0A 1MNEA 5M4YA 4LNUD 4C9BB 5C8YE 2FBNA 2DI4A 4G8KA 4UUCA 4DUIA 4ASKA 3LK2B 4BT8A 1HG2A 4XZCA 1XNRT 4RQIA 4OYJA 1YA0A 3VLEA 1XDPA 3SFYA 4GA2A 5BW8C 3UT7A 4DX5D 3Q9DA 4ISSA 3FEXA 3Q5MA 4BFRA 2IQCA 5EIBE 3L3PA 3RI5A 5JH7E 1H0AA 1QQEA 2QA7A 2FJAA 2F8YA 4OVVA 4P0AA 4UVCB 4EYUA 4GA1A 2VTBA 2KNDA 1SW6A 4YTMA 3QC1A 3CMLA 4LNBA 3PURA 2CA5A 5FXVA 3E37A 5EX0A 2XUEA 3QDNA 3G06A 1DVPA 1QUUA 4DUZT 1HO8A 3QNUA 2D0UA 2LE8A 3KAEA 4XZ4A 2ZIRA 3AAAB 1OEDE 1NP7A 2XGSA 3C5RA 3L08A 3ZT5A 3CPZA 3UU8A 1H6OA 3CR3A 3TLVA 4EBAA 2AW6A 3AG4E 3VR8A 4UI9K 4CXWA 1O1RA 3N9MA 4BJNA 1LF8A 4TN7B 1K3ZD 3TGOA 1HXIA 2GRRB 4ZFHA 2V7KA 1YKEB 3AEBA 5AQOB 4IHJE 2L9BA 1LD7A 3LYAA 3ESKA 3KV4A 1N33T 5L3FB 4DR5T 2IONA 2HPJA 4IDOA 3UFGA 4OFZA 3T8MA 5HEUA 4CT0A 3EDUA 4ILAA 4CCAA 3PUKA 3ULEG 1L0VA 3ONKA 2LO6A 4FC8A 3T5VA 4J8FA 3AXJB 3ABKE 5KJKA 4Y6CA 4HOTA 3ZGQA 4IRUA 3U3WA 4HE8A 3IHVA 2E9XD 4HFDA 5JRCA 3F2EA 4UV9B 5HXRA 1ELWA 3DSTA 3O1IA 3HXEA 4GK0E 5HS0A 4LCTA 4HFIA 4AKRB 2EIME 2IEJA 4H9RC 2QYUA 4JPSA 1N4RA 1J5ET 2DWZA 3UM2A 3PE0A 2ZGDA 3P4QA 1D1AA 3FTZA 1GQEA 1K1AA 4C91A 2B76A 3UFEA 3VU7H 2CHNA 3OBVE 2CHWA 2WXJA 3OXLA 1UW4B 4M3OA 3Q79A 3NZPA 4F53A 3FTWA 4DMVA 1J5WA 5AQMB 5A6CA 5BXOA 3Q7FA 2OEWA 4XBFB 5FT9A 4G26A 1OCRE 5AQKB 3RIFA 3RRNB 1MYOA 3JADA 2P58C 4A5XA 4JVSA 2E2AA 3EHNA 3DTOA 1UX4A 2HN2A 2DYSE 4JHJA 2PJQA 4U7YA 3K9IA 1FEWA 4CXYA 3C4ZA 4O60A 4HS2A 4QX8B 1KNPA 3NBXX 3IEEA 3NWIA 3O1HA 2M6BA 4DBQA 3CKDA 2KBXA 1U4QA 3OXGA 5B1BE 3BQLA 3DWLG 3X1DA 3I4GA 3ANWB 4OX9T 4ZXLA 2X6FA 4DJAA 4V3IA 4WBNE 2BTDA 5DJQC 2WDRA 1HZ4A 2NYJA 4I17A 3Q73A 5J90A 2E9XC 2P9PG 3DBSA 4OYSA 2OCCE 4DX1A 4QXBB 2OLTA 3NVOA 5LHIB 2NWBA 4PS8A 1T7SA 2WXQA 2K5BB 4O4IE 1T72A 5LNKA 4DR6T 4Z90A 3R9MA 3UT8A 2X0HA 3CQCB 2BKKB 2JLBA 2P9IG 2ACXA 3MJXA 1MMDA 5ENTD 4BTAA 2WS3A 4JEHA 2EHOC 3AEFA 3WAKA 3KFWX 3BG1B 3I5PA 3Q4AB 4X1IE 3K3NA 3UUMA 4JI2T 1TNBA 2PM6A 1DCQA 2K3WA 3LVQE 2LAIA 4U7EB 2XPKA 3LCAA 3QKYA 2WQ6A 1HFAA 3OJAA 3E0ZA 3TXMA 3DXKG 3D9PA 2XSBA 5A23A 1TNUA 4U8HA 2NW7A 1FJGT 2QVAA 2YINA 3OPCA 3D9IA 4DV2T 4IDZA 3MA9A 3FH5A 3JQ0A 4QH5A 2R59A 2P9UG 5AQPB 5LA6E 2H3RA 5DABA 2ZGGA 3ULYA 3MKRA 4NURA 2WM9A 2JJ9A 4U96D 3FXDB 3HVEA 3Q49B 2IO3C 2F8XK 3B5MA 4YSZA 4L2YA 4B3ST 3QK0A 3FH7A 1HE8A 2WDQA 5AQRB 1HNWT 3E30A 4Y6WA 1K8KG 3ZKRA 5FZRA 4MLPA 4HFCA 1KFYA 5DQWA 2VGXB 2LRLA 3KDSE 4GTTA 4H9PC 4G11A 1HTJF 3R9AB 4AV7A 3TJPA 2QRXA 3AG3E 1JUQA 4YFSA 3N2KE 1QBQA 3CQXC 1X9BA 3CHSA 5LHHB 4EB6E 4AKIA 2CMRA 4U3CA 4ILIA 4DV1T 5B3SE 3LKUA 5CRVA 1UK5A 2SPCA 3AE7A 5F3JA 3CVQA 3FULA 3QOFA 4ISTA 2M67A 3I4RB 4UQYA 4IE6A 2OV8A 5CJ5A 4O1OA 4Q94A 3UM0A 2EQXA 2Y8DA 2PTFA 1IJ5A 2A9UA 2C0MA 2H7VC 4MALA 3UT5E 4FJYA 2XAJB 1HF8A 4ILGA 4I0UA 3VRAA 2XEEA 4PJLA 4GYWA 4IT4A 3UTKA 4QFVA 3SNXA 4ANWA 2CEAA 3H37A 2YDQA 1US7B 5LOZA 3FUNA 4PK6A 2W4XA 3M3ZB 4TX5A 5BMVE 5IUXA 1BR2A 3T1YT 2NR4A 3APFA 3L9TA 4UWFA 3BU8A 1H6KA 2XQ8A 4RG9A 4BERA 1UJKA 5G05J 4AQFC 2L6JA 3RAUA 1NA3A 1S0PA 4ADZA 2W62A 3AEAA 4GMJA 2N1GA 2GK9A 2WWVA 1MZCA 2ZM2A 4I43A 1D0ZA 1KK7A 3B57A 5JDQA 2BG9A 5CCMA 4EIWA 3AE5A 3G2UA 1A5EA 1Z3XA 1N4SA 5FL1A 3D9HA 3K3OA 4MBGA 3V30A 5L3BB 4Z8XA 3IBEA 4YDOA 3U9WA 4GTMA 1OEDA 2WZHA 4KMCA 2XPYA 3QNKA 3ZYLA 4UWKA 4ILHB 4GZ3A 3J9X1 3A8YC 5FXWA 3UUNA 5LP6E 4DPRA 1O5MA 4JXTA 1N54A 2MHKA 4ILCA 1KZOA 2XY8B 3KV9A 4TWDA 2XGMA 3UINC 4LUNU 1QLBA 1BLXB 2Y4TA 2XASB 1X79A 3ULQA 2Y6XA 4RG6A 4DR7T 2HYZA 1IQUA 1B7TA 3L09A 4H9OC 3EHZA 1NEKA 3ZXSA 2VQET 4NXMT 4U63A 2YHCA 5LCWC 3CV0A 5D0QD 2D2SA 1P5QA 1OWAA 5HEGA 3C98A 5LG3A 2MYSA 5HYAA
chains in the Genus database with same CATH topology
3DPDA 2LEHA 4WNKA 3EJNA 1MNDA 4UI9C 4H63V 1S35A 5FP3A 4F7AA 4H9NC 5JR9B 2N9DA 4U0UA 4QHOA 2PQNA 4PFPA 3AS8A 5LGTB 4XKBA 5CHEE 5L3DB 2VSOE 3VKGA 4GU5A 1OUVA 5FWQA 2FF4A 4WBOA 1CUNA 3MX3A 4AXHA 3BG0B 3CKBA 3FU3A 3WXXA 4HOUA 3ONXA 4EECA 4AQFA 3FUEA 3U4TA 1HG5A 4BX9A 3GMIA 1JWGA 2Z6EA 2I2OA 1UCUA 2DWKA 4MFRA 1DNPA 5L2LA 2KCLA 2A2FX 3RYCE 5JDLA 5LFAA 5E75A 4UWLA 2W61A 4M1PA 3ZMZB 1L5JA 4RVBA 1SHZC 3ZN0B 5HAXA 1INZA 4GOUA 1OWOA 2JQQA 5BT1A 1PY1A 3CHRA 3LY8A 4J6IA 3OKQA 2J9QA 3AS5A 3OAWA 1XGWA 2WXIA 5LGUB 2J08A 1UX5A 3RRWA 3N9QA 3ZC0A 3Q15A 3PEUB 2ODVA 2X9HA 3ZPJA 1LVFA 3TKLB 2MTQA 2YK0A 3GYZA 2CLYC 2WAUA 4ZS3A 4OHFA 3OTNA 4WNDA 3T5XA 3IHRA 5BUZA 2XTLA 5T4YA 5LGNB 5T3RA 3RO3A 4HGAA 3RPUA 4CI2B 1PC2A 3PH0C 3L16A 1WYCA 5AJDA 3HA4A 1XNFA 3FY4A 1T98A 4JLEA 3CGHA 2X3MA 3B7SA 5G55A 2PL2A 3L17A 4XI0A 1GW6A 2WXPA 4AI6A 4GPKA 1WYBA 3C50A 1WRDA 4GZ5A 2VB6A 4B8AA 5LJNA 4E7SA 4TRQA 3RC3A 1N52A 3LK3B 3J7Yq 4ERRA 1EYHA 1BR4A 3E22E 2AXVA 1ZKEA 3ZN1B 2WXMA 4UI9J 3CVRA 2IC9A 5FQ8A 3JUIA 3GN5A 1TEZA 3CVNA 2A5UA 2VKJA 2MBGA 2ONDA 2R17C 3C4XA 4I1AA 4E6HA 3EDTB 3PUSA 4ZHQE 4IULA 4U07A 4G63A 3ASDA 4ZI2D 1JPLA 4GK5E 2C2LA 4KP3C 1FMWA 2GRMA 2DNXA 3CQGB 3ML8A 4HFGA 4KZCA 4CGVA 3FU5A 4WW0A 3ZJ1A 4HOQA 5BV1A 2J07A 2WXFA 3D9NA 3PRZA 3CVYA 3APCA 4IE5A 5HXHA 5EK2A 5E76A 2X66A 1MMNA 3N2OA 4PFOA 3RRUA 1WLXA 4UF0B 3PVLA 3CIAA 2XRYA 3MA5A 2L9QA 3ZYMA 5FNVE 3FHEA 1S94A 4DBRA 1BR1A 4MBQA 1QSDA 5J1GA 4JEUA 4EAHA 4HOSA 2CG2A 2EHOD 4UVBB 2LM9A 1H2UA 5FY7A 3FTXA 2C0SA 2WMNA 3IKOB 3TL5A 5BPPA 3JQ1A 4TZ4C 2V5FA 2KZTA 3CHMA 2W00A 5C2YA 4FLHA 3BK9A 1HH8A 3L6AA 2KWHA 3AA1B 4A56A 4UEMA 1FVFA 4XI9A 1MIVA 4J8DA 1HCIA 2MRIA 2PZIA 5ARFA 2EHOB 3ETUA 1NZNA 3RJVA 3O48A 4LERA 4NUVA 3TAXA 3JC6C 2JRKA 4AQGA 3ZMSB 3CSFA 2G0UA 4UF0A 3FUIA 4ANUA 4PUCA 3HKCE 4ZI3C 3N71A 1FMVA 5CB4E 3SFZA 2GRLA 2XAHB 1UJJA 4FADA 4GYYA 4PS7A 2BVLA 3ML9A 1JWFA 3ZLIA 5JRCB 3TG5A 2LT3A 3U66A 4N78D 4WUYA 5JDFA 3KVBA 5JDGA 2RA1A 2WXKA 3HR0A 2Y48B 4JUYA 4HORA 3FTVA 1WM5A 4H63H 2DLRA 3Q2MA 4KVOA 5EZYE 2LSIA 2CHZA 4AIFA 2XPZA 3AA0B 3R6NA 2L0IA 2KC7A 2MOZA 4YJ2E 4JL0A 4R7LA 2Q9QD 4KBQA 2VASA 3M65A 2NC9A 4GCNA 4W9RA 4WNEA 3AVSA 2X51A 4EQFA 3MKDA 3UULA 3ASHA 4G24A 2XGOA 3LDZA 2RD0A 1O3XA 3SHFA 4AKLA 4K0RA 3EVYA 3HIZA 2UY1B 2W63A 4ANVA 2BF0X 2X9XA 3RKVA 4AJWA 4L9IA 3MYVA 3CK9A 1ZHCA 2KINB 3DJBA 2WXRA 5EK4A 3RYIE 1Y64B 2WWUA 3AB3B 4EZ4A 4ZI3D 3RKOA 3ZYKA 3FUFA 5LOVE 4K0UA 3P1UA 2W0GA 1IAPA 3SOLA 4C0EA 2J09A 4N3BA 3NZSA 1Z0PA 4GZ6A 2A3DA 5JQGE 2OVFA 4ANXA 2ZM8A 3QC9A 3E08A 2AWIA 1IQRA 2IFUA 5CA1E 2ODUA 2UXNB 4KBMB 1E8XA 3FU6A 5KJMA 3R7QA 4NUUA 2DCFA 2KCVA 3QB2A 3QWVA 4HKAA 2X6KA 4X1YE 2CWOA 2J1DG 4CDMA 4MLKA 1HS7A 4CT4A 2DIWA 1ELKA 4MS6A 4WWPA 2QFCA 3L22A 3QJZA 3S7DA 5LYJE 1Y8MA 3LJCA 2A4ZA 2XHEA 3ASFA 4HEAA 3JC6D 3S7BA 4GYOA 5C1DA 3R84B 3F57A 3EHMA 1LKXA 5JJTA 3RX6A 4HLEA 3I0QA 3FWVA 3TG4A 4N3AA 2C0LA 3FUMA 3IEGA 5DBKA 3CK8A 2V26A 2I59A 3N9LA 5L3GB 4WNFA 3G2WA 1Z6TA 4UQXA 5FY1A 2GGFA 5KJLA 4AY6A 4U0SA 4OVUA 4PDXA 2X38A 5F8PA 4P29A 4TUUA 2VL8A 3D3MA 4UV8B 4GIWA 4H7YA 4I2ZA 2CFUA 3MKQB 5LX8A 3JYSA 2CWYA 4JZYA 4DVDA 4ACKA 2RP4A 3U3IA 4C90A 4IYPA 3AS4A 3CVPA 2I1KA 2V1DB 4KXKB 2K24A 2IU1A 4V1Av 3LK42 3HKEE 2JPFA 3MKQA 2VKOA 4C0MA 3P7IA 4QWNB 2KMFA 2V7IA 2FO7A 4KVMA 4H7XA 4GA0A 5E0OA 5ETWA 2CFZA 3LEWA 3ASGA 4XKCA 3AAEB 2QY7A 3FUJA 4RSYA 3D9OA 2JMHA 3FB2A 3PREA 3PTRB 4CI3B 4I6GA 3I9WA 4APOA 4BX8A 3HL6A 4URKA 3MXZA 3CVXA 5JDNA 3ZMVB 3B7TA 2ES0A 4DK5A 4PJMA 2LSVA 4N2QA 3SF4A 4NACA 3ZFWA 4O4JE 4ABNA 4ILUA 2I1JA 5G04C 1A17A 1G8XA 3N9OA 2P9BA 4O8SA 1WY6A 4APFA 3C64A 4DO0A 5LHGB 2NP9A 2WQ7A 3NRYA 5LP0A 5HWYA 3IBPA 3ANWA 1W3BA 4EOZB 2DHRA 4GYRA 4ZS2A 5FQ7A 1KNZA 2IAKA 4QKNA 3MZKB 2ILRA 4AY5A 4DLQA 3APDA 1OWPA 4WAFA 1E7VA 2PM7A 2KM4A 3MV2B 3A5XA 2LSUA 5H6QB 4N5CA 1E90A 4HXIA 2IOLA 3N5LA 5EX3A 3JCKC 3G2TA 5H6RB 4DNDA 4L1BA 1ELRA 5D0OD 1PAQA 2V0PA 1EF1C 3NZQA 1U5PA 3PS6A 5LG4A 4A3TA 2NSZA 2Y4UA 3PUQA 1HU3A 5CMYA 4HVBA 4OK0A 2HR2A 1TJCA 5ANRA 3HKDE 2VKDA 3C98B 2BZBA 3N2GE 2V4LA 4H9QC 4F3VA 2LSJA 3PDNA 4FP7A 5LCYA 3FUKA 5L3CB 4AKHA 5DQVA 3UPVA 2OVBA 3FHNA 3ZHEB 2D5UA 3PZDA 3ZIMA 4JEHB 2HH7A 3CSTA 5HXCA 4XIFA 5G04J 4BJMA 1E8WA 2X68A 1YW0A 1HX8A 4I6EA 5JHAA 4BTBA 3F31A 3ZRHA 5FQ6A 5ANLA 5DIZA 2BDEA 3EDVA 3PNTB 3GZ2A 4GZDA 4I9CA 3CX7B 2K9AA 3URZA 3CHPA 3W15B 2IW5B 3PE4A 3PEVB 1G73A 3QAQA 4KT6B 3EIQC 2X6HA 3LPZA 4A1SA 2XQYA 2XAFB 3C51A 3FDHA 3KBUA 2WBLA 3TXNA 4F6RC 4NRHB 3VKHA 2CXLA 3ZN3A 2E9XA 2C5IT 5AFUL 4KMOA 3RYFE 2AXUA 1E1HB 5EDSA 3RO2A 4UQZA 4H9SE 4DMWA 1UG3A 2PBIA 2XCBA 4I4TE 2WXGA 4IIJE 2LJLA 3KV5A 3AU4A 4I43B 4N2SA 2LOSA 1LRZA 4MHCA 4FI5A 3LVRE 4A1GA 2VGXA 5FJYA 4AP2A 1SZ9A 3OYZA 3K8PC 4J2CA 3LFMA 3ZC1A 4I1MA 4F1SA 5FXXA 2IJGX 4XAXB 4J8SA 3ZYQA 5G05C 3VTYA 5LBMA 1KT1A 2KZTB 1H7CA 4B8CB 3QUJA 3LBXA 3LG7A 3DP7A 3B7RL 3B13A 1EZ3A 2Q9QB 1IZNB 4U04A 1AJ3A 4I6JA 4JHRA 2PG8A 3ZEFB 3ZVVA 4GB9A 3QK6A 3CVWA 4UWGA 1SQMA 2NOXA 2WVIA 4PS3A 4X20E 3MV3B 2OOEA 5KMGP 3ZHEA 3R7RA 4BY6A 3ZW3A 1KLXA 4JA9A 5JHBA 2CCQA 3ZCJA 2V7MA 4CZZB 4E85A 1ZBPA 3UUXB 5LJMA 2YHEA 3ZPOA 3SBSA 2E8IA 4I55E 3FTSA 2NW9A 5BNWA 4DLOA 4I1OB 3VTXA 5EKQD 3CX6B 5FTPA 3CWZB 3SZ7A 4O2AE 3CKCA 2KWIB 2N2NA 5IHYA 2LNIA 5FZSA 4O4HE 5JDHA 4CEMA 3LJ3A 2Y3AA 4UELA 2WXHA 2H7OA 4O6FA 2I9CA 4FJOA 4IGUA 4WWNA 3PUGA 4FULA 4CI1B 3AAIA 3K3QC 5IYZE 4GZCA 2YEVC 1NAFA 4G1TA 4KUMB 1OWMA 3SD5A 4AM9A 1MIWA 1D1CA 3FUDA 5FYMA 3CHOA 3EIJA 3Q47B 2X67A 2HM8A 3UMVA 1UN9A 4O2BE 2MOWA 2KT9A 4FHJA 3IHYA 4ANJA 4PW8A 2WXLA 4Q96A 3FU0A 2E2EA 3CVVA 2PQRA 5HXSA 1IHGA 5LXTE 3MCXA 4UWHA 5FQ4A 2VJ8A 3RRCA 3LY9A 2DWGA 4UXNB 4P09A 4EYYR 2V7LA 2VYIA 3S2AA 4DI4A 3FXEB 5HXEA 2YU1A 1VOMA 4PJNA 4WWOA 2HO1A 1FIOA 2VKHA 1OXZA 1OWNA 1E96B 5JDMA 3U78A 4CDRA 3NQPA 3B7UX 3NZUA 1Z3YA 2VSYA 1X5BA 1D1BA 1VRBA 3MGBA 3LXUX 1WAO1 5ADXL 4IE4A 3GWHA 3SI5A 4B6XA 2AXZA 2L3LA 3KEZA 4PK5A 4PNIA 3SRZA 4QXHB 5JVDE 2Q7FA 4KYOB 4AVXA 2WB2A 3MZLB 1B89A 2XCCA 3N9PA 4FHKA 3QARA 4GCOA 4JHKA 3KS2A 4AOFA 1ZU2A 2LHNA 3ENEA 3BQKA 4JA7A 4AKGA 5KJNA 5A7DB 4A55A 2RG8A 4EZHA 2FI7A 1QNFA 2X6JA 1VDYA 4AXPA 4HN9A 3AVRA 3IV0A 1IJ6A 2M63A 5CA0E 1OWLA 1U3DA 3O4ZA 4U74A 4ZI2C 2WMOA 2XAQB 4G23A 5LCWJ 2IF4A 2LAHA 3ZJ2A 3RIBA 1NA0A 4CGWA 3AA6B 1E8YA 3S4UA 2A72A 3LBXB 2X9YA 2R5SA 4CQIA 3ZMTB 3OXFA 5TAOA 2IC6A 5AIJA 2VK9A 3HI2A 4EXTA 2WPVA 3CVUA 3UQ3A 3Q5XA 3GN5B 3KINB 5AJLA 3VLDA 2Q9QC 3HYMB 2OA5A 5JREA 4I2WA 4K03A 5KX5E 1HS6A 3S7JA 4YNDA 3QOUA 3KBTA 4FLBA 4CDNA 3SWHA 5CCLA 2LHRA 4YVQC 3QWWA 2V8SE 4HTEA 1E8ZA 1ZEEA 4QX7B 2QGSA 5GONE 2CM0A 4QXCB 2HPLA 1D0XA 3BQIA 3RC8A 5J2UE 5JJ6A 4HFVA 1YD8G 4I50E 3PE3A 3GA8A 2NW8A 3MACA 4DI3A 4LEUA 3GW4A 5FXZA 4YHJA 4L5GA 4N3CA 4BA9A 1SA0E 3V5UA 4KZ0A 3GZSA 4N39A 3D9LA 4J8EA 4U0ZA 4JC8A 3ONLA 1EDUA 3H3AA 3UUXA 1QZ2A 2NTYA 1EPUA 4TUYE 3CEQA 4IE0A 4Q69A 3G2SA 4NQ0A 4CXXA 2ZM0A 2J49A 4G2VA 3N9NA 3ZMUB 3EUHA 2KLQA 1NWMX 2KCKA 3AU5A 4E7ZA 3ESLA 2UWJG 2VSNA 3HVEB 3OYXA 2D0TA 4YLHA 3RRMB 4J0UA 4P0BA 3NRXA 5JR9A 3C4WA 2NXPA 5KCMA 2LOPA 2FEZA 1KT0A 4ZOLE 4UVAB 2LSGA 5AENA 2EHOA 3FH8A 2AVPA 1SZAA 4XX5A 3MEKA 2VTBB 4GAAA 1MMGA 3LS8A 5HQ8A 3P8CD 1Y6IA 2ZU6B 4PJJA 4XE0A 3T8OA 4BWRA 3PU3A 2WXOA 3D9KA 3GZ1A 3PUJA 1BR0A 2X6IA 3ZEFA 1WR6A 2JEKA 4YJ3E 1D0YA 2LSYA 2YU2A 2J4BA 3P2BA 2BUGA 3U64A 4EZLA 3FBZA 4EPZA 3FP3A 3WI3A 4I9EA 2KXPB 2XPIA 5ARGA 2XHEB 2VGYA 4L0RA 2I6HA 3HHMA 4JW1A 4OYKA 4GYSA 4BSXA 4JEUB 4MKTA 4PK4A 3S7FA 4FJZA 4B89A 1BPOA 2KZ7B 3RH3A 4YVOA 2E0IA 4MRUA 3VHLA 3I9YA 5HWXA 2XQ0A 2CLYB 1TJFA 5G2NA 2KATA 4TV3A 3HDXA 2L8KA 1YKHB 2ZLYA 3KD7A 4TV8E 2E9XB 3UT4A 5HI7A 5KDMC 4ME2A 3PUAA 3I0OA 1IYGA 4UIGA 4IN3B 1LVKA 3FUHA 2WSSV 3FBLA 3RK6A 4G25A 5A1LA 1H2TC 5JJ7A 2CG3A 3UX4A 1ZV4X 2CXDA 3PDYA 2IOSA 2XAGB 3CK7A 1H2VC 5T8IA 4GMLA 3CVLA 2GW1A 1FCHA 2UY1A 3NF1A 5LBQB 2X9WA 4L23A 3VLFA 2UXXB 3CX8B 2BVMA 3HKBE 2J4DA 4FU3A 4D10C 4PAGA 3PNLB 2YQ8A 4G2AA 2DCPA 2VQ2A 3L54A 4FA6A 3D0TA 3Q5WA 3CLJA 3LY7A 4PH4B 4EBAG 3CHQA 4B94A 3MJWA 1UN8A 5J2TE 3FFLA 5CMWA 4EZKA 4ACLA 2CXFA 5L3EB 3ZCIA 3O4XE 3AA7B 4L7TA 3SBTB 3RU0A 3ETVA 1FVHA 4BT9A 3FTUA 3G2VA 2K48A 4ZI7E 2XRZA 3FEYA 1MQSA 3SS1A 4BAYB 4AEZC 3E4BA 4B0ZA 3SGHA 4IE7A 3I3NA 1H19A 2NTXA 3KV6A 4WNGA 3D9MA 5JR9C 3RYHE 4ATGA 2Q9QA 5EK3A 5J08A 2FULA 1MMAA 2JMKA 1MHQA 3QWPA 2VSXE 3KVAA 3PU8A 5FY0A 1E7UA 2WXNA 3IF8B 3FTYA 2L0TB 4O4LE 2XEVA 4TV9E 3BEEA 5M72A 4A3VA 4EZJA 2C5JA 3L13A 2ZMAA 2VWAA 2PFVA 4CRWA 5FMNA 2DBAA 2V7JA 2CE7A 2X0LB 3MK7C 2C5KT 2CHXA 1U3CA 1V9DA 4LRZA 5ENNA 2B1EA 3D9JA 2WQHA 4U72A 5AYWD 5FZQA 2YNQA 4X1KE 3O9XA 4L2LA 3WAJA 3V5SA 2LSKA 3I1AA 3O1JA 1MIYA 5BV0A 1MNEA 5M4YA 4C9BB 5C8YE 2FBNA 2DI4A 4ASKA 3LK2B 4BT8A 1HG2A 4XZCA 4OYJA 1YA0A 3VLEA 4GA2A 5BW8C 3UT7A 3Q9DA 4ISSA 3FEXA 3Q5MA 4BFRA 2IQCA 3L3PA 1H0AA 5JH7E 1QQEA 2QA7A 4OVVA 4P0AA 4UVCB 4EYUA 4GA1A 2VTBA 2KNDA 3QC1A 3CMLA 3PURA 2CA5A 5FXVA 5EX0A 2XUEA 3QDNA 1DVPA 1QUUA 1HO8A 2D0UA 2LE8A 3KAEA 4XZ4A 3AAAB 1NP7A 2XGSA 3L08A 3CPZA 3CR3A 4EBAA 2AW6A 4UI9K 4CXWA 3N9MA 4BJNA 1LF8A 4TN7B 3TGOA 1HXIA 2V7KA 1YKEB 4IHJE 2L9BA 3LYAA 3ESKA 3KV4A 5L3FB 2IONA 2HPJA 4OFZA 3T8MA 4CT0A 3EDUA 4CCAA 3PUKA 3ONKA 2LO6A 4FC8A 3T5VA 4J8FA 4HOTA 5KJKA 4Y6CA 3ZGQA 4IRUA 3U3WA 4HE8A 3IHVA 2E9XD 5JRCA 3F2EA 4UV9B 5HXRA 1ELWA 3O1IA 4GK0E 4LCTA 4AKRB 4H9RC 4JPSA 3PE0A 1D1AA 3FTZA 4C91A 3UFEA 3VU7H 3OBVE 2CHWA 2WXJA 3OXLA 1UW4B 4M3OA 3NZPA 4F53A 3FTWA 4DMVA 5A6CA 4XBFB 5FT9A 4G26A 3RRNB 2P58C 4JVSA 3EHNA 3DTOA 1UX4A 4JHJA 2PJQA 3K9IA 1FEWA 4CXYA 3C4ZA 4HS2A 4QX8B 3NBXX 3IEEA 3O1HA 4DBQA 3CKDA 3OXGA 1U4QA 3BQLA 3I4GA 3ANWB 2X6FA 4DJAA 4V3IA 4WBNE 2BTDA 5DJQC 1HZ4A 4I17A 5J90A 2E9XC 3DBSA 4OYSA 4QXBB 5LHIB 2NWBA 4PS8A 2WXQA 2K5BB 4O4IE 3UT8A 5LNKA 3CQCB 2JLBA 2ACXA 3MJXA 1MMDA 4BTAA 4JEHA 2EHOC 3WAKA 3KFWX 3I5PA 3BG1B 3Q4AB 4X1IE 3K3NA 3UUMA 2PM6A 3LVQE 2LAIA 3LCAA 3QKYA 2WQ6A 1HFAA 3OJAA 3E0ZA 3TXMA 3D9PA 5A23A 4U8HA 2NW7A 2YINA 3D9IA 4IDZA 3MA9A 3FH5A 3JQ0A 2R59A 5LA6E 2H3RA 5DABA 3MKRA 4NURA 2WM9A 2JJ9A 3FXDB 3HVEA 3Q49B 4L2YA 3QK0A 3FH7A 1HE8A 4Y6WA 5FZRA 4MLPA 5DQWA 2VGXB 3KDSE 4H9PC 4G11A 1HTJF 3R9AB 4AV7A 3TJPA 1JUQA 4YFSA 3N2KE 3CQXC 3CHSA 5LHHB 4EB6E 4AKIA 2CMRA 4ILIA 3LKUA 2SPCA 5F3JA 3CVQA 3FULA 4ISTA 2M67A 3I4RB 4UQYA 4IE6A 2OV8A 4Q94A 2EQXA 2Y8DA 1IJ5A 2C0MA 2H7VC 4MALA 3UT5E 4FJYA 2XAJB 1HF8A 4ILGA 4PJLA 4GYWA 3UTKA 4QFVA 3SNXA 4ANWA 2CEAA 3H37A 1US7B 5LOZA 3FUNA 4PK6A 4TX5A 5BMVE 1BR2A 3APFA 4UWFA 1H6KA 4RG9A 1UJKA 5G05J 4AQFC 2L6JA 1NA3A 1S0PA 4ADZA 2W62A 4GMJA 2N1GA 2GK9A 2ZM2A 4I43A 1D0ZA 1KK7A 3B57A 5JDQA 5CCMA 4EIWA 3G2UA 1Z3XA 3K3OA 5L3BB 4Z8XA 3IBEA 3U9WA 4KMCA 2XPYA 3QNKA 3ZYLA 4UWKA 4ILHB 4GZ3A 3J9X1 5FXWA 3UUNA 5LP6E 4DPRA 4JXTA 1N54A 2MHKA 3KV9A 2XGMA 4LUNU 2Y4TA 2XASB 1X79A 3ULQA 2Y6XA 4RG6A 2HYZA 1IQUA 1B7TA 3L09A 4H9OC 3ZXSA 4U63A 2YHCA 5LCWC 3CV0A 5D0QD 2D2SA 1P5QA 1OWAA 3C98A 2MYSA 5HYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4R B;  3CQG B;  3CQC B; 
#chains in the Genus database with same CATH topology
 2RFM A;  3DPD A;  2YDR A;  4WZX A;  2LEH A;  3W9G A;  4WNK A;  2VVS A;  3EJN A;  1MND A;  1N94 A;  4UI9 C;  4H63 V;  1S35 A;  5FP3 A;  4F7A A;  1MX2 A;  4H9N C;  1KEY A;  3IXE A;  4DRX E;  5JR9 B;  4IDP A;  2N9D A;  4U0U A;  4QHO A;  2GRP B;  2PQN A;  4OAV B;  4PFP A;  3AS8 A;  2AXD S;  5LGT B;  2UXB T;  4EHM A;  1WFD A;  4XKB A;  5CHE E;  3L39 A;  2XQ7 A;  5L3D B;  2XM1 A;  1JCR A;  2VSO E;  3VKG A;  4GU5 A;  1AWC B;  1OUV A;  5FWQ A;  2FF4 A;  5EYP F;  4WBO A;  1CUN A;  1HNZ T;  3MX3 A;  4AXH A;  3FZF B;  1XMO T;  3BG0 B;  3CKB A;  3FU3 A;  3WXX A;  4HOU A;  3ONX A;  4EEC A;  4AQF A;  4YTP A;  3FUE A;  3U4T A;  1HG5 A;  2XM2 A;  2Y0B G;  4BX9 A;  3GMI A;  1JWG A;  2Z6E A;  1TYQ G;  2I2O A;  3K1S A;  3WG7 E;  4GTR A;  1UCU A;  2DWK A;  4MFR A;  1DNP A;  3DSU A;  1UGO A;  5L2L A;  3V2X A;  5CEC B;  2KCL A;  3DEO A;  2A2F X;  3RYC E;  3EHQ A;  5JDL A;  3PUY F;  4HWD A;  5LFA A;  5E75 A;  3DSS A;  4UWL A;  2W61 A;  4M1P A;  4X66 T;  5CGM A;  3ZMZ B;  1L5J A;  4RVB A;  5ENR D;  1SHZ C;  4TXR A;  4X65 T;  1ZP0 A;  3PUW F;  3ZN0 B;  5HAX A;  1INZ A;  4GOU A;  1OWO A;  2JQQ A;  5BT1 A;  1PY1 A;  3CHR A;  3LY8 A;  4F1P A;  4J6I A;  3OKQ A;  2J9Q A;  3EUV A;  3AS5 A;  3TWR A;  2W2U A;  3OAW A;  1Z8U A;  1XGW A;  2WXI A;  5LGU B;  2J08 A;  1UX5 A;  3RRW A;  3N9Q A;  5KNH D;  1FPP A;  4LG6 A;  3ZC0 A;  3Q15 A;  5EIL A;  2Y69 E;  3PEU B;  2ODV A;  2X9H A;  3ZPJ A;  2XZD G;  1LVF A;  3TKL B;  2MTQ A;  2YK0 A;  3GYZ A;  2CLY C;  2WAU A;  4JYA T;  3SQV A;  4ZS3 A;  4OHF A;  2IHR 1;  3OTN A;  4WND A;  3T5X A;  2FJE A;  5L47 A;  3IHR A;  4GTV A;  5BUZ A;  2XTL A;  5T4Y A;  1XNQ T;  5LGN B;  2BS4 A;  5T3R A;  3RO3 A;  4HGA A;  3RPU A;  4CI2 B;  1PC2 A;  3PH0 C;  5AQF B;  5LMU T;  3L16 A;  3TWQ A;  1WYC A;  4YDW A;  4AIS A;  2OV9 A;  3DEP A;  5AJD A;  2FO1 E;  3HA4 A;  3TWX A;  1XNF A;  2IML A;  2UUC T;  1T98 A;  3FY4 A;  4JLE A;  4HWI B;  3CGH A;  2X3M A;  3B7S A;  5G55 A;  4BSZ B;  2PL2 A;  3L17 A;  1UOH A;  4XI0 A;  1GW6 A;  2WXP A;  5B1A E;  5LB7 B;  4AI6 A;  5FL0 A;  4GPK A;  1WYB A;  5F5W A;  3C50 A;  1WRD A;  4GZ5 A;  3HRA A;  2VB6 A;  4B8A A;  2LUH A;  2JQK A;  5LJN A;  3J5Q B;  1OCC E;  4E7S A;  4TRQ A;  3RC3 A;  4YY3 T;  1N52 A;  3LK3 B;  3J7Y q;  2WZI A;  4ERR A;  4YSY A;  1D8D A;  1EYH A;  1BR4 A;  3E22 E;  4TNV A;  2AXV A;  1ZKE A;  3ZN1 B;  2WXM A;  3TLS A;  4JI7 T;  3CVR A;  2IC9 A;  4HRM B;  3JUI A;  4UI9 J;  5FQ8 A;  3GN5 A;  1TEZ A;  3CVN A;  2A5U A;  2VKJ A;  2MBG A;  4LFC T;  2OND A;  2R17 C;  3C4X A;  4I1A A;  1WG0 A;  4JI0 T;  4E6H A;  1UUS A;  3EDT B;  5CER B;  3PUS A;  4ZHQ E;  1TNZ A;  4IUL A;  4U07 A;  1OED C;  5ITZ F;  4G63 A;  3ASD A;  4ZI2 D;  1JPL A;  4GK5 E;  2C2L A;  4KP3 C;  1FMW A;  2GRM A;  2DNX A;  1NL4 A;  5HEH A;  3CQG B;  3ML8 A;  3TLW A;  2ACZ A;  4U8V D;  2IIU A;  4HFG A;  4KZC A;  4HWC A;  3UTM A;  4CGV A;  3FU5 A;  4WW0 A;  1XMQ T;  3ZJ1 A;  2E5V A;  4HOQ A;  5BV1 A;  2J07 A;  2WXF A;  3D9N A;  4Z91 A;  3UU6 A;  2P9K G;  3PRZ A;  3CVY A;  3APC A;  4IE5 A;  3RSE G;  5HXH A;  2WCA A;  5EK2 A;  3AE2 A;  5E76 A;  2X66 A;  1MMN A;  3N2O A;  4PFO A;  2BG9 E;  1WR0 A;  4CN6 A;  3RRU A;  1WLX A;  1MJ0 A;  4UF0 B;  3PVL A;  3CIA A;  2XRY A;  3MA5 A;  2L9Q A;  4DR3 T;  3ZYM A;  5FNV E;  1N32 T;  3RIA A;  3FHE A;  1KNR A;  4DBR A;  1S94 A;  1G3N B;  1BR1 A;  3TLU A;  1TN6 A;  1XWM A;  2D9D A;  4MBQ A;  1QSD A;  5J1G A;  4JEU A;  3SFD A;  4EAH A;  4HOS A;  2CG2 A;  2EHO D;  4UVB B;  2LM9 A;  1H2U A;  5FY7 A;  2BKO A;  3FTX A;  2C0S A;  2WMN A;  3IKO B;  2DZN A;  3TL5 A;  5BPP A;  3JQ1 A;  4DV7 T;  4TZ4 C;  2V5F A;  2KZT A;  1IBL T;  4O1P A;  2LRK A;  3CHM A;  5HRY A;  2W00 A;  5C2Y A;  4FLH A;  3BK9 A;  1HH8 A;  3HXF A;  3L6A A;  2KWH A;  4N5Q A;  4JI4 T;  3AA1 B;  4A56 A;  4UEM A;  1FVF A;  4XI9 A;  1MIV A;  4J8D A;  2VUR A;  3OVU A;  4GTS A;  1HCI A;  2MRI A;  2PZI A;  3NOG D;  2JAB A;  2EHO B;  5ARF A;  5KBA A;  3ETU A;  1YQ4 A;  2MYO A;  1NZN A;  3RJV A;  2GRN B;  4OAU C;  3O48 A;  1TN8 A;  4LER A;  3NBN B;  3FZL B;  4NUV A;  3TAX A;  3JC6 C;  2JRK A;  4AQG A;  3ZMS B;  5L4E A;  3T8K A;  3CSF A;  2G0U A;  4UF0 A;  3FUI A;  4ANU A;  4PUC A;  4LF9 T;  3HKC E;  4ZI3 C;  2ZM6 T;  3HXC A;  3Q7A A;  3N71 A;  1FMV A;  5FVL A;  5CB4 E;  3SFZ A;  2GRL A;  4DX2 A;  3PJA J;  2XAH B;  4K0K T;  4YDE A;  4HQD A;  2V5Q C;  1UJJ A;  3PZ2 A;  2F37 A;  5FKY A;  4FAD A;  4GYY A;  4PS7 A;  2BVL A;  2XJ7 A;  2M6I A;  3ML9 A;  1JWF A;  3ZT7 A;  3ZLI A;  3RHW A;  5JRC B;  3NOC D;  3TG5 A;  2LT3 A;  1O1T A;  4N78 D;  4WUY A;  4B3T T;  3U66 A;  5JDF A;  3KVB A;  4IL4 A;  4YT0 A;  5JDG A;  4GTO A;  4A97 A;  2RA1 A;  2WXK A;  3HR0 A;  2Y48 B;  4JUY A;  2IO2 C;  5JMN D;  4HOR A;  3FTV A;  1WM5 A;  4DR2 T;  2IDO B;  4H63 H;  1Z5S C;  2DLR A;  3Q2M A;  4KVO A;  5EZY E;  3PUZ F;  4DV4 T;  2E5L T;  1CHU A;  1ZOY A;  3SY2 A;  2B0O E;  1YMP A;  2LSI A;  2CHZ A;  4AIF A;  2XPZ A;  3AA0 B;  3R6N A;  2R02 A;  3PV0 F;  2L0I A;  1H6P A;  2KC7 A;  2MOZ A;  3UU5 A;  4YJ2 E;  4JL0 A;  5FIO A;  4R7L A;  2Q9Q D;  3UQ7 A;  1J1J A;  3C72 A;  4KBQ A;  2VAS A;  3M65 A;  2NC9 A;  4GCN A;  4W9R A;  4WNE A;  1IBK T;  1YQ3 A;  3AVS A;  2X51 A;  4EQF A;  3DSW A;  3MKD A;  1S63 A;  3UUL A;  3ASH A;  4G24 A;  2XGO A;  4NIK A;  2WP9 A;  3LDZ A;  3AE6 A;  2RD0 A;  1O3X A;  2RPA A;  3SHF A;  4AKL A;  4K0R A;  3EVY A;  3HIZ A;  2Y1L E;  2R05 A;  2UY1 B;  2VVN A;  2W63 A;  4ANV A;  2BF0 X;  2X9X A;  3RKV A;  4AJW A;  4L9I A;  3MYV A;  3CK9 A;  4NXN T;  1QYM A;  1BU9 A;  1ZHC A;  2KIN B;  3DJB A;  2WXR A;  5EK4 A;  3RYI E;  2CPT A;  1Y64 B;  2WWU A;  3AB3 B;  4EZ4 A;  4ZI3 D;  3RKO A;  3ZYK A;  3FUF A;  5LOV E;  3EAB A;  4K0U A;  3P1U A;  2LM2 A;  2W0G A;  1IAP A;  3SOL A;  4C0E A;  2J09 A;  4N3B A;  5AQS B;  3NZS A;  1Z0P A;  4GZ6 A;  2A3D A;  3RIU A;  5JQG E;  2OVF A;  4ANX A;  2ZM8 A;  3QC9 A;  3E08 A;  2AWI A;  2XZT G;  4TUM A;  1IQR A;  3CIR A;  2IFU A;  5CA1 E;  2ODU A;  4TNW A;  2UXN B;  1SUM B;  4KBM B;  1E8X A;  3FU6 A;  5KJM A;  3R7Q A;  5ENO D;  4NUU A;  2DCF A;  2KCV A;  3QB2 A;  3QWV A;  4HKA A;  3EU9 A;  2X6K A;  5EYL A;  1IXV A;  4X1Y E;  4YDY A;  2CWO A;  2FUP A;  2J1D G;  2ZIS A;  3LJN A;  2X0Y A;  3UKR G;  4CDM A;  4MLK A;  1HS7 A;  4CT4 A;  2DIW A;  1ELK A;  4MS6 A;  3TWV A;  4WWP A;  2QFC A;  4Z68 A;  3L22 A;  3QJZ A;  3S7D A;  5LYJ E;  4ATZ D;  1Y8M A;  3LJC A;  3L8R A;  2A4Z A;  2XHE A;  3ASF A;  4HEA A;  3JC6 D;  3S7B A;  4GYO A;  2J47 A;  5C1D A;  3R84 B;  1YYH A;  2BKG A;  2ZXW E;  3F57 A;  4HI8 A;  3EHM A;  1OXJ A;  4X8Q A;  1LKX A;  5JJT A;  3KEA A;  3Q9U C;  3RX6 A;  3C3O A;  4HLE A;  3I0Q A;  3ABV A;  5ABG A;  3FWV A;  3TG4 A;  4YSX A;  1N0Q A;  4N3A A;  2C0L A;  3FUM A;  3IEG A;  3DSV A;  2B6C A;  5DBK A;  3CK8 A;  2V26 A;  4U95 D;  2I59 A;  1M62 A;  3N9L A;  4DR1 T;  1N11 A;  5L3G B;  3V79 K;  1N9A A;  4WNF A;  3G2W A;  3VRB A;  1Z6T A;  4UQX A;  5FY1 A;  2GGF A;  4DX7 D;  5KJL A;  4AY6 A;  2YKS A;  4U0S A;  4OVU A;  4PDX A;  2X38 A;  5F8P A;  4P29 A;  4TUU A;  4A98 A;  2VL8 A;  3H3M A;  2J8S D;  3UI2 A;  3D3M A;  4UV8 B;  4GIW A;  4IL9 A;  2CBJ A;  4H7Y A;  4I2Z A;  2CFU A;  4U7I A;  1NI1 A;  3MKQ B;  5LX8 A;  3JYS A;  2H6H A;  5CED B;  2CWY A;  4JZY A;  4DVD A;  4ACK A;  2RP4 A;  3AED A;  3U3I A;  4C90 A;  4IYP A;  3Q78 A;  3AS4 A;  3ABM E;  3CVP A;  2I1K A;  4DV6 T;  2V1D B;  4KXK B;  2K24 A;  1R8I A;  2IU1 A;  4V1A v;  4CZ2 D;  4EED A;  3LK4 2;  3HKE E;  2JPF A;  3MKQ A;  1NEN A;  2VKO A;  2AJA A;  4C0M A;  3P7I A;  4QWN B;  3T1H T;  2KMF A;  1W0A A;  2V7I A;  2FO7 A;  4KVM A;  4H7X A;  4GA0 A;  5E0O A;  3PJA A;  5ETW A;  2CFZ A;  3LEW A;  3ASG A;  3E32 A;  4XKC A;  3AAE B;  2QY7 A;  3FUJ A;  4LNG A;  4RSY A;  3D9O A;  2JMH A;  3FB2 A;  2V5C A;  3PRE A;  4J8Y A;  3TWU A;  3EI0 A;  3PTR B;  4CI3 B;  4I6G A;  3I9W A;  4APO A;  4BX8 A;  3HL6 A;  4URK A;  2V4H C;  3MXZ A;  3CVX A;  3ONL C;  4AIU A;  5JDN A;  4IRE A;  3ZMV B;  3B7T A;  2ES0 A;  3AJI A;  4DK5 A;  4PJM A;  2LSV A;  4N2Q A;  3SF4 A;  5CRU A;  4NAC A;  3ZFW A;  4O4J E;  4ABN A;  4ILU A;  4KHP T;  2I1J A;  5G04 C;  3JAE A;  1A17 A;  1G8X A;  3N9O A;  5IWA T;  2P9B A;  4O8S A;  1WY6 A;  5H7P A;  4APF A;  3C64 A;  4DO0 A;  5JTG A;  5LHG B;  2NP9 A;  2WQ7 A;  3NRY A;  5D66 A;  5LP0 A;  5HWY A;  3IBP A;  3ANW A;  2XQ5 A;  1W3B A;  4EOZ B;  4LFB T;  2DHR A;  4GYR A;  4ZS2 A;  3PZ3 A;  1KNZ A;  5FQ7 A;  4HWH A;  3ONJ A;  2EIN E;  2IAK A;  3P4R A;  4QKN A;  3FZK B;  5ABE A;  1JCQ A;  3MZK B;  4LF8 T;  2ILR A;  4AY5 A;  4DLQ A;  3APD A;  5CFB A;  1OWP A;  1S70 B;  4WAF A;  1E7V A;  2PM7 A;  2KM4 A;  3MV2 B;  1N95 A;  3A5X A;  2LSU A;  1IKN D;  5H6Q B;  3JAF A;  4N5C A;  1E90 A;  4HXI A;  3RQU A;  2IOL A;  3AE8 A;  3N5L A;  5EX3 A;  3PUX F;  2QC9 A;  3JCK C;  3G2T A;  1N36 T;  5H6R B;  4DND A;  4L1B A;  4QQI A;  1ELR A;  5D0O D;  1PAQ A;  1HR0 T;  1V54 E;  2V0P A;  1EF1 C;  3NZQ A;  1U5P A;  1Q2Z A;  3PS6 A;  1DU2 A;  3AE9 A;  2LKH A;  5LG4 A;  4A3T A;  4HFB A;  2NSZ A;  3VR9 A;  2Y4U A;  4LSZ E;  3PUQ A;  1HU3 A;  5CMY A;  4HVB A;  3AG1 E;  2UU9 T;  4OK0 A;  3HXD A;  4KI0 F;  4DR4 T;  2HR2 A;  1TJC A;  4HRN A;  3V31 A;  5ANR A;  5CBN A;  3HKD E;  3Q5D A;  4LML A;  4GTQ A;  2VKD A;  3C98 B;  2BZB A;  3N2G E;  2V4L A;  4H9Q C;  4F3V A;  2LSJ A;  3PDN A;  1O1S A;  1HNX T;  4FP7 A;  3ZU7 B;  5LCY A;  3FUK A;  5L3C B;  3RKG A;  4AKH A;  1SA4 A;  1IHB A;  1FT1 A;  5BR8 T;  5DQV A;  3UPV A;  5IY5 E;  3ZT6 A;  2KXP C;  4NPP A;  5C3J A;  4JI8 T;  2BG9 C;  4BEP A;  2OVB A;  3FHN A;  3ZHE B;  2D5U A;  3PZD A;  3ZIM A;  5BXU A;  2JQ9 A;  4JEH B;  5AQB A;  2HH7 A;  3CST A;  5HXC A;  2P9S G;  4XIF A;  1LTX A;  5G04 J;  4BJM A;  1E8W A;  2X68 A;  4HFH A;  1YW0 A;  4F8H A;  1HX8 A;  3KSL A;  1T8B A;  2H6F A;  4I6E A;  5JHA A;  4BTB A;  3F31 A;  4ZEY A;  3ZRH A;  5FQ6 A;  4IDN A;  3EAM A;  1TNY A;  5JA4 D;  5ANL A;  5DIZ A;  2V6Y B;  2BDE A;  4CYM D;  3EDV A;  3PNT B;  3GZ2 A;  4GZD A;  4J7W A;  5FIN A;  4I9C A;  3CX7 B;  2P9N G;  4NIQ A;  2K9A A;  3UU3 A;  2I0M A;  5AQH B;  3URZ A;  3CHP A;  1NFI E;  3W15 B;  1N4Q A;  5AQ7 A;  5ABF A;  2IW5 B;  3PE4 A;  4LF6 T;  3PEV B;  1G73 A;  3BUA A;  3E33 A;  3QAQ A;  4KT6 B;  3EIQ C;  2X6H A;  4KX6 A;  3LPZ A;  4A1S A;  2XQY A;  2XAF B;  2XQ4 A;  4IDQ A;  3C51 A;  2QYJ A;  3FDH A;  3KBU A;  3QB5 K;  2WBL A;  3TXN A;  5HCJ A;  4F6R C;  4NRH B;  3VKH A;  1UUR A;  2CXL A;  3ZN3 A;  2E9X A;  2C5I T;  5AFU L;  3P4P A;  4KMO A;  2BKN A;  3RYF E;  2AXU A;  1E1H B;  5EDS A;  3RO2 A;  4UQZ A;  1N34 T;  4H9S E;  4DMW A;  1UG3 A;  5FVK A;  2LXM A;  2PBI A;  4HFE A;  5KWD A;  2XCB A;  4I4T E;  4AQY T;  2WXG A;  4IIJ E;  2LJL A;  3KV5 A;  3AU4 A;  4I43 B;  4N2S A;  2LOS A;  1LRZ A;  4MHC A;  2EIJ E;  2XS8 A;  2LKG A;  2IUB A;  4FI5 A;  2J4G A;  3LVR E;  3AE4 A;  4A1G A;  2VGX A;  3UIO C;  5HEJ A;  5FJY A;  4AP2 A;  1SZ9 A;  3OYZ A;  3K8P C;  4J2C A;  3LFM A;  3ZC1 A;  2XQ6 A;  4I1M A;  3UM1 A;  4F1S A;  5FXX A;  2IJG X;  4XAX B;  4J8S A;  3ZYQ A;  2UUA T;  5G05 C;  3VTY A;  5LBM A;  1KT1 A;  2KZT B;  1H7C A;  4YXD A;  4B8C B;  3QUJ A;  3LBX A;  4JI5 T;  3LG7 A;  4HLL A;  3DP7 A;  3B7R L;  1DCE A;  3B13 A;  1EZ3 A;  2Q9Q B;  2HE0 A;  2MPK A;  1IZN B;  4U04 A;  1W09 A;  1AJ3 A;  4I6J A;  4JHR A;  2PG8 A;  3ZEF B;  3ZVV A;  2KSR A;  4GB9 A;  3QK6 A;  3CVW A;  4UWG A;  1SQM A;  3PUV F;  3UXG A;  2NOX A;  4DV0 T;  2WVI A;  2XQ3 A;  4PS3 A;  4X20 E;  2P9L G;  3MV3 B;  2OOE A;  5KMG P;  2XZE A;  4U2Z A;  3UKU G;  3ZHE A;  3ASO E;  3R7R A;  4BY6 A;  3ZW3 A;  2FBW A;  1KLX A;  4JA9 A;  5JHB A;  2VGE A;  4B93 B;  2CCQ A;  2DL1 A;  3ZCJ A;  2V7M A;  4CZZ B;  4E85 A;  3Q9N C;  1ZBP A;  3UUX B;  2XSA A;  5LJM A;  3EU5 A;  2YHE A;  3ZPO A;  3SBS A;  2E8I A;  4I55 E;  3FTS A;  2NW9 A;  5BNW A;  4DLO A;  3RLF F;  4I1O B;  2LXL A;  3VTX A;  5EKQ D;  3CX6 B;  5FTP A;  3CWZ B;  3QB5 A;  3SZ7 A;  5J0Z A;  4O2A E;  3CKC A;  2KWI B;  2N2N A;  2V6Y A;  5IHY A;  2LNI A;  5FZS A;  4O4H E;  5JDH A;  4CEM A;  2BS2 A;  3JXI A;  5AQT B;  3LJ3 A;  2Y3A A;  4UEL A;  1LD8 A;  2WXH A;  2H7O A;  4O6F A;  1D8E A;  4FJO A;  2I9C A;  4IGU A;  4WWN A;  1V55 E;  3PUG A;  4FUL A;  4COF A;  4CI1 B;  3AAI A;  3K3Q C;  5IYZ E;  4GZC A;  2YEV C;  1NAF A;  4RLY A;  2LLY A;  3DXM G;  4G1T A;  4KUM B;  1OWM A;  3SD5 A;  4AM9 A;  3T9K A;  1MIW A;  1D1C A;  4LMK A;  3FUD A;  4DID B;  5FYM A;  2UXC T;  3B7B A;  3CHO A;  3EIJ A;  3Q47 B;  1W9R A;  2X67 A;  2HM8 A;  3UMV A;  2H6I A;  2V8S V;  2XEH A;  1UN9 A;  4O2B E;  1VCT A;  2MOW A;  5CBO A;  3AEG A;  1VCS A;  2KT9 A;  4FHJ A;  3IHY A;  4JI6 T;  2QZA A;  4ANJ A;  4PW8 A;  2WXL A;  4TXQ A;  4Q96 A;  4ZHB A;  3FU0 A;  2E2E A;  3CVV A;  2PQR A;  5HXS A;  1IHG A;  5LXT E;  4JBW F;  4G8L A;  3MCX A;  4UWH A;  5FQ4 A;  2H6G A;  2VJ8 A;  3HXB A;  3W9F A;  3RRC A;  3LY9 A;  2DWG A;  4UXN B;  4P09 A;  4EYY R;  2V7L A;  2VYI A;  1E2A A;  3S2A A;  1BD8 A;  4DI4 A;  1HX1 B;  3FXE B;  5HXE A;  2YU1 A;  4A63 B;  1VOM A;  4PJN A;  2IY0 C;  1TR4 A;  4WWO A;  2HO1 A;  2ETA A;  1FIO A;  2VKH A;  1OXZ A;  4GTP A;  1OWN A;  2A5E A;  1JNZ A;  1E96 B;  4U2Y A;  3U78 A;  5JDM A;  4CDR A;  3NQP A;  4L9P A;  2BS3 A;  3B7U X;  3NZU A;  1Z3Y A;  2VSY A;  1X5B A;  1D1B A;  4B3M T;  1VRB A;  3MGB A;  5ENQ D;  4HBD A;  1MX4 A;  2YN6 A;  3LXU X;  1WAO 1;  5ADX L;  4IE4 A;  4KHZ F;  3GWH A;  1AP7 A;  3SI5 A;  4B6X A;  4LF4 T;  2F4V T;  2AXZ A;  3B95 A;  2L3L A;  3KEZ A;  4PK5 A;  4PNI A;  3SRZ A;  4QXH B;  5JVD E;  2Q7F A;  4KYO B;  4AVX A;  2WB2 A;  2WB5 A;  4U33 A;  2BKP A;  3MZL B;  1B89 A;  2XCC A;  3N9P A;  4FHK A;  3QAR A;  4GCO A;  4JHK A;  5AN8 A;  3KS2 A;  5AAO A;  4AOF A;  1ZU2 A;  2LHN A;  3JCF A;  4YHH T;  3ENE A;  2XS1 A;  2W67 A;  5ABH A;  3BQK A;  4JA7 A;  2W66 A;  1YXR A;  3X2Q E;  4AKG A;  3AXJ A;  5KJN A;  1W0B A;  5A7D B;  4A55 A;  2XQ9 A;  2RG8 A;  3KSQ A;  5EID A;  4LFA T;  4BET A;  3AEC A;  5D2M C;  4EZH A;  2FI7 A;  3L82 A;  1QNF A;  2X6J A;  5AQA A;  4JV5 T;  2J62 A;  2JQH A;  1VDY A;  4AXP A;  4JI1 T;  4HN9 A;  4TWH A;  3AAA C;  3AVR A;  3IV0 A;  1IJ6 A;  2M63 A;  2P2C P;  5CA0 E;  1OWL A;  1U3D A;  2F0Y A;  4DX6 D;  3JUE A;  3O4Z A;  4U74 A;  4ZI2 C;  5KXJ A;  2WMO A;  2XAQ B;  4HRL A;  1SA5 A;  4G23 A;  3ASN E;  5LCW J;  2IF4 A;  2WQY A;  2LAH A;  3ZJ2 A;  3RIB A;  1NA0 A;  4CGW A;  4M7C A;  3AA6 B;  1E8Y A;  3S4U A;  4DV3 T;  2A72 A;  3LBX B;  2X9Y A;  2R5S A;  4CQI A;  2QYW A;  5AQI B;  3ZMT B;  3OXF A;  5TAO A;  1KPS B;  2IC6 A;  1JCS A;  5AIJ A;  2VK9 A;  3HI2 A;  4EXT A;  2XEN A;  1JNR A;  4EEB A;  2WPV A;  3CVU A;  2FJB A;  3UQ3 A;  1X81 A;  3Q5X A;  3GN5 B;  3KIN B;  5AJL A;  3VLD A;  2Q9Q C;  3HYM B;  2UUB T;  2OA5 A;  3DRA A;  3SFE A;  5JRE A;  4I2W A;  4K03 A;  5KX5 E;  1HS6 A;  2ETC A;  3S7J A;  3ZNG A;  4YND A;  3QOU A;  4C48 B;  3KBT A;  2HHH T;  4FLB A;  4CDN A;  3SWH A;  5C2T A;  5CCL A;  2LHR A;  4YVQ C;  3QWW A;  2V8S E;  2GRQ B;  4HTE A;  4LF5 T;  1E8Z A;  3OTO T;  1ZEE A;  4QX7 B;  2QGS A;  3BQO A;  3P4S A;  5AQN B;  5GON E;  2CM0 A;  4QXC B;  2HPL A;  1D0X A;  3BQI A;  1RW2 A;  4K5C A;  3RC8 A;  5J2U E;  3AEE A;  5JJ6 A;  1SVX A;  4HFV A;  1YD8 G;  4I50 E;  3PE3 A;  3GA8 A;  2NW8 A;  3MAC A;  4DI3 A;  4LEU A;  1K1B A;  4K5A B;  3GW4 A;  4BES A;  5FXZ A;  1M7K A;  4YHJ A;  2AE9 A;  2BED A;  4L5G A;  3TWT A;  4N3C A;  2CRB A;  4BA9 A;  1SA0 E;  2H89 A;  3V5U A;  4KZ0 A;  3GZS A;  4N39 A;  5EN5 D;  3D9L A;  4J8E A;  5L4H A;  4U0Z A;  4JC8 A;  3ONL A;  1EDU A;  4DV5 T;  3H3A A;  3UUX A;  1QZ2 A;  4TWF A;  3AG2 E;  2NTY A;  3ZST A;  1OY3 D;  1EPU A;  4TUY E;  1S64 A;  3CEQ A;  4IE0 A;  4Q69 A;  3G2S A;  1XZY A;  4NQ0 A;  4CXX A;  2ZM0 A;  2J49 A;  3IA3 A;  4G2V A;  3EHR A;  3N9N A;  1I94 T;  3ZMU B;  4HB5 A;  3EUH A;  2KLQ A;  3FZH B;  1NWM X;  2KCK A;  1D9S A;  3TWS A;  3AU5 A;  4E7Z A;  2WY2 A;  5HCM A;  3HG0 D;  3ESL A;  3P50 A;  2UWJ G;  2VSN A;  3HVE B;  3UM3 A;  3OYX A;  2D0T A;  4ZZC A;  4YLH A;  3RRM B;  4J0U A;  5AQU B;  4P0B A;  3Q75 A;  3NRX A;  5JR9 A;  3C4W A;  5ENS D;  2EIK E;  1DC2 A;  3ZUV B;  2NXP A;  5KCM A;  4U31 A;  2LOP A;  2FEZ A;  5AQL B;  1KT0 A;  4ZOL E;  4U8Y D;  4QH1 A;  2R03 A;  4XEI G;  5HKP A;  4UVA B;  2LSG A;  5AEN A;  2EHO A;  1XDO A;  1OED B;  1MX6 A;  3FH8 A;  4JI3 T;  2AVP A;  2UXD T;  1SZA A;  4XX5 A;  3MEK A;  2VTB B;  3UQ4 A;  1MMG A;  2VQF T;  3LS8 A;  4GAA A;  5HQ8 A;  3P8C D;  1Y6I A;  2RKK A;  4PJJ A;  2ZU6 B;  4XE0 A;  2WU5 A;  3T8O A;  3TWW A;  4BWR A;  4GKJ T;  2CBI A;  3PU3 A;  5AQJ B;  2WXO A;  3D9K A;  3GZ1 A;  3PUJ A;  1KF6 A;  2V5D A;  1BR0 A;  2X6I A;  4YTN A;  3DSX A;  3ZEF A;  1WR6 A;  2JEK A;  4YJ3 E;  1D0Y A;  2LSY A;  2YU2 A;  5AQ9 A;  4X62 T;  2J4B A;  4F6R D;  3P2B A;  3UIP C;  3AE1 A;  1TNO A;  2BUG A;  3U64 A;  4EZL A;  4EGW A;  3FBZ A;  4EPZ A;  2R2L A;  3FP3 A;  4UR9 A;  2BG9 B;  3WI3 A;  4I9E A;  2KXP B;  2XPI A;  5ARG A;  5AQQ B;  2XHE B;  2WU2 A;  2I6H A;  4L0R A;  4CN1 A;  2VGY A;  5CEA A;  3HHM A;  4JW1 A;  4OYK A;  4GYS A;  4BSX A;  4JEU B;  1ZB1 A;  5ENP D;  4MKT A;  4PK4 A;  3S7F A;  4FJZ A;  4B89 A;  3RQW A;  1BPO A;  2KZ7 B;  3RH3 A;  1OCO E;  4YVO A;  4LMJ A;  3SFX A;  2E0I A;  3ZKJ A;  2BBH A;  3C3R A;  3ISM C;  4MRU A;  3VHL A;  3I9Y A;  5HWX A;  2XQ0 A;  2CLY B;  5LMN T;  1TJF A;  1IBM T;  5G2N A;  2KAT A;  4K5B A;  3TLT A;  4TV3 A;  2CHO A;  1I6Z A;  3HDX A;  2L8K A;  3V2O A;  1YKH B;  2OEV A;  2ZLY A;  3KD7 A;  4TV8 E;  1KZP A;  2E9X B;  3UT4 A;  5HI7 A;  5KDM C;  4ME2 A;  3PUA A;  1U2V G;  3I0O A;  5AQV B;  1IYG A;  4UIG A;  4IN3 B;  3F6Q A;  1LVK A;  2WSS V;  3FBL A;  4HWF A;  3C3Q A;  3FUH A;  5A1L A;  1H2T C;  4G25 A;  2CG3 A;  3RK6 A;  3DPY A;  5JJ7 A;  5ABF B;  3UX4 A;  1ZV4 X;  4P1N A;  2CXD A;  2ETB A;  3PDY A;  2JIW A;  3LDQ B;  1SE7 A;  2IOS A;  2H88 A;  2XAG B;  3CK7 A;  1H2V C;  3PZ4 A;  5T8I A;  3RGL A;  4GML A;  3CVL A;  3UU4 A;  2GW1 A;  5HEO A;  1FCH A;  1YCS B;  2UY1 A;  3NF1 A;  4CN4 A;  2EIL E;  5LBQ B;  2X9W A;  4L23 A;  4TXP A;  2VL0 A;  2FJD A;  3VLF A;  2UXX B;  3CX8 B;  2BVM A;  3HKB E;  3NKZ A;  2J4D A;  3CK6 A;  1BI7 B;  4FU3 A;  4D10 C;  4PAG A;  3PNL B;  2YQ8 A;  4G2A A;  2DCP A;  2VQ2 A;  3L54 A;  4FA6 A;  3D0T A;  2DVW A;  2XQA A;  3Q5W A;  3CLJ A;  3LY7 A;  4JB8 P;  3P4W A;  1BI8 B;  2GRO B;  4PH4 B;  4EBA G;  3CHQ A;  3ABL E;  4B94 A;  3MJW A;  1UN8 A;  5J2T E;  4EV6 A;  3FFL A;  5CMW A;  4EZK A;  4ACL A;  2CXF A;  5L3E B;  2YDS A;  3ZCI A;  4HI9 A;  3O4X E;  3AA7 B;  3RF1 A;  4L7T A;  3SBT B;  3RU0 A;  3ETV A;  3NAW A;  5KNG A;  4ILB A;  4QH4 A;  4Q25 A;  5AQG B;  1FVH A;  3FZM B;  4LF7 T;  4BT9 A;  3FTU A;  4ZZB A;  2K48 A;  4ZI7 E;  3G2V A;  2XRZ A;  1TN7 A;  3FEY A;  1MQS A;  4HNA D;  3SS1 A;  4BAY B;  4AEZ C;  3E4B A;  4B0Z A;  3NB2 A;  2MAW A;  3SGH A;  4IE7 A;  4GKK T;  3I3N A;  1H19 A;  2NTX A;  3KV6 A;  1N0R A;  3D9M A;  4WNG A;  1WCR A;  4JD2 G;  5AAR A;  5JR9 C;  1Y01 A;  3RYH E;  2BBJ A;  4ATG A;  2Q9Q A;  4GMR A;  3A7M A;  5EK3 A;  5J08 A;  3Q5E A;  3ZXP A;  2FUL A;  3RIU C;  1MMA A;  2JMK A;  2HN1 A;  3LSV A;  4DUY T;  1MHQ A;  2DYR E;  1FT2 A;  1WDY A;  3KVA A;  2VSX E;  3QWP A;  2R6G F;  3ZSS A;  2RFA A;  3PU8 A;  5FY0 A;  1E7U A;  2WXN A;  3IF8 B;  3FTY A;  4GPM A;  4WYV A;  2PNN A;  2L0T B;  4O4L E;  2V6X A;  2YOE A;  4X64 T;  2XEV A;  4TV9 E;  3BEE A;  5M72 A;  3JXJ A;  4A3V A;  3SO8 A;  4EZJ A;  2C5J A;  1OCZ E;  3J5P A;  3L13 A;  3AE3 A;  2ZMA A;  2VWA A;  2PFV A;  4CRW A;  1OT8 A;  5FMN A;  2DBA A;  2V7J A;  2CE7 A;  2WDV A;  2X0L B;  3MK7 C;  2C5K T;  2CHX A;  1U3C A;  1V9D A;  4LRZ A;  5ENN A;  2B1E A;  1N4P A;  3D9J A;  2WQH A;  2L6B A;  4U72 A;  5AYW D;  5FZQ A;  1RZ4 A;  2YNQ A;  1E7P A;  4X1K E;  3UUB A;  3O9X A;  4L2L A;  3WAJ A;  4X5T A;  3V5S A;  2LSK A;  3I1A A;  3PZ1 A;  3O1J A;  4B3R T;  2DZO A;  3E34 A;  1MIY A;  5BV0 A;  1MNE A;  5M4Y A;  4LNU D;  4C9B B;  5C8Y E;  2FBN A;  2DI4 A;  4G8K A;  4UUC A;  4DUI A;  4ASK A;  3LK2 B;  4BT8 A;  1HG2 A;  4XZC A;  1XNR T;  4RQI A;  4OYJ A;  1YA0 A;  3VLE A;  1XDP A;  3SFY A;  4GA2 A;  5BW8 C;  3UT7 A;  4DX5 D;  3Q9D A;  4ISS A;  3FEX A;  3Q5M A;  4BFR A;  2IQC A;  5EIB E;  3L3P A;  3RI5 A;  5JH7 E;  1H0A A;  1QQE A;  2QA7 A;  2FJA A;  2F8Y A;  4OVV A;  4P0A A;  4UVC B;  4EYU A;  4GA1 A;  2VTB A;  2KND A;  1SW6 A;  4YTM A;  3QC1 A;  3CML A;  4LNB A;  3PUR A;  2CA5 A;  5FXV A;  3E37 A;  5EX0 A;  2XUE A;  3QDN A;  3G06 A;  1DVP A;  1QUU A;  4DUZ T;  1HO8 A;  3QNU A;  2D0U A;  2LE8 A;  3KAE A;  4XZ4 A;  2ZIR A;  3AAA B;  1OED E;  1NP7 A;  2XGS A;  3C5R A;  3L08 A;  3ZT5 A;  3CPZ A;  3UU8 A;  1H6O A;  3CR3 A;  3TLV A;  4EBA A;  2AW6 A;  3AG4 E;  3VR8 A;  4UI9 K;  4CXW A;  1O1R A;  3N9M A;  4BJN A;  1LF8 A;  4TN7 B;  1K3Z D;  3TGO A;  1HXI A;  2GRR B;  4ZFH A;  2V7K A;  1YKE B;  3AEB A;  5AQO B;  4IHJ E;  2L9B A;  1LD7 A;  3LYA A;  3ESK A;  3KV4 A;  1N33 T;  5L3F B;  4DR5 T;  2ION A;  2HPJ A;  4IDO A;  3UFG A;  4OFZ A;  3T8M A;  5HEU A;  4CT0 A;  3EDU A;  4ILA A;  4CCA A;  3PUK A;  3ULE G;  1L0V A;  3ONK A;  2LO6 A;  4FC8 A;  3T5V A;  4J8F A;  3AXJ B;  3ABK E;  5KJK A;  4Y6C A;  4HOT A;  3ZGQ A;  4IRU A;  3U3W A;  4HE8 A;  3IHV A;  2E9X D;  4HFD A;  5JRC A;  3F2E A;  4UV9 B;  5HXR A;  1ELW A;  3DST A;  3O1I A;  3HXE A;  4GK0 E;  5HS0 A;  4LCT A;  4HFI A;  4AKR B;  2EIM E;  2IEJ A;  4H9R C;  2QYU A;  4JPS A;  1N4R A;  1J5E T;  2DWZ A;  3UM2 A;  3PE0 A;  2ZGD A;  3P4Q A;  1D1A A;  3FTZ A;  1GQE A;  1K1A A;  4C91 A;  2B76 A;  3UFE A;  3VU7 H;  2CHN A;  3OBV E;  2CHW A;  2WXJ A;  3OXL A;  1UW4 B;  4M3O A;  3Q79 A;  3NZP A;  4F53 A;  3FTW A;  4DMV A;  1J5W A;  5AQM B;  5A6C A;  5BXO A;  3Q7F A;  2OEW A;  4XBF B;  5FT9 A;  4G26 A;  1OCR E;  5AQK B;  3RIF A;  3RRN B;  1MYO A;  3JAD A;  2P58 C;  4A5X A;  4JVS A;  2E2A A;  3EHN A;  3DTO A;  1UX4 A;  2HN2 A;  2DYS E;  4JHJ A;  2PJQ A;  4U7Y A;  3K9I A;  1FEW A;  4CXY A;  3C4Z A;  4O60 A;  4HS2 A;  4QX8 B;  1KNP A;  3NBX X;  3IEE A;  3NWI A;  3O1H A;  2M6B A;  4DBQ A;  3CKD A;  2KBX A;  1U4Q A;  3OXG A;  5B1B E;  3BQL A;  3DWL G;  3X1D A;  3I4G A;  3ANW B;  4OX9 T;  4ZXL A;  2X6F A;  4DJA A;  4V3I A;  4WBN E;  2BTD A;  5DJQ C;  2WDR A;  1HZ4 A;  2NYJ A;  4I17 A;  3Q73 A;  5J90 A;  2E9X C;  2P9P G;  3DBS A;  4OYS A;  2OCC E;  4DX1 A;  4QXB B;  2OLT A;  3NVO A;  5LHI B;  2NWB A;  4PS8 A;  1T7S A;  2WXQ A;  2K5B B;  4O4I E;  1T72 A;  5LNK A;  4DR6 T;  4Z90 A;  3R9M A;  3UT8 A;  2X0H A;  3CQC B;  2BKK B;  2JLB A;  2P9I G;  2ACX A;  3MJX A;  1MMD A;  5ENT D;  4BTA A;  2WS3 A;  4JEH A;  2EHO C;  3AEF A;  3WAK A;  3KFW X;  3BG1 B;  3I5P A;  3Q4A B;  4X1I E;  3K3N A;  3UUM A;  4JI2 T;  1TNB A;  2PM6 A;  1DCQ A;  2K3W A;  3LVQ E;  2LAI A;  4U7E B;  2XPK A;  3LCA A;  3QKY A;  2WQ6 A;  1HFA A;  3OJA A;  3E0Z A;  3TXM A;  3DXK G;  3D9P A;  2XSB A;  5A23 A;  1TNU A;  4U8H A;  2NW7 A;  1FJG T;  2QVA A;  2YIN A;  3OPC A;  3D9I A;  4DV2 T;  4IDZ A;  3MA9 A;  3FH5 A;  3JQ0 A;  4QH5 A;  2R59 A;  2P9U G;  5AQP B;  5LA6 E;  2H3R A;  5DAB A;  2ZGG A;  3ULY A;  3MKR A;  4NUR A;  2WM9 A;  2JJ9 A;  4U96 D;  3FXD B;  3HVE A;  3Q49 B;  2IO3 C;  2F8X K;  3B5M A;  4YSZ A;  4L2Y A;  4B3S T;  3QK0 A;  3FH7 A;  1HE8 A;  2WDQ A;  5AQR B;  1HNW T;  3E30 A;  4Y6W A;  1K8K G;  3ZKR A;  5FZR A;  4MLP A;  4HFC A;  1KFY A;  5DQW A;  2VGX B;  2LRL A;  3KDS E;  4GTT A;  4H9P C;  4G11 A;  1HTJ F;  3R9A B;  4AV7 A;  3TJP A;  2QRX A;  3AG3 E;  1JUQ A;  4YFS A;  3N2K E;  1QBQ A;  3CQX C;  1X9B A;  3CHS A;  5LHH B;  4EB6 E;  4AKI A;  2CMR A;  4U3C A;  4ILI A;  4DV1 T;  5B3S E;  3LKU A;  5CRV A;  1UK5 A;  2SPC A;  3AE7 A;  5F3J A;  3CVQ A;  3FUL A;  3QOF A;  4IST A;  2M67 A;  3I4R B;  4UQY A;  4IE6 A;  2OV8 A;  5CJ5 A;  4O1O A;  4Q94 A;  3UM0 A;  2EQX A;  2Y8D A;  2PTF A;  1IJ5 A;  2A9U A;  2C0M A;  2H7V C;  4MAL A;  3UT5 E;  4FJY A;  2XAJ B;  1HF8 A;  4ILG A;  4I0U A;  3VRA A;  2XEE A;  4PJL A;  4GYW A;  4IT4 A;  3UTK A;  4QFV A;  3SNX A;  4ANW A;  2CEA A;  3H37 A;  2YDQ A;  1US7 B;  5LOZ A;  3FUN A;  4PK6 A;  2W4X A;  3M3Z B;  4TX5 A;  5BMV E;  5IUX A;  1BR2 A;  3T1Y T;  2NR4 A;  3APF A;  3L9T A;  4UWF A;  3BU8 A;  1H6K A;  2XQ8 A;  4RG9 A;  4BER A;  1UJK A;  5G05 J;  4AQF C;  2L6J A;  3RAU A;  1NA3 A;  1S0P A;  4ADZ A;  2W62 A;  3AEA A;  4GMJ A;  2N1G A;  2GK9 A;  2WWV A;  1MZC A;  2ZM2 A;  4I43 A;  1D0Z A;  1KK7 A;  3B57 A;  5JDQ A;  2BG9 A;  5CCM A;  4EIW A;  3AE5 A;  3G2U A;  1A5E A;  1Z3X A;  1N4S A;  5FL1 A;  3D9H A;  3K3O A;  4MBG A;  3V30 A;  5L3B B;  4Z8X A;  3IBE A;  4YDO A;  3U9W A;  4GTM A;  1OED A;  2WZH A;  4KMC A;  2XPY A;  3QNK A;  3ZYL A;  4UWK A;  4ILH B;  4GZ3 A;  3J9X 1;  3A8Y C;  5FXW A;  3UUN A;  5LP6 E;  4DPR A;  1O5M A;  4JXT A;  1N54 A;  2MHK A;  4ILC A;  1KZO A;  2XY8 B;  3KV9 A;  4TWD A;  2XGM A;  3UIN C;  4LUN U;  1QLB A;  1BLX B;  2Y4T A;  2XAS B;  1X79 A;  3ULQ A;  2Y6X A;  4RG6 A;  4DR7 T;  2HYZ A;  1IQU A;  1B7T A;  3L09 A;  4H9O C;  3EHZ A;  1NEK A;  3ZXS A;  2VQE T;  4NXM T;  4U63 A;  2YHC A;  5LCW C;  3CV0 A;  5D0Q D;  2D2S A;  1P5Q A;  1OWA A;  5HEG A;  3C98 A;  5LG3 A;  2MYS A;  5HYA A; 
#chains in the Genus database with same CATH homology
 3DPD A;  2LEH A;  4WNK A;  3EJN A;  1MND A;  4UI9 C;  4H63 V;  1S35 A;  5FP3 A;  4F7A A;  4H9N C;  5JR9 B;  2N9D A;  4U0U A;  4QHO A;  2PQN A;  4PFP A;  3AS8 A;  5LGT B;  4XKB A;  5CHE E;  5L3D B;  2VSO E;  3VKG A;  4GU5 A;  1OUV A;  5FWQ A;  2FF4 A;  4WBO A;  1CUN A;  3MX3 A;  4AXH A;  3BG0 B;  3CKB A;  3FU3 A;  3WXX A;  4HOU A;  3ONX A;  4EEC A;  4AQF A;  3FUE A;  3U4T A;  1HG5 A;  4BX9 A;  3GMI A;  1JWG A;  2Z6E A;  2I2O A;  1UCU A;  2DWK A;  4MFR A;  1DNP A;  5L2L A;  2KCL A;  2A2F X;  3RYC E;  5JDL A;  5LFA A;  5E75 A;  4UWL A;  2W61 A;  4M1P A;  3ZMZ B;  1L5J A;  4RVB A;  1SHZ C;  3ZN0 B;  5HAX A;  1INZ A;  4GOU A;  1OWO A;  2JQQ A;  5BT1 A;  1PY1 A;  3CHR A;  3LY8 A;  4J6I A;  3OKQ A;  2J9Q A;  3AS5 A;  3OAW A;  1XGW A;  2WXI A;  5LGU B;  2J08 A;  1UX5 A;  3RRW A;  3N9Q A;  3ZC0 A;  3Q15 A;  3PEU B;  2ODV A;  2X9H A;  3ZPJ A;  1LVF A;  3TKL B;  2MTQ A;  2YK0 A;  3GYZ A;  2CLY C;  2WAU A;  4ZS3 A;  4OHF A;  3OTN A;  4WND A;  3T5X A;  3IHR A;  5BUZ A;  2XTL A;  5T4Y A;  5LGN B;  5T3R A;  3RO3 A;  4HGA A;  3RPU A;  4CI2 B;  1PC2 A;  3PH0 C;  3L16 A;  1WYC A;  5AJD A;  3HA4 A;  1XNF A;  3FY4 A;  1T98 A;  4JLE A;  3CGH A;  2X3M A;  3B7S A;  5G55 A;  2PL2 A;  3L17 A;  4XI0 A;  1GW6 A;  2WXP A;  4AI6 A;  4GPK A;  1WYB A;  3C50 A;  1WRD A;  4GZ5 A;  2VB6 A;  4B8A A;  5LJN A;  4E7S A;  4TRQ A;  3RC3 A;  1N52 A;  3LK3 B;  3J7Y q;  4ERR A;  1EYH A;  1BR4 A;  3E22 E;  2AXV A;  1ZKE A;  3ZN1 B;  2WXM A;  4UI9 J;  3CVR A;  2IC9 A;  5FQ8 A;  3JUI A;  3GN5 A;  1TEZ A;  3CVN A;  2A5U A;  2VKJ A;  2MBG A;  2OND A;  2R17 C;  3C4X A;  4I1A A;  4E6H A;  3EDT B;  3PUS A;  4ZHQ E;  4IUL A;  4U07 A;  4G63 A;  3ASD A;  4ZI2 D;  1JPL A;  4GK5 E;  2C2L A;  4KP3 C;  1FMW A;  2GRM A;  2DNX A;  3CQG B;  3ML8 A;  4HFG A;  4KZC A;  4CGV A;  3FU5 A;  4WW0 A;  3ZJ1 A;  4HOQ A;  5BV1 A;  2J07 A;  2WXF A;  3D9N A;  3PRZ A;  3CVY A;  3APC A;  4IE5 A;  5HXH A;  5EK2 A;  5E76 A;  2X66 A;  1MMN A;  3N2O A;  4PFO A;  3RRU A;  1WLX A;  4UF0 B;  3PVL A;  3CIA A;  2XRY A;  3MA5 A;  2L9Q A;  3ZYM A;  5FNV E;  3FHE A;  1S94 A;  4DBR A;  1BR1 A;  4MBQ A;  1QSD A;  5J1G A;  4JEU A;  4EAH A;  4HOS A;  2CG2 A;  2EHO D;  4UVB B;  2LM9 A;  1H2U A;  5FY7 A;  3FTX A;  2C0S A;  2WMN A;  3IKO B;  3TL5 A;  5BPP A;  3JQ1 A;  4TZ4 C;  2V5F A;  2KZT A;  3CHM A;  2W00 A;  5C2Y A;  4FLH A;  3BK9 A;  1HH8 A;  3L6A A;  2KWH A;  3AA1 B;  4A56 A;  4UEM A;  1FVF A;  4XI9 A;  1MIV A;  4J8D A;  1HCI A;  2MRI A;  2PZI A;  5ARF A;  2EHO B;  3ETU A;  1NZN A;  3RJV A;  3O48 A;  4LER A;  4NUV A;  3TAX A;  3JC6 C;  2JRK A;  4AQG A;  3ZMS B;  3CSF A;  2G0U A;  4UF0 A;  3FUI A;  4ANU A;  4PUC A;  3HKC E;  4ZI3 C;  3N71 A;  1FMV A;  5CB4 E;  3SFZ A;  2GRL A;  2XAH B;  1UJJ A;  4FAD A;  4GYY A;  4PS7 A;  2BVL A;  3ML9 A;  1JWF A;  3ZLI A;  5JRC B;  3TG5 A;  2LT3 A;  3U66 A;  4N78 D;  4WUY A;  5JDF A;  3KVB A;  5JDG A;  2RA1 A;  2WXK A;  3HR0 A;  2Y48 B;  4JUY A;  4HOR A;  3FTV A;  1WM5 A;  4H63 H;  2DLR A;  3Q2M A;  4KVO A;  5EZY E;  2LSI A;  2CHZ A;  4AIF A;  2XPZ A;  3AA0 B;  3R6N A;  2L0I A;  2KC7 A;  2MOZ A;  4YJ2 E;  4JL0 A;  4R7L A;  2Q9Q D;  4KBQ A;  2VAS A;  3M65 A;  2NC9 A;  4GCN A;  4W9R A;  4WNE A;  3AVS A;  2X51 A;  4EQF A;  3MKD A;  3UUL A;  3ASH A;  4G24 A;  2XGO A;  3LDZ A;  2RD0 A;  1O3X A;  3SHF A;  4AKL A;  4K0R A;  3EVY A;  3HIZ A;  2UY1 B;  2W63 A;  4ANV A;  2BF0 X;  2X9X A;  3RKV A;  4AJW A;  4L9I A;  3MYV A;  3CK9 A;  1ZHC A;  2KIN B;  3DJB A;  2WXR A;  5EK4 A;  3RYI E;  1Y64 B;  2WWU A;  3AB3 B;  4EZ4 A;  4ZI3 D;  3RKO A;  3ZYK A;  3FUF A;  5LOV E;  4K0U A;  3P1U A;  2W0G A;  1IAP A;  3SOL A;  4C0E A;  2J09 A;  4N3B A;  3NZS A;  1Z0P A;  4GZ6 A;  2A3D A;  5JQG E;  2OVF A;  4ANX A;  2ZM8 A;  3QC9 A;  3E08 A;  2AWI A;  1IQR A;  2IFU A;  5CA1 E;  2ODU A;  2UXN B;  4KBM B;  1E8X A;  3FU6 A;  5KJM A;  3R7Q A;  4NUU A;  2DCF A;  2KCV A;  3QB2 A;  3QWV A;  4HKA A;  2X6K A;  4X1Y E;  2CWO A;  2J1D G;  4CDM A;  4MLK A;  1HS7 A;  4CT4 A;  2DIW A;  1ELK A;  4MS6 A;  4WWP A;  2QFC A;  3L22 A;  3QJZ A;  3S7D A;  5LYJ E;  1Y8M A;  3LJC A;  2A4Z A;  2XHE A;  3ASF A;  4HEA A;  3JC6 D;  3S7B A;  4GYO A;  5C1D A;  3R84 B;  3F57 A;  3EHM A;  1LKX A;  5JJT A;  3RX6 A;  4HLE A;  3I0Q A;  3FWV A;  3TG4 A;  4N3A A;  2C0L A;  3FUM A;  3IEG A;  5DBK A;  3CK8 A;  2V26 A;  2I59 A;  3N9L A;  5L3G B;  4WNF A;  3G2W A;  1Z6T A;  4UQX A;  5FY1 A;  2GGF A;  5KJL A;  4AY6 A;  4U0S A;  4OVU A;  4PDX A;  2X38 A;  5F8P A;  4P29 A;  4TUU A;  2VL8 A;  3D3M A;  4UV8 B;  4GIW A;  4H7Y A;  4I2Z A;  2CFU A;  3MKQ B;  5LX8 A;  3JYS A;  2CWY A;  4JZY A;  4DVD A;  4ACK A;  2RP4 A;  3U3I A;  4C90 A;  4IYP A;  3AS4 A;  3CVP A;  2I1K A;  2V1D B;  4KXK B;  2K24 A;  2IU1 A;  4V1A v;  3LK4 2;  3HKE E;  2JPF A;  3MKQ A;  2VKO A;  4C0M A;  3P7I A;  4QWN B;  2KMF A;  2V7I A;  2FO7 A;  4KVM A;  4H7X A;  4GA0 A;  5E0O A;  5ETW A;  2CFZ A;  3LEW A;  3ASG A;  4XKC A;  3AAE B;  2QY7 A;  3FUJ A;  4RSY A;  3D9O A;  2JMH A;  3FB2 A;  3PRE A;  3PTR B;  4CI3 B;  4I6G A;  3I9W A;  4APO A;  4BX8 A;  3HL6 A;  4URK A;  3MXZ A;  3CVX A;  5JDN A;  3ZMV B;  3B7T A;  2ES0 A;  4DK5 A;  4PJM A;  2LSV A;  4N2Q A;  3SF4 A;  4NAC A;  3ZFW A;  4O4J E;  4ABN A;  4ILU A;  2I1J A;  5G04 C;  1A17 A;  1G8X A;  3N9O A;  2P9B A;  4O8S A;  1WY6 A;  4APF A;  3C64 A;  4DO0 A;  5LHG B;  2NP9 A;  2WQ7 A;  3NRY A;  5LP0 A;  5HWY A;  3IBP A;  3ANW A;  1W3B A;  4EOZ B;  2DHR A;  4GYR A;  4ZS2 A;  5FQ7 A;  1KNZ A;  2IAK A;  4QKN A;  3MZK B;  2ILR A;  4AY5 A;  4DLQ A;  3APD A;  1OWP A;  4WAF A;  1E7V A;  2PM7 A;  2KM4 A;  3MV2 B;  3A5X A;  2LSU A;  5H6Q B;  4N5C A;  1E90 A;  4HXI A;  2IOL A;  3N5L A;  5EX3 A;  3JCK C;  3G2T A;  5H6R B;  4DND A;  4L1B A;  1ELR A;  5D0O D;  1PAQ A;  2V0P A;  1EF1 C;  3NZQ A;  1U5P A;  3PS6 A;  5LG4 A;  4A3T A;  2NSZ A;  2Y4U A;  3PUQ A;  1HU3 A;  5CMY A;  4HVB A;  4OK0 A;  2HR2 A;  1TJC A;  5ANR A;  3HKD E;  2VKD A;  3C98 B;  2BZB A;  3N2G E;  2V4L A;  4H9Q C;  4F3V A;  2LSJ A;  3PDN A;  4FP7 A;  5LCY A;  3FUK A;  5L3C B;  4AKH A;  5DQV A;  3UPV A;  2OVB A;  3FHN A;  3ZHE B;  2D5U A;  3PZD A;  3ZIM A;  4JEH B;  2HH7 A;  3CST A;  5HXC A;  4XIF A;  5G04 J;  4BJM A;  1E8W A;  2X68 A;  1YW0 A;  1HX8 A;  4I6E A;  5JHA A;  4BTB A;  3F31 A;  3ZRH A;  5FQ6 A;  5ANL A;  5DIZ A;  2BDE A;  3EDV A;  3PNT B;  3GZ2 A;  4GZD A;  4I9C A;  3CX7 B;  2K9A A;  3URZ A;  3CHP A;  3W15 B;  2IW5 B;  3PE4 A;  3PEV B;  1G73 A;  3QAQ A;  4KT6 B;  3EIQ C;  2X6H A;  3LPZ A;  4A1S A;  2XQY A;  2XAF B;  3C51 A;  3FDH A;  3KBU A;  2WBL A;  3TXN A;  4F6R C;  4NRH B;  3VKH A;  2CXL A;  3ZN3 A;  2E9X A;  2C5I T;  5AFU L;  4KMO A;  3RYF E;  2AXU A;  1E1H B;  5EDS A;  3RO2 A;  4UQZ A;  4H9S E;  4DMW A;  1UG3 A;  2PBI A;  2XCB A;  4I4T E;  2WXG A;  4IIJ E;  2LJL A;  3KV5 A;  3AU4 A;  4I43 B;  4N2S A;  2LOS A;  1LRZ A;  4MHC A;  4FI5 A;  3LVR E;  4A1G A;  2VGX A;  5FJY A;  4AP2 A;  1SZ9 A;  3OYZ A;  3K8P C;  4J2C A;  3LFM A;  3ZC1 A;  4I1M A;  4F1S A;  5FXX A;  2IJG X;  4XAX B;  4J8S A;  3ZYQ A;  5G05 C;  3VTY A;  5LBM A;  1KT1 A;  2KZT B;  1H7C A;  4B8C B;  3QUJ A;  3LBX A;  3LG7 A;  3DP7 A;  3B7R L;  3B13 A;  1EZ3 A;  2Q9Q B;  1IZN B;  4U04 A;  1AJ3 A;  4I6J A;  4JHR A;  2PG8 A;  3ZEF B;  3ZVV A;  4GB9 A;  3QK6 A;  3CVW A;  4UWG A;  1SQM A;  2NOX A;  2WVI A;  4PS3 A;  4X20 E;  3MV3 B;  2OOE A;  5KMG P;  3ZHE A;  3R7R A;  4BY6 A;  3ZW3 A;  1KLX A;  4JA9 A;  5JHB A;  2CCQ A;  3ZCJ A;  2V7M A;  4CZZ B;  4E85 A;  1ZBP A;  3UUX B;  5LJM A;  2YHE A;  3ZPO A;  3SBS A;  2E8I A;  4I55 E;  3FTS A;  2NW9 A;  5BNW A;  4DLO A;  4I1O B;  3VTX A;  5EKQ D;  3CX6 B;  5FTP A;  3CWZ B;  3SZ7 A;  4O2A E;  3CKC A;  2KWI B;  2N2N A;  5IHY A;  2LNI A;  5FZS A;  4O4H E;  5JDH A;  4CEM A;  3LJ3 A;  2Y3A A;  4UEL A;  2WXH A;  2H7O A;  4O6F A;  2I9C A;  4FJO A;  4IGU A;  4WWN A;  3PUG A;  4FUL A;  4CI1 B;  3AAI A;  3K3Q C;  5IYZ E;  4GZC A;  2YEV C;  1NAF A;  4G1T A;  4KUM B;  1OWM A;  3SD5 A;  4AM9 A;  1MIW A;  1D1C A;  3FUD A;  5FYM A;  3CHO A;  3EIJ A;  3Q47 B;  2X67 A;  2HM8 A;  3UMV A;  1UN9 A;  4O2B E;  2MOW A;  2KT9 A;  4FHJ A;  3IHY A;  4ANJ A;  4PW8 A;  2WXL A;  4Q96 A;  3FU0 A;  2E2E A;  3CVV A;  2PQR A;  5HXS A;  1IHG A;  5LXT E;  3MCX A;  4UWH A;  5FQ4 A;  2VJ8 A;  3RRC A;  3LY9 A;  2DWG A;  4UXN B;  4P09 A;  4EYY R;  2V7L A;  2VYI A;  3S2A A;  4DI4 A;  3FXE B;  5HXE A;  2YU1 A;  1VOM A;  4PJN A;  4WWO A;  2HO1 A;  1FIO A;  2VKH A;  1OXZ A;  1OWN A;  1E96 B;  5JDM A;  3U78 A;  4CDR A;  3NQP A;  3B7U X;  3NZU A;  1Z3Y A;  2VSY A;  1X5B A;  1D1B A;  1VRB A;  3MGB A;  3LXU X;  1WAO 1;  5ADX L;  4IE4 A;  3GWH A;  3SI5 A;  4B6X A;  2AXZ A;  2L3L A;  3KEZ A;  4PK5 A;  4PNI A;  3SRZ A;  4QXH B;  5JVD E;  2Q7F A;  4KYO B;  4AVX A;  2WB2 A;  3MZL B;  1B89 A;  2XCC A;  3N9P A;  4FHK A;  3QAR A;  4GCO A;  4JHK A;  3KS2 A;  4AOF A;  1ZU2 A;  2LHN A;  3ENE A;  3BQK A;  4JA7 A;  4AKG A;  5KJN A;  5A7D B;  4A55 A;  2RG8 A;  4EZH A;  2FI7 A;  1QNF A;  2X6J A;  1VDY A;  4AXP A;  4HN9 A;  3AVR A;  3IV0 A;  1IJ6 A;  2M63 A;  5CA0 E;  1OWL A;  1U3D A;  3O4Z A;  4U74 A;  4ZI2 C;  2WMO A;  2XAQ B;  4G23 A;  5LCW J;  2IF4 A;  2LAH A;  3ZJ2 A;  3RIB A;  1NA0 A;  4CGW A;  3AA6 B;  1E8Y A;  3S4U A;  2A72 A;  3LBX B;  2X9Y A;  2R5S A;  4CQI A;  3ZMT B;  3OXF A;  5TAO A;  2IC6 A;  5AIJ A;  2VK9 A;  3HI2 A;  4EXT A;  2WPV A;  3CVU A;  3UQ3 A;  3Q5X A;  3GN5 B;  3KIN B;  5AJL A;  3VLD A;  2Q9Q C;  3HYM B;  2OA5 A;  5JRE A;  4I2W A;  4K03 A;  5KX5 E;  1HS6 A;  3S7J A;  4YND A;  3QOU A;  3KBT A;  4FLB A;  4CDN A;  3SWH A;  5CCL A;  2LHR A;  4YVQ C;  3QWW A;  2V8S E;  4HTE A;  1E8Z A;  1ZEE A;  4QX7 B;  2QGS A;  5GON E;  2CM0 A;  4QXC B;  2HPL A;  1D0X A;  3BQI A;  3RC8 A;  5J2U E;  5JJ6 A;  4HFV A;  1YD8 G;  4I50 E;  3PE3 A;  3GA8 A;  2NW8 A;  3MAC A;  4DI3 A;  4LEU A;  3GW4 A;  5FXZ A;  4YHJ A;  4L5G A;  4N3C A;  4BA9 A;  1SA0 E;  3V5U A;  4KZ0 A;  3GZS A;  4N39 A;  3D9L A;  4J8E A;  4U0Z A;  4JC8 A;  3ONL A;  1EDU A;  3H3A A;  3UUX A;  1QZ2 A;  2NTY A;  1EPU A;  4TUY E;  3CEQ A;  4IE0 A;  4Q69 A;  3G2S A;  4NQ0 A;  4CXX A;  2ZM0 A;  2J49 A;  4G2V A;  3N9N A;  3ZMU B;  3EUH A;  2KLQ A;  1NWM X;  2KCK A;  3AU5 A;  4E7Z A;  3ESL A;  2UWJ G;  2VSN A;  3HVE B;  3OYX A;  2D0T A;  4YLH A;  3RRM B;  4J0U A;  4P0B A;  3NRX A;  5JR9 A;  3C4W A;  2NXP A;  5KCM A;  2LOP A;  2FEZ A;  1KT0 A;  4ZOL E;  4UVA B;  2LSG A;  5AEN A;  2EHO A;  3FH8 A;  2AVP A;  1SZA A;  4XX5 A;  3MEK A;  2VTB B;  4GAA A;  1MMG A;  3LS8 A;  5HQ8 A;  3P8C D;  1Y6I A;  2ZU6 B;  4PJJ A;  4XE0 A;  3T8O A;  4BWR A;  3PU3 A;  2WXO A;  3D9K A;  3GZ1 A;  3PUJ A;  1BR0 A;  2X6I A;  3ZEF A;  1WR6 A;  2JEK A;  4YJ3 E;  1D0Y A;  2LSY A;  2YU2 A;  2J4B A;  3P2B A;  2BUG A;  3U64 A;  4EZL A;  3FBZ A;  4EPZ A;  3FP3 A;  3WI3 A;  4I9E A;  2KXP B;  2XPI A;  5ARG A;  2XHE B;  2VGY A;  4L0R A;  2I6H A;  3HHM A;  4JW1 A;  4OYK A;  4GYS A;  4BSX A;  4JEU B;  4MKT A;  4PK4 A;  3S7F A;  4FJZ A;  4B89 A;  1BPO A;  2KZ7 B;  3RH3 A;  4YVO A;  2E0I A;  4MRU A;  3VHL A;  3I9Y A;  5HWX A;  2XQ0 A;  2CLY B;  1TJF A;  5G2N A;  2KAT A;  4TV3 A;  3HDX A;  2L8K A;  1YKH B;  2ZLY A;  3KD7 A;  4TV8 E;  2E9X B;  3UT4 A;  5HI7 A;  5KDM C;  4ME2 A;  3PUA A;  3I0O A;  1IYG A;  4UIG A;  4IN3 B;  1LVK A;  3FUH A;  2WSS V;  3FBL A;  3RK6 A;  4G25 A;  5A1L A;  1H2T C;  5JJ7 A;  2CG3 A;  3UX4 A;  1ZV4 X;  2CXD A;  3PDY A;  2IOS A;  2XAG B;  3CK7 A;  1H2V C;  5T8I A;  4GML A;  3CVL A;  2GW1 A;  1FCH A;  2UY1 A;  3NF1 A;  5LBQ B;  2X9W A;  4L23 A;  3VLF A;  2UXX B;  3CX8 B;  2BVM A;  3HKB E;  2J4D A;  4FU3 A;  4D10 C;  4PAG A;  3PNL B;  2YQ8 A;  4G2A A;  2DCP A;  2VQ2 A;  3L54 A;  4FA6 A;  3D0T A;  3Q5W A;  3CLJ A;  3LY7 A;  4PH4 B;  4EBA G;  3CHQ A;  4B94 A;  3MJW A;  1UN8 A;  5J2T E;  3FFL A;  5CMW A;  4EZK A;  4ACL A;  2CXF A;  5L3E B;  3ZCI A;  3O4X E;  3AA7 B;  4L7T A;  3SBT B;  3RU0 A;  3ETV A;  1FVH A;  4BT9 A;  3FTU A;  3G2V A;  2K48 A;  4ZI7 E;  2XRZ A;  3FEY A;  1MQS A;  3SS1 A;  4BAY B;  4AEZ C;  3E4B A;  4B0Z A;  3SGH A;  4IE7 A;  3I3N A;  1H19 A;  2NTX A;  3KV6 A;  4WNG A;  3D9M A;  5JR9 C;  3RYH E;  4ATG A;  2Q9Q A;  5EK3 A;  5J08 A;  2FUL A;  1MMA A;  2JMK A;  1MHQ A;  3QWP A;  2VSX E;  3KVA A;  3PU8 A;  5FY0 A;  1E7U A;  2WXN A;  3IF8 B;  3FTY A;  2L0T B;  4O4L E;  2XEV A;  4TV9 E;  3BEE A;  5M72 A;  4A3V A;  4EZJ A;  2C5J A;  3L13 A;  2ZMA A;  2VWA A;  2PFV A;  4CRW A;  5FMN A;  2DBA A;  2V7J A;  2CE7 A;  2X0L B;  3MK7 C;  2C5K T;  2CHX A;  1U3C A;  1V9D A;  4LRZ A;  5ENN A;  2B1E A;  3D9J A;  2WQH A;  4U72 A;  5AYW D;  5FZQ A;  2YNQ A;  4X1K E;  3O9X A;  4L2L A;  3WAJ A;  3V5S A;  2LSK A;  3I1A A;  3O1J A;  1MIY A;  5BV0 A;  1MNE A;  5M4Y A;  4C9B B;  5C8Y E;  2FBN A;  2DI4 A;  4ASK A;  3LK2 B;  4BT8 A;  1HG2 A;  4XZC A;  4OYJ A;  1YA0 A;  3VLE A;  4GA2 A;  5BW8 C;  3UT7 A;  3Q9D A;  4ISS A;  3FEX A;  3Q5M A;  4BFR A;  2IQC A;  3L3P A;  1H0A A;  5JH7 E;  1QQE A;  2QA7 A;  4OVV A;  4P0A A;  4UVC B;  4EYU A;  4GA1 A;  2VTB A;  2KND A;  3QC1 A;  3CML A;  3PUR A;  2CA5 A;  5FXV A;  5EX0 A;  2XUE A;  3QDN A;  1DVP A;  1QUU A;  1HO8 A;  2D0U A;  2LE8 A;  3KAE A;  4XZ4 A;  3AAA B;  1NP7 A;  2XGS A;  3L08 A;  3CPZ A;  3CR3 A;  4EBA A;  2AW6 A;  4UI9 K;  4CXW A;  3N9M A;  4BJN A;  1LF8 A;  4TN7 B;  3TGO A;  1HXI A;  2V7K A;  1YKE B;  4IHJ E;  2L9B A;  3LYA A;  3ESK A;  3KV4 A;  5L3F B;  2ION A;  2HPJ A;  4OFZ A;  3T8M A;  4CT0 A;  3EDU A;  4CCA A;  3PUK A;  3ONK A;  2LO6 A;  4FC8 A;  3T5V A;  4J8F A;  4HOT A;  5KJK A;  4Y6C A;  3ZGQ A;  4IRU A;  3U3W A;  4HE8 A;  3IHV A;  2E9X D;  5JRC A;  3F2E A;  4UV9 B;  5HXR A;  1ELW A;  3O1I A;  4GK0 E;  4LCT A;  4AKR B;  4H9R C;  4JPS A;  3PE0 A;  1D1A A;  3FTZ A;  4C91 A;  3UFE A;  3VU7 H;  3OBV E;  2CHW A;  2WXJ A;  3OXL A;  1UW4 B;  4M3O A;  3NZP A;  4F53 A;  3FTW A;  4DMV A;  5A6C A;  4XBF B;  5FT9 A;  4G26 A;  3RRN B;  2P58 C;  4JVS A;  3EHN A;  3DTO A;  1UX4 A;  4JHJ A;  2PJQ A;  3K9I A;  1FEW A;  4CXY A;  3C4Z A;  4HS2 A;  4QX8 B;  3NBX X;  3IEE A;  3O1H A;  4DBQ A;  3CKD A;  3OXG A;  1U4Q A;  3BQL A;  3I4G A;  3ANW B;  2X6F A;  4DJA A;  4V3I A;  4WBN E;  2BTD A;  5DJQ C;  1HZ4 A;  4I17 A;  5J90 A;  2E9X C;  3DBS A;  4OYS A;  4QXB B;  5LHI B;  2NWB A;  4PS8 A;  2WXQ A;  2K5B B;  4O4I E;  3UT8 A;  5LNK A;  3CQC B;  2JLB A;  2ACX A;  3MJX A;  1MMD A;  4BTA A;  4JEH A;  2EHO C;  3WAK A;  3KFW X;  3I5P A;  3BG1 B;  3Q4A B;  4X1I E;  3K3N A;  3UUM A;  2PM6 A;  3LVQ E;  2LAI A;  3LCA A;  3QKY A;  2WQ6 A;  1HFA A;  3OJA A;  3E0Z A;  3TXM A;  3D9P A;  5A23 A;  4U8H A;  2NW7 A;  2YIN A;  3D9I A;  4IDZ A;  3MA9 A;  3FH5 A;  3JQ0 A;  2R59 A;  5LA6 E;  2H3R A;  5DAB A;  3MKR A;  4NUR A;  2WM9 A;  2JJ9 A;  3FXD B;  3HVE A;  3Q49 B;  4L2Y A;  3QK0 A;  3FH7 A;  1HE8 A;  4Y6W A;  5FZR A;  4MLP A;  5DQW A;  2VGX B;  3KDS E;  4H9P C;  4G11 A;  1HTJ F;  3R9A B;  4AV7 A;  3TJP A;  1JUQ A;  4YFS A;  3N2K E;  3CQX C;  3CHS A;  5LHH B;  4EB6 E;  4AKI A;  2CMR A;  4ILI A;  3LKU A;  2SPC A;  5F3J A;  3CVQ A;  3FUL A;  4IST A;  2M67 A;  3I4R B;  4UQY A;  4IE6 A;  2OV8 A;  4Q94 A;  2EQX A;  2Y8D A;  1IJ5 A;  2C0M A;  2H7V C;  4MAL A;  3UT5 E;  4FJY A;  2XAJ B;  1HF8 A;  4ILG A;  4PJL A;  4GYW A;  3UTK A;  4QFV A;  3SNX A;  4ANW A;  2CEA A;  3H37 A;  1US7 B;  5LOZ A;  3FUN A;  4PK6 A;  4TX5 A;  5BMV E;  1BR2 A;  3APF A;  4UWF A;  1H6K A;  4RG9 A;  1UJK A;  5G05 J;  4AQF C;  2L6J A;  1NA3 A;  1S0P A;  4ADZ A;  2W62 A;  4GMJ A;  2N1G A;  2GK9 A;  2ZM2 A;  4I43 A;  1D0Z A;  1KK7 A;  3B57 A;  5JDQ A;  5CCM A;  4EIW A;  3G2U A;  1Z3X A;  3K3O A;  5L3B B;  4Z8X A;  3IBE A;  3U9W A;  4KMC A;  2XPY A;  3QNK A;  3ZYL A;  4UWK A;  4ILH B;  4GZ3 A;  3J9X 1;  5FXW A;  3UUN A;  5LP6 E;  4DPR A;  4JXT A;  1N54 A;  2MHK A;  3KV9 A;  2XGM A;  4LUN U;  2Y4T A;  2XAS B;  1X79 A;  3ULQ A;  2Y6X A;  4RG6 A;  2HYZ A;  1IQU A;  1B7T A;  3L09 A;  4H9O C;  3ZXS A;  4U63 A;  2YHC A;  5LCW C;  3CV0 A;  5D0Q D;  2D2S A;  1P5Q A;  1OWA A;  3C98 A;  2MYS A;  5HYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...