3CQGB

Nucleoporin nup107/nup133 interaction complex, delta finger mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
184
Chain Sequence
LSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDENINDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADFEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear pore complex protein Nup107
publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 59
structure length 184
sequence length 222
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqgB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqgB02
3I4RB 3CQCB 3CQGB
chains in the Genus database with same CATH superfamily
2M67A 1N4QA 3B95A 4BJNA 3PURA 3SOLA 1H7CA 1UN9A 2AXVA 2RFAA 4H9OC 2I0MA 1N36T 4UVBB 3UIOC 5AENA 3H3MA 3C51A 3D9LA 5TAOA 3LBXA 1INZA 4EIWA 3KBTA 2IEJA 2PM6A 2XZEA 2VSYA 3NF1A 5L4EA 2JMHA 2EHOB 2HYZA 4AP2A 5LMUT 4GAAA 4HOTA 1WLXA 4CI2B 4AVXA 5ENOD 3F31A 2LSUA 3RIFA 2A4ZA 2E5VA 4IL9A 4TUYE 4NXNT 4WNDA 3ZYMA 2V26A 2XS1A 3NZQA 4JYAT 3EHRA 2NOXA 3AVRA 2VWAA 4TV8E 1WYCA 4IL4A 2HN1A 2W62A 4ZXLA 2V4HC 3CWZB 1OEDB 2XEEA 3N9NA 3I0OA 5H6QB 3HDXA 2B1EA 3J7Yq 2L0IA 2X66A 2J4GA 3CSFA 3UU3A 2X6IA 1D0XA 1W3BA 3ENEA 3J5QB 2XASB 3ZW3A 2I1KA 3F57A 3NZPA 5AIJA 2LSKA 3Q78A 5ENSD 3N9OA 4UVAB 3KV5A 2YDQA 4IIJE 3QWPA 3M3ZB 3D3MA 4ZZBA 5BV0A 1D9SA 3AAAB 1B89A 3AG1E 2HE0A 2LSYA 4KXKB 4RVBA 3IEGA 3SFXA 3MJWA 2IOSA 4GZCA 3AAEB 5AQGB 5CB4E 4DV7T 2ZISA 2P9NG 2KBXA 4ACKA 2JQQA 4XX5A 2KC7A 2VQET 4J8YA 3MA9A 4Q94A 4U63A 3B7UX 3AE4A 4C9BB 5EDSA 4AIUA 4KYOB 1N4SA 4U2YA 2PQRA 3ANWA 3TWRA 3KVBA 4JI6T 4DR2T 4GCNA 3CEQA 3TAXA 5BXUA 4CZZB 4EGWA 2X9HA 5CBOA 2L6JA 4U7IA 2KM4A 4QFVA 4EQFA 2R05A 2FJAA 3QJZA 2JQHA 1QSDA 1RZ4A 4PDXA 4IDZA 1N4PA 3AXJA 2XGSA 3Q9UC 3FUFA 3C3OA 4HRLA 1MIWA 4I6EA 2X9YA 2V7KA 4B89A 3CKDA 3QDNA 4PK5A 4EZKA 1VDYA 1W0AA 2BG9C 5G04C 3ZT5A 4JC8A 1FT2A 4U07A 2DWGA 4TNVA 1XMOT 2IMLA 4EAHA 2XPYA 3HL6A 2RD0A 3RIBA 4BTBA 4AM9A 4CDRA 2YDRA 3AEDA 3SZ7A 4U72A 3C98A 1FVFA 2XQ8A 3CV0A 2ZM8A 2WXPA 4E7ZA 4LUNU 2MAWA 3FHNA 1SVXA 3KV6A 5KMGP 1H2TC 3U64A 2Y4UA 4Z8XA 1MZCA 3N2KE 3BUAA 1MJ0A 3S7JA 3PU3A 5E75A 3EABA 2CM0A 4H63H 4UVCB 3LKUA 3LJNA 1W0BA 4ZI7E 4HFGA 3UQ3A 2Q9QC 1HNZT 4X8QA 4N78D 3V2OA 2XM2A 2WAUA 4O2AE 1IBMT 4OK0A 2XZTG 4BT9A 1H2VC 2XGOA 5BXOA 2W63A 4UR9A 3D9JA 1XDPA 4DR1T 4DUYT 5HRYA 3ZT6A 2QYWA 2XQ6A 4IDQA 1JCQA 3FUDA 2MPKA 3D9MA 5HYAA 2M6IA 3ZC0A 3MXZA 3C72A 3HIZA 2YKSA 3ZFWA 4PNIA 2DBAA 2VTBB 3MA5A 5KJMA 1Z0PA 2D0TA 2LAIA 3HYMB 2LEHA 1OY3D 3BU8A 1D0ZA 2MHKA 2P9SG 4A3VA 4KT6B 2LXMA 2LOSA 1LKXA 5BNWA 1ZOYA 3CK6A 5JA4D 3FDHA 3MV2B 2J4DA 2VKOA 5H7PA 1SZAA 3ZEFA 2NSZA 5FZQA 2W61A 1JCSA 5T4YA 1YMPA 5FY0A 3P4SA 4LEUA 2KZTA 2VSOE 3ZMZB 3CVXA 3ASFA 2MYOA 3FUNA 2JEKA 3LY8A 2BEDA 2VGXB 2VJ8A 2E8IA 1Z6TA 5JJTA 2DWZA 4A63B 1YYHA 3CLJA 1OT8A 2N2NA 3P7IA 3NWIA 5DQVA 2V0PA 1IKND 3HXCA 1E7VA 3QARA 2VL8A 4ANJA 4YTNA 3ZHEA 2ETAA 2WB5A 5FJYA 5JR9C 2Y0BG 2W67A 4HN9A 2V7JA 3Q2MA 2XS8A 4N5QA 2UY1B 5EYLA 2P2CP 4WWPA 2AE9A 3RYIE 4LF9T 2EIKE 4UWFA 1N11A 4A1GA 2WQ6A 4DR7T 1HG2A 2V7LA 3DSWA 4AQYT 4PJLA 2V1DB 1Y01A 2WU5A 3SD5A 4UI9J 5BMVE 1MX6A 2LHRA 5ARGA 3S7DA 2IQCA 1QQEA 1O3XA 4ABNA 3KSLA 1E1HB 4A98A 3LJCA 2ZGDA 4TV3A 3ZXPA 4HTEA 4EOZB 5ABHA 3PEUB 4DIDB 3Q7FA 2IFUA 2QRXA 3AE5A 5FP3A 4QX8B 3X1DA 2QFCA 4I50E 1SHZC 4HWCA 3FUKA 2KLQA 2KXPB 1Z5SC 5AQQB 5JDGA 3MX3A 3UM2A 3UMVA 3UULA 3VLEA 3D0TA 5A7DB 4G2VA 4J8DA 5LP6E 5LBMA 2V8SV 4AKGA 2XEVA 4IRUA 4B3MT 2VL0A 3LVQE 2CXDA 2DHRA 5LG4A 3RAUA 4LF5T 3BQLA 2E9XB 3ZT7A 1IJ5A 4I4TE 4UF0A 3GN5A 3HVEB 3R6NA 3K3NA 3CVRA 2R03A 2Y1LE 2Y6XA 3PVLA 1L0VA 2Q9QD 4AJWA 5EK4A 4IDOA 2L9BA 2VK9A 3BQOA 3FY4A 1E90A 3DSSA 5CJ5A 3GZ2A 1G8XA 5HEGA 5CMWA 4P0AA 3L22A 3TWSA 5CGMA 4JEHA 3FB2A 4JB8P 4AI6A 3IF8B 2WXQA 5LGNB 3O48A 1UK5A 2DNXA 1LD8A 3PUJA 3ZNGA 4HFVA 4ILGA 4U0SA 2IUBA 2PZIA 3RKVA 4BTAA 4XI9A 2L8KA 1JNRA 3RSEG 4ZHBA 3VHLA 4PJNA 4EHMA 4OHFA 1I6ZA 2EIME 4GMRA 4G2AA 5EIBE 3UUXB 2BBJA 3PUKA 3DP7A 1S35A 4ILCA 3MZLB 3Q49B 5J08A 4ISSA 4LNUD 2LSVA 5DJQC 1ELKA 2WP9A 4AV7A 4DJAA 2H6IA 2DWKA 1E7UA 2H88A 3WI3A 2KCKA 3MGBA 4DV1T 1N9AA 4CCAA 4IE0A 4CT0A 4UQXA 2YHEA 4CZ2D 3CVLA 3FP3A 4CN4A 4BSZB 1CUNA 1UW4B 3AS5A 3QOFA 2YOEA 3HHMA 1NA3A 1Z8UA 3OXLA 4GZ3A 3UU5A 2XRYA 3FTZA 2QA7A 3Q15A 4TXQA 2XQ5A 2UUBT 2XM1A 4K0UA 2LKGA 4OAVB 5LA6E 3R9MA 4U7YA 4FLBA 1UX4A 5ADXL 3W9FA 2OVBA 3ETVA 1ZP0A 5LHGB 2GW1A 4APFA 2NW9A 2PM7A 3MYVA 1MMAA 1HF8A 1KNRA 4N2SA 2V7IA 1UG3A 3SHFA 3LS8A 3LVRE 4UEMA 1D1BA 2WPVA 2KWIB 5FZSA 1S63A 1NA0A 2DL1A 4GB9A 2XCBA 4BESA 2XEHA 2J47A 3N2OA 1NEKA 1IHGA 2ETBA 4HOQA 5JQGE 2XPZA 5AQ9A 4HNAD 4DUIA 2OV9A 5LCWJ 4XAXB 3LK2B 4RQIA 3SY2A 3JAEA 1O1TA 3HXEA 5EK3A 4G23A 4PJMA 3FUJA 5BUZA 1JWGA 3FZLB 1E8YA 3PV0F 1E96B 3VR8A 1T7SA 3TLVA 3C3QA 4PK6A 4J2CA 1NP7A 4HFIA 4PS7A 3ULQA 4OX9T 1BPOA 4JD2G 3TLUA 1SA0E 3AB3B 3HXBA 2H6HA 4YT0A 4GTSA 2ZLYA 2XQ7A 5AQNB 2MYSA 5G05C 5F8PA 5AQTB 1TN8A 2BVMA 1IQUA 3OTNA 3GYZA 2I9CA 3K3QC 3IBPA 2RP4A 3AEEA 4JI0T 5CMYA 3HKDE 3L82A 4FHJA 2LRKA 2LSIA 1Z3XA 2CRBA 2XGMA 1ZU2A 1S0PA 5CBNA 4KP3C 2ETCA 3PZ1A 4ZEYA 3A8YC 3AEFA 1N52A 4A97A 3MKQB 4J0UA 4Q69A 1YCSB 4EZ4A 3T9KA 3CSTA 4EEBA 4FI5A 3U4TA 1KK7A 5LB7B 3ZJ2A 2J07A 3FH7A 1IXVA 4QKNA 4X5TA 2LT3A 4OYJA 2C5KT 5AQSB 1J1JA 5CA0E 4OYSA 3LYAA 5AQFB 1WY6A 3OVUA 4URKA 5CA1E 1T8BA 4JI1T 1JWFA 2WXKA 3OTOT 3L6AA 2X9WA 1KFYA 4TWDA 4J8SA 4ZS2A 3PS6A 2B0OE 3AECA 3ABKE 1B7TA 4AOFA 1WM5A 3N9QA 5KX5E 3E08A 1HX1B 2RPAA 4GZ6A 4ZHQE 3ZIMA 2B76A 1DU2A 5FNVE 2KINB 2BF0X 3FZHB 2WBLA 1N34T 1K8KG 1M7KA 1U4QA 2LM9A 2XAQB 3Q7AA 3E30A 4EBAA 2BG9A 2N1GA 3JADA 5E0OA 1UOHA 1IQRA 3UPVA 2X6HA 4WNKA 1XMQT 2BG9E 3EJNA 4HWDA 3QUJA 3URZA 3JC6D 4G24A 3ZKRA 4H9NC 4V3IA 3U9WA 3P4RA 4YHJA 5FXVA 1KEYA 1LF8A 3ULYA 2P9LG 4LF4T 4EV6A 3L39A 3FTSA 4K5BA 3JCFA 3JUIA 3Q5DA 4MRUA 4ERRA 1VCSA 2MBGA 4JHKA 5HWYA 4LRZA 2R2LA 3JQ0A 4I55E 2CE7A 1GQEA 2XAGB 5FQ7A 3RI5A 3CHPA 2XPKA 3OPCA 4UI9K 4Z90A 2ILRA 2X9XA 5J2UE 4BY6A 3Q79A 5ENNA 3IKOB 2IAKA 3U66A 4AISA 2CHZA 4ZOLE 4BWRA 3AE2A 2D5UA 5IY5E 2I6HA 4DNDA 4I6GA 2HPJA 3UTKA 2AXUA 1CHUA 1HCIA 3CKCA 5J2TE 3FH8A 3PZ3A 2ZM0A 3N5LA 1JPLA 5M72A 4BFRA 2AXZA 3FBLA 1S64A 2QC9A 1X79A 3JXJA 3PZ4A 4LFBT 3FH5A 3VLDA 4IE7A 4EZJA 4BJMA 4GYRA 3NOGD 3QOUA 5KBAA 2BKNA 4YXDA 4G11A 2KZ7B 5G04J 5HEUA 3R7QA 4IDNA 4AXPA 5FINA 3FTYA 1YA0A 5T3RA 5L3FB 3UQ7A 2AXDS 3KEAA 3NRXA 3M65A 5AQBA 4F1PA 1KPSB 4FADA 1TNUA 5A6CA 3Q9DA 1NWMX 5AN8A 1OEDA 2V5QC 3CVYA 1UX5A 5HXSA 1OWLA 1OEDE 4EYUA 3JXIA 1TN6A 5JJ7A 1SA4A 3EUHA 3S2AA 2BS4A 2IU1A 3RO3A 3P2BA 3I9WA 3PZ2A 3IHRA 4FC8A 4GPKA 1T98A 3RLFF 2C0LA 3S7BA 5L47A 2WY2A 2BKKB 4A5XA 3FHEA 2LAHA 5CRUA 2XAHB 4MFRA 2OVFA 5JR9A 3QB5A 2XRZA 3UUMA 2MRIA 3L09A 3NBXX 2WSSV 5EYPF 4A3TA 3WG7E 2NP9A 2LSGA 1QYMA 2YU2A 3TXNA 5FY7A 2RFMA 3MACA 5JREA 4ILUA 2P9BA 5J90A 2D9DA 3PDYA 1HNXT 2Y3AA 5JDHA 5EX0A 2X3MA 3CMLA 3L16A 4DX2A 3QK6A 3Q5XA 1G3NB 4U95D 4XI0A 5EILA 3FZKB 4L9IA 4IGUA 2A72A 3CK7A 1X9BA 5AQAA 1E2AA 2Y8DA 2UXDT 2E0IA 3CHRA 4UXNB 1TNBA 2YQ8A 3E32A 5AJDA 3MJXA 2J49A 5HXRA 3QC1A 2NTXA 4LF6T 3MCXA 2A3DA 2V5FA 2A5EA 2K9AA 2C2LA 4WWOA 3WAKA 2J1DG 4PFOA 3LK42 1UN8A 2K3WA 4X65T 4O6FA 5IUXA 4DMVA 3SFZA 4B3ST 5CECB 5L4HA 4J6IA 3P4PA 3UUNA 2XY8B 4JI7T 4CXYA 3AG2E 2WXHA 1UCUA 4HGAA 3CIAA 4U74A 1FMVA 4TWHA 3UU6A 2NTYA 3ZPJA 5JHBA 1O1SA 4GZDA 2CLYB 2NYJA 4CT4A 1FT1A 3TL5A 1TEZA 3EVYA 4H9SE 4G26A 4GTPA 5KCMA 1FCHA 4GIWA 4ILBA 5J0ZA 1Y8MA 5FQ4A 3L9TA 2F0YA 3GZ1A 2Q7FA 3G2VA 2RG8A 3VLFA 2J08A 2EQXA 5ANLA 3LK3B 5FT9A 2L3LA 5JDFA 1NAFA 5LJMA 5B1AE 4AXHA 2BKPA 1VOMA 3T5VA 1MNEA 2XQAA 2FJBA 2H7OA 4O2BE 5B1BE 5M4YA 5AQKB 4L1BA 1OCOE 4L7TA 5CCLA 3KAEA 3V2XA 3LY7A 1AWCB 1HG5A 4KVOA 2P9PG 3AA1B 2AJAA 3UT7A 4LFCT 3H3AA 4NPPA 3PE4A 3UT8A 4K03A 5AFUL 5FQ6A 4KBQA 2QVAA 4JA9A 5ENTD 4AY5A 4J7WA 1QNFA 1U3DA 4DX6D 1M62A 1MX2A 3EHZA 1SQMA 4GYYA 1ELRA 5LGUB 3T5XA 1DCEA 2BBHA 2VASA 4EYYR 3GW4A 4TX5A 4P1NA 2CMRA 4FU3A 1XNFA 3SNXA 2WXGA 5FZRA 4MALA 5HEJA 3C98B 4GTRA 2VTBA 2AW6A 3Q4AB 5BR8T 1LRZA 5T8IA 4HI9A 3CR3A 2EHOC 3NOCD 1UJJA 5L2LA 4HB5A 3NBNB 4FP7A 5AQHB 5LG3A 2IONA 3EDTB 2CBIA 4DR5T 3K3OA 4CN1A 2UXBT 3PUGA 4QX7B 3D9OA 2X0HA 2YNQA 3LDQB 2QYUA 3IHVA 3FUEA 4KI0F 2IDOB 4ZFHA 2CFUA 1HO8A 3VTXA 4AIFA 1HNWT 3FTVA 2LM2A 4KUMB 3EU9A 2D0UA 2VVSA 2VGXA 1MX4A 5ENPD 2XQYA 2VKDA 3B5MA 4GKJT 2ZGGA 1OEDC 3N9PA 3E22E 4GYSA 4C0EA 2OCCE 4JBWF 2XCCA 2JRKA 2D2SA 3AEGA 2P9UG 2XAFB 3SI5A 5FXZA 3KD7A 3FU6A 1WR0A 4AQFA 4DX7D 4MBGA 4DLQA 5AQUB 3BG0B 3CKBA 4X1YE 4JW1A 3ONJA 2GRPB 3CPZA 3JQ1A 3AAIA 4BT8A 1DVPA 2QZAA 3AAAC 4I2ZA 2L6BA 1GW6A 3IA3A 2ZM2A 2LUHA 4O1PA 2BTDA 3KVAA 2DVWA 3ZEFB 3EU5A 3ZYQA 1FIOA 4JEUB 3MK7C 5EZYE 2A2FX 2KMFA 5AAOA 5LFAA 3O4XE 5HXCA 2KZTB 3ABLE 3FUHA 2L0TB 5CCMA 3RYFE 4W9RA 1S94A 1YKHB 4LFAT 1ZBPA 3G2SA 2X0LB 1DCQA 4AKLA 3JCKC 4AKIA 4I43B 2PL2A 3OYXA 2GRLA 4TXRA 4DO0A 2W00A 4JUYA 3ZHEB 3UI2A 2LE8A 4QXHB 4RG9A 4AKRB 4KMOA 4U0UA 2X6FA 4YJ3E 4I1AA 3JAFA 3VKGA 4HOSA 4QH5A 1V55E 4X1KE 5FKYA 2WQHA 1OWOA 1EPUA 5CFBA 4GTMA 2M6BA 3AE6A 4YSYA 1QBQA 3HVEA 3SFYA 4KHPT 4IYPA 3AE7A 4JI4T 4DR3T 3O1JA 4UQZA 4UV9B 2XTLA 3Q73A 2DZNA 4YHHT 4GCOA 3H37A 2K5BB 4K5AB 4I9CA 4YSXA 4APOA 3KV9A 3CHSA 1OUVA 3PUQA 3VTYA 1ZEEA 1HE8A 3AG4E 3C4XA 3K8PC 2UUAT 1KLXA 3KDSE 3IBEA 2QYJA 4Q25A 3FTUA 2GK9A 1K1AA 1EDUA 4WWNA 4P0BA 3UKUG 2I1JA 3UT5E 3DPDA 5AARA 4CGWA 3OYZA 3TJPA 2VYIA 2F37A 3ABVA 2EHOD 4I2WA 5KXJA 5LOZA 1TNZA 5LJNA 3UKRG 1TJCA 2XZDG 3P4WA 5HKPA 2IO3C 3PREA 4J8EA 2CA5A 2QGSA 4X62T 1TNOA 4DV6T 1AP7A 3PUAA 4UF0B 3GN5B 4YJ2E 1NZNA 3RIUC 3B7SA 5LHHB 5D0OD 1O5MA 5LBQB 5G05J 2F4VT 4K0KT 2JQ9A 3LCAA 4A55A 2GRRB 2XQ9A 3NVOA 3V79K 1DNPA 4XIFA 2YK0A 1VRBA 3RRMB 4DMWA 4BETA 2WWUA 1H6PA 5LMNT 2UWJG 3LJ3A 4KHZF 3NRYA 1BD8A 2XQ4A 4YTPA 3PDNA 2VQFT 2X68A 4ANWA 3OXGA 4JEHB 4F6RC 3DSTA 5KJKA 4LMKA 4B0ZA 3ASHA 3D9KA 1WCRA 2C5JA 4CEMA 3U78A 3NQPA 1MYOA 3BG1B 3GWHA 3RRNB 5HS0A 4I1MA 3FXEB 1N4RA 5LYJE 1FVHA 2ODUA 1Q2ZA 3AA6B 3UQ4A 4HQDA 4ISTA 4DRXE 3HR0A 5J1GA 3RX6A 5FYMA 3RKGA 3G2WA 1SA5A 2X0YA 3IV0A 1JUQA 4O4LE 3GZSA 3QAQA 4U33A 3JYSA 4UELA 3RJVA 1ELWA 4GU5A 4B3RT 3PU8A 3JC6C 4HBDA 2KWHA 3PUWF 2WZHA 3RH3A 4JPSA 2CEAA 5LCYA 1D1CA 2UUCT 1HU3A 5HEHA 1E8WA 2WXOA 2DCFA 1WAO1 3A7MA 4A56A 2V6YB 4AQFC 3E4BA 3ML8A 1QLBA 4DV3T 3R84B 4UQYA 5ENQD 4UWLA 3DEOA 3G2TA 3T8OA 1NI1A 2XHEB 4YSZA 1IYGA 5L3CB 1V9DA 3AU4A 2CHXA 4IDPA 3B57A 4RG6A 2NW8A 1H2UA 5AQLB 3UTMA 3QB5K 5BT1A 4RSYA 4ILIA 3LXUX 4YDOA 3Q5MA 4KMCA 5LGTB 3RK6A 5FL0A 3UM0A 2F8YA 4LF8T 1KF6A 3FFLA 3HXDA 1EF1C 1U3CA 5BPPA 2V6XA 3FU5A 3TLTA 1FJGT 2VQ2A 4CDMA 4WAFA 1D8EA 5A1LA 4OYKA 2FJDA 2IJGX 2XQ0A 4M1PA 4QQIA 4GMJA 2KATA 2KXPC 1MMGA 3F6QA 3CVUA 3DWLG 2IF4A 3B7RL 1UGOA 4XEIG 5FXXA 3W9GA 1R8IA 3KSQA 1N94A 3GMIA 1EZ3A 2WCAA 3OBVE 4FJYA 2BZBA 2FO1E 2B6CA 3C4WA 3PE0A 4LMLA 4NIQA 2E2AA 4V1Av 5IWAT 2UU9T 3DBSA 1OXJA 1X5BA 1QUUA 3CIRA 5CRVA 2E9XC 1TNYA 3LFMA 2WXRA 5EKQD 3MKQA 4H7XA 3ISMC 3RPUA 4B8CB 4XKCA 2OOEA 4ANXA 4HRNA 2LKHA 3TG5A 3ZU7B 4TXPA 4QXCB 3LPZA 4J8FA 2PQNA 3QWWA 2BUGA 4JVSA 3Q5WA 2BVLA 1BR2A 3D9IA 1H6KA 5AQVB 3TWTA 1TJFA 2RA1A 3A5XA 1D1AA 5FMNA 3DEPA 5CHEE 4ILAA 2CG3A 4X20E 1WFDA 4GK5E 1OWPA 2H7VC 4HI8A 4DV2T 4Z68A 3ONLA 1OCZE 1MNDA 5KJNA 4OAUC 4B6XA 1ZV4X 4WNGA 5FQ8A 2WB2A 2A5UA 3OAWA 3RHWA 5BV1A 3BQKA 2M63A 1KNZA 2HN2A 3P1UA 2WXJA 4K5CA 3EHQA 4N3CA 4IE5A 1LVKA 1TYQG 4F6RD 5HCJA 4DV5T 4GTQA 4BEPA 1XGWA 1WYBA 2LOPA 5IYZE 3C64A 2LJLA 5JHAA 2I2OA 1N32T 1OCRE 3UUBA 3NZUA 3AG3E 2YHCA 3X2QE 4R7LA 4Y6WA 4IREA 3VKHA 4GMLA 4U8VD 4DV4T 4U3CA 3J9X1 3ZRHA 3MZKB 1N0RA 3EIQC 2EIJE 4ANVA 4JZYA 3SO8A 3V5SA 3OJAA 2VVNA 3KS2A 2VKJA 3MKRA 2VSNA 4KBMB 4ANUA 4CGVA 3T8KA 3ETUA 2HO1A 4GTTA 1HX8A 4ZI3C 3E0ZA 5AQOB 3TGOA 1IBKT 4P29A 4AQGA 4JHRA 4ATGA 4MHCA 4U7EB 2CFZA 4L0RA 4XZ4A 5ABFA 3RRCA 1HS6A 4GOUA 5ANRA 4DLOA 1FPPA 5FL1A 1XDOA 2YDSA 3LY9A 3QK0A 2X6KA 5DABA 3OKQA 4MS6A 1BR4A 5JRCB 5D0QD 3U3WA 2R17C 4BX9A 2ONDA 2ES0A 3SBTB 2ACXA 2BG9B 3UM3A 5CEAA 3RC8A 2R5SA 4B3TT 3QKYA 1BR0A 2X51A 5B3SE 3L8RA 4DBQA 4HWHA 1HH8A 5L3EB 5ABGA 4EECA 2ODVA 4YDWA 4I6JA 3KEZA 2DIWA 4EZLA 4BX8A 4HRMB 2EHOA 4JI8T 1H0AA 4MKTA 3N71A 3ZN1B 5JDQA 2AWIA 4H9RC 5EIDA 3AE8A 2VGEA 4ME2A 4NACA 4FLHA 4E7SA 2WXLA 1HXIA 3J5PA 2BDEA 1KNPA 3CVQA 2WDQA 2XJ7A 3SGHA 3K1SA 2OV8A 4O4HE 1XWMA 4NURA 5DQWA 3RO2A 1N54A 3HG0D 3AS8A 2Q9QB 2MTQA 1H19A 4LERA 2X67A 4WNEA 2E9XD 3IXEA 3QNKA 3CVWA 4XBFB 4DR6T 4O60A 2C0SA 3ZMVB 1JNZA 3VRBA 2GGFA 4ILHB 3C50A 2ZMAA 1BR1A 1D8DA 3VU7H 4N2QA 3ZCIA 1KT1A 3V31A 2JIWA 3SRZA 4DX5D 3LBXB 3DSVA 3ZMTB 3ZSTA 3PE3A 4JXTA 3DRAA 5AQ7A 2WS3A 3ZJ1A 3ESLA 1Z3YA 3CQGB 1EYHA 4BSXA 4DR4T 2XUEA 2VSXE 2IC9A 3HKBE 4HWIB 4GYOA 3N9MA 4LSZE 4D10C 3EHMA 1E7PA 2HPLA 3G2UA 2CHOA 3CHMA 5AQMB 2L9QA 3HKEE 2J62A 3RQWA 1KZOA 4TN7B 3UU8A 1ZKEA 4L2YA 2CXLA 3RC3A 1W9RA 2NXPA 3ASGA 4NIKA 2PJQA 1IZNB 4MLKA 2JLBA 2XSBA 4YVOA 4L5GA 4HXIA 3QWVA 4YFSA 2R02A 3UINC 5JTGA 4IHJE 4JA7A 5JR9B 4DX1A 4U8YD 4PAGA 2W4XA 3DJBA 3FWVA 3ONLC 4ATZD 3TLWA 2V8SE 3EI0A 1UJKA 5ARFA 3DTOA 4PS3A 4ZI3D 2E5LT 3APFA 4GA1A 2HR2A 4L2LA 1WDYA 3AA0B 3Q9NC 2F8XK 2CCQA 3PNLB 3CVPA 4DVDA 3CVNA 3IEEA 2NW7A 2KSRA 4JLEA 3C5RA 1O1RA 2J8SD 4L23A 4WZXA 2UXCT 1TN7A 1IAPA 1FMWA 3SF4A 4HFDA 4LF7T 1RW2A 3FU0A 4XZCA 3E33A 4H63V 5JH7E 4FA6A 1OXZA 1WR6A 3ANWB 4TWFA 3RIAA 4I1OB 4PUCA 4HORA 2QY7A 5JDNA 1OWNA 2WQ7A 3DSUA 2DYRE 4HOUA 1AJ3A 3L08A 4PFPA 4UV8B 2OEWA 2PBIA 5LX8A 2FEZA 3UX4A 5AQIB 1FEWA 5FVKA 2LNIA 2E2EA 4F8HA 5JJ6A 3PUVF 1MMDA 2P9IG 3AE3A 2FI7A 2HH7A 2WU2A 4CN6A 3TKLB 3U3IA 3AXJB 3RGLA 3DSXA 4COFA 1N0QA 4JI2T 3ASDA 2YN6A 4WW0A 2WDRA 3CX7B 3FUMA 3RIUA 3Q47B 2WDVA 4O1OA 4Z91A 1TR4A 4U96D 1P5QA 1HS7A 3C3RA 4C48B 4E6HA 3UFGA 2JJ9A 1MIVA 2C5IT 3ONXA 4I17A 1SW6A 4DK5A 3FEYA 3MEKA 2LSJA 4CDNA 4U8HA 4IE4A 3ZMSB 4YY3T 4LMJA 3OXFA 3TWUA 3PUZF 2XQ3A 4XKBA 1KT0A 5H6RB 3AU5A 4TUMA 4PW8A 4HFCA 1IHBA 2CBJA 5FY1A 1J5WA 3SS1A 4DV0T 2G0UA 4U2ZA 3RQUA 4C90A 2X38A 2WXIA 4I9EA 5ITZF 4PS8A 3SFEA 5L3BB 3R9AB 4ASKA 4N3AA 4QXBB 4ADZA 2K48A 4DBRA 3LG7A 3E37A 4CXWA 3NB2A 4G25A 2LRLA 2PNNA 2WVIA 4DUZT 3D9PA 1BI7B 3S4UA 2KCVA 4G1TA 4UUCA 1E8ZA 5KNHD 3O9XA 4G63A 3ZUVB 4AKHA 3N2GE 1N33T 2IOLA 4N39A 3I0QA 2LHNA 3APDA 3FZMB 3ZVVA 4BERA 2CWOA 2R59A 4G8KA 2N9DA 3ONKA 1NENA 3ZGQA 5HWXA 3I5PA 2KT9A 1MIYA 4GTOA 3PH0C 5L3DB 4YVQC 2UY1A 2PTFA 1HTJF 4UWGA 3UT4A 4YDYA 5EX3A 1WRDA 3D9HA 4GA0A 3KFWX 4JEUA 3TWVA 2JPFA 3FTXA 3RU0A 3EDUA 4F53A 3KINB 3ZXSA 3P4QA 3CGHA 2DLRA 3O1IA 4O4JE 2V4LA 4Q96A 3NAWA 1SZ9A 4NXMT 2A9UA 4I43A 3I4GA 2AVPA 4M7CA 2UXXB 3S7FA 4GYWA 3NZSA 5G2NA 1A5EA 3RKOA 1SE7A 2KCLA 4HFBA 2VURA 4FHKA 2H3RA 1OWAA 1OWMA 3APCA 4WNFA 1YQ3A 2CG2A 1ZHCA 1H6OA 2Y69E 3HRAA 2GRMA 4GPMA 2LLYA 2OLTA 1DC2A 1XZYA 1SUMB 2OEVA 4F1SA 4LG6A 3AEAA 3SBSA 4AEZC 3P50A 4O4IE 2Y4TA 3SWHA 2ZXWE 1QZ2A 5HAXA 3F2EA 1N95A 3HKCE 3BEEA 2J09A 3QC9A 3AS4A 4N5CA 5JMND 2E9XA 2IC6A 3RRUA 2CLYC 3I4RB 2ACZA 4TNWA 3TXMA 3ZLIA 3FBZA 2XPIA 3O1HA 4HE8A 3AEBA 4TUUA 2XSAA 3UIPC 2ZU6B 2BS2A 3FEXA 3TWQA 1YW0A 4QH4A 5JDLA 5LNKA 1OCCE 4IN3B 5FVLA 1D0YA 3T1HT 4FJZA 3G06A 3CVVA 5KNGA 3NKZA 4MBQA 4UWKA 5HXEA 4TV9E 2IHR1 5D2MC 2NWBA 2W2UA 1JCRA 3AA7B 2CWYA 3AJIA 4CRWA 3B7BA 5HEOA 4CXXA 4ZI2C 3ZPOA 4PK4A 2HM8A 4E85A 4LNBA 2FJEA 2V5CA 2ZM6T 5ETWA 3CK9A 3L17A 2SPCA 3QB2A 5C8YE 3JUEA 2LO6A 2K24A 4KZCA 4EPZA 5LOVE 2NR4A 3ZSSA 4GZ5A 2DI4A 2WXMA 3I1AA 3UUXA 3KV4A 3T8MA 3SQVA 1UUSA 1LVFA 1MQSA 1U5PA 3K9IA 4K0RA 3Q75A 2YINA 4U0ZA 5LHIB 1PY1A 4UIGA 3PRZA 5ABEA 4NUUA 4FULA 4EEDA 1U2VG 4X66T 5KDMC 4IT4A 2HHHT 2MOZA 2EINE 2BKGA 4GTVA 5AYWD 3UFEA 5JDMA 3VRAA 4OVVA 4LCTA 5C2TA 3R7RA 4EZHA 3D9NA 4ZS3A 3RYHE 3FU3A 2H89A 4BA9A 3B13A 1XNQT 4PH4B 4GKKT 4U04A 4FJOA 2YU1A 3O4ZA 1I94T 3I3NA 2DCPA 3P8CD 3CQXC 2Z6EA 4B93B 4P09A 3HXFA 4NUVA 3FTWA 4L9PA 5JVDE 4OFZA 4F7AA 4TZ4C 2WQYA 2FF4A 3N9LA 5AQJB 4B8AA 1WG0A 1KZPA 4WBOA 5IHYA 5KWDA 3FULA 4EB6E 2V6YA 2WMOA 4GK0E 3DXKG 2CXFA 2FO7A 5ENRD 4B94A 3LEWA 4UI9C 2V5DA 5FTPA 1K3ZD 2C0MA 3CQCB 2XHEA 3PUXF 4AY6A 2BKOA 1HR0T 4QH1A 3KBUA 2FULA 1LTXA 4ZZCA 1J5ET 3CHQA 1NL4A 2BS3A 2DZOA 2DYSE 2J4BA 3TG4A 3TLSA 3SFDA 2MOWA 2W66A 1BLXB 4A1SA 3AVSA 3CK8A 3T1YT 3DPYA 5C1DA 2FBWA 3C4ZA 3L13A 4KZ0A 5F3JA 4DI4A 3MKDA 2PG8A 5F5WA 4XE0A 3PNTB 3UXGA 1T72A 2FUPA 2PFVA 3ZCJA 4N3BA 3WAJA 5HCMA 1G73A 1Y64B 5CEDB 2RKKA 5DBKA 1A17A 2WXNA 4HWFA 4JHJA 4JL0A 3ASOE 4IE6A 4CQIA 5EK2A 3V30A 3GA8A 3RF1A 4HLLA 2H6GA 1K1BA 1V54E 4YDEA 2P9KG 3PUSA 3E34A 3ZN0B 2VKHA 3ULEG 4M3OA 3MV3B 2FBNA 3WXXA 3FZFB 1US7B 1W09A 2JQKA 3CX6B 3EDVA 4WYVA 5HXHA 4JV5T 3ESKA 1HZ4A 4HVBA 4ZI2D 4UWHA 3RYCE 4F3VA 5FIOA 2VB6A 4QHOA 4CI1B 1S70B 3ZYKA 3HA4A 3UU4A 3W15B 1VCTA 4HKAA 3ZYLA 5LXTE 4WUYA 5A23A 2LXLA 2WZIA 3PTRB 1ZB1A 4C91A 4NRHB 2OA5A 5GONE 4WBNE 2P58C 4KVMA 5E76A 1PAQA 2H6FA 4H9PC 4TRQA 1UURA 4I0UA 1IBLT 3HI2A 3EAMA 3ABME 2VGYA 3FUIA 5HI7A 4DI3A 3QNUA 2IIUA 1Y6IA 2JMKA 3IHYA 4U31A 3PZDA 3TWWA 2X6JA 3LDZA 2Y48B 3CX8B 5DIZA 5G55A 1MHQA 5C2YA 4Y6CA 4G8LA 4KX6A 2XAJB 1L5JA 3PEVB 3BQIA 3ZMUB 4BAYB 2I59A 3ZN3A 3PJAA 1MMNA 2ZIRA 4C0MA 3L54A 2WXFA 3TWXA 2NC9A 5FWQA 2GRNB 5AJLA 5LP0A 1HFAA 5L3GB 2WMNA 3EIJA 2XENA 1XNRT 2KNDA 2IO2C 5KJLA 3AE9A 4PJJA 2WM9A 3RRWA 2GRQB 1LD7A 4EBAG 4QWNB 4ACLA 4CYMD 4CI3B 4JI3T 3BK9A 4HS2A 4IULA 4JI5T 3LSVA 5CERB 2CHNA 3UM1A 2JABA 1IJ6A 2EILE 2R6GF 3V5UA 4GA2A 5C3JA 5JRCA 5AQRB 3ASNE 1E8XA 2YEVC 3I9YA 1BI8B 3Q5EA 4YTMA 4MLPA 5BW8C 3ZKJA 4HFEA 2W0GA 1YKEB 4EXTA 4OVUA 2IW5B 4HLEA 3L3PA 1YQ4A 4RLYA 4YLHA 1YXRA 2CHWA 4H7YA 5FXWA 3CHOA 3EUVA 4LNGA 4O8SA 3EHNA 4HFHA 5LCWC 3DXMG 3FXDB 4YNDA 2CPTA 1PC2A 1BU9A 4H9QC 3PJAJ 5HQ8A 4HEAA 4X64T 2UXNB 5EN5D 2IY0C 3ZC1A 1NFIE 3B7TA 4NQ0A 2V7MA 5ABFB 4X1IE 2J9QA 5D66A 5AQPB 4DPRA 2GROB 3PUYF 2WWVA 1X81A 1YD8G 3ML9A 3VR9A 3AE1A 2Q9QA
chains in the Genus database with same CATH topology
2M67A 4BJNA 3PURA 3SOLA 1H7CA 1UN9A 2AXVA 4H9OC 4UVBB 5AENA 3C51A 3D9LA 5TAOA 3LBXA 1INZA 4EIWA 3KBTA 2PM6A 2VSYA 3NF1A 2JMHA 2EHOB 2HYZA 4AP2A 4GAAA 4HOTA 1WLXA 4CI2B 4AVXA 3F31A 2LSUA 2A4ZA 4TUYE 4WNDA 3ZYMA 2V26A 3NZQA 2NOXA 3AVRA 2VWAA 4TV8E 1WYCA 2W62A 3CWZB 3N9NA 3I0OA 5H6QB 3HDXA 2B1EA 3J7Yq 2L0IA 2X66A 3CSFA 2X6IA 1D0XA 1W3BA 3ENEA 2XASB 3ZW3A 2I1KA 3F57A 3NZPA 5AIJA 2LSKA 3N9OA 4UVAB 3KV5A 4IIJE 3QWPA 3D3MA 5BV0A 3AAAB 1B89A 2LSYA 4KXKB 4RVBA 3IEGA 3MJWA 2IOSA 4GZCA 3AAEB 5CB4E 4ACKA 2JQQA 4XX5A 2KC7A 3MA9A 4Q94A 4U63A 3B7UX 4C9BB 5EDSA 4KYOB 2PQRA 3ANWA 3KVBA 4GCNA 3CEQA 3TAXA 4CZZB 2X9HA 2L6JA 2KM4A 4QFVA 4EQFA 3QJZA 1QSDA 4PDXA 4IDZA 2XGSA 3FUFA 1MIWA 4I6EA 2X9YA 2V7KA 4B89A 3CKDA 3QDNA 4PK5A 4EZKA 1VDYA 5G04C 4JC8A 4U07A 2DWGA 2XPYA 4BTBA 4EAHA 3RIBA 3HL6A 2RD0A 4AM9A 4CDRA 3SZ7A 4U72A 3C98A 1FVFA 3CV0A 2ZM8A 2WXPA 4E7ZA 4LUNU 3FHNA 3KV6A 5KMGP 1H2TC 3U64A 2Y4UA 4Z8XA 3N2KE 3S7JA 3PU3A 5E75A 2CM0A 4H63H 4UVCB 3LKUA 4ZI7E 4HFGA 3UQ3A 2Q9QC 4N78D 2WAUA 4O2AE 4OK0A 4BT9A 1H2VC 2XGOA 2W63A 3D9JA 3FUDA 3D9MA 5HYAA 3ZC0A 3MXZA 3HIZA 3ZFWA 4PNIA 2DBAA 2VTBB 3MA5A 5KJMA 1Z0PA 2D0TA 2LAIA 3HYMB 2LEHA 1D0ZA 2MHKA 4A3VA 4KT6B 2LOSA 1LKXA 5BNWA 3FDHA 3MV2B 2J4DA 2VKOA 1SZAA 3ZEFA 2NSZA 5FZQA 2W61A 5T4YA 5FY0A 4LEUA 3CVXA 2KZTA 2VSOE 3ZMZB 3ASFA 3FUNA 2JEKA 3LY8A 2VGXB 2VJ8A 2E8IA 1Z6TA 5JJTA 3CLJA 2N2NA 3P7IA 5DQVA 2V0PA 3QARA 1E7VA 2VL8A 4ANJA 3ZHEA 5FJYA 5JR9C 4HN9A 2V7JA 3Q2MA 2UY1B 4WWPA 3RYIE 4UWFA 4A1GA 2WQ6A 1HG2A 2V7LA 4PJLA 2V1DB 3SD5A 4UI9J 5BMVE 2LHRA 5ARGA 3S7DA 2IQCA 1QQEA 1O3XA 4ABNA 1E1HB 3LJCA 4TV3A 4HTEA 4EOZB 3PEUB 2IFUA 5FP3A 4QX8B 2QFCA 4I50E 1SHZC 3FUKA 2KLQA 2KXPB 5JDGA 3MX3A 3VLEA 3UMVA 3UULA 3D0TA 5A7DB 4G2VA 4J8DA 5LBMA 5LP6E 4AKGA 2XEVA 4IRUA 3LVQE 2CXDA 2DHRA 5LG4A 3BQLA 2E9XB 1IJ5A 4I4TE 4UF0A 3GN5A 3HVEB 3R6NA 3K3NA 3CVRA 2Y6XA 3PVLA 2Q9QD 4AJWA 5EK4A 2L9BA 2VK9A 3FY4A 1E90A 3GZ2A 1G8XA 5CMWA 4P0AA 3L22A 4JEHA 3FB2A 4AI6A 3IF8B 2WXQA 5LGNB 3O48A 2DNXA 3PUJA 4HFVA 4ILGA 4U0SA 3RKVA 2PZIA 4BTAA 4XI9A 2L8KA 3VHLA 4PJNA 4OHFA 4G2AA 3UUXB 3PUKA 3DP7A 1S35A 3MZLB 3Q49B 5J08A 4ISSA 2LSVA 5DJQC 1ELKA 4AV7A 4DJAA 2DWKA 1E7UA 3WI3A 2KCKA 3MGBA 4CCAA 4IE0A 4CT0A 4UQXA 2YHEA 3CVLA 3FP3A 1CUNA 1UW4B 3AS5A 3HHMA 1NA3A 3OXLA 4GZ3A 2XRYA 3FTZA 2QA7A 3Q15A 4K0UA 5LA6E 4FLBA 1UX4A 5ADXL 2OVBA 3ETVA 5LHGB 2GW1A 4APFA 2NW9A 2PM7A 3MYVA 1MMAA 1HF8A 4N2SA 2V7IA 1UG3A 3SHFA 3LS8A 3LVRE 4UEMA 1D1BA 2WPVA 2KWIB 5FZSA 1NA0A 4GB9A 2XCBA 3N2OA 1IHGA 4HOQA 5JQGE 2XPZA 5LCWJ 4XAXB 3LK2B 5EK3A 4G23A 4PJMA 3FUJA 5BUZA 1JWGA 1E8YA 1E96B 4PK6A 4J2CA 1NP7A 4PS7A 3ULQA 1BPOA 1SA0E 3AB3B 2ZLYA 2MYSA 5G05C 5F8PA 2BVMA 1IQUA 3OTNA 3GYZA 2I9CA 3K3QC 3IBPA 2RP4A 5CMYA 3HKDE 4FHJA 2LSIA 1Z3XA 2XGMA 1ZU2A 1S0PA 4KP3C 1N52A 3MKQB 4J0UA 4Q69A 4EZ4A 3CSTA 4FI5A 3U4TA 1KK7A 3ZJ2A 2J07A 3FH7A 4QKNA 2LT3A 4OYJA 2C5KT 5CA0E 4OYSA 3LYAA 1WY6A 4URKA 5CA1E 1JWFA 2WXKA 3L6AA 2X9WA 4J8SA 4ZS2A 3PS6A 1B7TA 4AOFA 1WM5A 3N9QA 5KX5E 3E08A 3ZIMA 4GZ6A 4ZHQE 5FNVE 2KINB 2BF0X 2WBLA 2XAQB 1U4QA 2LM9A 4EBAA 2N1GA 3UPVA 5E0OA 1IQRA 2X6HA 4WNKA 3EJNA 3QUJA 3URZA 3JC6D 4G24A 4H9NC 4V3IA 3U9WA 4YHJA 5FXVA 1LF8A 3FTSA 3JUIA 4MRUA 4ERRA 2MBGA 4JHKA 5HWYA 4LRZA 3JQ0A 4I55E 2CE7A 2XAGB 5FQ7A 4UI9K 3CHPA 2ILRA 2X9XA 5J2UE 4BY6A 5ENNA 3IKOB 2IAKA 3U66A 2CHZA 4ZOLE 4BWRA 2D5UA 4DNDA 2I6HA 4I6GA 2HPJA 3UTKA 2AXUA 1HCIA 3CKCA 3FH8A 5J2TE 2ZM0A 3N5LA 1JPLA 5M72A 4BFRA 2AXZA 3FBLA 1X79A 3FH5A 3VLDA 4IE7A 4EZJA 4BJMA 4GYRA 3QOUA 4G11A 2KZ7B 5G04J 3R7QA 4AXPA 3FTYA 1YA0A 5T3RA 5L3FB 3NRXA 3M65A 4FADA 5A6CA 3Q9DA 1NWMX 3CVYA 1UX5A 5HXSA 1OWLA 4EYUA 5JJ7A 3EUHA 3S2AA 2IU1A 3RO3A 3P2BA 3I9WA 4FC8A 3IHRA 4GPKA 1T98A 2C0LA 3S7BA 3FHEA 2LAHA 2XAHB 4MFRA 2OVFA 5JR9A 2XRZA 3UUMA 2MRIA 3L09A 3NBXX 2WSSV 4A3TA 2NP9A 2LSGA 2YU2A 3TXNA 5FY7A 3MACA 5JREA 4ILUA 2P9BA 5J90A 3PDYA 2Y3AA 5JDHA 5EX0A 2X3MA 3CMLA 3L16A 3QK6A 3Q5XA 4XI0A 4L9IA 4IGUA 2A72A 3CK7A 2Y8DA 3CHRA 2E0IA 4UXNB 2YQ8A 5AJDA 3MJXA 2J49A 5HXRA 3QC1A 2NTXA 3MCXA 2A3DA 2V5FA 2K9AA 2C2LA 4WWOA 3WAKA 2J1DG 4PFOA 3LK42 1UN8A 4O6FA 3SFZA 4DMVA 4J6IA 3UUNA 4CXYA 2WXHA 1UCUA 4HGAA 3CIAA 4U74A 1FMVA 2NTYA 3ZPJA 4GZDA 2CLYB 4CT4A 3TL5A 1TEZA 3EVYA 4H9SE 4G26A 5KCMA 1FCHA 4GIWA 5FQ4A 1Y8MA 3GZ1A 2Q7FA 3G2VA 2RG8A 3VLFA 2J08A 2EQXA 5ANLA 3LK3B 5FT9A 2L3LA 5JDFA 1NAFA 5LJMA 4AXHA 1VOMA 3T5VA 1MNEA 2H7OA 4O2BE 5M4YA 4L1BA 4L7TA 5CCLA 3KAEA 3LY7A 1HG5A 4KVOA 3AA1B 3UT7A 3H3AA 3PE4A 3UT8A 4K03A 5AFUL 5FQ6A 4KBQA 4JA9A 4AY5A 1QNFA 1U3DA 1SQMA 4GYYA 1ELRA 5LGUB 3T5XA 2VASA 4EYYR 3GW4A 4TX5A 4FU3A 2CMRA 1XNFA 3SNXA 2WXGA 5FZRA 4MALA 3C98B 2VTBA 2AW6A 3Q4AB 5T8IA 1LRZA 3CR3A 2EHOC 1UJJA 5L2LA 4FP7A 2IONA 3EDTB 3K3OA 3PUGA 4QX7B 3D9OA 2YNQA 3IHVA 3FUEA 2CFUA 1HO8A 3VTXA 4AIFA 3FTVA 4KUMB 2D0UA 2VGXA 2XQYA 2VKDA 3N9PA 3E22E 4GYSA 4C0EA 2XCCA 2JRKA 2D2SA 2XAFB 3SI5A 5FXZA 3KD7A 3FU6A 4AQFA 4DLQA 3BG0B 3CKBA 4X1YE 4JW1A 3CPZA 3JQ1A 3AAIA 4BT8A 1DVPA 4I2ZA 1GW6A 2ZM2A 2BTDA 3KVAA 3ZEFB 3ZYQA 1FIOA 4JEUB 3MK7C 5EZYE 2A2FX 2KMFA 5LFAA 3O4XE 5HXCA 2KZTB 3FUHA 2L0TB 5CCMA 3RYFE 4W9RA 1S94A 1YKHB 1ZBPA 3G2SA 2X0LB 4AKLA 3JCKC 4AKIA 4I43B 2PL2A 3OYXA 2GRLA 4DO0A 2W00A 4JUYA 3ZHEB 2LE8A 4QXHB 4RG9A 4AKRB 4KMOA 4U0UA 2X6FA 4YJ3E 4I1AA 3VKGA 4HOSA 4X1KE 2WQHA 1OWOA 1EPUA 3HVEA 4IYPA 3O1JA 4UQZA 4UV9B 2XTLA 4GCOA 3H37A 2K5BB 4I9CA 4APOA 3KV9A 3CHSA 1OUVA 3PUQA 3VTYA 1ZEEA 1HE8A 3C4XA 3K8PC 1KLXA 3KDSE 3IBEA 3FTUA 2GK9A 1EDUA 4WWNA 4P0BA 2I1JA 3UT5E 3DPDA 4CGWA 3OYZA 3TJPA 2VYIA 4I2WA 2EHOD 5LOZA 5LJNA 1TJCA 3PREA 4J8EA 2CA5A 2QGSA 3PUAA 4UF0B 3GN5B 4YJ2E 1NZNA 3B7SA 5LHHB 5D0OD 5LBQB 5G05J 3LCAA 4A55A 1DNPA 4XIFA 2YK0A 1VRBA 3RRMB 4DMWA 2WWUA 2UWJG 3LJ3A 3NRYA 3PDNA 2X68A 4ANWA 3OXGA 4JEHB 4F6RC 5KJKA 4B0ZA 3ASHA 3D9KA 2C5JA 4CEMA 3U78A 3NQPA 3BG1B 3GWHA 3RRNB 4I1MA 3FXEB 5LYJE 1FVHA 2ODUA 3AA6B 4ISTA 3HR0A 5J1GA 3RX6A 5FYMA 3G2WA 3IV0A 1JUQA 4O4LE 3GZSA 3QAQA 3JYSA 4UELA 3RJVA 1ELWA 4GU5A 3PU8A 3JC6C 2KWHA 3RH3A 4JPSA 2CEAA 5LCYA 1D1CA 1HU3A 1E8WA 2WXOA 2DCFA 1WAO1 4A56A 4AQFC 3E4BA 3ML8A 3R84B 4UQYA 4UWLA 3G2TA 3T8OA 2XHEB 1IYGA 5L3CB 1V9DA 3AU4A 2CHXA 4RG6A 3B57A 2NW8A 1H2UA 5BT1A 4RSYA 4ILIA 3LXUX 3Q5MA 4KMCA 5LGTB 3RK6A 3FFLA 1EF1C 1U3CA 5BPPA 3FU5A 4CDMA 2VQ2A 4WAFA 5A1LA 4OYKA 2IJGX 2XQ0A 4M1PA 4GMJA 2KATA 1MMGA 3CVUA 2IF4A 3B7RL 5FXXA 3GMIA 1EZ3A 3OBVE 4FJYA 2BZBA 3C4WA 3PE0A 4V1Av 3DBSA 1X5BA 1QUUA 2E9XC 3LFMA 2WXRA 5EKQD 3MKQA 4H7XA 3RPUA 4B8CB 4XKCA 2OOEA 4ANXA 3TG5A 4QXCB 3LPZA 4J8FA 2PQNA 3QWWA 2BUGA 4JVSA 3Q5WA 2BVLA 1BR2A 3D9IA 1H6KA 1TJFA 2RA1A 3A5XA 1D1AA 5FMNA 5CHEE 2CG3A 4X20E 4GK5E 1OWPA 2H7VC 3ONLA 1MNDA 5KJNA 4B6XA 1ZV4X 4WNGA 5FQ8A 2WB2A 2A5UA 3OAWA 5BV1A 3BQKA 2M63A 1KNZA 3P1UA 2WXJA 4N3CA 4IE5A 1LVKA 1XGWA 1WYBA 2LOPA 5IYZE 3C64A 2LJLA 5JHAA 2I2OA 3NZUA 2YHCA 4R7LA 4Y6WA 3VKHA 4GMLA 3J9X1 3ZRHA 3MZKB 3EIQC 4ANVA 4JZYA 3V5SA 3OJAA 3KS2A 2VKJA 3MKRA 2VSNA 4KBMB 4ANUA 4CGVA 3ETUA 2HO1A 1HX8A 4ZI3C 3E0ZA 3TGOA 4P29A 4AQGA 4JHRA 4ATGA 4MHCA 2CFZA 4L0RA 4XZ4A 3RRCA 1HS6A 4GOUA 5ANRA 4DLOA 3LY9A 3QK0A 2X6KA 5DABA 3OKQA 4MS6A 1BR4A 5JRCB 5D0QD 3U3WA 2R17C 4BX9A 2ONDA 2ES0A 3SBTB 2ACXA 3RC8A 2R5SA 3QKYA 1BR0A 2X51A 4DBQA 1HH8A 5L3EB 4EECA 2ODVA 4I6JA 3KEZA 2DIWA 4EZLA 4BX8A 2EHOA 1H0AA 4MKTA 3N71A 3ZN1B 5JDQA 2AWIA 4H9RC 4ME2A 4NACA 4FLHA 4E7SA 2WXLA 1HXIA 2BDEA 3CVQA 3SGHA 2OV8A 4O4HE 4NURA 5DQWA 3RO2A 1N54A 3AS8A 2Q9QB 2MTQA 1H19A 4LERA 2X67A 4WNEA 2E9XD 3QNKA 3CVWA 4XBFB 2C0SA 3ZMVB 2GGFA 4ILHB 3C50A 2ZMAA 1BR1A 3VU7H 4N2QA 3ZCIA 1KT1A 3SRZA 3LBXB 3ZMTB 3PE3A 4JXTA 3ZJ1A 3ESLA 1Z3YA 3CQGB 1EYHA 4BSXA 2XUEA 2VSXE 2IC9A 3HKBE 4GYOA 3N9MA 4D10C 3EHMA 2HPLA 3G2UA 3CHMA 2L9QA 3HKEE 4TN7B 1ZKEA 4L2YA 2CXLA 3RC3A 2NXPA 3ASGA 2PJQA 1IZNB 4MLKA 2JLBA 4YVOA 4L5GA 4HXIA 3QWVA 4YFSA 4IHJE 4JA7A 5JR9B 4PAGA 3DJBA 3FWVA 2V8SE 1UJKA 5ARFA 3DTOA 4PS3A 4ZI3D 3APFA 4GA1A 2HR2A 4L2LA 3AA0B 2CCQA 3PNLB 3CVPA 4DVDA 3CVNA 3IEEA 2NW7A 4JLEA 4L23A 1IAPA 1FMWA 3SF4A 3FU0A 4XZCA 4H63V 5JH7E 4FA6A 1OXZA 1WR6A 3ANWB 4I1OB 4HORA 4PUCA 2QY7A 5JDNA 1OWNA 2WQ7A 4HOUA 1AJ3A 3L08A 4PFPA 4UV8B 5LX8A 2PBIA 2FEZA 3UX4A 2LNIA 1FEWA 2E2EA 5JJ6A 1MMDA 2FI7A 2HH7A 3TKLB 3U3IA 3ASDA 4WW0A 3CX7B 3FUMA 3Q47B 1P5QA 1HS7A 4E6HA 2JJ9A 1MIVA 2C5IT 3ONXA 4I17A 4DK5A 3FEYA 3MEKA 2LSJA 4CDNA 4U8HA 4IE4A 3ZMSB 3OXFA 4XKBA 1KT0A 5H6RB 3AU5A 4PW8A 5FY1A 3SS1A 2G0UA 4C90A 2X38A 2WXIA 4I9EA 4PS8A 5L3BB 3R9AB 4ASKA 4N3AA 4QXBB 4ADZA 2K48A 4DBRA 3LG7A 4CXWA 4G25A 2WVIA 3D9PA 3S4UA 2KCVA 4G1TA 1E8ZA 3O9XA 4G63A 4AKHA 3N2GE 2IOLA 4N39A 3I0QA 2LHNA 3APDA 3ZVVA 2CWOA 2R59A 2N9DA 3ONKA 3ZGQA 5HWXA 3I5PA 2KT9A 1MIYA 3PH0C 5L3DB 4YVQC 2UY1A 1HTJF 4UWGA 3UT4A 5EX3A 1WRDA 4GA0A 3KFWX 4JEUA 2JPFA 3FTXA 3RU0A 3EDUA 4F53A 3KINB 3ZXSA 3CGHA 2DLRA 3O1IA 4O4JE 2V4LA 4Q96A 1SZ9A 4I43A 3I4GA 2AVPA 2UXXB 3S7FA 4GYWA 3NZSA 5G2NA 3RKOA 2KCLA 4FHKA 2H3RA 1OWAA 1OWMA 3APCA 4WNFA 2CG2A 1ZHCA 2GRMA 4F1SA 4AEZC 3SBSA 4O4IE 2Y4TA 3SWHA 1QZ2A 5HAXA 3F2EA 3HKCE 3BEEA 2J09A 3QC9A 3AS4A 4N5CA 2E9XA 2IC6A 3RRUA 2CLYC 3I4RB 3TXMA 3ZLIA 3FBZA 2XPIA 3O1HA 4HE8A 4TUUA 2ZU6B 3FEXA 1YW0A 5LNKA 5JDLA 4IN3B 1D0YA 4FJZA 3CVVA 4MBQA 4UWKA 5HXEA 4TV9E 2NWBA 3AA7B 2CWYA 4CRWA 4CXXA 4ZI2C 3ZPOA 4PK4A 2HM8A 4E85A 5ETWA 3CK9A 3L17A 2SPCA 3QB2A 5C8YE 2LO6A 2K24A 4KZCA 4EPZA 5LOVE 4GZ5A 2DI4A 2WXMA 3I1AA 3UUXA 3KV4A 3T8MA 1MQSA 1LVFA 3K9IA 1U5PA 4K0RA 2YINA 4U0ZA 5LHIB 1PY1A 4UIGA 3PRZA 4FULA 4NUUA 5KDMC 2MOZA 5AYWD 3UFEA 5JDMA 4OVVA 4LCTA 3R7RA 4EZHA 3D9NA 4ZS3A 3RYHE 3FU3A 4BA9A 3B13A 4PH4B 4U04A 4FJOA 2YU1A 3O4ZA 3I3NA 2DCPA 3P8CD 3CQXC 2Z6EA 4P09A 4NUVA 3FTWA 5JVDE 4OFZA 4F7AA 4TZ4C 2FF4A 3N9LA 4B8AA 4WBOA 5IHYA 3FULA 4EB6E 2WMOA 4GK0E 2CXFA 2FO7A 4B94A 3LEWA 4UI9C 5FTPA 2C0MA 3CQCB 2XHEA 4AY6A 3KBUA 2FULA 3CHQA 2J4BA 3TG4A 2MOWA 4A1SA 3AVSA 3CK8A 5C1DA 3C4ZA 3L13A 4KZ0A 5F3JA 4DI4A 3MKDA 2PG8A 4XE0A 3PNTB 2PFVA 3ZCJA 4N3BA 3WAJA 1G73A 1Y64B 5DBKA 1A17A 2WXNA 4JHJA 4JL0A 4IE6A 4CQIA 5EK2A 3GA8A 3PUSA 3ZN0B 2VKHA 4M3OA 3MV3B 2FBNA 3WXXA 1US7B 3EDVA 3CX6B 5HXHA 3ESKA 1HZ4A 4HVBA 4ZI2D 4UWHA 3RYCE 4F3VA 2VB6A 4QHOA 4CI1B 3ZYKA 3HA4A 3W15B 4HKAA 3ZYLA 5LXTE 4WUYA 5A23A 3PTRB 4C91A 4NRHB 2OA5A 5GONE 4WBNE 2P58C 4KVMA 5E76A 1PAQA 4H9PC 4TRQA 3HI2A 3FUIA 2VGYA 5HI7A 4DI3A 1Y6IA 2JMKA 3IHYA 3PZDA 2X6JA 3LDZA 2Y48B 3CX8B 5DIZA 5G55A 1MHQA 5C2YA 4Y6CA 2XAJB 1L5JA 3PEVB 3BQIA 3ZMUB 4BAYB 2I59A 3ZN3A 1MMNA 4C0MA 3L54A 2WXFA 2NC9A 5FWQA 5AJLA 5LP0A 1HFAA 5L3GB 2WMNA 3EIJA 2KNDA 5KJLA 4PJJA 2WM9A 3RRWA 4EBAG 4QWNB 4ACLA 4CI3B 3BK9A 4HS2A 4IULA 1IJ6A 3V5UA 4GA2A 5JRCA 1E8XA 2YEVC 3I9YA 4MLPA 5BW8C 2W0GA 1YKEB 4EXTA 4OVUA 2IW5B 4HLEA 3L3PA 4YLHA 2CHWA 4H7YA 5FXWA 3CHOA 4O8SA 3EHNA 5LCWC 3FXDB 4YNDA 1PC2A 4H9QC 5HQ8A 4HEAA 2UXNB 3ZC1A 3B7TA 4NQ0A 2V7MA 4X1IE 2J9QA 4DPRA 1YD8G 3ML9A 5JHBA 2Q9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4R B;  3CQC B;  3CQG B; 
#chains in the Genus database with same CATH topology
 2M67 A;  1N4Q A;  3B95 A;  4BJN A;  3PUR A;  3SOL A;  1H7C A;  1UN9 A;  2AXV A;  2RFA A;  4H9O C;  2I0M A;  1N36 T;  4UVB B;  3UIO C;  5AEN A;  3H3M A;  3C51 A;  3D9L A;  5TAO A;  3LBX A;  1INZ A;  4EIW A;  3KBT A;  2IEJ A;  2PM6 A;  2XZE A;  2VSY A;  3NF1 A;  5L4E A;  2JMH A;  2EHO B;  2HYZ A;  4AP2 A;  5LMU T;  4GAA A;  4HOT A;  1WLX A;  4CI2 B;  4AVX A;  5ENO D;  3F31 A;  2LSU A;  3RIF A;  2A4Z A;  2E5V A;  4IL9 A;  4TUY E;  4NXN T;  4WND A;  3ZYM A;  2V26 A;  2XS1 A;  3NZQ A;  4JYA T;  3EHR A;  2NOX A;  3AVR A;  2VWA A;  4TV8 E;  1WYC A;  4IL4 A;  2HN1 A;  2W62 A;  4ZXL A;  2V4H C;  3CWZ B;  1OED B;  2XEE A;  3N9N A;  3I0O A;  5H6Q B;  3HDX A;  2B1E A;  3J7Y q;  2L0I A;  2X66 A;  2J4G A;  3CSF A;  3UU3 A;  2X6I A;  1D0X A;  1W3B A;  3ENE A;  3J5Q B;  2XAS B;  3ZW3 A;  2I1K A;  3F57 A;  3NZP A;  5AIJ A;  2LSK A;  3Q78 A;  5ENS D;  3N9O A;  4UVA B;  3KV5 A;  2YDQ A;  4IIJ E;  3QWP A;  3M3Z B;  3D3M A;  4ZZB A;  5BV0 A;  1D9S A;  3AAA B;  1B89 A;  3AG1 E;  2HE0 A;  2LSY A;  4KXK B;  4RVB A;  3IEG A;  3SFX A;  3MJW A;  2IOS A;  4GZC A;  3AAE B;  5AQG B;  5CB4 E;  4DV7 T;  2ZIS A;  2P9N G;  2KBX A;  4ACK A;  2JQQ A;  4XX5 A;  2KC7 A;  2VQE T;  4J8Y A;  3MA9 A;  4Q94 A;  4U63 A;  3B7U X;  3AE4 A;  4C9B B;  5EDS A;  4AIU A;  4KYO B;  1N4S A;  4U2Y A;  2PQR A;  3ANW A;  3TWR A;  3KVB A;  4JI6 T;  4DR2 T;  4GCN A;  3CEQ A;  3TAX A;  5BXU A;  4CZZ B;  4EGW A;  2X9H A;  5CBO A;  2L6J A;  4U7I A;  2KM4 A;  4QFV A;  4EQF A;  2R05 A;  2FJA A;  3QJZ A;  2JQH A;  1QSD A;  1RZ4 A;  4PDX A;  4IDZ A;  1N4P A;  3AXJ A;  2XGS A;  3Q9U C;  3FUF A;  3C3O A;  4HRL A;  1MIW A;  4I6E A;  2X9Y A;  2V7K A;  4B89 A;  3CKD A;  3QDN A;  4PK5 A;  4EZK A;  1VDY A;  1W0A A;  2BG9 C;  5G04 C;  3ZT5 A;  4JC8 A;  1FT2 A;  4U07 A;  2DWG A;  4TNV A;  1XMO T;  2IML A;  4EAH A;  2XPY A;  3HL6 A;  2RD0 A;  3RIB A;  4BTB A;  4AM9 A;  4CDR A;  2YDR A;  3AED A;  3SZ7 A;  4U72 A;  3C98 A;  1FVF A;  2XQ8 A;  3CV0 A;  2ZM8 A;  2WXP A;  4E7Z A;  4LUN U;  2MAW A;  3FHN A;  1SVX A;  3KV6 A;  5KMG P;  1H2T C;  3U64 A;  2Y4U A;  4Z8X A;  1MZC A;  3N2K E;  3BUA A;  1MJ0 A;  3S7J A;  3PU3 A;  5E75 A;  3EAB A;  2CM0 A;  4H63 H;  4UVC B;  3LKU A;  3LJN A;  1W0B A;  4ZI7 E;  4HFG A;  3UQ3 A;  2Q9Q C;  1HNZ T;  4X8Q A;  4N78 D;  3V2O A;  2XM2 A;  2WAU A;  4O2A E;  1IBM T;  4OK0 A;  2XZT G;  4BT9 A;  1H2V C;  2XGO A;  5BXO A;  2W63 A;  4UR9 A;  3D9J A;  1XDP A;  4DR1 T;  4DUY T;  5HRY A;  3ZT6 A;  2QYW A;  2XQ6 A;  4IDQ A;  1JCQ A;  3FUD A;  2MPK A;  3D9M A;  5HYA A;  2M6I A;  3ZC0 A;  3MXZ A;  3C72 A;  3HIZ A;  2YKS A;  3ZFW A;  4PNI A;  2DBA A;  2VTB B;  3MA5 A;  5KJM A;  1Z0P A;  2D0T A;  2LAI A;  3HYM B;  2LEH A;  1OY3 D;  3BU8 A;  1D0Z A;  2MHK A;  2P9S G;  4A3V A;  4KT6 B;  2LXM A;  2LOS A;  1LKX A;  5BNW A;  1ZOY A;  3CK6 A;  5JA4 D;  3FDH A;  3MV2 B;  2J4D A;  2VKO A;  5H7P A;  1SZA A;  3ZEF A;  2NSZ A;  5FZQ A;  2W61 A;  1JCS A;  5T4Y A;  1YMP A;  5FY0 A;  3P4S A;  4LEU A;  2KZT A;  2VSO E;  3ZMZ B;  3CVX A;  3ASF A;  2MYO A;  3FUN A;  2JEK A;  3LY8 A;  2BED A;  2VGX B;  2VJ8 A;  2E8I A;  1Z6T A;  5JJT A;  2DWZ A;  4A63 B;  1YYH A;  3CLJ A;  1OT8 A;  2N2N A;  3P7I A;  3NWI A;  5DQV A;  2V0P A;  1IKN D;  3HXC A;  1E7V A;  3QAR A;  2VL8 A;  4ANJ A;  4YTN A;  3ZHE A;  2ETA A;  2WB5 A;  5FJY A;  5JR9 C;  2Y0B G;  2W67 A;  4HN9 A;  2V7J A;  3Q2M A;  2XS8 A;  4N5Q A;  2UY1 B;  5EYL A;  2P2C P;  4WWP A;  2AE9 A;  3RYI E;  4LF9 T;  2EIK E;  4UWF A;  1N11 A;  4A1G A;  2WQ6 A;  4DR7 T;  1HG2 A;  2V7L A;  3DSW A;  4AQY T;  4PJL A;  2V1D B;  1Y01 A;  2WU5 A;  3SD5 A;  4UI9 J;  5BMV E;  1MX6 A;  2LHR A;  5ARG A;  3S7D A;  2IQC A;  1QQE A;  1O3X A;  4ABN A;  3KSL A;  1E1H B;  4A98 A;  3LJC A;  2ZGD A;  4TV3 A;  3ZXP A;  4HTE A;  4EOZ B;  5ABH A;  3PEU B;  4DID B;  3Q7F A;  2IFU A;  2QRX A;  3AE5 A;  5FP3 A;  4QX8 B;  3X1D A;  2QFC A;  4I50 E;  1SHZ C;  4HWC A;  3FUK A;  2KLQ A;  2KXP B;  1Z5S C;  5AQQ B;  5JDG A;  3MX3 A;  3UM2 A;  3UMV A;  3UUL A;  3VLE A;  3D0T A;  5A7D B;  4G2V A;  4J8D A;  5LP6 E;  5LBM A;  2V8S V;  4AKG A;  2XEV A;  4IRU A;  4B3M T;  2VL0 A;  3LVQ E;  2CXD A;  2DHR A;  5LG4 A;  3RAU A;  4LF5 T;  3BQL A;  2E9X B;  3ZT7 A;  1IJ5 A;  4I4T E;  4UF0 A;  3GN5 A;  3HVE B;  3R6N A;  3K3N A;  3CVR A;  2R03 A;  2Y1L E;  2Y6X A;  3PVL A;  1L0V A;  2Q9Q D;  4AJW A;  5EK4 A;  4IDO A;  2L9B A;  2VK9 A;  3BQO A;  3FY4 A;  1E90 A;  3DSS A;  5CJ5 A;  3GZ2 A;  1G8X A;  5HEG A;  5CMW A;  4P0A A;  3L22 A;  3TWS A;  5CGM A;  4JEH A;  3FB2 A;  4JB8 P;  4AI6 A;  3IF8 B;  2WXQ A;  5LGN B;  3O48 A;  1UK5 A;  2DNX A;  1LD8 A;  3PUJ A;  3ZNG A;  4HFV A;  4ILG A;  4U0S A;  2IUB A;  2PZI A;  3RKV A;  4BTA A;  4XI9 A;  2L8K A;  1JNR A;  3RSE G;  4ZHB A;  3VHL A;  4PJN A;  4EHM A;  4OHF A;  1I6Z A;  2EIM E;  4GMR A;  4G2A A;  5EIB E;  3UUX B;  2BBJ A;  3PUK A;  3DP7 A;  1S35 A;  4ILC A;  3MZL B;  3Q49 B;  5J08 A;  4ISS A;  4LNU D;  2LSV A;  5DJQ C;  1ELK A;  2WP9 A;  4AV7 A;  4DJA A;  2H6I A;  2DWK A;  1E7U A;  2H88 A;  3WI3 A;  2KCK A;  3MGB A;  4DV1 T;  1N9A A;  4CCA A;  4IE0 A;  4CT0 A;  4UQX A;  2YHE A;  4CZ2 D;  3CVL A;  3FP3 A;  4CN4 A;  4BSZ B;  1CUN A;  1UW4 B;  3AS5 A;  3QOF A;  2YOE A;  3HHM A;  1NA3 A;  1Z8U A;  3OXL A;  4GZ3 A;  3UU5 A;  2XRY A;  3FTZ A;  2QA7 A;  3Q15 A;  4TXQ A;  2XQ5 A;  2UUB T;  2XM1 A;  4K0U A;  2LKG A;  4OAV B;  5LA6 E;  3R9M A;  4U7Y A;  4FLB A;  1UX4 A;  5ADX L;  3W9F A;  2OVB A;  3ETV A;  1ZP0 A;  5LHG B;  2GW1 A;  4APF A;  2NW9 A;  2PM7 A;  3MYV A;  1MMA A;  1HF8 A;  1KNR A;  4N2S A;  2V7I A;  1UG3 A;  3SHF A;  3LS8 A;  3LVR E;  4UEM A;  1D1B A;  2WPV A;  2KWI B;  5FZS A;  1S63 A;  1NA0 A;  2DL1 A;  4GB9 A;  2XCB A;  4BES A;  2XEH A;  2J47 A;  3N2O A;  1NEK A;  1IHG A;  2ETB A;  4HOQ A;  5JQG E;  2XPZ A;  5AQ9 A;  4HNA D;  4DUI A;  2OV9 A;  5LCW J;  4XAX B;  3LK2 B;  4RQI A;  3SY2 A;  3JAE A;  1O1T A;  3HXE A;  5EK3 A;  4G23 A;  4PJM A;  3FUJ A;  5BUZ A;  1JWG A;  3FZL B;  1E8Y A;  3PV0 F;  1E96 B;  3VR8 A;  1T7S A;  3TLV A;  3C3Q A;  4PK6 A;  4J2C A;  1NP7 A;  4HFI A;  4PS7 A;  3ULQ A;  4OX9 T;  1BPO A;  4JD2 G;  3TLU A;  1SA0 E;  3AB3 B;  3HXB A;  2H6H A;  4YT0 A;  4GTS A;  2ZLY A;  2XQ7 A;  5AQN B;  2MYS A;  5G05 C;  5F8P A;  5AQT B;  1TN8 A;  2BVM A;  1IQU A;  3OTN A;  3GYZ A;  2I9C A;  3K3Q C;  3IBP A;  2RP4 A;  3AEE A;  4JI0 T;  5CMY A;  3HKD E;  3L82 A;  4FHJ A;  2LRK A;  2LSI A;  1Z3X A;  2CRB A;  2XGM A;  1ZU2 A;  1S0P A;  5CBN A;  4KP3 C;  2ETC A;  3PZ1 A;  4ZEY A;  3A8Y C;  3AEF A;  1N52 A;  4A97 A;  3MKQ B;  4J0U A;  4Q69 A;  1YCS B;  4EZ4 A;  3T9K A;  3CST A;  4EEB A;  4FI5 A;  3U4T A;  1KK7 A;  5LB7 B;  3ZJ2 A;  2J07 A;  3FH7 A;  1IXV A;  4QKN A;  4X5T A;  2LT3 A;  4OYJ A;  2C5K T;  5AQS B;  1J1J A;  5CA0 E;  4OYS A;  3LYA A;  5AQF B;  1WY6 A;  3OVU A;  4URK A;  5CA1 E;  1T8B A;  4JI1 T;  1JWF A;  2WXK A;  3OTO T;  3L6A A;  2X9W A;  1KFY A;  4TWD A;  4J8S A;  4ZS2 A;  3PS6 A;  2B0O E;  3AEC A;  3ABK E;  1B7T A;  4AOF A;  1WM5 A;  3N9Q A;  5KX5 E;  3E08 A;  1HX1 B;  2RPA A;  4GZ6 A;  4ZHQ E;  3ZIM A;  2B76 A;  1DU2 A;  5FNV E;  2KIN B;  2BF0 X;  3FZH B;  2WBL A;  1N34 T;  1K8K G;  1M7K A;  1U4Q A;  2LM9 A;  2XAQ B;  3Q7A A;  3E30 A;  4EBA A;  2BG9 A;  2N1G A;  3JAD A;  5E0O A;  1UOH A;  1IQR A;  3UPV A;  2X6H A;  4WNK A;  1XMQ T;  2BG9 E;  3EJN A;  4HWD A;  3QUJ A;  3URZ A;  3JC6 D;  4G24 A;  3ZKR A;  4H9N C;  4V3I A;  3U9W A;  3P4R A;  4YHJ A;  5FXV A;  1KEY A;  1LF8 A;  3ULY A;  2P9L G;  4LF4 T;  4EV6 A;  3L39 A;  3FTS A;  4K5B A;  3JCF A;  3JUI A;  3Q5D A;  4MRU A;  4ERR A;  1VCS A;  2MBG A;  4JHK A;  5HWY A;  4LRZ A;  2R2L A;  3JQ0 A;  4I55 E;  2CE7 A;  1GQE A;  2XAG B;  5FQ7 A;  3RI5 A;  3CHP A;  2XPK A;  3OPC A;  4UI9 K;  4Z90 A;  2ILR A;  2X9X A;  5J2U E;  4BY6 A;  3Q79 A;  5ENN A;  3IKO B;  2IAK A;  3U66 A;  4AIS A;  2CHZ A;  4ZOL E;  4BWR A;  3AE2 A;  2D5U A;  5IY5 E;  2I6H A;  4DND A;  4I6G A;  2HPJ A;  3UTK A;  2AXU A;  1CHU A;  1HCI A;  3CKC A;  5J2T E;  3FH8 A;  3PZ3 A;  2ZM0 A;  3N5L A;  1JPL A;  5M72 A;  4BFR A;  2AXZ A;  3FBL A;  1S64 A;  2QC9 A;  1X79 A;  3JXJ A;  3PZ4 A;  4LFB T;  3FH5 A;  3VLD A;  4IE7 A;  4EZJ A;  4BJM A;  4GYR A;  3NOG D;  3QOU A;  5KBA A;  2BKN A;  4YXD A;  4G11 A;  2KZ7 B;  5G04 J;  5HEU A;  3R7Q A;  4IDN A;  4AXP A;  5FIN A;  3FTY A;  1YA0 A;  5T3R A;  5L3F B;  3UQ7 A;  2AXD S;  3KEA A;  3NRX A;  3M65 A;  5AQB A;  4F1P A;  1KPS B;  4FAD A;  1TNU A;  5A6C A;  3Q9D A;  1NWM X;  5AN8 A;  1OED A;  2V5Q C;  3CVY A;  1UX5 A;  5HXS A;  1OWL A;  1OED E;  4EYU A;  3JXI A;  1TN6 A;  5JJ7 A;  1SA4 A;  3EUH A;  3S2A A;  2BS4 A;  2IU1 A;  3RO3 A;  3P2B A;  3I9W A;  3PZ2 A;  3IHR A;  4FC8 A;  4GPK A;  1T98 A;  3RLF F;  2C0L A;  3S7B A;  5L47 A;  2WY2 A;  2BKK B;  4A5X A;  3FHE A;  2LAH A;  5CRU A;  2XAH B;  4MFR A;  2OVF A;  5JR9 A;  3QB5 A;  2XRZ A;  3UUM A;  2MRI A;  3L09 A;  3NBX X;  2WSS V;  5EYP F;  4A3T A;  3WG7 E;  2NP9 A;  2LSG A;  1QYM A;  2YU2 A;  3TXN A;  5FY7 A;  2RFM A;  3MAC A;  5JRE A;  4ILU A;  2P9B A;  5J90 A;  2D9D A;  3PDY A;  1HNX T;  2Y3A A;  5JDH A;  5EX0 A;  2X3M A;  3CML A;  3L16 A;  4DX2 A;  3QK6 A;  3Q5X A;  1G3N B;  4U95 D;  4XI0 A;  5EIL A;  3FZK B;  4L9I A;  4IGU A;  2A72 A;  3CK7 A;  1X9B A;  5AQA A;  1E2A A;  2Y8D A;  2UXD T;  2E0I A;  3CHR A;  4UXN B;  1TNB A;  2YQ8 A;  3E32 A;  5AJD A;  3MJX A;  2J49 A;  5HXR A;  3QC1 A;  2NTX A;  4LF6 T;  3MCX A;  2A3D A;  2V5F A;  2A5E A;  2K9A A;  2C2L A;  4WWO A;  3WAK A;  2J1D G;  4PFO A;  3LK4 2;  1UN8 A;  2K3W A;  4X65 T;  4O6F A;  5IUX A;  4DMV A;  3SFZ A;  4B3S T;  5CEC B;  5L4H A;  4J6I A;  3P4P A;  3UUN A;  2XY8 B;  4JI7 T;  4CXY A;  3AG2 E;  2WXH A;  1UCU A;  4HGA A;  3CIA A;  4U74 A;  1FMV A;  4TWH A;  3UU6 A;  2NTY A;  3ZPJ A;  5JHB A;  1O1S A;  4GZD A;  2CLY B;  2NYJ A;  4CT4 A;  1FT1 A;  3TL5 A;  1TEZ A;  3EVY A;  4H9S E;  4G26 A;  4GTP A;  5KCM A;  1FCH A;  4GIW A;  4ILB A;  5J0Z A;  1Y8M A;  5FQ4 A;  3L9T A;  2F0Y A;  3GZ1 A;  2Q7F A;  3G2V A;  2RG8 A;  3VLF A;  2J08 A;  2EQX A;  5ANL A;  3LK3 B;  5FT9 A;  2L3L A;  5JDF A;  1NAF A;  5LJM A;  5B1A E;  4AXH A;  2BKP A;  1VOM A;  3T5V A;  1MNE A;  2XQA A;  2FJB A;  2H7O A;  4O2B E;  5B1B E;  5M4Y A;  5AQK B;  4L1B A;  1OCO E;  4L7T A;  5CCL A;  3KAE A;  3V2X A;  3LY7 A;  1AWC B;  1HG5 A;  4KVO A;  2P9P G;  3AA1 B;  2AJA A;  3UT7 A;  4LFC T;  3H3A A;  4NPP A;  3PE4 A;  3UT8 A;  4K03 A;  5AFU L;  5FQ6 A;  4KBQ A;  2QVA A;  4JA9 A;  5ENT D;  4AY5 A;  4J7W A;  1QNF A;  1U3D A;  4DX6 D;  1M62 A;  1MX2 A;  3EHZ A;  1SQM A;  4GYY A;  1ELR A;  5LGU B;  3T5X A;  1DCE A;  2BBH A;  2VAS A;  4EYY R;  3GW4 A;  4TX5 A;  4P1N A;  2CMR A;  4FU3 A;  1XNF A;  3SNX A;  2WXG A;  5FZR A;  4MAL A;  5HEJ A;  3C98 B;  4GTR A;  2VTB A;  2AW6 A;  3Q4A B;  5BR8 T;  1LRZ A;  5T8I A;  4HI9 A;  3CR3 A;  2EHO C;  3NOC D;  1UJJ A;  5L2L A;  4HB5 A;  3NBN B;  4FP7 A;  5AQH B;  5LG3 A;  2ION A;  3EDT B;  2CBI A;  4DR5 T;  3K3O A;  4CN1 A;  2UXB T;  3PUG A;  4QX7 B;  3D9O A;  2X0H A;  2YNQ A;  3LDQ B;  2QYU A;  3IHV A;  3FUE A;  4KI0 F;  2IDO B;  4ZFH A;  2CFU A;  1HO8 A;  3VTX A;  4AIF A;  1HNW T;  3FTV A;  2LM2 A;  4KUM B;  3EU9 A;  2D0U A;  2VVS A;  2VGX A;  1MX4 A;  5ENP D;  2XQY A;  2VKD A;  3B5M A;  4GKJ T;  2ZGG A;  1OED C;  3N9P A;  3E22 E;  4GYS A;  4C0E A;  2OCC E;  4JBW F;  2XCC A;  2JRK A;  2D2S A;  3AEG A;  2P9U G;  2XAF B;  3SI5 A;  5FXZ A;  3KD7 A;  3FU6 A;  1WR0 A;  4AQF A;  4DX7 D;  4MBG A;  4DLQ A;  5AQU B;  3BG0 B;  3CKB A;  4X1Y E;  4JW1 A;  3ONJ A;  2GRP B;  3CPZ A;  3JQ1 A;  3AAI A;  4BT8 A;  1DVP A;  2QZA A;  3AAA C;  4I2Z A;  2L6B A;  1GW6 A;  3IA3 A;  2ZM2 A;  2LUH A;  4O1P A;  2BTD A;  3KVA A;  2DVW A;  3ZEF B;  3EU5 A;  3ZYQ A;  1FIO A;  4JEU B;  3MK7 C;  5EZY E;  2A2F X;  2KMF A;  5AAO A;  5LFA A;  3O4X E;  5HXC A;  2KZT B;  3ABL E;  3FUH A;  2L0T B;  5CCM A;  3RYF E;  4W9R A;  1S94 A;  1YKH B;  4LFA T;  1ZBP A;  3G2S A;  2X0L B;  1DCQ A;  4AKL A;  3JCK C;  4AKI A;  4I43 B;  2PL2 A;  3OYX A;  2GRL A;  4TXR A;  4DO0 A;  2W00 A;  4JUY A;  3ZHE B;  3UI2 A;  2LE8 A;  4QXH B;  4RG9 A;  4AKR B;  4KMO A;  4U0U A;  2X6F A;  4YJ3 E;  4I1A A;  3JAF A;  3VKG A;  4HOS A;  4QH5 A;  1V55 E;  4X1K E;  5FKY A;  2WQH A;  1OWO A;  1EPU A;  5CFB A;  4GTM A;  2M6B A;  3AE6 A;  4YSY A;  1QBQ A;  3HVE A;  3SFY A;  4KHP T;  4IYP A;  3AE7 A;  4JI4 T;  4DR3 T;  3O1J A;  4UQZ A;  4UV9 B;  2XTL A;  3Q73 A;  2DZN A;  4YHH T;  4GCO A;  3H37 A;  2K5B B;  4K5A B;  4I9C A;  4YSX A;  4APO A;  3KV9 A;  3CHS A;  1OUV A;  3PUQ A;  3VTY A;  1ZEE A;  1HE8 A;  3AG4 E;  3C4X A;  3K8P C;  2UUA T;  1KLX A;  3KDS E;  3IBE A;  2QYJ A;  4Q25 A;  3FTU A;  2GK9 A;  1K1A A;  1EDU A;  4WWN A;  4P0B A;  3UKU G;  2I1J A;  3UT5 E;  3DPD A;  5AAR A;  4CGW A;  3OYZ A;  3TJP A;  2VYI A;  2F37 A;  3ABV A;  2EHO D;  4I2W A;  5KXJ A;  5LOZ A;  1TNZ A;  5LJN A;  3UKR G;  1TJC A;  2XZD G;  3P4W A;  5HKP A;  2IO3 C;  3PRE A;  4J8E A;  2CA5 A;  2QGS A;  4X62 T;  1TNO A;  4DV6 T;  1AP7 A;  3PUA A;  4UF0 B;  3GN5 B;  4YJ2 E;  1NZN A;  3RIU C;  3B7S A;  5LHH B;  5D0O D;  1O5M A;  5LBQ B;  5G05 J;  2F4V T;  4K0K T;  2JQ9 A;  3LCA A;  4A55 A;  2GRR B;  2XQ9 A;  3NVO A;  3V79 K;  1DNP A;  4XIF A;  2YK0 A;  1VRB A;  3RRM B;  4DMW A;  4BET A;  2WWU A;  1H6P A;  5LMN T;  2UWJ G;  3LJ3 A;  4KHZ F;  3NRY A;  1BD8 A;  2XQ4 A;  4YTP A;  3PDN A;  2VQF T;  2X68 A;  4ANW A;  3OXG A;  4JEH B;  4F6R C;  3DST A;  5KJK A;  4LMK A;  4B0Z A;  3ASH A;  3D9K A;  1WCR A;  2C5J A;  4CEM A;  3U78 A;  3NQP A;  1MYO A;  3BG1 B;  3GWH A;  3RRN B;  5HS0 A;  4I1M A;  3FXE B;  1N4R A;  5LYJ E;  1FVH A;  2ODU A;  1Q2Z A;  3AA6 B;  3UQ4 A;  4HQD A;  4IST A;  4DRX E;  3HR0 A;  5J1G A;  3RX6 A;  5FYM A;  3RKG A;  3G2W A;  1SA5 A;  2X0Y A;  3IV0 A;  1JUQ A;  4O4L E;  3GZS A;  3QAQ A;  4U33 A;  3JYS A;  4UEL A;  3RJV A;  1ELW A;  4GU5 A;  4B3R T;  3PU8 A;  3JC6 C;  4HBD A;  2KWH A;  3PUW F;  2WZH A;  3RH3 A;  4JPS A;  2CEA A;  5LCY A;  1D1C A;  2UUC T;  1HU3 A;  5HEH A;  1E8W A;  2WXO A;  2DCF A;  1WAO 1;  3A7M A;  4A56 A;  2V6Y B;  4AQF C;  3E4B A;  3ML8 A;  1QLB A;  4DV3 T;  3R84 B;  4UQY A;  5ENQ D;  4UWL A;  3DEO A;  3G2T A;  3T8O A;  1NI1 A;  2XHE B;  4YSZ A;  1IYG A;  5L3C B;  1V9D A;  3AU4 A;  2CHX A;  4IDP A;  3B57 A;  4RG6 A;  2NW8 A;  1H2U A;  5AQL B;  3UTM A;  3QB5 K;  5BT1 A;  4RSY A;  4ILI A;  3LXU X;  4YDO A;  3Q5M A;  4KMC A;  5LGT B;  3RK6 A;  5FL0 A;  3UM0 A;  2F8Y A;  4LF8 T;  1KF6 A;  3FFL A;  3HXD A;  1EF1 C;  1U3C A;  5BPP A;  2V6X A;  3FU5 A;  3TLT A;  1FJG T;  2VQ2 A;  4CDM A;  4WAF A;  1D8E A;  5A1L A;  4OYK A;  2FJD A;  2IJG X;  2XQ0 A;  4M1P A;  4QQI A;  4GMJ A;  2KAT A;  2KXP C;  1MMG A;  3F6Q A;  3CVU A;  3DWL G;  2IF4 A;  3B7R L;  1UGO A;  4XEI G;  5FXX A;  3W9G A;  1R8I A;  3KSQ A;  1N94 A;  3GMI A;  1EZ3 A;  2WCA A;  3OBV E;  4FJY A;  2BZB A;  2FO1 E;  2B6C A;  3C4W A;  3PE0 A;  4LML A;  4NIQ A;  2E2A A;  4V1A v;  5IWA T;  2UU9 T;  3DBS A;  1OXJ A;  1X5B A;  1QUU A;  3CIR A;  5CRV A;  2E9X C;  1TNY A;  3LFM A;  2WXR A;  5EKQ D;  3MKQ A;  4H7X A;  3ISM C;  3RPU A;  4B8C B;  4XKC A;  2OOE A;  4ANX A;  4HRN A;  2LKH A;  3TG5 A;  3ZU7 B;  4TXP A;  4QXC B;  3LPZ A;  4J8F A;  2PQN A;  3QWW A;  2BUG A;  4JVS A;  3Q5W A;  2BVL A;  1BR2 A;  3D9I A;  1H6K A;  5AQV B;  3TWT A;  1TJF A;  2RA1 A;  3A5X A;  1D1A A;  5FMN A;  3DEP A;  5CHE E;  4ILA A;  2CG3 A;  4X20 E;  1WFD A;  4GK5 E;  1OWP A;  2H7V C;  4HI8 A;  4DV2 T;  4Z68 A;  3ONL A;  1OCZ E;  1MND A;  5KJN A;  4OAU C;  4B6X A;  1ZV4 X;  4WNG A;  5FQ8 A;  2WB2 A;  2A5U A;  3OAW A;  3RHW A;  5BV1 A;  3BQK A;  2M63 A;  1KNZ A;  2HN2 A;  3P1U A;  2WXJ A;  4K5C A;  3EHQ A;  4N3C A;  4IE5 A;  1LVK A;  1TYQ G;  4F6R D;  5HCJ A;  4DV5 T;  4GTQ A;  4BEP A;  1XGW A;  1WYB A;  2LOP A;  5IYZ E;  3C64 A;  2LJL A;  5JHA A;  2I2O A;  1N32 T;  1OCR E;  3UUB A;  3NZU A;  3AG3 E;  2YHC A;  3X2Q E;  4R7L A;  4Y6W A;  4IRE A;  3VKH A;  4GML A;  4U8V D;  4DV4 T;  4U3C A;  3J9X 1;  3ZRH A;  3MZK B;  1N0R A;  3EIQ C;  2EIJ E;  4ANV A;  4JZY A;  3SO8 A;  3V5S A;  3OJA A;  2VVN A;  3KS2 A;  2VKJ A;  3MKR A;  2VSN A;  4KBM B;  4ANU A;  4CGV A;  3T8K A;  3ETU A;  2HO1 A;  4GTT A;  1HX8 A;  4ZI3 C;  3E0Z A;  5AQO B;  3TGO A;  1IBK T;  4P29 A;  4AQG A;  4JHR A;  4ATG A;  4MHC A;  4U7E B;  2CFZ A;  4L0R A;  4XZ4 A;  5ABF A;  3RRC A;  1HS6 A;  4GOU A;  5ANR A;  4DLO A;  1FPP A;  5FL1 A;  1XDO A;  2YDS A;  3LY9 A;  3QK0 A;  2X6K A;  5DAB A;  3OKQ A;  4MS6 A;  1BR4 A;  5JRC B;  5D0Q D;  3U3W A;  2R17 C;  4BX9 A;  2OND A;  2ES0 A;  3SBT B;  2ACX A;  2BG9 B;  3UM3 A;  5CEA A;  3RC8 A;  2R5S A;  4B3T T;  3QKY A;  1BR0 A;  2X51 A;  5B3S E;  3L8R A;  4DBQ A;  4HWH A;  1HH8 A;  5L3E B;  5ABG A;  4EEC A;  2ODV A;  4YDW A;  4I6J A;  3KEZ A;  2DIW A;  4EZL A;  4BX8 A;  4HRM B;  2EHO A;  4JI8 T;  1H0A A;  4MKT A;  3N71 A;  3ZN1 B;  5JDQ A;  2AWI A;  4H9R C;  5EID A;  3AE8 A;  2VGE A;  4ME2 A;  4NAC A;  4FLH A;  4E7S A;  2WXL A;  1HXI A;  3J5P A;  2BDE A;  1KNP A;  3CVQ A;  2WDQ A;  2XJ7 A;  3SGH A;  3K1S A;  2OV8 A;  4O4H E;  1XWM A;  4NUR A;  5DQW A;  3RO2 A;  1N54 A;  3HG0 D;  3AS8 A;  2Q9Q B;  2MTQ A;  1H19 A;  4LER A;  2X67 A;  4WNE A;  2E9X D;  3IXE A;  3QNK A;  3CVW A;  4XBF B;  4DR6 T;  4O60 A;  2C0S A;  3ZMV B;  1JNZ A;  3VRB A;  2GGF A;  4ILH B;  3C50 A;  2ZMA A;  1BR1 A;  1D8D A;  3VU7 H;  4N2Q A;  3ZCI A;  1KT1 A;  3V31 A;  2JIW A;  3SRZ A;  4DX5 D;  3LBX B;  3DSV A;  3ZMT B;  3ZST A;  3PE3 A;  4JXT A;  3DRA A;  5AQ7 A;  2WS3 A;  3ZJ1 A;  3ESL A;  1Z3Y A;  3CQG B;  1EYH A;  4BSX A;  4DR4 T;  2XUE A;  2VSX E;  2IC9 A;  3HKB E;  4HWI B;  4GYO A;  3N9M A;  4LSZ E;  4D10 C;  3EHM A;  1E7P A;  2HPL A;  3G2U A;  2CHO A;  3CHM A;  5AQM B;  2L9Q A;  3HKE E;  2J62 A;  3RQW A;  1KZO A;  4TN7 B;  3UU8 A;  1ZKE A;  4L2Y A;  2CXL A;  3RC3 A;  1W9R A;  2NXP A;  3ASG A;  4NIK A;  2PJQ A;  1IZN B;  4MLK A;  2JLB A;  2XSB A;  4YVO A;  4L5G A;  4HXI A;  3QWV A;  4YFS A;  2R02 A;  3UIN C;  5JTG A;  4IHJ E;  4JA7 A;  5JR9 B;  4DX1 A;  4U8Y D;  4PAG A;  2W4X A;  3DJB A;  3FWV A;  3ONL C;  4ATZ D;  3TLW A;  2V8S E;  3EI0 A;  1UJK A;  5ARF A;  3DTO A;  4PS3 A;  4ZI3 D;  2E5L T;  3APF A;  4GA1 A;  2HR2 A;  4L2L A;  1WDY A;  3AA0 B;  3Q9N C;  2F8X K;  2CCQ A;  3PNL B;  3CVP A;  4DVD A;  3CVN A;  3IEE A;  2NW7 A;  2KSR A;  4JLE A;  3C5R A;  1O1R A;  2J8S D;  4L23 A;  4WZX A;  2UXC T;  1TN7 A;  1IAP A;  1FMW A;  3SF4 A;  4HFD A;  4LF7 T;  1RW2 A;  3FU0 A;  4XZC A;  3E33 A;  4H63 V;  5JH7 E;  4FA6 A;  1OXZ A;  1WR6 A;  3ANW B;  4TWF A;  3RIA A;  4I1O B;  4PUC A;  4HOR A;  2QY7 A;  5JDN A;  1OWN A;  2WQ7 A;  3DSU A;  2DYR E;  4HOU A;  1AJ3 A;  3L08 A;  4PFP A;  4UV8 B;  2OEW A;  2PBI A;  5LX8 A;  2FEZ A;  3UX4 A;  5AQI B;  1FEW A;  5FVK A;  2LNI A;  2E2E A;  4F8H A;  5JJ6 A;  3PUV F;  1MMD A;  2P9I G;  3AE3 A;  2FI7 A;  2HH7 A;  2WU2 A;  4CN6 A;  3TKL B;  3U3I A;  3AXJ B;  3RGL A;  3DSX A;  4COF A;  1N0Q A;  4JI2 T;  3ASD A;  2YN6 A;  4WW0 A;  2WDR A;  3CX7 B;  3FUM A;  3RIU A;  3Q47 B;  2WDV A;  4O1O A;  4Z91 A;  1TR4 A;  4U96 D;  1P5Q A;  1HS7 A;  3C3R A;  4C48 B;  4E6H A;  3UFG A;  2JJ9 A;  1MIV A;  2C5I T;  3ONX A;  4I17 A;  1SW6 A;  4DK5 A;  3FEY A;  3MEK A;  2LSJ A;  4CDN A;  4U8H A;  4IE4 A;  3ZMS B;  4YY3 T;  4LMJ A;  3OXF A;  3TWU A;  3PUZ F;  2XQ3 A;  4XKB A;  1KT0 A;  5H6R B;  3AU5 A;  4TUM A;  4PW8 A;  4HFC A;  1IHB A;  2CBJ A;  5FY1 A;  1J5W A;  3SS1 A;  4DV0 T;  2G0U A;  4U2Z A;  3RQU A;  4C90 A;  2X38 A;  2WXI A;  4I9E A;  5ITZ F;  4PS8 A;  3SFE A;  5L3B B;  3R9A B;  4ASK A;  4N3A A;  4QXB B;  4ADZ A;  2K48 A;  4DBR A;  3LG7 A;  3E37 A;  4CXW A;  3NB2 A;  4G25 A;  2LRL A;  2PNN A;  2WVI A;  4DUZ T;  3D9P A;  1BI7 B;  3S4U A;  2KCV A;  4G1T A;  4UUC A;  1E8Z A;  5KNH D;  3O9X A;  4G63 A;  3ZUV B;  4AKH A;  3N2G E;  1N33 T;  2IOL A;  4N39 A;  3I0Q A;  2LHN A;  3APD A;  3FZM B;  3ZVV A;  4BER A;  2CWO A;  2R59 A;  4G8K A;  2N9D A;  3ONK A;  1NEN A;  3ZGQ A;  5HWX A;  3I5P A;  2KT9 A;  1MIY A;  4GTO A;  3PH0 C;  5L3D B;  4YVQ C;  2UY1 A;  2PTF A;  1HTJ F;  4UWG A;  3UT4 A;  4YDY A;  5EX3 A;  1WRD A;  3D9H A;  4GA0 A;  3KFW X;  4JEU A;  3TWV A;  2JPF A;  3FTX A;  3RU0 A;  3EDU A;  4F53 A;  3KIN B;  3ZXS A;  3P4Q A;  3CGH A;  2DLR A;  3O1I A;  4O4J E;  2V4L A;  4Q96 A;  3NAW A;  1SZ9 A;  4NXM T;  2A9U A;  4I43 A;  3I4G A;  2AVP A;  4M7C A;  2UXX B;  3S7F A;  4GYW A;  3NZS A;  5G2N A;  1A5E A;  3RKO A;  1SE7 A;  2KCL A;  4HFB A;  2VUR A;  4FHK A;  2H3R A;  1OWA A;  1OWM A;  3APC A;  4WNF A;  1YQ3 A;  2CG2 A;  1ZHC A;  1H6O A;  2Y69 E;  3HRA A;  2GRM A;  4GPM A;  2LLY A;  2OLT A;  1DC2 A;  1XZY A;  1SUM B;  2OEV A;  4F1S A;  4LG6 A;  3AEA A;  3SBS A;  4AEZ C;  3P50 A;  4O4I E;  2Y4T A;  3SWH A;  2ZXW E;  1QZ2 A;  5HAX A;  3F2E A;  1N95 A;  3HKC E;  3BEE A;  2J09 A;  3QC9 A;  3AS4 A;  4N5C A;  5JMN D;  2E9X A;  2IC6 A;  3RRU A;  2CLY C;  3I4R B;  2ACZ A;  4TNW A;  3TXM A;  3ZLI A;  3FBZ A;  2XPI A;  3O1H A;  4HE8 A;  3AEB A;  4TUU A;  2XSA A;  3UIP C;  2ZU6 B;  2BS2 A;  3FEX A;  3TWQ A;  1YW0 A;  4QH4 A;  5JDL A;  5LNK A;  1OCC E;  4IN3 B;  5FVL A;  1D0Y A;  3T1H T;  4FJZ A;  3G06 A;  3CVV A;  5KNG A;  3NKZ A;  4MBQ A;  4UWK A;  5HXE A;  4TV9 E;  2IHR 1;  5D2M C;  2NWB A;  2W2U A;  1JCR A;  3AA7 B;  2CWY A;  3AJI A;  4CRW A;  3B7B A;  5HEO A;  4CXX A;  4ZI2 C;  3ZPO A;  4PK4 A;  2HM8 A;  4E85 A;  4LNB A;  2FJE A;  2V5C A;  2ZM6 T;  5ETW A;  3CK9 A;  3L17 A;  2SPC A;  3QB2 A;  5C8Y E;  3JUE A;  2LO6 A;  2K24 A;  4KZC A;  4EPZ A;  5LOV E;  2NR4 A;  3ZSS A;  4GZ5 A;  2DI4 A;  2WXM A;  3I1A A;  3UUX A;  3KV4 A;  3T8M A;  3SQV A;  1UUS A;  1LVF A;  1MQS A;  1U5P A;  3K9I A;  4K0R A;  3Q75 A;  2YIN A;  4U0Z A;  5LHI B;  1PY1 A;  4UIG A;  3PRZ A;  5ABE A;  4NUU A;  4FUL A;  4EED A;  1U2V G;  4X66 T;  5KDM C;  4IT4 A;  2HHH T;  2MOZ A;  2EIN E;  2BKG A;  4GTV A;  5AYW D;  3UFE A;  5JDM A;  3VRA A;  4OVV A;  4LCT A;  5C2T A;  3R7R A;  4EZH A;  3D9N A;  4ZS3 A;  3RYH E;  3FU3 A;  2H89 A;  4BA9 A;  3B13 A;  1XNQ T;  4PH4 B;  4GKK T;  4U04 A;  4FJO A;  2YU1 A;  3O4Z A;  1I94 T;  3I3N A;  2DCP A;  3P8C D;  3CQX C;  2Z6E A;  4B93 B;  4P09 A;  3HXF A;  4NUV A;  3FTW A;  4L9P A;  5JVD E;  4OFZ A;  4F7A A;  4TZ4 C;  2WQY A;  2FF4 A;  3N9L A;  5AQJ B;  4B8A A;  1WG0 A;  1KZP A;  4WBO A;  5IHY A;  5KWD A;  3FUL A;  4EB6 E;  2V6Y A;  2WMO A;  4GK0 E;  3DXK G;  2CXF A;  2FO7 A;  5ENR D;  4B94 A;  3LEW A;  4UI9 C;  2V5D A;  5FTP A;  1K3Z D;  2C0M A;  3CQC B;  2XHE A;  3PUX F;  4AY6 A;  2BKO A;  1HR0 T;  4QH1 A;  3KBU A;  2FUL A;  1LTX A;  4ZZC A;  1J5E T;  3CHQ A;  1NL4 A;  2BS3 A;  2DZO A;  2DYS E;  2J4B A;  3TG4 A;  3TLS A;  3SFD A;  2MOW A;  2W66 A;  1BLX B;  4A1S A;  3AVS A;  3CK8 A;  3T1Y T;  3DPY A;  5C1D A;  2FBW A;  3C4Z A;  3L13 A;  4KZ0 A;  5F3J A;  4DI4 A;  3MKD A;  2PG8 A;  5F5W A;  4XE0 A;  3PNT B;  3UXG A;  1T72 A;  2FUP A;  2PFV A;  3ZCJ A;  4N3B A;  3WAJ A;  5HCM A;  1G73 A;  1Y64 B;  5CED B;  2RKK A;  5DBK A;  1A17 A;  2WXN A;  4HWF A;  4JHJ A;  4JL0 A;  3ASO E;  4IE6 A;  4CQI A;  5EK2 A;  3V30 A;  3GA8 A;  3RF1 A;  4HLL A;  2H6G A;  1K1B A;  1V54 E;  4YDE A;  2P9K G;  3PUS A;  3E34 A;  3ZN0 B;  2VKH A;  3ULE G;  4M3O A;  3MV3 B;  2FBN A;  3WXX A;  3FZF B;  1US7 B;  1W09 A;  2JQK A;  3CX6 B;  3EDV A;  4WYV A;  5HXH A;  4JV5 T;  3ESK A;  1HZ4 A;  4HVB A;  4ZI2 D;  4UWH A;  3RYC E;  4F3V A;  5FIO A;  2VB6 A;  4QHO A;  4CI1 B;  1S70 B;  3ZYK A;  3HA4 A;  3UU4 A;  3W15 B;  1VCT A;  4HKA A;  3ZYL A;  5LXT E;  4WUY A;  5A23 A;  2LXL A;  2WZI A;  3PTR B;  1ZB1 A;  4C91 A;  4NRH B;  2OA5 A;  5GON E;  4WBN E;  2P58 C;  4KVM A;  5E76 A;  1PAQ A;  2H6F A;  4H9P C;  4TRQ A;  1UUR A;  4I0U A;  1IBL T;  3HI2 A;  3EAM A;  3ABM E;  2VGY A;  3FUI A;  5HI7 A;  4DI3 A;  3QNU A;  2IIU A;  1Y6I A;  2JMK A;  3IHY A;  4U31 A;  3PZD A;  3TWW A;  2X6J A;  3LDZ A;  2Y48 B;  3CX8 B;  5DIZ A;  5G55 A;  1MHQ A;  5C2Y A;  4Y6C A;  4G8L A;  4KX6 A;  2XAJ B;  1L5J A;  3PEV B;  3BQI A;  3ZMU B;  4BAY B;  2I59 A;  3ZN3 A;  3PJA A;  1MMN A;  2ZIR A;  4C0M A;  3L54 A;  2WXF A;  3TWX A;  2NC9 A;  5FWQ A;  2GRN B;  5AJL A;  5LP0 A;  1HFA A;  5L3G B;  2WMN A;  3EIJ A;  2XEN A;  1XNR T;  2KND A;  2IO2 C;  5KJL A;  3AE9 A;  4PJJ A;  2WM9 A;  3RRW A;  2GRQ B;  1LD7 A;  4EBA G;  4QWN B;  4ACL A;  4CYM D;  4CI3 B;  4JI3 T;  3BK9 A;  4HS2 A;  4IUL A;  4JI5 T;  3LSV A;  5CER B;  2CHN A;  3UM1 A;  2JAB A;  1IJ6 A;  2EIL E;  2R6G F;  3V5U A;  4GA2 A;  5C3J A;  5JRC A;  5AQR B;  3ASN E;  1E8X A;  2YEV C;  3I9Y A;  1BI8 B;  3Q5E A;  4YTM A;  4MLP A;  5BW8 C;  3ZKJ A;  4HFE A;  2W0G A;  1YKE B;  4EXT A;  4OVU A;  2IW5 B;  4HLE A;  3L3P A;  1YQ4 A;  4RLY A;  4YLH A;  1YXR A;  2CHW A;  4H7Y A;  5FXW A;  3CHO A;  3EUV A;  4LNG A;  4O8S A;  3EHN A;  4HFH A;  5LCW C;  3DXM G;  3FXD B;  4YND A;  2CPT A;  1PC2 A;  1BU9 A;  4H9Q C;  3PJA J;  5HQ8 A;  4HEA A;  4X64 T;  2UXN B;  5EN5 D;  2IY0 C;  3ZC1 A;  1NFI E;  3B7T A;  4NQ0 A;  2V7M A;  5ABF B;  4X1I E;  2J9Q A;  5D66 A;  5AQP B;  4DPR A;  2GRO B;  3PUY F;  2WWV A;  1X81 A;  1YD8 G;  3ML9 A;  3VR9 A;  3AE1 A;  2Q9Q A; 
#chains in the Genus database with same CATH homology
 2M67 A;  4BJN A;  3PUR A;  3SOL A;  1H7C A;  1UN9 A;  2AXV A;  4H9O C;  4UVB B;  5AEN A;  3C51 A;  3D9L A;  5TAO A;  3LBX A;  1INZ A;  4EIW A;  3KBT A;  2PM6 A;  2VSY A;  3NF1 A;  2JMH A;  2EHO B;  2HYZ A;  4AP2 A;  4GAA A;  4HOT A;  1WLX A;  4CI2 B;  4AVX A;  3F31 A;  2LSU A;  2A4Z A;  4TUY E;  4WND A;  3ZYM A;  2V26 A;  3NZQ A;  2NOX A;  3AVR A;  2VWA A;  4TV8 E;  1WYC A;  2W62 A;  3CWZ B;  3N9N A;  3I0O A;  5H6Q B;  3HDX A;  2B1E A;  3J7Y q;  2L0I A;  2X66 A;  3CSF A;  2X6I A;  1D0X A;  1W3B A;  3ENE A;  2XAS B;  3ZW3 A;  2I1K A;  3F57 A;  3NZP A;  5AIJ A;  2LSK A;  3N9O A;  4UVA B;  3KV5 A;  4IIJ E;  3QWP A;  3D3M A;  5BV0 A;  3AAA B;  1B89 A;  2LSY A;  4KXK B;  4RVB A;  3IEG A;  3MJW A;  2IOS A;  4GZC A;  3AAE B;  5CB4 E;  4ACK A;  2JQQ A;  4XX5 A;  2KC7 A;  3MA9 A;  4Q94 A;  4U63 A;  3B7U X;  4C9B B;  5EDS A;  4KYO B;  2PQR A;  3ANW A;  3KVB A;  4GCN A;  3CEQ A;  3TAX A;  4CZZ B;  2X9H A;  2L6J A;  2KM4 A;  4QFV A;  4EQF A;  3QJZ A;  1QSD A;  4PDX A;  4IDZ A;  2XGS A;  3FUF A;  1MIW A;  4I6E A;  2X9Y A;  2V7K A;  4B89 A;  3CKD A;  3QDN A;  4PK5 A;  4EZK A;  1VDY A;  5G04 C;  4JC8 A;  4U07 A;  2DWG A;  2XPY A;  4BTB A;  4EAH A;  3RIB A;  3HL6 A;  2RD0 A;  4AM9 A;  4CDR A;  3SZ7 A;  4U72 A;  3C98 A;  1FVF A;  3CV0 A;  2ZM8 A;  2WXP A;  4E7Z A;  4LUN U;  3FHN A;  3KV6 A;  5KMG P;  1H2T C;  3U64 A;  2Y4U A;  4Z8X A;  3N2K E;  3S7J A;  3PU3 A;  5E75 A;  2CM0 A;  4H63 H;  4UVC B;  3LKU A;  4ZI7 E;  4HFG A;  3UQ3 A;  2Q9Q C;  4N78 D;  2WAU A;  4O2A E;  4OK0 A;  4BT9 A;  1H2V C;  2XGO A;  2W63 A;  3D9J A;  3FUD A;  3D9M A;  5HYA A;  3ZC0 A;  3MXZ A;  3HIZ A;  3ZFW A;  4PNI A;  2DBA A;  2VTB B;  3MA5 A;  5KJM A;  1Z0P A;  2D0T A;  2LAI A;  3HYM B;  2LEH A;  1D0Z A;  2MHK A;  4A3V A;  4KT6 B;  2LOS A;  1LKX A;  5BNW A;  3FDH A;  3MV2 B;  2J4D A;  2VKO A;  1SZA A;  3ZEF A;  2NSZ A;  5FZQ A;  2W61 A;  5T4Y A;  5FY0 A;  4LEU A;  3CVX A;  2KZT A;  2VSO E;  3ZMZ B;  3ASF A;  3FUN A;  2JEK A;  3LY8 A;  2VGX B;  2VJ8 A;  2E8I A;  1Z6T A;  5JJT A;  3CLJ A;  2N2N A;  3P7I A;  5DQV A;  2V0P A;  3QAR A;  1E7V A;  2VL8 A;  4ANJ A;  3ZHE A;  5FJY A;  5JR9 C;  4HN9 A;  2V7J A;  3Q2M A;  2UY1 B;  4WWP A;  3RYI E;  4UWF A;  4A1G A;  2WQ6 A;  1HG2 A;  2V7L A;  4PJL A;  2V1D B;  3SD5 A;  4UI9 J;  5BMV E;  2LHR A;  5ARG A;  3S7D A;  2IQC A;  1QQE A;  1O3X A;  4ABN A;  1E1H B;  3LJC A;  4TV3 A;  4HTE A;  4EOZ B;  3PEU B;  2IFU A;  5FP3 A;  4QX8 B;  2QFC A;  4I50 E;  1SHZ C;  3FUK A;  2KLQ A;  2KXP B;  5JDG A;  3MX3 A;  3VLE A;  3UMV A;  3UUL A;  3D0T A;  5A7D B;  4G2V A;  4J8D A;  5LBM A;  5LP6 E;  4AKG A;  2XEV A;  4IRU A;  3LVQ E;  2CXD A;  2DHR A;  5LG4 A;  3BQL A;  2E9X B;  1IJ5 A;  4I4T E;  4UF0 A;  3GN5 A;  3HVE B;  3R6N A;  3K3N A;  3CVR A;  2Y6X A;  3PVL A;  2Q9Q D;  4AJW A;  5EK4 A;  2L9B A;  2VK9 A;  3FY4 A;  1E90 A;  3GZ2 A;  1G8X A;  5CMW A;  4P0A A;  3L22 A;  4JEH A;  3FB2 A;  4AI6 A;  3IF8 B;  2WXQ A;  5LGN B;  3O48 A;  2DNX A;  3PUJ A;  4HFV A;  4ILG A;  4U0S A;  3RKV A;  2PZI A;  4BTA A;  4XI9 A;  2L8K A;  3VHL A;  4PJN A;  4OHF A;  4G2A A;  3UUX B;  3PUK A;  3DP7 A;  1S35 A;  3MZL B;  3Q49 B;  5J08 A;  4ISS A;  2LSV A;  5DJQ C;  1ELK A;  4AV7 A;  4DJA A;  2DWK A;  1E7U A;  3WI3 A;  2KCK A;  3MGB A;  4CCA A;  4IE0 A;  4CT0 A;  4UQX A;  2YHE A;  3CVL A;  3FP3 A;  1CUN A;  1UW4 B;  3AS5 A;  3HHM A;  1NA3 A;  3OXL A;  4GZ3 A;  2XRY A;  3FTZ A;  2QA7 A;  3Q15 A;  4K0U A;  5LA6 E;  4FLB A;  1UX4 A;  5ADX L;  2OVB A;  3ETV A;  5LHG B;  2GW1 A;  4APF A;  2NW9 A;  2PM7 A;  3MYV A;  1MMA A;  1HF8 A;  4N2S A;  2V7I A;  1UG3 A;  3SHF A;  3LS8 A;  3LVR E;  4UEM A;  1D1B A;  2WPV A;  2KWI B;  5FZS A;  1NA0 A;  4GB9 A;  2XCB A;  3N2O A;  1IHG A;  4HOQ A;  5JQG E;  2XPZ A;  5LCW J;  4XAX B;  3LK2 B;  5EK3 A;  4G23 A;  4PJM A;  3FUJ A;  5BUZ A;  1JWG A;  1E8Y A;  1E96 B;  4PK6 A;  4J2C A;  1NP7 A;  4PS7 A;  3ULQ A;  1BPO A;  1SA0 E;  3AB3 B;  2ZLY A;  2MYS A;  5G05 C;  5F8P A;  2BVM A;  1IQU A;  3OTN A;  3GYZ A;  2I9C A;  3K3Q C;  3IBP A;  2RP4 A;  5CMY A;  3HKD E;  4FHJ A;  2LSI A;  1Z3X A;  2XGM A;  1ZU2 A;  1S0P A;  4KP3 C;  1N52 A;  3MKQ B;  4J0U A;  4Q69 A;  4EZ4 A;  3CST A;  4FI5 A;  3U4T A;  1KK7 A;  3ZJ2 A;  2J07 A;  3FH7 A;  4QKN A;  2LT3 A;  4OYJ A;  2C5K T;  5CA0 E;  4OYS A;  3LYA A;  1WY6 A;  4URK A;  5CA1 E;  1JWF A;  2WXK A;  3L6A A;  2X9W A;  4J8S A;  4ZS2 A;  3PS6 A;  1B7T A;  4AOF A;  1WM5 A;  3N9Q A;  5KX5 E;  3E08 A;  3ZIM A;  4GZ6 A;  4ZHQ E;  5FNV E;  2KIN B;  2BF0 X;  2WBL A;  2XAQ B;  1U4Q A;  2LM9 A;  4EBA A;  2N1G A;  3UPV A;  5E0O A;  1IQR A;  2X6H A;  4WNK A;  3EJN A;  3QUJ A;  3URZ A;  3JC6 D;  4G24 A;  4H9N C;  4V3I A;  3U9W A;  4YHJ A;  5FXV A;  1LF8 A;  3FTS A;  3JUI A;  4MRU A;  4ERR A;  2MBG A;  4JHK A;  5HWY A;  4LRZ A;  3JQ0 A;  4I55 E;  2CE7 A;  2XAG B;  5FQ7 A;  4UI9 K;  3CHP A;  2ILR A;  2X9X A;  5J2U E;  4BY6 A;  5ENN A;  3IKO B;  2IAK A;  3U66 A;  2CHZ A;  4ZOL E;  4BWR A;  2D5U A;  4DND A;  2I6H A;  4I6G A;  2HPJ A;  3UTK A;  2AXU A;  1HCI A;  3CKC A;  3FH8 A;  5J2T E;  2ZM0 A;  3N5L A;  1JPL A;  5M72 A;  4BFR A;  2AXZ A;  3FBL A;  1X79 A;  3FH5 A;  3VLD A;  4IE7 A;  4EZJ A;  4BJM A;  4GYR A;  3QOU A;  4G11 A;  2KZ7 B;  5G04 J;  3R7Q A;  4AXP A;  3FTY A;  1YA0 A;  5T3R A;  5L3F B;  3NRX A;  3M65 A;  4FAD A;  5A6C A;  3Q9D A;  1NWM X;  3CVY A;  1UX5 A;  5HXS A;  1OWL A;  4EYU A;  5JJ7 A;  3EUH A;  3S2A A;  2IU1 A;  3RO3 A;  3P2B A;  3I9W A;  4FC8 A;  3IHR A;  4GPK A;  1T98 A;  2C0L A;  3S7B A;  3FHE A;  2LAH A;  2XAH B;  4MFR A;  2OVF A;  5JR9 A;  2XRZ A;  3UUM A;  2MRI A;  3L09 A;  3NBX X;  2WSS V;  4A3T A;  2NP9 A;  2LSG A;  2YU2 A;  3TXN A;  5FY7 A;  3MAC A;  5JRE A;  4ILU A;  2P9B A;  5J90 A;  3PDY A;  2Y3A A;  5JDH A;  5EX0 A;  2X3M A;  3CML A;  3L16 A;  3QK6 A;  3Q5X A;  4XI0 A;  4L9I A;  4IGU A;  2A72 A;  3CK7 A;  2Y8D A;  3CHR A;  2E0I A;  4UXN B;  2YQ8 A;  5AJD A;  3MJX A;  2J49 A;  5HXR A;  3QC1 A;  2NTX A;  3MCX A;  2A3D A;  2V5F A;  2K9A A;  2C2L A;  4WWO A;  3WAK A;  2J1D G;  4PFO A;  3LK4 2;  1UN8 A;  4O6F A;  3SFZ A;  4DMV A;  4J6I A;  3UUN A;  4CXY A;  2WXH A;  1UCU A;  4HGA A;  3CIA A;  4U74 A;  1FMV A;  2NTY A;  3ZPJ A;  4GZD A;  2CLY B;  4CT4 A;  3TL5 A;  1TEZ A;  3EVY A;  4H9S E;  4G26 A;  5KCM A;  1FCH A;  4GIW A;  5FQ4 A;  1Y8M A;  3GZ1 A;  2Q7F A;  3G2V A;  2RG8 A;  3VLF A;  2J08 A;  2EQX A;  5ANL A;  3LK3 B;  5FT9 A;  2L3L A;  5JDF A;  1NAF A;  5LJM A;  4AXH A;  1VOM A;  3T5V A;  1MNE A;  2H7O A;  4O2B E;  5M4Y A;  4L1B A;  4L7T A;  5CCL A;  3KAE A;  3LY7 A;  1HG5 A;  4KVO A;  3AA1 B;  3UT7 A;  3H3A A;  3PE4 A;  3UT8 A;  4K03 A;  5AFU L;  5FQ6 A;  4KBQ A;  4JA9 A;  4AY5 A;  1QNF A;  1U3D A;  1SQM A;  4GYY A;  1ELR A;  5LGU B;  3T5X A;  2VAS A;  4EYY R;  3GW4 A;  4TX5 A;  4FU3 A;  2CMR A;  1XNF A;  3SNX A;  2WXG A;  5FZR A;  4MAL A;  3C98 B;  2VTB A;  2AW6 A;  3Q4A B;  5T8I A;  1LRZ A;  3CR3 A;  2EHO C;  1UJJ A;  5L2L A;  4FP7 A;  2ION A;  3EDT B;  3K3O A;  3PUG A;  4QX7 B;  3D9O A;  2YNQ A;  3IHV A;  3FUE A;  2CFU A;  1HO8 A;  3VTX A;  4AIF A;  3FTV A;  4KUM B;  2D0U A;  2VGX A;  2XQY A;  2VKD A;  3N9P A;  3E22 E;  4GYS A;  4C0E A;  2XCC A;  2JRK A;  2D2S A;  2XAF B;  3SI5 A;  5FXZ A;  3KD7 A;  3FU6 A;  4AQF A;  4DLQ A;  3BG0 B;  3CKB A;  4X1Y E;  4JW1 A;  3CPZ A;  3JQ1 A;  3AAI A;  4BT8 A;  1DVP A;  4I2Z A;  1GW6 A;  2ZM2 A;  2BTD A;  3KVA A;  3ZEF B;  3ZYQ A;  1FIO A;  4JEU B;  3MK7 C;  5EZY E;  2A2F X;  2KMF A;  5LFA A;  3O4X E;  5HXC A;  2KZT B;  3FUH A;  2L0T B;  5CCM A;  3RYF E;  4W9R A;  1S94 A;  1YKH B;  1ZBP A;  3G2S A;  2X0L B;  4AKL A;  3JCK C;  4AKI A;  4I43 B;  2PL2 A;  3OYX A;  2GRL A;  4DO0 A;  2W00 A;  4JUY A;  3ZHE B;  2LE8 A;  4QXH B;  4RG9 A;  4AKR B;  4KMO A;  4U0U A;  2X6F A;  4YJ3 E;  4I1A A;  3VKG A;  4HOS A;  4X1K E;  2WQH A;  1OWO A;  1EPU A;  3HVE A;  4IYP A;  3O1J A;  4UQZ A;  4UV9 B;  2XTL A;  4GCO A;  3H37 A;  2K5B B;  4I9C A;  4APO A;  3KV9 A;  3CHS A;  1OUV A;  3PUQ A;  3VTY A;  1ZEE A;  1HE8 A;  3C4X A;  3K8P C;  1KLX A;  3KDS E;  3IBE A;  3FTU A;  2GK9 A;  1EDU A;  4WWN A;  4P0B A;  2I1J A;  3UT5 E;  3DPD A;  4CGW A;  3OYZ A;  3TJP A;  2VYI A;  4I2W A;  2EHO D;  5LOZ A;  5LJN A;  1TJC A;  3PRE A;  4J8E A;  2CA5 A;  2QGS A;  3PUA A;  4UF0 B;  3GN5 B;  4YJ2 E;  1NZN A;  3B7S A;  5LHH B;  5D0O D;  5LBQ B;  5G05 J;  3LCA A;  4A55 A;  1DNP A;  4XIF A;  2YK0 A;  1VRB A;  3RRM B;  4DMW A;  2WWU A;  2UWJ G;  3LJ3 A;  3NRY A;  3PDN A;  2X68 A;  4ANW A;  3OXG A;  4JEH B;  4F6R C;  5KJK A;  4B0Z A;  3ASH A;  3D9K A;  2C5J A;  4CEM A;  3U78 A;  3NQP A;  3BG1 B;  3GWH A;  3RRN B;  4I1M A;  3FXE B;  5LYJ E;  1FVH A;  2ODU A;  3AA6 B;  4IST A;  3HR0 A;  5J1G A;  3RX6 A;  5FYM A;  3G2W A;  3IV0 A;  1JUQ A;  4O4L E;  3GZS A;  3QAQ A;  3JYS A;  4UEL A;  3RJV A;  1ELW A;  4GU5 A;  3PU8 A;  3JC6 C;  2KWH A;  3RH3 A;  4JPS A;  2CEA A;  5LCY A;  1D1C A;  1HU3 A;  1E8W A;  2WXO A;  2DCF A;  1WAO 1;  4A56 A;  4AQF C;  3E4B A;  3ML8 A;  3R84 B;  4UQY A;  4UWL A;  3G2T A;  3T8O A;  2XHE B;  1IYG A;  5L3C B;  1V9D A;  3AU4 A;  2CHX A;  4RG6 A;  3B57 A;  2NW8 A;  1H2U A;  5BT1 A;  4RSY A;  4ILI A;  3LXU X;  3Q5M A;  4KMC A;  5LGT B;  3RK6 A;  3FFL A;  1EF1 C;  1U3C A;  5BPP A;  3FU5 A;  4CDM A;  2VQ2 A;  4WAF A;  5A1L A;  4OYK A;  2IJG X;  2XQ0 A;  4M1P A;  4GMJ A;  2KAT A;  1MMG A;  3CVU A;  2IF4 A;  3B7R L;  5FXX A;  3GMI A;  1EZ3 A;  3OBV E;  4FJY A;  2BZB A;  3C4W A;  3PE0 A;  4V1A v;  3DBS A;  1X5B A;  1QUU A;  2E9X C;  3LFM A;  2WXR A;  5EKQ D;  3MKQ A;  4H7X A;  3RPU A;  4B8C B;  4XKC A;  2OOE A;  4ANX A;  3TG5 A;  4QXC B;  3LPZ A;  4J8F A;  2PQN A;  3QWW A;  2BUG A;  4JVS A;  3Q5W A;  2BVL A;  1BR2 A;  3D9I A;  1H6K A;  1TJF A;  2RA1 A;  3A5X A;  1D1A A;  5FMN A;  5CHE E;  2CG3 A;  4X20 E;  4GK5 E;  1OWP A;  2H7V C;  3ONL A;  1MND A;  5KJN A;  4B6X A;  1ZV4 X;  4WNG A;  5FQ8 A;  2WB2 A;  2A5U A;  3OAW A;  5BV1 A;  3BQK A;  2M63 A;  1KNZ A;  3P1U A;  2WXJ A;  4N3C A;  4IE5 A;  1LVK A;  1XGW A;  1WYB A;  2LOP A;  5IYZ E;  3C64 A;  2LJL A;  5JHA A;  2I2O A;  3NZU A;  2YHC A;  4R7L A;  4Y6W A;  3VKH A;  4GML A;  3J9X 1;  3ZRH A;  3MZK B;  3EIQ C;  4ANV A;  4JZY A;  3V5S A;  3OJA A;  3KS2 A;  2VKJ A;  3MKR A;  2VSN A;  4KBM B;  4ANU A;  4CGV A;  3ETU A;  2HO1 A;  1HX8 A;  4ZI3 C;  3E0Z A;  3TGO A;  4P29 A;  4AQG A;  4JHR A;  4ATG A;  4MHC A;  2CFZ A;  4L0R A;  4XZ4 A;  3RRC A;  1HS6 A;  4GOU A;  5ANR A;  4DLO A;  3LY9 A;  3QK0 A;  2X6K A;  5DAB A;  3OKQ A;  4MS6 A;  1BR4 A;  5JRC B;  5D0Q D;  3U3W A;  2R17 C;  4BX9 A;  2OND A;  2ES0 A;  3SBT B;  2ACX A;  3RC8 A;  2R5S A;  3QKY A;  1BR0 A;  2X51 A;  4DBQ A;  1HH8 A;  5L3E B;  4EEC A;  2ODV A;  4I6J A;  3KEZ A;  2DIW A;  4EZL A;  4BX8 A;  2EHO A;  1H0A A;  4MKT A;  3N71 A;  3ZN1 B;  5JDQ A;  2AWI A;  4H9R C;  4ME2 A;  4NAC A;  4FLH A;  4E7S A;  2WXL A;  1HXI A;  2BDE A;  3CVQ A;  3SGH A;  2OV8 A;  4O4H E;  4NUR A;  5DQW A;  3RO2 A;  1N54 A;  3AS8 A;  2Q9Q B;  2MTQ A;  1H19 A;  4LER A;  2X67 A;  4WNE A;  2E9X D;  3QNK A;  3CVW A;  4XBF B;  2C0S A;  3ZMV B;  2GGF A;  4ILH B;  3C50 A;  2ZMA A;  1BR1 A;  3VU7 H;  4N2Q A;  3ZCI A;  1KT1 A;  3SRZ A;  3LBX B;  3ZMT B;  3PE3 A;  4JXT A;  3ZJ1 A;  3ESL A;  1Z3Y A;  3CQG B;  1EYH A;  4BSX A;  2XUE A;  2VSX E;  2IC9 A;  3HKB E;  4GYO A;  3N9M A;  4D10 C;  3EHM A;  2HPL A;  3G2U A;  3CHM A;  2L9Q A;  3HKE E;  4TN7 B;  1ZKE A;  4L2Y A;  2CXL A;  3RC3 A;  2NXP A;  3ASG A;  2PJQ A;  1IZN B;  4MLK A;  2JLB A;  4YVO A;  4L5G A;  4HXI A;  3QWV A;  4YFS A;  4IHJ E;  4JA7 A;  5JR9 B;  4PAG A;  3DJB A;  3FWV A;  2V8S E;  1UJK A;  5ARF A;  3DTO A;  4PS3 A;  4ZI3 D;  3APF A;  4GA1 A;  2HR2 A;  4L2L A;  3AA0 B;  2CCQ A;  3PNL B;  3CVP A;  4DVD A;  3CVN A;  3IEE A;  2NW7 A;  4JLE A;  4L23 A;  1IAP A;  1FMW A;  3SF4 A;  3FU0 A;  4XZC A;  4H63 V;  5JH7 E;  4FA6 A;  1OXZ A;  1WR6 A;  3ANW B;  4I1O B;  4HOR A;  4PUC A;  2QY7 A;  5JDN A;  1OWN A;  2WQ7 A;  4HOU A;  1AJ3 A;  3L08 A;  4PFP A;  4UV8 B;  5LX8 A;  2PBI A;  2FEZ A;  3UX4 A;  2LNI A;  1FEW A;  2E2E A;  5JJ6 A;  1MMD A;  2FI7 A;  2HH7 A;  3TKL B;  3U3I A;  3ASD A;  4WW0 A;  3CX7 B;  3FUM A;  3Q47 B;  1P5Q A;  1HS7 A;  4E6H A;  2JJ9 A;  1MIV A;  2C5I T;  3ONX A;  4I17 A;  4DK5 A;  3FEY A;  3MEK A;  2LSJ A;  4CDN A;  4U8H A;  4IE4 A;  3ZMS B;  3OXF A;  4XKB A;  1KT0 A;  5H6R B;  3AU5 A;  4PW8 A;  5FY1 A;  3SS1 A;  2G0U A;  4C90 A;  2X38 A;  2WXI A;  4I9E A;  4PS8 A;  5L3B B;  3R9A B;  4ASK A;  4N3A A;  4QXB B;  4ADZ A;  2K48 A;  4DBR A;  3LG7 A;  4CXW A;  4G25 A;  2WVI A;  3D9P A;  3S4U A;  2KCV A;  4G1T A;  1E8Z A;  3O9X A;  4G63 A;  4AKH A;  3N2G E;  2IOL A;  4N39 A;  3I0Q A;  2LHN A;  3APD A;  3ZVV A;  2CWO A;  2R59 A;  2N9D A;  3ONK A;  3ZGQ A;  5HWX A;  3I5P A;  2KT9 A;  1MIY A;  3PH0 C;  5L3D B;  4YVQ C;  2UY1 A;  1HTJ F;  4UWG A;  3UT4 A;  5EX3 A;  1WRD A;  4GA0 A;  3KFW X;  4JEU A;  2JPF A;  3FTX A;  3RU0 A;  3EDU A;  4F53 A;  3KIN B;  3ZXS A;  3CGH A;  2DLR A;  3O1I A;  4O4J E;  2V4L A;  4Q96 A;  1SZ9 A;  4I43 A;  3I4G A;  2AVP A;  2UXX B;  3S7F A;  4GYW A;  3NZS A;  5G2N A;  3RKO A;  2KCL A;  4FHK A;  2H3R A;  1OWA A;  1OWM A;  3APC A;  4WNF A;  2CG2 A;  1ZHC A;  2GRM A;  4F1S A;  4AEZ C;  3SBS A;  4O4I E;  2Y4T A;  3SWH A;  1QZ2 A;  5HAX A;  3F2E A;  3HKC E;  3BEE A;  2J09 A;  3QC9 A;  3AS4 A;  4N5C A;  2E9X A;  2IC6 A;  3RRU A;  2CLY C;  3I4R B;  3TXM A;  3ZLI A;  3FBZ A;  2XPI A;  3O1H A;  4HE8 A;  4TUU A;  2ZU6 B;  3FEX A;  1YW0 A;  5LNK A;  5JDL A;  4IN3 B;  1D0Y A;  4FJZ A;  3CVV A;  4MBQ A;  4UWK A;  5HXE A;  4TV9 E;  2NWB A;  3AA7 B;  2CWY A;  4CRW A;  4CXX A;  4ZI2 C;  3ZPO A;  4PK4 A;  2HM8 A;  4E85 A;  5ETW A;  3CK9 A;  3L17 A;  2SPC A;  3QB2 A;  5C8Y E;  2LO6 A;  2K24 A;  4KZC A;  4EPZ A;  5LOV E;  4GZ5 A;  2DI4 A;  2WXM A;  3I1A A;  3UUX A;  3KV4 A;  3T8M A;  1MQS A;  1LVF A;  3K9I A;  1U5P A;  4K0R A;  2YIN A;  4U0Z A;  5LHI B;  1PY1 A;  4UIG A;  3PRZ A;  4FUL A;  4NUU A;  5KDM C;  2MOZ A;  5AYW D;  3UFE A;  5JDM A;  4OVV A;  4LCT A;  3R7R A;  4EZH A;  3D9N A;  4ZS3 A;  3RYH E;  3FU3 A;  4BA9 A;  3B13 A;  4PH4 B;  4U04 A;  4FJO A;  2YU1 A;  3O4Z A;  3I3N A;  2DCP A;  3P8C D;  3CQX C;  2Z6E A;  4P09 A;  4NUV A;  3FTW A;  5JVD E;  4OFZ A;  4F7A A;  4TZ4 C;  2FF4 A;  3N9L A;  4B8A A;  4WBO A;  5IHY A;  3FUL A;  4EB6 E;  2WMO A;  4GK0 E;  2CXF A;  2FO7 A;  4B94 A;  3LEW A;  4UI9 C;  5FTP A;  2C0M A;  3CQC B;  2XHE A;  4AY6 A;  3KBU A;  2FUL A;  3CHQ A;  2J4B A;  3TG4 A;  2MOW A;  4A1S A;  3AVS A;  3CK8 A;  5C1D A;  3C4Z A;  3L13 A;  4KZ0 A;  5F3J A;  4DI4 A;  3MKD A;  2PG8 A;  4XE0 A;  3PNT B;  2PFV A;  3ZCJ A;  4N3B A;  3WAJ A;  1G73 A;  1Y64 B;  5DBK A;  1A17 A;  2WXN A;  4JHJ A;  4JL0 A;  4IE6 A;  4CQI A;  5EK2 A;  3GA8 A;  3PUS A;  3ZN0 B;  2VKH A;  4M3O A;  3MV3 B;  2FBN A;  3WXX A;  1US7 B;  3EDV A;  3CX6 B;  5HXH A;  3ESK A;  1HZ4 A;  4HVB A;  4ZI2 D;  4UWH A;  3RYC E;  4F3V A;  2VB6 A;  4QHO A;  4CI1 B;  3ZYK A;  3HA4 A;  3W15 B;  4HKA A;  3ZYL A;  5LXT E;  4WUY A;  5A23 A;  3PTR B;  4C91 A;  4NRH B;  2OA5 A;  5GON E;  4WBN E;  2P58 C;  4KVM A;  5E76 A;  1PAQ A;  4H9P C;  4TRQ A;  3HI2 A;  3FUI A;  2VGY A;  5HI7 A;  4DI3 A;  1Y6I A;  2JMK A;  3IHY A;  3PZD A;  2X6J A;  3LDZ A;  2Y48 B;  3CX8 B;  5DIZ A;  5G55 A;  1MHQ A;  5C2Y A;  4Y6C A;  2XAJ B;  1L5J A;  3PEV B;  3BQI A;  3ZMU B;  4BAY B;  2I59 A;  3ZN3 A;  1MMN A;  4C0M A;  3L54 A;  2WXF A;  2NC9 A;  5FWQ A;  5AJL A;  5LP0 A;  1HFA A;  5L3G B;  2WMN A;  3EIJ A;  2KND A;  5KJL A;  4PJJ A;  2WM9 A;  3RRW A;  4EBA G;  4QWN B;  4ACL A;  4CI3 B;  3BK9 A;  4HS2 A;  4IUL A;  1IJ6 A;  3V5U A;  4GA2 A;  5JRC A;  1E8X A;  2YEV C;  3I9Y A;  4MLP A;  5BW8 C;  2W0G A;  1YKE B;  4EXT A;  4OVU A;  2IW5 B;  4HLE A;  3L3P A;  4YLH A;  2CHW A;  4H7Y A;  5FXW A;  3CHO A;  4O8S A;  3EHN A;  5LCW C;  3FXD B;  4YND A;  1PC2 A;  4H9Q C;  5HQ8 A;  4HEA A;  2UXN B;  3ZC1 A;  3B7T A;  4NQ0 A;  2V7M A;  4X1I E;  2J9Q A;  4DPR A;  1YD8 G;  3ML9 A;  5JHB A;  2Q9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...