3CQGB

Nucleoporin nup107/nup133 interaction complex, delta finger mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
184
Chain Sequence
LSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDENINDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADFEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear pore complex protein Nup107
publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 59
structure length 184
sequence length 222
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqgB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqgB02
3I4RB 3CQGB 3CQCB
chains in the Genus database with same CATH superfamily
4A97A 5JR9B 4APFA 2XRYA 3ISMC 4WWPA 2HE0A 3ZMZB 3P4RA 2F8YA 2HPLA 2W63A 4WWOA 4HQDA 2UY1B 3IHRA 4ZS3A 2J8SD 4IE4A 4EZ4A 3PZ2A 4O4JE 5G05J 5JDHA 3DSXA 4H7XA 2ZM6T 3P4QA 4I1AA 4DX1A 2MHKA 2XRZA 5KJNA 5FXVA 4EYYR 3Q5XA 3D9PA 2PNNA 1Z5SC 4P0AA 5KCMA 2LUHA 5AQNB 3CX7B 4A98A 5AYWD 1MX2A 3HDXA 2CWOA 3ZT6A 4FJYA 3E4BA 3Q7AA 2VQFT 3FTYA 4B3MT 1IQRA 3UKUG 4HRMB 2LAIA 4N39A 3CWZB 4H7YA 3N9QA 4AV7A 5LG4A 2DNXA 3ETVA 2RG8A 2RPAA 1N32T 4CXYA 4GAAA 4LMLA 2JABA 3JXJA 1EF1C 2V6XA 2YDRA 5HWYA 1B7TA 3UUXB 1GW6A 3QUJA 3TWTA 1X81A 5EIDA 4EBAA 2X9XA 1OCCE 3AEEA 3ZN3A 1DCEA 3C4ZA 5ABGA 3L9TA 3RK6A 4ACKA 3DEOA 3U9WA 3ZT5A 3QK6A 4JA7A 3KSLA 1WYCA 2L6JA 3T9KA 2VASA 2XS1A 3N2GE 5F3JA 3U64A 5BXUA 4GMRA 4WNDA 2LOSA 1JCSA 4AIUA 3P4WA 5LGTB 4G8LA 4IIJE 2EQXA 3VKHA 4Z90A 4U8VD 3O4ZA 4I2WA 3SY2A 4UI9J 4N5CA 2WQHA 1Y8MA 5BR8T 5CBOA 3EJNA 2CLYC 1KLXA 1HF8A 4G2AA 4O4HE 1N4PA 3B7SA 3UT8A 2AE9A 2LKGA 1IQUA 2WCAA 4ATZD 1JCRA 3NF1A 3AB3B 2NTXA 2I6HA 3ESLA 4I9CA 5ENQD 3AAIA 4HORA 2F0YA 2X9YA 3L3PA 5C2YA 4LF7T 4NRHB 2JJ9A 4EHMA 1KZOA 2H6GA 4IULA 2LSUA 3B7TA 1W3BA 3QNKA 2VKJA 5CEAA 3N9OA 1WYBA 5LP0A 4CZ2D 3SFEA 5M72A 3G2SA 4U96D 2WWUA 3VHLA 3G2WA 1S35A 3B5MA 5A23A 2CM0A 4OK0A 3FU5A 1TN6A 2ES0A 4BSXA 3T1HT 4LF8T 4I17A 4UI9K 4YSYA 4NURA 3ZN1B 4MBQA 5LHGB 2Y1LE 1ZEEA 2UWJG 2KZTB 4U0ZA 4XKBA 2F4VT 2GRPB 4GTRA 2LKHA 1TYQG 3RC3A 4C90A 5FP3A 4X20E 2QA7A 3T8OA 3I9YA 3OXGA 1P5QA 3F6QA 4AP2A 3PUWF 3KVBA 1Z3YA 3LSVA 1CUNA 3SOLA 3D9NA 5L47A 5J0ZA 2FEZA 1EPUA 5BMVE 2YKSA 3Q7FA 1KNRA 2XJ7A 1U5PA 3SS1A 2GGFA 3F31A 3HXBA 3V5SA 2OVFA 4I55E 4XX5A 2IO3C 4NPPA 1D1AA 1TNYA 4DV4T 5AJDA 2JQQA 3ZPJA 4IE7A 4DMWA 2XQ8A 4HEAA 3MZLB 3TLSA 4X5TA 4L9IA 4K03A 4CN6A 3NQPA 3C98A 4AXHA 4HWDA 5ABFA 5G55A 4X8QA 5FQ4A 2FBWA 3TWSA 2XUEA 4BSZB 3DXKG 5FWQA 2XZDG 4B93B 1BI7B 4HTEA 3ZFWA 3VTXA 4JI6T 2M67A 2L8KA 4X1KE 1D0XA 2WXLA 2A9UA 2V8SV 3NWIA 1NZNA 4FJZA 3CVYA 1HO8A 3VKGA 3D9IA 4OVUA 4ZHQE 5LJNA 3MKQA 4CXXA 2IO2C 2CWYA 1N94A 4AQYT 2NW8A 4HFHA 4ASKA 3I3NA 4ADZA 5JR9C 3AXJA 1Y64B 3UINC 4CI2B 2BS4A 2RD0A 4Z8XA 3RGLA 4ERRA 3KBUA 2P9LG 1VDYA 1N54A 3TG5A 3LK3B 4GIWA 3EDTB 1UK5A 2D9DA 4DBRA 1E8XA 1FT2A 5FINA 3PEUB 3PNLB 3MACA 1US7B 3GZ1A 3CHRA 4UQZA 4DR2T 3HKCE 4FADA 2BS3A 1V54E 3C4XA 2C0SA 3RRMB 3AEDA 4JA9A 4N2QA 2J07A 3UT7A 1SA0E 2Y3AA 3HXFA 2WB5A 2WDRA 3TL5A 3VLDA 3RO2A 5LCWJ 3UTKA 2WU2A 3SWHA 1FMVA 2LLYA 3AVRA 5FVKA 3MA5A 3J5PA 5EYLA 1SUMB 2LEHA 2JQKA 5FNVE 3FUIA 3PVLA 4FHKA 4TN7B 3CQXC 3LKUA 4JZYA 4GTVA 1LVFA 5JTGA 1DC2A 3Q9UC 3DPYA 5L3FB 4AOFA 3UUNA 2MRIA 3PZDA 3FXDB 2P9BA 3NRXA 2XQ0A 1NA0A 3ZHEB 5JVDE 4EZHA 3MCXA 3NZPA 3CQGB 2OEVA 2XQ5A 2ILRA 2CFZA 1XDOA 4GYWA 4JHRA 1MNDA 3HXEA 2JMKA 1N34T 2VYIA 2BKPA 4E7SA 3TWUA 1RW2A 3Q15A 5JHAA 4HFBA 4DVDA 2XASB 4KHPT 2FF4A 5HXSA 4Q94A 2AVPA 3L08A 4HFCA 4I43B 5DJQC 3LS8A 3IHYA 3G2TA 2C0LA 4B94A 5ADXL 4KHZF 3PRZA 5JJ7A 1SA5A 3DSSA 1ZOYA 5ABFB 1N9AA 2Y0BG 4YSXA 4QH4A 1KNPA 2NR4A 4FC8A 4F6RD 1TNZA 3QC1A 2P9PG 3CK8A 2HN2A 3AA1B 2XQ3A 2VVNA 4MKTA 1H19A 4IL4A 1FJGT 2DWKA 3G06A 4O1OA 4MALA 2CXFA 5AAOA 1W9RA 2BKOA 5AQTB 4AQFC 4F53A 4LFAT 5BNWA 4EXTA 2UUBT 1WAO1 3EHQA 1D0ZA 2XSAA 4YT0A 3B95A 2CE7A 4XAXB 4D10C 5F8PA 1VRBA 3D9HA 1MMGA 3ULQA 2JPFA 4HOSA 4PK5A 3HVEA 4UF0B 1HX8A 4CGWA 3AXJB 1PY1A 1VCTA 4UQYA 2WXKA 2B6CA 1YYHA 5LA6E 3CV0A 4C0MA 2CXDA 2C0MA 1SZAA 1Z8UA 3LK42 5L3GB 3TXMA 5AQJB 1UN8A 3CLJA 4UVBB 5HXEA 1KF6A 2OEWA 2YEVC 4KZCA 1WFDA 3ONXA 1HR0T 3AG2E 2PJQA 4G8KA 2WXPA 1LD7A 3OBVE 4PS3A 3LDQB 1FVHA 3TKLB 4JW1A 3ZCJA 3FBLA 4ZHBA 3IXEA 2GRMA 2QYWA 1V55E 2WAUA 4HFEA 3BQIA 2I1KA 4TXPA 3CSFA 3ZPOA 2PG8A 4PS8A 4GOUA 2I59A 3AS8A 1N52A 4K5BA 5CBNA 4LSZE 3PTRB 4U3CA 3UXGA 4HLEA 4RG9A 2LSYA 4GZCA 4QFVA 5A6CA 1VOMA 5L3CB 3FZMB 3VR8A 4EQFA 4H63H 3RI5A 2KCLA 2ACXA 2Y6XA 3PUGA 1OWOA 3ZC1A 4AKGA 2WMNA 2VSOE 3JAEA 1SZ9A 3QKYA 5HS0A 2LXMA 1D8DA 4DV5T 4TZ4C 2VQ2A 4U2ZA 5IWAT 4G23A 4EBAG 3N9MA 5AQBA 2KBXA 3QB5A 1HZ4A 1HCIA 4YTPA 2HH7A 4IE6A 2R59A 4JB8P 2AXVA 4U7EB 1RZ4A 2LJLA 5CHEE 4BEPA 2LHNA 2AXZA 1E96B 3J9X1 4KZ0A 4C9BB 2BF0X 3HKBE 5G2NA 4C0EA 2N9DA 2HPJA 5HYAA 3UFEA 3LY9A 3APDA 3D9KA 3S2AA 3BG1B 4HVBA 3L13A 3L17A 3LPZA 3ZGQA 3LK2B 1MJ0A 4KVMA 4Z91A 2Y4TA 4R7LA 1VCSA 5AFUL 4TUYE 2XQYA 3LEWA 3VR9A 3L6AA 3QWPA 5FJYA 4DV1T 4EZKA 3HYMB 2CEAA 2JRKA 3PJAA 4ISSA 1SA4A 1G73A 3UKRG 5CEDB 1T7SA 4JI1T 2GW1A 3ZC0A 2YOEA 4YJ2E 5AQSB 2XENA 2CHNA 3ML9A 3ZYLA 3FFLA 3ONKA 5AQAA 4PH4B 2GRLA 3R7RA 3UI2A 4UQXA 5ENRD 2CXLA 5KMGP 5G05C 3SD5A 3SFDA 3L22A 4RG6A 2C5KT 4P1NA 2CHZA 2IEJA 5D66A 2FJEA 4J8DA 5HEGA 3UUMA 3RRUA 4U7YA 2J4DA 5JR9A 4LRZA 5L3EB 3QC9A 2UXCT 1IXVA 3UUBA 3ZRHA 3QWVA 1U4QA 1QZ2A 2DCPA 4K5CA 4OYSA 3HRAA 4FU3A 4WWNA 3JC6D 3D9OA 1NI1A 4OHFA 5J2UE 3E32A 4WBOA 4BESA 3FUHA 2IC9A 1ZV4X 3J5QB 4I1MA 1ZU2A 4DV7T 3CVVA 3ZXPA 3Q73A 3MEKA 3CKBA 4TUUA 2UXBT 3MV3B 4EV6A 3BQOA 4YDEA 5CERB 4DPRA 5FTPA 5HEHA 4CI1B 4G63A 2J4BA 4GA1A 4PS7A 3C3QA 3UTMA 5FQ7A 4KX6A 4AISA 2UXXB 4XKCA 4BTAA 3CKDA 4C48B 3L8RA 4HRLA 3AEGA 4F7AA 5CA1E 3HG0D 4TUMA 5HI7A 3UUXA 1M7KA 3TAXA 2P9IG 1HX1B 4UI9C 2N1GA 3ZEFB 2K9AA 3HR0A 2HN1A 4FI5A 2XM2A 4QH5A 1BLXB 2LAHA 3PZ4A 3ASFA 4W9RA 3EUVA 5A7DB 1GQEA 1FT1A 1K3ZD 4AXPA 5FY1A 1NFIE 1ZB1A 1X5BA 5EX0A 3RIAA 5JDLA 3AA0B 4PJNA 4AEZC 5LB7B 3PUQA 5FXXA 2M6BA 4UELA 3FTUA 4M1PA 4DR3T 2GK9A 2PZIA 5BXOA 1Z0PA 3V31A 3E33A 2LSJA 2CG2A 2VSXE 3SRZA 2J4GA 4KBMB 1H6PA 4CN4A 2E5VA 1XDPA 3LG7A 1QQEA 3N9PA 2GRQB 1WY6A 3KDSE 1JWGA 3CVLA 2KM4A 2XQ9A 4ZI3C 4DI3A 2KWIB 3RRWA 3UU6A 2M63A 4A5XA 4ILCA 1LTXA 3NBNB 3CVWA 2EIME 1ZHCA 3JC6C 4NXNT 1IJ5A 3O1IA 3O1HA 2X6HA 3P50A 1IBKT 4GZ6A 3LJCA 4AQFA 5FMNA 2A2FX 2V7KA 3NB2A 1OWMA 3PE4A 5LHIB 3ANWB 1L5JA 2Y8DA 2DCFA 2NOXA 4Y6CA 1AP7A 4HLLA 2BBHA 4GTQA 5HEOA 4DI4A 4GK0E 1ELRA 2YNQA 4KXKB 4M7CA 2WS3A 3BQKA 4PFPA 2WXNA 2QVAA 4GZ5A 3KV9A 1V9DA 2KZTA 3NOCD 4ANUA 2KNDA 2X9WA 4I1OB 4QHOA 4HS2A 3WAKA 5LP6E 5D0QD 4ZI2D 1E7VA 1W0AA 5D0OD 3SNXA 1OCZE 3BG0B 4H9NC 2Y69E 3UM1A 4F1SA 4EPZA 1SW6A 2RKKA 3PUKA 3O4XE 3SFXA 3FU0A 3LY7A 2RFAA 2GRNB 2NTYA 3SBTB 3JAFA 1BR2A 3UQ3A 5FYMA 3K9IA 3AEAA 3NKZA 2DVWA 5FL0A 3MXZA 3J7Yq 5JDMA 3RYFE 3LCAA 3PUVF 4B89A 2FJBA 2ZM8A 4JI5T 3NZQA 4ILGA 4TNWA 4K0UA 2EILE 3JUIA 4HBDA 3V30A 5KDMC 3CIAA 2B76A 1J5WA 5FZSA 3I0OA 3Q47B 1N11A 1WDYA 5ANRA 5FY7A 2J08A 4DX2A 2QGSA 3JUEA 4E85A 1N4RA 2HHHT 1SE7A 3GZ2A 4N78D 4YVOA 4QQIA 4A63B 1UJJA 2JIWA 3RHWA 1FEWA 3ONLC 2IIUA 1WM5A 4YVQC 3PS6A 4AVXA 2DLRA 4HI9A 1UOHA 5LJMA 3UIOC 1G8XA 3P8CD 3DBSA 2A5EA 5C8YE 3D9MA 4K5AB 4BX8A 4I4TE 2WPVA 4GZDA 1E2AA 3P4PA 4BX9A 1OY3D 4RSYA 3CMLA 4HGAA 3V2XA 1FVFA 5HXRA 4YHHT 3ESKA 3OJAA 5IHYA 1HS6A 4B3RT 4MS6A 3BQLA 3RKOA 2EIJE 3QK0A 4B3ST 2WBLA 3APFA 4BJNA 1PAQA 4IGUA 4LNBA 2IUBA 3A7MA 2NW9A 4ZI2C 1S64A 1YA0A 3FULA 2I0MA 1H6OA 3K3NA 3PU8A 3DSWA 1IAPA 1UX4A 4DMVA 4IDOA 1BU9A 5DQVA 4U2YA 5ARGA 3DSUA 2XQ4A 2F37A 2ZMAA 3WXXA 2K5BB 2NP9A 2KT9A 2J1DG 3LY8A 1E1HB 5ITZF 3FXEB 3IBEA 5EIBE 2BVMA 3DTOA 4AQGA 2D0TA 4N3AA 4PK6A 3D9JA 2Q9QB 3ZHEA 4B0ZA 3EU5A 3TJPA 4M3OA 1W0BA 2C5IT 4JBWF 4HFVA 4GK5E 2ZIRA 2X6JA 2DL1A 4DK5A 3VLEA 4O4LE 3ZNGA 4F8HA 2ZM2A 2XAHB 2ZISA 5KNGA 2Q7FA 5KJKA 2CCQA 2CPTA 3PU3A 4UWLA 3QOUA 2J09A 1D9SA 4I43A 3FH8A 3K1SA 3AU4A 3B7UX 4O8SA 1PC2A 3DPDA 5E75A 5ENOD 2WB2A 2PFVA 1EZ3A 3B7RL 3FDHA 2EIKE 4AKRB 4AIFA 4TV9E 4GMLA 4LF4T 3UPVA 3OXFA 3R9MA 5ENNA 5AQGB 5CFBA 1Z3XA 3KEZA 4H9QC 2WQYA 4IDPA 4Q96A 4NIQA 3QB2A 4LNGA 5CCMA 4HOQA 3ABVA 3DSVA 3KSQA 1X79A 2CRBA 5IY5E 4TV3A 4LNUD 1NA3A 2VTBA 3AS4A 3AE9A 2XQ6A 2IU1A 4UF0A 4PK4A 4E6HA 3AE6A 1MX4A 3AEFA 2R02A 5CCLA 1J5ET 1FIOA 5LXTE 4YDOA 2IAKA 3SI5A 1IZNB 2A72A 3NRYA 1MQSA 1TJCA 3AECA 2IF4A 4OAVB 2XGMA 2XGOA 4U95D 4GU5A 2XAJB 4RVBA 4LFCT 3CVPA 5H6RB 3CVNA 2X6KA 2V4HC 3JADA 2C2LA 4QX7B 3FTWA 4U72A 5EZYE 3RSEG 2AXDS 4QWNB 4H9SE 3I1AA 2H7OA 2NXPA 5M4YA 3AA7B 4GA2A 2DHRA 2X6FA 3N9NA 2X66A 5JQGE 4FLHA 1ELWA 1Y6IA 2VGXB 3R7QA 1XNRT 1ZKEA 2LE8A 1YQ3A 1IKND 4L23A 3EUHA 3WG7E 2BVLA 4XEIG 3ZUVB 4UR9A 4I50E 2QYJA 2VWAA 3HKDE 3ZYKA 3OYZA 3QDNA 2IQCA 5AJLA 3RYCE 5BW8C 3CVRA 4OYJA 5KXJA 4L7TA 5AQOB 4UVAB 4LG6A 3L82A 2A5UA 2ZGGA 4A1SA 3C50A 5KNHD 1YD8G 3FUNA 4J8EA 1S70B 3ULYA 3FUMA 2DWZA 2LHRA 1OWNA 3C51A 3APCA 5JMND 2YN6A 2QY7A 3P1UA 4MHCA 4OX9T 4IREA 4QKNA 3T1YT 3R9AB 4ILAA 4I9EA 2R17C 4J6IA 1DCQA 1KZPA 2XPKA 4MRUA 2JEKA 2OLTA 2LM2A 1UW4B 3FY4A 3WAJA 1OWAA 2AXUA 3GN5B 5AQMB 5EK4A 3FTVA 3AG1E 4Q69A 1OXZA 3O48A 5AQUB 1O1SA 4WZXA 4O2BE 4LF9T 3N71A 2ZXWE 2KZ7B 2FJDA 2IHR1 4TNVA 5J1GA 4WW0A 5JHBA 1U3CA 2XQ7A 3CPZA 3S4UA 5KBAA 2FUPA 1A17A 3IEGA 5J2TE 2ETBA 2KWHA 2UXNB 3FEYA 4IN3B 4XIFA 1TEZA 3EVYA 4O60A 4V3IA 4OAUC 2E8IA 2EHOB 4JEUB 1HNZT 3FH7A 2VKHA 2V7IA 3ZSTA 2VTBB 5KJMA 2LXLA 2BG9B 4PAGA 2PM6A 2XSBA 2FBNA 4EYUA 5T4YA 1OCOE 3AE8A 4PJMA 3VRAA 3FZLB 3AE4A 4YLHA 4UEMA 5KWDA 2XAGB 3NAWA 3CKCA 3NOGD 5EKQD 2RP4A 2R6GF 3ONLA 4WAFA 3OTNA 1H2TC 5IYZE 3ZW3A 4CQIA 5JDGA 2I9CA 4HKAA 4GYOA 5HAXA 2R2LA 3RC8A 5EDSA 2Q9QC 1TNOA 2L9BA 2SPCA 4X62T 3EHZA 3UX4A 2WXOA 2L0IA 2M6IA 2WXHA 4BAYB 1MIYA 3R84B 4TWHA 4DR6T 3EI0A 4JUYA 5EILA 1IYGA 3FUEA 1UN9A 3BU8A 4CDRA 5AQKB 2WXIA 3FUJA 3ZYQA 2WWVA 4U8HA 3PUSA 4JC8A 5HCMA 2PBIA 1HH8A 2YHCA 3CHSA 1YKHB 4DV3T 2WVIA 2LO6A 4HOTA 4HWHA 2KXPB 4X65T 2XZEA 4LMJA 3KV6A 2R5SA 4BT8A 1LF8A 5D2MC 2D5UA 2PQNA 3CK9A 4ZFHA 1JPLA 1XNQT 1BI8B 4IDQA 3G2UA 4HWIB 3VRBA 3EHMA 4GTOA 3ASGA 2C5JA 3S7JA 3MKRA 5EK3A 2KCKA 3RAUA 4QXHB 3WI3A 1KK7A 1Q2ZA 1BR0A 5FZQA 4MLKA 4J2CA 3RQUA 4JLEA 4UXNB 2LNIA 2J9QA 3ZEFA 4BETA 2WQ6A 4J0UA 4DUYT 2D2SA 3B7BA 1WCRA 3HXDA 1NP7A 3U78A 2PL2A 5FXWA 4J7WA 4OFZA 3CR3A 3RLFF 2BKKB 3AG4E 4G1TA 4GPMA 3EHNA 5LBMA 3SFYA 4DUIA 1E8WA 1R8IA 4IRUA 5LOZA 3X2QE 2W66A 3K8PC 4DO0A 1LKXA 3A5XA 2MYOA 1FPPA 3FU3A 4YHJA 1K8KG 1EDUA 4BA9A 5BUZA 2L3LA 3AE2A 3KVAA 4ANVA 3ZXSA 4TXRA 5FQ8A 3A8YC 2CHOA 3PUZF 5JRCB 2CHXA 2EHOD 1FMWA 2HYZA 4ILUA 1SQMA 2J49A 2LSVA 3SHFA 1TJFA 1MYOA 4X1IE 4WBNE 3C3OA 2DI4A 4GPKA 1E8ZA 3RIUC 4JL0A 5LMUT 2I2OA 4LFBT 4YJ3E 5EYPF 1E8YA 4E7ZA 1T8BA 4H9PC 2Z6EA 3TWVA 1MX6A 3FTSA 4U63A 3DWLG 5JA4D 5F5WA 2JMHA 3ANWA 5FZRA 5BV0A 3MYVA 5L4EA 2D0UA 4K0KT 3Q4AB 3RIBA 3JQ0A 2OVBA 2WQ7A 1L0VA 2BG9E 3IEEA 2E9XB 1H2UA 1ZBPA 4A3VA 1LRZA 5DIZA 4DLQA 4PNIA 2BEDA 3JYSA 4ZI3D 3I9WA 4X66T 2CFUA 3PREA 3EIQC 2LSGA 2HO1A 1E7PA 1TNUA 1TR4A 3OTOT 2QRXA 2V6YB 1IBMT 4DX5D 4TXQA 3RPUA 2DBAA 3RQWA 2H6FA 5AQ9A 5AQQB 1B89A 2VGEA 1DVPA 2VURA 3FUFA 3CHMA 2LRKA 4K0RA 3OXLA 3RH3A 1HG5A 4ZZCA 4CT4A 2NC9A 3S7FA 2DWGA 2J47A 2QZAA 1BD8A 3UM3A 1J1JA 1EYHA 3FH5A 3TWXA 4BFRA 3PZ3A 3UQ7A 1XMQT 3CHQA 4AY6A 4J8FA 1M62A 3Q2MA 2E2EA 2XCCA 3AAEB 2EHOC 2CBJA 2W0GA 1WR6A 1A5EA 4DX6D 5B1BE 2Y48B 3QJZA 1NWMX 5LNKA 2WXJA 2JQHA 4HFIA 2WXMA 3PURA 1HG2A 5JH7E 4BERA 1MNEA 4MFRA 2BG9C 2WM9A 4GB9A 3U4TA 3ABKE 3W9FA 3TLUA 1KT0A 3NBXX 2MAWA 3FZKB 3KEAA 2VB6A 3ZIMA 2R03A 4ZS2A 2XHEB 5AQPB 5CMWA 1I6ZA 1N0QA 2YQ8A 4U31A 3R6NA 4G25A 4ANJA 2DYSE 2H89A 4UV9B 3PUAA 4GKKT 5FXZA 5AQ7A 4O4IE 3N9LA 3X1DA 2CA5A 2XZTG 3EIJA 4EB6E 1W09A 3K3OA 3T8KA 4YSZA 2EINE 1K1AA 4JI3T 3UIPC 2DZOA 4IE0A 1JNRA 3P2BA 3FWVA 2E2AA 5H6QB 4AKIA 4PDXA 5B3SE 1UX5A 2YU1A 4L2YA 4BY6A 4CEMA 3UQ4A 1UJKA 3RU0A 1H2VC 3PUJA 4G24A 4JI4T 1XGWA 3L16A 5LG3A 5HEJA 4ILBA 1OWLA 2KXPC 3ML8A 2L6BA 2XPZA 3JCKC 2YHEA 3OAWA 4GTPA 4PW8A 5AQFB 2XQAA 4EGWA 2OV9A 4HB5A 1TN8A 2ODVA 1XNFA 3AS5A 2E0IA 3LJNA 4QH1A 1LD8A 2WXQA 2XEVA 2E9XD 4L0RA 4KBQA 3HKEE 2K24A 3FHNA 3ENEA 2WXRA 3ABLE 3UT5E 3ULEG 2VJ8A 3AE7A 5CMYA 3F2EA 2XGSA 4H9RC 1OCRE 2V0PA 3OYXA 3RIFA 2LRLA 2KSRA 4ZI7E 4LF5T 2V4LA 2Q9QA 4QXCB 3ZCIA 2XPIA 1OEDC 1BPOA 3C72A 2BUGA 4TRQA 5FVLA 3RF1A 3TLWA 3K3QC 4KMOA 4B3TT 5L2LA 2DZNA 4J8SA 1S0PA 1O5MA 3ZN0B 4JEHA 5LOVE 4BT9A 2YDQA 5HXCA 2BDEA 3E37A 3CHPA 2ODUA 4I6GA 4AJWA 3KV4A 5FKYA 3LBXB 4EIWA 3GYZA 1TNBA 2X3MA 3FTXA 4NACA 2OV8A 4GTMA 3MX3A 3W15B 3ZYMA 3HA4A 1IJ6A 4A56A 3L09A 3FEXA 4BJMA 4DR4T 5HCJA 2LT3A 4WYVA 3PEVB 1MHQA 4LEUA 3FHEA 4NXMT 2UXDT 4YNDA 4O1PA 4UV8B 4O2AE 5KX5E 3LFMA 1QLBA 2OOEA 5HKPA 5JJTA 3LDZA 3Q78A 3O9XA 1N36T 5BPPA 3RO3A 5E76A 1K1BA 2X67A 1YQ4A 2XY8B 3HIZA 4DIDB 4ZEYA 1X9BA 4HN9A 2JQ9A 4G2VA 2E9XC 2A3DA 4IDNA 4ZZBA 3Q5MA 2N2NA 2R05A 4L9PA 3CQCB 5LYJE 2V5DA 1DNPA 3ZVVA 3LJ3A 5LCWC 1N0RA 3CSTA 5AENA 4QXBB 3SO8A 3VTYA 3V2OA 4U07A 1YW0A 2IMLA 2KC7A 3KS2A 3TXNA 1HE8A 3ASHA 4HWFA 4IE5A 5CA0E 5AQRB 1JWFA 3V5UA 2IOSA 1UG3A 1HNWT 2IJGX 3KAEA 2MTQA 3I4GA 2W4XA 1Z6TA 3Q9DA 4L2LA 1IBLT 4JI0T 3CVUA 5LMNT 4JYAT 5FY0A 1QNFA 2VGXA 1YXRA 3RIUA 3F57A 1UGOA 1QYMA 3C64A 5FIOA 3OKQA 5AIJA 1G3NB 3FTZA 1ZP0A 1HXIA 4FLBA 5T3RA 2MYSA 4CT0A 2X0HA 4GYSA 4U0SA 2H6IA 2VQET 4GYYA 3FBZA 4CXWA 4GA0A 3AAAB 5LX8A 1NL4A 2QFCA 3DEPA 5IUXA 4U7IA 3CHOA 4EECA 1CHUA 2I1JA 4JVSA 3FB2A 5ARFA 5JDFA 4CZZB 3ASDA 3IKOB 5ENPD 3PH0C 3MGBA 4FHJA 3L54A 4DR5T 4CRWA 5G04J 3UT4A 4TV8E 2V26A 3P4SA 4L5GA 2P2CP 4JEHB 1OWPA 2IFUA 3HL6A 3RX6A 1O1TA 2PQRA 3W9GA 3OPCA 3NZSA 1MZCA 5A1LA 3ZU7B 2G0UA 5CJ5A 3MV2B 3GN5A 3KFWX 2K48A 3JQ1A 4RLYA 2X0YA 3E08A 2XPYA 5HXHA 2WMOA 3Q9NC 4UWGA 1ELKA 1U2VG 3O1JA 2NSZA 4G26A 1BR4A 4ME2A 5LCYA 5ETWA 3VLFA 3PNTB 2JLBA 3UU3A 3AJIA 4GMJA 4CGVA 3ASNE 4TWDA 3N2OA 5CB4E 2P58C 3Q5EA 4EEDA 4AM9A 2BS2A 4DRXE 4IT4A 4X64T 3EDVA 4CCAA 3D3MA 5JJ6A 2VVSA 2EHOA 4JEUA 3QOFA 3RKVA 2XAQB 2XEEA 2V5QC 2OCCE 2VGYA 1UUSA 4N3CA 4U04A 2GROB 1KNZA 2CG3A 2BG9A 3TLVA 4HFGA 4BTBA 1U3DA 4HOUA 5BT1A 3GWHA 4HWCA 2XAFB 2ZGDA 4U33A 4QX8B 4I6JA 2WDQA 5C3JA 3URZA 2FI7A 4JI2T 5HQ8A 4GTTA 1KPSB 5L3BB 3BK9A 4WNKA 1HS7A 3EDUA 1NENA 4KP3C 4A3TA 4C91A 3MKDA 1S94A 2QC9A 3C3RA 3C5RA 2YDSA 4DNDA 5B1AE 1NEKA 3EABA 3ZMTB 1O3XA 2J62A 4HNAD 4FP7A 3S7DA 5BV1A 2XEHA 3TWRA 3GMIA 1SVXA 4ILIA 2LOPA 5ENTD 3IF8B 3CX8B 3PUXF 2YINA 4FULA 3TWQA 2W00A 2XS8A 1JUQA 3B13A 4UWKA 2L9QA 3Q75A 4YY3T 1OUVA 2MBGA 5LHHB 4AY5A 4B8CB 4WNEA 4O6FA 5DQWA 2V5FA 3IA3A 3ZJ1A 2BTDA 4JXTA 1E7UA 5ABHA 2Q9QD 1N33T 3U3IA 2DIWA 3PDNA 2P9UG 3G2VA 2ACZA 4ZXLA 4X1YE 2A4ZA 3V79K 1MIWA 2CHWA 2ONDA 4Y6WA 1QUUA 4JV5T 3E22E 4XBFB 4XZ4A 3AVSA 3LYAA 2YK0A 1OEDA 1IHGA 4YTNA 4N5QA 4LERA 3MJWA 1MMAA 3FZHB 2XM1A 1QSDA 5AN8A 3UU5A 4ANXA 5LGUB 3E0ZA 3NZUA 1H7CA 4U0UA 3CK7A 4EZLA 2WXFA 2KMFA 3UMVA 3PE0A 2VL0A 3AE5A 3UM2A 1HU3A 2KINB 5CGMA 2WU5A 5EK2A 3SBSA 4LF6T 5HWXA 4OVVA 4FJOA 5DABA 5JRCA 3PV0F 4PJJA 1NAFA 2UU9T 3AA6B 1MMDA 4DV0T 2V7JA 4EOZB 3AE3A 3C4WA 3C98B 3IBPA 4B8AA 2W61A 4P29A 2QYUA 1QBQA 3LVQE 3UULA 2X0LB 4DR1T 2AW6A 5FQ6A 3Q5WA 4DUZT 4JHJA 3IHVA 3JXIA 2P9NG 5T8IA 4FA6A 2ETCA 3AAAC 5J08A 1MMNA 3ABME 3N2KE 2WZHA 3I4RB 5C1DA 2E9XA 3MKQB 3DJBA 4IDZA 3PJAJ 4GCNA 4EEBA 3QB5K 2H6HA 2CMRA 4ATGA 3GA8A 1UURA 2AJAA 2V8SE 4DV2T 4JI7T 3ZKJA 3QNUA 5AQLB 3I5PA 3NVOA 2V6YA 3D9LA 4IYPA 4WUYA 3TGOA 4AI6A 4G11A 1YCSB 5LGNB 1XMOT 4J8YA 2KCVA 4L1BA 4CYMD 1E90A 3M65A 2IONA 3N5LA 3DP7A 1S63A 4XI9A 3M3ZB 5DBKA 4OYKA 3LXUX 1INZA 3ZT7A 2ETAA 4KT6B 3CVXA 2IY0C 4DJAA 4F1PA 4AKLA 2MOZA 3SQVA 4ACLA 3IV0A 3HXCA 4N3BA 4DV6T 4GCOA 2X51A 1YKEB 1OT8A 3AE1A 5AQVB 5GONE 4ISTA 3JCFA 3ZMUB 1LVKA 4YTMA 4EAHA 2LSKA 4TX5A 2AWIA 2BKNA 1JCQA 3EU9A 4JPSA 4DX7D 3QARA 1XWMA 2HR2A 4V1Av 3TG4A 3PZ1A 1FCHA 2NW7A 3MA9A 1OEDB 3KINB 2VSYA 3QAQA 2LSIA 4UUCA 5H7PA 4GYRA 2IW5B 3P7IA 5J90A 4P09A 3RYIE 3UFGA 2XHEA 3I0QA 3SZ7A 4NUUA 2VK9A 4F6RC 4ZOLE 4PFOA 3ZLIA 4HI8A 2RFMA 4UVCB 3GZSA 1AWCB 3UM0A 4HE8A 2RA1A 2WDVA 2VKOA 4YXDA 3UU8A 4HRNA 4UWHA 3ZJ2A 3ASOE 2W62A 5ANLA 3SF4A 1D8EA 3CX6B 3U3WA 2W67A 3Q49B 3RRCA 3RRNB 3T8MA 5EN5D 2E5LT 1SHZC 2NYJA 3KBTA 5E0OA 3UU4A 1N4QA 2BBJA 1D0YA 1WLXA 4HXIA 4GTSA 4NQ0A 5HEUA 3H3AA 2NWBA 2FO7A 2WSSV 4U8YD 4HFDA 2LM9A 4CDNA 3CEQA 4EZJA 1BR1A 2IOLA 3FZFB 3Q5DA 4KVOA 3EAMA 3E34A 4AKHA 1WG0A 2V7LA 3DXMG 5AARA 4N2SA 3EHRA 4IL9A 4Z68A 5L3DB 1I94T 5FT9A 4GZ3A 2BZBA 3L39A 2B0OE 3SGHA 4F3VA 2HM8A 5HRYA 2GRRB 4RQIA 5EX3A 2ZM0A 2YU2A 2XTLA 1HFAA 2V7MA 3LVRE 3CVQA 4ANWA 4DLOA 3HVEB 4PUCA 3PDYA 4XZCA 2P9KG 4MLPA 4JI8T 2IC6A 2MPKA 5TAOA 1T98A 2WP9A 1N4SA 4URKA 3MK7C 3HHMA 1KEYA 3TWWA 3ZSSA 3Q79A 3FU6A 4I6EA 2WZIA 4KYOB 3MJXA 4WNFA 2CLYB 1O1RA 1UCUA 4I0UA 4ABNA 3GW4A 1TN7A 1OXJA 2BKGA 2UY1A 4XE0A 1Y01A 4U74A 2CBIA 2V5CA 1JNZA 5L4HA 4KI0F 3DSTA 3CIRA 2H3RA 1HNXT 4CI3B 4CN1A 2OA5A 4KUMB 3LBXA 5ENSD 3H37A 1IHBA 1HTJF 3PE3A 4DR7T 3KD7A 5AQIB 2VKDA 2UUAT 3RJVA 2KATA 2X38A 5CRVA 5KJLA 5JDQA 1WR0A 3FUDA 2WXGA 5C2TA 2VL8A 3U66A 2Y4UA 3T5XA 4NUVA 3ZMSB 3FUKA 4LUNU 1AJ3A 4NIKA 2H88A 1H0AA 5FL1A 1DU2A 1OEDE 3ZKRA 5CRUA 2ZLYA 2DYRE 1YMPA 4UIGA 2K3WA 2KLQA 5LBQB 5JDNA 3AG3E 4H63V 3AEBA 2X68A 3MZKB 3ZMVB 3T5VA 2FULA 5CECB 3RYHE 5JREA 3RKGA 3BUAA 4A1GA 3ETUA 4XI0A 3OVUA 2FJAA 4WNGA 1T72A 3HI2A 2W2UA 5AQHB 2VSNA 3AU5A 5ABEA 4KMCA 3PUYF 3CGHA 3QWWA 3B57A 4PJLA 3S7BA 4GKJT 1D1CA 4YDWA 4P0BA 3BEEA 2X9HA 4APOA 1KFYA 2PM7A 1D1BA 3E30A 3CK6A 4H9OC 5LFAA 4UWFA 4JD2G 3DRAA 3D0TA 4COFA 1XZYA 4LMKA 2IDOB 3KV5A 1WRDA 4B6XA 4DBQA 4JHKA 3TLTA 3VU7H 4TWFA 5G04C 4YDYA 2L0TB 2ZU6B 4YFSA 2P9SG 4BWRA 4Q25A 2UUCT 3FP3A 1MIVA 4IHJE 3H3MA 2V1DB 2XCBA 4LCTA 4CDMA 2X6IA 2F8XK 2FO1E 1H6KA 2WY2A 2MOWA 4A55A 4MBGA 2PTFA 2B1EA 2H7VC 3ONJA 1KT1A 3SFZA 1N95A 4ILHB 4I2ZA
chains in the Genus database with same CATH topology
5JR9B 4APFA 2XRYA 4WWPA 3ZMZB 2HPLA 2W63A 4WWOA 2UY1B 3IHRA 4ZS3A 4IE4A 4EZ4A 4O4JE 5G05J 5JDHA 4H7XA 4I1AA 2XRZA 2MHKA 5KJNA 5FXVA 4EYYR 3Q5XA 3D9PA 5KCMA 4P0AA 3CX7B 5AYWD 3HDXA 2CWOA 4FJYA 3E4BA 3FTYA 1IQRA 2LAIA 4N39A 3CWZB 4H7YA 3N9QA 4AV7A 5LG4A 2DNXA 3ETVA 2RG8A 4CXYA 4GAAA 1EF1C 5HWYA 1B7TA 3UUXB 1GW6A 3QUJA 4EBAA 2X9XA 3ZN3A 3C4ZA 3RK6A 4ACKA 3U9WA 3QK6A 4JA7A 1WYCA 2L6JA 3U64A 2VASA 3N2GE 5F3JA 4WNDA 2LOSA 5LGTB 4IIJE 2EQXA 3VKHA 3O4ZA 4I2WA 4UI9J 4N5CA 2WQHA 1Y8MA 3EJNA 2CLYC 1KLXA 1HF8A 4G2AA 4O4HE 3UT8A 3B7SA 1IQUA 3NF1A 3AB3B 2NTXA 2I6HA 3ESLA 4I9CA 3AAIA 4HORA 2X9YA 3L3PA 5C2YA 4NRHB 2JJ9A 4IULA 2LSUA 3B7TA 1W3BA 3QNKA 2VKJA 3N9OA 1WYBA 5LP0A 5M72A 3G2SA 2WWUA 3VHLA 3G2WA 1S35A 5A23A 2CM0A 4OK0A 3FU5A 2ES0A 4BSXA 4I17A 4UI9K 4NURA 3ZN1B 4MBQA 5LHGB 1ZEEA 2UWJG 2KZTB 4U0ZA 4XKBA 3RC3A 4C90A 5FP3A 4X20E 2QA7A 3T8OA 3I9YA 3OXGA 1P5QA 4AP2A 3KVBA 1Z3YA 1CUNA 3SOLA 3D9NA 2FEZA 1EPUA 5BMVE 1U5PA 3SS1A 2GGFA 3F31A 3V5SA 2OVFA 4I55E 4XX5A 1D1AA 5AJDA 2JQQA 3ZPJA 4IE7A 4DMWA 4HEAA 3MZLB 4L9IA 4K03A 3NQPA 3C98A 4AXHA 5G55A 5FQ4A 2XUEA 5FWQA 4HTEA 3ZFWA 3VTXA 2M67A 2L8KA 4X1KE 1D0XA 2WXLA 1NZNA 4FJZA 3CVYA 1HO8A 3VKGA 3D9IA 4OVUA 4ZHQE 5LJNA 3MKQA 4CXXA 2CWYA 2NW8A 4ASKA 3I3NA 4ADZA 5JR9C 1Y64B 4CI2B 2RD0A 4Z8XA 4ERRA 3KBUA 1VDYA 1N54A 3TG5A 3LK3B 4GIWA 3EDTB 4DBRA 1E8XA 3PEUB 3PNLB 3MACA 1US7B 3GZ1A 3CHRA 4UQZA 3HKCE 4FADA 3C4XA 2C0SA 3RRMB 4JA9A 4N2QA 2J07A 3UT7A 1SA0E 2Y3AA 3TL5A 3VLDA 3RO2A 5LCWJ 3UTKA 3SWHA 1FMVA 3AVRA 3MA5A 2LEHA 5FNVE 3FUIA 3PVLA 4FHKA 4TN7B 3CQXC 3LKUA 4JZYA 1LVFA 5L3FB 4AOFA 3UUNA 2MRIA 3PZDA 3FXDB 2P9BA 3NRXA 2XQ0A 1NA0A 3ZHEB 5JVDE 4EZHA 3MCXA 3NZPA 3CQGB 2ILRA 2CFZA 4GYWA 4JHRA 1MNDA 2JMKA 2VYIA 4E7SA 3Q15A 5JHAA 4DVDA 2XASB 2FF4A 5HXSA 4Q94A 2AVPA 3L08A 4I43B 5DJQC 3LS8A 3IHYA 3G2TA 2C0LA 4B94A 5ADXL 3PRZA 5JJ7A 4FC8A 3QC1A 3CK8A 3AA1B 4MKTA 1H19A 2DWKA 4MALA 2CXFA 4AQFC 4F53A 5BNWA 4EXTA 1WAO1 1D0ZA 2CE7A 4XAXB 4D10C 5F8PA 1VRBA 1MMGA 3ULQA 2JPFA 4HOSA 4PK5A 3HVEA 4UF0B 1HX8A 4CGWA 1PY1A 4UQYA 2WXKA 5LA6E 3CV0A 4C0MA 2CXDA 2C0MA 1SZAA 3LK42 5L3GB 3TXMA 1UN8A 3CLJA 4UVBB 5HXEA 2YEVC 4KZCA 3ONXA 2PJQA 2WXPA 3OBVE 4PS3A 1FVHA 3TKLB 4JW1A 3ZCJA 3FBLA 2GRMA 2WAUA 3BQIA 2I1KA 3CSFA 3ZPOA 2PG8A 4PS8A 4GOUA 2I59A 3AS8A 1N52A 3PTRB 4HLEA 4RG9A 2LSYA 4GZCA 4QFVA 5A6CA 1VOMA 5L3CB 4EQFA 4H63H 2KCLA 2ACXA 2Y6XA 3PUGA 1OWOA 3ZC1A 4AKGA 2WMNA 2VSOE 1SZ9A 3QKYA 4TZ4C 2VQ2A 4G23A 4EBAG 3N9MA 1HZ4A 1HCIA 2HH7A 4IE6A 2R59A 2AXVA 2LJLA 5CHEE 2LHNA 2AXZA 1E96B 3J9X1 4KZ0A 4C9BB 2BF0X 3HKBE 5G2NA 4C0EA 2N9DA 2HPJA 5HYAA 3LY9A 3UFEA 3APDA 3D9KA 3S2AA 3BG1B 4HVBA 3L13A 3L17A 3LPZA 3ZGQA 3LK2B 4KVMA 2Y4TA 4R7LA 5AFUL 4TUYE 2XQYA 3LEWA 3L6AA 3QWPA 5FJYA 4EZKA 3HYMB 2CEAA 2JRKA 4ISSA 1G73A 2GW1A 3ZC0A 4YJ2E 3ML9A 3ZYLA 3FFLA 3ONKA 4PH4B 2GRLA 3R7RA 4UQXA 2CXLA 5KMGP 5G05C 3SD5A 3L22A 4RG6A 2C5KT 2CHZA 4J8DA 3UUMA 3RRUA 2J4DA 5JR9A 4LRZA 5L3EB 3QC9A 3ZRHA 3QWVA 1U4QA 1QZ2A 2DCPA 4OYSA 4FU3A 4WWNA 3JC6D 3D9OA 4OHFA 5J2UE 4WBOA 3FUHA 2IC9A 1ZV4X 4I1MA 1ZU2A 3CVVA 3MEKA 3CKBA 4TUUA 3MV3B 4DPRA 5FTPA 4GA1A 4CI1B 4G63A 2J4BA 4PS7A 5FQ7A 2UXXB 4XKCA 4BTAA 3CKDA 4F7AA 5CA1E 5HI7A 3UUXA 3TAXA 4UI9C 2N1GA 3ZEFB 2K9AA 3HR0A 4FI5A 2LAHA 3ASFA 4W9RA 5A7DB 4AXPA 5FY1A 1X5BA 5EX0A 5JDLA 3AA0B 4PJNA 4AEZC 3PUQA 5FXXA 4UELA 3FTUA 4M1PA 2GK9A 2PZIA 1Z0PA 2LSJA 2CG2A 2VSXE 3SRZA 4KBMB 3LG7A 1QQEA 3N9PA 1WY6A 3KDSE 1JWGA 3CVLA 2KM4A 4ZI3C 4DI3A 2KWIB 3RRWA 2M63A 3CVWA 1ZHCA 3JC6C 1IJ5A 3O1IA 3O1HA 2X6HA 4GZ6A 3LJCA 4AQFA 5FMNA 2A2FX 2V7KA 1OWMA 3PE4A 5LHIB 3ANWB 1L5JA 2Y8DA 2DCFA 2NOXA 4Y6CA 4DI4A 4GK0E 1ELRA 2YNQA 4KXKB 3BQKA 4PFPA 2WXNA 4GZ5A 3KV9A 1V9DA 2KZTA 4ANUA 2KNDA 2X9WA 4I1OB 4QHOA 4HS2A 3WAKA 5LP6E 5D0QD 4ZI2D 1E7VA 5D0OD 3SNXA 3BG0B 4H9NC 4F1SA 4EPZA 3PUKA 3O4XE 3FU0A 3LY7A 2NTYA 3SBTB 1BR2A 3UQ3A 5FYMA 3K9IA 3MXZA 3J7Yq 5JDMA 3RYFE 3LCAA 4B89A 2ZM8A 3NZQA 4ILGA 4K0UA 3JUIA 5KDMC 3CIAA 5FZSA 3I0OA 3Q47B 5ANRA 5FY7A 2J08A 2QGSA 4E85A 3GZ2A 4N78D 4YVOA 1UJJA 1FEWA 4AVXA 1WM5A 4YVQC 3PS6A 2DLRA 5LJMA 1G8XA 3P8CD 3DBSA 5C8YE 3D9MA 4BX8A 4I4TE 2WPVA 4GZDA 4BX9A 4RSYA 3CMLA 4HGAA 1FVFA 5HXRA 3ESKA 3OJAA 5IHYA 1HS6A 4MS6A 3BQLA 3RKOA 3QK0A 2WBLA 3APFA 4BJNA 1PAQA 4IGUA 2NW9A 4ZI2C 1YA0A 3FULA 3K3NA 3PU8A 1IAPA 1UX4A 4DMVA 5DQVA 5ARGA 2ZMAA 3WXXA 2K5BB 2NP9A 2KT9A 2J1DG 3LY8A 1E1HB 3FXEB 3IBEA 2BVMA 3DTOA 4AQGA 2D0TA 4N3AA 4PK6A 3D9JA 2Q9QB 3ZHEA 4B0ZA 3TJPA 4M3OA 2C5IT 4HFVA 4GK5E 2X6JA 4DK5A 3VLEA 4O4LE 2ZM2A 2XAHB 2Q7FA 5KJKA 2CCQA 3PU3A 4UWLA 3QOUA 2J09A 4I43A 3FH8A 3AU4A 3B7UX 4O8SA 1PC2A 3DPDA 5E75A 2WB2A 2PFVA 1EZ3A 3B7RL 3FDHA 4AKRB 4AIFA 4TV9E 4GMLA 3UPVA 3OXFA 5ENNA 1Z3XA 3KEZA 4H9QC 4Q96A 3QB2A 5CCMA 4HOQA 1X79A 4TV3A 2VTBA 1NA3A 3AS4A 2IU1A 4UF0A 4PK4A 4E6HA 5CCLA 1FIOA 5LXTE 2IAKA 3SI5A 1IZNB 2A72A 3NRYA 1MQSA 1TJCA 2IF4A 2XGMA 2XGOA 4GU5A 2XAJB 4RVBA 3CVPA 5H6RB 3CVNA 2X6KA 2C2LA 4QX7B 3FTWA 4U72A 5EZYE 4QWNB 4H9SE 3I1AA 2H7OA 2NXPA 5M4YA 3AA7B 4GA2A 2DHRA 2X6FA 3N9NA 2X66A 5JQGE 4FLHA 1ELWA 1Y6IA 2VGXB 3R7QA 1ZKEA 2LE8A 4L23A 3EUHA 2BVLA 4I50E 2VWAA 3HKDE 3ZYKA 3OYZA 3QDNA 2IQCA 5AJLA 3RYCE 5BW8C 3CVRA 4OYJA 4L7TA 4UVAB 2A5UA 4A1SA 3C50A 1YD8G 3FUNA 4J8EA 3FUMA 2LHRA 1OWNA 3C51A 3APCA 2QY7A 3P1UA 4MHCA 4QKNA 3R9AB 4I9EA 2R17C 4J6IA 4MRUA 2JEKA 1UW4B 3FY4A 3WAJA 1OWAA 2AXUA 3GN5B 5EK4A 3FTVA 4Q69A 1OXZA 3O48A 4O2BE 3N71A 2KZ7B 5J1GA 4WW0A 5JHBA 1U3CA 3CPZA 3S4UA 1A17A 3IEGA 5J2TE 2KWHA 2UXNB 3FEYA 4IN3B 4XIFA 1TEZA 3EVYA 4V3IA 2E8IA 2EHOB 4JEUB 3FH7A 2VKHA 2V7IA 2VTBB 5KJMA 4PAGA 2PM6A 2FBNA 4EYUA 5T4YA 4PJMA 4YLHA 4UEMA 2XAGB 3CKCA 5EKQD 2RP4A 3ONLA 4WAFA 3OTNA 1H2TC 5IYZE 3ZW3A 4CQIA 5JDGA 2I9CA 4HKAA 4GYOA 5HAXA 3RC8A 5EDSA 2Q9QC 2L9BA 2SPCA 3UX4A 2WXOA 2L0IA 2WXHA 4BAYB 1MIYA 3R84B 4JUYA 1IYGA 3FUEA 1UN9A 4CDRA 2WXIA 3FUJA 3ZYQA 4U8HA 3PUSA 4JC8A 2PBIA 1HH8A 2YHCA 3CHSA 1YKHB 2WVIA 2LO6A 4HOTA 2KXPB 3KV6A 2R5SA 4BT8A 1LF8A 2D5UA 2PQNA 3CK9A 1JPLA 3G2UA 3EHMA 3ASGA 2C5JA 3S7JA 3MKRA 5EK3A 2KCKA 4QXHB 3WI3A 1KK7A 1BR0A 5FZQA 4MLKA 4J2CA 4JLEA 4UXNB 2LNIA 2J9QA 3ZEFA 2WQ6A 4J0UA 2D2SA 1NP7A 3U78A 2PL2A 5FXWA 4OFZA 3CR3A 4G1TA 3EHNA 5LBMA 1E8WA 4IRUA 5LOZA 3K8PC 4DO0A 1LKXA 3A5XA 3FU3A 4YHJA 1EDUA 4BA9A 5BUZA 2L3LA 3KVAA 4ANVA 3ZXSA 5FQ8A 5JRCB 2CHXA 2EHOD 1FMWA 2HYZA 4ILUA 1SQMA 2J49A 2LSVA 3SHFA 1TJFA 4X1IE 4WBNE 2DI4A 4GPKA 1E8ZA 4JL0A 2I2OA 4YJ3E 1E8YA 4E7ZA 4H9PC 2Z6EA 3FTSA 4U63A 2JMHA 3ANWA 5FZRA 5BV0A 3MYVA 2D0UA 3Q4AB 3RIBA 3JQ0A 2OVBA 2WQ7A 3IEEA 2E9XB 1H2UA 1ZBPA 4A3VA 1LRZA 5DIZA 4DLQA 4PNIA 3JYSA 4ZI3D 3I9WA 2CFUA 3PREA 3EIQC 2LSGA 2HO1A 3RPUA 2DBAA 1B89A 1DVPA 3FUFA 3CHMA 4K0RA 3OXLA 3RH3A 1HG5A 4CT4A 2NC9A 3S7FA 2DWGA 1EYHA 3FH5A 4BFRA 3CHQA 4AY6A 4J8FA 3Q2MA 2E2EA 2XCCA 3AAEB 2EHOC 2W0GA 1WR6A 2Y48B 3QJZA 1NWMX 5LNKA 2WXJA 2WXMA 3PURA 1HG2A 5JH7E 1MNEA 4MFRA 2WM9A 4GB9A 3U4TA 1KT0A 3NBXX 2VB6A 3ZIMA 4ZS2A 2XHEB 5CMWA 2YQ8A 3R6NA 4G25A 4ANJA 4UV9B 3PUAA 5FXZA 4O4IE 3N9LA 2CA5A 3EIJA 4EB6E 3K3OA 4IE0A 3P2BA 3FWVA 5H6QB 4AKIA 4PDXA 1UX5A 2YU1A 4L2YA 4BY6A 4CEMA 1UJKA 3RU0A 1H2VC 3PUJA 4G24A 1XGWA 3L16A 3ML8A 1OWLA 2XPZA 3JCKC 2YHEA 3OAWA 4PW8A 2ODVA 1XNFA 3AS5A 2E0IA 2WXQA 2XEVA 2E9XD 4L0RA 4KBQA 3HKEE 2K24A 3FHNA 3ENEA 2WXRA 3UT5E 2VJ8A 5CMYA 3F2EA 2XGSA 4H9RC 2V0PA 3OYXA 4ZI7E 2V4LA 2Q9QA 4QXCB 3ZCIA 2XPIA 1BPOA 2BUGA 4TRQA 3K3QC 4KMOA 5L2LA 4J8SA 1S0PA 3ZN0B 4JEHA 5LOVE 4BT9A 5HXCA 2BDEA 3CHPA 2ODUA 4I6GA 4AJWA 3KV4A 3LBXB 4EIWA 3GYZA 2X3MA 3FTXA 4NACA 2OV8A 3MX3A 3W15B 3ZYMA 3HA4A 1IJ6A 4A56A 3L09A 3FEXA 4BJMA 2LT3A 3PEVB 1MHQA 4LEUA 3FHEA 4YNDA 4UV8B 4O2AE 5KX5E 3LFMA 2OOEA 5JJTA 3LDZA 3O9XA 5BPPA 3RO3A 5E76A 2X67A 3HIZA 4HN9A 4G2VA 2E9XC 2A3DA 3Q5MA 2N2NA 3CQCB 5LYJE 1DNPA 3ZVVA 3LJ3A 5LCWC 3CSTA 5AENA 4QXBB 3VTYA 4U07A 1YW0A 2KC7A 3KS2A 3TXNA 1HE8A 3ASHA 4IE5A 5CA0E 1JWFA 3V5UA 2IOSA 1UG3A 2IJGX 3KAEA 2MTQA 3I4GA 1Z6TA 3Q9DA 4L2LA 3CVUA 5FY0A 1QNFA 2VGXA 3F57A 5AIJA 3C64A 3OKQA 3FTZA 1HXIA 4FLBA 5T3RA 2MYSA 4CT0A 4GYSA 4U0SA 4GYYA 3FBZA 4CXWA 4GA0A 3AAAB 5LX8A 2QFCA 3CHOA 4EECA 2I1JA 4JVSA 3FB2A 5ARFA 5JDFA 4CZZB 3ASDA 3IKOB 3PH0C 3MGBA 4FHJA 3L54A 4CRWA 5G04J 3UT4A 4TV8E 2V26A 4L5GA 4JEHB 1OWPA 2IFUA 3HL6A 3RX6A 2PQRA 3NZSA 5A1LA 3MV2B 2G0UA 3GN5A 3KFWX 2K48A 3JQ1A 3E08A 2XPYA 5HXHA 2WMOA 4UWGA 1ELKA 4G26A 3O1JA 2NSZA 1BR4A 4ME2A 5LCYA 5ETWA 3VLFA 3PNTB 2JLBA 4GMJA 4CGVA 3N2OA 5CB4E 2P58C 4AM9A 3EDVA 4CCAA 3D3MA 5JJ6A 2EHOA 4JEUA 3RKVA 2XAQB 2VGYA 4N3CA 4U04A 1KNZA 2CG3A 4HFGA 4BTBA 1U3DA 4HOUA 5BT1A 3GWHA 2XAFB 4QX8B 4I6JA 3URZA 2FI7A 5HQ8A 5L3BB 3BK9A 4WNKA 1HS7A 3EDUA 4A3TA 4KP3C 4C91A 3MKDA 1S94A 4DNDA 3ZMTB 1O3XA 4FP7A 3S7DA 5BV1A 3GMIA 4ILIA 2LOPA 3IF8B 3CX8B 2YINA 4FULA 2W00A 1JUQA 3B13A 4UWKA 2L9QA 1OUVA 2MBGA 5LHHB 4AY5A 4B8CB 4WNEA 4O6FA 5DQWA 2V5FA 3ZJ1A 2BTDA 4JXTA 1E7UA 2Q9QD 3U3IA 2DIWA 3PDNA 3G2VA 4X1YE 2A4ZA 1MIWA 2CHWA 2ONDA 4Y6WA 1QUUA 3E22E 4XBFB 4XZ4A 3AVSA 3LYAA 2YK0A 1IHGA 4LERA 3MJWA 1MMAA 1QSDA 4ANXA 5LGUB 3E0ZA 3NZUA 1H7CA 4U0UA 3CK7A 4EZLA 2WXFA 2KMFA 3UMVA 3PE0A 1HU3A 2KINB 5EK2A 3SBSA 4OVVA 5HWXA 4FJOA 5DABA 5JRCA 4PJJA 1NAFA 3AA6B 1MMDA 2V7JA 4EOZB 3C4WA 3C98B 3IBPA 4B8AA 2W61A 4P29A 3LVQE 3UULA 2X0LB 2AW6A 5FQ6A 3Q5WA 4JHJA 3IHVA 5T8IA 4FA6A 5J08A 1MMNA 3N2KE 3I4RB 5C1DA 2E9XA 3MKQB 3DJBA 4IDZA 4GCNA 4ATGA 2CMRA 3GA8A 2V8SE 3I5PA 3D9LA 4IYPA 4WUYA 3TGOA 4AI6A 4G11A 5LGNB 4L1BA 2KCVA 1E90A 3M65A 2IONA 3N5LA 3DP7A 4XI9A 5DBKA 4OYKA 3LXUX 1INZA 4KT6B 3CVXA 4DJAA 4AKLA 2MOZA 4ACLA 3IV0A 4N3BA 4GCOA 2X51A 1YKEB 5GONE 4ISTA 1LVKA 3ZMUB 4EAHA 2LSKA 4TX5A 2AWIA 4JPSA 3QARA 2HR2A 4V1Av 3TG4A 1FCHA 2NW7A 3MA9A 3KINB 2VSYA 3QAQA 2LSIA 4GYRA 2IW5B 3P7IA 5J90A 4P09A 3RYIE 2XHEA 3I0QA 3SZ7A 4NUUA 2VK9A 4F6RC 4ZOLE 4PFOA 3ZLIA 4UVCB 3GZSA 4HE8A 2RA1A 2VKOA 4UWHA 3ZJ2A 2W62A 5ANLA 3SF4A 3CX6B 3U3WA 3Q49B 3RRCA 3RRNB 3T8MA 1SHZC 3KBTA 5E0OA 1D0YA 1WLXA 4HXIA 4NQ0A 3H3AA 2NWBA 2FO7A 2WSSV 2LM9A 4CDNA 3CEQA 4EZJA 1BR1A 2IOLA 4KVOA 4AKHA 2V7LA 4N2SA 5L3DB 5FT9A 4GZ3A 2BZBA 4F3VA 3SGHA 2HM8A 5EX3A 2ZM0A 2YU2A 2XTLA 1HFAA 2V7MA 3LVRE 3CVQA 4ANWA 4DLOA 3HVEB 4PUCA 3PDYA 4XZCA 4MLPA 2IC6A 5TAOA 1T98A 4URKA 3MK7C 3HHMA 3FU6A 4I6EA 4KYOB 3MJXA 4WNFA 2CLYB 1UCUA 4ABNA 3GW4A 2UY1A 4XE0A 4U74A 2H3RA 4CI3B 2OA5A 4KUMB 3LBXA 3H37A 1HTJF 3PE3A 3KD7A 2VKDA 3RJVA 2KATA 2X38A 5KJLA 5JDQA 3FUDA 2WXGA 2VL8A 3U66A 2Y4UA 3T5XA 4NUVA 3ZMSB 3FUKA 4LUNU 1AJ3A 1H0AA 2ZLYA 4UIGA 2KLQA 5LBQB 5JDNA 4H63V 2X68A 3MZKB 3ZMVB 3T5VA 2FULA 3RYHE 5JREA 4A1GA 3ETUA 4XI0A 4WNGA 3HI2A 2VSNA 3AU5A 4KMCA 3CGHA 3QWWA 3B57A 4PJLA 3S7BA 1D1CA 4P0BA 3BEEA 2X9HA 4APOA 2PM7A 1D1BA 4H9OC 5LFAA 4UWFA 3D0TA 3KV5A 1WRDA 4B6XA 4DBQA 4JHKA 3VU7H 5G04C 2L0TB 2ZU6B 4YFSA 4BWRA 3FP3A 1MIVA 4IHJE 2V1DB 2XCBA 4LCTA 4CDMA 2X6IA 1H6KA 4A55A 2MOWA 2B1EA 2H7VC 1KT1A 3SFZA 4ILHB 4I2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4R B;  3CQG B;  3CQC B; 
#chains in the Genus database with same CATH topology
 4A97 A;  5JR9 B;  4APF A;  2XRY A;  3ISM C;  4WWP A;  2HE0 A;  3ZMZ B;  3P4R A;  2F8Y A;  2HPL A;  2W63 A;  4WWO A;  4HQD A;  2UY1 B;  3IHR A;  4ZS3 A;  2J8S D;  4IE4 A;  4EZ4 A;  3PZ2 A;  4O4J E;  5G05 J;  5JDH A;  3DSX A;  4H7X A;  2ZM6 T;  3P4Q A;  4I1A A;  4DX1 A;  2MHK A;  2XRZ A;  5KJN A;  5FXV A;  4EYY R;  3Q5X A;  3D9P A;  2PNN A;  1Z5S C;  4P0A A;  5KCM A;  2LUH A;  5AQN B;  3CX7 B;  4A98 A;  5AYW D;  1MX2 A;  3HDX A;  2CWO A;  3ZT6 A;  4FJY A;  3E4B A;  3Q7A A;  2VQF T;  3FTY A;  4B3M T;  1IQR A;  3UKU G;  4HRM B;  2LAI A;  4N39 A;  3CWZ B;  4H7Y A;  3N9Q A;  4AV7 A;  5LG4 A;  2DNX A;  3ETV A;  2RG8 A;  2RPA A;  1N32 T;  4CXY A;  4GAA A;  4LML A;  2JAB A;  3JXJ A;  1EF1 C;  2V6X A;  2YDR A;  5HWY A;  1B7T A;  3UUX B;  1GW6 A;  3QUJ A;  3TWT A;  1X81 A;  5EID A;  4EBA A;  2X9X A;  1OCC E;  3AEE A;  3ZN3 A;  1DCE A;  3C4Z A;  5ABG A;  3L9T A;  3RK6 A;  4ACK A;  3DEO A;  3U9W A;  3ZT5 A;  3QK6 A;  4JA7 A;  3KSL A;  1WYC A;  2L6J A;  3T9K A;  2VAS A;  2XS1 A;  3N2G E;  5F3J A;  3U64 A;  5BXU A;  4GMR A;  4WND A;  2LOS A;  1JCS A;  4AIU A;  3P4W A;  5LGT B;  4G8L A;  4IIJ E;  2EQX A;  3VKH A;  4Z90 A;  4U8V D;  3O4Z A;  4I2W A;  3SY2 A;  4UI9 J;  4N5C A;  2WQH A;  1Y8M A;  5BR8 T;  5CBO A;  3EJN A;  2CLY C;  1KLX A;  1HF8 A;  4G2A A;  4O4H E;  1N4P A;  3B7S A;  3UT8 A;  2AE9 A;  2LKG A;  1IQU A;  2WCA A;  4ATZ D;  1JCR A;  3NF1 A;  3AB3 B;  2NTX A;  2I6H A;  3ESL A;  4I9C A;  5ENQ D;  3AAI A;  4HOR A;  2F0Y A;  2X9Y A;  3L3P A;  5C2Y A;  4LF7 T;  4NRH B;  2JJ9 A;  4EHM A;  1KZO A;  2H6G A;  4IUL A;  2LSU A;  3B7T A;  1W3B A;  3QNK A;  2VKJ A;  5CEA A;  3N9O A;  1WYB A;  5LP0 A;  4CZ2 D;  3SFE A;  5M72 A;  3G2S A;  4U96 D;  2WWU A;  3VHL A;  3G2W A;  1S35 A;  3B5M A;  5A23 A;  2CM0 A;  4OK0 A;  3FU5 A;  1TN6 A;  2ES0 A;  4BSX A;  3T1H T;  4LF8 T;  4I17 A;  4UI9 K;  4YSY A;  4NUR A;  3ZN1 B;  4MBQ A;  5LHG B;  2Y1L E;  1ZEE A;  2UWJ G;  2KZT B;  4U0Z A;  4XKB A;  2F4V T;  2GRP B;  4GTR A;  2LKH A;  1TYQ G;  3RC3 A;  4C90 A;  5FP3 A;  4X20 E;  2QA7 A;  3T8O A;  3I9Y A;  3OXG A;  1P5Q A;  3F6Q A;  4AP2 A;  3PUW F;  3KVB A;  1Z3Y A;  3LSV A;  1CUN A;  3SOL A;  3D9N A;  5L47 A;  5J0Z A;  2FEZ A;  1EPU A;  5BMV E;  2YKS A;  3Q7F A;  1KNR A;  2XJ7 A;  1U5P A;  3SS1 A;  2GGF A;  3F31 A;  3HXB A;  3V5S A;  2OVF A;  4I55 E;  4XX5 A;  2IO3 C;  4NPP A;  1D1A A;  1TNY A;  4DV4 T;  5AJD A;  2JQQ A;  3ZPJ A;  4IE7 A;  4DMW A;  2XQ8 A;  4HEA A;  3MZL B;  3TLS A;  4X5T A;  4L9I A;  4K03 A;  4CN6 A;  3NQP A;  3C98 A;  4AXH A;  4HWD A;  5ABF A;  5G55 A;  4X8Q A;  5FQ4 A;  2FBW A;  3TWS A;  2XUE A;  4BSZ B;  3DXK G;  5FWQ A;  2XZD G;  4B93 B;  1BI7 B;  4HTE A;  3ZFW A;  3VTX A;  4JI6 T;  2M67 A;  2L8K A;  4X1K E;  1D0X A;  2WXL A;  2A9U A;  2V8S V;  3NWI A;  1NZN A;  4FJZ A;  3CVY A;  1HO8 A;  3VKG A;  3D9I A;  4OVU A;  4ZHQ E;  5LJN A;  3MKQ A;  4CXX A;  2IO2 C;  2CWY A;  1N94 A;  4AQY T;  2NW8 A;  4HFH A;  4ASK A;  3I3N A;  4ADZ A;  5JR9 C;  3AXJ A;  1Y64 B;  3UIN C;  4CI2 B;  2BS4 A;  2RD0 A;  4Z8X A;  3RGL A;  4ERR A;  3KBU A;  2P9L G;  1VDY A;  1N54 A;  3TG5 A;  3LK3 B;  4GIW A;  3EDT B;  1UK5 A;  2D9D A;  4DBR A;  1E8X A;  1FT2 A;  5FIN A;  3PEU B;  3PNL B;  3MAC A;  1US7 B;  3GZ1 A;  3CHR A;  4UQZ A;  4DR2 T;  3HKC E;  4FAD A;  2BS3 A;  1V54 E;  3C4X A;  2C0S A;  3RRM B;  3AED A;  4JA9 A;  4N2Q A;  2J07 A;  3UT7 A;  1SA0 E;  2Y3A A;  3HXF A;  2WB5 A;  2WDR A;  3TL5 A;  3VLD A;  3RO2 A;  5LCW J;  3UTK A;  2WU2 A;  3SWH A;  1FMV A;  2LLY A;  3AVR A;  5FVK A;  3MA5 A;  3J5P A;  5EYL A;  1SUM B;  2LEH A;  2JQK A;  5FNV E;  3FUI A;  3PVL A;  4FHK A;  4TN7 B;  3CQX C;  3LKU A;  4JZY A;  4GTV A;  1LVF A;  5JTG A;  1DC2 A;  3Q9U C;  3DPY A;  5L3F B;  4AOF A;  3UUN A;  2MRI A;  3PZD A;  3FXD B;  2P9B A;  3NRX A;  2XQ0 A;  1NA0 A;  3ZHE B;  5JVD E;  4EZH A;  3MCX A;  3NZP A;  3CQG B;  2OEV A;  2XQ5 A;  2ILR A;  2CFZ A;  1XDO A;  4GYW A;  4JHR A;  1MND A;  3HXE A;  2JMK A;  1N34 T;  2VYI A;  2BKP A;  4E7S A;  3TWU A;  1RW2 A;  3Q15 A;  5JHA A;  4HFB A;  4DVD A;  2XAS B;  4KHP T;  2FF4 A;  5HXS A;  4Q94 A;  2AVP A;  3L08 A;  4HFC A;  4I43 B;  5DJQ C;  3LS8 A;  3IHY A;  3G2T A;  2C0L A;  4B94 A;  5ADX L;  4KHZ F;  3PRZ A;  5JJ7 A;  1SA5 A;  3DSS A;  1ZOY A;  5ABF B;  1N9A A;  2Y0B G;  4YSX A;  4QH4 A;  1KNP A;  2NR4 A;  4FC8 A;  4F6R D;  1TNZ A;  3QC1 A;  2P9P G;  3CK8 A;  2HN2 A;  3AA1 B;  2XQ3 A;  2VVN A;  4MKT A;  1H19 A;  4IL4 A;  1FJG T;  2DWK A;  3G06 A;  4O1O A;  4MAL A;  2CXF A;  5AAO A;  1W9R A;  2BKO A;  5AQT B;  4AQF C;  4F53 A;  4LFA T;  5BNW A;  4EXT A;  2UUB T;  1WAO 1;  3EHQ A;  1D0Z A;  2XSA A;  4YT0 A;  3B95 A;  2CE7 A;  4XAX B;  4D10 C;  5F8P A;  1VRB A;  3D9H A;  1MMG A;  3ULQ A;  2JPF A;  4HOS A;  4PK5 A;  3HVE A;  4UF0 B;  1HX8 A;  4CGW A;  3AXJ B;  1PY1 A;  1VCT A;  4UQY A;  2WXK A;  2B6C A;  1YYH A;  5LA6 E;  3CV0 A;  4C0M A;  2CXD A;  2C0M A;  1SZA A;  1Z8U A;  3LK4 2;  5L3G B;  3TXM A;  5AQJ B;  1UN8 A;  3CLJ A;  4UVB B;  5HXE A;  1KF6 A;  2OEW A;  2YEV C;  4KZC A;  1WFD A;  3ONX A;  1HR0 T;  3AG2 E;  2PJQ A;  4G8K A;  2WXP A;  1LD7 A;  3OBV E;  4PS3 A;  3LDQ B;  1FVH A;  3TKL B;  4JW1 A;  3ZCJ A;  3FBL A;  4ZHB A;  3IXE A;  2GRM A;  2QYW A;  1V55 E;  2WAU A;  4HFE A;  3BQI A;  2I1K A;  4TXP A;  3CSF A;  3ZPO A;  2PG8 A;  4PS8 A;  4GOU A;  2I59 A;  3AS8 A;  1N52 A;  4K5B A;  5CBN A;  4LSZ E;  3PTR B;  4U3C A;  3UXG A;  4HLE A;  4RG9 A;  2LSY A;  4GZC A;  4QFV A;  5A6C A;  1VOM A;  5L3C B;  3FZM B;  3VR8 A;  4EQF A;  4H63 H;  3RI5 A;  2KCL A;  2ACX A;  2Y6X A;  3PUG A;  1OWO A;  3ZC1 A;  4AKG A;  2WMN A;  2VSO E;  3JAE A;  1SZ9 A;  3QKY A;  5HS0 A;  2LXM A;  1D8D A;  4DV5 T;  4TZ4 C;  2VQ2 A;  4U2Z A;  5IWA T;  4G23 A;  4EBA G;  3N9M A;  5AQB A;  2KBX A;  3QB5 A;  1HZ4 A;  1HCI A;  4YTP A;  2HH7 A;  4IE6 A;  2R59 A;  4JB8 P;  2AXV A;  4U7E B;  1RZ4 A;  2LJL A;  5CHE E;  4BEP A;  2LHN A;  2AXZ A;  1E96 B;  3J9X 1;  4KZ0 A;  4C9B B;  2BF0 X;  3HKB E;  5G2N A;  4C0E A;  2N9D A;  2HPJ A;  5HYA A;  3UFE A;  3LY9 A;  3APD A;  3D9K A;  3S2A A;  3BG1 B;  4HVB A;  3L13 A;  3L17 A;  3LPZ A;  3ZGQ A;  3LK2 B;  1MJ0 A;  4KVM A;  4Z91 A;  2Y4T A;  4R7L A;  1VCS A;  5AFU L;  4TUY E;  2XQY A;  3LEW A;  3VR9 A;  3L6A A;  3QWP A;  5FJY A;  4DV1 T;  4EZK A;  3HYM B;  2CEA A;  2JRK A;  3PJA A;  4ISS A;  1SA4 A;  1G73 A;  3UKR G;  5CED B;  1T7S A;  4JI1 T;  2GW1 A;  3ZC0 A;  2YOE A;  4YJ2 E;  5AQS B;  2XEN A;  2CHN A;  3ML9 A;  3ZYL A;  3FFL A;  3ONK A;  5AQA A;  4PH4 B;  2GRL A;  3R7R A;  3UI2 A;  4UQX A;  5ENR D;  2CXL A;  5KMG P;  5G05 C;  3SD5 A;  3SFD A;  3L22 A;  4RG6 A;  2C5K T;  4P1N A;  2CHZ A;  2IEJ A;  5D66 A;  2FJE A;  4J8D A;  5HEG A;  3UUM A;  3RRU A;  4U7Y A;  2J4D A;  5JR9 A;  4LRZ A;  5L3E B;  3QC9 A;  2UXC T;  1IXV A;  3UUB A;  3ZRH A;  3QWV A;  1U4Q A;  1QZ2 A;  2DCP A;  4K5C A;  4OYS A;  3HRA A;  4FU3 A;  4WWN A;  3JC6 D;  3D9O A;  1NI1 A;  4OHF A;  5J2U E;  3E32 A;  4WBO A;  4BES A;  3FUH A;  2IC9 A;  1ZV4 X;  3J5Q B;  4I1M A;  1ZU2 A;  4DV7 T;  3CVV A;  3ZXP A;  3Q73 A;  3MEK A;  3CKB A;  4TUU A;  2UXB T;  3MV3 B;  4EV6 A;  3BQO A;  4YDE A;  5CER B;  4DPR A;  5FTP A;  5HEH A;  4CI1 B;  4G63 A;  2J4B A;  4GA1 A;  4PS7 A;  3C3Q A;  3UTM A;  5FQ7 A;  4KX6 A;  4AIS A;  2UXX B;  4XKC A;  4BTA A;  3CKD A;  4C48 B;  3L8R A;  4HRL A;  3AEG A;  4F7A A;  5CA1 E;  3HG0 D;  4TUM A;  5HI7 A;  3UUX A;  1M7K A;  3TAX A;  2P9I G;  1HX1 B;  4UI9 C;  2N1G A;  3ZEF B;  2K9A A;  3HR0 A;  2HN1 A;  4FI5 A;  2XM2 A;  4QH5 A;  1BLX B;  2LAH A;  3PZ4 A;  3ASF A;  4W9R A;  3EUV A;  5A7D B;  1GQE A;  1FT1 A;  1K3Z D;  4AXP A;  5FY1 A;  1NFI E;  1ZB1 A;  1X5B A;  5EX0 A;  3RIA A;  5JDL A;  3AA0 B;  4PJN A;  4AEZ C;  5LB7 B;  3PUQ A;  5FXX A;  2M6B A;  4UEL A;  3FTU A;  4M1P A;  4DR3 T;  2GK9 A;  2PZI A;  5BXO A;  1Z0P A;  3V31 A;  3E33 A;  2LSJ A;  2CG2 A;  2VSX E;  3SRZ A;  2J4G A;  4KBM B;  1H6P A;  4CN4 A;  2E5V A;  1XDP A;  3LG7 A;  1QQE A;  3N9P A;  2GRQ B;  1WY6 A;  3KDS E;  1JWG A;  3CVL A;  2KM4 A;  2XQ9 A;  4ZI3 C;  4DI3 A;  2KWI B;  3RRW A;  3UU6 A;  2M63 A;  4A5X A;  4ILC A;  1LTX A;  3NBN B;  3CVW A;  2EIM E;  1ZHC A;  3JC6 C;  4NXN T;  1IJ5 A;  3O1I A;  3O1H A;  2X6H A;  3P50 A;  1IBK T;  4GZ6 A;  3LJC A;  4AQF A;  5FMN A;  2A2F X;  2V7K A;  3NB2 A;  1OWM A;  3PE4 A;  5LHI B;  3ANW B;  1L5J A;  2Y8D A;  2DCF A;  2NOX A;  4Y6C A;  1AP7 A;  4HLL A;  2BBH A;  4GTQ A;  5HEO A;  4DI4 A;  4GK0 E;  1ELR A;  2YNQ A;  4KXK B;  4M7C A;  2WS3 A;  3BQK A;  4PFP A;  2WXN A;  2QVA A;  4GZ5 A;  3KV9 A;  1V9D A;  2KZT A;  3NOC D;  4ANU A;  2KND A;  2X9W A;  4I1O B;  4QHO A;  4HS2 A;  3WAK A;  5LP6 E;  5D0Q D;  4ZI2 D;  1E7V A;  1W0A A;  5D0O D;  3SNX A;  1OCZ E;  3BG0 B;  4H9N C;  2Y69 E;  3UM1 A;  4F1S A;  4EPZ A;  1SW6 A;  2RKK A;  3PUK A;  3O4X E;  3SFX A;  3FU0 A;  3LY7 A;  2RFA A;  2GRN B;  2NTY A;  3SBT B;  3JAF A;  1BR2 A;  3UQ3 A;  5FYM A;  3K9I A;  3AEA A;  3NKZ A;  2DVW A;  5FL0 A;  3MXZ A;  3J7Y q;  5JDM A;  3RYF E;  3LCA A;  3PUV F;  4B89 A;  2FJB A;  2ZM8 A;  4JI5 T;  3NZQ A;  4ILG A;  4TNW A;  4K0U A;  2EIL E;  3JUI A;  4HBD A;  3V30 A;  5KDM C;  3CIA A;  2B76 A;  1J5W A;  5FZS A;  3I0O A;  3Q47 B;  1N11 A;  1WDY A;  5ANR A;  5FY7 A;  2J08 A;  4DX2 A;  2QGS A;  3JUE A;  4E85 A;  1N4R A;  2HHH T;  1SE7 A;  3GZ2 A;  4N78 D;  4YVO A;  4QQI A;  4A63 B;  1UJJ A;  2JIW A;  3RHW A;  1FEW A;  3ONL C;  2IIU A;  1WM5 A;  4YVQ C;  3PS6 A;  4AVX A;  2DLR A;  4HI9 A;  1UOH A;  5LJM A;  3UIO C;  1G8X A;  3P8C D;  3DBS A;  2A5E A;  5C8Y E;  3D9M A;  4K5A B;  4BX8 A;  4I4T E;  2WPV A;  4GZD A;  1E2A A;  3P4P A;  4BX9 A;  1OY3 D;  4RSY A;  3CML A;  4HGA A;  3V2X A;  1FVF A;  5HXR A;  4YHH T;  3ESK A;  3OJA A;  5IHY A;  1HS6 A;  4B3R T;  4MS6 A;  3BQL A;  3RKO A;  2EIJ E;  3QK0 A;  4B3S T;  2WBL A;  3APF A;  4BJN A;  1PAQ A;  4IGU A;  4LNB A;  2IUB A;  3A7M A;  2NW9 A;  4ZI2 C;  1S64 A;  1YA0 A;  3FUL A;  2I0M A;  1H6O A;  3K3N A;  3PU8 A;  3DSW A;  1IAP A;  1UX4 A;  4DMV A;  4IDO A;  1BU9 A;  5DQV A;  4U2Y A;  5ARG A;  3DSU A;  2XQ4 A;  2F37 A;  2ZMA A;  3WXX A;  2K5B B;  2NP9 A;  2KT9 A;  2J1D G;  3LY8 A;  1E1H B;  5ITZ F;  3FXE B;  3IBE A;  5EIB E;  2BVM A;  3DTO A;  4AQG A;  2D0T A;  4N3A A;  4PK6 A;  3D9J A;  2Q9Q B;  3ZHE A;  4B0Z A;  3EU5 A;  3TJP A;  4M3O A;  1W0B A;  2C5I T;  4JBW F;  4HFV A;  4GK5 E;  2ZIR A;  2X6J A;  2DL1 A;  4DK5 A;  3VLE A;  4O4L E;  3ZNG A;  4F8H A;  2ZM2 A;  2XAH B;  2ZIS A;  5KNG A;  2Q7F A;  5KJK A;  2CCQ A;  2CPT A;  3PU3 A;  4UWL A;  3QOU A;  2J09 A;  1D9S A;  4I43 A;  3FH8 A;  3K1S A;  3AU4 A;  3B7U X;  4O8S A;  1PC2 A;  3DPD A;  5E75 A;  5ENO D;  2WB2 A;  2PFV A;  1EZ3 A;  3B7R L;  3FDH A;  2EIK E;  4AKR B;  4AIF A;  4TV9 E;  4GML A;  4LF4 T;  3UPV A;  3OXF A;  3R9M A;  5ENN A;  5AQG B;  5CFB A;  1Z3X A;  3KEZ A;  4H9Q C;  2WQY A;  4IDP A;  4Q96 A;  4NIQ A;  3QB2 A;  4LNG A;  5CCM A;  4HOQ A;  3ABV A;  3DSV A;  3KSQ A;  1X79 A;  2CRB A;  5IY5 E;  4TV3 A;  4LNU D;  1NA3 A;  2VTB A;  3AS4 A;  3AE9 A;  2XQ6 A;  2IU1 A;  4UF0 A;  4PK4 A;  4E6H A;  3AE6 A;  1MX4 A;  3AEF A;  2R02 A;  5CCL A;  1J5E T;  1FIO A;  5LXT E;  4YDO A;  2IAK A;  3SI5 A;  1IZN B;  2A72 A;  3NRY A;  1MQS A;  1TJC A;  3AEC A;  2IF4 A;  4OAV B;  2XGM A;  2XGO A;  4U95 D;  4GU5 A;  2XAJ B;  4RVB A;  4LFC T;  3CVP A;  5H6R B;  3CVN A;  2X6K A;  2V4H C;  3JAD A;  2C2L A;  4QX7 B;  3FTW A;  4U72 A;  5EZY E;  3RSE G;  2AXD S;  4QWN B;  4H9S E;  3I1A A;  2H7O A;  2NXP A;  5M4Y A;  3AA7 B;  4GA2 A;  2DHR A;  2X6F A;  3N9N A;  2X66 A;  5JQG E;  4FLH A;  1ELW A;  1Y6I A;  2VGX B;  3R7Q A;  1XNR T;  1ZKE A;  2LE8 A;  1YQ3 A;  1IKN D;  4L23 A;  3EUH A;  3WG7 E;  2BVL A;  4XEI G;  3ZUV B;  4UR9 A;  4I50 E;  2QYJ A;  2VWA A;  3HKD E;  3ZYK A;  3OYZ A;  3QDN A;  2IQC A;  5AJL A;  3RYC E;  5BW8 C;  3CVR A;  4OYJ A;  5KXJ A;  4L7T A;  5AQO B;  4UVA B;  4LG6 A;  3L82 A;  2A5U A;  2ZGG A;  4A1S A;  3C50 A;  5KNH D;  1YD8 G;  3FUN A;  4J8E A;  1S70 B;  3ULY A;  3FUM A;  2DWZ A;  2LHR A;  1OWN A;  3C51 A;  3APC A;  5JMN D;  2YN6 A;  2QY7 A;  3P1U A;  4MHC A;  4OX9 T;  4IRE A;  4QKN A;  3T1Y T;  3R9A B;  4ILA A;  4I9E A;  2R17 C;  4J6I A;  1DCQ A;  1KZP A;  2XPK A;  4MRU A;  2JEK A;  2OLT A;  2LM2 A;  1UW4 B;  3FY4 A;  3WAJ A;  1OWA A;  2AXU A;  3GN5 B;  5AQM B;  5EK4 A;  3FTV A;  3AG1 E;  4Q69 A;  1OXZ A;  3O48 A;  5AQU B;  1O1S A;  4WZX A;  4O2B E;  4LF9 T;  3N71 A;  2ZXW E;  2KZ7 B;  2FJD A;  2IHR 1;  4TNV A;  5J1G A;  4WW0 A;  5JHB A;  1U3C A;  2XQ7 A;  3CPZ A;  3S4U A;  5KBA A;  2FUP A;  1A17 A;  3IEG A;  5J2T E;  2ETB A;  2KWH A;  2UXN B;  3FEY A;  4IN3 B;  4XIF A;  1TEZ A;  3EVY A;  4O60 A;  4V3I A;  4OAU C;  2E8I A;  2EHO B;  4JEU B;  1HNZ T;  3FH7 A;  2VKH A;  2V7I A;  3ZST A;  2VTB B;  5KJM A;  2LXL A;  2BG9 B;  4PAG A;  2PM6 A;  2XSB A;  2FBN A;  4EYU A;  5T4Y A;  1OCO E;  3AE8 A;  4PJM A;  3VRA A;  3FZL B;  3AE4 A;  4YLH A;  4UEM A;  5KWD A;  2XAG B;  3NAW A;  3CKC A;  3NOG D;  5EKQ D;  2RP4 A;  2R6G F;  3ONL A;  4WAF A;  3OTN A;  1H2T C;  5IYZ E;  3ZW3 A;  4CQI A;  5JDG A;  2I9C A;  4HKA A;  4GYO A;  5HAX A;  2R2L A;  3RC8 A;  5EDS A;  2Q9Q C;  1TNO A;  2L9B A;  2SPC A;  4X62 T;  3EHZ A;  3UX4 A;  2WXO A;  2L0I A;  2M6I A;  2WXH A;  4BAY B;  1MIY A;  3R84 B;  4TWH A;  4DR6 T;  3EI0 A;  4JUY A;  5EIL A;  1IYG A;  3FUE A;  1UN9 A;  3BU8 A;  4CDR A;  5AQK B;  2WXI A;  3FUJ A;  3ZYQ A;  2WWV A;  4U8H A;  3PUS A;  4JC8 A;  5HCM A;  2PBI A;  1HH8 A;  2YHC A;  3CHS A;  1YKH B;  4DV3 T;  2WVI A;  2LO6 A;  4HOT A;  4HWH A;  2KXP B;  4X65 T;  2XZE A;  4LMJ A;  3KV6 A;  2R5S A;  4BT8 A;  1LF8 A;  5D2M C;  2D5U A;  2PQN A;  3CK9 A;  4ZFH A;  1JPL A;  1XNQ T;  1BI8 B;  4IDQ A;  3G2U A;  4HWI B;  3VRB A;  3EHM A;  4GTO A;  3ASG A;  2C5J A;  3S7J A;  3MKR A;  5EK3 A;  2KCK A;  3RAU A;  4QXH B;  3WI3 A;  1KK7 A;  1Q2Z A;  1BR0 A;  5FZQ A;  4MLK A;  4J2C A;  3RQU A;  4JLE A;  4UXN B;  2LNI A;  2J9Q A;  3ZEF A;  4BET A;  2WQ6 A;  4J0U A;  4DUY T;  2D2S A;  3B7B A;  1WCR A;  3HXD A;  1NP7 A;  3U78 A;  2PL2 A;  5FXW A;  4J7W A;  4OFZ A;  3CR3 A;  3RLF F;  2BKK B;  3AG4 E;  4G1T A;  4GPM A;  3EHN A;  5LBM A;  3SFY A;  4DUI A;  1E8W A;  1R8I A;  4IRU A;  5LOZ A;  3X2Q E;  2W66 A;  3K8P C;  4DO0 A;  1LKX A;  3A5X A;  2MYO A;  1FPP A;  3FU3 A;  4YHJ A;  1K8K G;  1EDU A;  4BA9 A;  5BUZ A;  2L3L A;  3AE2 A;  3KVA A;  4ANV A;  3ZXS A;  4TXR A;  5FQ8 A;  3A8Y C;  2CHO A;  3PUZ F;  5JRC B;  2CHX A;  2EHO D;  1FMW A;  2HYZ A;  4ILU A;  1SQM A;  2J49 A;  2LSV A;  3SHF A;  1TJF A;  1MYO A;  4X1I E;  4WBN E;  3C3O A;  2DI4 A;  4GPK A;  1E8Z A;  3RIU C;  4JL0 A;  5LMU T;  2I2O A;  4LFB T;  4YJ3 E;  5EYP F;  1E8Y A;  4E7Z A;  1T8B A;  4H9P C;  2Z6E A;  3TWV A;  1MX6 A;  3FTS A;  4U63 A;  3DWL G;  5JA4 D;  5F5W A;  2JMH A;  3ANW A;  5FZR A;  5BV0 A;  3MYV A;  5L4E A;  2D0U A;  4K0K T;  3Q4A B;  3RIB A;  3JQ0 A;  2OVB A;  2WQ7 A;  1L0V A;  2BG9 E;  3IEE A;  2E9X B;  1H2U A;  1ZBP A;  4A3V A;  1LRZ A;  5DIZ A;  4DLQ A;  4PNI A;  2BED A;  3JYS A;  4ZI3 D;  3I9W A;  4X66 T;  2CFU A;  3PRE A;  3EIQ C;  2LSG A;  2HO1 A;  1E7P A;  1TNU A;  1TR4 A;  3OTO T;  2QRX A;  2V6Y B;  1IBM T;  4DX5 D;  4TXQ A;  3RPU A;  2DBA A;  3RQW A;  2H6F A;  5AQ9 A;  5AQQ B;  1B89 A;  2VGE A;  1DVP A;  2VUR A;  3FUF A;  3CHM A;  2LRK A;  4K0R A;  3OXL A;  3RH3 A;  1HG5 A;  4ZZC A;  4CT4 A;  2NC9 A;  3S7F A;  2DWG A;  2J47 A;  2QZA A;  1BD8 A;  3UM3 A;  1J1J A;  1EYH A;  3FH5 A;  3TWX A;  4BFR A;  3PZ3 A;  3UQ7 A;  1XMQ T;  3CHQ A;  4AY6 A;  4J8F A;  1M62 A;  3Q2M A;  2E2E A;  2XCC A;  3AAE B;  2EHO C;  2CBJ A;  2W0G A;  1WR6 A;  1A5E A;  4DX6 D;  5B1B E;  2Y48 B;  3QJZ A;  1NWM X;  5LNK A;  2WXJ A;  2JQH A;  4HFI A;  2WXM A;  3PUR A;  1HG2 A;  5JH7 E;  4BER A;  1MNE A;  4MFR A;  2BG9 C;  2WM9 A;  4GB9 A;  3U4T A;  3ABK E;  3W9F A;  3TLU A;  1KT0 A;  3NBX X;  2MAW A;  3FZK B;  3KEA A;  2VB6 A;  3ZIM A;  2R03 A;  4ZS2 A;  2XHE B;  5AQP B;  5CMW A;  1I6Z A;  1N0Q A;  2YQ8 A;  4U31 A;  3R6N A;  4G25 A;  4ANJ A;  2DYS E;  2H89 A;  4UV9 B;  3PUA A;  4GKK T;  5FXZ A;  5AQ7 A;  4O4I E;  3N9L A;  3X1D A;  2CA5 A;  2XZT G;  3EIJ A;  4EB6 E;  1W09 A;  3K3O A;  3T8K A;  4YSZ A;  2EIN E;  1K1A A;  4JI3 T;  3UIP C;  2DZO A;  4IE0 A;  1JNR A;  3P2B A;  3FWV A;  2E2A A;  5H6Q B;  4AKI A;  4PDX A;  5B3S E;  1UX5 A;  2YU1 A;  4L2Y A;  4BY6 A;  4CEM A;  3UQ4 A;  1UJK A;  3RU0 A;  1H2V C;  3PUJ A;  4G24 A;  4JI4 T;  1XGW A;  3L16 A;  5LG3 A;  5HEJ A;  4ILB A;  1OWL A;  2KXP C;  3ML8 A;  2L6B A;  2XPZ A;  3JCK C;  2YHE A;  3OAW A;  4GTP A;  4PW8 A;  5AQF B;  2XQA A;  4EGW A;  2OV9 A;  4HB5 A;  1TN8 A;  2ODV A;  1XNF A;  3AS5 A;  2E0I A;  3LJN A;  4QH1 A;  1LD8 A;  2WXQ A;  2XEV A;  2E9X D;  4L0R A;  4KBQ A;  3HKE E;  2K24 A;  3FHN A;  3ENE A;  2WXR A;  3ABL E;  3UT5 E;  3ULE G;  2VJ8 A;  3AE7 A;  5CMY A;  3F2E A;  2XGS A;  4H9R C;  1OCR E;  2V0P A;  3OYX A;  3RIF A;  2LRL A;  2KSR A;  4ZI7 E;  4LF5 T;  2V4L A;  2Q9Q A;  4QXC B;  3ZCI A;  2XPI A;  1OED C;  1BPO A;  3C72 A;  2BUG A;  4TRQ A;  5FVL A;  3RF1 A;  3TLW A;  3K3Q C;  4KMO A;  4B3T T;  5L2L A;  2DZN A;  4J8S A;  1S0P A;  1O5M A;  3ZN0 B;  4JEH A;  5LOV E;  4BT9 A;  2YDQ A;  5HXC A;  2BDE A;  3E37 A;  3CHP A;  2ODU A;  4I6G A;  4AJW A;  3KV4 A;  5FKY A;  3LBX B;  4EIW A;  3GYZ A;  1TNB A;  2X3M A;  3FTX A;  4NAC A;  2OV8 A;  4GTM A;  3MX3 A;  3W15 B;  3ZYM A;  3HA4 A;  1IJ6 A;  4A56 A;  3L09 A;  3FEX A;  4BJM A;  4DR4 T;  5HCJ A;  2LT3 A;  4WYV A;  3PEV B;  1MHQ A;  4LEU A;  3FHE A;  4NXM T;  2UXD T;  4YND A;  4O1P A;  4UV8 B;  4O2A E;  5KX5 E;  3LFM A;  1QLB A;  2OOE A;  5HKP A;  5JJT A;  3LDZ A;  3Q78 A;  3O9X A;  1N36 T;  5BPP A;  3RO3 A;  5E76 A;  1K1B A;  2X67 A;  1YQ4 A;  2XY8 B;  3HIZ A;  4DID B;  4ZEY A;  1X9B A;  4HN9 A;  2JQ9 A;  4G2V A;  2E9X C;  2A3D A;  4IDN A;  4ZZB A;  3Q5M A;  2N2N A;  2R05 A;  4L9P A;  3CQC B;  5LYJ E;  2V5D A;  1DNP A;  3ZVV A;  3LJ3 A;  5LCW C;  1N0R A;  3CST A;  5AEN A;  4QXB B;  3SO8 A;  3VTY A;  3V2O A;  4U07 A;  1YW0 A;  2IML A;  2KC7 A;  3KS2 A;  3TXN A;  1HE8 A;  3ASH A;  4HWF A;  4IE5 A;  5CA0 E;  5AQR B;  1JWF A;  3V5U A;  2IOS A;  1UG3 A;  1HNW T;  2IJG X;  3KAE A;  2MTQ A;  3I4G A;  2W4X A;  1Z6T A;  3Q9D A;  4L2L A;  1IBL T;  4JI0 T;  3CVU A;  5LMN T;  4JYA T;  5FY0 A;  1QNF A;  2VGX A;  1YXR A;  3RIU A;  3F57 A;  1UGO A;  1QYM A;  3C64 A;  5FIO A;  3OKQ A;  5AIJ A;  1G3N B;  3FTZ A;  1ZP0 A;  1HXI A;  4FLB A;  5T3R A;  2MYS A;  4CT0 A;  2X0H A;  4GYS A;  4U0S A;  2H6I A;  2VQE T;  4GYY A;  3FBZ A;  4CXW A;  4GA0 A;  3AAA B;  5LX8 A;  1NL4 A;  2QFC A;  3DEP A;  5IUX A;  4U7I A;  3CHO A;  4EEC A;  1CHU A;  2I1J A;  4JVS A;  3FB2 A;  5ARF A;  5JDF A;  4CZZ B;  3ASD A;  3IKO B;  5ENP D;  3PH0 C;  3MGB A;  4FHJ A;  3L54 A;  4DR5 T;  4CRW A;  5G04 J;  3UT4 A;  4TV8 E;  2V26 A;  3P4S A;  4L5G A;  2P2C P;  4JEH B;  1OWP A;  2IFU A;  3HL6 A;  3RX6 A;  1O1T A;  2PQR A;  3W9G A;  3OPC A;  3NZS A;  1MZC A;  5A1L A;  3ZU7 B;  2G0U A;  5CJ5 A;  3MV2 B;  3GN5 A;  3KFW X;  2K48 A;  3JQ1 A;  4RLY A;  2X0Y A;  3E08 A;  2XPY A;  5HXH A;  2WMO A;  3Q9N C;  4UWG A;  1ELK A;  1U2V G;  3O1J A;  2NSZ A;  4G26 A;  1BR4 A;  4ME2 A;  5LCY A;  5ETW A;  3VLF A;  3PNT B;  2JLB A;  3UU3 A;  3AJI A;  4GMJ A;  4CGV A;  3ASN E;  4TWD A;  3N2O A;  5CB4 E;  2P58 C;  3Q5E A;  4EED A;  4AM9 A;  2BS2 A;  4DRX E;  4IT4 A;  4X64 T;  3EDV A;  4CCA A;  3D3M A;  5JJ6 A;  2VVS A;  2EHO A;  4JEU A;  3QOF A;  3RKV A;  2XAQ B;  2XEE A;  2V5Q C;  2OCC E;  2VGY A;  1UUS A;  4N3C A;  4U04 A;  2GRO B;  1KNZ A;  2CG3 A;  2BG9 A;  3TLV A;  4HFG A;  4BTB A;  1U3D A;  4HOU A;  5BT1 A;  3GWH A;  4HWC A;  2XAF B;  2ZGD A;  4U33 A;  4QX8 B;  4I6J A;  2WDQ A;  5C3J A;  3URZ A;  2FI7 A;  4JI2 T;  5HQ8 A;  4GTT A;  1KPS B;  5L3B B;  3BK9 A;  4WNK A;  1HS7 A;  3EDU A;  1NEN A;  4KP3 C;  4A3T A;  4C91 A;  3MKD A;  1S94 A;  2QC9 A;  3C3R A;  3C5R A;  2YDS A;  4DND A;  5B1A E;  1NEK A;  3EAB A;  3ZMT B;  1O3X A;  2J62 A;  4HNA D;  4FP7 A;  3S7D A;  5BV1 A;  2XEH A;  3TWR A;  3GMI A;  1SVX A;  4ILI A;  2LOP A;  5ENT D;  3IF8 B;  3CX8 B;  3PUX F;  2YIN A;  4FUL A;  3TWQ A;  2W00 A;  2XS8 A;  1JUQ A;  3B13 A;  4UWK A;  2L9Q A;  3Q75 A;  4YY3 T;  1OUV A;  2MBG A;  5LHH B;  4AY5 A;  4B8C B;  4WNE A;  4O6F A;  5DQW A;  2V5F A;  3IA3 A;  3ZJ1 A;  2BTD A;  4JXT A;  1E7U A;  5ABH A;  2Q9Q D;  1N33 T;  3U3I A;  2DIW A;  3PDN A;  2P9U G;  3G2V A;  2ACZ A;  4ZXL A;  4X1Y E;  2A4Z A;  3V79 K;  1MIW A;  2CHW A;  2OND A;  4Y6W A;  1QUU A;  4JV5 T;  3E22 E;  4XBF B;  4XZ4 A;  3AVS A;  3LYA A;  2YK0 A;  1OED A;  1IHG A;  4YTN A;  4N5Q A;  4LER A;  3MJW A;  1MMA A;  3FZH B;  2XM1 A;  1QSD A;  5AN8 A;  3UU5 A;  4ANX A;  5LGU B;  3E0Z A;  3NZU A;  1H7C A;  4U0U A;  3CK7 A;  4EZL A;  2WXF A;  2KMF A;  3UMV A;  3PE0 A;  2VL0 A;  3AE5 A;  3UM2 A;  1HU3 A;  2KIN B;  5CGM A;  2WU5 A;  5EK2 A;  3SBS A;  4LF6 T;  5HWX A;  4OVV A;  4FJO A;  5DAB A;  5JRC A;  3PV0 F;  4PJJ A;  1NAF A;  2UU9 T;  3AA6 B;  1MMD A;  4DV0 T;  2V7J A;  4EOZ B;  3AE3 A;  3C4W A;  3C98 B;  3IBP A;  4B8A A;  2W61 A;  4P29 A;  2QYU A;  1QBQ A;  3LVQ E;  3UUL A;  2X0L B;  4DR1 T;  2AW6 A;  5FQ6 A;  3Q5W A;  4DUZ T;  4JHJ A;  3IHV A;  3JXI A;  2P9N G;  5T8I A;  4FA6 A;  2ETC A;  3AAA C;  5J08 A;  1MMN A;  3ABM E;  3N2K E;  2WZH A;  3I4R B;  5C1D A;  2E9X A;  3MKQ B;  3DJB A;  4IDZ A;  3PJA J;  4GCN A;  4EEB A;  3QB5 K;  2H6H A;  2CMR A;  4ATG A;  3GA8 A;  1UUR A;  2AJA A;  2V8S E;  4DV2 T;  4JI7 T;  3ZKJ A;  3QNU A;  5AQL B;  3I5P A;  3NVO A;  2V6Y A;  3D9L A;  4IYP A;  4WUY A;  3TGO A;  4AI6 A;  4G11 A;  1YCS B;  5LGN B;  1XMO T;  4J8Y A;  2KCV A;  4L1B A;  4CYM D;  1E90 A;  3M65 A;  2ION A;  3N5L A;  3DP7 A;  1S63 A;  4XI9 A;  3M3Z B;  5DBK A;  4OYK A;  3LXU X;  1INZ A;  3ZT7 A;  2ETA A;  4KT6 B;  3CVX A;  2IY0 C;  4DJA A;  4F1P A;  4AKL A;  2MOZ A;  3SQV A;  4ACL A;  3IV0 A;  3HXC A;  4N3B A;  4DV6 T;  4GCO A;  2X51 A;  1YKE B;  1OT8 A;  3AE1 A;  5AQV B;  5GON E;  4IST A;  3JCF A;  3ZMU B;  1LVK A;  4YTM A;  4EAH A;  2LSK A;  4TX5 A;  2AWI A;  2BKN A;  1JCQ A;  3EU9 A;  4JPS A;  4DX7 D;  3QAR A;  1XWM A;  2HR2 A;  4V1A v;  3TG4 A;  3PZ1 A;  1FCH A;  2NW7 A;  3MA9 A;  1OED B;  3KIN B;  2VSY A;  3QAQ A;  2LSI A;  4UUC A;  5H7P A;  4GYR A;  2IW5 B;  3P7I A;  5J90 A;  4P09 A;  3RYI E;  3UFG A;  2XHE A;  3I0Q A;  3SZ7 A;  4NUU A;  2VK9 A;  4F6R C;  4ZOL E;  4PFO A;  3ZLI A;  4HI8 A;  2RFM A;  4UVC B;  3GZS A;  1AWC B;  3UM0 A;  4HE8 A;  2RA1 A;  2WDV A;  2VKO A;  4YXD A;  3UU8 A;  4HRN A;  4UWH A;  3ZJ2 A;  3ASO E;  2W62 A;  5ANL A;  3SF4 A;  1D8E A;  3CX6 B;  3U3W A;  2W67 A;  3Q49 B;  3RRC A;  3RRN B;  3T8M A;  5EN5 D;  2E5L T;  1SHZ C;  2NYJ A;  3KBT A;  5E0O A;  3UU4 A;  1N4Q A;  2BBJ A;  1D0Y A;  1WLX A;  4HXI A;  4GTS A;  4NQ0 A;  5HEU A;  3H3A A;  2NWB A;  2FO7 A;  2WSS V;  4U8Y D;  4HFD A;  2LM9 A;  4CDN A;  3CEQ A;  4EZJ A;  1BR1 A;  2IOL A;  3FZF B;  3Q5D A;  4KVO A;  3EAM A;  3E34 A;  4AKH A;  1WG0 A;  2V7L A;  3DXM G;  5AAR A;  4N2S A;  3EHR A;  4IL9 A;  4Z68 A;  5L3D B;  1I94 T;  5FT9 A;  4GZ3 A;  2BZB A;  3L39 A;  2B0O E;  3SGH A;  4F3V A;  2HM8 A;  5HRY A;  2GRR B;  4RQI A;  5EX3 A;  2ZM0 A;  2YU2 A;  2XTL A;  1HFA A;  2V7M A;  3LVR E;  3CVQ A;  4ANW A;  4DLO A;  3HVE B;  4PUC A;  3PDY A;  4XZC A;  2P9K G;  4MLP A;  4JI8 T;  2IC6 A;  2MPK A;  5TAO A;  1T98 A;  2WP9 A;  1N4S A;  4URK A;  3MK7 C;  3HHM A;  1KEY A;  3TWW A;  3ZSS A;  3Q79 A;  3FU6 A;  4I6E A;  2WZI A;  4KYO B;  3MJX A;  4WNF A;  2CLY B;  1O1R A;  1UCU A;  4I0U A;  4ABN A;  3GW4 A;  1TN7 A;  1OXJ A;  2BKG A;  2UY1 A;  4XE0 A;  1Y01 A;  4U74 A;  2CBI A;  2V5C A;  1JNZ A;  5L4H A;  4KI0 F;  3DST A;  3CIR A;  2H3R A;  1HNX T;  4CI3 B;  4CN1 A;  2OA5 A;  4KUM B;  3LBX A;  5ENS D;  3H37 A;  1IHB A;  1HTJ F;  3PE3 A;  4DR7 T;  3KD7 A;  5AQI B;  2VKD A;  2UUA T;  3RJV A;  2KAT A;  2X38 A;  5CRV A;  5KJL A;  5JDQ A;  1WR0 A;  3FUD A;  2WXG A;  5C2T A;  2VL8 A;  3U66 A;  2Y4U A;  3T5X A;  4NUV A;  3ZMS B;  3FUK A;  4LUN U;  1AJ3 A;  4NIK A;  2H88 A;  1H0A A;  5FL1 A;  1DU2 A;  1OED E;  3ZKR A;  5CRU A;  2ZLY A;  2DYR E;  1YMP A;  4UIG A;  2K3W A;  2KLQ A;  5LBQ B;  5JDN A;  3AG3 E;  4H63 V;  3AEB A;  2X68 A;  3MZK B;  3ZMV B;  3T5V A;  2FUL A;  5CEC B;  3RYH E;  5JRE A;  3RKG A;  3BUA A;  4A1G A;  3ETU A;  4XI0 A;  3OVU A;  2FJA A;  4WNG A;  1T72 A;  3HI2 A;  2W2U A;  5AQH B;  2VSN A;  3AU5 A;  5ABE A;  4KMC A;  3PUY F;  3CGH A;  3QWW A;  3B57 A;  4PJL A;  3S7B A;  4GKJ T;  1D1C A;  4YDW A;  4P0B A;  3BEE A;  2X9H A;  4APO A;  1KFY A;  2PM7 A;  1D1B A;  3E30 A;  3CK6 A;  4H9O C;  5LFA A;  4UWF A;  4JD2 G;  3DRA A;  3D0T A;  4COF A;  1XZY A;  4LMK A;  2IDO B;  3KV5 A;  1WRD A;  4B6X A;  4DBQ A;  4JHK A;  3TLT A;  3VU7 H;  4TWF A;  5G04 C;  4YDY A;  2L0T B;  2ZU6 B;  4YFS A;  2P9S G;  4BWR A;  4Q25 A;  2UUC T;  3FP3 A;  1MIV A;  4IHJ E;  3H3M A;  2V1D B;  2XCB A;  4LCT A;  4CDM A;  2X6I A;  2F8X K;  2FO1 E;  1H6K A;  2WY2 A;  2MOW A;  4A55 A;  4MBG A;  2PTF A;  2B1E A;  2H7V C;  3ONJ A;  1KT1 A;  3SFZ A;  1N95 A;  4ILH B;  4I2Z A; 
#chains in the Genus database with same CATH homology
 5JR9 B;  4APF A;  2XRY A;  4WWP A;  3ZMZ B;  2HPL A;  2W63 A;  4WWO A;  2UY1 B;  3IHR A;  4ZS3 A;  4IE4 A;  4EZ4 A;  4O4J E;  5G05 J;  5JDH A;  4H7X A;  4I1A A;  2XRZ A;  2MHK A;  5KJN A;  5FXV A;  4EYY R;  3Q5X A;  3D9P A;  5KCM A;  4P0A A;  3CX7 B;  5AYW D;  3HDX A;  2CWO A;  4FJY A;  3E4B A;  3FTY A;  1IQR A;  2LAI A;  4N39 A;  3CWZ B;  4H7Y A;  3N9Q A;  4AV7 A;  5LG4 A;  2DNX A;  3ETV A;  2RG8 A;  4CXY A;  4GAA A;  1EF1 C;  5HWY A;  1B7T A;  3UUX B;  1GW6 A;  3QUJ A;  4EBA A;  2X9X A;  3ZN3 A;  3C4Z A;  3RK6 A;  4ACK A;  3U9W A;  3QK6 A;  4JA7 A;  1WYC A;  2L6J A;  3U64 A;  2VAS A;  3N2G E;  5F3J A;  4WND A;  2LOS A;  5LGT B;  4IIJ E;  2EQX A;  3VKH A;  3O4Z A;  4I2W A;  4UI9 J;  4N5C A;  2WQH A;  1Y8M A;  3EJN A;  2CLY C;  1KLX A;  1HF8 A;  4G2A A;  4O4H E;  3UT8 A;  3B7S A;  1IQU A;  3NF1 A;  3AB3 B;  2NTX A;  2I6H A;  3ESL A;  4I9C A;  3AAI A;  4HOR A;  2X9Y A;  3L3P A;  5C2Y A;  4NRH B;  2JJ9 A;  4IUL A;  2LSU A;  3B7T A;  1W3B A;  3QNK A;  2VKJ A;  3N9O A;  1WYB A;  5LP0 A;  5M72 A;  3G2S A;  2WWU A;  3VHL A;  3G2W A;  1S35 A;  5A23 A;  2CM0 A;  4OK0 A;  3FU5 A;  2ES0 A;  4BSX A;  4I17 A;  4UI9 K;  4NUR A;  3ZN1 B;  4MBQ A;  5LHG B;  1ZEE A;  2UWJ G;  2KZT B;  4U0Z A;  4XKB A;  3RC3 A;  4C90 A;  5FP3 A;  4X20 E;  2QA7 A;  3T8O A;  3I9Y A;  3OXG A;  1P5Q A;  4AP2 A;  3KVB A;  1Z3Y A;  1CUN A;  3SOL A;  3D9N A;  2FEZ A;  1EPU A;  5BMV E;  1U5P A;  3SS1 A;  2GGF A;  3F31 A;  3V5S A;  2OVF A;  4I55 E;  4XX5 A;  1D1A A;  5AJD A;  2JQQ A;  3ZPJ A;  4IE7 A;  4DMW A;  4HEA A;  3MZL B;  4L9I A;  4K03 A;  3NQP A;  3C98 A;  4AXH A;  5G55 A;  5FQ4 A;  2XUE A;  5FWQ A;  4HTE A;  3ZFW A;  3VTX A;  2M67 A;  2L8K A;  4X1K E;  1D0X A;  2WXL A;  1NZN A;  4FJZ A;  3CVY A;  1HO8 A;  3VKG A;  3D9I A;  4OVU A;  4ZHQ E;  5LJN A;  3MKQ A;  4CXX A;  2CWY A;  2NW8 A;  4ASK A;  3I3N A;  4ADZ A;  5JR9 C;  1Y64 B;  4CI2 B;  2RD0 A;  4Z8X A;  4ERR A;  3KBU A;  1VDY A;  1N54 A;  3TG5 A;  3LK3 B;  4GIW A;  3EDT B;  4DBR A;  1E8X A;  3PEU B;  3PNL B;  3MAC A;  1US7 B;  3GZ1 A;  3CHR A;  4UQZ A;  3HKC E;  4FAD A;  3C4X A;  2C0S A;  3RRM B;  4JA9 A;  4N2Q A;  2J07 A;  3UT7 A;  1SA0 E;  2Y3A A;  3TL5 A;  3VLD A;  3RO2 A;  5LCW J;  3UTK A;  3SWH A;  1FMV A;  3AVR A;  3MA5 A;  2LEH A;  5FNV E;  3FUI A;  3PVL A;  4FHK A;  4TN7 B;  3CQX C;  3LKU A;  4JZY A;  1LVF A;  5L3F B;  4AOF A;  3UUN A;  2MRI A;  3PZD A;  3FXD B;  2P9B A;  3NRX A;  2XQ0 A;  1NA0 A;  3ZHE B;  5JVD E;  4EZH A;  3MCX A;  3NZP A;  3CQG B;  2ILR A;  2CFZ A;  4GYW A;  4JHR A;  1MND A;  2JMK A;  2VYI A;  4E7S A;  3Q15 A;  5JHA A;  4DVD A;  2XAS B;  2FF4 A;  5HXS A;  4Q94 A;  2AVP A;  3L08 A;  4I43 B;  5DJQ C;  3LS8 A;  3IHY A;  3G2T A;  2C0L A;  4B94 A;  5ADX L;  3PRZ A;  5JJ7 A;  4FC8 A;  3QC1 A;  3CK8 A;  3AA1 B;  4MKT A;  1H19 A;  2DWK A;  4MAL A;  2CXF A;  4AQF C;  4F53 A;  5BNW A;  4EXT A;  1WAO 1;  1D0Z A;  2CE7 A;  4XAX B;  4D10 C;  5F8P A;  1VRB A;  1MMG A;  3ULQ A;  2JPF A;  4HOS A;  4PK5 A;  3HVE A;  4UF0 B;  1HX8 A;  4CGW A;  1PY1 A;  4UQY A;  2WXK A;  5LA6 E;  3CV0 A;  4C0M A;  2CXD A;  2C0M A;  1SZA A;  3LK4 2;  5L3G B;  3TXM A;  1UN8 A;  3CLJ A;  4UVB B;  5HXE A;  2YEV C;  4KZC A;  3ONX A;  2PJQ A;  2WXP A;  3OBV E;  4PS3 A;  1FVH A;  3TKL B;  4JW1 A;  3ZCJ A;  3FBL A;  2GRM A;  2WAU A;  3BQI A;  2I1K A;  3CSF A;  3ZPO A;  2PG8 A;  4PS8 A;  4GOU A;  2I59 A;  3AS8 A;  1N52 A;  3PTR B;  4HLE A;  4RG9 A;  2LSY A;  4GZC A;  4QFV A;  5A6C A;  1VOM A;  5L3C B;  4EQF A;  4H63 H;  2KCL A;  2ACX A;  2Y6X A;  3PUG A;  1OWO A;  3ZC1 A;  4AKG A;  2WMN A;  2VSO E;  1SZ9 A;  3QKY A;  4TZ4 C;  2VQ2 A;  4G23 A;  4EBA G;  3N9M A;  1HZ4 A;  1HCI A;  2HH7 A;  4IE6 A;  2R59 A;  2AXV A;  2LJL A;  5CHE E;  2LHN A;  2AXZ A;  1E96 B;  3J9X 1;  4KZ0 A;  4C9B B;  2BF0 X;  3HKB E;  5G2N A;  4C0E A;  2N9D A;  2HPJ A;  5HYA A;  3LY9 A;  3UFE A;  3APD A;  3D9K A;  3S2A A;  3BG1 B;  4HVB A;  3L13 A;  3L17 A;  3LPZ A;  3ZGQ A;  3LK2 B;  4KVM A;  2Y4T A;  4R7L A;  5AFU L;  4TUY E;  2XQY A;  3LEW A;  3L6A A;  3QWP A;  5FJY A;  4EZK A;  3HYM B;  2CEA A;  2JRK A;  4ISS A;  1G73 A;  2GW1 A;  3ZC0 A;  4YJ2 E;  3ML9 A;  3ZYL A;  3FFL A;  3ONK A;  4PH4 B;  2GRL A;  3R7R A;  4UQX A;  2CXL A;  5KMG P;  5G05 C;  3SD5 A;  3L22 A;  4RG6 A;  2C5K T;  2CHZ A;  4J8D A;  3UUM A;  3RRU A;  2J4D A;  5JR9 A;  4LRZ A;  5L3E B;  3QC9 A;  3ZRH A;  3QWV A;  1U4Q A;  1QZ2 A;  2DCP A;  4OYS A;  4FU3 A;  4WWN A;  3JC6 D;  3D9O A;  4OHF A;  5J2U E;  4WBO A;  3FUH A;  2IC9 A;  1ZV4 X;  4I1M A;  1ZU2 A;  3CVV A;  3MEK A;  3CKB A;  4TUU A;  3MV3 B;  4DPR A;  5FTP A;  4GA1 A;  4CI1 B;  4G63 A;  2J4B A;  4PS7 A;  5FQ7 A;  2UXX B;  4XKC A;  4BTA A;  3CKD A;  4F7A A;  5CA1 E;  5HI7 A;  3UUX A;  3TAX A;  4UI9 C;  2N1G A;  3ZEF B;  2K9A A;  3HR0 A;  4FI5 A;  2LAH A;  3ASF A;  4W9R A;  5A7D B;  4AXP A;  5FY1 A;  1X5B A;  5EX0 A;  5JDL A;  3AA0 B;  4PJN A;  4AEZ C;  3PUQ A;  5FXX A;  4UEL A;  3FTU A;  4M1P A;  2GK9 A;  2PZI A;  1Z0P A;  2LSJ A;  2CG2 A;  2VSX E;  3SRZ A;  4KBM B;  3LG7 A;  1QQE A;  3N9P A;  1WY6 A;  3KDS E;  1JWG A;  3CVL A;  2KM4 A;  4ZI3 C;  4DI3 A;  2KWI B;  3RRW A;  2M63 A;  3CVW A;  1ZHC A;  3JC6 C;  1IJ5 A;  3O1I A;  3O1H A;  2X6H A;  4GZ6 A;  3LJC A;  4AQF A;  5FMN A;  2A2F X;  2V7K A;  1OWM A;  3PE4 A;  5LHI B;  3ANW B;  1L5J A;  2Y8D A;  2DCF A;  2NOX A;  4Y6C A;  4DI4 A;  4GK0 E;  1ELR A;  2YNQ A;  4KXK B;  3BQK A;  4PFP A;  2WXN A;  4GZ5 A;  3KV9 A;  1V9D A;  2KZT A;  4ANU A;  2KND A;  2X9W A;  4I1O B;  4QHO A;  4HS2 A;  3WAK A;  5LP6 E;  5D0Q D;  4ZI2 D;  1E7V A;  5D0O D;  3SNX A;  3BG0 B;  4H9N C;  4F1S A;  4EPZ A;  3PUK A;  3O4X E;  3FU0 A;  3LY7 A;  2NTY A;  3SBT B;  1BR2 A;  3UQ3 A;  5FYM A;  3K9I A;  3MXZ A;  3J7Y q;  5JDM A;  3RYF E;  3LCA A;  4B89 A;  2ZM8 A;  3NZQ A;  4ILG A;  4K0U A;  3JUI A;  5KDM C;  3CIA A;  5FZS A;  3I0O A;  3Q47 B;  5ANR A;  5FY7 A;  2J08 A;  2QGS A;  4E85 A;  3GZ2 A;  4N78 D;  4YVO A;  1UJJ A;  1FEW A;  4AVX A;  1WM5 A;  4YVQ C;  3PS6 A;  2DLR A;  5LJM A;  1G8X A;  3P8C D;  3DBS A;  5C8Y E;  3D9M A;  4BX8 A;  4I4T E;  2WPV A;  4GZD A;  4BX9 A;  4RSY A;  3CML A;  4HGA A;  1FVF A;  5HXR A;  3ESK A;  3OJA A;  5IHY A;  1HS6 A;  4MS6 A;  3BQL A;  3RKO A;  3QK0 A;  2WBL A;  3APF A;  4BJN A;  1PAQ A;  4IGU A;  2NW9 A;  4ZI2 C;  1YA0 A;  3FUL A;  3K3N A;  3PU8 A;  1IAP A;  1UX4 A;  4DMV A;  5DQV A;  5ARG A;  2ZMA A;  3WXX A;  2K5B B;  2NP9 A;  2KT9 A;  2J1D G;  3LY8 A;  1E1H B;  3FXE B;  3IBE A;  2BVM A;  3DTO A;  4AQG A;  2D0T A;  4N3A A;  4PK6 A;  3D9J A;  2Q9Q B;  3ZHE A;  4B0Z A;  3TJP A;  4M3O A;  2C5I T;  4HFV A;  4GK5 E;  2X6J A;  4DK5 A;  3VLE A;  4O4L E;  2ZM2 A;  2XAH B;  2Q7F A;  5KJK A;  2CCQ A;  3PU3 A;  4UWL A;  3QOU A;  2J09 A;  4I43 A;  3FH8 A;  3AU4 A;  3B7U X;  4O8S A;  1PC2 A;  3DPD A;  5E75 A;  2WB2 A;  2PFV A;  1EZ3 A;  3B7R L;  3FDH A;  4AKR B;  4AIF A;  4TV9 E;  4GML A;  3UPV A;  3OXF A;  5ENN A;  1Z3X A;  3KEZ A;  4H9Q C;  4Q96 A;  3QB2 A;  5CCM A;  4HOQ A;  1X79 A;  4TV3 A;  2VTB A;  1NA3 A;  3AS4 A;  2IU1 A;  4UF0 A;  4PK4 A;  4E6H A;  5CCL A;  1FIO A;  5LXT E;  2IAK A;  3SI5 A;  1IZN B;  2A72 A;  3NRY A;  1MQS A;  1TJC A;  2IF4 A;  2XGM A;  2XGO A;  4GU5 A;  2XAJ B;  4RVB A;  3CVP A;  5H6R B;  3CVN A;  2X6K A;  2C2L A;  4QX7 B;  3FTW A;  4U72 A;  5EZY E;  4QWN B;  4H9S E;  3I1A A;  2H7O A;  2NXP A;  5M4Y A;  3AA7 B;  4GA2 A;  2DHR A;  2X6F A;  3N9N A;  2X66 A;  5JQG E;  4FLH A;  1ELW A;  1Y6I A;  2VGX B;  3R7Q A;  1ZKE A;  2LE8 A;  4L23 A;  3EUH A;  2BVL A;  4I50 E;  2VWA A;  3HKD E;  3ZYK A;  3OYZ A;  3QDN A;  2IQC A;  5AJL A;  3RYC E;  5BW8 C;  3CVR A;  4OYJ A;  4L7T A;  4UVA B;  2A5U A;  4A1S A;  3C50 A;  1YD8 G;  3FUN A;  4J8E A;  3FUM A;  2LHR A;  1OWN A;  3C51 A;  3APC A;  2QY7 A;  3P1U A;  4MHC A;  4QKN A;  3R9A B;  4I9E A;  2R17 C;  4J6I A;  4MRU A;  2JEK A;  1UW4 B;  3FY4 A;  3WAJ A;  1OWA A;  2AXU A;  3GN5 B;  5EK4 A;  3FTV A;  4Q69 A;  1OXZ A;  3O48 A;  4O2B E;  3N71 A;  2KZ7 B;  5J1G A;  4WW0 A;  5JHB A;  1U3C A;  3CPZ A;  3S4U A;  1A17 A;  3IEG A;  5J2T E;  2KWH A;  2UXN B;  3FEY A;  4IN3 B;  4XIF A;  1TEZ A;  3EVY A;  4V3I A;  2E8I A;  2EHO B;  4JEU B;  3FH7 A;  2VKH A;  2V7I A;  2VTB B;  5KJM A;  4PAG A;  2PM6 A;  2FBN A;  4EYU A;  5T4Y A;  4PJM A;  4YLH A;  4UEM A;  2XAG B;  3CKC A;  5EKQ D;  2RP4 A;  3ONL A;  4WAF A;  3OTN A;  1H2T C;  5IYZ E;  3ZW3 A;  4CQI A;  5JDG A;  2I9C A;  4HKA A;  4GYO A;  5HAX A;  3RC8 A;  5EDS A;  2Q9Q C;  2L9B A;  2SPC A;  3UX4 A;  2WXO A;  2L0I A;  2WXH A;  4BAY B;  1MIY A;  3R84 B;  4JUY A;  1IYG A;  3FUE A;  1UN9 A;  4CDR A;  2WXI A;  3FUJ A;  3ZYQ A;  4U8H A;  3PUS A;  4JC8 A;  2PBI A;  1HH8 A;  2YHC A;  3CHS A;  1YKH B;  2WVI A;  2LO6 A;  4HOT A;  2KXP B;  3KV6 A;  2R5S A;  4BT8 A;  1LF8 A;  2D5U A;  2PQN A;  3CK9 A;  1JPL A;  3G2U A;  3EHM A;  3ASG A;  2C5J A;  3S7J A;  3MKR A;  5EK3 A;  2KCK A;  4QXH B;  3WI3 A;  1KK7 A;  1BR0 A;  5FZQ A;  4MLK A;  4J2C A;  4JLE A;  4UXN B;  2LNI A;  2J9Q A;  3ZEF A;  2WQ6 A;  4J0U A;  2D2S A;  1NP7 A;  3U78 A;  2PL2 A;  5FXW A;  4OFZ A;  3CR3 A;  4G1T A;  3EHN A;  5LBM A;  1E8W A;  4IRU A;  5LOZ A;  3K8P C;  4DO0 A;  1LKX A;  3A5X A;  3FU3 A;  4YHJ A;  1EDU A;  4BA9 A;  5BUZ A;  2L3L A;  3KVA A;  4ANV A;  3ZXS A;  5FQ8 A;  5JRC B;  2CHX A;  2EHO D;  1FMW A;  2HYZ A;  4ILU A;  1SQM A;  2J49 A;  2LSV A;  3SHF A;  1TJF A;  4X1I E;  4WBN E;  2DI4 A;  4GPK A;  1E8Z A;  4JL0 A;  2I2O A;  4YJ3 E;  1E8Y A;  4E7Z A;  4H9P C;  2Z6E A;  3FTS A;  4U63 A;  2JMH A;  3ANW A;  5FZR A;  5BV0 A;  3MYV A;  2D0U A;  3Q4A B;  3RIB A;  3JQ0 A;  2OVB A;  2WQ7 A;  3IEE A;  2E9X B;  1H2U A;  1ZBP A;  4A3V A;  1LRZ A;  5DIZ A;  4DLQ A;  4PNI A;  3JYS A;  4ZI3 D;  3I9W A;  2CFU A;  3PRE A;  3EIQ C;  2LSG A;  2HO1 A;  3RPU A;  2DBA A;  1B89 A;  1DVP A;  3FUF A;  3CHM A;  4K0R A;  3OXL A;  3RH3 A;  1HG5 A;  4CT4 A;  2NC9 A;  3S7F A;  2DWG A;  1EYH A;  3FH5 A;  4BFR A;  3CHQ A;  4AY6 A;  4J8F A;  3Q2M A;  2E2E A;  2XCC A;  3AAE B;  2EHO C;  2W0G A;  1WR6 A;  2Y48 B;  3QJZ A;  1NWM X;  5LNK A;  2WXJ A;  2WXM A;  3PUR A;  1HG2 A;  5JH7 E;  1MNE A;  4MFR A;  2WM9 A;  4GB9 A;  3U4T A;  1KT0 A;  3NBX X;  2VB6 A;  3ZIM A;  4ZS2 A;  2XHE B;  5CMW A;  2YQ8 A;  3R6N A;  4G25 A;  4ANJ A;  4UV9 B;  3PUA A;  5FXZ A;  4O4I E;  3N9L A;  2CA5 A;  3EIJ A;  4EB6 E;  3K3O A;  4IE0 A;  3P2B A;  3FWV A;  5H6Q B;  4AKI A;  4PDX A;  1UX5 A;  2YU1 A;  4L2Y A;  4BY6 A;  4CEM A;  1UJK A;  3RU0 A;  1H2V C;  3PUJ A;  4G24 A;  1XGW A;  3L16 A;  3ML8 A;  1OWL A;  2XPZ A;  3JCK C;  2YHE A;  3OAW A;  4PW8 A;  2ODV A;  1XNF A;  3AS5 A;  2E0I A;  2WXQ A;  2XEV A;  2E9X D;  4L0R A;  4KBQ A;  3HKE E;  2K24 A;  3FHN A;  3ENE A;  2WXR A;  3UT5 E;  2VJ8 A;  5CMY A;  3F2E A;  2XGS A;  4H9R C;  2V0P A;  3OYX A;  4ZI7 E;  2V4L A;  2Q9Q A;  4QXC B;  3ZCI A;  2XPI A;  1BPO A;  2BUG A;  4TRQ A;  3K3Q C;  4KMO A;  5L2L A;  4J8S A;  1S0P A;  3ZN0 B;  4JEH A;  5LOV E;  4BT9 A;  5HXC A;  2BDE A;  3CHP A;  2ODU A;  4I6G A;  4AJW A;  3KV4 A;  3LBX B;  4EIW A;  3GYZ A;  2X3M A;  3FTX A;  4NAC A;  2OV8 A;  3MX3 A;  3W15 B;  3ZYM A;  3HA4 A;  1IJ6 A;  4A56 A;  3L09 A;  3FEX A;  4BJM A;  2LT3 A;  3PEV B;  1MHQ A;  4LEU A;  3FHE A;  4YND A;  4UV8 B;  4O2A E;  5KX5 E;  3LFM A;  2OOE A;  5JJT A;  3LDZ A;  3O9X A;  5BPP A;  3RO3 A;  5E76 A;  2X67 A;  3HIZ A;  4HN9 A;  4G2V A;  2E9X C;  2A3D A;  3Q5M A;  2N2N A;  3CQC B;  5LYJ E;  1DNP A;  3ZVV A;  3LJ3 A;  5LCW C;  3CST A;  5AEN A;  4QXB B;  3VTY A;  4U07 A;  1YW0 A;  2KC7 A;  3KS2 A;  3TXN A;  1HE8 A;  3ASH A;  4IE5 A;  5CA0 E;  1JWF A;  3V5U A;  2IOS A;  1UG3 A;  2IJG X;  3KAE A;  2MTQ A;  3I4G A;  1Z6T A;  3Q9D A;  4L2L A;  3CVU A;  5FY0 A;  1QNF A;  2VGX A;  3F57 A;  5AIJ A;  3C64 A;  3OKQ A;  3FTZ A;  1HXI A;  4FLB A;  5T3R A;  2MYS A;  4CT0 A;  4GYS A;  4U0S A;  4GYY A;  3FBZ A;  4CXW A;  4GA0 A;  3AAA B;  5LX8 A;  2QFC A;  3CHO A;  4EEC A;  2I1J A;  4JVS A;  3FB2 A;  5ARF A;  5JDF A;  4CZZ B;  3ASD A;  3IKO B;  3PH0 C;  3MGB A;  4FHJ A;  3L54 A;  4CRW A;  5G04 J;  3UT4 A;  4TV8 E;  2V26 A;  4L5G A;  4JEH B;  1OWP A;  2IFU A;  3HL6 A;  3RX6 A;  2PQR A;  3NZS A;  5A1L A;  3MV2 B;  2G0U A;  3GN5 A;  3KFW X;  2K48 A;  3JQ1 A;  3E08 A;  2XPY A;  5HXH A;  2WMO A;  4UWG A;  1ELK A;  4G26 A;  3O1J A;  2NSZ A;  1BR4 A;  4ME2 A;  5LCY A;  5ETW A;  3VLF A;  3PNT B;  2JLB A;  4GMJ A;  4CGV A;  3N2O A;  5CB4 E;  2P58 C;  4AM9 A;  3EDV A;  4CCA A;  3D3M A;  5JJ6 A;  2EHO A;  4JEU A;  3RKV A;  2XAQ B;  2VGY A;  4N3C A;  4U04 A;  1KNZ A;  2CG3 A;  4HFG A;  4BTB A;  1U3D A;  4HOU A;  5BT1 A;  3GWH A;  2XAF B;  4QX8 B;  4I6J A;  3URZ A;  2FI7 A;  5HQ8 A;  5L3B B;  3BK9 A;  4WNK A;  1HS7 A;  3EDU A;  4A3T A;  4KP3 C;  4C91 A;  3MKD A;  1S94 A;  4DND A;  3ZMT B;  1O3X A;  4FP7 A;  3S7D A;  5BV1 A;  3GMI A;  4ILI A;  2LOP A;  3IF8 B;  3CX8 B;  2YIN A;  4FUL A;  2W00 A;  1JUQ A;  3B13 A;  4UWK A;  2L9Q A;  1OUV A;  2MBG A;  5LHH B;  4AY5 A;  4B8C B;  4WNE A;  4O6F A;  5DQW A;  2V5F A;  3ZJ1 A;  2BTD A;  4JXT A;  1E7U A;  2Q9Q D;  3U3I A;  2DIW A;  3PDN A;  3G2V A;  4X1Y E;  2A4Z A;  1MIW A;  2CHW A;  2OND A;  4Y6W A;  1QUU A;  3E22 E;  4XBF B;  4XZ4 A;  3AVS A;  3LYA A;  2YK0 A;  1IHG A;  4LER A;  3MJW A;  1MMA A;  1QSD A;  4ANX A;  5LGU B;  3E0Z A;  3NZU A;  1H7C A;  4U0U A;  3CK7 A;  4EZL A;  2WXF A;  2KMF A;  3UMV A;  3PE0 A;  1HU3 A;  2KIN B;  5EK2 A;  3SBS A;  4OVV A;  5HWX A;  4FJO A;  5DAB A;  5JRC A;  4PJJ A;  1NAF A;  3AA6 B;  1MMD A;  2V7J A;  4EOZ B;  3C4W A;  3C98 B;  3IBP A;  4B8A A;  2W61 A;  4P29 A;  3LVQ E;  3UUL A;  2X0L B;  2AW6 A;  5FQ6 A;  3Q5W A;  4JHJ A;  3IHV A;  5T8I A;  4FA6 A;  5J08 A;  1MMN A;  3N2K E;  3I4R B;  5C1D A;  2E9X A;  3MKQ B;  3DJB A;  4IDZ A;  4GCN A;  4ATG A;  2CMR A;  3GA8 A;  2V8S E;  3I5P A;  3D9L A;  4IYP A;  4WUY A;  3TGO A;  4AI6 A;  4G11 A;  5LGN B;  4L1B A;  2KCV A;  1E90 A;  3M65 A;  2ION A;  3N5L A;  3DP7 A;  4XI9 A;  5DBK A;  4OYK A;  3LXU X;  1INZ A;  4KT6 B;  3CVX A;  4DJA A;  4AKL A;  2MOZ A;  4ACL A;  3IV0 A;  4N3B A;  4GCO A;  2X51 A;  1YKE B;  5GON E;  4IST A;  1LVK A;  3ZMU B;  4EAH A;  2LSK A;  4TX5 A;  2AWI A;  4JPS A;  3QAR A;  2HR2 A;  4V1A v;  3TG4 A;  1FCH A;  2NW7 A;  3MA9 A;  3KIN B;  2VSY A;  3QAQ A;  2LSI A;  4GYR A;  2IW5 B;  3P7I A;  5J90 A;  4P09 A;  3RYI E;  2XHE A;  3I0Q A;  3SZ7 A;  4NUU A;  2VK9 A;  4F6R C;  4ZOL E;  4PFO A;  3ZLI A;  4UVC B;  3GZS A;  4HE8 A;  2RA1 A;  2VKO A;  4UWH A;  3ZJ2 A;  2W62 A;  5ANL A;  3SF4 A;  3CX6 B;  3U3W A;  3Q49 B;  3RRC A;  3RRN B;  3T8M A;  1SHZ C;  3KBT A;  5E0O A;  1D0Y A;  1WLX A;  4HXI A;  4NQ0 A;  3H3A A;  2NWB A;  2FO7 A;  2WSS V;  2LM9 A;  4CDN A;  3CEQ A;  4EZJ A;  1BR1 A;  2IOL A;  4KVO A;  4AKH A;  2V7L A;  4N2S A;  5L3D B;  5FT9 A;  4GZ3 A;  2BZB A;  4F3V A;  3SGH A;  2HM8 A;  5EX3 A;  2ZM0 A;  2YU2 A;  2XTL A;  1HFA A;  2V7M A;  3LVR E;  3CVQ A;  4ANW A;  4DLO A;  3HVE B;  4PUC A;  3PDY A;  4XZC A;  4MLP A;  2IC6 A;  5TAO A;  1T98 A;  4URK A;  3MK7 C;  3HHM A;  3FU6 A;  4I6E A;  4KYO B;  3MJX A;  4WNF A;  2CLY B;  1UCU A;  4ABN A;  3GW4 A;  2UY1 A;  4XE0 A;  4U74 A;  2H3R A;  4CI3 B;  2OA5 A;  4KUM B;  3LBX A;  3H37 A;  1HTJ F;  3PE3 A;  3KD7 A;  2VKD A;  3RJV A;  2KAT A;  2X38 A;  5KJL A;  5JDQ A;  3FUD A;  2WXG A;  2VL8 A;  3U66 A;  2Y4U A;  3T5X A;  4NUV A;  3ZMS B;  3FUK A;  4LUN U;  1AJ3 A;  1H0A A;  2ZLY A;  4UIG A;  2KLQ A;  5LBQ B;  5JDN A;  4H63 V;  2X68 A;  3MZK B;  3ZMV B;  3T5V A;  2FUL A;  3RYH E;  5JRE A;  4A1G A;  3ETU A;  4XI0 A;  4WNG A;  3HI2 A;  2VSN A;  3AU5 A;  4KMC A;  3CGH A;  3QWW A;  3B57 A;  4PJL A;  3S7B A;  1D1C A;  4P0B A;  3BEE A;  2X9H A;  4APO A;  2PM7 A;  1D1B A;  4H9O C;  5LFA A;  4UWF A;  3D0T A;  3KV5 A;  1WRD A;  4B6X A;  4DBQ A;  4JHK A;  3VU7 H;  5G04 C;  2L0T B;  2ZU6 B;  4YFS A;  4BWR A;  3FP3 A;  1MIV A;  4IHJ E;  2V1D B;  2XCB A;  4LCT A;  4CDM A;  2X6I A;  1H6K A;  4A55 A;  2MOW A;  2B1E A;  2H7V C;  1KT1 A;  3SFZ A;  4ILH B;  4I2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...