3CQGB

Nucleoporin nup107/nup133 interaction complex, delta finger mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
184
Chain Sequence
LSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDENINDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADFEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 184
sequence length 222
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqgB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqgB02
3CQCB 3CQGB 3I4RB
chains in the Genus database with same CATH superfamily
2H6HA 2WXQA 4ILIA 1KT1A 4RSYA 5E75A 4DR1T 2XASB 2WDRA 4YDWA 4K0KT 3EHNA 3KSQA 5G05C 4BESA 3SOLA 2BS3A 3G2UA 3URZA 3J9X1 4CI2B 3ESLA 4UWFA 3UFEA 4YJ3E 3D9HA 3FU0A 2WXPA 4M7CA 3N9LA 4V3IA 4LMLA 3P8CD 1FEWA 2OCCE 3PH0C 3TWWA 4LFBT 1WRDA 3AE3A 4NPPA 2ZIRA 5FXWA 3O4ZA 4L2YA 3PE3A 3MV2B 2CRBA 3FH7A 3S7JA 5FINA 2OV9A 3QOUA 4HWHA 3MZLB 1LRZA 3T5XA 5CCMA 4BX8A 5LCYA 5GONE 4U74A 3AEBA 3TG5A 3UT8A 5FKYA 4IDNA 5ABFA 2KINB 5L4EA 4LMJA 4OAVB 2V7KA 3KEZA 3V30A 1JUQA 3FUKA 2RKKA 2XZEA 2X9WA 1V9DA 4LF4T 1KNPA 2VASA 3LEWA 3CVNA 2WCAA 3B7UX 1U5PA 4I4TE 2AVPA 2XEHA 5EN5D 3GN5B 4E7SA 2PBIA 1M7KA 2L6BA 3NRXA 4NIKA 4OYKA 4ILAA 2BS4A 3F57A 3ZN1B 2MBGA 2KATA 3FFLA 4UWGA 5AQVB 3OAWA 3DBSA 4HFVA 1IKND 4EZ4A 4BWRA 4XAXB 2DBAA 3T9KA 3I9WA 4YHHT 3P4PA 2WAUA 5EX0A 2YK0A 4O60A 1IYGA 1J5ET 2WXGA 1PY1A 2LSYA 3NRYA 2EINE 3EJNA 2KZTA 4J8FA 3O1IA 4I6JA 5LBQB 2Y3AA 2J4BA 3CSFA 2XPZA 4OHFA 3R7QA 1TJFA 2VL0A 3RX6A 1YA0A 4L5GA 3PREA 4KMCA 3OJAA 1ZEEA 4X1IE 3DPYA 3FU5A 4AP2A 3UUBA 3RPUA 4MALA 4UWLA 5CGMA 2UXBT 4FLBA 1L5JA 1NFIE 2W2UA 2C0MA 4GA2A 3T8KA 4DMVA 3AE1A 5JREA 4CT0A 5C8YE 2UWJG 3PUSA 3IHYA 2WVIA 4CGVA 3ULYA 4A3TA 3TLWA 2LOPA 2E9XA 2C2LA 3AEFA 1LF8A 3KSLA 4EOZB 1SUMB 2ODUA 2L9QA 1D1AA 3PEVB 3UM3A 3U3WA 3NOGD 2V5CA 5HXSA 4PS7A 3PURA 4ILGA 4ANJA 5AENA 2KBXA 3O4XE 4BJNA 3PZ2A 4L1BA 1KZOA 3FUMA 3IEGA 4RLYA 4B94A 2XQ5A 2OLTA 3RRUA 4AY5A 3CGHA 3ONXA 4L23A 4PK5A 4UI9C 3FUHA 3ZEFB 3FEXA 4AXPA 2AJAA 3ZHEA 3ZKRA 3JQ0A 2FJBA 2D5UA 2XJ7A 3Q7FA 2JIWA 3BU8A 2NR4A 1O3XA 3AVRA 5ENPD 2YDSA 5LG4A 2BKOA 3I4GA 4JEHA 5AQOB 5CMYA 3G2SA 4ANWA 4WNKA 3L22A 4GYSA 1TR4A 3OYXA 2UXCT 4I55E 2JQ9A 2YN6A 3WAJA 4G25A 1H2VC 4Q96A 2PZIA 1EZ3A 1HX8A 4IDOA 5HEHA 3AB3B 3SFDA 3AA0B 3M3ZB 4ASKA 2XAQB 2BVLA 3QNKA 5BW8C 1UK5A 3FHNA 2WQ7A 4G1TA 4Q25A 1QZ2A 4I6GA 4AKHA 3LDQB 3ZMTB 4HFGA 4C90A 3EHZA 2KCLA 3LPZA 3UUMA 1OY3D 5LHIB 1US7B 3I0QA 4DR5T 4GCNA 4AIFA 3MEKA 3Q7AA 5HYAA 1N9AA 4GMRA 1QBQA 3HKCE 3LCAA 3HRAA 4JL0A 4QH5A 4G8KA 4E85A 2XHEA 4K03A 4I17A 3RRNB 3ZUVB 3ZCJA 2XGMA 4GK0E 3PZ4A 5E0OA 2VSOE 3CKDA 2YOEA 2RPAA 2JMKA 1N4PA 3SFXA 2XQYA 1IQRA 2QY7A 4J0UA 5ARGA 2NTYA 3Q5MA 4XZ4A 3SS1A 3PZ3A 4CRWA 1W0BA 4PNIA 2JJ9A 4A63B 1MNEA 2YNQA 2R59A 2NW9A 3KFWX 4EBAA 1SZ9A 2FI7A 4ZS2A 4AQGA 3D9LA 5ABHA 3DJBA 3K3QC 2WXFA 2NXPA 1W09A 1UCUA 3FXEB 3Q9UC 4WUYA 2XQ6A 3GW4A 4G23A 4PJNA 3E4BA 5LJMA 4J8SA 2L0IA 1MMDA 2CLYB 3SQVA 2EIKE 3SHFA 4AKRB 3L8RA 3CHOA 3LDZA 5BUZA 4XKCA 1WM5A 5FY0A 3EAMA 2MYSA 4KYOB 3EHQA 1ZKEA 4X20E 4JI8T 2WM9A 1YD8G 4NXMT 4NACA 2W67A 4LF7T 1HTJF 4WZXA 4DUZT 1LKXA 2G0UA 5B1AE 5HKPA 4DR3T 1IAPA 3Q47B 5J90A 4JHRA 2GGFA 1A5EA 1H2UA 5HAXA 1NENA 2VGEA 4N3BA 4FU3A 2YU2A 4FADA 3EU9A 1NL4A 2IMLA 3HKEE 2P9IG 3QJZA 3AE6A 1MYOA 3G2WA 5CA1E 3ONLC 3HA4A 4UF0B 4IYPA 4AISA 4DI4A 4JI6T 2CWOA 4O8SA 2A3DA 2F37A 2JPFA 3ZKJA 1UJKA 2UUCT 3UUXA 3C4ZA 2E5LT 4GZCA 5IYZE 3TLTA 2ETCA 1MIYA 3O48A 2X9HA 5F5WA 4BERA 3SFZA 2IY0C 4QXCB 2LXMA 4UWHA 2DNXA 4HI9A 1HO8A 2KWHA 3N2GE 3U64A 4JVSA 4UUCA 4CT4A 2E9XB 1HS7A 5ABEA 4UWKA 5JR9C 5ENNA 3RO3A 3CV0A 4B89A 1JPLA 2GRPB 4JA7A 2X6JA 5CRUA 2JEKA 2V4LA 5AQSB 4BA9A 2BUGA 1T8BA 1A17A 3HXFA 1TN7A 3P50A 2V0PA 1DCQA 2A72A 2EIME 4CZZB 3CEQA 1QSDA 2NSZA 3LS8A 3NZPA 4P0AA 2PM7A 2XEVA 4AQFA 1YCSB 3V5UA 2P9NG 4HFCA 4JD2G 5ARFA 2QYJA 2AE9A 3K8PC 1SVXA 5EDSA 1N95A 2EHOC 3CK9A 5BV1A 3H37A 4X1KE 1BR2A 1E7PA 1YKEB 1RW2A 3ZU7B 3CHSA 5BXOA 3VR9A 4HFIA 4DJAA 2PFVA 2WQYA 1WCRA 1DVPA 5A1LA 2KXPB 5FXVA 2D9DA 5H6RB 4HOQA 5ABGA 4U31A 2M63A 3QUJA 2WQ6A 5ETWA 2QVAA 3LJ3A 4KVMA 2HHHT 3ABLE 3UM1A 3GZ1A 5KXJA 2J1DG 3B7TA 2V6YB 3FTSA 4HBDA 3D0TA 3TXMA 4GTSA 3AG2E 5L3EB 4LF6T 4RG9A 5AYWD 4AI6A 1Q2ZA 3GZSA 4MLPA 4DLQA 2DL1A 4QXHB 3KV5A 4XX5A 4TXRA 3DTOA 5AQFB 3K9IA 2BVMA 3MV3B 3JQ1A 2V5DA 4TWHA 5FZSA 3JXIA 2NYJA 3N9PA 2UY1A 3OKQA 5HCJA 2HPJA 2IAKA 5F3JA 1EPUA 3ZPJA 3ETVA 5H6QB 3PDNA 2XHEB 2W61A 1OT8A 2XQ4A 4WAFA 4HWFA 1HNWT 4C9BB 3UU4A 2I6HA 4K0UA 5BR8T 4C0EA 1N52A 3UU8A 2VL8A 1L0VA 3GWHA 5JQGE 1ELWA 4MRUA 4BT9A 4M1PA 4GKJT 2CFUA 3Q78A 3DXMG 1OWAA 1UN8A 2DCFA 3U78A 5JMND 4EZHA 4DR4T 1XNRT 2XM2A 5AQAA 2X0HA 2BG9C 2BDEA 2QYWA 3RYIE 2VQET 2LE8A 2YKSA 3PNLB 4I43A 5HRYA 1JWFA 4ATZD 5CA0E 2L3LA 4PJJA 4CDRA 5KBAA 2DWGA 4DV4T 5G04J 4DO0A 1Y6IA 1YMPA 3EDUA 5L47A 3QWWA 4A1GA 1N4RA 4DX7D 2HN1A 2R02A 2I1JA 5AQNB 4I1AA 4ZOLE 4HE8A 3ML8A 4QWNB 4EEDA 4HRMB 4GZ6A 3NZSA 1HNXT 4GTOA 1DC2A 2YHCA 1G3NB 1WYCA 5F8PA 1S64A 1G8XA 2DWKA 2Y1LE 4ANVA 5A6CA 5FQ8A 5LCWJ 4FULA 3RYFE 4GPKA 2V1DB 1AWCB 4I1MA 3P2BA 3VRBA 3UULA 4AEZC 4GA0A 2VTBA 3H3AA 2M6BA 5FP3A 2NOXA 3NQPA 4N2SA 4KI0F 4A56A 1T98A 3C64A 2BBHA 3QK6A 4HWDA 5ENOD 3TWVA 2CXFA 3FWVA 1FJGT 3CX6B 4UQXA 3WG7E 1HE8A 5T8IA 4JLEA 2EHOD 2A5UA 3MGBA 2BKPA 1WFDA 3AECA 4DV5T 4ISSA 4YSZA 4TZ4C 3UUXB 2JQHA 3SD5A 2C0SA 4GB9A 3N9OA 1OWOA 3V31A 4FA6A 3LJCA 4O1OA 3KV6A 3Q15A 4BSXA 2QA7A 4U63A 3CR3A 5AQHB 4GAAA 4IRUA 4EECA 5KJKA 5J1GA 3FEYA 2BKGA 4LSZE 5ENTD 5KMGP 2LO6A 1NAFA 3C50A 3QB2A 3FTZA 2E0IA 2CEAA 2ZM0A 5EK4A 2IW5B 1T72A 4JBWF 2WXRA 3KEAA 4F53A 5J2TE 4XBFB 2JRKA 4EEBA 2EILE 2V5FA 4WBOA 2EIJE 3QWVA 1FIOA 3EDTB 4LMKA 2QZAA 1UX5A 4IIJE 4ME2A 2VKHA 4I50E 3DSWA 4P0BA 4GMLA 4AM9A 5JRCA 2LSUA 2R05A 4NUUA 2ZU6B 2FBWA 3ZYMA 4X1YE 1FT1A 5TAOA 5CJ5A 3UT5E 3QAQA 5CHEE 3L08A 2WMOA 3CPZA 3QB5A 4C91A 2IJGX 4DX1A 5FY7A 3UTKA 1H6PA 5AQ9A 3L09A 4HFDA 4BETA 4TNWA 2PQRA 2DVWA 3LY9A 3R9AB 3K3NA 4GZ5A 3ONKA 5AQIB 4CXWA 3T8MA 3ZT5A 2N1GA 4HN9A 3IEEA 3UXGA 1B89A 5EK3A 4UQZA 3LBXA 2ZGDA 3KV4A 1KNZA 5G55A 4Z8XA 2LLYA 1TNBA 2H88A 4YY3T 2GRLA 3V79K 5DIZA 4WWNA 1D8EA 2XRYA 3C3RA 3MKRA 3TWXA 3P7IA 5AQUB 5JDHA 1ELKA 2W00A 3SBSA 2UY1B 2X6HA 2XPIA 2J8SD 4YDYA 4NIQA 1IQUA 1S0PA 2Y69E 4XE0A 4DX2A 2L0TB 5KJNA 3V2XA 3DSSA 3AEGA 4PW8A 3IBPA 2H6IA 3IHVA 4KUMB 4MBGA 3UU3A 4MFRA 4DR2T 4IGUA 4JB8P 1OEDB 5C1DA 2LSGA 3PUZF 2LXLA 3PJAA 3ESKA 3CHMA 2VB6A 3ZT6A 1RZ4A 3HL6A 3ZCIA 3T5VA 3FZHB 5LNKA 4CQIA 4UV8B 2ZISA 4LF8T 3BG0B 1OXJA 2XGSA 3EUHA 2XS1A 4Q94A 1UX4A 4KMOA 3X2QE 2XPYA 3BK9A 4U96D 4GU5A 3H3MA 3NF1A 4EZLA 4BAYB 1YW0A 2MTQA 2VGXB 2GK9A 5LBMA 3VU7H 2NP9A 4AVXA 1BPOA 1XNFA 3SNXA 3FBZA 2ZM2A 4H9QC 1WLXA 2ACXA 5AJLA 1FMWA 5ENRD 3CK8A 5HXRA 4FJZA 5A23A 4TNVA 3UTMA 3KVAA 3ABME 4KBQA 1FCHA 3QNUA 3ZXPA 4IN3B 4PK4A 2V7LA 4U2YA 5J0ZA 1MZCA 3CVVA 3FUIA 4UV9B 2AXDS 3N5LA 3C3QA 3PE0A 3IF8B 3W9GA 1ZHCA 1E2AA 3O1HA 4IL4A 4L2LA 1WR0A 1GQEA 3DSTA 2ZGGA 2W63A 3W15B 4EAHA 2P9KG 2BEDA 4C48B 2K3WA 2WDVA 2XQAA 4DMWA 5BMVE 1S63A 1YYHA 4G8LA 1S70B 5ANRA 2K5BB 4XI9A 3HXDA 3U66A 3NKZA 1J1JA 3BQKA 2X51A 3SO8A 2CHWA 3LKUA 4I2WA 2A9UA 2FJAA 3WXXA 3RYHE 5AQMB 5AN8A 1R8IA 3HXCA 5EX3A 2NC9A 2WXIA 4FC8A 5DQWA 1MX2A 2IONA 5CEDB 3AS4A 1XGWA 2L9BA 3APFA 1VOMA 5HWXA 2CFZA 5AARA 1G73A 1IHGA 3IV0A 4EYUA 2NWBA 3T1YT 4EQFA 3FB2A 2Q9QB 1N34T 2DI4A 4DV2T 4DRXE 4JI7T 2VK9A 1N54A 3D9NA 2IO3C 4FI5A 4A1SA 2J4GA 3V5SA 4DR6T 2V7MA 2I1KA 2F0YA 2X38A 4U7EB 3N9MA 3UINC 4DR7T 1MJ0A 4BY6A 5AJDA 2VVSA 1M62A 3VKHA 4HVBA 3SFEA 4OAUC 1Z8UA 2QGSA 3UIPC 1T7SA 4QX8B 2IFUA 5HEUA 4GOUA 3KD7A 3L6AA 3I9YA 1OUVA 2RFAA 3AEDA 2QYUA 2XZDG 4BTAA 3R9MA 3U4TA 1PC2A 1MIWA 2WXLA 4UQYA 2VWAA 2X66A 3ONLA 2IUBA 3P4QA 2X3MA 2E2EA 3AE2A 1MX6A 3KDSE 3Q75A 4I1OB 5C2YA 3ZVVA 1JNZA 3N2OA 2LSKA 2XM1A 3TLVA 4N5CA 2F8YA 4IE4A 3PUGA 3LJNA 4U8VD 3CQXC 2WY2A 3HKBE 2XAHB 4QH1A 1XMQT 1MHQA 1TN8A 2J47A 5JR9A 2GRMA 5FVKA 4ZFHA 2OEWA 4X64T 3N9NA 4MLKA 1HF8A 1W0AA 1DU2A 1FT2A 4ZZBA 2LM2A 3ZMVB 4G26A 4OFZA 2A2FX 5FVLA 4QFVA 3S7BA 1SA4A 3LK42 4DVDA 2XQ0A 3DWLG 4ZI7E 2I9CA 4ZZCA 2YQ8A 4O4LE 3CLJA 4U07A 3G06A 5FXZA 1IBLT 5IY5E 1AJ3A 4Z68A 3ZPOA 5IWAT 2EHOA 2IF4A 2J08A 1P5QA 4Y6WA 2LEHA 4BEPA 1NWMX 5LG3A 4BFRA 5EYLA 2N9DA 2Y0BG 3CVRA 3E0ZA 3AVSA 5LMUT 4I6EA 3L39A 5ABFB 5D0QD 5AQRB 1HNZT 1WR6A 2SPCA 2ETAA 1Z6TA 4J2CA 3DSXA 1X79A 5HEJA 4EB6E 3C5RA 3RSEG 3DRAA 1VDYA 4UEMA 4HWIB 4GTMA 5FIOA 3GA8A 4CZ2D 4H9SE 4XKBA 2XQ8A 1BLXB 3AE5A 5FYMA 3ZJ2A 1EDUA 1K1AA 3ZT7A 4J8EA 3E08A 3UM2A 1K1BA 2MHKA 2CLYC 2C5IT 3SGHA 4A98A 3FH5A 4ACLA 4W9RA 1BD8A 1GW6A 2CHNA 4WYVA 2LRLA 4GTQA 5CBNA 2EQXA 3KAEA 2L6JA 4DX6D 4B6XA 3LXUX 1NA0A 3HG0D 5L2LA 4LFAT 3RK6A 2ETBA 1H2TC 2HO1A 5KNHD 2CHXA 3AA7B 4JI3T 3DP7A 3TWQA 3ML9A 4JUYA 2DCPA 1N4QA 4KZ0A 3JAEA 5AQKB 1E96B 2DHRA 2WXJA 4G24A 3Q5XA 2R5SA 2CG2A 2P9PG 3LVQE 1D0ZA 1N33T 1FVFA 1XMOT 1QNFA 4U95D 2DZOA 3Q9DA 5M72A 2KZTB 3VR8A 2IO2C 2J07A 3B57A 3TWTA 4IE6A 1KF6A 4DBQA 5CFBA 3NOCD 4O2BE 3CIAA 3UQ4A 3FZMB 3UQ3A 2PQNA 1S94A 1HU3A 1UJJA 4YNDA 2BG9E 4IDZA 3ZC1A 2V6XA 2LAIA 5BV0A 4X62T 2IC9A 2XSBA 3TWSA 3C98A 2E9XC 4YTNA 2BTDA 2LRKA 3CSTA 4LUNU 4U04A 5D66A 2M67A 3ZW3A 3RKVA 2WXMA 1V54E 4ATGA 5AQBA 4BSZB 3MKQA 1HR0T 3TXNA 3C4XA 5J08A 2E2AA 3D9IA 2B0OE 2F8XK 1E7VA 3MJXA 3HDXA 2VVNA 4ANUA 1HFAA 3UT4A 3X1DA 2IDOB 2WB5A 4LF9T 2WB2A 3U3IA 1UGOA 4WW0A 1BR1A 4H9RC 3UFGA 3EIQC 2P2CP 2UXDT 4OK0A 5L3CB 3HIZA 4OYSA 5FJYA 1E8XA 1W9RA 3PUVF 3CKCA 4HTEA 5LP6E 3VRAA 3FUFA 1KEYA 2LSIA 4HB5A 1IZNB 2YEVC 4HOSA 1TN6A 2WQHA 2OVBA 3RHWA 4AXHA 5AQ7A 2KXPC 1E7UA 3FY4A 3C51A 4A55A 4IT4A 3AA1B 3VTYA 3ZHEB 4O6FA 5LYJE 1JCRA 1Z0PA 3AXJA 4J8DA 1UN9A 4DPRA 4JEHB 4GA1A 4B8CB 2CE7A 2YHEA 2BS2A 5L3GB 3E22E 1OWPA 3D9KA 4JW1A 2JQKA 4APFA 3FUEA 3OXLA 4HFEA 3D9JA 3FTVA 4GYWA 4HOUA 4XEIG 3HXEA 5JJTA 3RIUC 3AU4A 4DBRA 2PNNA 2XEEA 4JEUA 2Y4TA 3P4SA 3AU5A 5A7DB 4YTMA 3J7Yq 2XTLA 2ES0A 1TJCA 2GRNB 2WXNA 4CXYA 1V55E 3JUEA 3UMVA 4QXBB 2WXHA 5FZRA 4OVVA 5LGNB 4MBQA 3KS2A 3UQ7A 3FZLB 3CQCB 2UXXB 3RC3A 3JUIA 2WWVA 4H7XA 3UI2A 5AQLB 4YSXA 4O1PA 4CEMA 2MPKA 1H7CA 2CG3A 4CYMD 2IC6A 2HYZA 1ZP0A 3EI0A 5FMNA 5IUXA 4DV6T 1FMVA 1HXIA 3N71A 5EIDA 4F6RC 4QHOA 2NTXA 2QC9A 3D3MA 2JMHA 3B5MA 3L16A 3I5PA 1XNQT 4Z91A 4JI4T 3UX4A 4L0RA 3ASFA 4AOFA 3EHRA 4TUUA 1JWGA 3HVEA 1N0QA 2LT3A 2GROB 2V7IA 1EYHA 2CWYA 3ENEA 2XPKA 1Y64B 1LD8A 4HORA 5LGUB 3JAFA 3PUWF 4PDXA 5JDFA 2R03A 2FJEA 3CVUA 3RIAA 3ASNE 4YLHA 3D9OA 4LRZA 4O4HE 1D8DA 3ZXSA 2E9XD 5JDLA 3BQLA 2Y8DA 4ZXLA 3Q2MA 3DSUA 1UUSA 5ENQD 3RO2A 3SFYA 2B6CA 2DIWA 4DV3T 4XIFA 2LSVA 1OEDE 3FXDB 2OEVA 3RAUA 1BR4A 4HRLA 4GPMA 3NVOA 4E6HA 3J5PA 2R2LA 4CN6A 1VCSA 4U0UA 2X68A 3RKOA 1SA0E 1E8WA 2WPVA 4TRQA 5HS0A 3ZRHA 4I0UA 4BT8A 2LOSA 1Z3YA 2K48A 2E5VA 4YVQC 3PUXF 3SF4A 4H63V 3SY2A 1OCRE 2VKJA 3IKOB 4G2AA 1QYMA 4EXTA 3WAKA 4ILBA 2B76A 3CHPA 1JNRA 3L9TA 4G11A 2CHZA 5FTPA 4QQIA 3TG4A 3GN5A 3Q73A 3JYSA 5T3RA 5JDGA 3AAIA 4HXIA 4B3RT 5CECB 2Y48B 2KWIB 2W0GA 3B7BA 4J7WA 4IDPA 4GTTA 2CA5A 2B1EA 3LK2B 1K8KG 5EIBE 2H6FA 1Z5SC 3MKQB 3SWHA 4O4IE 2LKGA 1JCSA 3EDVA 2HE0A 5KNGA 4O4JE 2XQ7A 4AQYT 1IXVA 1NEKA 1DCEA 4U8HA 2IOSA 3PEUB 4HLEA 4IHJE 4N39A 2X67A 4U3CA 4CGWA 5JTGA 3JXJA 3E34A 3QDNA 5G04C 3TWUA 3QC1A 1MIVA 2GW1A 3SBTB 1NA3A 4KHPT 4G63A 4ISTA 1SW6A 5LHHB 4EV6A 4K5AB 3ZFWA 3FZKB 3UUNA 1E90A 1HH8A 4YFSA 2XENA 5EKQD 3ANWA 1N94A 3MXZA 2WP9A 4AKGA 4ABNA 1OWNA 1U3DA 5LCWC 3KVBA 2MAWA 2PJQA 3Q5WA 3ETUA 3NBXX 3CWZB 3JCKC 5G05J 1XDOA 4F6RD 3HHMA 2DZNA 5LHGB 5FWQA 5KDMC 3UPVA 1D0YA 5ADXL 2P9LG 2W62A 2UUBT 2OVFA 3APDA 2ILRA 4WWOA 2BKKB 4K0RA 2M6IA 3U9WA 3FBLA 3W9FA 2KSRA 2CXDA 2AXZA 4DUIA 3ZYQA 1CUNA 2Z6EA 3N9QA 4JEUB 3FTWA 2IHR1 4HI8A 4U0ZA 4U8YD 4PFPA 2R17C 1MNDA 4APOA 3L54A 2WU2A 3K3OA 5HXHA 3D9PA 2W66A 2W4XA 5IHYA 5EYPF 3RRCA 3OTNA 3AAAB 3BEEA 4H7YA 3DSVA 4ILCA 1I6ZA 4AY6A 3L82A 2H6GA 3E37A 3LY8A 2R6GF 2WSSV 3ABKE 1OEDC 3KINB 3AE4A 4GTVA 4TV3A 4I2ZA 2RFMA 2X0LB 1BU9A 2X6KA 3RH3A 1LD7A 5FQ7A 3ZSTA 1H6OA 4R7LA 1HG2A 4OYJA 2LHNA 3KV9A 4HEAA 2WZIA 3OBVE 2VKDA 2XAJB 5B3SE 3ZMSB 3I3NA 4PFOA 3TGOA 3ASGA 4WNGA 3HVEB 3ZMZB 4AIUA 2KCKA 2OV8A 2WXOA 4U7IA 3HR0A 3V2OA 3ZSSA 1ZBPA 2HPLA 4I43B 5KWDA 4B8AA 2JABA 5KX5E 4P09A 4FHJA 4MKTA 2D2SA 1QLBA 3UU6A 2KC7A 5T4YA 4H9PC 5LXTE 1XZYA 4ACKA 4LEUA 5CERB 3RIBA 3CVQA 3RU0A 1PAQA 1LTXA 5LOZA 2UUAT 1NZNA 2LUHA 1Y01A 4DNDA 5DQVA 3B7RL 2CHOA 3CKBA 4YT0A 5LJNA 2AXUA 2XZTG 2YINA 4DX5D 1IBMT 5HQ8A 4ILHB 3PUKA 3PNTB 1D1CA 3CK6A 4ZS3A 5LFAA 2VTBB 3VTXA 2WBLA 3NZUA 3QB5K 2AWIA 1H19A 3ULQA 4HOTA 1KZPA 2FEZA 5FT9A 3RJVA 4F1PA 2XSAA 3CQGB 4BX9A 2FO7A 2J9QA 3OTOT 4UXNB 2Q9QC 3R84B 4JI1T 1E8ZA 5CEAA 3Q79A 5LA6E 3AE8A 2I2OA 4NRHB 3UKUG 2H3RA 2J4DA 4JC8A 4PJLA 3B13A 3GZ2A 4TWFA 4GKKT 4YDEA 5HCMA 4FLHA 4PH4B 4HFBA 5BT1A 3PU3A 2A4ZA 4J6IA 4UI9J 3CVPA 3ZIMA 5HEOA 1IJ6A 4GYRA 3MKDA 2J09A 1OCCE 4J8YA 2C5JA 4UVAB 4F7AA 3PJAJ 2VSXE 3VLDA 1MMGA 4YTPA 5J2UE 3OXGA 3PVLA 4TXQA 2DLRA 5JJ7A 3FTXA 2RD0A 4A97A 3QARA 5L4HA 3LFMA 2DWZA 3HYMB 1BI7B 3ANWB 4UI9K 2KM4A 4QH4A 5JRCB 3AS5A 4ZI3C 4UF0A 5L3DB 2VYIA 2MRIA 3DXKG 1SQMA 3BQOA 3O9XA 4KP3C 3PUAA 3T8OA 1Y8MA 4AJWA 3BG1B 2X9XA 5BXUA 1B7TA 4UR9A 5JHBA 4CXXA 3F2EA 2PM6A 4TUMA 5KJMA 5LB7B 5C2TA 4JI5T 1OWLA 4IL9A 5HI7A 4TWDA 1WDYA 2BF0X 2ZM8A 3RF1A 1U2VG 4ZHQE 3K1SA 2V5QC 3AE9A 3LBXB 4PUCA 3AEEA 2CXLA 4F8HA 3UIOC 4L7TA 2N2NA 3TJPA 5BPPA 4AKLA 2IOLA 3S7DA 2IQCA 2LSJA 5LMNT 4N3AA 3ZC0A 1Z3XA 2VQ2A 2WDQA 4PK6A 3LVRE 4JI2T 4TV9E 4CCAA 3ASOE 4A5XA 4GCOA 1YXRA 3BQIA 2KCVA 3RC8A 2D0TA 4JI0T 2MOWA 4GK5E 2X6FA 2XCCA 1HZ4A 3D9MA 4U0SA 3RLFF 2V8SV 4RG6A 2LKHA 4OX9T 3DPDA 1INZA 4JHKA 3PZDA 3A7MA 3ZYLA 2PG8A 2XQ9A 4B93B 3A8YC 2WU5A 3APCA 1XWMA 2Y4UA 5JA4D 3UT7A 5FXXA 3MX3A 5AIJA 2X9YA 3FHEA 4DK5A 4B3ST 3J5QB 2V6YA 3AAEB 4OVUA 1OCOE 4IREA 4PAGA 2BBJA 2WMNA 3CVYA 3MK7C 1HX1B 3VLEA 4CI3B 1TEZA 3RGLA 1NI1A 2V8SE 5M4YA 4Y6CA 1WAO1 4EZJA 2I0MA 3TLUA 2ZLYA 4DV7T 4JYAT 2FO1E 4L9IA 3RI5A 3C3OA 3EIJA 1XDPA 2LNIA 1EF1C 5CMWA 2J62A 3RIUA 4LFCT 1SZAA 2Q9QD 3JC6C 1QQEA 3ASHA 2RA1A 4P1NA 5KCMA 3P1UA 2WWUA 3FP3A 3NZQA 3FULA 2C0LA 4H9OC 3F31A 1N0RA 3OYZA 4GTPA 4PS3A 2L8KA 3PDYA 3S4UA 1TNZA 1AP7A 1H0AA 4B3TT 5AFUL 2AXVA 3UU5A 1CHUA 4I9EA 1DNPA 3PUYF 2ODVA 2XAGB 2FF4A 4BTBA 3RRMB 5HXCA 2AW6A 4NUVA 3A5XA 4N3CA 5L3BB 3JADA 3PUQA 4ZEYA 2P9BA 4DUYT 4RQIA 4UVCB 4MHCA 3P4WA 1MMNA 4ZI3D 5CCLA 3ZN0B 2IIUA 2HM8A 3L3PA 2ONDA 4EIWA 3IA3A 4LCTA 1KNRA 5BNWA 2ZMAA 3GMIA 3OPCA 5FL0A 4RVBA 5G2NA 2H7OA 2BG9A 1TYQG 4WNEA 4YDOA 3RKGA 3CHQA 4ANXA 2Q7FA 1IHBA 3LYAA 3MJWA 4KX6A 4CN4A 1O1TA 5FQ6A 4CN1A 4YJ2E 3VHLA 5FL1A 5JVDE 1UOHA 3LK3B 3FU6A 3IHRA 4O2AE 3ABVA 4U7YA 3ONJA 3SI5A 4P29A 1VCTA 2WZHA 4BJMA 1MQSA 2XS8A 3MCXA 5E76A 3Q5DA 3CVLA 3S2AA 2KT9A 4DV1T 4EZKA 4DI3A 5DJQC 4HNAD 4M3OA 3FTUA 3I4RB 4Q69A 3EABA 2NW7A 2K9AA 4WWPA 4I9CA 4DLOA 3T1HT 2XQ3A 4KHZF 2GRRB 5JDQA 4IE5A 1OWMA 2WXKA 2C5KT 3AG3E 3LSVA 2OA5A 4ZI2C 3G2TA 2KNDA 4EHMA 3R6NA 5LP0A 1WG0A 3FDHA 4N78D 3F6QA 5EK2A 4N5QA 1D1BA 5C3JA 4TXPA 5ITZF 2KLQA 2XY8B 3ZJ1A 1KT0A 3RQWA 2CM0A 4HKAA 3TL5A 5CRVA 3OXFA 2VGYA 4AV7A 3I1AA 4HWCA 3Q49B 4KT6B 5AQPB 1E1HB 4UVBB 2ZM6T 3AE7A 4UELA 4YXDA 4EBAG 5AAOA 2KMFA 3ZNGA 3I0OA 4QKNA 1ZV4X 3MACA 2RG8A 1UURA 4WNDA 1SE7A 5B1BE 1LVFA 4COFA 3Q9NC 4NXNT 4GMJA 1KK7A 1VRBA 2PL2A 3B7SA 2HR2A 1TNYA 4GIWA 3CMLA 1I94T 2JLBA 3KBTA 5JHAA 4FJOA 3CX8B 5JR9B 3ZYKA 3NBNB 1TNOA 3JC6D 3TLSA 3JCFA 2CBIA 3TWRA 2MOZA 2IEJA 4JA9A 3AEAA 4GZDA 4V1Av 4HFHA 2XCBA 4IULA 5EZYE 3R7RA 3PU8A 4HS2A 2CMRA 4GZ3A 5LX8A 4IE0A 3AA6B 3OVUA 2QRXA 3E32A 3HI2A 3HKDE 2PTFA 4HLLA 4JXTA 3ASDA 3DEOA 4MS6A 1HS6A 1KFYA 3WI3A 4CDMA 3S7FA 4GYYA 4JPSA 1J5WA 1SA5A 3QC9A 4QX7B 4G2VA 5JJ6A 1FVHA 4IE7A 2EHOB 4C0MA 2YU1A 2DYRE 5JH7E 3AS8A 3NAWA 4B0ZA 3LG7A 3IBEA 3FU3A 5DABA 4FJYA 1YQ4A 2A5EA 2HH7A 1HG5A 3P4RA 4TUYE 3Q4AB 3Q5EA 4KBMB 3AG1E 2WS3A 4ADZA 3VKGA 2P58C 5LOVE 2K24A 2CCQA 4U72A 3MA9A 5HWYA 1JCQA 3RRWA 3EVYA 3PE4A 1O1SA 4TV8E 1MX4A 4N2QA 3FTYA 5KJLA 5LGTB 2ZXWE 1QUUA 1YQ3A 3HXBA 2X6IA 1BI8B 1ZOYA 2P9SG 3FUJA 4ZHBA 3EUVA 3CHRA 4XI0A 2VQFT 4GYOA 5D2MC 3QKYA 5AQTB 2P9UG 2BKNA 1ELRA 3QWPA 1D9SA 1BR0A 1OEDA 1U4QA 4JV5T 4D10C 4FP7A 2V26A 3CK7A 1D0XA 3B95A 4U2ZA 2LHRA 3L17A 2Y6XA 1TNUA 3O1JA 3AG4E 4EYYR 3ULEG 2BZBA 3ZLIA 4X66T 4A3VA 2DYSE 2YDRA 3PZ1A 3FZFB 1SHZC 4XZCA 4HQDA 4KXKB 2FJDA 4ZI2D 5D0OD 4NQ0A 2X0YA 4TX5A 3NB2A 2VJ8A 3AJIA 3E30A 1W3BA 3M65A 4E7ZA 3G2VA 4JZYA 2VGXA 2BG9B 5FY1A 2RP4A 2VSNA 1UW4B 4ERRA 2UU9T 1FPPA 3BUAA 2XRZA 4LF5T 1MMAA 1KPSB 5HXEA 4X8QA 2CPTA 1YKHB 4LNBA 3UKRG 4CDNA 5FNVE 3FUDA 4K5CA 5H7PA 1X9BA 5AQJB 1N32T 3C98B 5ANLA 2LJLA 2I59A 5DBKA 2LAHA 4HGAA 1E8YA 1IBKT 3NWIA 3GYZA 3QK0A 5CB4E 2NW8A 3ZMUB 1S35A 1N4SA 4URKA 2FUPA 3SRZA 2UXNB 3RIFA 1N11A 2V4HC 3C4WA 4NURA 2F4VT 1ZB1A 5HEGA 3CIRA 1LVKA 2VKOA 5JDMA 3UM0A 5AQGB 4PS8A 3TAXA 3ZGQA 5FQ4A 3ISMC 4JHJA 1IJ5A 4AQFC 5JDNA 3IXEA 3PUJA 5L3FB 4ILUA 3RQUA 4DIDB 2HN2A 3KBUA 4K5BA 1OXZA 3CVWA 3PV0F 2FULA 5ENSD 2XAFB 2MYOA 3TKLB 2J49A 2VURA 2D0UA 5FZQA 1U3CA 1WYBA 4KZCA 1NP7A 4TN7B 2JQQA 3MYVA 2Q9QA 3CX7B 4IDQA 5AQQB 5CBOA 3AXJB 2FBNA 1UG3A 1N36T 4WNFA 4PJMA 3MZKB 4Z90A 4DV0T 4WBNE 3AAAC 3EU5A 3E33A 3PS6A 4B3MT 4AKIA 2GRQB 4KVOA 3MA5A 4H63H 4X65T 4FHKA 3DEPA 2E8IA 2LM9A 1HCIA 4YHJA 3FUNA 4YSYA 1WY6A 3VLFA 1OCZE 3C72A 4LNUD 4UIGA 1O1RA 5EILA 3PRZA 3LY7A 4LERA 2XGOA 4L9PA 4GTRA 4X5TA 2H7VC 3CVXA 1O5MA 2YDQA 4YVOA 4CI1B 4F3VA 4F1SA 4U33A 3RYCE 1ZU2A 1K3ZD 2QFCA 3ZN3A 4EGWA 2ACZA 3ZEFA 2IU1A 2VSYA 1KLXA 3PTRB 3L13A 3EHMA 2OOEA 2CBJA 3QOFA 1X5BA 2XUEA 4HRNA 4LG6A 2V7JA 3SZ7A 4LNGA 4EPZA 2KZ7B 1H6KA 3N2KE 4H9NC 2H89A 1X81A 3FH8A
chains in the Genus database with same CATH topology
2WXQA 4ILIA 1KT1A 4RSYA 5E75A 2XASB 3EHNA 5G05C 3SOLA 3URZA 3G2UA 3J9X1 4CI2B 3ESLA 4UWFA 3UFEA 4YJ3E 3FU0A 2WXPA 3N9LA 4V3IA 3P8CD 1FEWA 3PH0C 1WRDA 5FXWA 3O4ZA 4L2YA 3PE3A 3MV2B 3FH7A 3S7JA 3QOUA 3MZLB 1LRZA 3T5XA 5CCMA 4BX8A 5GONE 5LCYA 4U74A 3TG5A 3UT8A 2KINB 2V7KA 3KEZA 1JUQA 3FUKA 2X9WA 1V9DA 2VASA 3LEWA 3CVNA 3B7UX 1U5PA 4I4TE 2AVPA 3GN5B 4E7SA 2PBIA 3NRXA 4OYKA 3F57A 3ZN1B 2MBGA 2KATA 3FFLA 4UWGA 3OAWA 3DBSA 4HFVA 4EZ4A 4BWRA 4XAXB 2DBAA 3I9WA 2WAUA 5EX0A 2YK0A 1IYGA 2WXGA 1PY1A 2LSYA 3NRYA 3EJNA 2KZTA 4J8FA 3O1IA 4I6JA 5LBQB 2Y3AA 2J4BA 3CSFA 2XPZA 4OHFA 3R7QA 1TJFA 3RX6A 1YA0A 4L5GA 3PREA 4KMCA 3OJAA 1ZEEA 4X1IE 3FU5A 4AP2A 3RPUA 4MALA 4UWLA 4FLBA 1L5JA 2C0MA 4GA2A 4DMVA 5JREA 4CT0A 5C8YE 2UWJG 3PUSA 3IHYA 2WVIA 4CGVA 4A3TA 2LOPA 2E9XA 2C2LA 1LF8A 4EOZB 2ODUA 2L9QA 1D1AA 3PEVB 3U3WA 5HXSA 4PS7A 3PURA 4ILGA 4ANJA 5AENA 3O4XE 4BJNA 4L1BA 3FUMA 3IEGA 4B94A 3RRUA 4AY5A 3CGHA 3ONXA 4L23A 4PK5A 4UI9C 3FUHA 3ZEFB 3FEXA 4AXPA 3ZHEA 3JQ0A 2D5UA 1O3XA 3AVRA 5LG4A 3I4GA 4JEHA 5CMYA 3G2SA 4ANWA 4WNKA 3L22A 4GYSA 3OYXA 4I55E 4G25A 3WAJA 1H2VC 4Q96A 2PZIA 1EZ3A 1HX8A 3AB3B 3AA0B 4ASKA 2XAQB 2BVLA 3QNKA 5BW8C 3FHNA 2WQ7A 4G1TA 4I6GA 1QZ2A 4AKHA 3ZMTB 4HFGA 4C90A 2KCLA 3LPZA 3UUMA 4GCNA 5LHIB 1US7B 3I0QA 4AIFA 3MEKA 5HYAA 3HKCE 3LCAA 4JL0A 4E85A 2XHEA 4K03A 4I17A 3RRNB 3ZCJA 2XGMA 4GK0E 5E0OA 2VSOE 3CKDA 2JMKA 2XQYA 1IQRA 2QY7A 4J0UA 5ARGA 2NTYA 3Q5MA 4XZ4A 3SS1A 4CRWA 4PNIA 2JJ9A 1MNEA 2YNQA 2R59A 2NW9A 3KFWX 4EBAA 1SZ9A 2FI7A 4ZS2A 4AQGA 3D9LA 3DJBA 3K3QC 2WXFA 2NXPA 1UCUA 3FXEB 4WUYA 3GW4A 4G23A 4PJNA 3E4BA 5LJMA 4J8SA 2L0IA 1MMDA 2CLYB 3SHFA 4AKRB 3CHOA 3LDZA 5BUZA 4XKCA 1WM5A 5FY0A 2MYSA 4KYOB 1ZKEA 4X20E 2WM9A 1YD8G 4NACA 1HTJF 1LKXA 2G0UA 1IAPA 3Q47B 5J90A 4JHRA 2GGFA 1H2UA 5HAXA 4N3BA 4FU3A 2YU2A 4FADA 3HKEE 3QJZA 3G2WA 5CA1E 3HA4A 4UF0B 4IYPA 4DI4A 2CWOA 4O8SA 2A3DA 2JPFA 1UJKA 3UUXA 3C4ZA 4GZCA 5IYZE 3O48A 1MIYA 2X9HA 3SFZA 4QXCB 4UWHA 2DNXA 1HO8A 2KWHA 3N2GE 3U64A 4JVSA 4CT4A 2E9XB 1HS7A 5ENNA 4UWKA 5JR9C 3RO3A 3CV0A 4B89A 1JPLA 4JA7A 2X6JA 2JEKA 2V4LA 4BA9A 2BUGA 1A17A 2V0PA 2A72A 4CZZB 3CEQA 1QSDA 2NSZA 3LS8A 3NZPA 4P0AA 2PM7A 2XEVA 4AQFA 3V5UA 5ARFA 3K8PC 5EDSA 2EHOC 3CK9A 5BV1A 3H37A 4X1KE 1BR2A 1YKEB 3CHSA 4DJAA 2PFVA 1DVPA 5A1LA 2KXPB 5FXVA 5H6RB 4HOQA 2M63A 3QUJA 2WQ6A 5ETWA 3LJ3A 4KVMA 3GZ1A 2J1DG 3B7TA 3FTSA 3D0TA 3TXMA 5L3EB 4RG9A 5AYWD 4AI6A 3GZSA 4MLPA 4DLQA 4QXHB 3KV5A 4XX5A 3DTOA 3K9IA 2BVMA 3MV3B 3JQ1A 5FZSA 3N9PA 2UY1A 3OKQA 2HPJA 2IAKA 5F3JA 1EPUA 3ZPJA 3ETVA 5H6QB 3PDNA 2XHEB 2W61A 4WAFA 4C9BB 2I6HA 4K0UA 4C0EA 1N52A 2VL8A 3GWHA 5JQGE 1ELWA 4MRUA 4BT9A 4M1PA 2CFUA 1OWAA 1UN8A 2DCFA 3U78A 4EZHA 2BDEA 3RYIE 2LE8A 3PNLB 4I43A 1JWFA 5CA0E 2L3LA 4PJJA 4CDRA 2DWGA 5G04J 4DO0A 1Y6IA 3EDUA 3QWWA 4A1GA 2I1JA 4I1AA 4ZOLE 4HE8A 3ML8A 4QWNB 4GZ6A 3NZSA 2YHCA 1WYCA 5F8PA 1G8XA 2DWKA 4ANVA 5A6CA 5FQ8A 5LCWJ 4FULA 3RYFE 4GPKA 2V1DB 4I1MA 3P2BA 3UULA 4AEZC 4GA0A 2VTBA 3H3AA 5FP3A 2NOXA 3NQPA 4N2SA 4A56A 1T98A 3C64A 3QK6A 2CXFA 3FWVA 3CX6B 4UQXA 1HE8A 5T8IA 4JLEA 2EHOD 2A5UA 3MGBA 4ISSA 4TZ4C 3UUXB 3SD5A 2C0SA 4GB9A 3N9OA 1OWOA 4FA6A 3LJCA 3KV6A 3Q15A 4BSXA 2QA7A 4U63A 3CR3A 4IRUA 4GAAA 4EECA 5KJKA 5J1GA 3FEYA 5KMGP 2LO6A 1NAFA 3C50A 3QB2A 3FTZA 2E0IA 2CEAA 2ZM0A 5EK4A 2IW5B 2WXRA 4F53A 5J2TE 4XBFB 2JRKA 2V5FA 4WBOA 3QWVA 1FIOA 3EDTB 1UX5A 4IIJE 4ME2A 2VKHA 4I50E 4P0BA 4GMLA 4AM9A 5JRCA 2LSUA 4NUUA 2ZU6B 3ZYMA 4X1YE 5TAOA 3UT5E 3QAQA 5CHEE 3L08A 2WMOA 3CPZA 4C91A 2IJGX 5FY7A 3UTKA 3L09A 2PQRA 3LY9A 3R9AB 3K3NA 4GZ5A 3ONKA 4CXWA 3T8MA 2N1GA 4HN9A 3IEEA 1B89A 5EK3A 4UQZA 3LBXA 3KV4A 1KNZA 5G55A 4Z8XA 2GRLA 5DIZA 4WWNA 2XRYA 3MKRA 3P7IA 5JDHA 1ELKA 2W00A 3SBSA 2UY1B 2X6HA 2XPIA 1S0PA 1IQUA 4XE0A 2L0TB 5KJNA 4PW8A 3IBPA 3IHVA 4KUMB 4MFRA 4IGUA 5C1DA 2LSGA 3ESKA 3CHMA 2VB6A 3HL6A 3ZCIA 3T5VA 5LNKA 4CQIA 4UV8B 3BG0B 2XGSA 3EUHA 4Q94A 1UX4A 4KMOA 2XPYA 3BK9A 4GU5A 3NF1A 4EZLA 4BAYB 1YW0A 2MTQA 2VGXB 2GK9A 5LBMA 3VU7H 2NP9A 4AVXA 1BPOA 1XNFA 3SNXA 3FBZA 2ZM2A 4H9QC 1WLXA 2ACXA 5AJLA 1FMWA 3CK8A 5HXRA 4FJZA 5A23A 3KVAA 4KBQA 1FCHA 4IN3B 4PK4A 2V7LA 3CVVA 3FUIA 4UV9B 3N5LA 3PE0A 3IF8B 1ZHCA 3O1HA 4L2LA 2W63A 3W15B 4EAHA 4DMWA 5BMVE 5ANRA 2K5BB 4XI9A 3U66A 3BQKA 2X51A 2CHWA 3LKUA 4I2WA 3WXXA 3RYHE 5EX3A 2NC9A 2WXIA 4FC8A 5DQWA 2IONA 3AS4A 1XGWA 2L9BA 3APFA 1VOMA 5HWXA 2CFZA 1G73A 1IHGA 3IV0A 4EYUA 2NWBA 4EQFA 3FB2A 2Q9QB 2DI4A 2VK9A 1N54A 3D9NA 4FI5A 4A1SA 3V5SA 2V7MA 2I1KA 2X38A 3N9MA 4BY6A 5AJDA 3VKHA 4HVBA 2QGSA 4QX8B 2IFUA 4GOUA 3KD7A 3L6AA 3I9YA 1OUVA 4BTAA 3U4TA 1PC2A 1MIWA 2WXLA 4UQYA 2VWAA 2X66A 3ONLA 2X3MA 2E2EA 5C2YA 3KDSE 4I1OB 3ZVVA 3N2OA 2LSKA 4N5CA 4IE4A 3PUGA 3CQXC 3HKBE 2XAHB 1MHQA 5JR9A 2GRMA 3N9NA 4MLKA 1HF8A 3ZMVB 4G26A 4OFZA 2A2FX 4QFVA 3S7BA 3LK42 4DVDA 2XQ0A 4ZI7E 2I9CA 2YQ8A 4O4LE 3CLJA 4U07A 5FXZA 1AJ3A 3ZPOA 2EHOA 2IF4A 2J08A 1P5QA 4Y6WA 2LEHA 1NWMX 4BFRA 2N9DA 3CVRA 3E0ZA 3AVSA 4I6EA 5D0QD 1WR6A 2SPCA 1Z6TA 4J2CA 1X79A 4EB6E 1VDYA 4UEMA 3GA8A 4H9SE 4XKBA 5FYMA 3ZJ2A 1EDUA 4J8EA 3E08A 2MHKA 2CLYC 2C5IT 3SGHA 3FH5A 4ACLA 4W9RA 1GW6A 2EQXA 3KAEA 2L6JA 4B6XA 3LXUX 1NA0A 5L2LA 3RK6A 1H2TC 2HO1A 2CHXA 3AA7B 3DP7A 3ML9A 4JUYA 2DCPA 4KZ0A 1E96B 2DHRA 2WXJA 4G24A 3Q5XA 3LVQE 2CG2A 2R5SA 1D0ZA 1QNFA 1FVFA 3Q9DA 5M72A 2KZTB 2J07A 3B57A 4IE6A 4DBQA 4O2BE 3CIAA 3UQ3A 2PQNA 1S94A 1HU3A 1UJJA 4YNDA 4IDZA 3ZC1A 2LAIA 5BV0A 2IC9A 3C98A 2E9XC 2BTDA 4LUNU 3CSTA 4U04A 2M67A 3ZW3A 3RKVA 2WXMA 4ATGA 3MKQA 3TXNA 3C4XA 5J08A 3D9IA 1E7VA 3MJXA 3HDXA 4ANUA 1HFAA 3UT4A 2WB2A 3U3IA 4WW0A 1BR1A 4H9RC 3EIQC 4OK0A 5L3CB 3HIZA 4OYSA 5FJYA 1E8XA 3CKCA 4HTEA 5LP6E 3FUFA 2LSIA 1IZNB 2YEVC 4HOSA 2WQHA 2OVBA 4AXHA 1E7UA 3FY4A 3C51A 4A55A 3AA1B 3VTYA 3ZHEB 4O6FA 5LYJE 1Z0PA 4J8DA 1UN9A 4DPRA 4JEHB 4GA1A 4B8CB 2CE7A 2YHEA 5L3GB 3E22E 1OWPA 3D9KA 4JW1A 4APFA 3FUEA 3OXLA 3D9JA 4HOUA 3FTVA 4GYWA 5JJTA 3AU4A 4DBRA 4JEUA 2Y4TA 3AU5A 5A7DB 3J7Yq 2XTLA 2ES0A 1TJCA 2WXNA 4CXYA 3UMVA 4QXBB 2WXHA 5FZRA 4OVVA 5LGNB 4MBQA 3KS2A 3CQCB 2UXXB 3RC3A 3JUIA 4H7XA 4CEMA 1H7CA 2CG3A 2IC6A 2HYZA 5FMNA 1FMVA 1HXIA 3N71A 4F6RC 4QHOA 2NTXA 3D3MA 2JMHA 3L16A 3I5PA 3UX4A 4L0RA 3ASFA 4AOFA 4TUUA 1JWGA 3HVEA 2LT3A 2V7IA 1EYHA 2CWYA 3ENEA 1Y64B 4HORA 5LGUB 4PDXA 5JDFA 3CVUA 3D9OA 4YLHA 4LRZA 4O4HE 3ZXSA 2E9XD 5JDLA 3BQLA 2Y8DA 3Q2MA 3RO2A 2DIWA 4XIFA 2LSVA 3FXDB 1BR4A 4E6HA 4U0UA 2X68A 3RKOA 1SA0E 1E8WA 2WPVA 4TRQA 3ZRHA 4BT8A 2LOSA 1Z3YA 2K48A 4YVQC 3SF4A 4H63V 2VKJA 3IKOB 4G2AA 4EXTA 3WAKA 3CHPA 4G11A 2CHZA 5FTPA 3TG4A 3GN5A 3JYSA 5T3RA 5JDGA 3AAIA 4HXIA 2Y48B 2KWIB 2W0GA 2CA5A 2B1EA 3LK2B 3MKQB 3SWHA 4O4IE 3EDVA 4O4JE 4U8HA 2IOSA 3PEUB 4HLEA 4IHJE 4N39A 2X67A 4CGWA 3QDNA 5G04C 3QC1A 1MIVA 2GW1A 3SBTB 1NA3A 4G63A 4ISTA 5LHHB 3ZFWA 3UUNA 1E90A 1HH8A 4YFSA 5EKQD 3ANWA 3MXZA 4AKGA 4ABNA 1OWNA 1U3DA 5LCWC 3KVBA 2PJQA 3Q5WA 3ETUA 3NBXX 3CWZB 3JCKC 5G05J 3HHMA 5LHGB 5FWQA 5KDMC 3UPVA 1D0YA 5ADXL 2W62A 2OVFA 3APDA 2ILRA 4WWOA 4K0RA 3U9WA 3FBLA 2CXDA 2AXZA 3ZYQA 1CUNA 2Z6EA 3N9QA 4JEUB 3FTWA 4U0ZA 4PFPA 2R17C 1MNDA 4APOA 3L54A 3K3OA 5HXHA 3D9PA 5IHYA 3RRCA 3OTNA 3AAAB 3BEEA 4H7YA 4AY6A 3LY8A 2WSSV 3KINB 4TV3A 4I2ZA 2X0LB 2X6KA 3RH3A 5FQ7A 4R7LA 1HG2A 4OYJA 2LHNA 3KV9A 4HEAA 3OBVE 2VKDA 2XAJB 3ZMSB 3I3NA 4PFOA 3TGOA 3ASGA 4WNGA 3HVEB 3ZMZB 2KCKA 2OV8A 2WXOA 3HR0A 1ZBPA 2HPLA 4I43B 4B8AA 5KX5E 4P09A 4FHJA 4MKTA 2D2SA 5T4YA 2KC7A 4H9PC 5LXTE 4ACKA 4LEUA 3RIBA 3CVQA 3RU0A 1PAQA 5LOZA 1NZNA 4DNDA 5DQVA 3B7RL 3CKBA 5LJNA 2AXUA 2YINA 5HQ8A 4ILHB 3PUKA 3PNTB 1D1CA 4ZS3A 5LFAA 2VTBB 3VTXA 2WBLA 3NZUA 2AWIA 1H19A 3ULQA 4HOTA 2FEZA 5FT9A 3RJVA 3CQGB 4BX9A 2FO7A 2J9QA 4UXNB 2Q9QC 3R84B 1E8ZA 4NRHB 5LA6E 2I2OA 2H3RA 2J4DA 4JC8A 4PJLA 3B13A 3GZ2A 4FLHA 4PH4B 5BT1A 3PU3A 2A4ZA 4J6IA 4UI9J 3CVPA 3ZIMA 1IJ6A 4GYRA 3MKDA 2J09A 2C5JA 4UVAB 4F7AA 2VSXE 3VLDA 1MMGA 5J2UE 3OXGA 3PVLA 2DLRA 5JJ7A 3FTXA 2RD0A 3QARA 3LFMA 3HYMB 3ANWB 4UI9K 2KM4A 5JRCB 3AS5A 4ZI3C 4UF0A 5L3DB 2VYIA 2MRIA 1SQMA 3O9XA 4KP3C 3PUAA 3T8OA 1Y8MA 4AJWA 3BG1B 2X9XA 1B7TA 5JHBA 4CXXA 3F2EA 2PM6A 5KJMA 1OWLA 5HI7A 2BF0X 2ZM8A 4ZHQE 3LBXB 4PUCA 2CXLA 4L7TA 2N2NA 3TJPA 5BPPA 4AKLA 2IOLA 3S7DA 2IQCA 2LSJA 4N3AA 3ZC0A 1Z3XA 2VQ2A 4PK6A 3LVRE 4TV9E 4CCAA 4GCOA 3BQIA 2KCVA 3RC8A 2D0TA 2MOWA 4GK5E 2X6FA 2XCCA 1HZ4A 3D9MA 4U0SA 4RG6A 3DPDA 1INZA 4JHKA 3PZDA 3ZYLA 2PG8A 3APCA 2Y4UA 3UT7A 5FXXA 3MX3A 5AIJA 2X9YA 3FHEA 4DK5A 3AAEB 4OVUA 4PAGA 3CVYA 2WMNA 3MK7C 3VLEA 4CI3B 1TEZA 2V8SE 5M4YA 4Y6CA 1WAO1 4EZJA 2ZLYA 4L9IA 3EIJA 2LNIA 1EF1C 5CMWA 1SZAA 2Q9QD 3JC6C 1QQEA 3ASHA 2RA1A 5KCMA 3P1UA 2WWUA 3FP3A 3NZQA 3FULA 2C0LA 4H9OC 3F31A 3OYZA 4PS3A 2L8KA 3PDYA 3S4UA 1H0AA 5AFUL 2AXVA 4I9EA 1DNPA 2ODVA 2XAGB 2FF4A 4BTBA 3RRMB 5HXCA 2AW6A 4NUVA 3A5XA 4N3CA 5L3BB 3PUQA 2P9BA 4UVCB 4MHCA 1MMNA 4ZI3D 5CCLA 3ZN0B 2HM8A 3L3PA 2ONDA 4EIWA 4LCTA 5BNWA 2ZMAA 3GMIA 5G2NA 4RVBA 2H7OA 4WNEA 3CHQA 4ANXA 2Q7FA 3LYAA 3MJWA 5FQ6A 4YJ2E 3VHLA 5JVDE 3LK3B 3FU6A 3IHRA 4O2AE 3SI5A 4P29A 4BJMA 1MQSA 3MCXA 5E76A 3CVLA 3S2AA 2KT9A 4EZKA 4DI3A 5DJQC 4M3OA 3FTUA 3I4RB 4Q69A 2NW7A 2K9AA 4WWPA 4I9CA 4DLOA 5JDQA 4IE5A 1OWMA 2WXKA 2C5KT 3G2TA 2OA5A 4ZI2C 2KNDA 3R6NA 5LP0A 3FDHA 4N78D 5EK2A 1D1BA 2KLQA 3ZJ1A 1KT0A 2CM0A 4HKAA 3TL5A 3OXFA 2VGYA 4AV7A 3I1AA 3Q49B 4KT6B 1E1HB 4UVBB 4EBAG 4UELA 2KMFA 3I0OA 4QKNA 1ZV4X 3MACA 2RG8A 4WNDA 1LVFA 4GMJA 1KK7A 1VRBA 2PL2A 3B7SA 2HR2A 4GIWA 3CMLA 2JLBA 3KBTA 5JHAA 4FJOA 3CX8B 5JR9B 3ZYKA 3JC6D 2MOZA 4JA9A 4GZDA 4V1Av 2XCBA 4IULA 5EZYE 3R7RA 3PU8A 4HS2A 2CMRA 4GZ3A 5LX8A 4IE0A 3AA6B 3HI2A 3HKDE 4JXTA 3ASDA 4MS6A 1HS6A 3WI3A 4CDMA 3S7FA 4GYYA 4JPSA 3QC9A 4QX7B 4G2VA 5JJ6A 1FVHA 4IE7A 2EHOB 4C0MA 2YU1A 3AS8A 5JH7E 4B0ZA 3LG7A 3IBEA 3FU3A 5DABA 4FJYA 2HH7A 1HG5A 4TUYE 3Q4AB 4KBMB 4ADZA 3VKGA 2P58C 5LOVE 2K24A 2CCQA 4U72A 3MA9A 5HWYA 3RRWA 3EVYA 3PE4A 4TV8E 4N2QA 3FTYA 5KJLA 5LGTB 1QUUA 2X6IA 3FUJA 3CHRA 4XI0A 4GYOA 3QKYA 1ELRA 3QWPA 1BR0A 1U4QA 4D10C 4FP7A 2V26A 3CK7A 1D0XA 2LHRA 3L17A 2Y6XA 3O1JA 4EYYR 2BZBA 3ZLIA 4A3VA 1SHZC 4XZCA 4KXKB 5D0OD 4ZI2D 4NQ0A 4TX5A 2VJ8A 1W3BA 3M65A 4E7ZA 3G2VA 4JZYA 2VGXA 5FY1A 2RP4A 2VSNA 1UW4B 4ERRA 2XRZA 1MMAA 5HXEA 1YKHB 4CDNA 5FNVE 3FUDA 3C98B 5ANLA 2LJLA 2I59A 5DBKA 2LAHA 4HGAA 1E8YA 3QK0A 3GYZA 5CB4E 2NW8A 3ZMUB 1S35A 4URKA 3SRZA 2UXNB 3C4WA 4NURA 1LVKA 2VKOA 5JDMA 3ZGQA 4PS8A 3TAXA 5FQ4A 4JHJA 1IJ5A 4AQFC 5JDNA 3PUJA 5L3FB 4ILUA 3KBUA 1OXZA 3CVWA 2FULA 2XAFB 3TKLB 2J49A 2D0UA 5FZQA 1U3CA 1WYBA 4KZCA 1NP7A 4TN7B 2JQQA 3MYVA 2Q9QA 3CX7B 2FBNA 1UG3A 4WNFA 4PJMA 3MZKB 4WBNE 3PS6A 4AKIA 4KVOA 3MA5A 4H63H 4FHKA 2E8IA 2LM9A 1HCIA 4YHJA 3FUNA 1WY6A 3VLFA 4UIGA 3PRZA 3LY7A 4LERA 2XGOA 2H7VC 3CVXA 4YVOA 4CI1B 4F3VA 4F1SA 3RYCE 1ZU2A 2QFCA 3ZN3A 3ZEFA 2IU1A 2VSYA 1KLXA 3PTRB 3L13A 3EHMA 2OOEA 1X5BA 2XUEA 2V7JA 3SZ7A 4EPZA 2KZ7B 1H6KA 3N2KE 4H9NC 3FH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQC B;  3CQG B;  3I4R B; 
#chains in the Genus database with same CATH topology
 2H6H A;  2WXQ A;  4ILI A;  1KT1 A;  4RSY A;  5E75 A;  4DR1 T;  2XAS B;  2WDR A;  4YDW A;  4K0K T;  3EHN A;  3KSQ A;  5G05 C;  4BES A;  3SOL A;  2BS3 A;  3G2U A;  3URZ A;  3J9X 1;  4CI2 B;  3ESL A;  4UWF A;  3UFE A;  4YJ3 E;  3D9H A;  3FU0 A;  2WXP A;  4M7C A;  3N9L A;  4V3I A;  4LML A;  3P8C D;  1FEW A;  2OCC E;  3PH0 C;  3TWW A;  4LFB T;  1WRD A;  3AE3 A;  4NPP A;  2ZIR A;  5FXW A;  3O4Z A;  4L2Y A;  3PE3 A;  3MV2 B;  2CRB A;  3FH7 A;  3S7J A;  5FIN A;  2OV9 A;  3QOU A;  4HWH A;  3MZL B;  1LRZ A;  3T5X A;  5CCM A;  4BX8 A;  5LCY A;  5GON E;  4U74 A;  3AEB A;  3TG5 A;  3UT8 A;  5FKY A;  4IDN A;  5ABF A;  2KIN B;  5L4E A;  4LMJ A;  4OAV B;  2V7K A;  3KEZ A;  3V30 A;  1JUQ A;  3FUK A;  2RKK A;  2XZE A;  2X9W A;  1V9D A;  4LF4 T;  1KNP A;  2VAS A;  3LEW A;  3CVN A;  2WCA A;  3B7U X;  1U5P A;  4I4T E;  2AVP A;  2XEH A;  5EN5 D;  3GN5 B;  4E7S A;  2PBI A;  1M7K A;  2L6B A;  3NRX A;  4NIK A;  4OYK A;  4ILA A;  2BS4 A;  3F57 A;  3ZN1 B;  2MBG A;  2KAT A;  3FFL A;  4UWG A;  5AQV B;  3OAW A;  3DBS A;  4HFV A;  1IKN D;  4EZ4 A;  4BWR A;  4XAX B;  2DBA A;  3T9K A;  3I9W A;  4YHH T;  3P4P A;  2WAU A;  5EX0 A;  2YK0 A;  4O60 A;  1IYG A;  1J5E T;  2WXG A;  1PY1 A;  2LSY A;  3NRY A;  2EIN E;  3EJN A;  2KZT A;  4J8F A;  3O1I A;  4I6J A;  5LBQ B;  2Y3A A;  2J4B A;  3CSF A;  2XPZ A;  4OHF A;  3R7Q A;  1TJF A;  2VL0 A;  3RX6 A;  1YA0 A;  4L5G A;  3PRE A;  4KMC A;  3OJA A;  1ZEE A;  4X1I E;  3DPY A;  3FU5 A;  4AP2 A;  3UUB A;  3RPU A;  4MAL A;  4UWL A;  5CGM A;  2UXB T;  4FLB A;  1L5J A;  1NFI E;  2W2U A;  2C0M A;  4GA2 A;  3T8K A;  4DMV A;  3AE1 A;  5JRE A;  4CT0 A;  5C8Y E;  2UWJ G;  3PUS A;  3IHY A;  2WVI A;  4CGV A;  3ULY A;  4A3T A;  3TLW A;  2LOP A;  2E9X A;  2C2L A;  3AEF A;  1LF8 A;  3KSL A;  4EOZ B;  1SUM B;  2ODU A;  2L9Q A;  1D1A A;  3PEV B;  3UM3 A;  3U3W A;  3NOG D;  2V5C A;  5HXS A;  4PS7 A;  3PUR A;  4ILG A;  4ANJ A;  5AEN A;  2KBX A;  3O4X E;  4BJN A;  3PZ2 A;  4L1B A;  1KZO A;  3FUM A;  3IEG A;  4RLY A;  4B94 A;  2XQ5 A;  2OLT A;  3RRU A;  4AY5 A;  3CGH A;  3ONX A;  4L23 A;  4PK5 A;  4UI9 C;  3FUH A;  3ZEF B;  3FEX A;  4AXP A;  2AJA A;  3ZHE A;  3ZKR A;  3JQ0 A;  2FJB A;  2D5U A;  2XJ7 A;  3Q7F A;  2JIW A;  3BU8 A;  2NR4 A;  1O3X A;  3AVR A;  5ENP D;  2YDS A;  5LG4 A;  2BKO A;  3I4G A;  4JEH A;  5AQO B;  5CMY A;  3G2S A;  4ANW A;  4WNK A;  3L22 A;  4GYS A;  1TR4 A;  3OYX A;  2UXC T;  4I55 E;  2JQ9 A;  2YN6 A;  3WAJ A;  4G25 A;  1H2V C;  4Q96 A;  2PZI A;  1EZ3 A;  1HX8 A;  4IDO A;  5HEH A;  3AB3 B;  3SFD A;  3AA0 B;  3M3Z B;  4ASK A;  2XAQ B;  2BVL A;  3QNK A;  5BW8 C;  1UK5 A;  3FHN A;  2WQ7 A;  4G1T A;  4Q25 A;  1QZ2 A;  4I6G A;  4AKH A;  3LDQ B;  3ZMT B;  4HFG A;  4C90 A;  3EHZ A;  2KCL A;  3LPZ A;  3UUM A;  1OY3 D;  5LHI B;  1US7 B;  3I0Q A;  4DR5 T;  4GCN A;  4AIF A;  3MEK A;  3Q7A A;  5HYA A;  1N9A A;  4GMR A;  1QBQ A;  3HKC E;  3LCA A;  3HRA A;  4JL0 A;  4QH5 A;  4G8K A;  4E85 A;  2XHE A;  4K03 A;  4I17 A;  3RRN B;  3ZUV B;  3ZCJ A;  2XGM A;  4GK0 E;  3PZ4 A;  5E0O A;  2VSO E;  3CKD A;  2YOE A;  2RPA A;  2JMK A;  1N4P A;  3SFX A;  2XQY A;  1IQR A;  2QY7 A;  4J0U A;  5ARG A;  2NTY A;  3Q5M A;  4XZ4 A;  3SS1 A;  3PZ3 A;  4CRW A;  1W0B A;  4PNI A;  2JJ9 A;  4A63 B;  1MNE A;  2YNQ A;  2R59 A;  2NW9 A;  3KFW X;  4EBA A;  1SZ9 A;  2FI7 A;  4ZS2 A;  4AQG A;  3D9L A;  5ABH A;  3DJB A;  3K3Q C;  2WXF A;  2NXP A;  1W09 A;  1UCU A;  3FXE B;  3Q9U C;  4WUY A;  2XQ6 A;  3GW4 A;  4G23 A;  4PJN A;  3E4B A;  5LJM A;  4J8S A;  2L0I A;  1MMD A;  2CLY B;  3SQV A;  2EIK E;  3SHF A;  4AKR B;  3L8R A;  3CHO A;  3LDZ A;  5BUZ A;  4XKC A;  1WM5 A;  5FY0 A;  3EAM A;  2MYS A;  4KYO B;  3EHQ A;  1ZKE A;  4X20 E;  4JI8 T;  2WM9 A;  1YD8 G;  4NXM T;  4NAC A;  2W67 A;  4LF7 T;  1HTJ F;  4WZX A;  4DUZ T;  1LKX A;  2G0U A;  5B1A E;  5HKP A;  4DR3 T;  1IAP A;  3Q47 B;  5J90 A;  4JHR A;  2GGF A;  1A5E A;  1H2U A;  5HAX A;  1NEN A;  2VGE A;  4N3B A;  4FU3 A;  2YU2 A;  4FAD A;  3EU9 A;  1NL4 A;  2IML A;  3HKE E;  2P9I G;  3QJZ A;  3AE6 A;  1MYO A;  3G2W A;  5CA1 E;  3ONL C;  3HA4 A;  4UF0 B;  4IYP A;  4AIS A;  4DI4 A;  4JI6 T;  2CWO A;  4O8S A;  2A3D A;  2F37 A;  2JPF A;  3ZKJ A;  1UJK A;  2UUC T;  3UUX A;  3C4Z A;  2E5L T;  4GZC A;  5IYZ E;  3TLT A;  2ETC A;  1MIY A;  3O48 A;  2X9H A;  5F5W A;  4BER A;  3SFZ A;  2IY0 C;  4QXC B;  2LXM A;  4UWH A;  2DNX A;  4HI9 A;  1HO8 A;  2KWH A;  3N2G E;  3U64 A;  4JVS A;  4UUC A;  4CT4 A;  2E9X B;  1HS7 A;  5ABE A;  4UWK A;  5JR9 C;  5ENN A;  3RO3 A;  3CV0 A;  4B89 A;  1JPL A;  2GRP B;  4JA7 A;  2X6J A;  5CRU A;  2JEK A;  2V4L A;  5AQS B;  4BA9 A;  2BUG A;  1T8B A;  1A17 A;  3HXF A;  1TN7 A;  3P50 A;  2V0P A;  1DCQ A;  2A72 A;  2EIM E;  4CZZ B;  3CEQ A;  1QSD A;  2NSZ A;  3LS8 A;  3NZP A;  4P0A A;  2PM7 A;  2XEV A;  4AQF A;  1YCS B;  3V5U A;  2P9N G;  4HFC A;  4JD2 G;  5ARF A;  2QYJ A;  2AE9 A;  3K8P C;  1SVX A;  5EDS A;  1N95 A;  2EHO C;  3CK9 A;  5BV1 A;  3H37 A;  4X1K E;  1BR2 A;  1E7P A;  1YKE B;  1RW2 A;  3ZU7 B;  3CHS A;  5BXO A;  3VR9 A;  4HFI A;  4DJA A;  2PFV A;  2WQY A;  1WCR A;  1DVP A;  5A1L A;  2KXP B;  5FXV A;  2D9D A;  5H6R B;  4HOQ A;  5ABG A;  4U31 A;  2M63 A;  3QUJ A;  2WQ6 A;  5ETW A;  2QVA A;  3LJ3 A;  4KVM A;  2HHH T;  3ABL E;  3UM1 A;  3GZ1 A;  5KXJ A;  2J1D G;  3B7T A;  2V6Y B;  3FTS A;  4HBD A;  3D0T A;  3TXM A;  4GTS A;  3AG2 E;  5L3E B;  4LF6 T;  4RG9 A;  5AYW D;  4AI6 A;  1Q2Z A;  3GZS A;  4MLP A;  4DLQ A;  2DL1 A;  4QXH B;  3KV5 A;  4XX5 A;  4TXR A;  3DTO A;  5AQF B;  3K9I A;  2BVM A;  3MV3 B;  3JQ1 A;  2V5D A;  4TWH A;  5FZS A;  3JXI A;  2NYJ A;  3N9P A;  2UY1 A;  3OKQ A;  5HCJ A;  2HPJ A;  2IAK A;  5F3J A;  1EPU A;  3ZPJ A;  3ETV A;  5H6Q B;  3PDN A;  2XHE B;  2W61 A;  1OT8 A;  2XQ4 A;  4WAF A;  4HWF A;  1HNW T;  4C9B B;  3UU4 A;  2I6H A;  4K0U A;  5BR8 T;  4C0E A;  1N52 A;  3UU8 A;  2VL8 A;  1L0V A;  3GWH A;  5JQG E;  1ELW A;  4MRU A;  4BT9 A;  4M1P A;  4GKJ T;  2CFU A;  3Q78 A;  3DXM G;  1OWA A;  1UN8 A;  2DCF A;  3U78 A;  5JMN D;  4EZH A;  4DR4 T;  1XNR T;  2XM2 A;  5AQA A;  2X0H A;  2BG9 C;  2BDE A;  2QYW A;  3RYI E;  2VQE T;  2LE8 A;  2YKS A;  3PNL B;  4I43 A;  5HRY A;  1JWF A;  4ATZ D;  5CA0 E;  2L3L A;  4PJJ A;  4CDR A;  5KBA A;  2DWG A;  4DV4 T;  5G04 J;  4DO0 A;  1Y6I A;  1YMP A;  3EDU A;  5L47 A;  3QWW A;  4A1G A;  1N4R A;  4DX7 D;  2HN1 A;  2R02 A;  2I1J A;  5AQN B;  4I1A A;  4ZOL E;  4HE8 A;  3ML8 A;  4QWN B;  4EED A;  4HRM B;  4GZ6 A;  3NZS A;  1HNX T;  4GTO A;  1DC2 A;  2YHC A;  1G3N B;  1WYC A;  5F8P A;  1S64 A;  1G8X A;  2DWK A;  2Y1L E;  4ANV A;  5A6C A;  5FQ8 A;  5LCW J;  4FUL A;  3RYF E;  4GPK A;  2V1D B;  1AWC B;  4I1M A;  3P2B A;  3VRB A;  3UUL A;  4AEZ C;  4GA0 A;  2VTB A;  3H3A A;  2M6B A;  5FP3 A;  2NOX A;  3NQP A;  4N2S A;  4KI0 F;  4A56 A;  1T98 A;  3C64 A;  2BBH A;  3QK6 A;  4HWD A;  5ENO D;  3TWV A;  2CXF A;  3FWV A;  1FJG T;  3CX6 B;  4UQX A;  3WG7 E;  1HE8 A;  5T8I A;  4JLE A;  2EHO D;  2A5U A;  3MGB A;  2BKP A;  1WFD A;  3AEC A;  4DV5 T;  4ISS A;  4YSZ A;  4TZ4 C;  3UUX B;  2JQH A;  3SD5 A;  2C0S A;  4GB9 A;  3N9O A;  1OWO A;  3V31 A;  4FA6 A;  3LJC A;  4O1O A;  3KV6 A;  3Q15 A;  4BSX A;  2QA7 A;  4U63 A;  3CR3 A;  5AQH B;  4GAA A;  4IRU A;  4EEC A;  5KJK A;  5J1G A;  3FEY A;  2BKG A;  4LSZ E;  5ENT D;  5KMG P;  2LO6 A;  1NAF A;  3C50 A;  3QB2 A;  3FTZ A;  2E0I A;  2CEA A;  2ZM0 A;  5EK4 A;  2IW5 B;  1T72 A;  4JBW F;  2WXR A;  3KEA A;  4F53 A;  5J2T E;  4XBF B;  2JRK A;  4EEB A;  2EIL E;  2V5F A;  4WBO A;  2EIJ E;  3QWV A;  1FIO A;  3EDT B;  4LMK A;  2QZA A;  1UX5 A;  4IIJ E;  4ME2 A;  2VKH A;  4I50 E;  3DSW A;  4P0B A;  4GML A;  4AM9 A;  5JRC A;  2LSU A;  2R05 A;  4NUU A;  2ZU6 B;  2FBW A;  3ZYM A;  4X1Y E;  1FT1 A;  5TAO A;  5CJ5 A;  3UT5 E;  3QAQ A;  5CHE E;  3L08 A;  2WMO A;  3CPZ A;  3QB5 A;  4C91 A;  2IJG X;  4DX1 A;  5FY7 A;  3UTK A;  1H6P A;  5AQ9 A;  3L09 A;  4HFD A;  4BET A;  4TNW A;  2PQR A;  2DVW A;  3LY9 A;  3R9A B;  3K3N A;  4GZ5 A;  3ONK A;  5AQI B;  4CXW A;  3T8M A;  3ZT5 A;  2N1G A;  4HN9 A;  3IEE A;  3UXG A;  1B89 A;  5EK3 A;  4UQZ A;  3LBX A;  2ZGD A;  3KV4 A;  1KNZ A;  5G55 A;  4Z8X A;  2LLY A;  1TNB A;  2H88 A;  4YY3 T;  2GRL A;  3V79 K;  5DIZ A;  4WWN A;  1D8E A;  2XRY A;  3C3R A;  3MKR A;  3TWX A;  3P7I A;  5AQU B;  5JDH A;  1ELK A;  2W00 A;  3SBS A;  2UY1 B;  2X6H A;  2XPI A;  2J8S D;  4YDY A;  4NIQ A;  1IQU A;  1S0P A;  2Y69 E;  4XE0 A;  4DX2 A;  2L0T B;  5KJN A;  3V2X A;  3DSS A;  3AEG A;  4PW8 A;  3IBP A;  2H6I A;  3IHV A;  4KUM B;  4MBG A;  3UU3 A;  4MFR A;  4DR2 T;  4IGU A;  4JB8 P;  1OED B;  5C1D A;  2LSG A;  3PUZ F;  2LXL A;  3PJA A;  3ESK A;  3CHM A;  2VB6 A;  3ZT6 A;  1RZ4 A;  3HL6 A;  3ZCI A;  3T5V A;  3FZH B;  5LNK A;  4CQI A;  4UV8 B;  2ZIS A;  4LF8 T;  3BG0 B;  1OXJ A;  2XGS A;  3EUH A;  2XS1 A;  4Q94 A;  1UX4 A;  4KMO A;  3X2Q E;  2XPY A;  3BK9 A;  4U96 D;  4GU5 A;  3H3M A;  3NF1 A;  4EZL A;  4BAY B;  1YW0 A;  2MTQ A;  2VGX B;  2GK9 A;  5LBM A;  3VU7 H;  2NP9 A;  4AVX A;  1BPO A;  1XNF A;  3SNX A;  3FBZ A;  2ZM2 A;  4H9Q C;  1WLX A;  2ACX A;  5AJL A;  1FMW A;  5ENR D;  3CK8 A;  5HXR A;  4FJZ A;  5A23 A;  4TNV A;  3UTM A;  3KVA A;  3ABM E;  4KBQ A;  1FCH A;  3QNU A;  3ZXP A;  4IN3 B;  4PK4 A;  2V7L A;  4U2Y A;  5J0Z A;  1MZC A;  3CVV A;  3FUI A;  4UV9 B;  2AXD S;  3N5L A;  3C3Q A;  3PE0 A;  3IF8 B;  3W9G A;  1ZHC A;  1E2A A;  3O1H A;  4IL4 A;  4L2L A;  1WR0 A;  1GQE A;  3DST A;  2ZGG A;  2W63 A;  3W15 B;  4EAH A;  2P9K G;  2BED A;  4C48 B;  2K3W A;  2WDV A;  2XQA A;  4DMW A;  5BMV E;  1S63 A;  1YYH A;  4G8L A;  1S70 B;  5ANR A;  2K5B B;  4XI9 A;  3HXD A;  3U66 A;  3NKZ A;  1J1J A;  3BQK A;  2X51 A;  3SO8 A;  2CHW A;  3LKU A;  4I2W A;  2A9U A;  2FJA A;  3WXX A;  3RYH E;  5AQM B;  5AN8 A;  1R8I A;  3HXC A;  5EX3 A;  2NC9 A;  2WXI A;  4FC8 A;  5DQW A;  1MX2 A;  2ION A;  5CED B;  3AS4 A;  1XGW A;  2L9B A;  3APF A;  1VOM A;  5HWX A;  2CFZ A;  5AAR A;  1G73 A;  1IHG A;  3IV0 A;  4EYU A;  2NWB A;  3T1Y T;  4EQF A;  3FB2 A;  2Q9Q B;  1N34 T;  2DI4 A;  4DV2 T;  4DRX E;  4JI7 T;  2VK9 A;  1N54 A;  3D9N A;  2IO3 C;  4FI5 A;  4A1S A;  2J4G A;  3V5S A;  4DR6 T;  2V7M A;  2I1K A;  2F0Y A;  2X38 A;  4U7E B;  3N9M A;  3UIN C;  4DR7 T;  1MJ0 A;  4BY6 A;  5AJD A;  2VVS A;  1M62 A;  3VKH A;  4HVB A;  3SFE A;  4OAU C;  1Z8U A;  2QGS A;  3UIP C;  1T7S A;  4QX8 B;  2IFU A;  5HEU A;  4GOU A;  3KD7 A;  3L6A A;  3I9Y A;  1OUV A;  2RFA A;  3AED A;  2QYU A;  2XZD G;  4BTA A;  3R9M A;  3U4T A;  1PC2 A;  1MIW A;  2WXL A;  4UQY A;  2VWA A;  2X66 A;  3ONL A;  2IUB A;  3P4Q A;  2X3M A;  2E2E A;  3AE2 A;  1MX6 A;  3KDS E;  3Q75 A;  4I1O B;  5C2Y A;  3ZVV A;  1JNZ A;  3N2O A;  2LSK A;  2XM1 A;  3TLV A;  4N5C A;  2F8Y A;  4IE4 A;  3PUG A;  3LJN A;  4U8V D;  3CQX C;  2WY2 A;  3HKB E;  2XAH B;  4QH1 A;  1XMQ T;  1MHQ A;  1TN8 A;  2J47 A;  5JR9 A;  2GRM A;  5FVK A;  4ZFH A;  2OEW A;  4X64 T;  3N9N A;  4MLK A;  1HF8 A;  1W0A A;  1DU2 A;  1FT2 A;  4ZZB A;  2LM2 A;  3ZMV B;  4G26 A;  4OFZ A;  2A2F X;  5FVL A;  4QFV A;  3S7B A;  1SA4 A;  3LK4 2;  4DVD A;  2XQ0 A;  3DWL G;  4ZI7 E;  2I9C A;  4ZZC A;  2YQ8 A;  4O4L E;  3CLJ A;  4U07 A;  3G06 A;  5FXZ A;  1IBL T;  5IY5 E;  1AJ3 A;  4Z68 A;  3ZPO A;  5IWA T;  2EHO A;  2IF4 A;  2J08 A;  1P5Q A;  4Y6W A;  2LEH A;  4BEP A;  1NWM X;  5LG3 A;  4BFR A;  5EYL A;  2N9D A;  2Y0B G;  3CVR A;  3E0Z A;  3AVS A;  5LMU T;  4I6E A;  3L39 A;  5ABF B;  5D0Q D;  5AQR B;  1HNZ T;  1WR6 A;  2SPC A;  2ETA A;  1Z6T A;  4J2C A;  3DSX A;  1X79 A;  5HEJ A;  4EB6 E;  3C5R A;  3RSE G;  3DRA A;  1VDY A;  4UEM A;  4HWI B;  4GTM A;  5FIO A;  3GA8 A;  4CZ2 D;  4H9S E;  4XKB A;  2XQ8 A;  1BLX B;  3AE5 A;  5FYM A;  3ZJ2 A;  1EDU A;  1K1A A;  3ZT7 A;  4J8E A;  3E08 A;  3UM2 A;  1K1B A;  2MHK A;  2CLY C;  2C5I T;  3SGH A;  4A98 A;  3FH5 A;  4ACL A;  4W9R A;  1BD8 A;  1GW6 A;  2CHN A;  4WYV A;  2LRL A;  4GTQ A;  5CBN A;  2EQX A;  3KAE A;  2L6J A;  4DX6 D;  4B6X A;  3LXU X;  1NA0 A;  3HG0 D;  5L2L A;  4LFA T;  3RK6 A;  2ETB A;  1H2T C;  2HO1 A;  5KNH D;  2CHX A;  3AA7 B;  4JI3 T;  3DP7 A;  3TWQ A;  3ML9 A;  4JUY A;  2DCP A;  1N4Q A;  4KZ0 A;  3JAE A;  5AQK B;  1E96 B;  2DHR A;  2WXJ A;  4G24 A;  3Q5X A;  2R5S A;  2CG2 A;  2P9P G;  3LVQ E;  1D0Z A;  1N33 T;  1FVF A;  1XMO T;  1QNF A;  4U95 D;  2DZO A;  3Q9D A;  5M72 A;  2KZT B;  3VR8 A;  2IO2 C;  2J07 A;  3B57 A;  3TWT A;  4IE6 A;  1KF6 A;  4DBQ A;  5CFB A;  3NOC D;  4O2B E;  3CIA A;  3UQ4 A;  3FZM B;  3UQ3 A;  2PQN A;  1S94 A;  1HU3 A;  1UJJ A;  4YND A;  2BG9 E;  4IDZ A;  3ZC1 A;  2V6X A;  2LAI A;  5BV0 A;  4X62 T;  2IC9 A;  2XSB A;  3TWS A;  3C98 A;  2E9X C;  4YTN A;  2BTD A;  2LRK A;  3CST A;  4LUN U;  4U04 A;  5D66 A;  2M67 A;  3ZW3 A;  3RKV A;  2WXM A;  1V54 E;  4ATG A;  5AQB A;  4BSZ B;  3MKQ A;  1HR0 T;  3TXN A;  3C4X A;  5J08 A;  2E2A A;  3D9I A;  2B0O E;  2F8X K;  1E7V A;  3MJX A;  3HDX A;  2VVN A;  4ANU A;  1HFA A;  3UT4 A;  3X1D A;  2IDO B;  2WB5 A;  4LF9 T;  2WB2 A;  3U3I A;  1UGO A;  4WW0 A;  1BR1 A;  4H9R C;  3UFG A;  3EIQ C;  2P2C P;  2UXD T;  4OK0 A;  5L3C B;  3HIZ A;  4OYS A;  5FJY A;  1E8X A;  1W9R A;  3PUV F;  3CKC A;  4HTE A;  5LP6 E;  3VRA A;  3FUF A;  1KEY A;  2LSI A;  4HB5 A;  1IZN B;  2YEV C;  4HOS A;  1TN6 A;  2WQH A;  2OVB A;  3RHW A;  4AXH A;  5AQ7 A;  2KXP C;  1E7U A;  3FY4 A;  3C51 A;  4A55 A;  4IT4 A;  3AA1 B;  3VTY A;  3ZHE B;  4O6F A;  5LYJ E;  1JCR A;  1Z0P A;  3AXJ A;  4J8D A;  1UN9 A;  4DPR A;  4JEH B;  4GA1 A;  4B8C B;  2CE7 A;  2YHE A;  2BS2 A;  5L3G B;  3E22 E;  1OWP A;  3D9K A;  4JW1 A;  2JQK A;  4APF A;  3FUE A;  3OXL A;  4HFE A;  3D9J A;  3FTV A;  4GYW A;  4HOU A;  4XEI G;  3HXE A;  5JJT A;  3RIU C;  3AU4 A;  4DBR A;  2PNN A;  2XEE A;  4JEU A;  2Y4T A;  3P4S A;  3AU5 A;  5A7D B;  4YTM A;  3J7Y q;  2XTL A;  2ES0 A;  1TJC A;  2GRN B;  2WXN A;  4CXY A;  1V55 E;  3JUE A;  3UMV A;  4QXB B;  2WXH A;  5FZR A;  4OVV A;  5LGN B;  4MBQ A;  3KS2 A;  3UQ7 A;  3FZL B;  3CQC B;  2UXX B;  3RC3 A;  3JUI A;  2WWV A;  4H7X A;  3UI2 A;  5AQL B;  4YSX A;  4O1P A;  4CEM A;  2MPK A;  1H7C A;  2CG3 A;  4CYM D;  2IC6 A;  2HYZ A;  1ZP0 A;  3EI0 A;  5FMN A;  5IUX A;  4DV6 T;  1FMV A;  1HXI A;  3N71 A;  5EID A;  4F6R C;  4QHO A;  2NTX A;  2QC9 A;  3D3M A;  2JMH A;  3B5M A;  3L16 A;  3I5P A;  1XNQ T;  4Z91 A;  4JI4 T;  3UX4 A;  4L0R A;  3ASF A;  4AOF A;  3EHR A;  4TUU A;  1JWG A;  3HVE A;  1N0Q A;  2LT3 A;  2GRO B;  2V7I A;  1EYH A;  2CWY A;  3ENE A;  2XPK A;  1Y64 B;  1LD8 A;  4HOR A;  5LGU B;  3JAF A;  3PUW F;  4PDX A;  5JDF A;  2R03 A;  2FJE A;  3CVU A;  3RIA A;  3ASN E;  4YLH A;  3D9O A;  4LRZ A;  4O4H E;  1D8D A;  3ZXS A;  2E9X D;  5JDL A;  3BQL A;  2Y8D A;  4ZXL A;  3Q2M A;  3DSU A;  1UUS A;  5ENQ D;  3RO2 A;  3SFY A;  2B6C A;  2DIW A;  4DV3 T;  4XIF A;  2LSV A;  1OED E;  3FXD B;  2OEV A;  3RAU A;  1BR4 A;  4HRL A;  4GPM A;  3NVO A;  4E6H A;  3J5P A;  2R2L A;  4CN6 A;  1VCS A;  4U0U A;  2X68 A;  3RKO A;  1SA0 E;  1E8W A;  2WPV A;  4TRQ A;  5HS0 A;  3ZRH A;  4I0U A;  4BT8 A;  2LOS A;  1Z3Y A;  2K48 A;  2E5V A;  4YVQ C;  3PUX F;  3SF4 A;  4H63 V;  3SY2 A;  1OCR E;  2VKJ A;  3IKO B;  4G2A A;  1QYM A;  4EXT A;  3WAK A;  4ILB A;  2B76 A;  3CHP A;  1JNR A;  3L9T A;  4G11 A;  2CHZ A;  5FTP A;  4QQI A;  3TG4 A;  3GN5 A;  3Q73 A;  3JYS A;  5T3R A;  5JDG A;  3AAI A;  4HXI A;  4B3R T;  5CEC B;  2Y48 B;  2KWI B;  2W0G A;  3B7B A;  4J7W A;  4IDP A;  4GTT A;  2CA5 A;  2B1E A;  3LK2 B;  1K8K G;  5EIB E;  2H6F A;  1Z5S C;  3MKQ B;  3SWH A;  4O4I E;  2LKG A;  1JCS A;  3EDV A;  2HE0 A;  5KNG A;  4O4J E;  2XQ7 A;  4AQY T;  1IXV A;  1NEK A;  1DCE A;  4U8H A;  2IOS A;  3PEU B;  4HLE A;  4IHJ E;  4N39 A;  2X67 A;  4U3C A;  4CGW A;  5JTG A;  3JXJ A;  3E34 A;  3QDN A;  5G04 C;  3TWU A;  3QC1 A;  1MIV A;  2GW1 A;  3SBT B;  1NA3 A;  4KHP T;  4G63 A;  4IST A;  1SW6 A;  5LHH B;  4EV6 A;  4K5A B;  3ZFW A;  3FZK B;  3UUN A;  1E90 A;  1HH8 A;  4YFS A;  2XEN A;  5EKQ D;  3ANW A;  1N94 A;  3MXZ A;  2WP9 A;  4AKG A;  4ABN A;  1OWN A;  1U3D A;  5LCW C;  3KVB A;  2MAW A;  2PJQ A;  3Q5W A;  3ETU A;  3NBX X;  3CWZ B;  3JCK C;  5G05 J;  1XDO A;  4F6R D;  3HHM A;  2DZN A;  5LHG B;  5FWQ A;  5KDM C;  3UPV A;  1D0Y A;  5ADX L;  2P9L G;  2W62 A;  2UUB T;  2OVF A;  3APD A;  2ILR A;  4WWO A;  2BKK B;  4K0R A;  2M6I A;  3U9W A;  3FBL A;  3W9F A;  2KSR A;  2CXD A;  2AXZ A;  4DUI A;  3ZYQ A;  1CUN A;  2Z6E A;  3N9Q A;  4JEU B;  3FTW A;  2IHR 1;  4HI8 A;  4U0Z A;  4U8Y D;  4PFP A;  2R17 C;  1MND A;  4APO A;  3L54 A;  2WU2 A;  3K3O A;  5HXH A;  3D9P A;  2W66 A;  2W4X A;  5IHY A;  5EYP F;  3RRC A;  3OTN A;  3AAA B;  3BEE A;  4H7Y A;  3DSV A;  4ILC A;  1I6Z A;  4AY6 A;  3L82 A;  2H6G A;  3E37 A;  3LY8 A;  2R6G F;  2WSS V;  3ABK E;  1OED C;  3KIN B;  3AE4 A;  4GTV A;  4TV3 A;  4I2Z A;  2RFM A;  2X0L B;  1BU9 A;  2X6K A;  3RH3 A;  1LD7 A;  5FQ7 A;  3ZST A;  1H6O A;  4R7L A;  1HG2 A;  4OYJ A;  2LHN A;  3KV9 A;  4HEA A;  2WZI A;  3OBV E;  2VKD A;  2XAJ B;  5B3S E;  3ZMS B;  3I3N A;  4PFO A;  3TGO A;  3ASG A;  4WNG A;  3HVE B;  3ZMZ B;  4AIU A;  2KCK A;  2OV8 A;  2WXO A;  4U7I A;  3HR0 A;  3V2O A;  3ZSS A;  1ZBP A;  2HPL A;  4I43 B;  5KWD A;  4B8A A;  2JAB A;  5KX5 E;  4P09 A;  4FHJ A;  4MKT A;  2D2S A;  1QLB A;  3UU6 A;  2KC7 A;  5T4Y A;  4H9P C;  5LXT E;  1XZY A;  4ACK A;  4LEU A;  5CER B;  3RIB A;  3CVQ A;  3RU0 A;  1PAQ A;  1LTX A;  5LOZ A;  2UUA T;  1NZN A;  2LUH A;  1Y01 A;  4DND A;  5DQV A;  3B7R L;  2CHO A;  3CKB A;  4YT0 A;  5LJN A;  2AXU A;  2XZT G;  2YIN A;  4DX5 D;  1IBM T;  5HQ8 A;  4ILH B;  3PUK A;  3PNT B;  1D1C A;  3CK6 A;  4ZS3 A;  5LFA A;  2VTB B;  3VTX A;  2WBL A;  3NZU A;  3QB5 K;  2AWI A;  1H19 A;  3ULQ A;  4HOT A;  1KZP A;  2FEZ A;  5FT9 A;  3RJV A;  4F1P A;  2XSA A;  3CQG B;  4BX9 A;  2FO7 A;  2J9Q A;  3OTO T;  4UXN B;  2Q9Q C;  3R84 B;  4JI1 T;  1E8Z A;  5CEA A;  3Q79 A;  5LA6 E;  3AE8 A;  2I2O A;  4NRH B;  3UKU G;  2H3R A;  2J4D A;  4JC8 A;  4PJL A;  3B13 A;  3GZ2 A;  4TWF A;  4GKK T;  4YDE A;  5HCM A;  4FLH A;  4PH4 B;  4HFB A;  5BT1 A;  3PU3 A;  2A4Z A;  4J6I A;  4UI9 J;  3CVP A;  3ZIM A;  5HEO A;  1IJ6 A;  4GYR A;  3MKD A;  2J09 A;  1OCC E;  4J8Y A;  2C5J A;  4UVA B;  4F7A A;  3PJA J;  2VSX E;  3VLD A;  1MMG A;  4YTP A;  5J2U E;  3OXG A;  3PVL A;  4TXQ A;  2DLR A;  5JJ7 A;  3FTX A;  2RD0 A;  4A97 A;  3QAR A;  5L4H A;  3LFM A;  2DWZ A;  3HYM B;  1BI7 B;  3ANW B;  4UI9 K;  2KM4 A;  4QH4 A;  5JRC B;  3AS5 A;  4ZI3 C;  4UF0 A;  5L3D B;  2VYI A;  2MRI A;  3DXK G;  1SQM A;  3BQO A;  3O9X A;  4KP3 C;  3PUA A;  3T8O A;  1Y8M A;  4AJW A;  3BG1 B;  2X9X A;  5BXU A;  1B7T A;  4UR9 A;  5JHB A;  4CXX A;  3F2E A;  2PM6 A;  4TUM A;  5KJM A;  5LB7 B;  5C2T A;  4JI5 T;  1OWL A;  4IL9 A;  5HI7 A;  4TWD A;  1WDY A;  2BF0 X;  2ZM8 A;  3RF1 A;  1U2V G;  4ZHQ E;  3K1S A;  2V5Q C;  3AE9 A;  3LBX B;  4PUC A;  3AEE A;  2CXL A;  4F8H A;  3UIO C;  4L7T A;  2N2N A;  3TJP A;  5BPP A;  4AKL A;  2IOL A;  3S7D A;  2IQC A;  2LSJ A;  5LMN T;  4N3A A;  3ZC0 A;  1Z3X A;  2VQ2 A;  2WDQ A;  4PK6 A;  3LVR E;  4JI2 T;  4TV9 E;  4CCA A;  3ASO E;  4A5X A;  4GCO A;  1YXR A;  3BQI A;  2KCV A;  3RC8 A;  2D0T A;  4JI0 T;  2MOW A;  4GK5 E;  2X6F A;  2XCC A;  1HZ4 A;  3D9M A;  4U0S A;  3RLF F;  2V8S V;  4RG6 A;  2LKH A;  4OX9 T;  3DPD A;  1INZ A;  4JHK A;  3PZD A;  3A7M A;  3ZYL A;  2PG8 A;  2XQ9 A;  4B93 B;  3A8Y C;  2WU5 A;  3APC A;  1XWM A;  2Y4U A;  5JA4 D;  3UT7 A;  5FXX A;  3MX3 A;  5AIJ A;  2X9Y A;  3FHE A;  4DK5 A;  4B3S T;  3J5Q B;  2V6Y A;  3AAE B;  4OVU A;  1OCO E;  4IRE A;  4PAG A;  2BBJ A;  2WMN A;  3CVY A;  3MK7 C;  1HX1 B;  3VLE A;  4CI3 B;  1TEZ A;  3RGL A;  1NI1 A;  2V8S E;  5M4Y A;  4Y6C A;  1WAO 1;  4EZJ A;  2I0M A;  3TLU A;  2ZLY A;  4DV7 T;  4JYA T;  2FO1 E;  4L9I A;  3RI5 A;  3C3O A;  3EIJ A;  1XDP A;  2LNI A;  1EF1 C;  5CMW A;  2J62 A;  3RIU A;  4LFC T;  1SZA A;  2Q9Q D;  3JC6 C;  1QQE A;  3ASH A;  2RA1 A;  4P1N A;  5KCM A;  3P1U A;  2WWU A;  3FP3 A;  3NZQ A;  3FUL A;  2C0L A;  4H9O C;  3F31 A;  1N0R A;  3OYZ A;  4GTP A;  4PS3 A;  2L8K A;  3PDY A;  3S4U A;  1TNZ A;  1AP7 A;  1H0A A;  4B3T T;  5AFU L;  2AXV A;  3UU5 A;  1CHU A;  4I9E A;  1DNP A;  3PUY F;  2ODV A;  2XAG B;  2FF4 A;  4BTB A;  3RRM B;  5HXC A;  2AW6 A;  4NUV A;  3A5X A;  4N3C A;  5L3B B;  3JAD A;  3PUQ A;  4ZEY A;  2P9B A;  4DUY T;  4RQI A;  4UVC B;  4MHC A;  3P4W A;  1MMN A;  4ZI3 D;  5CCL A;  3ZN0 B;  2IIU A;  2HM8 A;  3L3P A;  2OND A;  4EIW A;  3IA3 A;  4LCT A;  1KNR A;  5BNW A;  2ZMA A;  3GMI A;  3OPC A;  5FL0 A;  4RVB A;  5G2N A;  2H7O A;  2BG9 A;  1TYQ G;  4WNE A;  4YDO A;  3RKG A;  3CHQ A;  4ANX A;  2Q7F A;  1IHB A;  3LYA A;  3MJW A;  4KX6 A;  4CN4 A;  1O1T A;  5FQ6 A;  4CN1 A;  4YJ2 E;  3VHL A;  5FL1 A;  5JVD E;  1UOH A;  3LK3 B;  3FU6 A;  3IHR A;  4O2A E;  3ABV A;  4U7Y A;  3ONJ A;  3SI5 A;  4P29 A;  1VCT A;  2WZH A;  4BJM A;  1MQS A;  2XS8 A;  3MCX A;  5E76 A;  3Q5D A;  3CVL A;  3S2A A;  2KT9 A;  4DV1 T;  4EZK A;  4DI3 A;  5DJQ C;  4HNA D;  4M3O A;  3FTU A;  3I4R B;  4Q69 A;  3EAB A;  2NW7 A;  2K9A A;  4WWP A;  4I9C A;  4DLO A;  3T1H T;  2XQ3 A;  4KHZ F;  2GRR B;  5JDQ A;  4IE5 A;  1OWM A;  2WXK A;  2C5K T;  3AG3 E;  3LSV A;  2OA5 A;  4ZI2 C;  3G2T A;  2KND A;  4EHM A;  3R6N A;  5LP0 A;  1WG0 A;  3FDH A;  4N78 D;  3F6Q A;  5EK2 A;  4N5Q A;  1D1B A;  5C3J A;  4TXP A;  5ITZ F;  2KLQ A;  2XY8 B;  3ZJ1 A;  1KT0 A;  3RQW A;  2CM0 A;  4HKA A;  3TL5 A;  5CRV A;  3OXF A;  2VGY A;  4AV7 A;  3I1A A;  4HWC A;  3Q49 B;  4KT6 B;  5AQP B;  1E1H B;  4UVB B;  2ZM6 T;  3AE7 A;  4UEL A;  4YXD A;  4EBA G;  5AAO A;  2KMF A;  3ZNG A;  3I0O A;  4QKN A;  1ZV4 X;  3MAC A;  2RG8 A;  1UUR A;  4WND A;  1SE7 A;  5B1B E;  1LVF A;  4COF A;  3Q9N C;  4NXN T;  4GMJ A;  1KK7 A;  1VRB A;  2PL2 A;  3B7S A;  2HR2 A;  1TNY A;  4GIW A;  3CML A;  1I94 T;  2JLB A;  3KBT A;  5JHA A;  4FJO A;  3CX8 B;  5JR9 B;  3ZYK A;  3NBN B;  1TNO A;  3JC6 D;  3TLS A;  3JCF A;  2CBI A;  3TWR A;  2MOZ A;  2IEJ A;  4JA9 A;  3AEA A;  4GZD A;  4V1A v;  4HFH A;  2XCB A;  4IUL A;  5EZY E;  3R7R A;  3PU8 A;  4HS2 A;  2CMR A;  4GZ3 A;  5LX8 A;  4IE0 A;  3AA6 B;  3OVU A;  2QRX A;  3E32 A;  3HI2 A;  3HKD E;  2PTF A;  4HLL A;  4JXT A;  3ASD A;  3DEO A;  4MS6 A;  1HS6 A;  1KFY A;  3WI3 A;  4CDM A;  3S7F A;  4GYY A;  4JPS A;  1J5W A;  1SA5 A;  3QC9 A;  4QX7 B;  4G2V A;  5JJ6 A;  1FVH A;  4IE7 A;  2EHO B;  4C0M A;  2YU1 A;  2DYR E;  5JH7 E;  3AS8 A;  3NAW A;  4B0Z A;  3LG7 A;  3IBE A;  3FU3 A;  5DAB A;  4FJY A;  1YQ4 A;  2A5E A;  2HH7 A;  1HG5 A;  3P4R A;  4TUY E;  3Q4A B;  3Q5E A;  4KBM B;  3AG1 E;  2WS3 A;  4ADZ A;  3VKG A;  2P58 C;  5LOV E;  2K24 A;  2CCQ A;  4U72 A;  3MA9 A;  5HWY A;  1JCQ A;  3RRW A;  3EVY A;  3PE4 A;  1O1S A;  4TV8 E;  1MX4 A;  4N2Q A;  3FTY A;  5KJL A;  5LGT B;  2ZXW E;  1QUU A;  1YQ3 A;  3HXB A;  2X6I A;  1BI8 B;  1ZOY A;  2P9S G;  3FUJ A;  4ZHB A;  3EUV A;  3CHR A;  4XI0 A;  2VQF T;  4GYO A;  5D2M C;  3QKY A;  5AQT B;  2P9U G;  2BKN A;  1ELR A;  3QWP A;  1D9S A;  1BR0 A;  1OED A;  1U4Q A;  4JV5 T;  4D10 C;  4FP7 A;  2V26 A;  3CK7 A;  1D0X A;  3B95 A;  4U2Z A;  2LHR A;  3L17 A;  2Y6X A;  1TNU A;  3O1J A;  3AG4 E;  4EYY R;  3ULE G;  2BZB A;  3ZLI A;  4X66 T;  4A3V A;  2DYS E;  2YDR A;  3PZ1 A;  3FZF B;  1SHZ C;  4XZC A;  4HQD A;  4KXK B;  2FJD A;  4ZI2 D;  5D0O D;  4NQ0 A;  2X0Y A;  4TX5 A;  3NB2 A;  2VJ8 A;  3AJI A;  3E30 A;  1W3B A;  3M65 A;  4E7Z A;  3G2V A;  4JZY A;  2VGX A;  2BG9 B;  5FY1 A;  2RP4 A;  2VSN A;  1UW4 B;  4ERR A;  2UU9 T;  1FPP A;  3BUA A;  2XRZ A;  4LF5 T;  1MMA A;  1KPS B;  5HXE A;  4X8Q A;  2CPT A;  1YKH B;  4LNB A;  3UKR G;  4CDN A;  5FNV E;  3FUD A;  4K5C A;  5H7P A;  1X9B A;  5AQJ B;  1N32 T;  3C98 B;  5ANL A;  2LJL A;  2I59 A;  5DBK A;  2LAH A;  4HGA A;  1E8Y A;  1IBK T;  3NWI A;  3GYZ A;  3QK0 A;  5CB4 E;  2NW8 A;  3ZMU B;  1S35 A;  1N4S A;  4URK A;  2FUP A;  3SRZ A;  2UXN B;  3RIF A;  1N11 A;  2V4H C;  3C4W A;  4NUR A;  2F4V T;  1ZB1 A;  5HEG A;  3CIR A;  1LVK A;  2VKO A;  5JDM A;  3UM0 A;  5AQG B;  4PS8 A;  3TAX A;  3ZGQ A;  5FQ4 A;  3ISM C;  4JHJ A;  1IJ5 A;  4AQF C;  5JDN A;  3IXE A;  3PUJ A;  5L3F B;  4ILU A;  3RQU A;  4DID B;  2HN2 A;  3KBU A;  4K5B A;  1OXZ A;  3CVW A;  3PV0 F;  2FUL A;  5ENS D;  2XAF B;  2MYO A;  3TKL B;  2J49 A;  2VUR A;  2D0U A;  5FZQ A;  1U3C A;  1WYB A;  4KZC A;  1NP7 A;  4TN7 B;  2JQQ A;  3MYV A;  2Q9Q A;  3CX7 B;  4IDQ A;  5AQQ B;  5CBO A;  3AXJ B;  2FBN A;  1UG3 A;  1N36 T;  4WNF A;  4PJM A;  3MZK B;  4Z90 A;  4DV0 T;  4WBN E;  3AAA C;  3EU5 A;  3E33 A;  3PS6 A;  4B3M T;  4AKI A;  2GRQ B;  4KVO A;  3MA5 A;  4H63 H;  4X65 T;  4FHK A;  3DEP A;  2E8I A;  2LM9 A;  1HCI A;  4YHJ A;  3FUN A;  4YSY A;  1WY6 A;  3VLF A;  1OCZ E;  3C72 A;  4LNU D;  4UIG A;  1O1R A;  5EIL A;  3PRZ A;  3LY7 A;  4LER A;  2XGO A;  4L9P A;  4GTR A;  4X5T A;  2H7V C;  3CVX A;  1O5M A;  2YDQ A;  4YVO A;  4CI1 B;  4F3V A;  4F1S A;  4U33 A;  3RYC E;  1ZU2 A;  1K3Z D;  2QFC A;  3ZN3 A;  4EGW A;  2ACZ A;  3ZEF A;  2IU1 A;  2VSY A;  1KLX A;  3PTR B;  3L13 A;  3EHM A;  2OOE A;  2CBJ A;  3QOF A;  1X5B A;  2XUE A;  4HRN A;  4LG6 A;  2V7J A;  3SZ7 A;  4LNG A;  4EPZ A;  2KZ7 B;  1H6K A;  3N2K E;  4H9N C;  2H89 A;  1X81 A;  3FH8 A; 
#chains in the Genus database with same CATH homology
 2WXQ A;  4ILI A;  1KT1 A;  4RSY A;  5E75 A;  2XAS B;  3EHN A;  5G05 C;  3SOL A;  3URZ A;  3G2U A;  3J9X 1;  4CI2 B;  3ESL A;  4UWF A;  3UFE A;  4YJ3 E;  3FU0 A;  2WXP A;  3N9L A;  4V3I A;  3P8C D;  1FEW A;  3PH0 C;  1WRD A;  5FXW A;  3O4Z A;  4L2Y A;  3PE3 A;  3MV2 B;  3FH7 A;  3S7J A;  3QOU A;  3MZL B;  1LRZ A;  3T5X A;  5CCM A;  4BX8 A;  5GON E;  5LCY A;  4U74 A;  3TG5 A;  3UT8 A;  2KIN B;  2V7K A;  3KEZ A;  1JUQ A;  3FUK A;  2X9W A;  1V9D A;  2VAS A;  3LEW A;  3CVN A;  3B7U X;  1U5P A;  4I4T E;  2AVP A;  3GN5 B;  4E7S A;  2PBI A;  3NRX A;  4OYK A;  3F57 A;  3ZN1 B;  2MBG A;  2KAT A;  3FFL A;  4UWG A;  3OAW A;  3DBS A;  4HFV A;  4EZ4 A;  4BWR A;  4XAX B;  2DBA A;  3I9W A;  2WAU A;  5EX0 A;  2YK0 A;  1IYG A;  2WXG A;  1PY1 A;  2LSY A;  3NRY A;  3EJN A;  2KZT A;  4J8F A;  3O1I A;  4I6J A;  5LBQ B;  2Y3A A;  2J4B A;  3CSF A;  2XPZ A;  4OHF A;  3R7Q A;  1TJF A;  3RX6 A;  1YA0 A;  4L5G A;  3PRE A;  4KMC A;  3OJA A;  1ZEE A;  4X1I E;  3FU5 A;  4AP2 A;  3RPU A;  4MAL A;  4UWL A;  4FLB A;  1L5J A;  2C0M A;  4GA2 A;  4DMV A;  5JRE A;  4CT0 A;  5C8Y E;  2UWJ G;  3PUS A;  3IHY A;  2WVI A;  4CGV A;  4A3T A;  2LOP A;  2E9X A;  2C2L A;  1LF8 A;  4EOZ B;  2ODU A;  2L9Q A;  1D1A A;  3PEV B;  3U3W A;  5HXS A;  4PS7 A;  3PUR A;  4ILG A;  4ANJ A;  5AEN A;  3O4X E;  4BJN A;  4L1B A;  3FUM A;  3IEG A;  4B94 A;  3RRU A;  4AY5 A;  3CGH A;  3ONX A;  4L23 A;  4PK5 A;  4UI9 C;  3FUH A;  3ZEF B;  3FEX A;  4AXP A;  3ZHE A;  3JQ0 A;  2D5U A;  1O3X A;  3AVR A;  5LG4 A;  3I4G A;  4JEH A;  5CMY A;  3G2S A;  4ANW A;  4WNK A;  3L22 A;  4GYS A;  3OYX A;  4I55 E;  4G25 A;  3WAJ A;  1H2V C;  4Q96 A;  2PZI A;  1EZ3 A;  1HX8 A;  3AB3 B;  3AA0 B;  4ASK A;  2XAQ B;  2BVL A;  3QNK A;  5BW8 C;  3FHN A;  2WQ7 A;  4G1T A;  4I6G A;  1QZ2 A;  4AKH A;  3ZMT B;  4HFG A;  4C90 A;  2KCL A;  3LPZ A;  3UUM A;  4GCN A;  5LHI B;  1US7 B;  3I0Q A;  4AIF A;  3MEK A;  5HYA A;  3HKC E;  3LCA A;  4JL0 A;  4E85 A;  2XHE A;  4K03 A;  4I17 A;  3RRN B;  3ZCJ A;  2XGM A;  4GK0 E;  5E0O A;  2VSO E;  3CKD A;  2JMK A;  2XQY A;  1IQR A;  2QY7 A;  4J0U A;  5ARG A;  2NTY A;  3Q5M A;  4XZ4 A;  3SS1 A;  4CRW A;  4PNI A;  2JJ9 A;  1MNE A;  2YNQ A;  2R59 A;  2NW9 A;  3KFW X;  4EBA A;  1SZ9 A;  2FI7 A;  4ZS2 A;  4AQG A;  3D9L A;  3DJB A;  3K3Q C;  2WXF A;  2NXP A;  1UCU A;  3FXE B;  4WUY A;  3GW4 A;  4G23 A;  4PJN A;  3E4B A;  5LJM A;  4J8S A;  2L0I A;  1MMD A;  2CLY B;  3SHF A;  4AKR B;  3CHO A;  3LDZ A;  5BUZ A;  4XKC A;  1WM5 A;  5FY0 A;  2MYS A;  4KYO B;  1ZKE A;  4X20 E;  2WM9 A;  1YD8 G;  4NAC A;  1HTJ F;  1LKX A;  2G0U A;  1IAP A;  3Q47 B;  5J90 A;  4JHR A;  2GGF A;  1H2U A;  5HAX A;  4N3B A;  4FU3 A;  2YU2 A;  4FAD A;  3HKE E;  3QJZ A;  3G2W A;  5CA1 E;  3HA4 A;  4UF0 B;  4IYP A;  4DI4 A;  2CWO A;  4O8S A;  2A3D A;  2JPF A;  1UJK A;  3UUX A;  3C4Z A;  4GZC A;  5IYZ E;  3O48 A;  1MIY A;  2X9H A;  3SFZ A;  4QXC B;  4UWH A;  2DNX A;  1HO8 A;  2KWH A;  3N2G E;  3U64 A;  4JVS A;  4CT4 A;  2E9X B;  1HS7 A;  5ENN A;  4UWK A;  5JR9 C;  3RO3 A;  3CV0 A;  4B89 A;  1JPL A;  4JA7 A;  2X6J A;  2JEK A;  2V4L A;  4BA9 A;  2BUG A;  1A17 A;  2V0P A;  2A72 A;  4CZZ B;  3CEQ A;  1QSD A;  2NSZ A;  3LS8 A;  3NZP A;  4P0A A;  2PM7 A;  2XEV A;  4AQF A;  3V5U A;  5ARF A;  3K8P C;  5EDS A;  2EHO C;  3CK9 A;  5BV1 A;  3H37 A;  4X1K E;  1BR2 A;  1YKE B;  3CHS A;  4DJA A;  2PFV A;  1DVP A;  5A1L A;  2KXP B;  5FXV A;  5H6R B;  4HOQ A;  2M63 A;  3QUJ A;  2WQ6 A;  5ETW A;  3LJ3 A;  4KVM A;  3GZ1 A;  2J1D G;  3B7T A;  3FTS A;  3D0T A;  3TXM A;  5L3E B;  4RG9 A;  5AYW D;  4AI6 A;  3GZS A;  4MLP A;  4DLQ A;  4QXH B;  3KV5 A;  4XX5 A;  3DTO A;  3K9I A;  2BVM A;  3MV3 B;  3JQ1 A;  5FZS A;  3N9P A;  2UY1 A;  3OKQ A;  2HPJ A;  2IAK A;  5F3J A;  1EPU A;  3ZPJ A;  3ETV A;  5H6Q B;  3PDN A;  2XHE B;  2W61 A;  4WAF A;  4C9B B;  2I6H A;  4K0U A;  4C0E A;  1N52 A;  2VL8 A;  3GWH A;  5JQG E;  1ELW A;  4MRU A;  4BT9 A;  4M1P A;  2CFU A;  1OWA A;  1UN8 A;  2DCF A;  3U78 A;  4EZH A;  2BDE A;  3RYI E;  2LE8 A;  3PNL B;  4I43 A;  1JWF A;  5CA0 E;  2L3L A;  4PJJ A;  4CDR A;  2DWG A;  5G04 J;  4DO0 A;  1Y6I A;  3EDU A;  3QWW A;  4A1G A;  2I1J A;  4I1A A;  4ZOL E;  4HE8 A;  3ML8 A;  4QWN B;  4GZ6 A;  3NZS A;  2YHC A;  1WYC A;  5F8P A;  1G8X A;  2DWK A;  4ANV A;  5A6C A;  5FQ8 A;  5LCW J;  4FUL A;  3RYF E;  4GPK A;  2V1D B;  4I1M A;  3P2B A;  3UUL A;  4AEZ C;  4GA0 A;  2VTB A;  3H3A A;  5FP3 A;  2NOX A;  3NQP A;  4N2S A;  4A56 A;  1T98 A;  3C64 A;  3QK6 A;  2CXF A;  3FWV A;  3CX6 B;  4UQX A;  1HE8 A;  5T8I A;  4JLE A;  2EHO D;  2A5U A;  3MGB A;  4ISS A;  4TZ4 C;  3UUX B;  3SD5 A;  2C0S A;  4GB9 A;  3N9O A;  1OWO A;  4FA6 A;  3LJC A;  3KV6 A;  3Q15 A;  4BSX A;  2QA7 A;  4U63 A;  3CR3 A;  4IRU A;  4GAA A;  4EEC A;  5KJK A;  5J1G A;  3FEY A;  5KMG P;  2LO6 A;  1NAF A;  3C50 A;  3QB2 A;  3FTZ A;  2E0I A;  2CEA A;  2ZM0 A;  5EK4 A;  2IW5 B;  2WXR A;  4F53 A;  5J2T E;  4XBF B;  2JRK A;  2V5F A;  4WBO A;  3QWV A;  1FIO A;  3EDT B;  1UX5 A;  4IIJ E;  4ME2 A;  2VKH A;  4I50 E;  4P0B A;  4GML A;  4AM9 A;  5JRC A;  2LSU A;  4NUU A;  2ZU6 B;  3ZYM A;  4X1Y E;  5TAO A;  3UT5 E;  3QAQ A;  5CHE E;  3L08 A;  2WMO A;  3CPZ A;  4C91 A;  2IJG X;  5FY7 A;  3UTK A;  3L09 A;  2PQR A;  3LY9 A;  3R9A B;  3K3N A;  4GZ5 A;  3ONK A;  4CXW A;  3T8M A;  2N1G A;  4HN9 A;  3IEE A;  1B89 A;  5EK3 A;  4UQZ A;  3LBX A;  3KV4 A;  1KNZ A;  5G55 A;  4Z8X A;  2GRL A;  5DIZ A;  4WWN A;  2XRY A;  3MKR A;  3P7I A;  5JDH A;  1ELK A;  2W00 A;  3SBS A;  2UY1 B;  2X6H A;  2XPI A;  1S0P A;  1IQU A;  4XE0 A;  2L0T B;  5KJN A;  4PW8 A;  3IBP A;  3IHV A;  4KUM B;  4MFR A;  4IGU A;  5C1D A;  2LSG A;  3ESK A;  3CHM A;  2VB6 A;  3HL6 A;  3ZCI A;  3T5V A;  5LNK A;  4CQI A;  4UV8 B;  3BG0 B;  2XGS A;  3EUH A;  4Q94 A;  1UX4 A;  4KMO A;  2XPY A;  3BK9 A;  4GU5 A;  3NF1 A;  4EZL A;  4BAY B;  1YW0 A;  2MTQ A;  2VGX B;  2GK9 A;  5LBM A;  3VU7 H;  2NP9 A;  4AVX A;  1BPO A;  1XNF A;  3SNX A;  3FBZ A;  2ZM2 A;  4H9Q C;  1WLX A;  2ACX A;  5AJL A;  1FMW A;  3CK8 A;  5HXR A;  4FJZ A;  5A23 A;  3KVA A;  4KBQ A;  1FCH A;  4IN3 B;  4PK4 A;  2V7L A;  3CVV A;  3FUI A;  4UV9 B;  3N5L A;  3PE0 A;  3IF8 B;  1ZHC A;  3O1H A;  4L2L A;  2W63 A;  3W15 B;  4EAH A;  4DMW A;  5BMV E;  5ANR A;  2K5B B;  4XI9 A;  3U66 A;  3BQK A;  2X51 A;  2CHW A;  3LKU A;  4I2W A;  3WXX A;  3RYH E;  5EX3 A;  2NC9 A;  2WXI A;  4FC8 A;  5DQW A;  2ION A;  3AS4 A;  1XGW A;  2L9B A;  3APF A;  1VOM A;  5HWX A;  2CFZ A;  1G73 A;  1IHG A;  3IV0 A;  4EYU A;  2NWB A;  4EQF A;  3FB2 A;  2Q9Q B;  2DI4 A;  2VK9 A;  1N54 A;  3D9N A;  4FI5 A;  4A1S A;  3V5S A;  2V7M A;  2I1K A;  2X38 A;  3N9M A;  4BY6 A;  5AJD A;  3VKH A;  4HVB A;  2QGS A;  4QX8 B;  2IFU A;  4GOU A;  3KD7 A;  3L6A A;  3I9Y A;  1OUV A;  4BTA A;  3U4T A;  1PC2 A;  1MIW A;  2WXL A;  4UQY A;  2VWA A;  2X66 A;  3ONL A;  2X3M A;  2E2E A;  5C2Y A;  3KDS E;  4I1O B;  3ZVV A;  3N2O A;  2LSK A;  4N5C A;  4IE4 A;  3PUG A;  3CQX C;  3HKB E;  2XAH B;  1MHQ A;  5JR9 A;  2GRM A;  3N9N A;  4MLK A;  1HF8 A;  3ZMV B;  4G26 A;  4OFZ A;  2A2F X;  4QFV A;  3S7B A;  3LK4 2;  4DVD A;  2XQ0 A;  4ZI7 E;  2I9C A;  2YQ8 A;  4O4L E;  3CLJ A;  4U07 A;  5FXZ A;  1AJ3 A;  3ZPO A;  2EHO A;  2IF4 A;  2J08 A;  1P5Q A;  4Y6W A;  2LEH A;  1NWM X;  4BFR A;  2N9D A;  3CVR A;  3E0Z A;  3AVS A;  4I6E A;  5D0Q D;  1WR6 A;  2SPC A;  1Z6T A;  4J2C A;  1X79 A;  4EB6 E;  1VDY A;  4UEM A;  3GA8 A;  4H9S E;  4XKB A;  5FYM A;  3ZJ2 A;  1EDU A;  4J8E A;  3E08 A;  2MHK A;  2CLY C;  2C5I T;  3SGH A;  3FH5 A;  4ACL A;  4W9R A;  1GW6 A;  2EQX A;  3KAE A;  2L6J A;  4B6X A;  3LXU X;  1NA0 A;  5L2L A;  3RK6 A;  1H2T C;  2HO1 A;  2CHX A;  3AA7 B;  3DP7 A;  3ML9 A;  4JUY A;  2DCP A;  4KZ0 A;  1E96 B;  2DHR A;  2WXJ A;  4G24 A;  3Q5X A;  3LVQ E;  2CG2 A;  2R5S A;  1D0Z A;  1QNF A;  1FVF A;  3Q9D A;  5M72 A;  2KZT B;  2J07 A;  3B57 A;  4IE6 A;  4DBQ A;  4O2B E;  3CIA A;  3UQ3 A;  2PQN A;  1S94 A;  1HU3 A;  1UJJ A;  4YND A;  4IDZ A;  3ZC1 A;  2LAI A;  5BV0 A;  2IC9 A;  3C98 A;  2E9X C;  2BTD A;  4LUN U;  3CST A;  4U04 A;  2M67 A;  3ZW3 A;  3RKV A;  2WXM A;  4ATG A;  3MKQ A;  3TXN A;  3C4X A;  5J08 A;  3D9I A;  1E7V A;  3MJX A;  3HDX A;  4ANU A;  1HFA A;  3UT4 A;  2WB2 A;  3U3I A;  4WW0 A;  1BR1 A;  4H9R C;  3EIQ C;  4OK0 A;  5L3C B;  3HIZ A;  4OYS A;  5FJY A;  1E8X A;  3CKC A;  4HTE A;  5LP6 E;  3FUF A;  2LSI A;  1IZN B;  2YEV C;  4HOS A;  2WQH A;  2OVB A;  4AXH A;  1E7U A;  3FY4 A;  3C51 A;  4A55 A;  3AA1 B;  3VTY A;  3ZHE B;  4O6F A;  5LYJ E;  1Z0P A;  4J8D A;  1UN9 A;  4DPR A;  4JEH B;  4GA1 A;  4B8C B;  2CE7 A;  2YHE A;  5L3G B;  3E22 E;  1OWP A;  3D9K A;  4JW1 A;  4APF A;  3FUE A;  3OXL A;  3D9J A;  4HOU A;  3FTV A;  4GYW A;  5JJT A;  3AU4 A;  4DBR A;  4JEU A;  2Y4T A;  3AU5 A;  5A7D B;  3J7Y q;  2XTL A;  2ES0 A;  1TJC A;  2WXN A;  4CXY A;  3UMV A;  4QXB B;  2WXH A;  5FZR A;  4OVV A;  5LGN B;  4MBQ A;  3KS2 A;  3CQC B;  2UXX B;  3RC3 A;  3JUI A;  4H7X A;  4CEM A;  1H7C A;  2CG3 A;  2IC6 A;  2HYZ A;  5FMN A;  1FMV A;  1HXI A;  3N71 A;  4F6R C;  4QHO A;  2NTX A;  3D3M A;  2JMH A;  3L16 A;  3I5P A;  3UX4 A;  4L0R A;  3ASF A;  4AOF A;  4TUU A;  1JWG A;  3HVE A;  2LT3 A;  2V7I A;  1EYH A;  2CWY A;  3ENE A;  1Y64 B;  4HOR A;  5LGU B;  4PDX A;  5JDF A;  3CVU A;  3D9O A;  4YLH A;  4LRZ A;  4O4H E;  3ZXS A;  2E9X D;  5JDL A;  3BQL A;  2Y8D A;  3Q2M A;  3RO2 A;  2DIW A;  4XIF A;  2LSV A;  3FXD B;  1BR4 A;  4E6H A;  4U0U A;  2X68 A;  3RKO A;  1SA0 E;  1E8W A;  2WPV A;  4TRQ A;  3ZRH A;  4BT8 A;  2LOS A;  1Z3Y A;  2K48 A;  4YVQ C;  3SF4 A;  4H63 V;  2VKJ A;  3IKO B;  4G2A A;  4EXT A;  3WAK A;  3CHP A;  4G11 A;  2CHZ A;  5FTP A;  3TG4 A;  3GN5 A;  3JYS A;  5T3R A;  5JDG A;  3AAI A;  4HXI A;  2Y48 B;  2KWI B;  2W0G A;  2CA5 A;  2B1E A;  3LK2 B;  3MKQ B;  3SWH A;  4O4I E;  3EDV A;  4O4J E;  4U8H A;  2IOS A;  3PEU B;  4HLE A;  4IHJ E;  4N39 A;  2X67 A;  4CGW A;  3QDN A;  5G04 C;  3QC1 A;  1MIV A;  2GW1 A;  3SBT B;  1NA3 A;  4G63 A;  4IST A;  5LHH B;  3ZFW A;  3UUN A;  1E90 A;  1HH8 A;  4YFS A;  5EKQ D;  3ANW A;  3MXZ A;  4AKG A;  4ABN A;  1OWN A;  1U3D A;  5LCW C;  3KVB A;  2PJQ A;  3Q5W A;  3ETU A;  3NBX X;  3CWZ B;  3JCK C;  5G05 J;  3HHM A;  5LHG B;  5FWQ A;  5KDM C;  3UPV A;  1D0Y A;  5ADX L;  2W62 A;  2OVF A;  3APD A;  2ILR A;  4WWO A;  4K0R A;  3U9W A;  3FBL A;  2CXD A;  2AXZ A;  3ZYQ A;  1CUN A;  2Z6E A;  3N9Q A;  4JEU B;  3FTW A;  4U0Z A;  4PFP A;  2R17 C;  1MND A;  4APO A;  3L54 A;  3K3O A;  5HXH A;  3D9P A;  5IHY A;  3RRC A;  3OTN A;  3AAA B;  3BEE A;  4H7Y A;  4AY6 A;  3LY8 A;  2WSS V;  3KIN B;  4TV3 A;  4I2Z A;  2X0L B;  2X6K A;  3RH3 A;  5FQ7 A;  4R7L A;  1HG2 A;  4OYJ A;  2LHN A;  3KV9 A;  4HEA A;  3OBV E;  2VKD A;  2XAJ B;  3ZMS B;  3I3N A;  4PFO A;  3TGO A;  3ASG A;  4WNG A;  3HVE B;  3ZMZ B;  2KCK A;  2OV8 A;  2WXO A;  3HR0 A;  1ZBP A;  2HPL A;  4I43 B;  4B8A A;  5KX5 E;  4P09 A;  4FHJ A;  4MKT A;  2D2S A;  5T4Y A;  2KC7 A;  4H9P C;  5LXT E;  4ACK A;  4LEU A;  3RIB A;  3CVQ A;  3RU0 A;  1PAQ A;  5LOZ A;  1NZN A;  4DND A;  5DQV A;  3B7R L;  3CKB A;  5LJN A;  2AXU A;  2YIN A;  5HQ8 A;  4ILH B;  3PUK A;  3PNT B;  1D1C A;  4ZS3 A;  5LFA A;  2VTB B;  3VTX A;  2WBL A;  3NZU A;  2AWI A;  1H19 A;  3ULQ A;  4HOT A;  2FEZ A;  5FT9 A;  3RJV A;  3CQG B;  4BX9 A;  2FO7 A;  2J9Q A;  4UXN B;  2Q9Q C;  3R84 B;  1E8Z A;  4NRH B;  5LA6 E;  2I2O A;  2H3R A;  2J4D A;  4JC8 A;  4PJL A;  3B13 A;  3GZ2 A;  4FLH A;  4PH4 B;  5BT1 A;  3PU3 A;  2A4Z A;  4J6I A;  4UI9 J;  3CVP A;  3ZIM A;  1IJ6 A;  4GYR A;  3MKD A;  2J09 A;  2C5J A;  4UVA B;  4F7A A;  2VSX E;  3VLD A;  1MMG A;  5J2U E;  3OXG A;  3PVL A;  2DLR A;  5JJ7 A;  3FTX A;  2RD0 A;  3QAR A;  3LFM A;  3HYM B;  3ANW B;  4UI9 K;  2KM4 A;  5JRC B;  3AS5 A;  4ZI3 C;  4UF0 A;  5L3D B;  2VYI A;  2MRI A;  1SQM A;  3O9X A;  4KP3 C;  3PUA A;  3T8O A;  1Y8M A;  4AJW A;  3BG1 B;  2X9X A;  1B7T A;  5JHB A;  4CXX A;  3F2E A;  2PM6 A;  5KJM A;  1OWL A;  5HI7 A;  2BF0 X;  2ZM8 A;  4ZHQ E;  3LBX B;  4PUC A;  2CXL A;  4L7T A;  2N2N A;  3TJP A;  5BPP A;  4AKL A;  2IOL A;  3S7D A;  2IQC A;  2LSJ A;  4N3A A;  3ZC0 A;  1Z3X A;  2VQ2 A;  4PK6 A;  3LVR E;  4TV9 E;  4CCA A;  4GCO A;  3BQI A;  2KCV A;  3RC8 A;  2D0T A;  2MOW A;  4GK5 E;  2X6F A;  2XCC A;  1HZ4 A;  3D9M A;  4U0S A;  4RG6 A;  3DPD A;  1INZ A;  4JHK A;  3PZD A;  3ZYL A;  2PG8 A;  3APC A;  2Y4U A;  3UT7 A;  5FXX A;  3MX3 A;  5AIJ A;  2X9Y A;  3FHE A;  4DK5 A;  3AAE B;  4OVU A;  4PAG A;  3CVY A;  2WMN A;  3MK7 C;  3VLE A;  4CI3 B;  1TEZ A;  2V8S E;  5M4Y A;  4Y6C A;  1WAO 1;  4EZJ A;  2ZLY A;  4L9I A;  3EIJ A;  2LNI A;  1EF1 C;  5CMW A;  1SZA A;  2Q9Q D;  3JC6 C;  1QQE A;  3ASH A;  2RA1 A;  5KCM A;  3P1U A;  2WWU A;  3FP3 A;  3NZQ A;  3FUL A;  2C0L A;  4H9O C;  3F31 A;  3OYZ A;  4PS3 A;  2L8K A;  3PDY A;  3S4U A;  1H0A A;  5AFU L;  2AXV A;  4I9E A;  1DNP A;  2ODV A;  2XAG B;  2FF4 A;  4BTB A;  3RRM B;  5HXC A;  2AW6 A;  4NUV A;  3A5X A;  4N3C A;  5L3B B;  3PUQ A;  2P9B A;  4UVC B;  4MHC A;  1MMN A;  4ZI3 D;  5CCL A;  3ZN0 B;  2HM8 A;  3L3P A;  2OND A;  4EIW A;  4LCT A;  5BNW A;  2ZMA A;  3GMI A;  5G2N A;  4RVB A;  2H7O A;  4WNE A;  3CHQ A;  4ANX A;  2Q7F A;  3LYA A;  3MJW A;  5FQ6 A;  4YJ2 E;  3VHL A;  5JVD E;  3LK3 B;  3FU6 A;  3IHR A;  4O2A E;  3SI5 A;  4P29 A;  4BJM A;  1MQS A;  3MCX A;  5E76 A;  3CVL A;  3S2A A;  2KT9 A;  4EZK A;  4DI3 A;  5DJQ C;  4M3O A;  3FTU A;  3I4R B;  4Q69 A;  2NW7 A;  2K9A A;  4WWP A;  4I9C A;  4DLO A;  5JDQ A;  4IE5 A;  1OWM A;  2WXK A;  2C5K T;  3G2T A;  2OA5 A;  4ZI2 C;  2KND A;  3R6N A;  5LP0 A;  3FDH A;  4N78 D;  5EK2 A;  1D1B A;  2KLQ A;  3ZJ1 A;  1KT0 A;  2CM0 A;  4HKA A;  3TL5 A;  3OXF A;  2VGY A;  4AV7 A;  3I1A A;  3Q49 B;  4KT6 B;  1E1H B;  4UVB B;  4EBA G;  4UEL A;  2KMF A;  3I0O A;  4QKN A;  1ZV4 X;  3MAC A;  2RG8 A;  4WND A;  1LVF A;  4GMJ A;  1KK7 A;  1VRB A;  2PL2 A;  3B7S A;  2HR2 A;  4GIW A;  3CML A;  2JLB A;  3KBT A;  5JHA A;  4FJO A;  3CX8 B;  5JR9 B;  3ZYK A;  3JC6 D;  2MOZ A;  4JA9 A;  4GZD A;  4V1A v;  2XCB A;  4IUL A;  5EZY E;  3R7R A;  3PU8 A;  4HS2 A;  2CMR A;  4GZ3 A;  5LX8 A;  4IE0 A;  3AA6 B;  3HI2 A;  3HKD E;  4JXT A;  3ASD A;  4MS6 A;  1HS6 A;  3WI3 A;  4CDM A;  3S7F A;  4GYY A;  4JPS A;  3QC9 A;  4QX7 B;  4G2V A;  5JJ6 A;  1FVH A;  4IE7 A;  2EHO B;  4C0M A;  2YU1 A;  3AS8 A;  5JH7 E;  4B0Z A;  3LG7 A;  3IBE A;  3FU3 A;  5DAB A;  4FJY A;  2HH7 A;  1HG5 A;  4TUY E;  3Q4A B;  4KBM B;  4ADZ A;  3VKG A;  2P58 C;  5LOV E;  2K24 A;  2CCQ A;  4U72 A;  3MA9 A;  5HWY A;  3RRW A;  3EVY A;  3PE4 A;  4TV8 E;  4N2Q A;  3FTY A;  5KJL A;  5LGT B;  1QUU A;  2X6I A;  3FUJ A;  3CHR A;  4XI0 A;  4GYO A;  3QKY A;  1ELR A;  3QWP A;  1BR0 A;  1U4Q A;  4D10 C;  4FP7 A;  2V26 A;  3CK7 A;  1D0X A;  2LHR A;  3L17 A;  2Y6X A;  3O1J A;  4EYY R;  2BZB A;  3ZLI A;  4A3V A;  1SHZ C;  4XZC A;  4KXK B;  5D0O D;  4ZI2 D;  4NQ0 A;  4TX5 A;  2VJ8 A;  1W3B A;  3M65 A;  4E7Z A;  3G2V A;  4JZY A;  2VGX A;  5FY1 A;  2RP4 A;  2VSN A;  1UW4 B;  4ERR A;  2XRZ A;  1MMA A;  5HXE A;  1YKH B;  4CDN A;  5FNV E;  3FUD A;  3C98 B;  5ANL A;  2LJL A;  2I59 A;  5DBK A;  2LAH A;  4HGA A;  1E8Y A;  3QK0 A;  3GYZ A;  5CB4 E;  2NW8 A;  3ZMU B;  1S35 A;  4URK A;  3SRZ A;  2UXN B;  3C4W A;  4NUR A;  1LVK A;  2VKO A;  5JDM A;  3ZGQ A;  4PS8 A;  3TAX A;  5FQ4 A;  4JHJ A;  1IJ5 A;  4AQF C;  5JDN A;  3PUJ A;  5L3F B;  4ILU A;  3KBU A;  1OXZ A;  3CVW A;  2FUL A;  2XAF B;  3TKL B;  2J49 A;  2D0U A;  5FZQ A;  1U3C A;  1WYB A;  4KZC A;  1NP7 A;  4TN7 B;  2JQQ A;  3MYV A;  2Q9Q A;  3CX7 B;  2FBN A;  1UG3 A;  4WNF A;  4PJM A;  3MZK B;  4WBN E;  3PS6 A;  4AKI A;  4KVO A;  3MA5 A;  4H63 H;  4FHK A;  2E8I A;  2LM9 A;  1HCI A;  4YHJ A;  3FUN A;  1WY6 A;  3VLF A;  4UIG A;  3PRZ A;  3LY7 A;  4LER A;  2XGO A;  2H7V C;  3CVX A;  4YVO A;  4CI1 B;  4F3V A;  4F1S A;  3RYC E;  1ZU2 A;  2QFC A;  3ZN3 A;  3ZEF A;  2IU1 A;  2VSY A;  1KLX A;  3PTR B;  3L13 A;  3EHM A;  2OOE A;  1X5B A;  2XUE A;  2V7J A;  3SZ7 A;  4EPZ A;  2KZ7 B;  1H6K A;  3N2K E;  4H9N C;  3FH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...