1INZA

Solution structure of the epsin n-terminal homology (enth) domain of human epsin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
GSSRMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords EPS15-INTERACTING PORTEIN(EPSIN)
publication title Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2000-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1inzA00
1VDYA 1ELKA 1HF8A 3RRUA 4FLBA 1HX8A 1EDUA 4AVXA 2KM4A 4GZCA 3G2TA 4FU3A 1PY1A 1X5BA 1HFAA 3D9KA 3ZYMA 3D9JA 4JXTA 1UJKA 3D9PA 3G2UA 5J08A 1MHQA 4NACA 1INZA 4HFGA 3D9NA 1EYHA 2QY7A 1JWGA 4Q96A 2DCPA 4Q94A 1JWFA 3D9MA 5LOZA 1HG2A 1HG5A 2DIWA 5CMYA 1H0AA 1SZAA 3ZYLA 3ONLA 3ONKA 1LF8A 3ZYQA 2L0IA 3D9OA 2MOWA 3D9IA 1UJJA 3ZYKA 1SZ9A 5CMWA 5LP0A 1JPLA 1JUQA 4GZDA 3D9LA 3LDZA 3CLJA 2L0TB 2V8SE 3G2VA 1DVPA 2BF0X 2LO6A 1XGWA 3G2SA 3G2WA
chains in the Genus database with same CATH superfamily
3AJIA 4L7TA 4JD2G 2MYOA 3L82A 2WPVA 4UI9J 1SW6A 1HXIA 4JA9A 1MX6A 3RRMB 1NA0A 1Y6IA 3MKQB 3IKOB 3UIPC 3PRZA 4BX8A 4LNGA 1W3BA 2XRYA 4F1PA 3IBEA 2WM9A 4F6RD 1SA4A 1INZA 4Q96A 3B7UX 1H0AA 4XIFA 4A3TA 2HM8A 1E8YA 4QQIA 2OV8A 5FTPA 4J8SA 3CR3A 4KZ0A 5G05J 4FULA 3FUDA 4AY5A 1JWFA 3HVEA 4APFA 1E96B 5JHBA 4HRNA 2XCBA 1U3CA 5ENQD 5C1DA 3QDNA 4K03A 3FTSA 3FUMA 3U64A 3ZYMA 1D9SA 1H2TC 1HG5A 3TG4A 3I4GA 5FQ4A 2LAHA 3NOGD 3RU0A 3BQOA 5FZRA 1Q2ZA 5G2NA 3DSVA 2OEWA 5FQ7A 3TG5A 3MJWA 1OT8A 2KZTB 4G25A 5AARA 4NURA 3TXMA 4M7CA 1IQRA 2OVBA 3QWVA 4LEUA 4NRHB 3MV3B 2YHCA 4J0UA 3AU4A 2DYRE 3CK7A 3IHVA 3DSWA 3TWXA 3FEYA 2ETCA 2VTBB 1ZB1A 3FP3A 4KZCA 4XZ4A 5EYPF 3ZYQA 3SBSA 3EHNA 3L13A 4OYSA 1DNPA 4G1TA 1MJ0A 4GTQA 1DCQA 5BV1A 1IHBA 3JXIA 3Q47B 3DSTA 3FEXA 3PE4A 4N5QA 1HZ4A 5CBOA 2LO6A 3L08A 5AQBA 1NI1A 3NBNB 2X6FA 1MX4A 4I6GA 5B1AE 3LEWA 1TEZA 3D9JA 3TL5A 2IFUA 3X2QE 3FTUA 2H6GA 4L23A 4G8LA 1H19A 1Z5SC 3ASFA 4F1SA 1LF8A 1UJJA 4EZJA 2WMOA 3SFZA 3U9WA 2AWIA 3MX3A 1X5BA 5D2MC 3JXJA 3RRNB 4IN3B 2ETBA 4U0SA 4CEMA 3W9FA 5CERB 3L16A 4JEHA 1S70B 3UXGA 1WY6A 2J07A 2IOLA 5FJYA 2R05A 3AG3E 4U95D 2WXPA 2IONA 3PVLA 2KCLA 5E76A 4N2SA 3B7RL 2UWJG 2WXNA 2HE0A 1X81A 1HH8A 5AYWD 4OAVB 1K8KG 1IQUA 2NC9A 3HXCA 3TWQA 2P9PG 3TWSA 4NQ0A 3OXFA 3ASGA 4XI0A 3G2WA 2ZXWE 3Q9UC 1Z3YA 3FUIA 4YDWA 3HYMB 4FU3A 4PS8A 2BEDA 3UT4A 1MZCA 4FJZA 2IEJA 3FUKA 3IV0A 3EU5A 4J8FA 3T5VA 2BF0X 5JMND 4AJWA 4HNAD 3PS6A 2EIJE 4K0RA 3ZFWA 4OAUC 4BSXA 1E8WA 2DCPA 4DI3A 1BLXB 5BW8C 1DC2A 2VSOE 1N9AA 2XRZA 4N5CA 4ANUA 3SFYA 4XKBA 4YDOA 2WXOA 3TWTA 3ULQA 2WQHA 4BETA 3CKBA 4GTMA 4DUIA 1OCOE 2JLBA 4ANWA 5G04J 4UI9C 1OWLA 4HVBA 3CEQA 1QYMA 3RRUA 4YVOA 3FH8A 4HXIA 3HVEB 1IHGA 5AQAA 3PZ4A 3CVPA 1ELRA 3ESLA 5HKPA 3KEZA 5FZQA 1HU3A 3ONLA 4EZLA 1E8XA 1OCZE 5AAOA 4I1AA 3LYAA 3FTXA 3Q4AB 3DPYA 4F7AA 2OCCE 4KVOA 5CCMA 4N2QA 3D9NA 2P2CP 4F3VA 2PM7A 4GCNA 5G05C 3HDXA 5KJNA 1P5QA 2XEEA 3BUAA 2ETAA 4I6EA 2PQRA 5H7PA 1L5JA 2I1JA 5CCLA 1DCEA 5CRUA 4ABNA 2YNQA 3HHMA 3N71A 4A1SA 2XPIA 5LFAA 3FULA 3ZKJA 4HI9A 4G11A 3CHRA 3HXEA 3JYSA 4EECA 3B7BA 2X38A 3FFLA 4UQXA 2DBAA 3VLDA 3ABLE 1TN7A 3GZ2A 4G24A 2YINA 4M3OA 2BKKB 5HS0A 3D3MA 4O6FA 3JCKC 3LY9A 3FTYA 1WG0A 3Q9NC 4L1BA 4XKCA 1UOHA 4ATZD 4GMJA 4MKTA 1K1BA 1NA3A 5KNGA 3G2SA 4K5AB 5A6CA 2R2LA 1D8EA 3CQCB 4ANXA 3S7DA 5KBAA 3FUNA 2XS8A 4PS3A 1Z3XA 3SBTB 1LD8A 3AS5A 3HRAA 2R03A 5AJDA 4GZ5A 2HR2A 1KPSB 2ZIRA 3IEGA 5ITZF 4G26A 3V31A 1OWPA 3CVXA 3F6QA 3Q15A 5T4YA 4FA6A 3DEPA 3E32A 3NZSA 4CRWA 2VGXA 2AXZA 1UN9A 2P9SG 3CVVA 4U63A 3LXUX 2GGFA 5BNWA 2MHKA 2XENA 3LVRE 1H6PA 3VLFA 3FH7A 3FY4A 4TXRA 2A5EA 2GW1A 3NB2A 4XE0A 4U8VD 3PZ1A 3EHMA 4WWOA 2V5FA 4ACKA 4PDXA 2P9LG 5EYLA 4TXPA 5EIDA 3KAEA 1S0PA 4BTBA 5JJ7A 2A4ZA 5FIOA 2WXGA 3ONKA 2AXUA 4UWHA 3U66A 3SD5A 4DX2A 4GTSA 5LX8A 5ENSD 4HRLA 5AQ9A 3AG4E 4K5BA 1GW6A 2QYUA 3CSFA 3L22A 1E7VA 2WB2A 4EPZA 3CHSA 3QWPA 4LERA 4BESA 4HLLA 3SY2A 4O60A 3DWLG 4ZHBA 2WXJA 3ULYA 3RK6A 2EQXA 4APOA 1A5EA 4B0ZA 2ONDA 1FCHA 3GZSA 3MCXA 4EQFA 1KZPA 3UUXA 4URKA 2VQ2A 5E75A 1MQSA 1ELWA 4HRMB 1NFIE 4LSZE 2GROB 4WWPA 2J8SD 3FHEA 3D9IA 3FTWA 5KJKA 2F8XK 4ILGA 3PNLB 4CCAA 3Q5MA 1TJCA 2H6HA 3HG0D 3MV2B 4Y6WA 4RVBA 3UM3A 2EIME 1H6OA 4FADA 4FHJA 5ARFA 1N11A 3JUEA 3BU8A 2WQ6A 1N94A 4B94A 2V4LA 3SQVA 1JCQA 3MGBA 3C72A 4GYYA 1NP7A 4HS2A 3KSLA 2GRPB 4CZ2D 3UTMA 3CK8A 4AVXA 2C0MA 2YQ8A 3S7FA 3ZHEB 3AS8A 4WUYA 3UI2A 3ENEA 1BD8A 1EYHA 4PS7A 4BY6A 3SZ7A 2C0LA 3QKYA 4I2ZA 5FT9A 2R02A 3G2TA 4JXTA 2F0YA 5G04C 4ME2A 2UY1A 2ZU6B 1H6KA 3RO2A 2FEZA 3GYZA 1SZAA 5CRVA 4E85A 4KXKB 4JHRA 4MBGA 1OWNA 3OTNA 3CVNA 3QARA 3SO8A 5D0OD 1EDUA 3Q49B 3E33A 1S64A 5A7DB 1YA0A 4FLHA 5BXOA 3DSUA 4BEPA 2WXFA 1EF1C 3QK0A 2HYZA 3PZDA 3TWUA 3I5PA 2X6JA 2WXLA 2H6FA 5DBKA 2R59A 4N39A 3KEAA 1ZBPA 3ZGQA 1OCCE 4GA0A 2KCVA 2RG8A 3NF1A 4YVQC 3CHOA 2XCCA 4ATGA 3BG1B 4BX9A 3ASNE 2CHXA 2WMNA 5EILA 2RFAA 3D9OA 4X8QA 3E4BA 2L0TB 1FVFA 5JHAA 4D10C 4KYOB 3NAWA 2L9BA 4GB9A 2ZISA 4UUCA 3LS8A 5EDSA 3FTZA 4B8AA 3LY8A 5CMYA 3SNXA 4FP7A 4KT6B 2FI7A 2QYJA 4G2VA 3SFXA 4KVMA 5KCMA 4HI8A 5ENOD 5LCWJ 4CT0A 3AG2E 3TXNA 4HFGA 2QY7A 2VJ8A 3AG1E 4WAFA 3HXFA 2QC9A 3HIZA 3OXLA 3OXGA 2PQNA 3S7JA 5CHEE 3Q7FA 4B8CB 4E6HA 5D0QD 4HB5A 5EN5D 3UKRG 2VGXB 3QNKA 4BT8A 1RW2A 1FT2A 5FZSA 2MRIA 1KT0A 2X6IA 4MRUA 4GTVA 1BPOA 1YYHA 1MX2A 4U0UA 3PZ3A 3UM2A 3S2AA 4WNFA 1UG3A 5AJLA 3PEVB 4HOUA 4J7WA 3ZRHA 1N0RA 1K1AA 5B3SE 1OXJA 3V30A 3ASOE 1B89A 2GRNB 2B0OE 4GYOA 3LJNA 2J09A 4YDEA 5B1BE 3CLJA 4WWNA 2IU1A 4FLBA 3UT8A 4GZCA 3RIBA 3FUEA 4U04A 3QB2A 1K3ZD 1FPPA 5LOZA 5KNHD 3FDHA 3ABKE 2LXMA 4H7YA 3ZIMA 4N3AA 2FULA 5FQ8A 1KT1A 2LSVA 2OVFA 3MA5A 1HF8A 3U3WA 3K9IA 4GA2A 4AY6A 2IO3C 4JC8A 3EU9A 4U8YD 1QBQA 2WXRA 3G2UA 1JWGA 2BKGA 3D9MA 4JHJA 1SVXA 4R7LA 3CVWA 2C2LA 4LRZA 2OEVA 4DPRA 3Q75A 3MZLB 2OOEA 4ANVA 2AJAA 2PNNA 1QZ2A 4DX5D 2XPYA 4Y6CA 2J4BA 2IO2C 1TJFA 2PZIA 3QC1A 5BV0A 4P29A 3P2BA 1TN8A 1AP7A 4YDYA 3URZA 1NL4A 3C98A 3V2OA 4UWGA 2X3MA 2V4HC 4UI9K 4N3BA 2GRQB 3EIJA 2GRMA 4KMOA 4U8HA 1N54A 1UN8A 4DLQA 3B13A 2UY1B 4A55A 2VSXE 2XPZA 3CHMA 5D66A 2LXLA 3CVYA 3ZYKA 3EDTB 4B93B 4J8YA 4Z68A 4GU5A 2CG3A 4OVVA 4JL0A 1HE8A 3D9PA 4NACA 1UW4B 1BU9A 1U2VG 1IXVA 4U07A 3TAXA 4U0ZA 5FWQA 4GZ6A 4G23A 4ZFHA 2MOWA 1V54E 1TYQG 5AENA 4GAAA 3CKCA 3R7QA 5CEAA 2IOSA 1EPUA 4ILIA 1UJKA 2ZGGA 4CYMD 1V55E 4RG9A 4L9PA 4XEIG 2VSYA 3PE3A 3ASHA 4ILHB 5T3RA 4Q69A 4HOQA 1FVHA 4WNDA 3ASDA 3PEUB 3ZUVB 1HX8A 5KWDA 3MEKA 3T9KA 5J08A 4DX1A 3PUKA 5JJ6A 2XEVA 3CVQA 3PDNA 2YHEA 2X6HA 3VTYA 1XNFA 3DPDA 1JPLA 1FT1A 1QNFA 4JPSA 2CHZA 2XGMA 3GZ1A 4LUNU 3DXKG 3ML9A 1TNOA 4AOFA 1OWOA 4BFRA 4HOTA 2FF4A 3S7BA 4GTRA 2JEKA 3APFA 3L54A 5IY5E 2FBNA 3FTVA 3CGHA 1N0QA 3R7RA 2P9NG 1O5MA 5JJTA 3ZPJA 3NZUA 2XQ0A 4AXHA 3LVQE 2GRLA 4W9RA 4WNEA 2WXKA 4HOSA 4TXQA 5LCWC 4RSYA 5EX3A 5ENPD 2AW6A 3FUJA 2J08A 4RQIA 4J8DA 2ILRA 5ENNA 1TR4A 1N4SA 1G3NB 2FO1E 5KJLA 5KJMA 4DX6D 1SZ9A 2XZTG 3HXBA 3VLEA 3L17A 2V5QC 3AAAC 2R17C 3J5PA 4EBAA 2E2EA 3LJ3A 2WVIA 3MKRA 3ABME 2F8YA 4AP2A 4GZDA 3G2VA 4JA7A 5G55A 2LUHA 2AVPA 4L2YA 4RG6A 4GPMA 4HQDA 2V0PA 4TUUA 4DK5A 4QFVA 2J4DA 4TUMA 2XGOA 2I9CA 2FO7A 3FUFA 3L9TA 5CBNA 3ULEG 2I2OA 3ISMC 3JQ0A 3U4TA 1MYOA 2WQ7A 3EUVA 4HORA 1N4QA 4ACLA 5CECB 2J49A 4FHKA 4BTAA 1TNUA 1OWMA 4MLPA 4IYPA 3ZNGA 2H6IA 1E7UA 3D9HA 3E30A 4H7XA 4A3VA 3C3QA 5ARGA 4IULA 3C3OA 2WXIA 3B7TA 3V79K 3UMVA 5CEDB 4LNUD 3BG0B 5AN8A 4WNGA 2L0IA 4HBDA 2B6CA 2X6KA 2XZDG 4L2LA 4XI9A 3CK9A 1VDYA 3TJPA 4KBQA 1HFAA 3B7SA 2RKKA 5ENTD 5C2YA 4LG6A 4CDNA 3CV0A 4EZKA 1H2UA 1TNZA 4I9EA 3LKUA 2V8SE 1DVPA 2BTDA 3JQ1A 3O48A 4OVUA 2M63A 2KM4A 3TGOA 1H2VC 1N95A 3EHQA 1KLXA 3V2XA 3R9AB 2AXVA 4DRXE 4BWRA 4O1PA 4EHMA 4JB8P 5CMWA 1JUQA 1O1RA 1TN6A 3UQ3A 4AEZC 4UWKA 3PUJA 3T8MA 3TWWA 3QAQA 2XS1A 4YNDA 2L6JA 2NXPA 4DI4A 3HXDA 3KD7A 2DWZA 4A63B 3C3RA 1TNBA 3JUIA 2NYJA 4PH4B 1Z6TA 3C5RA 3DRAA 4I9CA 4UQZA 2WXMA 2WXQA 5BT1A 3R9MA 4EBAG 3CIAA 3UM0A 3QWWA 3NQPA 5EKQD 1A17A 1U3DA 4C9BB 3AU5A 4GCOA 3Q73A 3RJVA 2Q7FA 4DLOA 3LY7A 3UX4A 4C48B 3ESKA 3ZXSA 1YCSB 1OY3D 4XX5A 2BUGA 4LCTA 3ZN3A 2VSNA 4GZ3A 4CGVA 1N4PA 5DIZA 3SI5A 5ANRA 4GYWA 3CHPA 4I43A 2CFZA 4C0MA 2F37A 4DX7D 4BSZB 4LNBA 2KC7A 4BT9A 5HRYA 4Q94A 3WG7E 4TV3A 3LCAA 4I6JA 2DIWA 4UWLA 4V3IA 3PH0C 3Q7AA 3Q79A 4I2WA 4U96D 2CFUA 4F53A 4HLEA 3KS2A 2ZGDA 2A5UA 2L6BA 2I1KA 4BERA 3AS4A 3T8KA 2LSUA 2P58C 1IKND 3BEEA 1OCRE 3FH5A 2IY0C 3E34A 3UKUG 3B95A 3TWVA 2Y69E 3OAWA 3CQGB 3MKQA 3FU6A 4U7EB 1MHQA 3L6AA 3QJZA 1WDYA 1PAQA 5ENRD 3ZYLA 5LP0A 1TNYA 1AWCB 3WXXA 2KXPC 2IF4A 3UM1A 1OUVA 4MS6A 4GMRA 3UIOC 4NIKA 3FU0A 3CVUA 3RO3A 4FJYA 3NOCD 4RLYA 2Y0BG 2DZNA 3ZEFA 2WXHA 2QZAA 5BUZA 3I4RB 3ZVVA 4J6IA 4GMLA 2RD0A 5M72A 4AV7A 3FUHA 4JW1A 2HO1A 3VTXA 3ZW3A 5JA4D 3PZ2A 1E90A 2XGSA 3FU5A 3EIQC 3FU3A 3UINC 2LAIA 4GA1A 1KZOA 5ANLA 3TWRA 3ZHEA 1E8ZA 1WM5A 3SGHA 5AIJA 3W9GA 4JZYA 5FQ6A 3CVLA 4GTPA 1HS6A 3O4ZA 4K5CA 2IJGX 5EX0A 2KATA 3SHFA 1YMPA 2P9IG 4I1MA 2KZTA 4C0EA 1WAO1 3Q78A 1D8DA 2DYSE 3ML8A 5EIBE 4I17A 2GRRB 2Y4TA 3MYVA 2KBXA 4TRQA 2Y3AA 2NSZA 2Y4UA 4A1GA 1Y8MA 3T5XA 2CG2A 2LNIA 2DZOA 1LTXA 5FINA 3DXMG 5J90A 3IXEA 4CT4A 2DVWA 2VTBA 3P1UA 5T8IA 1PY1A 1IYGA 5A23A 1SQMA 3DBSA 4CGWA 1HO8A 2IQCA 3QOUA 3RSEG 5AQ7A 3APCA 1N4RA 4FC8A 4AM9A 5BXUA 1JCSA 3FWVA 2CHWA 3APDA 2VYIA 3ZXPA 1JCRA 1S63A 4CDMA 4GPKA 3IHYA 3J5QB 3CSTA 3EJNA 4J8EA 4AIFA 2QFCA 1O1TA 3CHQA 3EHRA 1PC2A 4IRUA 2JABA 3DSSA 4UQYA 4GTOA 2XEHA 4JEUA 1HG2A 2XHEA 3SF4A 2R5SA 3E37A 4UWFA 4DJAA 1SA5A 3LDZA 5HI7A 4G8KA 1QQEA 4N3CA 2PM6A 2EIKE 2EILE 2Y1LE 4JVSA 3PREA 2P9KG 3GW4A 1BI8B 4GTTA 3LPZA 3DSXA 1ZU2A 2I6HA 2KCKA 2VGYA 3I3NA 2P9UG 4PUCA 3PNTB 3RAUA 3UPVA 1XGWA 1LD7A 4JHKA 2E0IA 2RFMA 1ELKA 4CDRA 2J9QA 3UT7A 1O1SA 2PL2A 2VGEA 1BI7B 3D9KA 4B89A 3KSQA 5BPPA 1RZ4A 1N52A 1NZNA 3DEOA 2EINE 4I1OB 4O1OA 3ZU7B 3D9LA 3RKVA 5HQ8A
chains in the Genus database with same CATH topology
4L7TA 2IU1A 4OVUA 4FLBA 3UT8A 2M63A 4G11A 3CHRA 2KM4A 4GZCA 2WPVA 3RIBA 3JYSA 3FUEA 3TGOA 1H2VC 4EECA 4UI9J 4U04A 1HXIA 4JA9A 1KLXA 3QB2A 3R9AB 2AXVA 2X38A 5LOZA 3FFLA 4BWRA 4UQXA 2DBAA 3FDHA 3RRMB 1NA0A 3VLDA 1Y6IA 3MKQB 4H7YA 3IKOB 3ZIMA 5CMWA 3GZ2A 4N3AA 2FULA 1JUQA 4G24A 2YINA 4M3OA 5FQ8A 3PRZA 3UQ3A 4BX8A 1KT1A 2LSVA 2OVFA 1W3BA 4AEZC 3MA5A 1HF8A 3U3WA 3K9IA 4GA2A 4AY6A 2XRYA 4UWKA 4JC8A 3IBEA 3D3MA 4O6FA 3PUJA 2WXRA 2WM9A 3G2UA 3JCKC 3T8MA 3LY9A 1INZA 1JWGA 3FTYA 4Q96A 3D9MA 4JHJA 3QAQA 4L1BA 3B7UX 1H0AA 4R7LA 4XKCA 4XIFA 3CVWA 4A3TA 4YNDA 2C2LA 4GMJA 4MKTA 2L6JA 2NXPA 4LRZA 4DPRA 4DI4A 1NA3A 5A6CA 3G2SA 2HM8A 1E8YA 3KD7A 3MZLB 2OV8A 5FTPA 4J8SA 3CQCB 3CR3A 4KZ0A 3JUIA 4ANXA 3S7DA 4PH4B 5G05J 2OOEA 1Z6TA 3FUNA 4ANVA 4FULA 3FUDA 1QZ2A 4I9CA 4UQZA 2WXMA 2WXQA 4PS3A 5BT1A 4EBAG 1Z3XA 2XPYA 3SBTB 4Y6CA 3CIAA 3QWWA 4AY5A 3NQPA 1JWFA 1A17A 5EKQD 3AS5A 3HVEA 2J4BA 4WWNA 1TJFA 1U3DA 4APFA 2PZIA 5AJDA 4C9BB 1E96B 3QC1A 5JHBA 3AU5A 4GCOA 5BV0A 3RJVA 4GZ5A 2Q7FA 4P29A 4DLOA 2XCBA 1U3CA 3LY7A 5C1DA 3UX4A 2HR2A 3ESKA 3P2BA 3IEGA 4G26A 3ZXSA 1OWPA 3CVXA 3QDNA 3URZA 3Q15A 4XX5A 2BUGA 3FTSA 3FUMA 4K03A 5T4YA 3U64A 3C98A 4FA6A 4LCTA 3ZYMA 3ZN3A 3NZSA 2VSNA 4GZ3A 4CRWA 4UWGA 2X3MA 4CGVA 1H2TC 2AXZA 2VGXA 5DIZA 1UN9A 3SI5A 1HG5A 4UI9K 3TG4A 4N3BA 5ANRA 3I4GA 3CVVA 5FQ4A 2LAHA 4U63A 3EIJA 2GRMA 3LXUX 2GGFA 3RU0A 5BNWA 4KMOA 2MHKA 4GYWA 5FZRA 3LVRE 4U8HA 5G2NA 1N54A 3CHPA 3VLFA 1UN8A 4I43A 3B13A 2CFZA 4DLQA 2UY1B 3FH7A 3FY4A 4C0MA 2GW1A 4XE0A 5FQ7A 3TG5A 3EHMA 4A55A 4WWOA 3MJWA 2VSXE 2V5FA 2XPZA 3CHMA 4ACKA 2KZTB 4PDXA 2KC7A 4G25A 4BT9A 4Q94A 4NURA 3KAEA 1S0PA 4TV3A 3TXMA 4BTBA 3LCAA 4I6JA 5JJ7A 2DIWA 3CVYA 2A4ZA 1IQRA 2WXGA 3ONKA 2AXUA 4V3IA 2OVBA 3QWVA 4UWHA 4UWLA 4LEUA 3U66A 3ZYKA 3EDTB 3PH0C 3SD5A 4I2WA 4NRHB 3MV3B 4GU5A 2YHCA 4J0UA 5LX8A 2CG3A 3AU4A 2CFUA 4F53A 4HLEA 3CK7A 4OVVA 3IHVA 3KS2A 4JL0A 1HE8A 2A5UA 3D9PA 3FEYA 4NACA 1UW4B 1GW6A 2I1KA 4U07A 3AS4A 3TAXA 4U0ZA 2VTBB 3CSFA 3FP3A 4KZCA 2LSUA 4GZ6A 3L22A 1E7VA 4G23A 4XZ4A 5FWQA 3ZYQA 2P58C 2WB2A 2MOWA 3BEEA 4EPZA 3CHSA 3FH5A 3QWPA 4LERA 5AENA 4GAAA 3CKCA 3SBSA 3R7QA 3EHNA 2WXJA 3L13A 3RK6A 3OAWA 2EQXA 4OYSA 3CQGB 3MKQA 4APOA 1DNPA 2ONDA 3FU6A 2IOSA 4B0ZA 4G1TA 1FCHA 1EPUA 3GZSA 4ILIA 1UJKA 3MCXA 4EQFA 4URKA 3UUXA 2VQ2A 5E75A 1MHQA 3L6AA 3QJZA 1MQSA 4RG9A 1ELWA 1PAQA 5BV1A 3ZYLA 4WWPA 2VSYA 3FHEA 3Q47B 3D9IA 3FTWA 5LP0A 3PE3A 5KJKA 3FEXA 3PE4A 3WXXA 3ASHA 3PNLB 4ILGA 4ILHB 1HZ4A 4CCAA 5T3RA 2LO6A 4Q69A 4HOQA 2IF4A 3L08A 3Q5MA 1OUVA 1FVHA 4WNDA 4MS6A 1TJCA 3ASDA 2X6FA 3PEUB 3FU0A 1HX8A 4Y6WA 3MV2B 4I6GA 3CVUA 4RVBA 3LEWA 3MEKA 1TEZA 3D9JA 3RO3A 4FADA 5J08A 4FHJA 4FJYA 5ARFA 3TL5A 3ZEFA 2IFUA 3PUKA 5JJ6A 2WXHA 3FTUA 2WQ6A 4L23A 4B94A 2XEVA 3CVQA 1H19A 2V4LA 3PDNA 3ASFA 2YHEA 5BUZA 3I4RB 3ZVVA 3MGBA 4F1SA 2X6HA 3VTYA 1LF8A 4J6IA 1XNFA 3DPDA 1UJJA 4GYYA 4EZJA 1JPLA 1NP7A 4GMLA 4JPSA 1QNFA 4HS2A 2CHZA 2RD0A 5M72A 4AV7A 2XGMA 3GZ1A 2WMOA 4LUNU 3SFZA 3FUHA 4JW1A 2HO1A 3U9WA 2AWIA 3CK8A 3ML9A 3VTXA 4AOFA 3ZW3A 4AVXA 1E90A 3MX3A 2XGSA 1OWOA 4BFRA 2C0MA 1X5BA 4HOTA 2FF4A 3FU5A 2YQ8A 3S7FA 3RRNB 4IN3B 3ZHEB 3AS8A 3EIQC 3FU3A 4U0SA 4WUYA 3S7BA 4CEMA 3ENEA 2JEKA 1EYHA 3L16A 2LAIA 4GA1A 4JEHA 5ANLA 4PS7A 3APFA 1WY6A 2J07A 3ZHEA 3SZ7A 1E8ZA 4BY6A 3L54A 2IOLA 1WM5A 5FJYA 2FBNA 3FTVA 2WXPA 3SGHA 3CGHA 5AIJA 2IONA 3PVLA 2KCLA 2C0LA 3QKYA 4I2ZA 5E76A 4JZYA 5FQ6A 5FT9A 4N2SA 3CVLA 3R7RA 3B7RL 3G2TA 2UWJG 5JJTA 2WXNA 4JXTA 3ZPJA 1HH8A 3NZUA 2XQ0A 1HS6A 3O4ZA 5AYWD 5G04C 4ME2A 2UY1A 4AXHA 2ZU6B 1H6KA 3LVQE 2IJGX 3RO2A 1IQUA 2FEZA 2GRLA 2NC9A 5EX0A 2KATA 3GYZA 1SZAA 4W9RA 4WNEA 3SHFA 4E85A 4I1MA 4KXKB 2WXKA 4JHRA 4HOSA 4NQ0A 2KZTA 1OWNA 3ASGA 3OXFA 4C0EA 5LCWC 1WAO1 3ML8A 4XI0A 3OTNA 3G2WA 3CVNA 3QARA 4I17A 2Y4TA 1Z3YA 1EDUA 3MYVA 4RSYA 3Q49B 5D0OD 5EX3A 3FUIA 2AW6A 3FUJA 3HYMB 4TRQA 2Y3AA 4FU3A 2J08A 2NSZA 5A7DB 2Y4UA 4PS8A 4J8DA 3UT4A 1YA0A 4FLHA 2ILRA 5ENNA 4A1GA 1Y8MA 3T5XA 4FJZA 3FUKA 3IV0A 2CG2A 2WXFA 1EF1C 3QK0A 2HYZA 3PZDA 2LNIA 5KJLA 3I5PA 2X6JA 4J8FA 5KJMA 1SZ9A 2WXLA 5DBKA 5J90A 3VLEA 2R59A 4N39A 3L17A 3T5VA 2BF0X 4AJWA 2R17C 3PS6A 4CT4A 2VTBA 4K0RA 4EBAA 1ZBPA 3ZGQA 3P1UA 4GA0A 5T8IA 1PY1A 2E2EA 2KCVA 2WVIA 3LJ3A 3MKRA 1IYGA 3ZFWA 4BSXA 5A23A 2RG8A 3NF1A 1SQMA 4YVQC 3CHOA 2XCCA 3DBSA 4AP2A 4CGWA 1E8WA 4ATGA 1HO8A 2DCPA 4DI3A 3BG1B 4BX9A 2CHXA 2WMNA 2IQCA 5BW8C 3QOUA 3D9OA 2VSOE 3APCA 4GZDA 3E4BA 2L0TB 3G2VA 2XRZA 4FC8A 4N5CA 1FVFA 4JA7A 5G55A 4ANUA 4AM9A 5JHAA 2AVPA 4XKBA 4L2YA 4RG6A 4D10C 3FWVA 4KYOB 2CHWA 2L9BA 4GB9A 3APDA 2V0PA 4TUUA 2WXOA 4DK5A 2VYIA 3ULQA 2WQHA 3LS8A 5EDSA 4QFVA 2J4DA 4CDMA 3FTZA 4GPKA 3IHYA 2XGOA 4B8AA 2I9CA 2FO7A 3CSTA 3LY8A 3CKBA 5CMYA 3FUFA 3EJNA 4J8EA 2JLBA 3SNXA 4ANWA 4AIFA 4FP7A 5G04J 2QFCA 4KT6B 4UI9C 1OWLA 2FI7A 4HVBA 2I2OA 3CEQA 3CHQA 4YVOA 3FH8A 4G2VA 3RRUA 4HXIA 4KVMA 3HVEB 1IHGA 5KCMA 3JQ0A 1PC2A 3U4TA 5LCWJ 4IRUA 4CT0A 2WQ7A 4HORA 4UQYA 3CVPA 4ACLA 2J49A 3TXNA 4HFGA 2QY7A 4JEUA 2VJ8A 4FHKA 4BTAA 1ELRA 1HG2A 2XHEA 3ESLA 3KEZA 3SF4A 2R5SA 1HU3A 1OWMA 4MLPA 4IYPA 4WAFA 5FZQA 3ONLA 4EZLA 3HIZA 3OXLA 1E7UA 3OXGA 4UWFA 2PQNA 3S7JA 4DJAA 5CHEE 3LDZA 1E8XA 4H7XA 5HI7A 4A3VA 4B8CB 5ARGA 5D0QD 4E6HA 4IULA 1QQEA 2VGXB 3QNKA 2WXIA 4N3CA 2PM6A 3LYAA 4I1AA 4BT8A 4JVSA 3B7TA 3FTXA 3PREA 3GW4A 3UMVA 5FZSA 3Q4AB 2MRIA 4F7AA 1KT0A 3BG0B 2X6IA 4KVOA 5CCMA 3LPZA 4MRUA 4N2QA 3D9NA 1BPOA 1ZU2A 4WNGA 4F3VA 2I6HA 2KCKA 2PM7A 4GCNA 2VGYA 3HDXA 2L0IA 3I3NA 1P5QA 4PUCA 4U0UA 3PNTB 5G05C 5KJNA 3S2AA 3UPVA 4WNFA 1UG3A 2X6KA 5AJLA 1XGWA 4L2LA 3PEVB 4JHKA 4XI9A 3CK9A 1VDYA 2E0IA 1ELKA 4CDRA 2J9QA 4HOUA 3TJPA 4I6EA 3UT7A 3ZRHA 2PL2A 2PQRA 4KBQA 1L5JA 1HFAA 2I1JA 3B7SA 3D9KA 4B89A 5C2YA 5CCLA 5BPPA 1N52A 4ABNA 4CDNA 1NZNA 3CV0A 2YNQA 3HHMA 4EZKA 1B89A 1H2UA 4I1OB 3N71A 4GYOA 4I9EA 4A1SA 2XPIA 3LKUA 2J09A 3D9LA 3RKVA 3CLJA 5HQ8A 2V8SE 5LFAA 1DVPA 3FULA 2BTDA 3JQ1A 3O48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDY A;  1ELK A;  1HF8 A;  3RRU A;  4FLB A;  1HX8 A;  1EDU A;  4AVX A;  2KM4 A;  4GZC A;  3G2T A;  4FU3 A;  1PY1 A;  1X5B A;  1HFA A;  3D9K A;  3ZYM A;  3D9J A;  4JXT A;  1UJK A;  3D9P A;  3G2U A;  5J08 A;  1MHQ A;  4NAC A;  1INZ A;  4HFG A;  3D9N A;  1EYH A;  2QY7 A;  1JWG A;  4Q96 A;  2DCP A;  4Q94 A;  1JWF A;  3D9M A;  5LOZ A;  1HG2 A;  1HG5 A;  2DIW A;  5CMY A;  1H0A A;  1SZA A;  3ZYL A;  3ONL A;  3ONK A;  1LF8 A;  3ZYQ A;  2L0I A;  3D9O A;  2MOW A;  3D9I A;  1UJJ A;  3ZYK A;  1SZ9 A;  5CMW A;  5LP0 A;  1JPL A;  1JUQ A;  4GZD A;  3D9L A;  3LDZ A;  3CLJ A;  2L0T B;  2V8S E;  3G2V A;  1DVP A;  2BF0 X;  2LO6 A;  1XGW A;  3G2S A;  3G2W A; 
#chains in the Genus database with same CATH topology
 3AJI A;  4L7T A;  4JD2 G;  2MYO A;  3L82 A;  2WPV A;  4UI9 J;  1SW6 A;  1HXI A;  4JA9 A;  1MX6 A;  3RRM B;  1NA0 A;  1Y6I A;  3MKQ B;  3IKO B;  3UIP C;  3PRZ A;  4BX8 A;  4LNG A;  1W3B A;  2XRY A;  4F1P A;  3IBE A;  2WM9 A;  4F6R D;  1SA4 A;  1INZ A;  4Q96 A;  3B7U X;  1H0A A;  4XIF A;  4A3T A;  2HM8 A;  1E8Y A;  4QQI A;  2OV8 A;  5FTP A;  4J8S A;  3CR3 A;  4KZ0 A;  5G05 J;  4FUL A;  3FUD A;  4AY5 A;  1JWF A;  3HVE A;  4APF A;  1E96 B;  5JHB A;  4HRN A;  2XCB A;  1U3C A;  5ENQ D;  5C1D A;  3QDN A;  4K03 A;  3FTS A;  3FUM A;  3U64 A;  3ZYM A;  1D9S A;  1H2T C;  1HG5 A;  3TG4 A;  3I4G A;  5FQ4 A;  2LAH A;  3NOG D;  3RU0 A;  3BQO A;  5FZR A;  1Q2Z A;  5G2N A;  3DSV A;  2OEW A;  5FQ7 A;  3TG5 A;  3MJW A;  1OT8 A;  2KZT B;  4G25 A;  5AAR A;  4NUR A;  3TXM A;  4M7C A;  1IQR A;  2OVB A;  3QWV A;  4LEU A;  4NRH B;  3MV3 B;  2YHC A;  4J0U A;  3AU4 A;  2DYR E;  3CK7 A;  3IHV A;  3DSW A;  3TWX A;  3FEY A;  2ETC A;  2VTB B;  1ZB1 A;  3FP3 A;  4KZC A;  4XZ4 A;  5EYP F;  3ZYQ A;  3SBS A;  3EHN A;  3L13 A;  4OYS A;  1DNP A;  4G1T A;  1MJ0 A;  4GTQ A;  1DCQ A;  5BV1 A;  1IHB A;  3JXI A;  3Q47 B;  3DST A;  3FEX A;  3PE4 A;  4N5Q A;  1HZ4 A;  5CBO A;  2LO6 A;  3L08 A;  5AQB A;  1NI1 A;  3NBN B;  2X6F A;  1MX4 A;  4I6G A;  5B1A E;  3LEW A;  1TEZ A;  3D9J A;  3TL5 A;  2IFU A;  3X2Q E;  3FTU A;  2H6G A;  4L23 A;  4G8L A;  1H19 A;  1Z5S C;  3ASF A;  4F1S A;  1LF8 A;  1UJJ A;  4EZJ A;  2WMO A;  3SFZ A;  3U9W A;  2AWI A;  3MX3 A;  1X5B A;  5D2M C;  3JXJ A;  3RRN B;  4IN3 B;  2ETB A;  4U0S A;  4CEM A;  3W9F A;  5CER B;  3L16 A;  4JEH A;  1S70 B;  3UXG A;  1WY6 A;  2J07 A;  2IOL A;  5FJY A;  2R05 A;  3AG3 E;  4U95 D;  2WXP A;  2ION A;  3PVL A;  2KCL A;  5E76 A;  4N2S A;  3B7R L;  2UWJ G;  2WXN A;  2HE0 A;  1X81 A;  1HH8 A;  5AYW D;  4OAV B;  1K8K G;  1IQU A;  2NC9 A;  3HXC A;  3TWQ A;  2P9P G;  3TWS A;  4NQ0 A;  3OXF A;  3ASG A;  4XI0 A;  3G2W A;  2ZXW E;  3Q9U C;  1Z3Y A;  3FUI A;  4YDW A;  3HYM B;  4FU3 A;  4PS8 A;  2BED A;  3UT4 A;  1MZC A;  4FJZ A;  2IEJ A;  3FUK A;  3IV0 A;  3EU5 A;  4J8F A;  3T5V A;  2BF0 X;  5JMN D;  4AJW A;  4HNA D;  3PS6 A;  2EIJ E;  4K0R A;  3ZFW A;  4OAU C;  4BSX A;  1E8W A;  2DCP A;  4DI3 A;  1BLX B;  5BW8 C;  1DC2 A;  2VSO E;  1N9A A;  2XRZ A;  4N5C A;  4ANU A;  3SFY A;  4XKB A;  4YDO A;  2WXO A;  3TWT A;  3ULQ A;  2WQH A;  4BET A;  3CKB A;  4GTM A;  4DUI A;  1OCO E;  2JLB A;  4ANW A;  5G04 J;  4UI9 C;  1OWL A;  4HVB A;  3CEQ A;  1QYM A;  3RRU A;  4YVO A;  3FH8 A;  4HXI A;  3HVE B;  1IHG A;  5AQA A;  3PZ4 A;  3CVP A;  1ELR A;  3ESL A;  5HKP A;  3KEZ A;  5FZQ A;  1HU3 A;  3ONL A;  4EZL A;  1E8X A;  1OCZ E;  5AAO A;  4I1A A;  3LYA A;  3FTX A;  3Q4A B;  3DPY A;  4F7A A;  2OCC E;  4KVO A;  5CCM A;  4N2Q A;  3D9N A;  2P2C P;  4F3V A;  2PM7 A;  4GCN A;  5G05 C;  3HDX A;  5KJN A;  1P5Q A;  2XEE A;  3BUA A;  2ETA A;  4I6E A;  2PQR A;  5H7P A;  1L5J A;  2I1J A;  5CCL A;  1DCE A;  5CRU A;  4ABN A;  2YNQ A;  3HHM A;  3N71 A;  4A1S A;  2XPI A;  5LFA A;  3FUL A;  3ZKJ A;  4HI9 A;  4G11 A;  3CHR A;  3HXE A;  3JYS A;  4EEC A;  3B7B A;  2X38 A;  3FFL A;  4UQX A;  2DBA A;  3VLD A;  3ABL E;  1TN7 A;  3GZ2 A;  4G24 A;  2YIN A;  4M3O A;  2BKK B;  5HS0 A;  3D3M A;  4O6F A;  3JCK C;  3LY9 A;  3FTY A;  1WG0 A;  3Q9N C;  4L1B A;  4XKC A;  1UOH A;  4ATZ D;  4GMJ A;  4MKT A;  1K1B A;  1NA3 A;  5KNG A;  3G2S A;  4K5A B;  5A6C A;  2R2L A;  1D8E A;  3CQC B;  4ANX A;  3S7D A;  5KBA A;  3FUN A;  2XS8 A;  4PS3 A;  1Z3X A;  3SBT B;  1LD8 A;  3AS5 A;  3HRA A;  2R03 A;  5AJD A;  4GZ5 A;  2HR2 A;  1KPS B;  2ZIR A;  3IEG A;  5ITZ F;  4G26 A;  3V31 A;  1OWP A;  3CVX A;  3F6Q A;  3Q15 A;  5T4Y A;  4FA6 A;  3DEP A;  3E32 A;  3NZS A;  4CRW A;  2VGX A;  2AXZ A;  1UN9 A;  2P9S G;  3CVV A;  4U63 A;  3LXU X;  2GGF A;  5BNW A;  2MHK A;  2XEN A;  3LVR E;  1H6P A;  3VLF A;  3FH7 A;  3FY4 A;  4TXR A;  2A5E A;  2GW1 A;  3NB2 A;  4XE0 A;  4U8V D;  3PZ1 A;  3EHM A;  4WWO A;  2V5F A;  4ACK A;  4PDX A;  2P9L G;  5EYL A;  4TXP A;  5EID A;  3KAE A;  1S0P A;  4BTB A;  5JJ7 A;  2A4Z A;  5FIO A;  2WXG A;  3ONK A;  2AXU A;  4UWH A;  3U66 A;  3SD5 A;  4DX2 A;  4GTS A;  5LX8 A;  5ENS D;  4HRL A;  5AQ9 A;  3AG4 E;  4K5B A;  1GW6 A;  2QYU A;  3CSF A;  3L22 A;  1E7V A;  2WB2 A;  4EPZ A;  3CHS A;  3QWP A;  4LER A;  4BES A;  4HLL A;  3SY2 A;  4O60 A;  3DWL G;  4ZHB A;  2WXJ A;  3ULY A;  3RK6 A;  2EQX A;  4APO A;  1A5E A;  4B0Z A;  2OND A;  1FCH A;  3GZS A;  3MCX A;  4EQF A;  1KZP A;  3UUX A;  4URK A;  2VQ2 A;  5E75 A;  1MQS A;  1ELW A;  4HRM B;  1NFI E;  4LSZ E;  2GRO B;  4WWP A;  2J8S D;  3FHE A;  3D9I A;  3FTW A;  5KJK A;  2F8X K;  4ILG A;  3PNL B;  4CCA A;  3Q5M A;  1TJC A;  2H6H A;  3HG0 D;  3MV2 B;  4Y6W A;  4RVB A;  3UM3 A;  2EIM E;  1H6O A;  4FAD A;  4FHJ A;  5ARF A;  1N11 A;  3JUE A;  3BU8 A;  2WQ6 A;  1N94 A;  4B94 A;  2V4L A;  3SQV A;  1JCQ A;  3MGB A;  3C72 A;  4GYY A;  1NP7 A;  4HS2 A;  3KSL A;  2GRP B;  4CZ2 D;  3UTM A;  3CK8 A;  4AVX A;  2C0M A;  2YQ8 A;  3S7F A;  3ZHE B;  3AS8 A;  4WUY A;  3UI2 A;  3ENE A;  1BD8 A;  1EYH A;  4PS7 A;  4BY6 A;  3SZ7 A;  2C0L A;  3QKY A;  4I2Z A;  5FT9 A;  2R02 A;  3G2T A;  4JXT A;  2F0Y A;  5G04 C;  4ME2 A;  2UY1 A;  2ZU6 B;  1H6K A;  3RO2 A;  2FEZ A;  3GYZ A;  1SZA A;  5CRV A;  4E85 A;  4KXK B;  4JHR A;  4MBG A;  1OWN A;  3OTN A;  3CVN A;  3QAR A;  3SO8 A;  5D0O D;  1EDU A;  3Q49 B;  3E33 A;  1S64 A;  5A7D B;  1YA0 A;  4FLH A;  5BXO A;  3DSU A;  4BEP A;  2WXF A;  1EF1 C;  3QK0 A;  2HYZ A;  3PZD A;  3TWU A;  3I5P A;  2X6J A;  2WXL A;  2H6F A;  5DBK A;  2R59 A;  4N39 A;  3KEA A;  1ZBP A;  3ZGQ A;  1OCC E;  4GA0 A;  2KCV A;  2RG8 A;  3NF1 A;  4YVQ C;  3CHO A;  2XCC A;  4ATG A;  3BG1 B;  4BX9 A;  3ASN E;  2CHX A;  2WMN A;  5EIL A;  2RFA A;  3D9O A;  4X8Q A;  3E4B A;  2L0T B;  1FVF A;  5JHA A;  4D10 C;  4KYO B;  3NAW A;  2L9B A;  4GB9 A;  2ZIS A;  4UUC A;  3LS8 A;  5EDS A;  3FTZ A;  4B8A A;  3LY8 A;  5CMY A;  3SNX A;  4FP7 A;  4KT6 B;  2FI7 A;  2QYJ A;  4G2V A;  3SFX A;  4KVM A;  5KCM A;  4HI8 A;  5ENO D;  5LCW J;  4CT0 A;  3AG2 E;  3TXN A;  4HFG A;  2QY7 A;  2VJ8 A;  3AG1 E;  4WAF A;  3HXF A;  2QC9 A;  3HIZ A;  3OXL A;  3OXG A;  2PQN A;  3S7J A;  5CHE E;  3Q7F A;  4B8C B;  4E6H A;  5D0Q D;  4HB5 A;  5EN5 D;  3UKR G;  2VGX B;  3QNK A;  4BT8 A;  1RW2 A;  1FT2 A;  5FZS A;  2MRI A;  1KT0 A;  2X6I A;  4MRU A;  4GTV A;  1BPO A;  1YYH A;  1MX2 A;  4U0U A;  3PZ3 A;  3UM2 A;  3S2A A;  4WNF A;  1UG3 A;  5AJL A;  3PEV B;  4HOU A;  4J7W A;  3ZRH A;  1N0R A;  1K1A A;  5B3S E;  1OXJ A;  3V30 A;  3ASO E;  1B89 A;  2GRN B;  2B0O E;  4GYO A;  3LJN A;  2J09 A;  4YDE A;  5B1B E;  3CLJ A;  4WWN A;  2IU1 A;  4FLB A;  3UT8 A;  4GZC A;  3RIB A;  3FUE A;  4U04 A;  3QB2 A;  1K3Z D;  1FPP A;  5LOZ A;  5KNH D;  3FDH A;  3ABK E;  2LXM A;  4H7Y A;  3ZIM A;  4N3A A;  2FUL A;  5FQ8 A;  1KT1 A;  2LSV A;  2OVF A;  3MA5 A;  1HF8 A;  3U3W A;  3K9I A;  4GA2 A;  4AY6 A;  2IO3 C;  4JC8 A;  3EU9 A;  4U8Y D;  1QBQ A;  2WXR A;  3G2U A;  1JWG A;  2BKG A;  3D9M A;  4JHJ A;  1SVX A;  4R7L A;  3CVW A;  2C2L A;  4LRZ A;  2OEV A;  4DPR A;  3Q75 A;  3MZL B;  2OOE A;  4ANV A;  2AJA A;  2PNN A;  1QZ2 A;  4DX5 D;  2XPY A;  4Y6C A;  2J4B A;  2IO2 C;  1TJF A;  2PZI A;  3QC1 A;  5BV0 A;  4P29 A;  3P2B A;  1TN8 A;  1AP7 A;  4YDY A;  3URZ A;  1NL4 A;  3C98 A;  3V2O A;  4UWG A;  2X3M A;  2V4H C;  4UI9 K;  4N3B A;  2GRQ B;  3EIJ A;  2GRM A;  4KMO A;  4U8H A;  1N54 A;  1UN8 A;  4DLQ A;  3B13 A;  2UY1 B;  4A55 A;  2VSX E;  2XPZ A;  3CHM A;  5D66 A;  2LXL A;  3CVY A;  3ZYK A;  3EDT B;  4B93 B;  4J8Y A;  4Z68 A;  4GU5 A;  2CG3 A;  4OVV A;  4JL0 A;  1HE8 A;  3D9P A;  4NAC A;  1UW4 B;  1BU9 A;  1U2V G;  1IXV A;  4U07 A;  3TAX A;  4U0Z A;  5FWQ A;  4GZ6 A;  4G23 A;  4ZFH A;  2MOW A;  1V54 E;  1TYQ G;  5AEN A;  4GAA A;  3CKC A;  3R7Q A;  5CEA A;  2IOS A;  1EPU A;  4ILI A;  1UJK A;  2ZGG A;  4CYM D;  1V55 E;  4RG9 A;  4L9P A;  4XEI G;  2VSY A;  3PE3 A;  3ASH A;  4ILH B;  5T3R A;  4Q69 A;  4HOQ A;  1FVH A;  4WND A;  3ASD A;  3PEU B;  3ZUV B;  1HX8 A;  5KWD A;  3MEK A;  3T9K A;  5J08 A;  4DX1 A;  3PUK A;  5JJ6 A;  2XEV A;  3CVQ A;  3PDN A;  2YHE A;  2X6H A;  3VTY A;  1XNF A;  3DPD A;  1JPL A;  1FT1 A;  1QNF A;  4JPS A;  2CHZ A;  2XGM A;  3GZ1 A;  4LUN U;  3DXK G;  3ML9 A;  1TNO A;  4AOF A;  1OWO A;  4BFR A;  4HOT A;  2FF4 A;  3S7B A;  4GTR A;  2JEK A;  3APF A;  3L54 A;  5IY5 E;  2FBN A;  3FTV A;  3CGH A;  1N0Q A;  3R7R A;  2P9N G;  1O5M A;  5JJT A;  3ZPJ A;  3NZU A;  2XQ0 A;  4AXH A;  3LVQ E;  2GRL A;  4W9R A;  4WNE A;  2WXK A;  4HOS A;  4TXQ A;  5LCW C;  4RSY A;  5EX3 A;  5ENP D;  2AW6 A;  3FUJ A;  2J08 A;  4RQI A;  4J8D A;  2ILR A;  5ENN A;  1TR4 A;  1N4S A;  1G3N B;  2FO1 E;  5KJL A;  5KJM A;  4DX6 D;  1SZ9 A;  2XZT G;  3HXB A;  3VLE A;  3L17 A;  2V5Q C;  3AAA C;  2R17 C;  3J5P A;  4EBA A;  2E2E A;  3LJ3 A;  2WVI A;  3MKR A;  3ABM E;  2F8Y A;  4AP2 A;  4GZD A;  3G2V A;  4JA7 A;  5G55 A;  2LUH A;  2AVP A;  4L2Y A;  4RG6 A;  4GPM A;  4HQD A;  2V0P A;  4TUU A;  4DK5 A;  4QFV A;  2J4D A;  4TUM A;  2XGO A;  2I9C A;  2FO7 A;  3FUF A;  3L9T A;  5CBN A;  3ULE G;  2I2O A;  3ISM C;  3JQ0 A;  3U4T A;  1MYO A;  2WQ7 A;  3EUV A;  4HOR A;  1N4Q A;  4ACL A;  5CEC B;  2J49 A;  4FHK A;  4BTA A;  1TNU A;  1OWM A;  4MLP A;  4IYP A;  3ZNG A;  2H6I A;  1E7U A;  3D9H A;  3E30 A;  4H7X A;  4A3V A;  3C3Q A;  5ARG A;  4IUL A;  3C3O A;  2WXI A;  3B7T A;  3V79 K;  3UMV A;  5CED B;  4LNU D;  3BG0 B;  5AN8 A;  4WNG A;  2L0I A;  4HBD A;  2B6C A;  2X6K A;  2XZD G;  4L2L A;  4XI9 A;  3CK9 A;  1VDY A;  3TJP A;  4KBQ A;  1HFA A;  3B7S A;  2RKK A;  5ENT D;  5C2Y A;  4LG6 A;  4CDN A;  3CV0 A;  4EZK A;  1H2U A;  1TNZ A;  4I9E A;  3LKU A;  2V8S E;  1DVP A;  2BTD A;  3JQ1 A;  3O48 A;  4OVU A;  2M63 A;  2KM4 A;  3TGO A;  1H2V C;  1N95 A;  3EHQ A;  1KLX A;  3V2X A;  3R9A B;  2AXV A;  4DRX E;  4BWR A;  4O1P A;  4EHM A;  4JB8 P;  5CMW A;  1JUQ A;  1O1R A;  1TN6 A;  3UQ3 A;  4AEZ C;  4UWK A;  3PUJ A;  3T8M A;  3TWW A;  3QAQ A;  2XS1 A;  4YND A;  2L6J A;  2NXP A;  4DI4 A;  3HXD A;  3KD7 A;  2DWZ A;  4A63 B;  3C3R A;  1TNB A;  3JUI A;  2NYJ A;  4PH4 B;  1Z6T A;  3C5R A;  3DRA A;  4I9C A;  4UQZ A;  2WXM A;  2WXQ A;  5BT1 A;  3R9M A;  4EBA G;  3CIA A;  3UM0 A;  3QWW A;  3NQP A;  5EKQ D;  1A17 A;  1U3D A;  4C9B B;  3AU5 A;  4GCO A;  3Q73 A;  3RJV A;  2Q7F A;  4DLO A;  3LY7 A;  3UX4 A;  4C48 B;  3ESK A;  3ZXS A;  1YCS B;  1OY3 D;  4XX5 A;  2BUG A;  4LCT A;  3ZN3 A;  2VSN A;  4GZ3 A;  4CGV A;  1N4P A;  5DIZ A;  3SI5 A;  5ANR A;  4GYW A;  3CHP A;  4I43 A;  2CFZ A;  4C0M A;  2F37 A;  4DX7 D;  4BSZ B;  4LNB A;  2KC7 A;  4BT9 A;  5HRY A;  4Q94 A;  3WG7 E;  4TV3 A;  3LCA A;  4I6J A;  2DIW A;  4UWL A;  4V3I A;  3PH0 C;  3Q7A A;  3Q79 A;  4I2W A;  4U96 D;  2CFU A;  4F53 A;  4HLE A;  3KS2 A;  2ZGD A;  2A5U A;  2L6B A;  2I1K A;  4BER A;  3AS4 A;  3T8K A;  2LSU A;  2P58 C;  1IKN D;  3BEE A;  1OCR E;  3FH5 A;  2IY0 C;  3E34 A;  3UKU G;  3B95 A;  3TWV A;  2Y69 E;  3OAW A;  3CQG B;  3MKQ A;  3FU6 A;  4U7E B;  1MHQ A;  3L6A A;  3QJZ A;  1WDY A;  1PAQ A;  5ENR D;  3ZYL A;  5LP0 A;  1TNY A;  1AWC B;  3WXX A;  2KXP C;  2IF4 A;  3UM1 A;  1OUV A;  4MS6 A;  4GMR A;  3UIO C;  4NIK A;  3FU0 A;  3CVU A;  3RO3 A;  4FJY A;  3NOC D;  4RLY A;  2Y0B G;  2DZN A;  3ZEF A;  2WXH A;  2QZA A;  5BUZ A;  3I4R B;  3ZVV A;  4J6I A;  4GML A;  2RD0 A;  5M72 A;  4AV7 A;  3FUH A;  4JW1 A;  2HO1 A;  3VTX A;  3ZW3 A;  5JA4 D;  3PZ2 A;  1E90 A;  2XGS A;  3FU5 A;  3EIQ C;  3FU3 A;  3UIN C;  2LAI A;  4GA1 A;  1KZO A;  5ANL A;  3TWR A;  3ZHE A;  1E8Z A;  1WM5 A;  3SGH A;  5AIJ A;  3W9G A;  4JZY A;  5FQ6 A;  3CVL A;  4GTP A;  1HS6 A;  3O4Z A;  4K5C A;  2IJG X;  5EX0 A;  2KAT A;  3SHF A;  1YMP A;  2P9I G;  4I1M A;  2KZT A;  4C0E A;  1WAO 1;  3Q78 A;  1D8D A;  2DYS E;  3ML8 A;  5EIB E;  4I17 A;  2GRR B;  2Y4T A;  3MYV A;  2KBX A;  4TRQ A;  2Y3A A;  2NSZ A;  2Y4U A;  4A1G A;  1Y8M A;  3T5X A;  2CG2 A;  2LNI A;  2DZO A;  1LTX A;  5FIN A;  3DXM G;  5J90 A;  3IXE A;  4CT4 A;  2DVW A;  2VTB A;  3P1U A;  5T8I A;  1PY1 A;  1IYG A;  5A23 A;  1SQM A;  3DBS A;  4CGW A;  1HO8 A;  2IQC A;  3QOU A;  3RSE G;  5AQ7 A;  3APC A;  1N4R A;  4FC8 A;  4AM9 A;  5BXU A;  1JCS A;  3FWV A;  2CHW A;  3APD A;  2VYI A;  3ZXP A;  1JCR A;  1S63 A;  4CDM A;  4GPK A;  3IHY A;  3J5Q B;  3CST A;  3EJN A;  4J8E A;  4AIF A;  2QFC A;  1O1T A;  3CHQ A;  3EHR A;  1PC2 A;  4IRU A;  2JAB A;  3DSS A;  4UQY A;  4GTO A;  2XEH A;  4JEU A;  1HG2 A;  2XHE A;  3SF4 A;  2R5S A;  3E37 A;  4UWF A;  4DJA A;  1SA5 A;  3LDZ A;  5HI7 A;  4G8K A;  1QQE A;  4N3C A;  2PM6 A;  2EIK E;  2EIL E;  2Y1L E;  4JVS A;  3PRE A;  2P9K G;  3GW4 A;  1BI8 B;  4GTT A;  3LPZ A;  3DSX A;  1ZU2 A;  2I6H A;  2KCK A;  2VGY A;  3I3N A;  2P9U G;  4PUC A;  3PNT B;  3RAU A;  3UPV A;  1XGW A;  1LD7 A;  4JHK A;  2E0I A;  2RFM A;  1ELK A;  4CDR A;  2J9Q A;  3UT7 A;  1O1S A;  2PL2 A;  2VGE A;  1BI7 B;  3D9K A;  4B89 A;  3KSQ A;  5BPP A;  1RZ4 A;  1N52 A;  1NZN A;  3DEO A;  2EIN E;  4I1O B;  4O1O A;  3ZU7 B;  3D9L A;  3RKV A;  5HQ8 A; 
#chains in the Genus database with same CATH homology
 4L7T A;  2IU1 A;  4OVU A;  4FLB A;  3UT8 A;  2M63 A;  4G11 A;  3CHR A;  2KM4 A;  4GZC A;  2WPV A;  3RIB A;  3JYS A;  3FUE A;  3TGO A;  1H2V C;  4EEC A;  4UI9 J;  4U04 A;  1HXI A;  4JA9 A;  1KLX A;  3QB2 A;  3R9A B;  2AXV A;  2X38 A;  5LOZ A;  3FFL A;  4BWR A;  4UQX A;  2DBA A;  3FDH A;  3RRM B;  1NA0 A;  3VLD A;  1Y6I A;  3MKQ B;  4H7Y A;  3IKO B;  3ZIM A;  5CMW A;  3GZ2 A;  4N3A A;  2FUL A;  1JUQ A;  4G24 A;  2YIN A;  4M3O A;  5FQ8 A;  3PRZ A;  3UQ3 A;  4BX8 A;  1KT1 A;  2LSV A;  2OVF A;  1W3B A;  4AEZ C;  3MA5 A;  1HF8 A;  3U3W A;  3K9I A;  4GA2 A;  4AY6 A;  2XRY A;  4UWK A;  4JC8 A;  3IBE A;  3D3M A;  4O6F A;  3PUJ A;  2WXR A;  2WM9 A;  3G2U A;  3JCK C;  3T8M A;  3LY9 A;  1INZ A;  1JWG A;  3FTY A;  4Q96 A;  3D9M A;  4JHJ A;  3QAQ A;  4L1B A;  3B7U X;  1H0A A;  4R7L A;  4XKC A;  4XIF A;  3CVW A;  4A3T A;  4YND A;  2C2L A;  4GMJ A;  4MKT A;  2L6J A;  2NXP A;  4LRZ A;  4DPR A;  4DI4 A;  1NA3 A;  5A6C A;  3G2S A;  2HM8 A;  1E8Y A;  3KD7 A;  3MZL B;  2OV8 A;  5FTP A;  4J8S A;  3CQC B;  3CR3 A;  4KZ0 A;  3JUI A;  4ANX A;  3S7D A;  4PH4 B;  5G05 J;  2OOE A;  1Z6T A;  3FUN A;  4ANV A;  4FUL A;  3FUD A;  1QZ2 A;  4I9C A;  4UQZ A;  2WXM A;  2WXQ A;  4PS3 A;  5BT1 A;  4EBA G;  1Z3X A;  2XPY A;  3SBT B;  4Y6C A;  3CIA A;  3QWW A;  4AY5 A;  3NQP A;  1JWF A;  1A17 A;  5EKQ D;  3AS5 A;  3HVE A;  2J4B A;  4WWN A;  1TJF A;  1U3D A;  4APF A;  2PZI A;  5AJD A;  4C9B B;  1E96 B;  3QC1 A;  5JHB A;  3AU5 A;  4GCO A;  5BV0 A;  3RJV A;  4GZ5 A;  2Q7F A;  4P29 A;  4DLO A;  2XCB A;  1U3C A;  3LY7 A;  5C1D A;  3UX4 A;  2HR2 A;  3ESK A;  3P2B A;  3IEG A;  4G26 A;  3ZXS A;  1OWP A;  3CVX A;  3QDN A;  3URZ A;  3Q15 A;  4XX5 A;  2BUG A;  3FTS A;  3FUM A;  4K03 A;  5T4Y A;  3U64 A;  3C98 A;  4FA6 A;  4LCT A;  3ZYM A;  3ZN3 A;  3NZS A;  2VSN A;  4GZ3 A;  4CRW A;  4UWG A;  2X3M A;  4CGV A;  1H2T C;  2AXZ A;  2VGX A;  5DIZ A;  1UN9 A;  3SI5 A;  1HG5 A;  4UI9 K;  3TG4 A;  4N3B A;  5ANR A;  3I4G A;  3CVV A;  5FQ4 A;  2LAH A;  4U63 A;  3EIJ A;  2GRM A;  3LXU X;  2GGF A;  3RU0 A;  5BNW A;  4KMO A;  2MHK A;  4GYW A;  5FZR A;  3LVR E;  4U8H A;  5G2N A;  1N54 A;  3CHP A;  3VLF A;  1UN8 A;  4I43 A;  3B13 A;  2CFZ A;  4DLQ A;  2UY1 B;  3FH7 A;  3FY4 A;  4C0M A;  2GW1 A;  4XE0 A;  5FQ7 A;  3TG5 A;  3EHM A;  4A55 A;  4WWO A;  3MJW A;  2VSX E;  2V5F A;  2XPZ A;  3CHM A;  4ACK A;  2KZT B;  4PDX A;  2KC7 A;  4G25 A;  4BT9 A;  4Q94 A;  4NUR A;  3KAE A;  1S0P A;  4TV3 A;  3TXM A;  4BTB A;  3LCA A;  4I6J A;  5JJ7 A;  2DIW A;  3CVY A;  2A4Z A;  1IQR A;  2WXG A;  3ONK A;  2AXU A;  4V3I A;  2OVB A;  3QWV A;  4UWH A;  4UWL A;  4LEU A;  3U66 A;  3ZYK A;  3EDT B;  3PH0 C;  3SD5 A;  4I2W A;  4NRH B;  3MV3 B;  4GU5 A;  2YHC A;  4J0U A;  5LX8 A;  2CG3 A;  3AU4 A;  2CFU A;  4F53 A;  4HLE A;  3CK7 A;  4OVV A;  3IHV A;  3KS2 A;  4JL0 A;  1HE8 A;  2A5U A;  3D9P A;  3FEY A;  4NAC A;  1UW4 B;  1GW6 A;  2I1K A;  4U07 A;  3AS4 A;  3TAX A;  4U0Z A;  2VTB B;  3CSF A;  3FP3 A;  4KZC A;  2LSU A;  4GZ6 A;  3L22 A;  1E7V A;  4G23 A;  4XZ4 A;  5FWQ A;  3ZYQ A;  2P58 C;  2WB2 A;  2MOW A;  3BEE A;  4EPZ A;  3CHS A;  3FH5 A;  3QWP A;  4LER A;  5AEN A;  4GAA A;  3CKC A;  3SBS A;  3R7Q A;  3EHN A;  2WXJ A;  3L13 A;  3RK6 A;  3OAW A;  2EQX A;  4OYS A;  3CQG B;  3MKQ A;  4APO A;  1DNP A;  2OND A;  3FU6 A;  2IOS A;  4B0Z A;  4G1T A;  1FCH A;  1EPU A;  3GZS A;  4ILI A;  1UJK A;  3MCX A;  4EQF A;  4URK A;  3UUX A;  2VQ2 A;  5E75 A;  1MHQ A;  3L6A A;  3QJZ A;  1MQS A;  4RG9 A;  1ELW A;  1PAQ A;  5BV1 A;  3ZYL A;  4WWP A;  2VSY A;  3FHE A;  3Q47 B;  3D9I A;  3FTW A;  5LP0 A;  3PE3 A;  5KJK A;  3FEX A;  3PE4 A;  3WXX A;  3ASH A;  3PNL B;  4ILG A;  4ILH B;  1HZ4 A;  4CCA A;  5T3R A;  2LO6 A;  4Q69 A;  4HOQ A;  2IF4 A;  3L08 A;  3Q5M A;  1OUV A;  1FVH A;  4WND A;  4MS6 A;  1TJC A;  3ASD A;  2X6F A;  3PEU B;  3FU0 A;  1HX8 A;  4Y6W A;  3MV2 B;  4I6G A;  3CVU A;  4RVB A;  3LEW A;  3MEK A;  1TEZ A;  3D9J A;  3RO3 A;  4FAD A;  5J08 A;  4FHJ A;  4FJY A;  5ARF A;  3TL5 A;  3ZEF A;  2IFU A;  3PUK A;  5JJ6 A;  2WXH A;  3FTU A;  2WQ6 A;  4L23 A;  4B94 A;  2XEV A;  3CVQ A;  1H19 A;  2V4L A;  3PDN A;  3ASF A;  2YHE A;  5BUZ A;  3I4R B;  3ZVV A;  3MGB A;  4F1S A;  2X6H A;  3VTY A;  1LF8 A;  4J6I A;  1XNF A;  3DPD A;  1UJJ A;  4GYY A;  4EZJ A;  1JPL A;  1NP7 A;  4GML A;  4JPS A;  1QNF A;  4HS2 A;  2CHZ A;  2RD0 A;  5M72 A;  4AV7 A;  2XGM A;  3GZ1 A;  2WMO A;  4LUN U;  3SFZ A;  3FUH A;  4JW1 A;  2HO1 A;  3U9W A;  2AWI A;  3CK8 A;  3ML9 A;  3VTX A;  4AOF A;  3ZW3 A;  4AVX A;  1E90 A;  3MX3 A;  2XGS A;  1OWO A;  4BFR A;  2C0M A;  1X5B A;  4HOT A;  2FF4 A;  3FU5 A;  2YQ8 A;  3S7F A;  3RRN B;  4IN3 B;  3ZHE B;  3AS8 A;  3EIQ C;  3FU3 A;  4U0S A;  4WUY A;  3S7B A;  4CEM A;  3ENE A;  2JEK A;  1EYH A;  3L16 A;  2LAI A;  4GA1 A;  4JEH A;  5ANL A;  4PS7 A;  3APF A;  1WY6 A;  2J07 A;  3ZHE A;  3SZ7 A;  1E8Z A;  4BY6 A;  3L54 A;  2IOL A;  1WM5 A;  5FJY A;  2FBN A;  3FTV A;  2WXP A;  3SGH A;  3CGH A;  5AIJ A;  2ION A;  3PVL A;  2KCL A;  2C0L A;  3QKY A;  4I2Z A;  5E76 A;  4JZY A;  5FQ6 A;  5FT9 A;  4N2S A;  3CVL A;  3R7R A;  3B7R L;  3G2T A;  2UWJ G;  5JJT A;  2WXN A;  4JXT A;  3ZPJ A;  1HH8 A;  3NZU A;  2XQ0 A;  1HS6 A;  3O4Z A;  5AYW D;  5G04 C;  4ME2 A;  2UY1 A;  4AXH A;  2ZU6 B;  1H6K A;  3LVQ E;  2IJG X;  3RO2 A;  1IQU A;  2FEZ A;  2GRL A;  2NC9 A;  5EX0 A;  2KAT A;  3GYZ A;  1SZA A;  4W9R A;  4WNE A;  3SHF A;  4E85 A;  4I1M A;  4KXK B;  2WXK A;  4JHR A;  4HOS A;  4NQ0 A;  2KZT A;  1OWN A;  3ASG A;  3OXF A;  4C0E A;  5LCW C;  1WAO 1;  3ML8 A;  4XI0 A;  3OTN A;  3G2W A;  3CVN A;  3QAR A;  4I17 A;  2Y4T A;  1Z3Y A;  1EDU A;  3MYV A;  4RSY A;  3Q49 B;  5D0O D;  5EX3 A;  3FUI A;  2AW6 A;  3FUJ A;  3HYM B;  4TRQ A;  2Y3A A;  4FU3 A;  2J08 A;  2NSZ A;  5A7D B;  2Y4U A;  4PS8 A;  4J8D A;  3UT4 A;  1YA0 A;  4FLH A;  2ILR A;  5ENN A;  4A1G A;  1Y8M A;  3T5X A;  4FJZ A;  3FUK A;  3IV0 A;  2CG2 A;  2WXF A;  1EF1 C;  3QK0 A;  2HYZ A;  3PZD A;  2LNI A;  5KJL A;  3I5P A;  2X6J A;  4J8F A;  5KJM A;  1SZ9 A;  2WXL A;  5DBK A;  5J90 A;  3VLE A;  2R59 A;  4N39 A;  3L17 A;  3T5V A;  2BF0 X;  4AJW A;  2R17 C;  3PS6 A;  4CT4 A;  2VTB A;  4K0R A;  4EBA A;  1ZBP A;  3ZGQ A;  3P1U A;  4GA0 A;  5T8I A;  1PY1 A;  2E2E A;  2KCV A;  2WVI A;  3LJ3 A;  3MKR A;  1IYG A;  3ZFW A;  4BSX A;  5A23 A;  2RG8 A;  3NF1 A;  1SQM A;  4YVQ C;  3CHO A;  2XCC A;  3DBS A;  4AP2 A;  4CGW A;  1E8W A;  4ATG A;  1HO8 A;  2DCP A;  4DI3 A;  3BG1 B;  4BX9 A;  2CHX A;  2WMN A;  2IQC A;  5BW8 C;  3QOU A;  3D9O A;  2VSO E;  3APC A;  4GZD A;  3E4B A;  2L0T B;  3G2V A;  2XRZ A;  4FC8 A;  4N5C A;  1FVF A;  4JA7 A;  5G55 A;  4ANU A;  4AM9 A;  5JHA A;  2AVP A;  4XKB A;  4L2Y A;  4RG6 A;  4D10 C;  3FWV A;  4KYO B;  2CHW A;  2L9B A;  4GB9 A;  3APD A;  2V0P A;  4TUU A;  2WXO A;  4DK5 A;  2VYI A;  3ULQ A;  2WQH A;  3LS8 A;  5EDS A;  4QFV A;  2J4D A;  4CDM A;  3FTZ A;  4GPK A;  3IHY A;  2XGO A;  4B8A A;  2I9C A;  2FO7 A;  3CST A;  3LY8 A;  3CKB A;  5CMY A;  3FUF A;  3EJN A;  4J8E A;  2JLB A;  3SNX A;  4ANW A;  4AIF A;  4FP7 A;  5G04 J;  2QFC A;  4KT6 B;  4UI9 C;  1OWL A;  2FI7 A;  4HVB A;  2I2O A;  3CEQ A;  3CHQ A;  4YVO A;  3FH8 A;  4G2V A;  3RRU A;  4HXI A;  4KVM A;  3HVE B;  1IHG A;  5KCM A;  3JQ0 A;  1PC2 A;  3U4T A;  5LCW J;  4IRU A;  4CT0 A;  2WQ7 A;  4HOR A;  4UQY A;  3CVP A;  4ACL A;  2J49 A;  3TXN A;  4HFG A;  2QY7 A;  4JEU A;  2VJ8 A;  4FHK A;  4BTA A;  1ELR A;  1HG2 A;  2XHE A;  3ESL A;  3KEZ A;  3SF4 A;  2R5S A;  1HU3 A;  1OWM A;  4MLP A;  4IYP A;  4WAF A;  5FZQ A;  3ONL A;  4EZL A;  3HIZ A;  3OXL A;  1E7U A;  3OXG A;  4UWF A;  2PQN A;  3S7J A;  4DJA A;  5CHE E;  3LDZ A;  1E8X A;  4H7X A;  5HI7 A;  4A3V A;  4B8C B;  5ARG A;  5D0Q D;  4E6H A;  4IUL A;  1QQE A;  2VGX B;  3QNK A;  2WXI A;  4N3C A;  2PM6 A;  3LYA A;  4I1A A;  4BT8 A;  4JVS A;  3B7T A;  3FTX A;  3PRE A;  3GW4 A;  3UMV A;  5FZS A;  3Q4A B;  2MRI A;  4F7A A;  1KT0 A;  3BG0 B;  2X6I A;  4KVO A;  5CCM A;  3LPZ A;  4MRU A;  4N2Q A;  3D9N A;  1BPO A;  1ZU2 A;  4WNG A;  4F3V A;  2I6H A;  2KCK A;  2PM7 A;  4GCN A;  2VGY A;  3HDX A;  2L0I A;  3I3N A;  1P5Q A;  4PUC A;  4U0U A;  3PNT B;  5G05 C;  5KJN A;  3S2A A;  3UPV A;  4WNF A;  1UG3 A;  2X6K A;  5AJL A;  1XGW A;  4L2L A;  3PEV B;  4JHK A;  4XI9 A;  3CK9 A;  1VDY A;  2E0I A;  1ELK A;  4CDR A;  2J9Q A;  4HOU A;  3TJP A;  4I6E A;  3UT7 A;  3ZRH A;  2PL2 A;  2PQR A;  4KBQ A;  1L5J A;  1HFA A;  2I1J A;  3B7S A;  3D9K A;  4B89 A;  5C2Y A;  5CCL A;  5BPP A;  1N52 A;  4ABN A;  4CDN A;  1NZN A;  3CV0 A;  2YNQ A;  3HHM A;  4EZK A;  1B89 A;  1H2U A;  4I1O B;  3N71 A;  4GYO A;  4I9E A;  4A1S A;  2XPI A;  3LKU A;  2J09 A;  3D9L A;  3RKV A;  3CLJ A;  5HQ8 A;  2V8S E;  5LFA A;  1DVP A;  3FUL A;  2BTD A;  3JQ1 A;  3O48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...