2IFUA

Crystal structure of a gamma-snap from danio rerio
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
275
structure length
275
Chain Sequence
AAQKISEAHEHIAKAEKYLKTSFMKWKPDYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTPDTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAALEDLLQAYDEQDEEQLLRVCRSPLVTYMDNDYAKLAISLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords gamma-snap
publication title Structure and dynamics of gamma-SNAP: insight into flexibility of proteins from the SNAP family.
pubmed doi rcsb
source organism Danio rerio
total genus 112
structure length 275
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ifuA00
1HXIA 4XI9A 4XIFA 2PL2A 3BEEA 3Q15A 2OOEA 5D0OD 3AS8A 3CVPA 3Q4AB 4N5CA 5A7DB 3TG5A 5C1DA 4N3CA 4AY6A 4CGVA 3ASGA 2UWJG 2FEZA 3ZPJA 3ASFA 3CKBA 2KATA 3GW4A 4BTBA 5JJ6A 5EX0A 2UY1A 4W9RA 5ARFA 1FCHA 2XGSA 1P5QA 3KD7A 3MKRA 4GYOA 4G23A 3GZ1A 5BT1A 4G2VA 4I2ZA 2V5FA 4YNDA 5EX3A 2IFUA 4U04A 4J0UA 4UQYA 5G04C 5HQ8A 3Q47B 3LY7A 3Q5MA 4I17A 1YA0A 3CV0A 2JLBA 2NC9A 5KJKA 3ESKA 3FP3A 4H7XA 2HYZA 5G04J 4U0UA 1ELWA 3TGOA 2LNIA 4KXKB 4I2WA 3HYMB 2PZIA 2FO7A 4AM9A 4HOQA 3RO2A 1HZ4A 1ELRA 2WPVA 3SF4A 4J8EA 3MV3B 2XPIA 4J8DA 3CK9A 2VSYA 3GYZA 3OXGA 3LY8A 4AIFA 4A1SA 3S7DA 3FWVA 3U3WA 4N39A 2GW1A 3GZ2A 3URZA 4N2SA 4G26A 4IN3B 4N2QA 2FBNA 5KJNA 3FFLA 3S7FA 3EDTB 4UI9K 5FZQA 5DIZA 3ZN3A 4XI0A 2C0MA 3VTYA 2LSVA 5FZSA 2MHKA 1XNFA 5D0QD 3AS5A 4BWRA 2Y4UA 2E2EA 3ASDA 1PC2A 2VYIA 3ZFWA 5FJYA 4WNDA 4U0ZA 3CVLA 3S7JA 3LKUA 3CVNA 2VQ2A 1KT0A 3SZ7A 4Y6CA 4U0SA 4GYWA 4N3AA 2XCCA 2PQNA 5A6CA 1Y8MA 3ZGQA 4WNGA 3CKCA 4GA2A 4LEUA 4GCNA 5JJ7A 5G05C 3LYAA 4F3VA 4GCOA 2J9QA 3E4BA 5FT9A 4WUYA 3CEQA 5BW8C 5G05J 4UQZA 4GA1A 4KYOB 1ZU2A 3MV2B 4KBQA 1NA3A 4J8FA 4H7YA 2AVPA 2DBAA 3CK7A 2VGXA 3JYSA 4NRHB 3PDNA 3ULQA 2XCBA 4Y6WA 3O48A 4NQ0A 2I6HA 3CVQA 3NF1A 3Q49B 4WNFA 5CCMA 1E96B 2VGXB 2BUGA 1IYGA 3R9AB 3K9IA 3TAXA 3CK8A 5EKQD 3OXLA 3RJVA 2KC7A 2Q7FA 2FI7A 4HOSA 2QFCA 2C2LA 3TG4A 2YQ8A 5KJLA 4GZ5A 3QWPA 3VTXA 2HR2A 1NA0A 4UQXA 1QQEA 2R5SA 3UPVA 5LCWC 3OXFA 3U4TA 1W3BA 3RO3A 5HI7A 3UUXA 4BT8A 2VGYA 4CDRA 5CHEE 4HOUA 4I9EA 5FZRA 4GYYA 5LCWJ 2XGOA 2ONDA 2PQRA 1WM5A 1OUVA 3ASHA 1A17A 3PE3A 4GZ6A 4BTAA 3QWWA 3RIBA 4EQFA 2L6JA 4GA0A 1IHGA 2WQHA 3LPZA 2XEVA 4JA9A 2HO1A 4JHRA 4B94A 4JL0A 3IEGA 3RKVA 5DBKA 3ZHEA 4APOA 3PE4A 5BNWA 1HH8A 3KAEA 4RG6A 3S7BA 4YVQC 4YVOA 2KCKA 4I9CA 1ZBPA 2UY1B 1B89A 3ZHEB 2LSUA 5AYWD 2FF4A 4UI9C 4ABNA 2KCLA 4I1AA 1QZ2A 4G25A 1KLXA 3KS2A 4AY5A 1KT1A 3LCAA 2Y4TA 4U07A 4UI9J 5KJMA 2P58C 3RU0A 4JA7A 4G24A 2C0LA 4WNEA 4RG9A 2IF4A 3MA5A 3UQ3A 1NZNA 3N71A 1WAO1 4GZ3A 5M72A 2KCVA 5JJTA 3QKYA 4G1TA 4HORA 4HOTA 3LY9A 5CCLA 3QWVA 3QDNA 4BT9A 4O6FA 5FTPA 4ME2A 3AS4A 3WXXA 2VSNA 3QOUA 2YHCA 1TJCA 3MEKA 4N3BA 2XGMA 5ARGA 4GPKA 4CGWA
chains in the Genus database with same CATH superfamily
4XIFA 2PL2A 3ISMC 4DX2A 3G2VA 3AS8A 3CVPA 3Q4AB 3V30A 4N5CA 1L5JA 4O1PA 4AY6A 4HRNA 3NZUA 3CHSA 4UUCA 1BU9A 2UWJG 3ZPJA 3ASFA 2KATA 3D9OA 1E7UA 3FTXA 5EX0A 1E90A 4L9PA 4OVVA 4W9RA 3IHYA 2IO3C 1YYHA 4CDMA 4L2YA 3MKRA 4G23A 1SVXA 3KSQA 4V3IA 1U3CA 4KZCA 4F1SA 1D9SA 3HVEB 5EX3A 2DYRE 3IBEA 2MRIA 2IFUA 1LD8A 3PREA 5HQ8A 3MKQA 2YHEA 3PUKA 4FLBA 4GTTA 1PAQA 3WG7E 5BPPA 3CHQA 5BV1A 1TYQG 3RSEG 4EZJA 2JLBA 5T4YA 4F7AA 1HU3A 4H7XA 2A5UA 2P9LG 3ZNGA 1OWLA 5EN5D 3NZSA 1HFAA 2A4ZA 4I2WA 2FO7A 4AM9A 3RO2A 4FLHA 4O1OA 1HS6A 3FEYA 1ELRA 1N9AA 2XHEA 4A3VA 3MV3B 4AEZC 2VSYA 3S7DA 4DX1A 3FWVA 2AXUA 2GW1A 2X6HA 5B1BE 4JHJA 2IY0C 4J8SA 4G26A 4IN3B 4N5QA 4N2QA 2FBNA 3Q73A 2Y1LE 4HNAD 1UOHA 1V55E 3S7FA 3C3RA 3UIOC 3SGHA 3V2XA 3PEUB 2C0MA 3VTYA 4OAVB 2YNQA 3FH5A 3FTYA 3P1UA 3BG0B 1XNFA 5D0QD 3ASDA 2VYIA 5AQBA 3ZFWA 2OEVA 4WNDA 3L22A 3CVLA 3LKUA 3FUMA 2XEEA 3LEWA 4ANXA 2DVWA 4LRZA 3I5PA 4N3AA 2GRPB 2PQNA 5FINA 1Y8MA 4LEUA 4ZFHA 3LYAA 4GCOA 3I3NA 3AU5A 1TNUA 1UN9A 5FT9A 1OY3D 3PNLB 5JMND 3CEQA 3EU9A 2P9UG 3UM2A 4LCTA 1NA3A 4H7YA 1OCCE 4TUUA 2DZNA 4C9BB 4GTOA 4PH4B 4NRHB 2R17C 4APFA 3QC1A 3T5VA 2IJGX 5CCMA 3E37A 4B8AA 5ANRA 3FUHA 2OVFA 1FT1A 4BY6A 3SY2A 3T5XA 3PNTB 4B0ZA 1H6PA 2JEKA 5CRUA 2AJAA 3TAXA 4J6IA 3ZYMA 5EKQD 2H6IA 2X6JA 4E6HA 1G3NB 2KC7A 3KEAA 2FI7A 4HOSA 4BSXA 3TXMA 4U8HA 1SQMA 3RK6A 5FQ7A 1TNYA 3I4GA 3VLEA 3JQ0A 3SI5A 5HI7A 3SO8A 3Q7FA 4HXIA 4RSYA 2J07A 4ATZD 3HHMA 5FZRA 5AJLA 3UI2A 2PQRA 3OTNA 5ENSD 1OUVA 1A17A 3DPYA 4BFRA 4I1OB 3SFYA 3RRUA 3RIBA 2XZTG 2BF0X 2XEVA 5T3RA 2XENA 3MJWA 3TWTA 1X81A 5IY5E 3FY4A 3C98A 3JXIA 3ZHEA 2EILE 4AP2A 3SFZA 3PE4A 1E8ZA 4YVQC 2EIKE 5AAOA 4YVOA 3LJNA 3QNKA 1BLXB 4TUMA 3TJPA 4HRLA 3ZHEB 1N0RA 4HLEA 2FF4A 4YDEA 1KLXA 2VJ8A 2DCPA 3O4ZA 4BX8A 3D9PA 4ILHB 1S0PA 3LCAA 1YCSB 3APFA 5KJMA 5B3SE 3ZXSA 3RU0A 1EF1C 3MCXA 2IO2C 4GMRA 1V54E 2ZU6B 1TNZA 2RFAA 2IF4A 2WQ7A 4AV7A 1NZNA 3N71A 3PZ2A 4E85A 4OVUA 4NURA 4Q96A 4PDXA 4U8VD 3R7RA 4DUIA 2KCVA 1U3DA 4HOTA 4QFVA 1OCZE 3CLJA 3QWVA 3QDNA 1UJJA 4WWPA 4ME2A 4M7CA 4JEHA 3DRAA 2OEWA 4GZCA 4EBAG 2ILRA 3WXXA 3FUKA 2GRLA 4J7WA 3J5QB 2YHCA 3J5PA 5G2NA 3TXNA 2WXMA 4C48B 4KVMA 2XS8A 2CFUA 2XPZA 3LS8A 4GPKA 1Z6TA 4CGWA 3NQPA 4K0RA 3BEEA 3CGHA 3X2QE 2X6KA 2IQCA 2R05A 3LVRE 4N3CA 4I6GA 4UWLA 3ASGA 1DNPA 2EIJE 1OXJA 2WXJA 3HRAA 4WAFA 4U96D 3GW4A 1JUQA 5EIDA 4BTBA 4LNUD 3CQCB 1HG5A 1N0QA 3BUAA 1KPSB 5ARFA 3ABME 2I1JA 3CSFA 3D9LA 5EYLA 3ULYA 2MOWA 3MZLB 3QARA 4GYOA 3PZ1A 4A3TA 5EYPF 3G2WA 1O1RA 1HE8A 4HBDA 2MYOA 4I2ZA 4YNDA 3UTMA 5KCMA 2AXZA 1DCEA 2VTBA 2WXGA 1OWMA 3AG1E 3DSTA 2WXLA 4UQYA 2LUHA 2CG2A 4FP7A 4IYPA 3SNXA 1MX6A 3CVVA 3L82A 3ZYQA 3FUDA 2NC9A 5KJKA 2HYZA 3F6QA 4U0UA 3TGOA 3UT4A 2PZIA 4HOQA 3MYVA 3IV0A 3DWLG 1H6KA 3SF4A 2XPIA 1QNFA 4J8DA 3GYZA 3LY8A 3C3QA 4A1SA 2LAHA 4A1GA 1IQRA 1HG2A 3UINC 3U3WA 5ENTD 2GRRB 3ENEA 2GGFA 3URZA 2BKGA 4KMOA 4HLLA 3ZW3A 4IRUA 4YDYA 4JB8P 4UI9K 3DSSA 3ZN3A 5CBOA 3Q9UC 2LAIA 5BXOA 2LSVA 3LXUX 1UW4B 1PC2A 2YINA 3CVNA 3ZUVB 3GZSA 3SZ7A 2J49A 2P9PG 3ONLA 5T8IA 5A6CA 3UT8A 4MRUA 3CKCA 4HI9A 3HVEA 4F53A 4F3VA 2WXRA 2J9QA 3E4BA 2IOLA 3TWQA 1OT8A 4WUYA 3TWRA 2E0IA 3RRNB 4HVBA 2ETCA 4XX5A 5BW8C 1D8EA 4UQZA 3LVQE 3ML9A 4A55A 2AVPA 4U8YD 2BEDA 3CK7A 3FHEA 3PDNA 3SBTB 4EZLA 2XCBA 2Y3AA 1WG0A 3B7BA 2QYJA 5CRVA 4B8CB 4UWKA 1UG3A 3R9MA 3R9AB 3K9IA 3CIAA 3D9KA 4K5BA 2KZTB 3RJVA 2P9KG 2NSZA 2Q7FA 3TG4A 3BU8A 5KJLA 2F8YA 1FPPA 4PS7A 3P2BA 3EIQC 4ANWA 3UPVA 5LCWC 2P2CP 4CRWA 1AP7A 3U4TA 1JWGA 4DLQA 3HIZA 1W3BA 3JUIA 3UUXA 5B1AE 3D9JA 4AVXA 3E30A 3MX3A 1TN8A 4K5AB 5CEAA 2WXKA 4U63A 3ASHA 3PZ4A 1H2TC 2CHWA 4GZ6A 1VDYA 3Q78A 4JVSA 3QWWA 4X8QA 5CEDB 5KNHD 4EQFA 2L6JA 2WQHA 4ANUA 3B7RL 1D8DA 1E8WA 3LPZA 3CSTA 2FO1E 2GRMA 4HS2A 4TRQA 3T8MA 3RKVA 3ZRHA 2IEJA 1HH8A 2XRYA 4GTMA 4I9CA 1ZBPA 2NYJA 5AENA 2UY1B 1B89A 2LSUA 1SA5A 3V79K 4UI9C 4ABNA 1MYOA 1QZ2A 2F8XK 1HO8A 3KS2A 1FVFA 4GB9A 1KZOA 3FU6A 2X3MA 2CHXA 3Q7AA 3FH7A 2Y4TA 3FU3A 1N94A 2P58C 2ZGGA 4P29A 2C0LA 2DIWA 5AIJA 4ZHBA 2X38A 3UQ3A 1S64A 4DI4A 1UJKA 3AU4A 1QBQA 1WAO1 3PZDA 2J09A 4G1TA 1TN6A 3DXMG 5JHBA 2RD0A 2B0OE 1O1TA 5FTPA 4FC8A 2VSXE 2IU1A 5LP0A 2QZAA 4PUCA 2I9CA 2WQ6A 5FQ6A 1EYHA 1E8XA 3MEKA 4R7LA 2XEHA 2XGMA 1N54A 1S63A 3B7UX 1HXIA 2KM4A 3AG2E 4XI9A 2OOEA 1H0AA 2LO6A 2WXQA 4K5CA 5C1DA 3C72A 3Q9NC 4C0MA 3PH0C 3BG1B 4GMLA 2GRNB 4GPMA 4UWHA 4JHKA 3FUNA 4ATGA 1SA4A 2JABA 5AQ9A 3ASNE 3KD7A 3CVWA 3EJNA 3NOGD 3EHNA 3PRZA 2R2LA 4RQIA 4UWFA 1IKND 4GTVA 4G2VA 4CT0A 2WB2A 2Y0BG 4Q69A 3EIJA 2XPYA 4IULA 3NAWA 3HXDA 4J0UA 2ZISA 5G04C 2X6IA 3Q47B 5C2YA 3LY7A 4CZ2D 1OCRE 4YDOA 4I17A 5KNGA 2BKKB 3ZYKA 3CV0A 1N4SA 2V4LA 2X6FA 1N95A 2F37A 3ESKA 3L17A 1ELWA 4AJWA 3ONKA 1TNOA 3I4RB 2WPVA 3CVXA 4J8EA 3D3MA 3OXGA 1E8YA 1IQUA 5HRYA 4N39A 3GZ2A 5EDSA 4Z68A 5CERB 4N2SA 5KJNA 3ABLE 5AARA 3TWSA 4LSZE 2WXHA 4O60A 3HDXA 3MGBA 5FZQA 2WM9A 4JEUA 4HFGA 3FU0A 3BQOA 4XI0A 3AJIA 5KWDA 3T8KA 1FT2A 4F1PA 2VGEA 3ESLA 4M3OA 3FTWA 1DVPA 2J08A 4WWNA 3AS5A 4BWRA 1E7VA 3TWVA 5ITZF 2Y4UA 1NFIE 3PZ3A 1NL4A 2WXNA 5CMWA 1TNBA 1N52A 4DLOA 5FJYA 4G11A 1O5MA 2FULA 2CFZA 1MQSA 2VQ2A 1KT0A 1Z5SC 4GYWA 3FH8A 3UXGA 2XCCA 3CHOA 3V2OA 5LOZA 3HXEA 1MJ0A 2OV8A 4BEPA 4KT6B 3QB2A 5JJ7A 2EINE 3FTUA 5G05C 3UM0A 2WXOA 2BTDA 5CMYA 1GW6A 1OWPA 4Q94A 3FUIA 2R59A 3B7SA 3SQVA 1ELKA 2HE0A 1OWOA 4GA1A 4KYOB 1TEZA 1ZU2A 4KBQA 2DBAA 1BI7B 1MZCA 3HXBA 4JZYA 3V31A 2VGXA 3JYSA 2ZIRA 5FQ4A 3UKRG 4NACA 4FHJA 4Y6WA 3O48A 3HXCA 1PY1A 2ZGDA 5AQ7A 2VGXB 2BUGA 5HS0A 3FUJA 3OXLA 3E32A 3EUVA 5A23A 2V0PA 4FHKA 2NXPA 3QAQA 5D66A 4L2LA 1INZA 2DZOA 2QFCA 3PS6A 2C2LA 1Y6IA 1YMPA 3QWPA 3Q79A 3SD5A 2EQXA 4GTRA 3G2UA 3UM1A 2XRZA 4UQXA 3UKUG 4EBAA 3OXFA 3U64A 4PS3A 3EHRA 2F0YA 3AG4E 3JUEA 1N11A 4BT8A 2VGYA 4CDRA 1X5BA 4HOUA 4I9EA 4DX7D 2V5QC 5LCWJ 2XGOA 2ONDA 1TN7A 1S70B 1WM5A 3EU5A 3FTVA 4MLPA 3ASOE 4GA0A 1IHGA 2I1KA 4JA9A 2HO1A 4B94A 4JL0A 4KVOA 4A63B 4FU3A 2H6GA 4UWGA 5DBKA 4APOA 3RAUA 4ANVA 4BETA 1MHQA 4RG6A 1HF8A 3S7BA 1N4QA 4I6EA 2KCKA 4DJAA 3ULEG 3DSWA 1IHBA 2EIME 3L08A 2KCLA 4I1AA 1LTXA 4G25A 2PM6A 1IXVA 4G8LA 4CT4A 3D9MA 4EZKA 4AY5A 1KT1A 2KZTA 3E33A 2L0TB 4U07A 4UI9J 2J4BA 4JA7A 4G24A 4LNGA 2KXPC 3FDHA 4XE0A 3DSVA 3DBSA 4GU5A 3TWWA 3B7TA 3EHQA 3MKQB 3PVLA 1JCSA 5JJTA 3DSXA 2VSOE 1LF8A 4FULA 4L1BA 4K03A 4EPZA 1U2VG 5CCLA 2ZXWE 2WXPA 1K8KG 4GTPA 5ENNA 4O6FA 4J8YA 2VSNA 1MX2A 1A5EA 3ZXPA 3ZU7B 3HXFA 1TJCA 4HQDA 2P9NG 2WMNA 5ARGA 3U66A 1Z3XA 5KBAA 1SZ9A 3Q15A 3PEVB 3UIPC 3C5RA 5D0OD 3U9WA 4BESA 5A7DB 3TG5A 1OWNA 2IOSA 3LDZA 3NOCD 1K1AA 4CGVA 2KBXA 1H2VC 2FEZA 3TWUA 3CKBA 4FA6A 1EDUA 2WMOA 3IHVA 5EILA 3B95A 5JJ6A 2UY1A 1NP7A 4KZ0A 3ZYLA 1FCHA 4XEIG 1JWFA 1N4PA 4U95D 1DC2A 2A5EA 2HM8A 1FVHA 2XGSA 1P5QA 2AXVA 4HRMB 3L6AA 3G2TA 3GZ1A 1AWCB 3ZEFA 5ENRD 2L9BA 5BT1A 3ABKE 2P9SG 3AAAC 4CEMA 1LD7A 4WWOA 2DYSE 1SZAA 3FEXA 3PUJA 3D9NA 2V5FA 3W9FA 2WXIA 3NB2A 1H6OA 3CVUA 3EHMA 1N4RA 3FU5A 1BD8A 4U04A 3TL5A 2AWIA 4FADA 3Q5MA 1Q2ZA 4TV3A 2GRQB 4I6JA 1YA0A 2LXMA 4TXQA 3FP3A 1Z3YA 2V4HC 5G04J 1RW2A 2RG8A 2LNIA 4KXKB 3HYMB 3L9TA 2DWZA 1HZ4A 4D10C 2ETBA 1JPLA 2QYUA 3CK9A 3AG3E 4AIFA 2L0IA 5HKPA 3CHRA 1DCQA 4GZDA 3CHMA 3IKOB 3QJZA 5BV0A 4ILGA 4GMJA 4ILIA 1JCQA 4GTQA 5ENPD 3UT7A 3FFLA 2XZDG 3EDTB 2V8SE 3KSLA 5DIZA 4CCAA 5EIBE 5FZSA 3ZKJA 2MHKA 3FUEA 3D9HA 5J08A 4NIKA 1KZPA 2E2EA 3VLDA 5CBNA 1OCOE 4MKTA 3UX4A 2Y69E 4U0ZA 4LG6A 2AW6A 3S7JA 2J8SD 5BUZA 2GROB 3DPDA 3T9KA 4Y6CA 4EECA 4U7EB 4U0SA 1EPUA 1WY6A 4I1MA 3JQ1A 3ZGQA 4WNGA 4GA2A 4URKA 4GCNA 3QK0A 4CDNA 4ACLA 3Q75A 4PS8A 5ANLA 3SBSA 5ENQD 2XQ0A 4B89A 3R7QA 3HG0D 5G05J 4BSZB 3FUFA 3MV2B 4J8FA 4L7TA 5H7PA 4RVBA 3ULQA 4XKBA 4L23A 1O1SA 4NQ0A 2I6HA 3CVQA 3NF1A 1ZB1A 3Q49B 4WNFA 2ETAA 1H2UA 3D9IA 3NBNB 1E96B 4YDWA 4F6RD 1IYGA 4JD2G 4DI3A 2P9IG 4G8KA 4MBGA 3CVYA 5BXUA 2CHZA 1BPOA 4B93B 3CK8A 5J90A 1RZ4A 4LUNU 3JXJA 3SHFA 5LFAA 2B6CA 4EHMA 5E75A 3G2SA 3TWXA 1QYMA 4OAUC 4ACKA 2YQ8A 1JCRA 4DPRA 4GZ5A 4AOFA 3VTXA 2HR2A 4FJYA 4GTSA 5E76A 3ZVVA 1NA0A 2J4DA 1QQEA 3CR3A 2R5SA 2WXFA 3VLFA 4JW1A 3RO3A 3B13A 2CG3A 3APDA 4JC8A 5CHEE 1TR4A 2QC9A 4GYYA 4XZ4A 3CQGB 5CECB 5JHAA 3C3OA 3IXEA 5G55A 3PE3A 3ML8A 4BTAA 2H6HA 2OCCE 1XGWA 2QY7A 3CHPA 1TJFA 4JHRA 1K1BA 4DK5A 2XS1A 2OVBA 4I43A 1UN8A 4JPSA 3IEGA 3FTSA 4RLYA 3L54A 3RRMB 1NI1A 1HX8A 5BNWA 2R03A 5D2MC 3KAEA 4C0EA 1WDYA 3SFXA 5AJDA 4DX6D 4DRXE 4CYMD 5AQAA 4TXPA 5JA4D 5AYWD 4HB5A 3FTZA 3APCA 2IONA 3DEPA 4HI8A 4JXTA 2I2OA 3FULA 3ZIMA 3L13A 4TXRA 3DSUA 2RFMA 3UM3A 1H19A 2L6BA 4MS6A 4GAAA 4WNEA 3UMVA 4XKCA 4FJZA 4RG9A 5LX8A 3MA5A 3OAWA 2VTBB 3DXKG 3S2AA 4BERA 3KEZA 5FWQA 4QQIA 5AN8A 2RKKA 4OYSA 4GZ3A 5M72A 4BX9A 3QKYA 4HORA 5FIOA 1SW6A 3LY9A 5FQ8A 1K3ZD 3E34A 2PNNA 4BT9A 2H6FA 4AXHA 1MX4A 2WVIA 2LXLA 4LERA 3AS4A 3QOUA 3LJ3A 2PM7A 1BI8B 3DEOA 3W9GA 5ENOD 3L16A 4N3BA 2R02A 2M63A 3JCKC 4LNBA 4DX5D
chains in the Genus database with same CATH topology
1HXIA 2KM4A 4K0RA 4XI9A 4XIFA 2PL2A 3BEEA 1SZ9A 3Q15A 2OOEA 3CGHA 3PEVB 1H0AA 5D0OD 2LO6A 2WXQA 3G2VA 3AS8A 3CVPA 3Q4AB 4N5CA 3U9WA 1L5JA 5A7DB 1OWNA 2IQCA 2IOSA 2X6KA 3LVRE 4N3CA 3TG5A 5C1DA 4C0MA 4I6GA 3LDZA 4UWLA 4AY6A 3PH0C 4CGVA 3NZUA 3CHSA 3ASGA 3BG1B 4GMLA 1DNPA 1H2VC 2UWJG 2FEZA 3ZPJA 3ASFA 2WXJA 4WAFA 3CKBA 2KATA 3GW4A 3D9OA 1JUQA 4FA6A 1EDUA 2WMOA 3IHVA 4UWHA 1E7UA 3CQCB 5JJ6A 3FTXA 4JHKA 5EX0A 1E90A 1HG5A 2UY1A 1NP7A 4OVVA 4KZ0A 4W9RA 3FUNA 4ATGA 3IHYA 5ARFA 3ZYLA 1FCHA 1JWFA 2I1JA 4CDMA 2HM8A 1FVHA 2XGSA 1P5QA 3CSFA 3KD7A 3D9LA 2AXVA 2MOWA 3MZLB 4L2YA 3CVWA 3MKRA 3EJNA 3QARA 3EHNA 3PRZA 3TL5A 4GYOA 3L6AA 4G23A 3G2TA 4UWFA 3GZ1A 4A3TA 4V3IA 3ZEFA 2L9BA 1U3CA 3G2WA 5BT1A 4CEMA 4G2VA 4WWOA 4CT0A 2WB2A 1SZAA 3FEXA 4KZCA 4F1SA 1HE8A 4Q69A 3EIJA 4I2ZA 2XPYA 3PUJA 3D9NA 2V5FA 2WXIA 4YNDA 3CVUA 5KCMA 2AXZA 3HVEB 4IULA 5EX3A 3EHMA 2VTBA 2WXGA 3IBEA 1OWMA 2MRIA 3FU5A 2IFUA 4U04A 2WXLA 4J0UA 4UQYA 3PREA 2AWIA 2CG2A 4FP7A 3MKQA 2YHEA 5G04C 4IYPA 3SNXA 3PUKA 4FLBA 5HQ8A 2X6IA 3Q47B 5C2YA 1PAQA 3CVVA 4FADA 5BPPA 3LY7A 3Q5MA 3CHQA 3ZYQA 5BV1A 4TV3A 4I6JA 4I17A 1YA0A 3ZYKA 3CV0A 3FUDA 4EZJA 2JLBA 5T4YA 4F7AA 1HU3A 2V4LA 2NC9A 2X6FA 5KJKA 3ESKA 3FP3A 1Z3YA 2A5UA 2HYZA 1OWLA 4H7XA 5G04J 4U0UA 3L17A 3NZSA 1ELWA 3TGOA 2RG8A 1HFAA 2A4ZA 2LNIA 4KXKB 4I2WA 3ONKA 3HYMB 3UT4A 2PZIA 2FO7A 4AJWA 4AM9A 4HOQA 3MYVA 3IV0A 3RO2A 4FLHA 3I4RB 1HZ4A 4D10C 1HS6A 3FEYA 1ELRA 1H6KA 2XHEA 2WPVA 4J8EA 2XPIA 1QNFA 1JPLA 3MV3B 4J8DA 3SF4A 3CK9A 4AEZC 2VSYA 3GYZA 3D3MA 3OXGA 1E8YA 1IQUA 2L0IA 3LY8A 2LAHA 3S7DA 4A1SA 4AIFA 3CHRA 4A1GA 1IQRA 1HG2A 3FWVA 3U3WA 2AXUA 2GW1A 2X6HA 4N39A 4GZDA 3ENEA 4JHJA 3CHMA 3GZ2A 5EDSA 2GGFA 4J8SA 3IKOB 3URZA 4N2SA 4KMOA 3QJZA 5BV0A 4G26A 3ZW3A 4IN3B 4ILGA 4IRUA 4GMJA 4N2QA 2FBNA 4ILIA 5KJNA 2WXHA 3HDXA 3UT7A 3FFLA 3S7FA 3EDTB 4UI9K 3MGBA 5FZQA 2V8SE 2WM9A 4HFGA 4JEUA 5DIZA 3ZN3A 4CCAA 3SGHA 3FU0A 4XI0A 2LAIA 3PEUB 2C0MA 3VTYA 2LSVA 5FZSA 4BTBA 2YNQA 3ESLA 3FH5A 3FTYA 4M3OA 3P1UA 2MHKA 3BG0B 3FTWA 1XNFA 3FUEA 1DVPA 5D0QD 2J08A 4WWNA 5J08A 3AS5A 4BWRA 1E7VA 4A3VA 2Y4UA 3LXUX 2E2EA 1UW4B 3VLDA 3ASDA 2WXNA 1PC2A 2VYIA 4MKTA 5CMWA 1N52A 4DLOA 3ZFWA 5FJYA 4WNDA 3UX4A 4G11A 4U0ZA 3L22A 2YINA 3CVLA 2AW6A 3S7JA 2FULA 5BUZA 3LKUA 3FUMA 3CVNA 2CFZA 1MQSA 2VQ2A 3LEWA 1KT0A 4ANXA 3GZSA 3DPDA 4LRZA 3SZ7A 4Y6CA 2J49A 3ONLA 4EECA 3I5PA 4U0SA 4GYWA 3FH8A 4N3AA 2XCCA 3CHOA 5T8IA 2PQNA 5A6CA 5LOZA 3UT8A 4MRUA 1EPUA 2OV8A 1WY6A 4I1MA 1Y8MA 3JQ1A 3ZGQA 4WNGA 3CKCA 4KT6B 4GA2A 3HVEA 3QB2A 4GCNA 4LEUA 4URKA 5JJ7A 3QK0A 4CDNA 4ACLA 4F53A 3FTUA 5G05C 2WXOA 3LYAA 2BTDA 5CMYA 4F3VA 2WXRA 1GW6A 4PS8A 4GCOA 2J9QA 3I3NA 3AU5A 1OWPA 4Q94A 3E4BA 5ANLA 3FUIA 2IOLA 3SBSA 1UN9A 5FT9A 4WUYA 2R59A 2E0IA 3PNLB 3B7SA 2XQ0A 3RRNB 4B89A 3CEQA 1ELKA 1OWOA 4HVBA 4XX5A 3R7QA 5BW8C 5G05J 4UQZA 4GA1A 4KYOB 1TEZA 1ZU2A 3FUFA 3MV2B 3LVQE 4KBQA 3ML9A 4LCTA 1NA3A 4J8FA 4A55A 4H7YA 4L7TA 2AVPA 4TUUA 2DBAA 4JZYA 4C9BB 3CK7A 2VGXA 3JYSA 3FHEA 4PH4B 4NRHB 4RVBA 5FQ4A 3PDNA 2R17C 4NACA 3SBTB 3ULQA 4FHJA 4APFA 4EZLA 2XCBA 3QC1A 4XKBA 2Y3AA 4L23A 4Y6WA 3T5VA 3O48A 4NQ0A 2I6HA 3CVQA 3NF1A 1PY1A 3Q49B 4WNFA 2IJGX 4B8CB 5CCMA 4B8AA 5ANRA 1H2UA 3FUHA 2OVFA 4BY6A 3D9IA 1E96B 2VGXB 4UWKA 1UG3A 2BUGA 1IYGA 3T5XA 4DI3A 3FUJA 3PNTB 4B0ZA 3R9AB 2JEKA 3CVYA 3K9IA 3CIAA 2CHZA 1BPOA 3TAXA 3CK8A 4J6IA 5J90A 3ZYMA 5EKQD 2X6JA 3D9KA 2KZTB 3OXLA 3RJVA 4LUNU 4E6HA 3SHFA 2NSZA 5A23A 2V0PA 5LFAA 2KC7A 2Q7FA 2NXPA 4FHKA 3QAQA 5E75A 3G2SA 4L2LA 2FI7A 4HOSA 1INZA 2QFCA 4BSXA 3PS6A 2C2LA 3TG4A 3TXMA 1Y6IA 4ACKA 2YQ8A 4DPRA 5KJLA 4GZ5A 3QWPA 3SD5A 4AOFA 3VTXA 2EQXA 2HR2A 3G2UA 4FJYA 4PS7A 5E76A 3P2BA 2XRZA 3ZVVA 1NA0A 2J4DA 4UQXA 1QQEA 4U8HA 3CR3A 2R5SA 2WXFA 3EIQC 1SQMA 3VLFA 3RK6A 4ANWA 4EBAA 3UPVA 5LCWC 3OXFA 5FQ7A 3I4GA 3U64A 3VLEA 4PS3A 4CRWA 3JQ0A 3U4TA 1JWGA 4JW1A 4DLQA 3SI5A 3HIZA 1W3BA 3RO3A 5HI7A 4HXIA 3B13A 3JUIA 2CG3A 3APDA 3UUXA 4JC8A 4RSYA 4BT8A 2J07A 2VGYA 4CDRA 3D9JA 4AVXA 1X5BA 4HOUA 3HHMA 5CHEE 4I9EA 3MX3A 5FZRA 4GYYA 3B7UX 5AJLA 4XZ4A 3CQGB 2XGOA 2WXKA 5JHAA 5LCWJ 2ONDA 4U63A 2PQRA 1WM5A 3OTNA 1OUVA 5G55A 3ASHA 1A17A 1H2TC 3PE3A 3FTVA 3ML8A 2CHWA 4GZ6A 1VDYA 4JVSA 4BTAA 3QWWA 4BFRA 4I1OB 4MLPA 3RRUA 3RIBA 4EQFA 2L6JA 4GA0A 1IHGA 2WQHA 4ANUA 3B7RL 2I1KA 1XGWA 2BF0X 2QY7A 1E8WA 2XEVA 1TJFA 3CHPA 2HO1A 3LPZA 3CSTA 4JA9A 4JHRA 5T3RA 4B94A 4JL0A 4DK5A 2OVBA 4KVOA 4I43A 1UN8A 2GRMA 3MJWA 4HS2A 4JPSA 3IEGA 3FTSA 4FU3A 3FY4A 4TRQA 3RKVA 3T8MA 3ZRHA 3C98A 4UWGA 3L54A 5DBKA 3ZHEA 3RRMB 1HX8A 4APOA 4AP2A 3SFZA 3PE4A 5BNWA 4ANVA 1HH8A 2XRYA 3KAEA 4C0EA 1MHQA 4RG6A 1HF8A 1E8ZA 4YVQC 3S7BA 4I6EA 4YVOA 2KCKA 4I9CA 4DJAA 1ZBPA 5AJDA 5AENA 2UY1B 1B89A 3QNKA 3CVXA 3TJPA 3ZHEB 2LSUA 5AYWD 4HLEA 2FF4A 4UI9C 3L08A 4ABNA 2KCLA 4I1AA 1QZ2A 4G25A 1KLXA 2VJ8A 2DCPA 3FTZA 2PM6A 3APCA 2IONA 3O4ZA 1HO8A 4CT4A 3D9MA 4JXTA 3KS2A 3D9PA 4BX8A 1FVFA 2I2OA 4EZKA 3FULA 4GB9A 4ILHB 4AY5A 1KT1A 1S0PA 2KZTA 3FU6A 2X3MA 3LCAA 3ZIMA 3APFA 2CHXA 3L13A 3FH7A 2L0TB 2Y4TA 3FU3A 4U07A 4UI9J 5KJMA 2J4BA 2P58C 3ZXSA 3RU0A 4JA7A 1EF1C 1H19A 3MCXA 4G24A 4P29A 2C0LA 4MS6A 4GAAA 4WNEA 3UMVA 4XKCA 2DIWA 4FJZA 2ZU6B 3FDHA 5AIJA 4RG9A 4XE0A 2X38A 2IF4A 5LX8A 3MA5A 3OAWA 3UQ3A 4AV7A 1NZNA 3N71A 4DI4A 4E85A 3DBSA 2WQ7A 2VTBB 4OVUA 3S2AA 4NURA 1UJKA 4Q96A 3KEZA 4GU5A 3B7TA 5FWQA 3AU4A 4PDXA 3MKQB 3R7RA 3PVLA 4OYSA 1WAO1 3PZDA 2J09A 4GZ3A 5M72A 2KCVA 4BX9A 5JJTA 3QKYA 2VSOE 4G1TA 1LF8A 1U3DA 4HORA 4HOTA 4QFVA 5JHBA 3LY9A 4FULA 4L1BA 5FQ8A 4K03A 4EPZA 3CLJA 5CCLA 3QWVA 3QDNA 2RD0A 4BT9A 2WXPA 1UJJA 4WWPA 5ENNA 4FC8A 4O6FA 5FTPA 4ME2A 4AXHA 2WVIA 4JEHA 2VSXE 4GZCA 4LERA 4EBAG 2IU1A 2ILRA 3AS4A 3WXXA 2VSNA 3QOUA 5LP0A 3FUKA 2GRLA 3LJ3A 2PM7A 4PUCA 2I9CA 2YHCA 2WQ6A 5FQ6A 5G2NA 3TXNA 1EYHA 2WXMA 1E8XA 1TJCA 3L16A 3MEKA 4N3BA 4KVMA 2CFUA 4R7LA 2XPZA 2XGMA 1N54A 2WMNA 3LS8A 5ARGA 3U66A 4GPKA 2M63A 1Z6TA 3JCKC 3NQPA 4CGWA 1Z3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXI A;  4XI9 A;  4XIF A;  2PL2 A;  3BEE A;  3Q15 A;  2OOE A;  5D0O D;  3AS8 A;  3CVP A;  3Q4A B;  4N5C A;  5A7D B;  3TG5 A;  5C1D A;  4N3C A;  4AY6 A;  4CGV A;  3ASG A;  2UWJ G;  2FEZ A;  3ZPJ A;  3ASF A;  3CKB A;  2KAT A;  3GW4 A;  4BTB A;  5JJ6 A;  5EX0 A;  2UY1 A;  4W9R A;  5ARF A;  1FCH A;  2XGS A;  1P5Q A;  3KD7 A;  3MKR A;  4GYO A;  4G23 A;  3GZ1 A;  5BT1 A;  4G2V A;  4I2Z A;  2V5F A;  4YND A;  5EX3 A;  2IFU A;  4U04 A;  4J0U A;  4UQY A;  5G04 C;  5HQ8 A;  3Q47 B;  3LY7 A;  3Q5M A;  4I17 A;  1YA0 A;  3CV0 A;  2JLB A;  2NC9 A;  5KJK A;  3ESK A;  3FP3 A;  4H7X A;  2HYZ A;  5G04 J;  4U0U A;  1ELW A;  3TGO A;  2LNI A;  4KXK B;  4I2W A;  3HYM B;  2PZI A;  2FO7 A;  4AM9 A;  4HOQ A;  3RO2 A;  1HZ4 A;  1ELR A;  2WPV A;  3SF4 A;  4J8E A;  3MV3 B;  2XPI A;  4J8D A;  3CK9 A;  2VSY A;  3GYZ A;  3OXG A;  3LY8 A;  4AIF A;  4A1S A;  3S7D A;  3FWV A;  3U3W A;  4N39 A;  2GW1 A;  3GZ2 A;  3URZ A;  4N2S A;  4G26 A;  4IN3 B;  4N2Q A;  2FBN A;  5KJN A;  3FFL A;  3S7F A;  3EDT B;  4UI9 K;  5FZQ A;  5DIZ A;  3ZN3 A;  4XI0 A;  2C0M A;  3VTY A;  2LSV A;  5FZS A;  2MHK A;  1XNF A;  5D0Q D;  3AS5 A;  4BWR A;  2Y4U A;  2E2E A;  3ASD A;  1PC2 A;  2VYI A;  3ZFW A;  5FJY A;  4WND A;  4U0Z A;  3CVL A;  3S7J A;  3LKU A;  3CVN A;  2VQ2 A;  1KT0 A;  3SZ7 A;  4Y6C A;  4U0S A;  4GYW A;  4N3A A;  2XCC A;  2PQN A;  5A6C A;  1Y8M A;  3ZGQ A;  4WNG A;  3CKC A;  4GA2 A;  4LEU A;  4GCN A;  5JJ7 A;  5G05 C;  3LYA A;  4F3V A;  4GCO A;  2J9Q A;  3E4B A;  5FT9 A;  4WUY A;  3CEQ A;  5BW8 C;  5G05 J;  4UQZ A;  4GA1 A;  4KYO B;  1ZU2 A;  3MV2 B;  4KBQ A;  1NA3 A;  4J8F A;  4H7Y A;  2AVP A;  2DBA A;  3CK7 A;  2VGX A;  3JYS A;  4NRH B;  3PDN A;  3ULQ A;  2XCB A;  4Y6W A;  3O48 A;  4NQ0 A;  2I6H A;  3CVQ A;  3NF1 A;  3Q49 B;  4WNF A;  5CCM A;  1E96 B;  2VGX B;  2BUG A;  1IYG A;  3R9A B;  3K9I A;  3TAX A;  3CK8 A;  5EKQ D;  3OXL A;  3RJV A;  2KC7 A;  2Q7F A;  2FI7 A;  4HOS A;  2QFC A;  2C2L A;  3TG4 A;  2YQ8 A;  5KJL A;  4GZ5 A;  3QWP A;  3VTX A;  2HR2 A;  1NA0 A;  4UQX A;  1QQE A;  2R5S A;  3UPV A;  5LCW C;  3OXF A;  3U4T A;  1W3B A;  3RO3 A;  5HI7 A;  3UUX A;  4BT8 A;  2VGY A;  4CDR A;  5CHE E;  4HOU A;  4I9E A;  5FZR A;  4GYY A;  5LCW J;  2XGO A;  2OND A;  2PQR A;  1WM5 A;  1OUV A;  3ASH A;  1A17 A;  3PE3 A;  4GZ6 A;  4BTA A;  3QWW A;  3RIB A;  4EQF A;  2L6J A;  4GA0 A;  1IHG A;  2WQH A;  3LPZ A;  2XEV A;  4JA9 A;  2HO1 A;  4JHR A;  4B94 A;  4JL0 A;  3IEG A;  3RKV A;  5DBK A;  3ZHE A;  4APO A;  3PE4 A;  5BNW A;  1HH8 A;  3KAE A;  4RG6 A;  3S7B A;  4YVQ C;  4YVO A;  2KCK A;  4I9C A;  1ZBP A;  2UY1 B;  1B89 A;  3ZHE B;  2LSU A;  5AYW D;  2FF4 A;  4UI9 C;  4ABN A;  2KCL A;  4I1A A;  1QZ2 A;  4G25 A;  1KLX A;  3KS2 A;  4AY5 A;  1KT1 A;  3LCA A;  2Y4T A;  4U07 A;  4UI9 J;  5KJM A;  2P58 C;  3RU0 A;  4JA7 A;  4G24 A;  2C0L A;  4WNE A;  4RG9 A;  2IF4 A;  3MA5 A;  3UQ3 A;  1NZN A;  3N71 A;  1WAO 1;  4GZ3 A;  5M72 A;  2KCV A;  5JJT A;  3QKY A;  4G1T A;  4HOR A;  4HOT A;  3LY9 A;  5CCL A;  3QWV A;  3QDN A;  4BT9 A;  4O6F A;  5FTP A;  4ME2 A;  3AS4 A;  3WXX A;  2VSN A;  3QOU A;  2YHC A;  1TJC A;  3MEK A;  4N3B A;  2XGM A;  5ARG A;  4GPK A;  4CGW A; 
#chains in the Genus database with same CATH topology
 4XIF A;  2PL2 A;  3ISM C;  4DX2 A;  3G2V A;  3AS8 A;  3CVP A;  3Q4A B;  3V30 A;  4N5C A;  1L5J A;  4O1P A;  4AY6 A;  4HRN A;  3NZU A;  3CHS A;  4UUC A;  1BU9 A;  2UWJ G;  3ZPJ A;  3ASF A;  2KAT A;  3D9O A;  1E7U A;  3FTX A;  5EX0 A;  1E90 A;  4L9P A;  4OVV A;  4W9R A;  3IHY A;  2IO3 C;  1YYH A;  4CDM A;  4L2Y A;  3MKR A;  4G23 A;  1SVX A;  3KSQ A;  4V3I A;  1U3C A;  4KZC A;  4F1S A;  1D9S A;  3HVE B;  5EX3 A;  2DYR E;  3IBE A;  2MRI A;  2IFU A;  1LD8 A;  3PRE A;  5HQ8 A;  3MKQ A;  2YHE A;  3PUK A;  4FLB A;  4GTT A;  1PAQ A;  3WG7 E;  5BPP A;  3CHQ A;  5BV1 A;  1TYQ G;  3RSE G;  4EZJ A;  2JLB A;  5T4Y A;  4F7A A;  1HU3 A;  4H7X A;  2A5U A;  2P9L G;  3ZNG A;  1OWL A;  5EN5 D;  3NZS A;  1HFA A;  2A4Z A;  4I2W A;  2FO7 A;  4AM9 A;  3RO2 A;  4FLH A;  4O1O A;  1HS6 A;  3FEY A;  1ELR A;  1N9A A;  2XHE A;  4A3V A;  3MV3 B;  4AEZ C;  2VSY A;  3S7D A;  4DX1 A;  3FWV A;  2AXU A;  2GW1 A;  2X6H A;  5B1B E;  4JHJ A;  2IY0 C;  4J8S A;  4G26 A;  4IN3 B;  4N5Q A;  4N2Q A;  2FBN A;  3Q73 A;  2Y1L E;  4HNA D;  1UOH A;  1V55 E;  3S7F A;  3C3R A;  3UIO C;  3SGH A;  3V2X A;  3PEU B;  2C0M A;  3VTY A;  4OAV B;  2YNQ A;  3FH5 A;  3FTY A;  3P1U A;  3BG0 B;  1XNF A;  5D0Q D;  3ASD A;  2VYI A;  5AQB A;  3ZFW A;  2OEV A;  4WND A;  3L22 A;  3CVL A;  3LKU A;  3FUM A;  2XEE A;  3LEW A;  4ANX A;  2DVW A;  4LRZ A;  3I5P A;  4N3A A;  2GRP B;  2PQN A;  5FIN A;  1Y8M A;  4LEU A;  4ZFH A;  3LYA A;  4GCO A;  3I3N A;  3AU5 A;  1TNU A;  1UN9 A;  5FT9 A;  1OY3 D;  3PNL B;  5JMN D;  3CEQ A;  3EU9 A;  2P9U G;  3UM2 A;  4LCT A;  1NA3 A;  4H7Y A;  1OCC E;  4TUU A;  2DZN A;  4C9B B;  4GTO A;  4PH4 B;  4NRH B;  2R17 C;  4APF A;  3QC1 A;  3T5V A;  2IJG X;  5CCM A;  3E37 A;  4B8A A;  5ANR A;  3FUH A;  2OVF A;  1FT1 A;  4BY6 A;  3SY2 A;  3T5X A;  3PNT B;  4B0Z A;  1H6P A;  2JEK A;  5CRU A;  2AJA A;  3TAX A;  4J6I A;  3ZYM A;  5EKQ D;  2H6I A;  2X6J A;  4E6H A;  1G3N B;  2KC7 A;  3KEA A;  2FI7 A;  4HOS A;  4BSX A;  3TXM A;  4U8H A;  1SQM A;  3RK6 A;  5FQ7 A;  1TNY A;  3I4G A;  3VLE A;  3JQ0 A;  3SI5 A;  5HI7 A;  3SO8 A;  3Q7F A;  4HXI A;  4RSY A;  2J07 A;  4ATZ D;  3HHM A;  5FZR A;  5AJL A;  3UI2 A;  2PQR A;  3OTN A;  5ENS D;  1OUV A;  1A17 A;  3DPY A;  4BFR A;  4I1O B;  3SFY A;  3RRU A;  3RIB A;  2XZT G;  2BF0 X;  2XEV A;  5T3R A;  2XEN A;  3MJW A;  3TWT A;  1X81 A;  5IY5 E;  3FY4 A;  3C98 A;  3JXI A;  3ZHE A;  2EIL E;  4AP2 A;  3SFZ A;  3PE4 A;  1E8Z A;  4YVQ C;  2EIK E;  5AAO A;  4YVO A;  3LJN A;  3QNK A;  1BLX B;  4TUM A;  3TJP A;  4HRL A;  3ZHE B;  1N0R A;  4HLE A;  2FF4 A;  4YDE A;  1KLX A;  2VJ8 A;  2DCP A;  3O4Z A;  4BX8 A;  3D9P A;  4ILH B;  1S0P A;  3LCA A;  1YCS B;  3APF A;  5KJM A;  5B3S E;  3ZXS A;  3RU0 A;  1EF1 C;  3MCX A;  2IO2 C;  4GMR A;  1V54 E;  2ZU6 B;  1TNZ A;  2RFA A;  2IF4 A;  2WQ7 A;  4AV7 A;  1NZN A;  3N71 A;  3PZ2 A;  4E85 A;  4OVU A;  4NUR A;  4Q96 A;  4PDX A;  4U8V D;  3R7R A;  4DUI A;  2KCV A;  1U3D A;  4HOT A;  4QFV A;  1OCZ E;  3CLJ A;  3QWV A;  3QDN A;  1UJJ A;  4WWP A;  4ME2 A;  4M7C A;  4JEH A;  3DRA A;  2OEW A;  4GZC A;  4EBA G;  2ILR A;  3WXX A;  3FUK A;  2GRL A;  4J7W A;  3J5Q B;  2YHC A;  3J5P A;  5G2N A;  3TXN A;  2WXM A;  4C48 B;  4KVM A;  2XS8 A;  2CFU A;  2XPZ A;  3LS8 A;  4GPK A;  1Z6T A;  4CGW A;  3NQP A;  4K0R A;  3BEE A;  3CGH A;  3X2Q E;  2X6K A;  2IQC A;  2R05 A;  3LVR E;  4N3C A;  4I6G A;  4UWL A;  3ASG A;  1DNP A;  2EIJ E;  1OXJ A;  2WXJ A;  3HRA A;  4WAF A;  4U96 D;  3GW4 A;  1JUQ A;  5EID A;  4BTB A;  4LNU D;  3CQC B;  1HG5 A;  1N0Q A;  3BUA A;  1KPS B;  5ARF A;  3ABM E;  2I1J A;  3CSF A;  3D9L A;  5EYL A;  3ULY A;  2MOW A;  3MZL B;  3QAR A;  4GYO A;  3PZ1 A;  4A3T A;  5EYP F;  3G2W A;  1O1R A;  1HE8 A;  4HBD A;  2MYO A;  4I2Z A;  4YND A;  3UTM A;  5KCM A;  2AXZ A;  1DCE A;  2VTB A;  2WXG A;  1OWM A;  3AG1 E;  3DST A;  2WXL A;  4UQY A;  2LUH A;  2CG2 A;  4FP7 A;  4IYP A;  3SNX A;  1MX6 A;  3CVV A;  3L82 A;  3ZYQ A;  3FUD A;  2NC9 A;  5KJK A;  2HYZ A;  3F6Q A;  4U0U A;  3TGO A;  3UT4 A;  2PZI A;  4HOQ A;  3MYV A;  3IV0 A;  3DWL G;  1H6K A;  3SF4 A;  2XPI A;  1QNF A;  4J8D A;  3GYZ A;  3LY8 A;  3C3Q A;  4A1S A;  2LAH A;  4A1G A;  1IQR A;  1HG2 A;  3UIN C;  3U3W A;  5ENT D;  2GRR B;  3ENE A;  2GGF A;  3URZ A;  2BKG A;  4KMO A;  4HLL A;  3ZW3 A;  4IRU A;  4YDY A;  4JB8 P;  4UI9 K;  3DSS A;  3ZN3 A;  5CBO A;  3Q9U C;  2LAI A;  5BXO A;  2LSV A;  3LXU X;  1UW4 B;  1PC2 A;  2YIN A;  3CVN A;  3ZUV B;  3GZS A;  3SZ7 A;  2J49 A;  2P9P G;  3ONL A;  5T8I A;  5A6C A;  3UT8 A;  4MRU A;  3CKC A;  4HI9 A;  3HVE A;  4F53 A;  4F3V A;  2WXR A;  2J9Q A;  3E4B A;  2IOL A;  3TWQ A;  1OT8 A;  4WUY A;  3TWR A;  2E0I A;  3RRN B;  4HVB A;  2ETC A;  4XX5 A;  5BW8 C;  1D8E A;  4UQZ A;  3LVQ E;  3ML9 A;  4A55 A;  2AVP A;  4U8Y D;  2BED A;  3CK7 A;  3FHE A;  3PDN A;  3SBT B;  4EZL A;  2XCB A;  2Y3A A;  1WG0 A;  3B7B A;  2QYJ A;  5CRV A;  4B8C B;  4UWK A;  1UG3 A;  3R9M A;  3R9A B;  3K9I A;  3CIA A;  3D9K A;  4K5B A;  2KZT B;  3RJV A;  2P9K G;  2NSZ A;  2Q7F A;  3TG4 A;  3BU8 A;  5KJL A;  2F8Y A;  1FPP A;  4PS7 A;  3P2B A;  3EIQ C;  4ANW A;  3UPV A;  5LCW C;  2P2C P;  4CRW A;  1AP7 A;  3U4T A;  1JWG A;  4DLQ A;  3HIZ A;  1W3B A;  3JUI A;  3UUX A;  5B1A E;  3D9J A;  4AVX A;  3E30 A;  3MX3 A;  1TN8 A;  4K5A B;  5CEA A;  2WXK A;  4U63 A;  3ASH A;  3PZ4 A;  1H2T C;  2CHW A;  4GZ6 A;  1VDY A;  3Q78 A;  4JVS A;  3QWW A;  4X8Q A;  5CED B;  5KNH D;  4EQF A;  2L6J A;  2WQH A;  4ANU A;  3B7R L;  1D8D A;  1E8W A;  3LPZ A;  3CST A;  2FO1 E;  2GRM A;  4HS2 A;  4TRQ A;  3T8M A;  3RKV A;  3ZRH A;  2IEJ A;  1HH8 A;  2XRY A;  4GTM A;  4I9C A;  1ZBP A;  2NYJ A;  5AEN A;  2UY1 B;  1B89 A;  2LSU A;  1SA5 A;  3V79 K;  4UI9 C;  4ABN A;  1MYO A;  1QZ2 A;  2F8X K;  1HO8 A;  3KS2 A;  1FVF A;  4GB9 A;  1KZO A;  3FU6 A;  2X3M A;  2CHX A;  3Q7A A;  3FH7 A;  2Y4T A;  3FU3 A;  1N94 A;  2P58 C;  2ZGG A;  4P29 A;  2C0L A;  2DIW A;  5AIJ A;  4ZHB A;  2X38 A;  3UQ3 A;  1S64 A;  4DI4 A;  1UJK A;  3AU4 A;  1QBQ A;  1WAO 1;  3PZD A;  2J09 A;  4G1T A;  1TN6 A;  3DXM G;  5JHB A;  2RD0 A;  2B0O E;  1O1T A;  5FTP A;  4FC8 A;  2VSX E;  2IU1 A;  5LP0 A;  2QZA A;  4PUC A;  2I9C A;  2WQ6 A;  5FQ6 A;  1EYH A;  1E8X A;  3MEK A;  4R7L A;  2XEH A;  2XGM A;  1N54 A;  1S63 A;  3B7U X;  1HXI A;  2KM4 A;  3AG2 E;  4XI9 A;  2OOE A;  1H0A A;  2LO6 A;  2WXQ A;  4K5C A;  5C1D A;  3C72 A;  3Q9N C;  4C0M A;  3PH0 C;  3BG1 B;  4GML A;  2GRN B;  4GPM A;  4UWH A;  4JHK A;  3FUN A;  4ATG A;  1SA4 A;  2JAB A;  5AQ9 A;  3ASN E;  3KD7 A;  3CVW A;  3EJN A;  3NOG D;  3EHN A;  3PRZ A;  2R2L A;  4RQI A;  4UWF A;  1IKN D;  4GTV A;  4G2V A;  4CT0 A;  2WB2 A;  2Y0B G;  4Q69 A;  3EIJ A;  2XPY A;  4IUL A;  3NAW A;  3HXD A;  4J0U A;  2ZIS A;  5G04 C;  2X6I A;  3Q47 B;  5C2Y A;  3LY7 A;  4CZ2 D;  1OCR E;  4YDO A;  4I17 A;  5KNG A;  2BKK B;  3ZYK A;  3CV0 A;  1N4S A;  2V4L A;  2X6F A;  1N95 A;  2F37 A;  3ESK A;  3L17 A;  1ELW A;  4AJW A;  3ONK A;  1TNO A;  3I4R B;  2WPV A;  3CVX A;  4J8E A;  3D3M A;  3OXG A;  1E8Y A;  1IQU A;  5HRY A;  4N39 A;  3GZ2 A;  5EDS A;  4Z68 A;  5CER B;  4N2S A;  5KJN A;  3ABL E;  5AAR A;  3TWS A;  4LSZ E;  2WXH A;  4O60 A;  3HDX A;  3MGB A;  5FZQ A;  2WM9 A;  4JEU A;  4HFG A;  3FU0 A;  3BQO A;  4XI0 A;  3AJI A;  5KWD A;  3T8K A;  1FT2 A;  4F1P A;  2VGE A;  3ESL A;  4M3O A;  3FTW A;  1DVP A;  2J08 A;  4WWN A;  3AS5 A;  4BWR A;  1E7V A;  3TWV A;  5ITZ F;  2Y4U A;  1NFI E;  3PZ3 A;  1NL4 A;  2WXN A;  5CMW A;  1TNB A;  1N52 A;  4DLO A;  5FJY A;  4G11 A;  1O5M A;  2FUL A;  2CFZ A;  1MQS A;  2VQ2 A;  1KT0 A;  1Z5S C;  4GYW A;  3FH8 A;  3UXG A;  2XCC A;  3CHO A;  3V2O A;  5LOZ A;  3HXE A;  1MJ0 A;  2OV8 A;  4BEP A;  4KT6 B;  3QB2 A;  5JJ7 A;  2EIN E;  3FTU A;  5G05 C;  3UM0 A;  2WXO A;  2BTD A;  5CMY A;  1GW6 A;  1OWP A;  4Q94 A;  3FUI A;  2R59 A;  3B7S A;  3SQV A;  1ELK A;  2HE0 A;  1OWO A;  4GA1 A;  4KYO B;  1TEZ A;  1ZU2 A;  4KBQ A;  2DBA A;  1BI7 B;  1MZC A;  3HXB A;  4JZY A;  3V31 A;  2VGX A;  3JYS A;  2ZIR A;  5FQ4 A;  3UKR G;  4NAC A;  4FHJ A;  4Y6W A;  3O48 A;  3HXC A;  1PY1 A;  2ZGD A;  5AQ7 A;  2VGX B;  2BUG A;  5HS0 A;  3FUJ A;  3OXL A;  3E32 A;  3EUV A;  5A23 A;  2V0P A;  4FHK A;  2NXP A;  3QAQ A;  5D66 A;  4L2L A;  1INZ A;  2DZO A;  2QFC A;  3PS6 A;  2C2L A;  1Y6I A;  1YMP A;  3QWP A;  3Q79 A;  3SD5 A;  2EQX A;  4GTR A;  3G2U A;  3UM1 A;  2XRZ A;  4UQX A;  3UKU G;  4EBA A;  3OXF A;  3U64 A;  4PS3 A;  3EHR A;  2F0Y A;  3AG4 E;  3JUE A;  1N11 A;  4BT8 A;  2VGY A;  4CDR A;  1X5B A;  4HOU A;  4I9E A;  4DX7 D;  2V5Q C;  5LCW J;  2XGO A;  2OND A;  1TN7 A;  1S70 B;  1WM5 A;  3EU5 A;  3FTV A;  4MLP A;  3ASO E;  4GA0 A;  1IHG A;  2I1K A;  4JA9 A;  2HO1 A;  4B94 A;  4JL0 A;  4KVO A;  4A63 B;  4FU3 A;  2H6G A;  4UWG A;  5DBK A;  4APO A;  3RAU A;  4ANV A;  4BET A;  1MHQ A;  4RG6 A;  1HF8 A;  3S7B A;  1N4Q A;  4I6E A;  2KCK A;  4DJA A;  3ULE G;  3DSW A;  1IHB A;  2EIM E;  3L08 A;  2KCL A;  4I1A A;  1LTX A;  4G25 A;  2PM6 A;  1IXV A;  4G8L A;  4CT4 A;  3D9M A;  4EZK A;  4AY5 A;  1KT1 A;  2KZT A;  3E33 A;  2L0T B;  4U07 A;  4UI9 J;  2J4B A;  4JA7 A;  4G24 A;  4LNG A;  2KXP C;  3FDH A;  4XE0 A;  3DSV A;  3DBS A;  4GU5 A;  3TWW A;  3B7T A;  3EHQ A;  3MKQ B;  3PVL A;  1JCS A;  5JJT A;  3DSX A;  2VSO E;  1LF8 A;  4FUL A;  4L1B A;  4K03 A;  4EPZ A;  1U2V G;  5CCL A;  2ZXW E;  2WXP A;  1K8K G;  4GTP A;  5ENN A;  4O6F A;  4J8Y A;  2VSN A;  1MX2 A;  1A5E A;  3ZXP A;  3ZU7 B;  3HXF A;  1TJC A;  4HQD A;  2P9N G;  2WMN A;  5ARG A;  3U66 A;  1Z3X A;  5KBA A;  1SZ9 A;  3Q15 A;  3PEV B;  3UIP C;  3C5R A;  5D0O D;  3U9W A;  4BES A;  5A7D B;  3TG5 A;  1OWN A;  2IOS A;  3LDZ A;  3NOC D;  1K1A A;  4CGV A;  2KBX A;  1H2V C;  2FEZ A;  3TWU A;  3CKB A;  4FA6 A;  1EDU A;  2WMO A;  3IHV A;  5EIL A;  3B95 A;  5JJ6 A;  2UY1 A;  1NP7 A;  4KZ0 A;  3ZYL A;  1FCH A;  4XEI G;  1JWF A;  1N4P A;  4U95 D;  1DC2 A;  2A5E A;  2HM8 A;  1FVH A;  2XGS A;  1P5Q A;  2AXV A;  4HRM B;  3L6A A;  3G2T A;  3GZ1 A;  1AWC B;  3ZEF A;  5ENR D;  2L9B A;  5BT1 A;  3ABK E;  2P9S G;  3AAA C;  4CEM A;  1LD7 A;  4WWO A;  2DYS E;  1SZA A;  3FEX A;  3PUJ A;  3D9N A;  2V5F A;  3W9F A;  2WXI A;  3NB2 A;  1H6O A;  3CVU A;  3EHM A;  1N4R A;  3FU5 A;  1BD8 A;  4U04 A;  3TL5 A;  2AWI A;  4FAD A;  3Q5M A;  1Q2Z A;  4TV3 A;  2GRQ B;  4I6J A;  1YA0 A;  2LXM A;  4TXQ A;  3FP3 A;  1Z3Y A;  2V4H C;  5G04 J;  1RW2 A;  2RG8 A;  2LNI A;  4KXK B;  3HYM B;  3L9T A;  2DWZ A;  1HZ4 A;  4D10 C;  2ETB A;  1JPL A;  2QYU A;  3CK9 A;  3AG3 E;  4AIF A;  2L0I A;  5HKP A;  3CHR A;  1DCQ A;  4GZD A;  3CHM A;  3IKO B;  3QJZ A;  5BV0 A;  4ILG A;  4GMJ A;  4ILI A;  1JCQ A;  4GTQ A;  5ENP D;  3UT7 A;  3FFL A;  2XZD G;  3EDT B;  2V8S E;  3KSL A;  5DIZ A;  4CCA A;  5EIB E;  5FZS A;  3ZKJ A;  2MHK A;  3FUE A;  3D9H A;  5J08 A;  4NIK A;  1KZP A;  2E2E A;  3VLD A;  5CBN A;  1OCO E;  4MKT A;  3UX4 A;  2Y69 E;  4U0Z A;  4LG6 A;  2AW6 A;  3S7J A;  2J8S D;  5BUZ A;  2GRO B;  3DPD A;  3T9K A;  4Y6C A;  4EEC A;  4U7E B;  4U0S A;  1EPU A;  1WY6 A;  4I1M A;  3JQ1 A;  3ZGQ A;  4WNG A;  4GA2 A;  4URK A;  4GCN A;  3QK0 A;  4CDN A;  4ACL A;  3Q75 A;  4PS8 A;  5ANL A;  3SBS A;  5ENQ D;  2XQ0 A;  4B89 A;  3R7Q A;  3HG0 D;  5G05 J;  4BSZ B;  3FUF A;  3MV2 B;  4J8F A;  4L7T A;  5H7P A;  4RVB A;  3ULQ A;  4XKB A;  4L23 A;  1O1S A;  4NQ0 A;  2I6H A;  3CVQ A;  3NF1 A;  1ZB1 A;  3Q49 B;  4WNF A;  2ETA A;  1H2U A;  3D9I A;  3NBN B;  1E96 B;  4YDW A;  4F6R D;  1IYG A;  4JD2 G;  4DI3 A;  2P9I G;  4G8K A;  4MBG A;  3CVY A;  5BXU A;  2CHZ A;  1BPO A;  4B93 B;  3CK8 A;  5J90 A;  1RZ4 A;  4LUN U;  3JXJ A;  3SHF A;  5LFA A;  2B6C A;  4EHM A;  5E75 A;  3G2S A;  3TWX A;  1QYM A;  4OAU C;  4ACK A;  2YQ8 A;  1JCR A;  4DPR A;  4GZ5 A;  4AOF A;  3VTX A;  2HR2 A;  4FJY A;  4GTS A;  5E76 A;  3ZVV A;  1NA0 A;  2J4D A;  1QQE A;  3CR3 A;  2R5S A;  2WXF A;  3VLF A;  4JW1 A;  3RO3 A;  3B13 A;  2CG3 A;  3APD A;  4JC8 A;  5CHE E;  1TR4 A;  2QC9 A;  4GYY A;  4XZ4 A;  3CQG B;  5CEC B;  5JHA A;  3C3O A;  3IXE A;  5G55 A;  3PE3 A;  3ML8 A;  4BTA A;  2H6H A;  2OCC E;  1XGW A;  2QY7 A;  3CHP A;  1TJF A;  4JHR A;  1K1B A;  4DK5 A;  2XS1 A;  2OVB A;  4I43 A;  1UN8 A;  4JPS A;  3IEG A;  3FTS A;  4RLY A;  3L54 A;  3RRM B;  1NI1 A;  1HX8 A;  5BNW A;  2R03 A;  5D2M C;  3KAE A;  4C0E A;  1WDY A;  3SFX A;  5AJD A;  4DX6 D;  4DRX E;  4CYM D;  5AQA A;  4TXP A;  5JA4 D;  5AYW D;  4HB5 A;  3FTZ A;  3APC A;  2ION A;  3DEP A;  4HI8 A;  4JXT A;  2I2O A;  3FUL A;  3ZIM A;  3L13 A;  4TXR A;  3DSU A;  2RFM A;  3UM3 A;  1H19 A;  2L6B A;  4MS6 A;  4GAA A;  4WNE A;  3UMV A;  4XKC A;  4FJZ A;  4RG9 A;  5LX8 A;  3MA5 A;  3OAW A;  2VTB B;  3DXK G;  3S2A A;  4BER A;  3KEZ A;  5FWQ A;  4QQI A;  5AN8 A;  2RKK A;  4OYS A;  4GZ3 A;  5M72 A;  4BX9 A;  3QKY A;  4HOR A;  5FIO A;  1SW6 A;  3LY9 A;  5FQ8 A;  1K3Z D;  3E34 A;  2PNN A;  4BT9 A;  2H6F A;  4AXH A;  1MX4 A;  2WVI A;  2LXL A;  4LER A;  3AS4 A;  3QOU A;  3LJ3 A;  2PM7 A;  1BI8 B;  3DEO A;  3W9G A;  5ENO D;  3L16 A;  4N3B A;  2R02 A;  2M63 A;  3JCK C;  4LNB A;  4DX5 D; 
#chains in the Genus database with same CATH homology
 1HXI A;  2KM4 A;  4K0R A;  4XI9 A;  4XIF A;  2PL2 A;  3BEE A;  1SZ9 A;  3Q15 A;  2OOE A;  3CGH A;  3PEV B;  1H0A A;  5D0O D;  2LO6 A;  2WXQ A;  3G2V A;  3AS8 A;  3CVP A;  3Q4A B;  4N5C A;  3U9W A;  1L5J A;  5A7D B;  1OWN A;  2IQC A;  2IOS A;  2X6K A;  3LVR E;  4N3C A;  3TG5 A;  5C1D A;  4C0M A;  4I6G A;  3LDZ A;  4UWL A;  4AY6 A;  3PH0 C;  4CGV A;  3NZU A;  3CHS A;  3ASG A;  3BG1 B;  4GML A;  1DNP A;  1H2V C;  2UWJ G;  2FEZ A;  3ZPJ A;  3ASF A;  2WXJ A;  4WAF A;  3CKB A;  2KAT A;  3GW4 A;  3D9O A;  1JUQ A;  4FA6 A;  1EDU A;  2WMO A;  3IHV A;  4UWH A;  1E7U A;  3CQC B;  5JJ6 A;  3FTX A;  4JHK A;  5EX0 A;  1E90 A;  1HG5 A;  2UY1 A;  1NP7 A;  4OVV A;  4KZ0 A;  4W9R A;  3FUN A;  4ATG A;  3IHY A;  5ARF A;  3ZYL A;  1FCH A;  1JWF A;  2I1J A;  4CDM A;  2HM8 A;  1FVH A;  2XGS A;  1P5Q A;  3CSF A;  3KD7 A;  3D9L A;  2AXV A;  2MOW A;  3MZL B;  4L2Y A;  3CVW A;  3MKR A;  3EJN A;  3QAR A;  3EHN A;  3PRZ A;  3TL5 A;  4GYO A;  3L6A A;  4G23 A;  3G2T A;  4UWF A;  3GZ1 A;  4A3T A;  4V3I A;  3ZEF A;  2L9B A;  1U3C A;  3G2W A;  5BT1 A;  4CEM A;  4G2V A;  4WWO A;  4CT0 A;  2WB2 A;  1SZA A;  3FEX A;  4KZC A;  4F1S A;  1HE8 A;  4Q69 A;  3EIJ A;  4I2Z A;  2XPY A;  3PUJ A;  3D9N A;  2V5F A;  2WXI A;  4YND A;  3CVU A;  5KCM A;  2AXZ A;  3HVE B;  4IUL A;  5EX3 A;  3EHM A;  2VTB A;  2WXG A;  3IBE A;  1OWM A;  2MRI A;  3FU5 A;  2IFU A;  4U04 A;  2WXL A;  4J0U A;  4UQY A;  3PRE A;  2AWI A;  2CG2 A;  4FP7 A;  3MKQ A;  2YHE A;  5G04 C;  4IYP A;  3SNX A;  3PUK A;  4FLB A;  5HQ8 A;  2X6I A;  3Q47 B;  5C2Y A;  1PAQ A;  3CVV A;  4FAD A;  5BPP A;  3LY7 A;  3Q5M A;  3CHQ A;  3ZYQ A;  5BV1 A;  4TV3 A;  4I6J A;  4I17 A;  1YA0 A;  3ZYK A;  3CV0 A;  3FUD A;  4EZJ A;  2JLB A;  5T4Y A;  4F7A A;  1HU3 A;  2V4L A;  2NC9 A;  2X6F A;  5KJK A;  3ESK A;  3FP3 A;  1Z3Y A;  2A5U A;  2HYZ A;  1OWL A;  4H7X A;  5G04 J;  4U0U A;  3L17 A;  3NZS A;  1ELW A;  3TGO A;  2RG8 A;  1HFA A;  2A4Z A;  2LNI A;  4KXK B;  4I2W A;  3ONK A;  3HYM B;  3UT4 A;  2PZI A;  2FO7 A;  4AJW A;  4AM9 A;  4HOQ A;  3MYV A;  3IV0 A;  3RO2 A;  4FLH A;  3I4R B;  1HZ4 A;  4D10 C;  1HS6 A;  3FEY A;  1ELR A;  1H6K A;  2XHE A;  2WPV A;  4J8E A;  2XPI A;  1QNF A;  1JPL A;  3MV3 B;  4J8D A;  3SF4 A;  3CK9 A;  4AEZ C;  2VSY A;  3GYZ A;  3D3M A;  3OXG A;  1E8Y A;  1IQU A;  2L0I A;  3LY8 A;  2LAH A;  3S7D A;  4A1S A;  4AIF A;  3CHR A;  4A1G A;  1IQR A;  1HG2 A;  3FWV A;  3U3W A;  2AXU A;  2GW1 A;  2X6H A;  4N39 A;  4GZD A;  3ENE A;  4JHJ A;  3CHM A;  3GZ2 A;  5EDS A;  2GGF A;  4J8S A;  3IKO B;  3URZ A;  4N2S A;  4KMO A;  3QJZ A;  5BV0 A;  4G26 A;  3ZW3 A;  4IN3 B;  4ILG A;  4IRU A;  4GMJ A;  4N2Q A;  2FBN A;  4ILI A;  5KJN A;  2WXH A;  3HDX A;  3UT7 A;  3FFL A;  3S7F A;  3EDT B;  4UI9 K;  3MGB A;  5FZQ A;  2V8S E;  2WM9 A;  4HFG A;  4JEU A;  5DIZ A;  3ZN3 A;  4CCA A;  3SGH A;  3FU0 A;  4XI0 A;  2LAI A;  3PEU B;  2C0M A;  3VTY A;  2LSV A;  5FZS A;  4BTB A;  2YNQ A;  3ESL A;  3FH5 A;  3FTY A;  4M3O A;  3P1U A;  2MHK A;  3BG0 B;  3FTW A;  1XNF A;  3FUE A;  1DVP A;  5D0Q D;  2J08 A;  4WWN A;  5J08 A;  3AS5 A;  4BWR A;  1E7V A;  4A3V A;  2Y4U A;  3LXU X;  2E2E A;  1UW4 B;  3VLD A;  3ASD A;  2WXN A;  1PC2 A;  2VYI A;  4MKT A;  5CMW A;  1N52 A;  4DLO A;  3ZFW A;  5FJY A;  4WND A;  3UX4 A;  4G11 A;  4U0Z A;  3L22 A;  2YIN A;  3CVL A;  2AW6 A;  3S7J A;  2FUL A;  5BUZ A;  3LKU A;  3FUM A;  3CVN A;  2CFZ A;  1MQS A;  2VQ2 A;  3LEW A;  1KT0 A;  4ANX A;  3GZS A;  3DPD A;  4LRZ A;  3SZ7 A;  4Y6C A;  2J49 A;  3ONL A;  4EEC A;  3I5P A;  4U0S A;  4GYW A;  3FH8 A;  4N3A A;  2XCC A;  3CHO A;  5T8I A;  2PQN A;  5A6C A;  5LOZ A;  3UT8 A;  4MRU A;  1EPU A;  2OV8 A;  1WY6 A;  4I1M A;  1Y8M A;  3JQ1 A;  3ZGQ A;  4WNG A;  3CKC A;  4KT6 B;  4GA2 A;  3HVE A;  3QB2 A;  4GCN A;  4LEU A;  4URK A;  5JJ7 A;  3QK0 A;  4CDN A;  4ACL A;  4F53 A;  3FTU A;  5G05 C;  2WXO A;  3LYA A;  2BTD A;  5CMY A;  4F3V A;  2WXR A;  1GW6 A;  4PS8 A;  4GCO A;  2J9Q A;  3I3N A;  3AU5 A;  1OWP A;  4Q94 A;  3E4B A;  5ANL A;  3FUI A;  2IOL A;  3SBS A;  1UN9 A;  5FT9 A;  4WUY A;  2R59 A;  2E0I A;  3PNL B;  3B7S A;  2XQ0 A;  3RRN B;  4B89 A;  3CEQ A;  1ELK A;  1OWO A;  4HVB A;  4XX5 A;  3R7Q A;  5BW8 C;  5G05 J;  4UQZ A;  4GA1 A;  4KYO B;  1TEZ A;  1ZU2 A;  3FUF A;  3MV2 B;  3LVQ E;  4KBQ A;  3ML9 A;  4LCT A;  1NA3 A;  4J8F A;  4A55 A;  4H7Y A;  4L7T A;  2AVP A;  4TUU A;  2DBA A;  4JZY A;  4C9B B;  3CK7 A;  2VGX A;  3JYS A;  3FHE A;  4PH4 B;  4NRH B;  4RVB A;  5FQ4 A;  3PDN A;  2R17 C;  4NAC A;  3SBT B;  3ULQ A;  4FHJ A;  4APF A;  4EZL A;  2XCB A;  3QC1 A;  4XKB A;  2Y3A A;  4L23 A;  4Y6W A;  3T5V A;  3O48 A;  4NQ0 A;  2I6H A;  3CVQ A;  3NF1 A;  1PY1 A;  3Q49 B;  4WNF A;  2IJG X;  4B8C B;  5CCM A;  4B8A A;  5ANR A;  1H2U A;  3FUH A;  2OVF A;  4BY6 A;  3D9I A;  1E96 B;  2VGX B;  4UWK A;  1UG3 A;  2BUG A;  1IYG A;  3T5X A;  4DI3 A;  3FUJ A;  3PNT B;  4B0Z A;  3R9A B;  2JEK A;  3CVY A;  3K9I A;  3CIA A;  2CHZ A;  1BPO A;  3TAX A;  3CK8 A;  4J6I A;  5J90 A;  3ZYM A;  5EKQ D;  2X6J A;  3D9K A;  2KZT B;  3OXL A;  3RJV A;  4LUN U;  4E6H A;  3SHF A;  2NSZ A;  5A23 A;  2V0P A;  5LFA A;  2KC7 A;  2Q7F A;  2NXP A;  4FHK A;  3QAQ A;  5E75 A;  3G2S A;  4L2L A;  2FI7 A;  4HOS A;  1INZ A;  2QFC A;  4BSX A;  3PS6 A;  2C2L A;  3TG4 A;  3TXM A;  1Y6I A;  4ACK A;  2YQ8 A;  4DPR A;  5KJL A;  4GZ5 A;  3QWP A;  3SD5 A;  4AOF A;  3VTX A;  2EQX A;  2HR2 A;  3G2U A;  4FJY A;  4PS7 A;  5E76 A;  3P2B A;  2XRZ A;  3ZVV A;  1NA0 A;  2J4D A;  4UQX A;  1QQE A;  4U8H A;  3CR3 A;  2R5S A;  2WXF A;  3EIQ C;  1SQM A;  3VLF A;  3RK6 A;  4ANW A;  4EBA A;  3UPV A;  5LCW C;  3OXF A;  5FQ7 A;  3I4G A;  3U64 A;  3VLE A;  4PS3 A;  4CRW A;  3JQ0 A;  3U4T A;  1JWG A;  4JW1 A;  4DLQ A;  3SI5 A;  3HIZ A;  1W3B A;  3RO3 A;  5HI7 A;  4HXI A;  3B13 A;  3JUI A;  2CG3 A;  3APD A;  3UUX A;  4JC8 A;  4RSY A;  4BT8 A;  2J07 A;  2VGY A;  4CDR A;  3D9J A;  4AVX A;  1X5B A;  4HOU A;  3HHM A;  5CHE E;  4I9E A;  3MX3 A;  5FZR A;  4GYY A;  3B7U X;  5AJL A;  4XZ4 A;  3CQG B;  2XGO A;  2WXK A;  5JHA A;  5LCW J;  2OND A;  4U63 A;  2PQR A;  1WM5 A;  3OTN A;  1OUV A;  5G55 A;  3ASH A;  1A17 A;  1H2T C;  3PE3 A;  3FTV A;  3ML8 A;  2CHW A;  4GZ6 A;  1VDY A;  4JVS A;  4BTA A;  3QWW A;  4BFR A;  4I1O B;  4MLP A;  3RRU A;  3RIB A;  4EQF A;  2L6J A;  4GA0 A;  1IHG A;  2WQH A;  4ANU A;  3B7R L;  2I1K A;  1XGW A;  2BF0 X;  2QY7 A;  1E8W A;  2XEV A;  1TJF A;  3CHP A;  2HO1 A;  3LPZ A;  3CST A;  4JA9 A;  4JHR A;  5T3R A;  4B94 A;  4JL0 A;  4DK5 A;  2OVB A;  4KVO A;  4I43 A;  1UN8 A;  2GRM A;  3MJW A;  4HS2 A;  4JPS A;  3IEG A;  3FTS A;  4FU3 A;  3FY4 A;  4TRQ A;  3RKV A;  3T8M A;  3ZRH A;  3C98 A;  4UWG A;  3L54 A;  5DBK A;  3ZHE A;  3RRM B;  1HX8 A;  4APO A;  4AP2 A;  3SFZ A;  3PE4 A;  5BNW A;  4ANV A;  1HH8 A;  2XRY A;  3KAE A;  4C0E A;  1MHQ A;  4RG6 A;  1HF8 A;  1E8Z A;  4YVQ C;  3S7B A;  4I6E A;  4YVO A;  2KCK A;  4I9C A;  4DJA A;  1ZBP A;  5AJD A;  5AEN A;  2UY1 B;  1B89 A;  3QNK A;  3CVX A;  3TJP A;  3ZHE B;  2LSU A;  5AYW D;  4HLE A;  2FF4 A;  4UI9 C;  3L08 A;  4ABN A;  2KCL A;  4I1A A;  1QZ2 A;  4G25 A;  1KLX A;  2VJ8 A;  2DCP A;  3FTZ A;  2PM6 A;  3APC A;  2ION A;  3O4Z A;  1HO8 A;  4CT4 A;  3D9M A;  4JXT A;  3KS2 A;  3D9P A;  4BX8 A;  1FVF A;  2I2O A;  4EZK A;  3FUL A;  4GB9 A;  4ILH B;  4AY5 A;  1KT1 A;  1S0P A;  2KZT A;  3FU6 A;  2X3M A;  3LCA A;  3ZIM A;  3APF A;  2CHX A;  3L13 A;  3FH7 A;  2L0T B;  2Y4T A;  3FU3 A;  4U07 A;  4UI9 J;  5KJM A;  2J4B A;  2P58 C;  3ZXS A;  3RU0 A;  4JA7 A;  1EF1 C;  1H19 A;  3MCX A;  4G24 A;  4P29 A;  2C0L A;  4MS6 A;  4GAA A;  4WNE A;  3UMV A;  4XKC A;  2DIW A;  4FJZ A;  2ZU6 B;  3FDH A;  5AIJ A;  4RG9 A;  4XE0 A;  2X38 A;  2IF4 A;  5LX8 A;  3MA5 A;  3OAW A;  3UQ3 A;  4AV7 A;  1NZN A;  3N71 A;  4DI4 A;  4E85 A;  3DBS A;  2WQ7 A;  2VTB B;  4OVU A;  3S2A A;  4NUR A;  1UJK A;  4Q96 A;  3KEZ A;  4GU5 A;  3B7T A;  5FWQ A;  3AU4 A;  4PDX A;  3MKQ B;  3R7R A;  3PVL A;  4OYS A;  1WAO 1;  3PZD A;  2J09 A;  4GZ3 A;  5M72 A;  2KCV A;  4BX9 A;  5JJT A;  3QKY A;  2VSO E;  4G1T A;  1LF8 A;  1U3D A;  4HOR A;  4HOT A;  4QFV A;  5JHB A;  3LY9 A;  4FUL A;  4L1B A;  5FQ8 A;  4K03 A;  4EPZ A;  3CLJ A;  5CCL A;  3QWV A;  3QDN A;  2RD0 A;  4BT9 A;  2WXP A;  1UJJ A;  4WWP A;  5ENN A;  4FC8 A;  4O6F A;  5FTP A;  4ME2 A;  4AXH A;  2WVI A;  4JEH A;  2VSX E;  4GZC A;  4LER A;  4EBA G;  2IU1 A;  2ILR A;  3AS4 A;  3WXX A;  2VSN A;  3QOU A;  5LP0 A;  3FUK A;  2GRL A;  3LJ3 A;  2PM7 A;  4PUC A;  2I9C A;  2YHC A;  2WQ6 A;  5FQ6 A;  5G2N A;  3TXN A;  1EYH A;  2WXM A;  1E8X A;  1TJC A;  3L16 A;  3MEK A;  4N3B A;  4KVM A;  2CFU A;  4R7L A;  2XPZ A;  2XGM A;  1N54 A;  2WMN A;  3LS8 A;  5ARG A;  3U66 A;  4GPK A;  2M63 A;  1Z6T A;  3JCK C;  3NQP A;  4CGW A;  1Z3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...