5BXUA

Human tankyrase-2 in complex with macrocyclised extended peptide cp4n4m5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
b'GSGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Human Tankyrase-2 in Complex with Extended Stapled Peptide sp4n4m5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 50
structure length 163
sequence length 163
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5bxuA00
4DUIA 4A63B 1IHBA 4G8KA 4F6RD 2NYJA 5CBNA 3HG0D 5HKPA 4BETA 4CYMD 1MX4A 3V30A 5BXUA 1N11A 5ENOD 1UOHA 3NOGD 3ZKJA 4C48B 4DX1A 3IXEA 2B0OE 4K5AB 4U96D 3TWSA 4OAVB 3V31A 1YCSB 4U8VD 5EIBE 4J8YA 3KEAA 4QFVA 1QYMA 3EHQA 3T9KA 2Y1LE 1TR4A 2XEHA 1BU9A 5ENQD 5CBOA 2Y0BG 4G8LA 3V2OA 5D66A 3ZUVB 3UXGA 4BSZB 2PNNA 3UTMA 4CZ2D 3TWTA 3J5PA 2L6BA 1N0QA 4YDWA 2VGEA 2JABA 4RLYA 3DEOA 3J5QB 4ZHBA 4UUCA 2XENA 4N5QA 1K1AA 5AARA 3Q9NC 2XEEA 4HNAD 4QQIA 3AAAC 5EILA 2DWZA 2AJAA 4BESA 4LG6A 5EYPF 3W9FA 5BXOA 2F8XK 3Q9UC 2XZDG 4HB5A 5ENPD 3TWVA 1AWCB 1A5EA 1G3NB 5KBAA 2P2CP 1IKND 5CEDB 4U95D 3TWXA 3C5RA 2MYOA 4OAUC 3HRAA 4LSZE 2RFMA 2DVWA 5AQ9A 4DRXE 5JMND 2RFAA 1IXVA 2J8SD 1WDYA 1YYHA 4HBDA 4HLLA 3ZNGA 3NBNB 1K1BA 1MYOA 4K5BA 5KNGA 1MX6A 4DX5D 1MX2A 1S70B 5HS0A 5KNHD 2ETBA 4DX2A 3V2XA 5AN8A 5KWDA 2KXPC 3AJIA 3B7BA 3V79K 5ENTD 2F37A 2ZGDA 3TWRA 2QYJA 5CERB 4TUMA 4J7WA 4HRMB 2HE0A 3TWWA 4B93B 1D9SA 4BEPA 5FINA 4GMRA 4O60A 3TWQA 5ENRD 4HI8A 4F1PA 4BERA 1BI8B 5CEAA 3SO8A 3TWUA 4ZFHA 1SVXA 1AP7A 1NFIE 4HQDA 4HRLA 4O1OA 2QC9A 3D9HA 1BLXB 1DCQA 3UI2A 5ITZF 2FO1E 5AQAA 2ETCA 2V4HC 3T8KA 3F6QA 1MJ0A 3ZU7B 2KBXA 3JXJA 3EHRA 2F8YA 4YDYA 5AAOA 5EN5D 3JUEA 3JXIA 2BKGA 4NIKA 2ZGGA 5FIOA 5HRYA 2V5QC 1N0RA 1BI7B 1WG0A 4HRNA 5AQBA 3DEPA 1DC2A 1BD8A 2BKKB 4JB8P 4K5CA 4LNUD 4ATZD 3EU9A 1OT8A 2DZNA 4GPMA 5EIDA 5JA4D 4O1PA 4U8YD 3W9GA 5ENSD 1YMPA 4DX6D 4Z68A 2DZOA 5AQ7A 5CECB 2ETAA 1OY3D 2XZTG 1SW6A 3NOCD 4DX7D 3LJNA 2A5EA 3B95A 5EYLA 4HI9A 1K3ZD
chains in the Genus database with same CATH superfamily
4DUIA 3U3WA 3D9JA 5AYWD 3UKRG 4BT9A 2CFZA 2X3MA 4MS6A 4YNDA 3DSXA 5LFAA 3QOUA 1TR4A 4G26A 4JHKA 2UWJG 4G8LA 1N0QA 1H2VC 5CHEE 3J5QB 4G24A 4L2YA 1TN8A 4G11A 5AARA 4ATGA 1NI1A 2WXGA 2Y4TA 4F3VA 3HXCA 1A5EA 5G05C 2WXIA 2MYOA 2VSYA 2WB2A 3KSLA 1N4QA 1OWMA 3RO3A 1IXVA 2J8SD 4BWRA 4EPZA 2X38A 2VGYA 3SNXA 1V55E 3V2XA 4F53A 4U0ZA 5AN8A 2RKKA 3MV3B 3NZUA 5DBKA 3TWWA 4FADA 3ABKE 3QKYA 3OXFA 4F1PA 4C0EA 4UI9K 3AU4A 5JJTA 1DVPA 4PDXA 2YINA 4GA1A 3ZHEB 4UWFA 1TNBA 4H7YA 5KJMA 4GYWA 1RW2A 1TEZA 4L1BA 3JXJA 4PS3A 4F7AA 2ZGGA 4CT0A 3MGBA 1BI7B 3DEPA 3ZFWA 4J8DA 2OV8A 2GRLA 1X5BA 4Z68A 2XCCA 2DZOA 3FH8A 3HVEB 4GA2A 3BG1B 1NL4A 3HG0D 5EX3A 3UUXA 2E0IA 1H6PA 5T8IA 4C48B 4FA6A 3TWSA 1HFAA 2XEHA 2VGXA 2QYUA 4AVXA 3J5PA 3OTNA 2VGEA 2XS8A 4UUCA 2XENA 3Q9NC 2XEEA 3L9TA 5EILA 2YHCA 4HS2A 2P9LG 1HS6A 3PREA 3I4RB 3GZ2A 1Z5SC 3AG2E 3EUVA 3QNKA 5H7PA 3IBEA 2WMNA 3MKRA 4RG9A 3UM0A 1UJKA 3E30A 3TWQA 4UI9J 2YHEA 3B7UX 3UQ3A 2OEVA 2QY7A 3DSSA 4P29A 3CK9A 4UQYA 3BG0B 1BLXB 5ITZF 5LCWJ 3ULEG 2V4HC 2R59A 2X6HA 3CGHA 3PH0C 4M3OA 3Q5MA 1YMPA 3QC1A 3LJNA 3RO2A 1S63A 3PE3A 1IHBA 5BW8C 2L0IA 2L9BA 3Q47B 3CVNA 3HXEA 1JCQA 3CSFA 3WXXA 4U0UA 5JJ6A 5T3RA 3UTMA 4HFGA 4KBQA 1ELKA 3CVYA 3AU5A 3DEOA 5BT1A 4N5QA 3ZXPA 4XE0A 4AV7A 4AEZC 4BESA 4APFA 4A1GA 2LSUA 2P9NG 3C5RA 4EECA 3HRAA 3CVXA 2C0LA 2EINE 1LTXA 1SA5A 2LAHA 4FHKA 3JYSA 3CHOA 1MYOA 4GYOA 1E7VA 1S70B 4DX2A 2KXPC 1JCRA 3CHSA 2PQRA 4GZ3A 2QYJA 4OYSA 2DYRE 5FINA 5G05J 5CEAA 4ACKA 4ILHB 4BSXA 4Q94A 4HQDA 3EIQC 3SD5A 4KYOB 3E34A 1TNUA 1UJJA 3R9MA 4N3CA 3JXIA 3UPVA 2P58C 3LS8A 3DRAA 1P5QA 3EU9A 1Y6IA 2VTBA 2I2OA 1LD8A 4WWOA 3CK7A 4I43A 4A63B 4G8KA 3ZW3A 4CYMD 5BV1A 5IY5E 1FVFA 2WXFA 1IQUA 3KEAA 1BU9A 1EDUA 1FPPA 3UX4A 4I1OB 2EILE 2IFUA 1TJCA 1PY1A 4XKBA 5LP0A 3JQ1A 4CDMA 3T5VA 3L16A 3Q78A 2V8SE 4JD2G 2YQ8A 4GZCA 2DVWA 4LCTA 1SA4A 3PDNA 3ASDA 1H2TC 5G04J 1GW6A 3RIBA 4BFRA 2LSVA 2ETBA 3ZPJA 1INZA 1SQMA 1FT2A 5D0QD 2KZTA 4B93B 2IO2C 2AXVA 3HIZA 3D9MA 4H7XA 3SQVA 2IU1A 3E32A 4J0UA 3LVQE 1E8WA 3DXMG 5ENNA 4FLBA 2NSZA 2CHWA 4WUYA 3L82A 3LY8A 4YVQC 1WAO1 4LERA 2BKKB 4K5CA 5CMYA 1FCHA 3BUAA 2GGFA 4YDEA 2XGSA 4B94A 2EIME 2Y3AA 3MZLB 3K9IA 3PRZA 3Q4AB 5C1DA 1MX4A 1TN7A 5BXUA 4MLPA 5ENOD 1UOHA 4CEMA 3I4GA 3MYVA 2VTBB 5ENQD 3RRNB 2R02A 3G2VA 2LNIA 1XNFA 2VQ2A 2RD0A 3FUNA 4NACA 1KT0A 1OCOE 1VDYA 4GCNA 3OXGA 5EX0A 2WXKA 3FULA 4OAUC 4CRWA 2L0TB 3ULQA 3O4ZA 2WXJA 3ZNGA 3NBNB 5FQ4A 3RKVA 1N54A 4DX5D 3GZ1A 2ZGDA 5CRVA 3CVVA 2KCVA 2L6JA 4WWPA 3PNLB 1B89A 4ANUA 2QC9A 3ZHEA 2R5SA 3SY2A 4JA7A 5BPPA 1D8EA 4JL0A 2OVFA 3TXMA 3NAWA 4N3BA 1N0RA 2KZTB 3CVUA 3IEGA 4KVMA 1L5JA 1K8KG 1OT8A 3DWLG 5JA4D 1JWGA 2WMOA 3ULYA 3S2AA 3LY9A 1N4PA 3CIAA 3HVEA 3SHFA 4F6RD 5CBNA 1X81A 3FTSA 3ISMC 3EU5A 4L9PA 4CT4A 5AJDA 3RRMB 2Y1LE 2IQCA 2V4LA 4K03A 2CFUA 3TGOA 3FDHA 3GZSA 2L6BA 4ACLA 1ZU2A 1OWOA 4LEUA 5ANLA 3FP3A 2J4DA 2F8XK 4URKA 5HQ8A 4ILGA 3LCAA 3S7FA 3FU5A 4A3TA 2EIKE 4FHJA 4GA0A 4HORA 2DCPA 4GZ5A 4RG6A 1YYHA 1MX2A 5KNHD 4LNBA 4GB9A 4BY6A 3AG4E 1QZ2A 4XEIG 3FUHA 4XX5A 2HE0A 2ZXWE 4O60A 4OVVA 4GCOA 2LAIA 3FTWA 3LY7A 4DK5A 2P9KG 1NFIE 2FF4A 2FO1E 1Z6TA 3ASNE 4U8HA 4U0SA 2IJGX 5KJNA 2JEKA 1A17A 2LO6A 3Q49B 1JWFA 3C98A 2X6KA 1ELWA 2V5FA 3L22A 3QB2A 1BD8A 1BPOA 4C0MA 2C2LA 2H6FA 1EF1C 3CVLA 4RSYA 3NOCD 3B95A 4TXQA 1N94A 2PZIA 1IQRA 4UWGA 4K0RA 1XGWA 3ZKJA 3MX3A 4K5AB 3V31A 3B7SA 1LF8A 1HO8A 3TWTA 1HX8A 2VSNA 4GTSA 2PL2A 3EJNA 5BXOA 4LG6A 3FH5A 4HB5A 3TWXA 4GTPA 4Y6CA 2I1KA 4I17A 1ZBPA 3ASOE 2AW6A 3VLFA 2I6HA 2OEWA 4JHRA 4FJYA 2KC7A 3EIJA 4K5BA 5FWQA 3SBSA 5EKQD 2BTDA 1KLXA 2UY1B 5FQ6A 5ARFA 1OCRE 3FHEA 5KJLA 4CDRA 5A6CA 4HRLA 2I1JA 1N4SA 3ESLA 4U7EB 4IN3B 2NC9A 2ETCA 3C3QA 2CG2A 5AAOA 3T8MA 3BU8A 3CVQA 4LNUD 4GPMA 3U9WA 2LXMA 3NQPA 3R9AB 3HXFA 3D9PA 4GMLA 2WQ6A 3ML8A 2GRRB 3MEKA 4RVBA 2BF0X 4TUUA 2WXNA 2DBAA 5KJKA 3CR3A 3CKCA 1IHGA 2WXHA 2QZAA 4CCAA 2FI7A 1O5MA 2WM9A 4X8QA 3BEEA 2J4BA 2J9QA 3UIOC 2GRNB 3D9NA 3L08A 1DCEA 3ZYQA 3Q7AA 4PUCA 3UM1A 4HNAD 2CHZA 2IOSA 2HR2A 3ML9A 4ME2A 2Y69E 3SZ7A 3Q73A 2X6JA 4U95D 2I9CA 4I6GA 3BQOA 3LJ3A 2XGOA 4GTVA 1FVHA 1EYHA 3IHYA 3D9KA 2Y4UA 5ANRA 2GRMA 4ILIA 4B8CB 4TUMA 4F1SA 4J7WA 4GMJA 2XEVA 2VSOE 3Q75A 3PZ3A 2J09A 2IOLA 1MHQA 4JVSA 3C3OA 4G23A 4M7CA 1O1RA 4WNGA 1KT1A 1TNYA 3P1UA 3ZU7B 5JHBA 3EHRA 3ABME 4I2ZA 4GTRA 3UM3A 1HXIA 3TG5A 3S7DA 2QFCA 2F0YA 5EYLA 2HM8A 4HI9A 4ANWA 2X6IA 3DSUA 3PUKA 3SFXA 1N11A 3HHMA 4C9BB 4HVBA 3UT8A 4XKCA 2XS1A 2GRPB 3PNTB 4BSZB 2IEJA 3RK6A 1H6OA 3VLEA 2IY0C 4AM9A 2MRIA 1S0PA 4QQIA 4DLOA 3Q9UC 3RJVA 2XZDG 3FUEA 4L23A 1AWCB 5KBAA 3LPZA 3PEVB 2H6GA 2RFMA 5EDSA 1WM5A 5M72A 3FFLA 2P9PG 3ZEFA 3FTZA 2LXLA 5B1BE 1UW4B 3OXLA 4AP2A 3TJPA 1D9SA 3KAEA 3DXKG 3FU6A 4NRHB 4BERA 3UINC 4I1AA 4J6IA 4ZFHA 3ZYKA 2EQXA 4O1OA 4KT6B 2EIJE 3G2TA 4EZJA 3FTUA 5AQAA 4JPSA 3VTXA 2F8YA 4BX9A 3JUEA 5FIOA 3DSVA 1W3BA 4WNEA 3RAUA 4ATZD 5C2YA 1KZPA 3NZSA 3EHNA 3CK8A 5E75A 5A7DB 3UKUG 4L7TA 4TV3A 3ZYMA 2R2LA 2GROB 3L54A 3ZVVA 3C3RA 5HKPA 4JEUA 4FU3A 3V30A 4JEHA 4J8SA 3NOGD 4D10C 2XHEA 2XRZA 3CHRA 3FWVA 4QFVA 4LUNU 4CGVA 2J49A 5FQ8A 4YDOA 1N95A 3C72A 4HOQA 5J90A 4RLYA 3ZIMA 3FTXA 4EZLA 4UWKA 3QJZA 4G1TA 3G2UA 5EYPF 3DSTA 4GZ6A 1IKND 1O1TA 3O48A 1U3DA 1HZ4A 4AIFA 4J8FA 1RZ4A 2KATA 5HS0A 3CHMA 4GU5A 3KD7A 1WY6A 4BTAA 3RU0A 5CERB 5BUZA 1TJFA 3U4TA 3UIPC 4LRZA 3S7BA 1E8ZA 3X2QE 1D8DA 2HO1A 1N9AA 3CVPA 3LKUA 2WQ7A 1DCQA 3UI2A 2ILRA 1MJ0A 3QARA 5HRYA 4KMOA 1UN8A 3ABLE 4IRUA 3TG4A 4HRNA 1MZCA 4GZDA 5AQBA 2XQ0A 3IHVA 3CEQA 5FZQA 2IF4A 2OVBA 4I9CA 4DX7D 1NP7A 4GAAA 4G2VA 4APOA 3CSTA 3PEUB 1H6KA 5LX8A 3FUFA 3PVLA 3ASHA 2B0OE 3ESKA 1YCSB 3JUIA 4UI9C 3T9KA 2WPVA 5LCWC 3VTYA 3ONKA 4HOSA 1HG2A 3W9FA 1O1SA 2BEDA 1Z3YA 2KCLA 3L17A 3FH7A 5D0OD 4DRXE 3IV0A 1HU3A 4JXTA 5KWDA 4HOUA 4MKTA 4TRQA 5ENTD 1TN6A 3CQGB 1MQSA 2UY1A 2AXZA 4XI9A 3UT4A 4RQIA 4TXRA 1HE8A 1SZ9A 3TWUA 1U2VG 4FJZA 4GTQA 4R7LA 4GTOA 4ANXA 3R7QA 4J8EA 2CHXA 3FUJA 2WXMA 3B7RL 3QK0A 2DZNA 2WQHA 4HLEA 3ONLA 1HH8A 2H6IA 4DPRA 4L2LA 1K3ZD 2NYJA 4N5CA 4BETA 3IXEA 4DI3A 4OAVB 5AENA 3UM2A 1QYMA 1TNZA 2PM6A 2YNQA 3KEZA 2Y0BG 3CKBA 4O6FA 3FEYA 4U04A 2PNNA 1KPSB 1DNPA 2GW1A 4XI0A 4DLQA 3ENEA 3PZDA 3TL5A 3RRUA 3D3MA 2ZIRA 5LOZA 4E85A 4I6JA 3NB2A 5AQ9A 5CCMA 1UN9A 5JMND 2RFAA 2DIWA 1HG5A 2MOWA 2P9UG 4PS7A 1MX6A 1HF8A 2PM7A 4EZKA 2C0MA 4WAFA 3B7BA 3TWRA 4DJAA 2J08A 5BNWA 4GTTA 4KZ0A 4GMRA 4AOFA 5ENRD 3B13A 2FBNA 5AIJA 1QQEA 4PS8A 1SZAA 3DSWA 2OCCE 5FTPA 3D9IA 4NIKA 1QBQA 3NF1A 1E8YA 2V5QC 3ZXSA 4HOTA 3FTVA 4FC8A 2M63A 5EIDA 3B7TA 2CG3A 5G04C 5CECB 2ETAA 3CQCB 2A5EA 4MBGA 3GW4A 3SFZA 5B3SE 3SFYA 3DPDA 3MCXA 4UWHA 4I6EA 5E76A 4AJWA 4U8VD 4J8YA 4KVOA 2WXRA 5D66A 2WXLA 5FZRA 4CZ2D 3QWPA 3ZGQA 2HYZA 1OWNA 4E6HA 2XGMA 2BUGA 2AJAA 2ZISA 4N39A 3MKQA 3TWVA 3AS8A 2P2CP 5G55A 3IKOB 2AWIA 5CEDB 4N2SA 4N3AA 1S64A 3FY4A 5G2NA 5FZSA 1WDYA 2R03A 4JW1A 3PE4A 5FJYA 3VLDA 3ZRHA 3AG3E 3KSQA 5CMWA 1FT1A 3HDXA 2OOEA 5FT9A 4AY5A 2X6FA 4HRMB 4G25A 2R05A 3HXDA 3DPYA 3G2SA 2V0PA 3APFA 3FUIA 4W9RA 2FULA 2R17C 1Z3XA 3RSEG 3R7RA 5B1AE 1U3CA 3D9HA 4YVOA 4KZCA 5A23A 4EQFA 4YDYA 5EN5D 3U64A 2BKGA 4V3IA 3Q15A 4A55A 4EBAG 4AY6A 1E90A 4JZYA 3W9GA 5ENSD 4ABNA 2XZTG 1OXJA 5CRUA 4I1MA 5CCLA 3JCKC 5T4YA 3E4BA 2AVPA 1Y8MA 3JQ0A 2GRQB 4TXPA 2VGXB 1UG3A 1ELRA 4IULA 3CHPA 3PZ1A 4MRUA 2Q7FA 2WXQA 2AXUA 3FUDA 3PUJA 3EHMA 5J08A 4ZHBA 3QWVA 4XIFA 3Q7FA 3AAAC 2DWZA 2IONA 3MA5A 4GYYA 3CVWA 5HI7A 3S7JA 3D9OA 3LEWA 3PZ2A 3OAWA 4DI4A 3I5PA 4N2QA 4HBDA 1K1BA 5JJ7A 5DIZA 2B6CA 3V79K 3MKQB 4BTBA 2KM4A 4NURA 3DBSA 3QDNA 4WWNA 1BI8B 3UT7A 2A4ZA 1AP7A 5D2MC 3LDZA 3TAXA 4B8AA 1E7UA 1WG0A 1N4RA 4WNDA 1N52A 4JB8P 3GYZA 4I2WA 2H6HA 4B89A 4O1PA 1H0AA 5AQ7A 4WNFA 4IYPA 1OY3D 1SW6A 4KXKB 2XCBA 3E33A 1TNOA 1EPUA 3QAQA 4DX1A 4U96D 3D9LA 5EIBE 3FU3A 4Q96A 3EHQA 2A5UA 3U66A 3V2OA 3ZUVB 1E96B 3UXGA 2E2EA 3APDA 4UQXA 5AJLA 4A3VA 2VJ8A 4YDWA 3SI5A 2JABA 5JHAA 3ASFA 1K1AA 4XZ4A 2XPIA 4Y6WA 5ENPD 3HXBA 4UWLA 3HYMB 2VYIA 1OWLA 2FEZA 3SF4A 3SBTB 1QNFA 1LD7A 3WG7E 2ONDA 2ZU6B 2XRYA 3FUMA 3PS6A 1OWPA 1ZB1A 3QWWA 4CDNA 1KZOA 2F37A 3FUKA 3LXUX 3URZA 3Q79A 1IYGA 1PC2A 3CLJA 1JPLA 4BT8A 4BEPA 4BX8A 2P9SG 5ARGA 3I3NA 4HXIA 4LNGA 3SO8A 3TXNA 4OVUA 5BV0A 3AS5A 2KCKA 3T8KA 3AS4A 3AG1E 2PQNA 3UMVA 4ANVA 3MJWA 5KCMA 3APCA 2WXOA 2MHKA 2FO7A 4U8YD 1H19A 4B0ZA 1NA3A 2NXPA 1H2UA 4U63A 2XPYA 2LUHA 1TYQG 2WVIA 1NA0A 3LYAA 2VSXE 3FU0A 4JA9A 4FLHA 4GTMA 5CBOA 4UQZA 1JCSA 4Q69A 3SGHA 4CGWA 4JHJA 4GPKA 1Q2ZA 3EDTB 2XPZA 1V54E 3ASGA 3ZYLA 1OCCE 2RG8A 3T5XA 4I9EA 4JC8A 1E8XA 1G3NB 3CV0A 3FEXA 3N71A 2WXPA 4LSZE 3L13A 3LVRE 2JLBA 4EHMA 5KNGA 4A1SA 1OCZE 3MV2B 3AJIA 4AXHA 2P9IG 2IO3C 3CHQA 3L6AA 1NZNA 4HI8A 1YA0A 4PH4B 3P2BA 3FTYA 5FQ7A 1SVXA 3G2WA 3PZ4A 4FULA 3F6QA 2KBXA 3KS2A 1JUQA 4NQ0A 2J07A 1DC2A 3E37A 4FP7A 1OUVA 4DX6D 4EBAA 4U07A 3ZN3A 2DYSE 4HLLA 1PAQA
chains in the Genus database with same CATH topology
4DUIA 4A63B 1IHBA 4G8KA 4F6RD 2NYJA 5CBNA 3HG0D 5HKPA 4BETA 4CYMD 1MX4A 3V30A 5BXUA 1N11A 5ENOD 1UOHA 3NOGD 3ZKJA 4C48B 4DX1A 3IXEA 2B0OE 4K5AB 4U96D 3TWSA 4OAVB 3V31A 1YCSB 4U8VD 5EIBE 4J8YA 3KEAA 4QFVA 1QYMA 3EHQA 3T9KA 2Y1LE 1TR4A 2XEHA 1BU9A 5ENQD 5CBOA 2Y0BG 4G8LA 3V2OA 5D66A 3ZUVB 3UXGA 4BSZB 2PNNA 3UTMA 4CZ2D 3TWTA 3J5PA 2L6BA 1N0QA 4YDWA 2VGEA 2JABA 4RLYA 3DEOA 3J5QB 4ZHBA 4UUCA 2XENA 4N5QA 1K1AA 5AARA 3Q9NC 2XEEA 4HNAD 4QQIA 3AAAC 5EILA 2DWZA 2AJAA 4BESA 4LG6A 5EYPF 3W9FA 5BXOA 2F8XK 3Q9UC 2XZDG 4HB5A 5ENPD 3TWVA 1AWCB 1A5EA 1G3NB 5KBAA 2P2CP 1IKND 5CEDB 4U95D 3TWXA 3C5RA 2MYOA 4OAUC 3HRAA 4LSZE 2RFMA 2DVWA 5AQ9A 4DRXE 5JMND 2RFAA 1IXVA 2J8SD 1WDYA 1YYHA 4HBDA 4HLLA 3ZNGA 3NBNB 1K1BA 1MYOA 4K5BA 5KNGA 1MX6A 4DX5D 1MX2A 1S70B 5HS0A 5KNHD 2ETBA 4DX2A 3V2XA 5AN8A 5KWDA 2KXPC 3AJIA 3B7BA 3V79K 5ENTD 2F37A 2ZGDA 3TWRA 2QYJA 5CERB 4TUMA 4J7WA 4HRMB 2HE0A 3TWWA 4B93B 1D9SA 4BEPA 5FINA 4GMRA 4O60A 3TWQA 5ENRD 4HI8A 4F1PA 4BERA 1BI8B 5CEAA 3SO8A 3TWUA 4ZFHA 1SVXA 1AP7A 1NFIE 4HQDA 4HRLA 4O1OA 2QC9A 3D9HA 1BLXB 1DCQA 3UI2A 5ITZF 2FO1E 5AQAA 2ETCA 2V4HC 3T8KA 3F6QA 1MJ0A 3ZU7B 2KBXA 3JXJA 3EHRA 2F8YA 4YDYA 5AAOA 5EN5D 3JUEA 3JXIA 2BKGA 4NIKA 2ZGGA 5FIOA 5HRYA 2V5QC 1N0RA 1BI7B 1WG0A 4HRNA 5AQBA 3DEPA 1DC2A 1BD8A 2BKKB 4JB8P 4K5CA 4LNUD 4ATZD 3EU9A 1OT8A 2DZNA 4GPMA 5EIDA 5JA4D 4O1PA 4U8YD 3W9GA 5ENSD 1YMPA 4DX6D 4Z68A 2DZOA 5AQ7A 5CECB 2ETAA 1OY3D 2XZTG 1SW6A 3NOCD 4DX7D 3LJNA 2A5EA 3B95A 5EYLA 4HI9A 1K3ZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUI A;  4A63 B;  1IHB A;  4G8K A;  4F6R D;  2NYJ A;  5CBN A;  3HG0 D;  5HKP A;  4BET A;  4CYM D;  1MX4 A;  3V30 A;  5BXU A;  1N11 A;  5ENO D;  1UOH A;  3NOG D;  3ZKJ A;  4C48 B;  4DX1 A;  3IXE A;  2B0O E;  4K5A B;  4U96 D;  3TWS A;  4OAV B;  3V31 A;  1YCS B;  4U8V D;  5EIB E;  4J8Y A;  3KEA A;  4QFV A;  1QYM A;  3EHQ A;  3T9K A;  2Y1L E;  1TR4 A;  2XEH A;  1BU9 A;  5ENQ D;  5CBO A;  2Y0B G;  4G8L A;  3V2O A;  5D66 A;  3ZUV B;  3UXG A;  4BSZ B;  2PNN A;  3UTM A;  4CZ2 D;  3TWT A;  3J5P A;  2L6B A;  1N0Q A;  4YDW A;  2VGE A;  2JAB A;  4RLY A;  3DEO A;  3J5Q B;  4ZHB A;  4UUC A;  2XEN A;  4N5Q A;  1K1A A;  5AAR A;  3Q9N C;  2XEE A;  4HNA D;  4QQI A;  3AAA C;  5EIL A;  2DWZ A;  2AJA A;  4BES A;  4LG6 A;  5EYP F;  3W9F A;  5BXO A;  2F8X K;  3Q9U C;  2XZD G;  4HB5 A;  5ENP D;  3TWV A;  1AWC B;  1A5E A;  1G3N B;  5KBA A;  2P2C P;  1IKN D;  5CED B;  4U95 D;  3TWX A;  3C5R A;  2MYO A;  4OAU C;  3HRA A;  4LSZ E;  2RFM A;  2DVW A;  5AQ9 A;  4DRX E;  5JMN D;  2RFA A;  1IXV A;  2J8S D;  1WDY A;  1YYH A;  4HBD A;  4HLL A;  3ZNG A;  3NBN B;  1K1B A;  1MYO A;  4K5B A;  5KNG A;  1MX6 A;  4DX5 D;  1MX2 A;  1S70 B;  5HS0 A;  5KNH D;  2ETB A;  4DX2 A;  3V2X A;  5AN8 A;  5KWD A;  2KXP C;  3AJI A;  3B7B A;  3V79 K;  5ENT D;  2F37 A;  2ZGD A;  3TWR A;  2QYJ A;  5CER B;  4TUM A;  4J7W A;  4HRM B;  2HE0 A;  3TWW A;  4B93 B;  1D9S A;  4BEP A;  5FIN A;  4GMR A;  4O60 A;  3TWQ A;  5ENR D;  4HI8 A;  4F1P A;  4BER A;  1BI8 B;  5CEA A;  3SO8 A;  3TWU A;  4ZFH A;  1SVX A;  1AP7 A;  1NFI E;  4HQD A;  4HRL A;  4O1O A;  2QC9 A;  3D9H A;  1BLX B;  1DCQ A;  3UI2 A;  5ITZ F;  2FO1 E;  5AQA A;  2ETC A;  2V4H C;  3T8K A;  3F6Q A;  1MJ0 A;  3ZU7 B;  2KBX A;  3JXJ A;  3EHR A;  2F8Y A;  4YDY A;  5AAO A;  5EN5 D;  3JUE A;  3JXI A;  2BKG A;  4NIK A;  2ZGG A;  5FIO A;  5HRY A;  2V5Q C;  1N0R A;  1BI7 B;  1WG0 A;  4HRN A;  5AQB A;  3DEP A;  1DC2 A;  1BD8 A;  2BKK B;  4JB8 P;  4K5C A;  4LNU D;  4ATZ D;  3EU9 A;  1OT8 A;  2DZN A;  4GPM A;  5EID A;  5JA4 D;  4O1P A;  4U8Y D;  3W9G A;  5ENS D;  1YMP A;  4DX6 D;  4Z68 A;  2DZO A;  5AQ7 A;  5CEC B;  2ETA A;  1OY3 D;  2XZT G;  1SW6 A;  3NOC D;  4DX7 D;  3LJN A;  2A5E A;  3B95 A;  5EYL A;  4HI9 A;  1K3Z D; 
#chains in the Genus database with same CATH topology
 4DUI A;  3U3W A;  3D9J A;  5AYW D;  3UKR G;  4BT9 A;  2CFZ A;  2X3M A;  4MS6 A;  4YND A;  3DSX A;  5LFA A;  3QOU A;  1TR4 A;  4G26 A;  4JHK A;  2UWJ G;  4G8L A;  1N0Q A;  1H2V C;  5CHE E;  3J5Q B;  4G24 A;  4L2Y A;  1TN8 A;  4G11 A;  5AAR A;  4ATG A;  1NI1 A;  2WXG A;  2Y4T A;  4F3V A;  3HXC A;  1A5E A;  5G05 C;  2WXI A;  2MYO A;  2VSY A;  2WB2 A;  3KSL A;  1N4Q A;  1OWM A;  3RO3 A;  1IXV A;  2J8S D;  4BWR A;  4EPZ A;  2X38 A;  2VGY A;  3SNX A;  1V55 E;  3V2X A;  4F53 A;  4U0Z A;  5AN8 A;  2RKK A;  3MV3 B;  3NZU A;  5DBK A;  3TWW A;  4FAD A;  3ABK E;  3QKY A;  3OXF A;  4F1P A;  4C0E A;  4UI9 K;  3AU4 A;  5JJT A;  1DVP A;  4PDX A;  2YIN A;  4GA1 A;  3ZHE B;  4UWF A;  1TNB A;  4H7Y A;  5KJM A;  4GYW A;  1RW2 A;  1TEZ A;  4L1B A;  3JXJ A;  4PS3 A;  4F7A A;  2ZGG A;  4CT0 A;  3MGB A;  1BI7 B;  3DEP A;  3ZFW A;  4J8D A;  2OV8 A;  2GRL A;  1X5B A;  4Z68 A;  2XCC A;  2DZO A;  3FH8 A;  3HVE B;  4GA2 A;  3BG1 B;  1NL4 A;  3HG0 D;  5EX3 A;  3UUX A;  2E0I A;  1H6P A;  5T8I A;  4C48 B;  4FA6 A;  3TWS A;  1HFA A;  2XEH A;  2VGX A;  2QYU A;  4AVX A;  3J5P A;  3OTN A;  2VGE A;  2XS8 A;  4UUC A;  2XEN A;  3Q9N C;  2XEE A;  3L9T A;  5EIL A;  2YHC A;  4HS2 A;  2P9L G;  1HS6 A;  3PRE A;  3I4R B;  3GZ2 A;  1Z5S C;  3AG2 E;  3EUV A;  3QNK A;  5H7P A;  3IBE A;  2WMN A;  3MKR A;  4RG9 A;  3UM0 A;  1UJK A;  3E30 A;  3TWQ A;  4UI9 J;  2YHE A;  3B7U X;  3UQ3 A;  2OEV A;  2QY7 A;  3DSS A;  4P29 A;  3CK9 A;  4UQY A;  3BG0 B;  1BLX B;  5ITZ F;  5LCW J;  3ULE G;  2V4H C;  2R59 A;  2X6H A;  3CGH A;  3PH0 C;  4M3O A;  3Q5M A;  1YMP A;  3QC1 A;  3LJN A;  3RO2 A;  1S63 A;  3PE3 A;  1IHB A;  5BW8 C;  2L0I A;  2L9B A;  3Q47 B;  3CVN A;  3HXE A;  1JCQ A;  3CSF A;  3WXX A;  4U0U A;  5JJ6 A;  5T3R A;  3UTM A;  4HFG A;  4KBQ A;  1ELK A;  3CVY A;  3AU5 A;  3DEO A;  5BT1 A;  4N5Q A;  3ZXP A;  4XE0 A;  4AV7 A;  4AEZ C;  4BES A;  4APF A;  4A1G A;  2LSU A;  2P9N G;  3C5R A;  4EEC A;  3HRA A;  3CVX A;  2C0L A;  2EIN E;  1LTX A;  1SA5 A;  2LAH A;  4FHK A;  3JYS A;  3CHO A;  1MYO A;  4GYO A;  1E7V A;  1S70 B;  4DX2 A;  2KXP C;  1JCR A;  3CHS A;  2PQR A;  4GZ3 A;  2QYJ A;  4OYS A;  2DYR E;  5FIN A;  5G05 J;  5CEA A;  4ACK A;  4ILH B;  4BSX A;  4Q94 A;  4HQD A;  3EIQ C;  3SD5 A;  4KYO B;  3E34 A;  1TNU A;  1UJJ A;  3R9M A;  4N3C A;  3JXI A;  3UPV A;  2P58 C;  3LS8 A;  3DRA A;  1P5Q A;  3EU9 A;  1Y6I A;  2VTB A;  2I2O A;  1LD8 A;  4WWO A;  3CK7 A;  4I43 A;  4A63 B;  4G8K A;  3ZW3 A;  4CYM D;  5BV1 A;  5IY5 E;  1FVF A;  2WXF A;  1IQU A;  3KEA A;  1BU9 A;  1EDU A;  1FPP A;  3UX4 A;  4I1O B;  2EIL E;  2IFU A;  1TJC A;  1PY1 A;  4XKB A;  5LP0 A;  3JQ1 A;  4CDM A;  3T5V A;  3L16 A;  3Q78 A;  2V8S E;  4JD2 G;  2YQ8 A;  4GZC A;  2DVW A;  4LCT A;  1SA4 A;  3PDN A;  3ASD A;  1H2T C;  5G04 J;  1GW6 A;  3RIB A;  4BFR A;  2LSV A;  2ETB A;  3ZPJ A;  1INZ A;  1SQM A;  1FT2 A;  5D0Q D;  2KZT A;  4B93 B;  2IO2 C;  2AXV A;  3HIZ A;  3D9M A;  4H7X A;  3SQV A;  2IU1 A;  3E32 A;  4J0U A;  3LVQ E;  1E8W A;  3DXM G;  5ENN A;  4FLB A;  2NSZ A;  2CHW A;  4WUY A;  3L82 A;  3LY8 A;  4YVQ C;  1WAO 1;  4LER A;  2BKK B;  4K5C A;  5CMY A;  1FCH A;  3BUA A;  2GGF A;  4YDE A;  2XGS A;  4B94 A;  2EIM E;  2Y3A A;  3MZL B;  3K9I A;  3PRZ A;  3Q4A B;  5C1D A;  1MX4 A;  1TN7 A;  5BXU A;  4MLP A;  5ENO D;  1UOH A;  4CEM A;  3I4G A;  3MYV A;  2VTB B;  5ENQ D;  3RRN B;  2R02 A;  3G2V A;  2LNI A;  1XNF A;  2VQ2 A;  2RD0 A;  3FUN A;  4NAC A;  1KT0 A;  1OCO E;  1VDY A;  4GCN A;  3OXG A;  5EX0 A;  2WXK A;  3FUL A;  4OAU C;  4CRW A;  2L0T B;  3ULQ A;  3O4Z A;  2WXJ A;  3ZNG A;  3NBN B;  5FQ4 A;  3RKV A;  1N54 A;  4DX5 D;  3GZ1 A;  2ZGD A;  5CRV A;  3CVV A;  2KCV A;  2L6J A;  4WWP A;  3PNL B;  1B89 A;  4ANU A;  2QC9 A;  3ZHE A;  2R5S A;  3SY2 A;  4JA7 A;  5BPP A;  1D8E A;  4JL0 A;  2OVF A;  3TXM A;  3NAW A;  4N3B A;  1N0R A;  2KZT B;  3CVU A;  3IEG A;  4KVM A;  1L5J A;  1K8K G;  1OT8 A;  3DWL G;  5JA4 D;  1JWG A;  2WMO A;  3ULY A;  3S2A A;  3LY9 A;  1N4P A;  3CIA A;  3HVE A;  3SHF A;  4F6R D;  5CBN A;  1X81 A;  3FTS A;  3ISM C;  3EU5 A;  4L9P A;  4CT4 A;  5AJD A;  3RRM B;  2Y1L E;  2IQC A;  2V4L A;  4K03 A;  2CFU A;  3TGO A;  3FDH A;  3GZS A;  2L6B A;  4ACL A;  1ZU2 A;  1OWO A;  4LEU A;  5ANL A;  3FP3 A;  2J4D A;  2F8X K;  4URK A;  5HQ8 A;  4ILG A;  3LCA A;  3S7F A;  3FU5 A;  4A3T A;  2EIK E;  4FHJ A;  4GA0 A;  4HOR A;  2DCP A;  4GZ5 A;  4RG6 A;  1YYH A;  1MX2 A;  5KNH D;  4LNB A;  4GB9 A;  4BY6 A;  3AG4 E;  1QZ2 A;  4XEI G;  3FUH A;  4XX5 A;  2HE0 A;  2ZXW E;  4O60 A;  4OVV A;  4GCO A;  2LAI A;  3FTW A;  3LY7 A;  4DK5 A;  2P9K G;  1NFI E;  2FF4 A;  2FO1 E;  1Z6T A;  3ASN E;  4U8H A;  4U0S A;  2IJG X;  5KJN A;  2JEK A;  1A17 A;  2LO6 A;  3Q49 B;  1JWF A;  3C98 A;  2X6K A;  1ELW A;  2V5F A;  3L22 A;  3QB2 A;  1BD8 A;  1BPO A;  4C0M A;  2C2L A;  2H6F A;  1EF1 C;  3CVL A;  4RSY A;  3NOC D;  3B95 A;  4TXQ A;  1N94 A;  2PZI A;  1IQR A;  4UWG A;  4K0R A;  1XGW A;  3ZKJ A;  3MX3 A;  4K5A B;  3V31 A;  3B7S A;  1LF8 A;  1HO8 A;  3TWT A;  1HX8 A;  2VSN A;  4GTS A;  2PL2 A;  3EJN A;  5BXO A;  4LG6 A;  3FH5 A;  4HB5 A;  3TWX A;  4GTP A;  4Y6C A;  2I1K A;  4I17 A;  1ZBP A;  3ASO E;  2AW6 A;  3VLF A;  2I6H A;  2OEW A;  4JHR A;  4FJY A;  2KC7 A;  3EIJ A;  4K5B A;  5FWQ A;  3SBS A;  5EKQ D;  2BTD A;  1KLX A;  2UY1 B;  5FQ6 A;  5ARF A;  1OCR E;  3FHE A;  5KJL A;  4CDR A;  5A6C A;  4HRL A;  2I1J A;  1N4S A;  3ESL A;  4U7E B;  4IN3 B;  2NC9 A;  2ETC A;  3C3Q A;  2CG2 A;  5AAO A;  3T8M A;  3BU8 A;  3CVQ A;  4LNU D;  4GPM A;  3U9W A;  2LXM A;  3NQP A;  3R9A B;  3HXF A;  3D9P A;  4GML A;  2WQ6 A;  3ML8 A;  2GRR B;  3MEK A;  4RVB A;  2BF0 X;  4TUU A;  2WXN A;  2DBA A;  5KJK A;  3CR3 A;  3CKC A;  1IHG A;  2WXH A;  2QZA A;  4CCA A;  2FI7 A;  1O5M A;  2WM9 A;  4X8Q A;  3BEE A;  2J4B A;  2J9Q A;  3UIO C;  2GRN B;  3D9N A;  3L08 A;  1DCE A;  3ZYQ A;  3Q7A A;  4PUC A;  3UM1 A;  4HNA D;  2CHZ A;  2IOS A;  2HR2 A;  3ML9 A;  4ME2 A;  2Y69 E;  3SZ7 A;  3Q73 A;  2X6J A;  4U95 D;  2I9C A;  4I6G A;  3BQO A;  3LJ3 A;  2XGO A;  4GTV A;  1FVH A;  1EYH A;  3IHY A;  3D9K A;  2Y4U A;  5ANR A;  2GRM A;  4ILI A;  4B8C B;  4TUM A;  4F1S A;  4J7W A;  4GMJ A;  2XEV A;  2VSO E;  3Q75 A;  3PZ3 A;  2J09 A;  2IOL A;  1MHQ A;  4JVS A;  3C3O A;  4G23 A;  4M7C A;  1O1R A;  4WNG A;  1KT1 A;  1TNY A;  3P1U A;  3ZU7 B;  5JHB A;  3EHR A;  3ABM E;  4I2Z A;  4GTR A;  3UM3 A;  1HXI A;  3TG5 A;  3S7D A;  2QFC A;  2F0Y A;  5EYL A;  2HM8 A;  4HI9 A;  4ANW A;  2X6I A;  3DSU A;  3PUK A;  3SFX A;  1N11 A;  3HHM A;  4C9B B;  4HVB A;  3UT8 A;  4XKC A;  2XS1 A;  2GRP B;  3PNT B;  4BSZ B;  2IEJ A;  3RK6 A;  1H6O A;  3VLE A;  2IY0 C;  4AM9 A;  2MRI A;  1S0P A;  4QQI A;  4DLO A;  3Q9U C;  3RJV A;  2XZD G;  3FUE A;  4L23 A;  1AWC B;  5KBA A;  3LPZ A;  3PEV B;  2H6G A;  2RFM A;  5EDS A;  1WM5 A;  5M72 A;  3FFL A;  2P9P G;  3ZEF A;  3FTZ A;  2LXL A;  5B1B E;  1UW4 B;  3OXL A;  4AP2 A;  3TJP A;  1D9S A;  3KAE A;  3DXK G;  3FU6 A;  4NRH B;  4BER A;  3UIN C;  4I1A A;  4J6I A;  4ZFH A;  3ZYK A;  2EQX A;  4O1O A;  4KT6 B;  2EIJ E;  3G2T A;  4EZJ A;  3FTU A;  5AQA A;  4JPS A;  3VTX A;  2F8Y A;  4BX9 A;  3JUE A;  5FIO A;  3DSV A;  1W3B A;  4WNE A;  3RAU A;  4ATZ D;  5C2Y A;  1KZP A;  3NZS A;  3EHN A;  3CK8 A;  5E75 A;  5A7D B;  3UKU G;  4L7T A;  4TV3 A;  3ZYM A;  2R2L A;  2GRO B;  3L54 A;  3ZVV A;  3C3R A;  5HKP A;  4JEU A;  4FU3 A;  3V30 A;  4JEH A;  4J8S A;  3NOG D;  4D10 C;  2XHE A;  2XRZ A;  3CHR A;  3FWV A;  4QFV A;  4LUN U;  4CGV A;  2J49 A;  5FQ8 A;  4YDO A;  1N95 A;  3C72 A;  4HOQ A;  5J90 A;  4RLY A;  3ZIM A;  3FTX A;  4EZL A;  4UWK A;  3QJZ A;  4G1T A;  3G2U A;  5EYP F;  3DST A;  4GZ6 A;  1IKN D;  1O1T A;  3O48 A;  1U3D A;  1HZ4 A;  4AIF A;  4J8F A;  1RZ4 A;  2KAT A;  5HS0 A;  3CHM A;  4GU5 A;  3KD7 A;  1WY6 A;  4BTA A;  3RU0 A;  5CER B;  5BUZ A;  1TJF A;  3U4T A;  3UIP C;  4LRZ A;  3S7B A;  1E8Z A;  3X2Q E;  1D8D A;  2HO1 A;  1N9A A;  3CVP A;  3LKU A;  2WQ7 A;  1DCQ A;  3UI2 A;  2ILR A;  1MJ0 A;  3QAR A;  5HRY A;  4KMO A;  1UN8 A;  3ABL E;  4IRU A;  3TG4 A;  4HRN A;  1MZC A;  4GZD A;  5AQB A;  2XQ0 A;  3IHV A;  3CEQ A;  5FZQ A;  2IF4 A;  2OVB A;  4I9C A;  4DX7 D;  1NP7 A;  4GAA A;  4G2V A;  4APO A;  3CST A;  3PEU B;  1H6K A;  5LX8 A;  3FUF A;  3PVL A;  3ASH A;  2B0O E;  3ESK A;  1YCS B;  3JUI A;  4UI9 C;  3T9K A;  2WPV A;  5LCW C;  3VTY A;  3ONK A;  4HOS A;  1HG2 A;  3W9F A;  1O1S A;  2BED A;  1Z3Y A;  2KCL A;  3L17 A;  3FH7 A;  5D0O D;  4DRX E;  3IV0 A;  1HU3 A;  4JXT A;  5KWD A;  4HOU A;  4MKT A;  4TRQ A;  5ENT D;  1TN6 A;  3CQG B;  1MQS A;  2UY1 A;  2AXZ A;  4XI9 A;  3UT4 A;  4RQI A;  4TXR A;  1HE8 A;  1SZ9 A;  3TWU A;  1U2V G;  4FJZ A;  4GTQ A;  4R7L A;  4GTO A;  4ANX A;  3R7Q A;  4J8E A;  2CHX A;  3FUJ A;  2WXM A;  3B7R L;  3QK0 A;  2DZN A;  2WQH A;  4HLE A;  3ONL A;  1HH8 A;  2H6I A;  4DPR A;  4L2L A;  1K3Z D;  2NYJ A;  4N5C A;  4BET A;  3IXE A;  4DI3 A;  4OAV B;  5AEN A;  3UM2 A;  1QYM A;  1TNZ A;  2PM6 A;  2YNQ A;  3KEZ A;  2Y0B G;  3CKB A;  4O6F A;  3FEY A;  4U04 A;  2PNN A;  1KPS B;  1DNP A;  2GW1 A;  4XI0 A;  4DLQ A;  3ENE A;  3PZD A;  3TL5 A;  3RRU A;  3D3M A;  2ZIR A;  5LOZ A;  4E85 A;  4I6J A;  3NB2 A;  5AQ9 A;  5CCM A;  1UN9 A;  5JMN D;  2RFA A;  2DIW A;  1HG5 A;  2MOW A;  2P9U G;  4PS7 A;  1MX6 A;  1HF8 A;  2PM7 A;  4EZK A;  2C0M A;  4WAF A;  3B7B A;  3TWR A;  4DJA A;  2J08 A;  5BNW A;  4GTT A;  4KZ0 A;  4GMR A;  4AOF A;  5ENR D;  3B13 A;  2FBN A;  5AIJ A;  1QQE A;  4PS8 A;  1SZA A;  3DSW A;  2OCC E;  5FTP A;  3D9I A;  4NIK A;  1QBQ A;  3NF1 A;  1E8Y A;  2V5Q C;  3ZXS A;  4HOT A;  3FTV A;  4FC8 A;  2M63 A;  5EID A;  3B7T A;  2CG3 A;  5G04 C;  5CEC B;  2ETA A;  3CQC B;  2A5E A;  4MBG A;  3GW4 A;  3SFZ A;  5B3S E;  3SFY A;  3DPD A;  3MCX A;  4UWH A;  4I6E A;  5E76 A;  4AJW A;  4U8V D;  4J8Y A;  4KVO A;  2WXR A;  5D66 A;  2WXL A;  5FZR A;  4CZ2 D;  3QWP A;  3ZGQ A;  2HYZ A;  1OWN A;  4E6H A;  2XGM A;  2BUG A;  2AJA A;  2ZIS A;  4N39 A;  3MKQ A;  3TWV A;  3AS8 A;  2P2C P;  5G55 A;  3IKO B;  2AWI A;  5CED B;  4N2S A;  4N3A A;  1S64 A;  3FY4 A;  5G2N A;  5FZS A;  1WDY A;  2R03 A;  4JW1 A;  3PE4 A;  5FJY A;  3VLD A;  3ZRH A;  3AG3 E;  3KSQ A;  5CMW A;  1FT1 A;  3HDX A;  2OOE A;  5FT9 A;  4AY5 A;  2X6F A;  4HRM B;  4G25 A;  2R05 A;  3HXD A;  3DPY A;  3G2S A;  2V0P A;  3APF A;  3FUI A;  4W9R A;  2FUL A;  2R17 C;  1Z3X A;  3RSE G;  3R7R A;  5B1A E;  1U3C A;  3D9H A;  4YVO A;  4KZC A;  5A23 A;  4EQF A;  4YDY A;  5EN5 D;  3U64 A;  2BKG A;  4V3I A;  3Q15 A;  4A55 A;  4EBA G;  4AY6 A;  1E90 A;  4JZY A;  3W9G A;  5ENS D;  4ABN A;  2XZT G;  1OXJ A;  5CRU A;  4I1M A;  5CCL A;  3JCK C;  5T4Y A;  3E4B A;  2AVP A;  1Y8M A;  3JQ0 A;  2GRQ B;  4TXP A;  2VGX B;  1UG3 A;  1ELR A;  4IUL A;  3CHP A;  3PZ1 A;  4MRU A;  2Q7F A;  2WXQ A;  2AXU A;  3FUD A;  3PUJ A;  3EHM A;  5J08 A;  4ZHB A;  3QWV A;  4XIF A;  3Q7F A;  3AAA C;  2DWZ A;  2ION A;  3MA5 A;  4GYY A;  3CVW A;  5HI7 A;  3S7J A;  3D9O A;  3LEW A;  3PZ2 A;  3OAW A;  4DI4 A;  3I5P A;  4N2Q A;  4HBD A;  1K1B A;  5JJ7 A;  5DIZ A;  2B6C A;  3V79 K;  3MKQ B;  4BTB A;  2KM4 A;  4NUR A;  3DBS A;  3QDN A;  4WWN A;  1BI8 B;  3UT7 A;  2A4Z A;  1AP7 A;  5D2M C;  3LDZ A;  3TAX A;  4B8A A;  1E7U A;  1WG0 A;  1N4R A;  4WND A;  1N52 A;  4JB8 P;  3GYZ A;  4I2W A;  2H6H A;  4B89 A;  4O1P A;  1H0A A;  5AQ7 A;  4WNF A;  4IYP A;  1OY3 D;  1SW6 A;  4KXK B;  2XCB A;  3E33 A;  1TNO A;  1EPU A;  3QAQ A;  4DX1 A;  4U96 D;  3D9L A;  5EIB E;  3FU3 A;  4Q96 A;  3EHQ A;  2A5U A;  3U66 A;  3V2O A;  3ZUV B;  1E96 B;  3UXG A;  2E2E A;  3APD A;  4UQX A;  5AJL A;  4A3V A;  2VJ8 A;  4YDW A;  3SI5 A;  2JAB A;  5JHA A;  3ASF A;  1K1A A;  4XZ4 A;  2XPI A;  4Y6W A;  5ENP D;  3HXB A;  4UWL A;  3HYM B;  2VYI A;  1OWL A;  2FEZ A;  3SF4 A;  3SBT B;  1QNF A;  1LD7 A;  3WG7 E;  2OND A;  2ZU6 B;  2XRY A;  3FUM A;  3PS6 A;  1OWP A;  1ZB1 A;  3QWW A;  4CDN A;  1KZO A;  2F37 A;  3FUK A;  3LXU X;  3URZ A;  3Q79 A;  1IYG A;  1PC2 A;  3CLJ A;  1JPL A;  4BT8 A;  4BEP A;  4BX8 A;  2P9S G;  5ARG A;  3I3N A;  4HXI A;  4LNG A;  3SO8 A;  3TXN A;  4OVU A;  5BV0 A;  3AS5 A;  2KCK A;  3T8K A;  3AS4 A;  3AG1 E;  2PQN A;  3UMV A;  4ANV A;  3MJW A;  5KCM A;  3APC A;  2WXO A;  2MHK A;  2FO7 A;  4U8Y D;  1H19 A;  4B0Z A;  1NA3 A;  2NXP A;  1H2U A;  4U63 A;  2XPY A;  2LUH A;  1TYQ G;  2WVI A;  1NA0 A;  3LYA A;  2VSX E;  3FU0 A;  4JA9 A;  4FLH A;  4GTM A;  5CBO A;  4UQZ A;  1JCS A;  4Q69 A;  3SGH A;  4CGW A;  4JHJ A;  4GPK A;  1Q2Z A;  3EDT B;  2XPZ A;  1V54 E;  3ASG A;  3ZYL A;  1OCC E;  2RG8 A;  3T5X A;  4I9E A;  4JC8 A;  1E8X A;  1G3N B;  3CV0 A;  3FEX A;  3N71 A;  2WXP A;  4LSZ E;  3L13 A;  3LVR E;  2JLB A;  4EHM A;  5KNG A;  4A1S A;  1OCZ E;  3MV2 B;  3AJI A;  4AXH A;  2P9I G;  2IO3 C;  3CHQ A;  3L6A A;  1NZN A;  4HI8 A;  1YA0 A;  4PH4 B;  3P2B A;  3FTY A;  5FQ7 A;  1SVX A;  3G2W A;  3PZ4 A;  4FUL A;  3F6Q A;  2KBX A;  3KS2 A;  1JUQ A;  4NQ0 A;  2J07 A;  1DC2 A;  3E37 A;  4FP7 A;  1OUV A;  4DX6 D;  4EBA A;  4U07 A;  3ZN3 A;  2DYS E;  4HLL A;  1PAQ A; 
#chains in the Genus database with same CATH homology
 4DUI A;  4A63 B;  1IHB A;  4G8K A;  4F6R D;  2NYJ A;  5CBN A;  3HG0 D;  5HKP A;  4BET A;  4CYM D;  1MX4 A;  3V30 A;  5BXU A;  1N11 A;  5ENO D;  1UOH A;  3NOG D;  3ZKJ A;  4C48 B;  4DX1 A;  3IXE A;  2B0O E;  4K5A B;  4U96 D;  3TWS A;  4OAV B;  3V31 A;  1YCS B;  4U8V D;  5EIB E;  4J8Y A;  3KEA A;  4QFV A;  1QYM A;  3EHQ A;  3T9K A;  2Y1L E;  1TR4 A;  2XEH A;  1BU9 A;  5ENQ D;  5CBO A;  2Y0B G;  4G8L A;  3V2O A;  5D66 A;  3ZUV B;  3UXG A;  4BSZ B;  2PNN A;  3UTM A;  4CZ2 D;  3TWT A;  3J5P A;  2L6B A;  1N0Q A;  4YDW A;  2VGE A;  2JAB A;  4RLY A;  3DEO A;  3J5Q B;  4ZHB A;  4UUC A;  2XEN A;  4N5Q A;  1K1A A;  5AAR A;  3Q9N C;  2XEE A;  4HNA D;  4QQI A;  3AAA C;  5EIL A;  2DWZ A;  2AJA A;  4BES A;  4LG6 A;  5EYP F;  3W9F A;  5BXO A;  2F8X K;  3Q9U C;  2XZD G;  4HB5 A;  5ENP D;  3TWV A;  1AWC B;  1A5E A;  1G3N B;  5KBA A;  2P2C P;  1IKN D;  5CED B;  4U95 D;  3TWX A;  3C5R A;  2MYO A;  4OAU C;  3HRA A;  4LSZ E;  2RFM A;  2DVW A;  5AQ9 A;  4DRX E;  5JMN D;  2RFA A;  1IXV A;  2J8S D;  1WDY A;  1YYH A;  4HBD A;  4HLL A;  3ZNG A;  3NBN B;  1K1B A;  1MYO A;  4K5B A;  5KNG A;  1MX6 A;  4DX5 D;  1MX2 A;  1S70 B;  5HS0 A;  5KNH D;  2ETB A;  4DX2 A;  3V2X A;  5AN8 A;  5KWD A;  2KXP C;  3AJI A;  3B7B A;  3V79 K;  5ENT D;  2F37 A;  2ZGD A;  3TWR A;  2QYJ A;  5CER B;  4TUM A;  4J7W A;  4HRM B;  2HE0 A;  3TWW A;  4B93 B;  1D9S A;  4BEP A;  5FIN A;  4GMR A;  4O60 A;  3TWQ A;  5ENR D;  4HI8 A;  4F1P A;  4BER A;  1BI8 B;  5CEA A;  3SO8 A;  3TWU A;  4ZFH A;  1SVX A;  1AP7 A;  1NFI E;  4HQD A;  4HRL A;  4O1O A;  2QC9 A;  3D9H A;  1BLX B;  1DCQ A;  3UI2 A;  5ITZ F;  2FO1 E;  5AQA A;  2ETC A;  2V4H C;  3T8K A;  3F6Q A;  1MJ0 A;  3ZU7 B;  2KBX A;  3JXJ A;  3EHR A;  2F8Y A;  4YDY A;  5AAO A;  5EN5 D;  3JUE A;  3JXI A;  2BKG A;  4NIK A;  2ZGG A;  5FIO A;  5HRY A;  2V5Q C;  1N0R A;  1BI7 B;  1WG0 A;  4HRN A;  5AQB A;  3DEP A;  1DC2 A;  1BD8 A;  2BKK B;  4JB8 P;  4K5C A;  4LNU D;  4ATZ D;  3EU9 A;  1OT8 A;  2DZN A;  4GPM A;  5EID A;  5JA4 D;  4O1P A;  4U8Y D;  3W9G A;  5ENS D;  1YMP A;  4DX6 D;  4Z68 A;  2DZO A;  5AQ7 A;  5CEC B;  2ETA A;  1OY3 D;  2XZT G;  1SW6 A;  3NOC D;  4DX7 D;  3LJN A;  2A5E A;  3B95 A;  5EYL A;  4HI9 A;  1K3Z D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...