1AJ3A

Solution structure of the spectrin repeat, nmr, 20 structures
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
98
structure length
98
Chain Sequence
b'HQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA SPECTRIN
publication title Solution structure of the spectrin repeat: a left-handed antiparallel triple-helical coiled-coil.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 49
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1997-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1aj3A00
1S35A 2SPCA 1OWAA 1U4QA 1QUUA 3UULA 1WLXA 3LBXB 1CUNA 3LBXA 2ODVA 3FB2A 3EDVA 3UUNA 1HCIA 2ODUA 3UUMA 3PE0A 3F31A 1U5PA 1AJ3A
chains in the Genus database with same CATH superfamily
3FZLB 4O8SA 2K9AA 3N2KE 3AE9A 2CHNA 4LMLA 3NZQA 4DR2T 5LHGB 2Q9QC 3LSVA 2OV9A 1LVFA 3N2GE 1UURA 4PK5A 4JI4T 1MMDA 2BKNA 2LM9A 4PJNA 4ISTA 4QX8B 4EEDA 1KNPA 1M7KA 1UX5A 4A56A 3VR9A 2J4GA 2LJLA 2VKHA 5L2LA 1J5WA 3IBPA 2HPLA 3K1SA 5AQPB 5AQKB 2LKGA 4ERRA 2KZ7B 4JUYA 2BBJA 3ZN1B 5AQLB 2LSYA 2QGSA 4J2CA 4YXDA 1FIOA 3NKZA 2DNXA 3QB5A 4JEHB 3QK6A 4IREA 3P4PA 3F31A 3MXZA 1UK5A 4U72A 2UXDT 4U2ZA 3AA1B 3J9X1 3SS1A 3ZCIA 5L4EA 5HEJA 1ZP0A 2XTLA 3PTRB 4DIDB 2XY8B 4JI6T 3AA0B 2L8KA 3RF1A 4TX5A 3AA7B 4CI2B 3N9PA 4HFEA 3PUXF 3RIFA 1SHZC 1OXZA 4H9OC 4JBWF 4B3TT 1FJGT 4ZZBA 1D0YA 5KXJA 3RH3A 1OEDA 4BJNA 5HYAA 4HWDA 5JQGE 4P0BA 2VWAA 3L09A 2UXNB 3LK3B 2A2FX 2SPCA 2RP4A 4JI3T 4HWHA 4ANJA 2E2AA 1EZ3A 4HFDA 4Z90A 3F57A 3A5XA 3AXJA 3ZC0A 4DBQA 4DO0A 1LRZA 3EABA 3C4ZA 2WWVA 4DV4T 1YXRA 5CA1E 2FBWA 2CBIA 3WAKA 1ZHCA 4QXHB 4KUMB 2E9XA 3N9OA 4GK5E 3PUGA 3VU7H 5FL0A 3BK9A 1ZKEA 4DV1T 2D0TA 5AQUB 1HS7A 1KNZA 3UQ7A 5HEOA 2BS2A 4O4HE 3GWHA 3M3ZB 3BQKA 1V9DA 3BQIA 3QB5K 4O2AE 3ZC1A 2C0SA 3CQXC 4CI1B 5AQMB 3FZHB 4JLEA 5KMGP 5EZYE 2IW5B 2WY2A 3HA4A 4TNWA 5AQRB 3ZT6A 4ZS2A 4I0UA 3VRAA 2MAWA 2Z6EA 1KFYA 1WYBA 1IBLT 2XQ8A 2NWBA 3AE8A 3KDSE 3RKOA 3RIAA 5AQHB 4ZI2C 2BG9A 3Q5WA 4JI8T 3AE5A 4DR7T 2M67A 2MOZA 3JCFA 5GONE 2H7VC 2VKJA 4NIQA 3SRZA 2WSSV 3UFGA 3HKCE 4EEBA 3ONJA 4LF4T 2WBLA 2MTQA 5ABGA 3AEAA 4COFA 4NXMT 2E9XD 5TAOA 1OWAA 4IDQA 5ABFB 3PJAA 3MA9A 3VKGA 4GKKT 3ETUA 4WZXA 4ZEYA 4JI7T 2YU1A 5J0ZA 5J2UE 4MHCA 1U4QA 5JDFA 2HPJA 3ZMVB 2Y48B 2XQYA 1J5ET 2ODVA 5L47A 5LMUT 3T1HT 5FMNA 3JAEA 4ILBA 3UUBA 4TN7B 2IC9A 2RPAA 4A5XA 2XHEB 1HNZT 3FXEB 3CWZB 4EXTA 4EB6E 3SFEA 3KBUA 1W0BA 3MK7C 5ADXL 2XAFB 3AB3B 4HWCA 3LK42 4DR1T 2CBJA 3KV6A 2X0YA 2XZEA 2VKDA 3C4WA 2LKHA 2BKPA 3ZLIA 2CE7A 4TWFA 1WCRA 5JDLA 3HKEE 5HWXA 5IWAT 2CXDA 4NPPA 5JH7E 3RHWA 2K3WA 3AVRA 2HN2A 3CX7B 3AE2A 3ZMSB 3OBVE 4DV7T 3VR8A 5EK3A 1WLXA 3MACA 4PAGA 4EIWA 3EDVA 3ETVA 5JDHA 3KVAA 2UXXB 1ZEEA 1S35A 5DJQC 3M65A 4LFAT 4UVAB 2VQET 3ZCJA 4U33A 1HFAA 5FXZA 5KX5E 1T98A 4B3RT 2W67A 1HX1B 3PU8A 2D9DA 3HKDE 2JQHA 3PDYA 4HGAA 2AE9A 3RIUA 2QA7A 3N9NA 3SFDA 2D0UA 4OX9T 2HH7A 3Q5XA 2HN1A 1NENA 4M1PA 3RKGA 2K48A 2CHOA 5DQVA 3QNUA 3JC6C 1AJ3A 4AKHA 3GA8A 3T8OA 4CXWA 1BR2A 3S4UA 3ONLC 3ZEFB 2V26A 5HEHA 1QSDA 3KVBA 3OTOT 4K0UA 4YY3T 2LEHA 3PUAA 2CWOA 5LG3A 4X66T 5DABA 3N2OA 5AQIB 1XDPA 4QH5A 3RX6A 2IIUA 5AQJB 4QH4A 4PJJA 1R8IA 4Q25A 4EAHA 4IE6A 3RQUA 2YOEA 5JTGA 4WBOA 4O4IE 4NXNT 2XSAA 4LF9T 2WWUA 5LBQB 2VB6A 2XASB 2X66A 3KINB 4KHZF 4NUUA 5JR9A 3U3IA 3ZT7A 4NUVA 1UX4A 4TWDA 3PE0A 1T7SA 2BVLA 2MYSA 3IEEA 4TWHA 1D1CA 3PUYF 2C5IT 1ZOYA 2ACZA 2JMHA 2KXPB 4GK0E 4YTNA 4ISSA 5J1GA 3ZPOA 4HFBA 2V6YA 3AEBA 5C3JA 4UV8B 4ILUA 1D0ZA 3LJCA 1NAFA 3QOFA 1YQ4A 5C2TA 3FZFB 1X79A 3WI3A 3P4QA 1FEWA 2KWIB 3A7MA 3UTKA 4WYVA 4JI0T 2BDEA 2VKOA 3KV4A 3NRXA 3K3QC 2XAHB 4Z91A 5LBMA 4DV3T 3PUWF 2WMNA 4QX7B 5HXEA 1XMQT 2DWKA 3U78A 3IHRA 5IHYA 4N78D 3AEFA 1LVKA 3TLSA 5FL1A 2I59A 4B6XA 5L3GB 4IT4A 2J62A 3RYFE 5FXVA 4B3MT 5CJ5A 5FKYA 5FY0A 4G2AA 1Y01A 3FXDB 5CFBA 4LMKA 2D5UA 4YSZA 2CM0A 4JI5T 1T72A 2L9QA 4X62T 3NZPA 2WCAA 3KFWX 2XQAA 3P7IA 4WNKA 3O4XE 5J2TE 4FI5A 2G0UA 4AQFC 2WU5A 4YSYA 2WDQA 4H63V 4GYRA 2RA1A 4X64T 3HL6A 2CPTA 5IYZE 3O9XA 3L39A 1XNRT 1WRDA 3P8CD 4O4LE 2X9HA 4JV5T 2Y8DA 4DV6T 1MNDA 5JDQA 4F6RC 3RC3A 3HI2A 2W62A 3EVYA 2XSBA 4A98A 4UF0B 5LHIB 1U5PA 1S94A 5LMNT 1HNXT 1T8BA 2EHOB 2YDSA 3OJAA 1HR0T 3RRWA 2N9DA 3EDUA 3OYZA 4E7SA 3C98B 3KV5A 2QYWA 1KNRA 3WAJA 2BG9E 4I50E 3OVUA 2X9XA 4YJ2E 2ZM0A 4DR5T 3QUJA 3E08A 1H7CA 2Q9QB 4K0KT 2CMRA 4YT0A 4UVCB 2E5LT 5LJMA 2X68A 3ZYLA 3C51A 4ZI3C 2NTXA 4XBFB 2ZMAA 4TZ4C 5EK4A 2NW8A 3TLWA 4X1KE 3PU3A 4P1NA 3CPZA 2LHRA 3ZYKA 3UU5A 1N32T 5LB7B 3LBXB 4I4TE 4CXYA 3H3MA 1G8XA 4X1IE 3MZKB 2PG8A 2NP9A 4CI3B 3MKDA 2PTFA 4HE8A 4U3CA 5LCYA 3X1DA 2YINA 3ANWB 5HWYA 2A72A 4H9NC 1YKHB 4X65T 1OEDC 4ZI2D 4U2YA 2V8SV 2WDRA 1XDOA 3GN5A 2CCQA 3CMLA 4DUZT 4U74A 1HG2A 3C4XA 1HTJF 4CN6A 4LF6T 3UU8A 3V5SA 4PFOA 4DNDA 5LXTE 2LSJA 2BZBA 4P09A 1HNWT 2V7LA 5FNVE 3DP7A 2VASA 2WMOA 4H63H 5L3EB 3TLUA 5LA6E 2X0HA 2CXLA 1MMNA 4TV9E 4GIWA 2BS3A 2LSGA 4WW0A 4IE5A 3AECA 4AKLA 2FJBA 3A8YC 3ABVA 4QHOA 2WDVA 5AQFB 2C5KT 4IDZA 2E9XC 2XQ5A 4YLHA 5JVDE 5ETWA 3P4RA 1QLBA 5AQQB 1I6ZA 3AE7A 2H3RA 3GMIA 3E0ZA 4UELA 2VURA 3PUZF 3R6NA 3LFMA 2CLYC 5LHHB 4EGWA 3N9LA 1KF6A 2BKOA 3O1IA 2DHRA 4CZZB 3PUQA 4UIGA 3P50A 2J47A 4DV2T 4YFSA 4DR3T 1GQEA 5HXCA 2K24A 3AVSA 1X9BA 1US7B 2VVNA 1YKEB 3ZSSA 3CX8B 4IE4A 2ODUA 5CGMA 4IGUA 3I9WA 3RPUA 3ZJ1A 4MLKA 1N36T 1N33T 4CQIA 2PBIA 2CXFA 5AQTB 3ZSTA 4JI1T 1J1JA 1FMVA 2BBHA 5HAXA 3AAEB 4HFIA 1O3XA 2KWHA 5F5WA 4EOZB 3RYHE 2BG9C 2C5JA 2W2UA 4DMVA 2IUBA 2XQ4A 4YJ3E 4DV5T 3OPCA 4JEUB 3Q5EA 2KLQA 4X5TA 2KSRA 2LOPA 4AQYT 2DL1A 4DV0T 4ADZA 4TV8E 2IC6A 1BR4A 2IHR1 3UUNA 3UUMA 4OYJA 3V5UA 5KDMC 3HKBE 3G06A 4L0RA 4YSXA 4YHHT 5L3DB 3CX6B 3UU4A 1Z8UA 2MBGA 2JRKA 4UV9B 4IDOA 2WQYA 2NOXA 1IZNB 2N1GA 2KNDA 1M62A 5HXHA 2WAUA 3ZMUB 1XNQT 2VVSA 5IUXA 5BR8T 3OKQA 1KK7A 4HN9A 5LGUB 3FBLA 5EK2A 3FHNA 5AQNB 2XQ7A 2BVMA 3O1HA 3RI5A 2Q9QA 2W0GA 4PW8A 4CN1A 4OHFA 2NW7A 2LOSA 4H9SE 3JC6D 2W66A 3NVOA 4IHJE 1IAPA 3AEDA 5AFUL 3ZN0B 4BAYB 4Z8XA 5FXXA 5FXWA 2WM9A 3LBXA 4U31A 2JMKA 3SWHA 3ZMZB 2XM2A 1IBMT 3W15B 1MIYA 1FMWA 5F3JA 1VOMA 2XPKA 4PJMA 4YTMA 2WP9A 4G63A 3AE6A 2VL8A 3H37A 3FZMB 2JQQA 2L3LA 4O4JE 4QXBB 3CK6A 2EHOD 4I43B 3CQCB 4HFCA 3VRBA 5JDNA 4DUYT 4ZHQE 4L5GA 2CRBA 4JYAT 4GKJT 2NW9A 4E7ZA 2FJEA 2ZLYA 3UQ4A 4ZZCA 4KI0F 2YKSA 4HEAA 3TKLB 4B3ST 2GK9A 3F2EA 4I55E 5HXSA 4PFPA 2X51A 2ZM8A 4EV6A 2BG9B 4XZCA 5ABFA 2DI4A 1NEKA 3B57A 3FB2A 4ZS3A 2Q9QD 3PUVF 1WR0A 3ESLA 1HG5A 4H9PC 2FUPA 1YD8G 4P0AA 2X67A 4TUYE 2J1DG 2IDOB 4YHJA 2DCFA 5H6QB 2NR4A 3K8PC 3RIUC 2M6IA 1HCIA 3PV0F 4CN4A 1OEDE 4DR6T 2XJ7A 4F8HA 1W0AA 2N2NA 2WB5A 3EUHA 1MMGA 1B7TA 3PJAJ 2DLRA 1UGOA 4KHPT 4AKRB 4HFHA 2K5BB 3RC8A 1LKXA 1D1BA 3B13A 4PK4A 3C64A 2V7KA 4H9QC 2B76A 4GOUA 5HCJA 1VCTA 3UU3A 2XQ3A 4OFZA 2MPKA 5JDGA 3AA6B 3UULA 3CVRA 3H3AA 5JRCB 2I0MA 4EYYR 2LE8A 3ZYMA 4AQGA 4PNIA 5HXRA 1YW0A 2HHHT 4ASKA 1KEYA 5JR9C 2UU9T 4A97A 4MALA 5AQGB 3FBZA 1JNZA 4OYKA 4L9IA 4QKNA 3KBTA 3RQWA 4ZI7E 3JAFA 3N9MA 4AKIA 4LF8T 5A1LA 3OYXA 3PUSA 4C91A 3IF8B 1UCUA 1D1AA 2WZHA 2JQ9A 5LP6E 5L3BB 3LK2B 2V5CA 4KBMB 4QXCB 2XAJB 2NTYA 2LT3A 1SA0E 4IL9A 3D0TA 2PFVA 4IDNA 4QWNB 2V7JA 4AKGA 3RLFF 2A9UA 2LRLA 2YU2A 3NWIA 4UXNB 2WU2A 3CKDA 4AIUA 1HF8A 3VKHA 4X1YE 5L3CB 4EYUA 4LMJA 3P4SA 4X20E 2ZM6T 3ZJ2A 4LFCT 4EZ4A 4O2BE 4OK0A 3ONXA 4ILCA 2P9BA 2VL0A 3C50A 4ZI3D 4KP3C 4ZOLE 3E22E 2UXCT 2YDRA 3Q2MA 5FY1A 4MFRA 3Q5DA 4UVBB 2X9WA 4FJOA 4TNVA 1XZYA 2BS4A 1SE7A 2X0LB 3N5LA 2PJQA 3UFEA 1YQ3A 2W4XA 3EI0A 3NBXX 5LG4A 3MJXA 4LF5T 2B1EA 2FJDA 4AXPA 2LSIA 2XM1A 2VQFT 2QVAA 5LGNB 3IA3A 4U7YA 5ABHA 3P4WA 3KV9A 3J7Yq 1Z0PA 2JPFA 1IJ6A 2V7MA 4IDPA 5DQWA 2DWGA 3JADA 2XAQB 4MBQA 5F8PA 2UUBT 3RGLA 2UXBT 1NWMX 4LFBT 2M6BA 5CA0E 2YK0A 3AEGA 4PJLA 2D2SA 5JR9B 1MIVA 2R6GF 4IL4A 3RYIE 1Y64B 2LM2A 1D0XA 4V1Av 1HX8A 2I6HA 5AQOB 1XWMA 3SOLA 4IE0A 2XUEA 2LHNA 3CQGB 3LDQB 4QH1A 3L3PA 3RYCE 4C90A 4WBNE 2V1DB 3FZKB 1BR1A 5LGTB 4LF7T 3DJBA 1W9RA 3I0QA 1QUUA 2JJ9A 3ZT5A 1MMAA 5ABEA 2V6YB 2Y6XA 4ILAA 4AI6A 2LLYA 3I9YA 5JRCA 1VCSA 4CXXA 4DVDA 5E0OA 5M4YA 4DMWA 3EAMA 4H9RC 4XAXB 2UUCT 3BQLA 5LYJE 1IJ5A 2YN6A 2YEVC 1N34T 4HTEA 3ZKRA 3K3OA 3T1YT 2WS3A 3I0OA 2F4VT 3UT5E 1W09A 2E5VA 5FYMA 5HEUA 1CHUA 3I1AA 2W61A 1DU2A 2IAKA 5LNKA 3RRCA 4HWIB 1E2AA 4HKAA 3AEEA 4UR9A 1UUSA 3NRYA 5FVLA 2W63A 3DTOA 4KMCA 1MNEA 4GYSA 4UF0A 4KX6A 3UUXB 3L8RA 1VRBA 5LJNA 1WR6A 5BMVE 2WZIA 2EHOA 2H88A 5H6RB 1I94T 1OEDB 2V5DA 5L3FB 2E8IA 2JIWA 4U7IA 2H89A 5CB4E 4DR4T 2H7OA 2XAGB 3EHZA 4HWFA 2OLTA 3N9QA 2V7IA 1G73A 5FVKA 1BR0A 2ES0A 1CUNA 2X9YA 4DBRA 3HR0A 4BA9A 1XMOT 3AXJB 3AE3A 1WYCA 2W00A 3AAIA 4AISA 2AXDS 2XQ6A 3AE4A 5FY7A 3ZMTB 2UUAT 1L0VA 3UU6A 2E9XB 1ZV4X 2CA5A 1E1HB 3AAAB 2CLYB 3ANWA 1IBKT 3VHLA 4EZHA 2KINB 3CIRA 1JNRA 3TLTA 4PK6A 5AQSB 1SUMB 2CWYA 2V6XA 5LOVE 2FJAA 4JI2T 3QC9A 5AQVB 4ZXLA 3AE1A 4HFVA 2IMLA 3B5MA 5L4HA 2LRKA 1WFDA 4UEMA 4IE7A 2KT9A 2VK9A 1MIWA 4BJMA 2YDQA 2QRXA 1E7PA 2A3DA 3Q9DA 5JREA 5JDMA 2KMFA 5HEGA 4YTPA 2ZM2A 3R84B 2EHOC 5HCMA 5C8YE 4AQFA 2CEAA 2XQ9A 2LSKA 3GN5B 3PURA 2OA5A 5FP3A 3TLVA 3K3NA 4IIJE 3O1JA 3LG7A 2JQKA 2ACXA
chains in the Genus database with same CATH topology
1ZEEA 4TV9E 4GIWA 1S35A 4O8SA 5DJQC 2LSGA 2LT3A 4WW0A 2K9AA 1SA0E 3M65A 4IE5A 3D0TA 3N2KE 4UVAB 2PFVA 3ZCJA 4QWNB 2V7JA 3NZQA 4AKGA 4AKLA 1HFAA 5LHGB 2Q9QC 5FXZA 5KX5E 2YU2A 4QHOA 4UXNB 1LVFA 2C5KT 3CKDA 3N2GE 4IDZA 1T98A 1HF8A 4PK5A 2E9XC 1MMDA 2LM9A 4YLHA 5JVDE 5ETWA 4PJNA 3PU8A 4ISTA 3VKHA 4QX8B 4X1YE 2H3RA 3HKDE 3GMIA 3E0ZA 4UELA 3R6NA 3PDYA 4HGAA 5L3CB 4EYUA 3LFMA 1UX5A 4A56A 2CLYC 5LHHB 2LJLA 2VKHA 4X20E 2QA7A 3N9LA 5L2LA 3N9NA 3IBPA 2D0UA 2HPLA 3ZJ2A 2HH7A 3Q5XA 4EZ4A 4O2BE 4OK0A 3ONXA 4M1PA 2P9BA 3O1IA 2DHRA 2K48A 4CZZB 3PUQA 5DQVA 4UIGA 3JC6C 3C50A 4ERRA 4ZI3D 1AJ3A 2KZ7B 4AKHA 3GA8A 4JUYA 4KP3C 4ZOLE 3E22E 4YFSA 3T8OA 4CXWA 3Q2MA 1BR2A 3ZN1B 5HXCA 2K24A 3AVSA 3S4UA 5FY1A 2LSYA 2QGSA 4J2CA 4MFRA 1US7B 3ZEFB 2V26A 1YKEB 4UVBB 2X9WA 1QSDA 3CX8B 4FJOA 1FIOA 3KVBA 4IE4A 2DNXA 2ODUA 4JEHB 4IGUA 3I9WA 4K0UA 3RPUA 3ZJ1A 4MLKA 3QK6A 4CQIA 2PBIA 2X0LB 2LEHA 3N5LA 3F31A 2PJQA 3MXZA 3UFEA 2CXFA 3PUAA 3NBXX 4U72A 2CWOA 5LG4A 3MJXA 2B1EA 5HAXA 1FMVA 3AAEB 5DABA 4AXPA 3N2OA 3AA1B 3J9X1 2LSIA 3SS1A 3RX6A 3ZCIA 1O3XA 2KWHA 4PJJA 5LGNB 4EOZB 3KV9A 3RYHE 2XTLA 3PTRB 4EAHA 4IE6A 2C5JA 3J7Yq 3AA0B 4WBOA 4O4IE 4DMVA 2L8KA 1Z0PA 2JPFA 1IJ6A 2WWUA 4TX5A 3AA7B 4CI2B 2V7MA 5LBQB 3N9PA 5DQWA 2VB6A 2XASB 2DWGA 2X66A 3KINB 4YJ3E 1SHZC 1OXZA 4NUUA 2XAQB 5JR9A 4JEUB 4H9OC 4MBQA 3U3IA 2KLQA 1D0YA 3RH3A 2LOPA 4NUVA 4BJNA 5F8PA 5HYAA 4ADZA 4TV8E 2IC6A 1BR4A 1UX4A 3UUNA 3UUMA 1NWMX 4OYJA 5JQGE 3PE0A 5CA0E 3V5UA 2BVLA 2MYSA 3HKBE 4P0BA 2VWAA 3IEEA 3L09A 5KDMC 2YK0A 1D1CA 4L0RA 2UXNB 3LK3B 4PJLA 2D2SA 2A2FX 5JR9B 1MIVA 5L3DB 3CX6B 3RYIE 2C5IT 2SPCA 2MBGA 1Y64B 2JRKA 1D0XA 4UV9B 4V1Av 2JMHA 2RP4A 1HX8A 2KXPB 4GK0E 2NOXA 3SOLA 1IZNB 2N1GA 4ANJA 2KNDA 4IE0A 2XUEA 1EZ3A 2LHNA 3CQGB 5HXHA 4ISSA 5J1GA 3F57A 2WAUA 3ZPOA 3ZMUB 3A5XA 3L3PA 3RYCE 4C90A 3ZC0A 4WBNE 2V1DB 3OKQA 4DBQA 4UV8B 4ILUA 1KK7A 1BR1A 4HN9A 1LRZA 3FBLA 4DO0A 5LGUB 5EK2A 3C4ZA 5LGTB 3FHNA 3DJBA 1D0ZA 3LJCA 5CA1E 3I0QA 1NAFA 1QUUA 2JJ9A 2BVMA 1X79A 3O1HA 3WI3A 2Q9QA 1FEWA 2KWIB 2W0GA 4PW8A 3UTKA 3WAKA 1ZHCA 4OHFA 4QXHB 2BDEA 2VKOA 4KUMB 1MMAA 2NW7A 2E9XA 3KV4A 2LOSA 4H9SE 2Y6XA 3N9OA 3JC6D 3NRXA 3K3QC 4GK5E 4IHJE 2XAHB 1IAPA 3PUGA 5AFUL 3VU7H 5LBMA 4AI6A 3BK9A 3ZN0B 4BAYB 1ZKEA 3I9YA 4Z8XA 5JRCA 2D0TA 5FXXA 5FXWA 4CXXA 1HS7A 2WM9A 4DVDA 2WMNA 4QX7B 5E0OA 5M4YA 1KNZA 3LBXA 5HXEA 4DMWA 4H9RC 4XAXB 2JMKA 3SWHA 3ZMZB 2DWKA 3BQLA 4O4HE 5LYJE 5JRCB 1IJ5A 2YEVC 3U78A 3IHRA 5IHYA 3W15B 4N78D 3GWHA 3BQKA 1MIYA 1V9DA 4HTEA 3K3OA 3I0OA 1LVKA 3UT5E 3BQIA 4O2AE 2I59A 1FMWA 5F3JA 5FYMA 4B6XA 3ZC1A 2C0SA 3CQXC 5L3GB 1VOMA 3I1AA 2W61A 4PJMA 3RYFE 5FXVA 4CI1B 4JLEA 2IAKA 4G63A 5KMGP 5LNKA 3RRCA 2VL8A 3H37A 5EZYE 2IW5B 3HA4A 5FY0A 4G2AA 4ZS2A 3FXDB 4HKAA 2Z6EA 2JQQA 2L3LA 2D5UA 4O4JE 2CM0A 1WYBA 4QXBB 2L9QA 2NWBA 3NRYA 3NZPA 3KDSE 3KFWX 2W63A 3DTOA 3P7IA 3RKOA 4WNKA 3O4XE 5J2TE 2EHOD 4I43B 4ZI2C 3CQCB 4KMCA 1MNEA 4FI5A 2G0UA 5JDNA 4AQFC 4ZHQE 4H63V 3Q5WA 2RA1A 4GYRA 4GYSA 4UF0A 2M67A 2MOZA 3HL6A 5GONE 4L5GA 3UUXB 2H7VC 5IYZE 3O9XA 2VKJA 2NW9A 4E7ZA 1VRBA 1WRDA 2WSSV 2ZLYA 3SRZA 5LJNA 3P8CD 1WR6A 5BMVE 4HEAA 3TKLB 2GK9A 3F2EA 2X9HA 4I55E 4O4LE 5HXSA 4PFPA 2Y8DA 2EHOA 5H6RB 3HKCE 2X51A 2ZM8A 1MNDA 5JDQA 4F6RC 4XZCA 5L3FB 2E8IA 3RC3A 2DI4A 3HI2A 2W62A 3EVYA 3B57A 3FB2A 4ZS3A 2Q9QD 2WBLA 2MTQA 4UF0B 5CB4E 2H7OA 5LHIB 2XAGB 1U5PA 3ESLA 1HG5A 4H9PC 2E9XD 1YD8G 4P0AA 2X67A 1S94A 3N9QA 2V7IA 5TAOA 4TUYE 2J1DG 1G73A 4YHJA 2DCFA 1BR0A 1OWAA 5H6QB 2EHOB 3OJAA 3K8PC 3RRWA 2N9DA 3EDUA 2ES0A 3MA9A 3VKGA 1CUNA 2X9YA 3OYZA 4DBRA 4E7SA 3C98B 3HR0A 4BA9A 1HCIA 3ETUA 3KV5A 3WAJA 4I50E 2YU1A 2X9XA 5J2UE 2N2NA 3EUHA 4MHCA 1MMGA 1B7TA 1WYCA 2W00A 2ZM0A 3AAIA 4YJ2E 1U4QA 5JDFA 3QUJA 2HPJA 2DLRA 3E08A 3ZMVB 1H7CA 2Q9QB 2Y48B 2XQYA 4AKRB 2CMRA 5FY7A 2K5BB 2ODVA 3RC8A 4UVCB 1LKXA 3ZMTB 1D1BA 3B13A 4PK4A 5LJMA 3C64A 2E9XB 1ZV4X 2X68A 3ZYLA 3C51A 5FMNA 4ZI3C 2NTXA 2V7KA 4H9QC 4GOUA 4TN7B 2CA5A 2IC9A 4OFZA 1E1HB 4XBFB 2ZMAA 4TZ4C 5EK4A 3AAAB 5JDGA 2CLYB 2NW8A 2XHEB 3AA6B 3CVRA 3ANWA 3FXEB 3H3AA 3CWZB 3CPZA 2LHRA 3PU3A 4X1KE 3UULA 3ZYKA 3VHLA 4EB6E 4EXTA 4EZHA 2KINB 4EYYR 3KBUA 3LBXB 2LE8A 3MK7C 4I4TE 3ZYMA 5ADXL 4PK6A 4AQGA 2XAFB 4CXYA 2CWYA 3AB3B 4PNIA 1G8XA 4X1IE 3MZKB 2PG8A 2NP9A 4CI3B 5LOVE 3MKDA 5HXRA 3LK42 4HE8A 5LCYA 1YW0A 3KV6A 3QC9A 4ASKA 2VKDA 3C4WA 2YINA 3ZLIA 2CE7A 4HFVA 3ANWB 5JR9C 5HWYA 4MALA 2A72A 3FBZA 4H9NC 5JDLA 3HKEE 1YKHB 5HWXA 4UEMA 4IE7A 2KT9A 2CXDA 2VK9A 4ZI2D 4OYKA 4L9IA 1MIWA 5JH7E 4BJMA 3GN5A 2CCQA 3CMLA 4QKNA 4U74A 1HG2A 3C4XA 3KBTA 2A3DA 3Q9DA 1HTJF 3AVRA 4ZI7E 5JREA 5JDMA 2KMFA 3CX7B 3N9MA 3ZMSB 3OBVE 4AKIA 3V5SA 5A1LA 4PFOA 3OYXA 2ZM2A 4DNDA 5EK3A 3PUSA 3R84B 4C91A 5LXTE 3IF8B 1WLXA 2LSJA 3MACA 2EHOC 1UCUA 2BZBA 4P09A 1D1AA 2V7LA 5C8YE 4PAGA 5FNVE 3DP7A 4AQFA 5LP6E 2CEAA 5L3BB 4EIWA 2VASA 3EDVA 2LSKA 3LK2B 2ACXA 3GN5B 3ETVA 3PURA 2OA5A 4KBMB 2WMOA 5FP3A 4QXCB 5JDHA 3K3NA 4H63H 5L3EB 4IIJE 3O1JA 5LA6E 3KVAA 2CXLA 3LG7A 2UXXB 1MMNA 2XAJB 2NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S35 A;  2SPC A;  1OWA A;  1U4Q A;  1QUU A;  3UUL A;  1WLX A;  3LBX B;  1CUN A;  3LBX A;  2ODV A;  3FB2 A;  3EDV A;  3UUN A;  1HCI A;  2ODU A;  3UUM A;  3PE0 A;  3F31 A;  1U5P A;  1AJ3 A; 
#chains in the Genus database with same CATH topology
 3FZL B;  4O8S A;  2K9A A;  3N2K E;  3AE9 A;  2CHN A;  4LML A;  3NZQ A;  4DR2 T;  5LHG B;  2Q9Q C;  3LSV A;  2OV9 A;  1LVF A;  3N2G E;  1UUR A;  4PK5 A;  4JI4 T;  1MMD A;  2BKN A;  2LM9 A;  4PJN A;  4IST A;  4QX8 B;  4EED A;  1KNP A;  1M7K A;  1UX5 A;  4A56 A;  3VR9 A;  2J4G A;  2LJL A;  2VKH A;  5L2L A;  1J5W A;  3IBP A;  2HPL A;  3K1S A;  5AQP B;  5AQK B;  2LKG A;  4ERR A;  2KZ7 B;  4JUY A;  2BBJ A;  3ZN1 B;  5AQL B;  2LSY A;  2QGS A;  4J2C A;  4YXD A;  1FIO A;  3NKZ A;  2DNX A;  3QB5 A;  4JEH B;  3QK6 A;  4IRE A;  3P4P A;  3F31 A;  3MXZ A;  1UK5 A;  4U72 A;  2UXD T;  4U2Z A;  3AA1 B;  3J9X 1;  3SS1 A;  3ZCI A;  5L4E A;  5HEJ A;  1ZP0 A;  2XTL A;  3PTR B;  4DID B;  2XY8 B;  4JI6 T;  3AA0 B;  2L8K A;  3RF1 A;  4TX5 A;  3AA7 B;  4CI2 B;  3N9P A;  4HFE A;  3PUX F;  3RIF A;  1SHZ C;  1OXZ A;  4H9O C;  4JBW F;  4B3T T;  1FJG T;  4ZZB A;  1D0Y A;  5KXJ A;  3RH3 A;  1OED A;  4BJN A;  5HYA A;  4HWD A;  5JQG E;  4P0B A;  2VWA A;  3L09 A;  2UXN B;  3LK3 B;  2A2F X;  2SPC A;  2RP4 A;  4JI3 T;  4HWH A;  4ANJ A;  2E2A A;  1EZ3 A;  4HFD A;  4Z90 A;  3F57 A;  3A5X A;  3AXJ A;  3ZC0 A;  4DBQ A;  4DO0 A;  1LRZ A;  3EAB A;  3C4Z A;  2WWV A;  4DV4 T;  1YXR A;  5CA1 E;  2FBW A;  2CBI A;  3WAK A;  1ZHC A;  4QXH B;  4KUM B;  2E9X A;  3N9O A;  4GK5 E;  3PUG A;  3VU7 H;  5FL0 A;  3BK9 A;  1ZKE A;  4DV1 T;  2D0T A;  5AQU B;  1HS7 A;  1KNZ A;  3UQ7 A;  5HEO A;  2BS2 A;  4O4H E;  3GWH A;  3M3Z B;  3BQK A;  1V9D A;  3BQI A;  3QB5 K;  4O2A E;  3ZC1 A;  2C0S A;  3CQX C;  4CI1 B;  5AQM B;  3FZH B;  4JLE A;  5KMG P;  5EZY E;  2IW5 B;  2WY2 A;  3HA4 A;  4TNW A;  5AQR B;  3ZT6 A;  4ZS2 A;  4I0U A;  3VRA A;  2MAW A;  2Z6E A;  1KFY A;  1WYB A;  1IBL T;  2XQ8 A;  2NWB A;  3AE8 A;  3KDS E;  3RKO A;  3RIA A;  5AQH B;  4ZI2 C;  2BG9 A;  3Q5W A;  4JI8 T;  3AE5 A;  4DR7 T;  2M67 A;  2MOZ A;  3JCF A;  5GON E;  2H7V C;  2VKJ A;  4NIQ A;  3SRZ A;  2WSS V;  3UFG A;  3HKC E;  4EEB A;  3ONJ A;  4LF4 T;  2WBL A;  2MTQ A;  5ABG A;  3AEA A;  4COF A;  4NXM T;  2E9X D;  5TAO A;  1OWA A;  4IDQ A;  5ABF B;  3PJA A;  3MA9 A;  3VKG A;  4GKK T;  3ETU A;  4WZX A;  4ZEY A;  4JI7 T;  2YU1 A;  5J0Z A;  5J2U E;  4MHC A;  1U4Q A;  5JDF A;  2HPJ A;  3ZMV B;  2Y48 B;  2XQY A;  1J5E T;  2ODV A;  5L47 A;  5LMU T;  3T1H T;  5FMN A;  3JAE A;  4ILB A;  3UUB A;  4TN7 B;  2IC9 A;  2RPA A;  4A5X A;  2XHE B;  1HNZ T;  3FXE B;  3CWZ B;  4EXT A;  4EB6 E;  3SFE A;  3KBU A;  1W0B A;  3MK7 C;  5ADX L;  2XAF B;  3AB3 B;  4HWC A;  3LK4 2;  4DR1 T;  2CBJ A;  3KV6 A;  2X0Y A;  2XZE A;  2VKD A;  3C4W A;  2LKH A;  2BKP A;  3ZLI A;  2CE7 A;  4TWF A;  1WCR A;  5JDL A;  3HKE E;  5HWX A;  5IWA T;  2CXD A;  4NPP A;  5JH7 E;  3RHW A;  2K3W A;  3AVR A;  2HN2 A;  3CX7 B;  3AE2 A;  3ZMS B;  3OBV E;  4DV7 T;  3VR8 A;  5EK3 A;  1WLX A;  3MAC A;  4PAG A;  4EIW A;  3EDV A;  3ETV A;  5JDH A;  3KVA A;  2UXX B;  1ZEE A;  1S35 A;  5DJQ C;  3M65 A;  4LFA T;  4UVA B;  2VQE T;  3ZCJ A;  4U33 A;  1HFA A;  5FXZ A;  5KX5 E;  1T98 A;  4B3R T;  2W67 A;  1HX1 B;  3PU8 A;  2D9D A;  3HKD E;  2JQH A;  3PDY A;  4HGA A;  2AE9 A;  3RIU A;  2QA7 A;  3N9N A;  3SFD A;  2D0U A;  4OX9 T;  2HH7 A;  3Q5X A;  2HN1 A;  1NEN A;  4M1P A;  3RKG A;  2K48 A;  2CHO A;  5DQV A;  3QNU A;  3JC6 C;  1AJ3 A;  4AKH A;  3GA8 A;  3T8O A;  4CXW A;  1BR2 A;  3S4U A;  3ONL C;  3ZEF B;  2V26 A;  5HEH A;  1QSD A;  3KVB A;  3OTO T;  4K0U A;  4YY3 T;  2LEH A;  3PUA A;  2CWO A;  5LG3 A;  4X66 T;  5DAB A;  3N2O A;  5AQI B;  1XDP A;  4QH5 A;  3RX6 A;  2IIU A;  5AQJ B;  4QH4 A;  4PJJ A;  1R8I A;  4Q25 A;  4EAH A;  4IE6 A;  3RQU A;  2YOE A;  5JTG A;  4WBO A;  4O4I E;  4NXN T;  2XSA A;  4LF9 T;  2WWU A;  5LBQ B;  2VB6 A;  2XAS B;  2X66 A;  3KIN B;  4KHZ F;  4NUU A;  5JR9 A;  3U3I A;  3ZT7 A;  4NUV A;  1UX4 A;  4TWD A;  3PE0 A;  1T7S A;  2BVL A;  2MYS A;  3IEE A;  4TWH A;  1D1C A;  3PUY F;  2C5I T;  1ZOY A;  2ACZ A;  2JMH A;  2KXP B;  4GK0 E;  4YTN A;  4ISS A;  5J1G A;  3ZPO A;  4HFB A;  2V6Y A;  3AEB A;  5C3J A;  4UV8 B;  4ILU A;  1D0Z A;  3LJC A;  1NAF A;  3QOF A;  1YQ4 A;  5C2T A;  3FZF B;  1X79 A;  3WI3 A;  3P4Q A;  1FEW A;  2KWI B;  3A7M A;  3UTK A;  4WYV A;  4JI0 T;  2BDE A;  2VKO A;  3KV4 A;  3NRX A;  3K3Q C;  2XAH B;  4Z91 A;  5LBM A;  4DV3 T;  3PUW F;  2WMN A;  4QX7 B;  5HXE A;  1XMQ T;  2DWK A;  3U78 A;  3IHR A;  5IHY A;  4N78 D;  3AEF A;  1LVK A;  3TLS A;  5FL1 A;  2I59 A;  4B6X A;  5L3G B;  4IT4 A;  2J62 A;  3RYF E;  5FXV A;  4B3M T;  5CJ5 A;  5FKY A;  5FY0 A;  4G2A A;  1Y01 A;  3FXD B;  5CFB A;  4LMK A;  2D5U A;  4YSZ A;  2CM0 A;  4JI5 T;  1T72 A;  2L9Q A;  4X62 T;  3NZP A;  2WCA A;  3KFW X;  2XQA A;  3P7I A;  4WNK A;  3O4X E;  5J2T E;  4FI5 A;  2G0U A;  4AQF C;  2WU5 A;  4YSY A;  2WDQ A;  4H63 V;  4GYR A;  2RA1 A;  4X64 T;  3HL6 A;  2CPT A;  5IYZ E;  3O9X A;  3L39 A;  1XNR T;  1WRD A;  3P8C D;  4O4L E;  2X9H A;  4JV5 T;  2Y8D A;  4DV6 T;  1MND A;  5JDQ A;  4F6R C;  3RC3 A;  3HI2 A;  2W62 A;  3EVY A;  2XSB A;  4A98 A;  4UF0 B;  5LHI B;  1U5P A;  1S94 A;  5LMN T;  1HNX T;  1T8B A;  2EHO B;  2YDS A;  3OJA A;  1HR0 T;  3RRW A;  2N9D A;  3EDU A;  3OYZ A;  4E7S A;  3C98 B;  3KV5 A;  2QYW A;  1KNR A;  3WAJ A;  2BG9 E;  4I50 E;  3OVU A;  2X9X A;  4YJ2 E;  2ZM0 A;  4DR5 T;  3QUJ A;  3E08 A;  1H7C A;  2Q9Q B;  4K0K T;  2CMR A;  4YT0 A;  4UVC B;  2E5L T;  5LJM A;  2X68 A;  3ZYL A;  3C51 A;  4ZI3 C;  2NTX A;  4XBF B;  2ZMA A;  4TZ4 C;  5EK4 A;  2NW8 A;  3TLW A;  4X1K E;  3PU3 A;  4P1N A;  3CPZ A;  2LHR A;  3ZYK A;  3UU5 A;  1N32 T;  5LB7 B;  3LBX B;  4I4T E;  4CXY A;  3H3M A;  1G8X A;  4X1I E;  3MZK B;  2PG8 A;  2NP9 A;  4CI3 B;  3MKD A;  2PTF A;  4HE8 A;  4U3C A;  5LCY A;  3X1D A;  2YIN A;  3ANW B;  5HWY A;  2A72 A;  4H9N C;  1YKH B;  4X65 T;  1OED C;  4ZI2 D;  4U2Y A;  2V8S V;  2WDR A;  1XDO A;  3GN5 A;  2CCQ A;  3CML A;  4DUZ T;  4U74 A;  1HG2 A;  3C4X A;  1HTJ F;  4CN6 A;  4LF6 T;  3UU8 A;  3V5S A;  4PFO A;  4DND A;  5LXT E;  2LSJ A;  2BZB A;  4P09 A;  1HNW T;  2V7L A;  5FNV E;  3DP7 A;  2VAS A;  2WMO A;  4H63 H;  5L3E B;  3TLU A;  5LA6 E;  2X0H A;  2CXL A;  1MMN A;  4TV9 E;  4GIW A;  2BS3 A;  2LSG A;  4WW0 A;  4IE5 A;  3AEC A;  4AKL A;  2FJB A;  3A8Y C;  3ABV A;  4QHO A;  2WDV A;  5AQF B;  2C5K T;  4IDZ A;  2E9X C;  2XQ5 A;  4YLH A;  5JVD E;  5ETW A;  3P4R A;  1QLB A;  5AQQ B;  1I6Z A;  3AE7 A;  2H3R A;  3GMI A;  3E0Z A;  4UEL A;  2VUR A;  3PUZ F;  3R6N A;  3LFM A;  2CLY C;  5LHH B;  4EGW A;  3N9L A;  1KF6 A;  2BKO A;  3O1I A;  2DHR A;  4CZZ B;  3PUQ A;  4UIG A;  3P50 A;  2J47 A;  4DV2 T;  4YFS A;  4DR3 T;  1GQE A;  5HXC A;  2K24 A;  3AVS A;  1X9B A;  1US7 B;  2VVN A;  1YKE B;  3ZSS A;  3CX8 B;  4IE4 A;  2ODU A;  5CGM A;  4IGU A;  3I9W A;  3RPU A;  3ZJ1 A;  4MLK A;  1N36 T;  1N33 T;  4CQI A;  2PBI A;  2CXF A;  5AQT B;  3ZST A;  4JI1 T;  1J1J A;  1FMV A;  2BBH A;  5HAX A;  3AAE B;  4HFI A;  1O3X A;  2KWH A;  5F5W A;  4EOZ B;  3RYH E;  2BG9 C;  2C5J A;  2W2U A;  4DMV A;  2IUB A;  2XQ4 A;  4YJ3 E;  4DV5 T;  3OPC A;  4JEU B;  3Q5E A;  2KLQ A;  4X5T A;  2KSR A;  2LOP A;  4AQY T;  2DL1 A;  4DV0 T;  4ADZ A;  4TV8 E;  2IC6 A;  1BR4 A;  2IHR 1;  3UUN A;  3UUM A;  4OYJ A;  3V5U A;  5KDM C;  3HKB E;  3G06 A;  4L0R A;  4YSX A;  4YHH T;  5L3D B;  3CX6 B;  3UU4 A;  1Z8U A;  2MBG A;  2JRK A;  4UV9 B;  4IDO A;  2WQY A;  2NOX A;  1IZN B;  2N1G A;  2KND A;  1M62 A;  5HXH A;  2WAU A;  3ZMU B;  1XNQ T;  2VVS A;  5IUX A;  5BR8 T;  3OKQ A;  1KK7 A;  4HN9 A;  5LGU B;  3FBL A;  5EK2 A;  3FHN A;  5AQN B;  2XQ7 A;  2BVM A;  3O1H A;  3RI5 A;  2Q9Q A;  2W0G A;  4PW8 A;  4CN1 A;  4OHF A;  2NW7 A;  2LOS A;  4H9S E;  3JC6 D;  2W66 A;  3NVO A;  4IHJ E;  1IAP A;  3AED A;  5AFU L;  3ZN0 B;  4BAY B;  4Z8X A;  5FXX A;  5FXW A;  2WM9 A;  3LBX A;  4U31 A;  2JMK A;  3SWH A;  3ZMZ B;  2XM2 A;  1IBM T;  3W15 B;  1MIY A;  1FMW A;  5F3J A;  1VOM A;  2XPK A;  4PJM A;  4YTM A;  2WP9 A;  4G63 A;  3AE6 A;  2VL8 A;  3H37 A;  3FZM B;  2JQQ A;  2L3L A;  4O4J E;  4QXB B;  3CK6 A;  2EHO D;  4I43 B;  3CQC B;  4HFC A;  3VRB A;  5JDN A;  4DUY T;  4ZHQ E;  4L5G A;  2CRB A;  4JYA T;  4GKJ T;  2NW9 A;  4E7Z A;  2FJE A;  2ZLY A;  3UQ4 A;  4ZZC A;  4KI0 F;  2YKS A;  4HEA A;  3TKL B;  4B3S T;  2GK9 A;  3F2E A;  4I55 E;  5HXS A;  4PFP A;  2X51 A;  2ZM8 A;  4EV6 A;  2BG9 B;  4XZC A;  5ABF A;  2DI4 A;  1NEK A;  3B57 A;  3FB2 A;  4ZS3 A;  2Q9Q D;  3PUV F;  1WR0 A;  3ESL A;  1HG5 A;  4H9P C;  2FUP A;  1YD8 G;  4P0A A;  2X67 A;  4TUY E;  2J1D G;  2IDO B;  4YHJ A;  2DCF A;  5H6Q B;  2NR4 A;  3K8P C;  3RIU C;  2M6I A;  1HCI A;  3PV0 F;  4CN4 A;  1OED E;  4DR6 T;  2XJ7 A;  4F8H A;  1W0A A;  2N2N A;  2WB5 A;  3EUH A;  1MMG A;  1B7T A;  3PJA J;  2DLR A;  1UGO A;  4KHP T;  4AKR B;  4HFH A;  2K5B B;  3RC8 A;  1LKX A;  1D1B A;  3B13 A;  4PK4 A;  3C64 A;  2V7K A;  4H9Q C;  2B76 A;  4GOU A;  5HCJ A;  1VCT A;  3UU3 A;  2XQ3 A;  4OFZ A;  2MPK A;  5JDG A;  3AA6 B;  3UUL A;  3CVR A;  3H3A A;  5JRC B;  2I0M A;  4EYY R;  2LE8 A;  3ZYM A;  4AQG A;  4PNI A;  5HXR A;  1YW0 A;  2HHH T;  4ASK A;  1KEY A;  5JR9 C;  2UU9 T;  4A97 A;  4MAL A;  5AQG B;  3FBZ A;  1JNZ A;  4OYK A;  4L9I A;  4QKN A;  3KBT A;  3RQW A;  4ZI7 E;  3JAF A;  3N9M A;  4AKI A;  4LF8 T;  5A1L A;  3OYX A;  3PUS A;  4C91 A;  3IF8 B;  1UCU A;  1D1A A;  2WZH A;  2JQ9 A;  5LP6 E;  5L3B B;  3LK2 B;  2V5C A;  4KBM B;  4QXC B;  2XAJ B;  2NTY A;  2LT3 A;  1SA0 E;  4IL9 A;  3D0T A;  2PFV A;  4IDN A;  4QWN B;  2V7J A;  4AKG A;  3RLF F;  2A9U A;  2LRL A;  2YU2 A;  3NWI A;  4UXN B;  2WU2 A;  3CKD A;  4AIU A;  1HF8 A;  3VKH A;  4X1Y E;  5L3C B;  4EYU A;  4LMJ A;  3P4S A;  4X20 E;  2ZM6 T;  3ZJ2 A;  4LFC T;  4EZ4 A;  4O2B E;  4OK0 A;  3ONX A;  4ILC A;  2P9B A;  2VL0 A;  3C50 A;  4ZI3 D;  4KP3 C;  4ZOL E;  3E22 E;  2UXC T;  2YDR A;  3Q2M A;  5FY1 A;  4MFR A;  3Q5D A;  4UVB B;  2X9W A;  4FJO A;  4TNV A;  1XZY A;  2BS4 A;  1SE7 A;  2X0L B;  3N5L A;  2PJQ A;  3UFE A;  1YQ3 A;  2W4X A;  3EI0 A;  3NBX X;  5LG4 A;  3MJX A;  4LF5 T;  2B1E A;  2FJD A;  4AXP A;  2LSI A;  2XM1 A;  2VQF T;  2QVA A;  5LGN B;  3IA3 A;  4U7Y A;  5ABH A;  3P4W A;  3KV9 A;  3J7Y q;  1Z0P A;  2JPF A;  1IJ6 A;  2V7M A;  4IDP A;  5DQW A;  2DWG A;  3JAD A;  2XAQ B;  4MBQ A;  5F8P A;  2UUB T;  3RGL A;  2UXB T;  1NWM X;  4LFB T;  2M6B A;  5CA0 E;  2YK0 A;  3AEG A;  4PJL A;  2D2S A;  5JR9 B;  1MIV A;  2R6G F;  4IL4 A;  3RYI E;  1Y64 B;  2LM2 A;  1D0X A;  4V1A v;  1HX8 A;  2I6H A;  5AQO B;  1XWM A;  3SOL A;  4IE0 A;  2XUE A;  2LHN A;  3CQG B;  3LDQ B;  4QH1 A;  3L3P A;  3RYC E;  4C90 A;  4WBN E;  2V1D B;  3FZK B;  1BR1 A;  5LGT B;  4LF7 T;  3DJB A;  1W9R A;  3I0Q A;  1QUU A;  2JJ9 A;  3ZT5 A;  1MMA A;  5ABE A;  2V6Y B;  2Y6X A;  4ILA A;  4AI6 A;  2LLY A;  3I9Y A;  5JRC A;  1VCS A;  4CXX A;  4DVD A;  5E0O A;  5M4Y A;  4DMW A;  3EAM A;  4H9R C;  4XAX B;  2UUC T;  3BQL A;  5LYJ E;  1IJ5 A;  2YN6 A;  2YEV C;  1N34 T;  4HTE A;  3ZKR A;  3K3O A;  3T1Y T;  2WS3 A;  3I0O A;  2F4V T;  3UT5 E;  1W09 A;  2E5V A;  5FYM A;  5HEU A;  1CHU A;  3I1A A;  2W61 A;  1DU2 A;  2IAK A;  5LNK A;  3RRC A;  4HWI B;  1E2A A;  4HKA A;  3AEE A;  4UR9 A;  1UUS A;  3NRY A;  5FVL A;  2W63 A;  3DTO A;  4KMC A;  1MNE A;  4GYS A;  4UF0 A;  4KX6 A;  3UUX B;  3L8R A;  1VRB A;  5LJN A;  1WR6 A;  5BMV E;  2WZI A;  2EHO A;  2H88 A;  5H6R B;  1I94 T;  1OED B;  2V5D A;  5L3F B;  2E8I A;  2JIW A;  4U7I A;  2H89 A;  5CB4 E;  4DR4 T;  2H7O A;  2XAG B;  3EHZ A;  4HWF A;  2OLT A;  3N9Q A;  2V7I A;  1G73 A;  5FVK A;  1BR0 A;  2ES0 A;  1CUN A;  2X9Y A;  4DBR A;  3HR0 A;  4BA9 A;  1XMO T;  3AXJ B;  3AE3 A;  1WYC A;  2W00 A;  3AAI A;  4AIS A;  2AXD S;  2XQ6 A;  3AE4 A;  5FY7 A;  3ZMT B;  2UUA T;  1L0V A;  3UU6 A;  2E9X B;  1ZV4 X;  2CA5 A;  1E1H B;  3AAA B;  2CLY B;  3ANW A;  1IBK T;  3VHL A;  4EZH A;  2KIN B;  3CIR A;  1JNR A;  3TLT A;  4PK6 A;  5AQS B;  1SUM B;  2CWY A;  2V6X A;  5LOV E;  2FJA A;  4JI2 T;  3QC9 A;  5AQV B;  4ZXL A;  3AE1 A;  4HFV A;  2IML A;  3B5M A;  5L4H A;  2LRK A;  1WFD A;  4UEM A;  4IE7 A;  2KT9 A;  2VK9 A;  1MIW A;  4BJM A;  2YDQ A;  2QRX A;  1E7P A;  2A3D A;  3Q9D A;  5JRE A;  5JDM A;  2KMF A;  5HEG A;  4YTP A;  2ZM2 A;  3R84 B;  2EHO C;  5HCM A;  5C8Y E;  4AQF A;  2CEA A;  2XQ9 A;  2LSK A;  3GN5 B;  3PUR A;  2OA5 A;  5FP3 A;  3TLV A;  3K3N A;  4IIJ E;  3O1J A;  3LG7 A;  2JQK A;  2ACX A; 
#chains in the Genus database with same CATH homology
 1ZEE A;  4TV9 E;  4GIW A;  1S35 A;  4O8S A;  5DJQ C;  2LSG A;  2LT3 A;  4WW0 A;  2K9A A;  1SA0 E;  3M65 A;  4IE5 A;  3D0T A;  3N2K E;  4UVA B;  2PFV A;  3ZCJ A;  4QWN B;  2V7J A;  3NZQ A;  4AKG A;  4AKL A;  1HFA A;  5LHG B;  2Q9Q C;  5FXZ A;  5KX5 E;  2YU2 A;  4QHO A;  4UXN B;  1LVF A;  2C5K T;  3CKD A;  3N2G E;  4IDZ A;  1T98 A;  1HF8 A;  4PK5 A;  2E9X C;  1MMD A;  2LM9 A;  4YLH A;  5JVD E;  5ETW A;  4PJN A;  3PU8 A;  4IST A;  3VKH A;  4QX8 B;  4X1Y E;  2H3R A;  3HKD E;  3GMI A;  3E0Z A;  4UEL A;  3R6N A;  3PDY A;  4HGA A;  5L3C B;  4EYU A;  3LFM A;  1UX5 A;  4A56 A;  2CLY C;  5LHH B;  2LJL A;  2VKH A;  4X20 E;  2QA7 A;  3N9L A;  5L2L A;  3N9N A;  3IBP A;  2D0U A;  2HPL A;  3ZJ2 A;  2HH7 A;  3Q5X A;  4EZ4 A;  4O2B E;  4OK0 A;  3ONX A;  4M1P A;  2P9B A;  3O1I A;  2DHR A;  2K48 A;  4CZZ B;  3PUQ A;  5DQV A;  4UIG A;  3JC6 C;  3C50 A;  4ERR A;  4ZI3 D;  1AJ3 A;  2KZ7 B;  4AKH A;  3GA8 A;  4JUY A;  4KP3 C;  4ZOL E;  3E22 E;  4YFS A;  3T8O A;  4CXW A;  3Q2M A;  1BR2 A;  3ZN1 B;  5HXC A;  2K24 A;  3AVS A;  3S4U A;  5FY1 A;  2LSY A;  2QGS A;  4J2C A;  4MFR A;  1US7 B;  3ZEF B;  2V26 A;  1YKE B;  4UVB B;  2X9W A;  1QSD A;  3CX8 B;  4FJO A;  1FIO A;  3KVB A;  4IE4 A;  2DNX A;  2ODU A;  4JEH B;  4IGU A;  3I9W A;  4K0U A;  3RPU A;  3ZJ1 A;  4MLK A;  3QK6 A;  4CQI A;  2PBI A;  2X0L B;  2LEH A;  3N5L A;  3F31 A;  2PJQ A;  3MXZ A;  3UFE A;  2CXF A;  3PUA A;  3NBX X;  4U72 A;  2CWO A;  5LG4 A;  3MJX A;  2B1E A;  5HAX A;  1FMV A;  3AAE B;  5DAB A;  4AXP A;  3N2O A;  3AA1 B;  3J9X 1;  2LSI A;  3SS1 A;  3RX6 A;  3ZCI A;  1O3X A;  2KWH A;  4PJJ A;  5LGN B;  4EOZ B;  3KV9 A;  3RYH E;  2XTL A;  3PTR B;  4EAH A;  4IE6 A;  2C5J A;  3J7Y q;  3AA0 B;  4WBO A;  4O4I E;  4DMV A;  2L8K A;  1Z0P A;  2JPF A;  1IJ6 A;  2WWU A;  4TX5 A;  3AA7 B;  4CI2 B;  2V7M A;  5LBQ B;  3N9P A;  5DQW A;  2VB6 A;  2XAS B;  2DWG A;  2X66 A;  3KIN B;  4YJ3 E;  1SHZ C;  1OXZ A;  4NUU A;  2XAQ B;  5JR9 A;  4JEU B;  4H9O C;  4MBQ A;  3U3I A;  2KLQ A;  1D0Y A;  3RH3 A;  2LOP A;  4NUV A;  4BJN A;  5F8P A;  5HYA A;  4ADZ A;  4TV8 E;  2IC6 A;  1BR4 A;  1UX4 A;  3UUN A;  3UUM A;  1NWM X;  4OYJ A;  5JQG E;  3PE0 A;  5CA0 E;  3V5U A;  2BVL A;  2MYS A;  3HKB E;  4P0B A;  2VWA A;  3IEE A;  3L09 A;  5KDM C;  2YK0 A;  1D1C A;  4L0R A;  2UXN B;  3LK3 B;  4PJL A;  2D2S A;  2A2F X;  5JR9 B;  1MIV A;  5L3D B;  3CX6 B;  3RYI E;  2C5I T;  2SPC A;  2MBG A;  1Y64 B;  2JRK A;  1D0X A;  4UV9 B;  4V1A v;  2JMH A;  2RP4 A;  1HX8 A;  2KXP B;  4GK0 E;  2NOX A;  3SOL A;  1IZN B;  2N1G A;  4ANJ A;  2KND A;  4IE0 A;  2XUE A;  1EZ3 A;  2LHN A;  3CQG B;  5HXH A;  4ISS A;  5J1G A;  3F57 A;  2WAU A;  3ZPO A;  3ZMU B;  3A5X A;  3L3P A;  3RYC E;  4C90 A;  3ZC0 A;  4WBN E;  2V1D B;  3OKQ A;  4DBQ A;  4UV8 B;  4ILU A;  1KK7 A;  1BR1 A;  4HN9 A;  1LRZ A;  3FBL A;  4DO0 A;  5LGU B;  5EK2 A;  3C4Z A;  5LGT B;  3FHN A;  3DJB A;  1D0Z A;  3LJC A;  5CA1 E;  3I0Q A;  1NAF A;  1QUU A;  2JJ9 A;  2BVM A;  1X79 A;  3O1H A;  3WI3 A;  2Q9Q A;  1FEW A;  2KWI B;  2W0G A;  4PW8 A;  3UTK A;  3WAK A;  1ZHC A;  4OHF A;  4QXH B;  2BDE A;  2VKO A;  4KUM B;  1MMA A;  2NW7 A;  2E9X A;  3KV4 A;  2LOS A;  4H9S E;  2Y6X A;  3N9O A;  3JC6 D;  3NRX A;  3K3Q C;  4GK5 E;  4IHJ E;  2XAH B;  1IAP A;  3PUG A;  5AFU L;  3VU7 H;  5LBM A;  4AI6 A;  3BK9 A;  3ZN0 B;  4BAY B;  1ZKE A;  3I9Y A;  4Z8X A;  5JRC A;  2D0T A;  5FXX A;  5FXW A;  4CXX A;  1HS7 A;  2WM9 A;  4DVD A;  2WMN A;  4QX7 B;  5E0O A;  5M4Y A;  1KNZ A;  3LBX A;  5HXE A;  4DMW A;  4H9R C;  4XAX B;  2JMK A;  3SWH A;  3ZMZ B;  2DWK A;  3BQL A;  4O4H E;  5LYJ E;  5JRC B;  1IJ5 A;  2YEV C;  3U78 A;  3IHR A;  5IHY A;  3W15 B;  4N78 D;  3GWH A;  3BQK A;  1MIY A;  1V9D A;  4HTE A;  3K3O A;  3I0O A;  1LVK A;  3UT5 E;  3BQI A;  4O2A E;  2I59 A;  1FMW A;  5F3J A;  5FYM A;  4B6X A;  3ZC1 A;  2C0S A;  3CQX C;  5L3G B;  1VOM A;  3I1A A;  2W61 A;  4PJM A;  3RYF E;  5FXV A;  4CI1 B;  4JLE A;  2IAK A;  4G63 A;  5KMG P;  5LNK A;  3RRC A;  2VL8 A;  3H37 A;  5EZY E;  2IW5 B;  3HA4 A;  5FY0 A;  4G2A A;  4ZS2 A;  3FXD B;  4HKA A;  2Z6E A;  2JQQ A;  2L3L A;  2D5U A;  4O4J E;  2CM0 A;  1WYB A;  4QXB B;  2L9Q A;  2NWB A;  3NRY A;  3NZP A;  3KDS E;  3KFW X;  2W63 A;  3DTO A;  3P7I A;  3RKO A;  4WNK A;  3O4X E;  5J2T E;  2EHO D;  4I43 B;  4ZI2 C;  3CQC B;  4KMC A;  1MNE A;  4FI5 A;  2G0U A;  5JDN A;  4AQF C;  4ZHQ E;  4H63 V;  3Q5W A;  2RA1 A;  4GYR A;  4GYS A;  4UF0 A;  2M67 A;  2MOZ A;  3HL6 A;  5GON E;  4L5G A;  3UUX B;  2H7V C;  5IYZ E;  3O9X A;  2VKJ A;  2NW9 A;  4E7Z A;  1VRB A;  1WRD A;  2WSS V;  2ZLY A;  3SRZ A;  5LJN A;  3P8C D;  1WR6 A;  5BMV E;  4HEA A;  3TKL B;  2GK9 A;  3F2E A;  2X9H A;  4I55 E;  4O4L E;  5HXS A;  4PFP A;  2Y8D A;  2EHO A;  5H6R B;  3HKC E;  2X51 A;  2ZM8 A;  1MND A;  5JDQ A;  4F6R C;  4XZC A;  5L3F B;  2E8I A;  3RC3 A;  2DI4 A;  3HI2 A;  2W62 A;  3EVY A;  3B57 A;  3FB2 A;  4ZS3 A;  2Q9Q D;  2WBL A;  2MTQ A;  4UF0 B;  5CB4 E;  2H7O A;  5LHI B;  2XAG B;  1U5P A;  3ESL A;  1HG5 A;  4H9P C;  2E9X D;  1YD8 G;  4P0A A;  2X67 A;  1S94 A;  3N9Q A;  2V7I A;  5TAO A;  4TUY E;  2J1D G;  1G73 A;  4YHJ A;  2DCF A;  1BR0 A;  1OWA A;  5H6Q B;  2EHO B;  3OJA A;  3K8P C;  3RRW A;  2N9D A;  3EDU A;  2ES0 A;  3MA9 A;  3VKG A;  1CUN A;  2X9Y A;  3OYZ A;  4DBR A;  4E7S A;  3C98 B;  3HR0 A;  4BA9 A;  1HCI A;  3ETU A;  3KV5 A;  3WAJ A;  4I50 E;  2YU1 A;  2X9X A;  5J2U E;  2N2N A;  3EUH A;  4MHC A;  1MMG A;  1B7T A;  1WYC A;  2W00 A;  2ZM0 A;  3AAI A;  4YJ2 E;  1U4Q A;  5JDF A;  3QUJ A;  2HPJ A;  2DLR A;  3E08 A;  3ZMV B;  1H7C A;  2Q9Q B;  2Y48 B;  2XQY A;  4AKR B;  2CMR A;  5FY7 A;  2K5B B;  2ODV A;  3RC8 A;  4UVC B;  1LKX A;  3ZMT B;  1D1B A;  3B13 A;  4PK4 A;  5LJM A;  3C64 A;  2E9X B;  1ZV4 X;  2X68 A;  3ZYL A;  3C51 A;  5FMN A;  4ZI3 C;  2NTX A;  2V7K A;  4H9Q C;  4GOU A;  4TN7 B;  2CA5 A;  2IC9 A;  4OFZ A;  1E1H B;  4XBF B;  2ZMA A;  4TZ4 C;  5EK4 A;  3AAA B;  5JDG A;  2CLY B;  2NW8 A;  2XHE B;  3AA6 B;  3CVR A;  3ANW A;  3FXE B;  3H3A A;  3CWZ B;  3CPZ A;  2LHR A;  3PU3 A;  4X1K E;  3UUL A;  3ZYK A;  3VHL A;  4EB6 E;  4EXT A;  4EZH A;  2KIN B;  4EYY R;  3KBU A;  3LBX B;  2LE8 A;  3MK7 C;  4I4T E;  3ZYM A;  5ADX L;  4PK6 A;  4AQG A;  2XAF B;  4CXY A;  2CWY A;  3AB3 B;  4PNI A;  1G8X A;  4X1I E;  3MZK B;  2PG8 A;  2NP9 A;  4CI3 B;  5LOV E;  3MKD A;  5HXR A;  3LK4 2;  4HE8 A;  5LCY A;  1YW0 A;  3KV6 A;  3QC9 A;  4ASK A;  2VKD A;  3C4W A;  2YIN A;  3ZLI A;  2CE7 A;  4HFV A;  3ANW B;  5JR9 C;  5HWY A;  4MAL A;  2A72 A;  3FBZ A;  4H9N C;  5JDL A;  3HKE E;  1YKH B;  5HWX A;  4UEM A;  4IE7 A;  2KT9 A;  2CXD A;  2VK9 A;  4ZI2 D;  4OYK A;  4L9I A;  1MIW A;  5JH7 E;  4BJM A;  3GN5 A;  2CCQ A;  3CML A;  4QKN A;  4U74 A;  1HG2 A;  3C4X A;  3KBT A;  2A3D A;  3Q9D A;  1HTJ F;  3AVR A;  4ZI7 E;  5JRE A;  5JDM A;  2KMF A;  3CX7 B;  3N9M A;  3ZMS B;  3OBV E;  4AKI A;  3V5S A;  5A1L A;  4PFO A;  3OYX A;  2ZM2 A;  4DND A;  5EK3 A;  3PUS A;  3R84 B;  4C91 A;  5LXT E;  3IF8 B;  1WLX A;  2LSJ A;  3MAC A;  2EHO C;  1UCU A;  2BZB A;  4P09 A;  1D1A A;  2V7L A;  5C8Y E;  4PAG A;  5FNV E;  3DP7 A;  4AQF A;  5LP6 E;  2CEA A;  5L3B B;  4EIW A;  2VAS A;  3EDV A;  2LSK A;  3LK2 B;  2ACX A;  3GN5 B;  3ETV A;  3PUR A;  2OA5 A;  4KBM B;  2WMO A;  5FP3 A;  4QXC B;  5JDH A;  3K3N A;  4H63 H;  5L3E B;  4IIJ E;  3O1J A;  5LA6 E;  3KVA A;  2CXL A;  3LG7 A;  2UXX B;  1MMN A;  2XAJ B;  2NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...