2F4VT

30s ribosome + designer antibiotic
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2f4vT00
5IWAT 4JI8T 4JI1T 4JI5T 4DUYT 4DV1T 4B3RT 1IBKT 4AQYT 3T1YT 4JV5T 4LF8T 3OTOT 2VQFT 4OX9T 4LFCT 1XMOT 1XNQT 4JI2T 4DR7T 1FJGT 4YY3T 4NXNT 4DUZT 1N33T 4DR2T 4K0KT 2ZM6T 3T1HT 1IBLT 2UU9T 4LFAT 4JI0T 1HNZT 4X66T 4LF4T 4DR1T 4DR6T 4B3MT 4JI4T 4DV2T 4LFBT 2UUBT 2E5LT 4LF7T 2HHHT 1N36T 1IBMT 4JI7T 4DR5T 4LF6T 4DR4T 4X64T 4LF5T 2UXDT 4DV4T 4DV7T 1I94T 4DR3T 1HNWT 5BR8T 4JI6T 4JYAT 1XMQT 4DV0T 2UXCT 1N34T 4JI3T 5LMNT 4NXMT 4X62T 2F4VT 2VQET 4GKKT 4B3ST 1N32T 2UXBT 1HNXT 1XNRT 1J5ET 4X65T 4YHHT 5LMUT 2UUCT 4DV6T 2UUAT 4GKJT 4LF9T 1HR0T 4KHPT 4B3TT 4DV5T 4DV3T
chains in the Genus database with same CATH superfamily
5AQHB 3ONJA 3T1YT 2CA5A 5C8YE 3OTOT 4NUUA 3FBLA 5JDGA 3UU4A 1D1AA 2W62A 1YD8G 5L3CB 3QNUA 3SOLA 2ZM6T 3DTOA 1XDOA 3AEDA 1FIOA 2V8SV 2RP4A 3FZKB 3AE4A 3LDQB 3BQKA 2V6XA 5JVDE 3QUJA 4K0UA 4B3MT 3PUZF 4G2AA 3EAMA 3KINB 3PJAA 3TLWA 2LSJA 2X9YA 3NRXA 1IBMT 4TWHA 2B1EA 4LF5T 2I0MA 3TKLB 1QSDA 2KZ7B 3J7Yq 2V7KA 5DQVA 2CHNA 2F4VT 2VQET 3T8OA 5AQQB 3NZPA 2JQ9A 4X65T 4MHCA 3ZPOA 4U31A 2X66A 4EEBA 2NP9A 3KBTA 4IDOA 2LHRA 3PUWF 3RRWA 4A98A 1T7SA 3RYFE 2LM2A 3N9LA 5FY0A 4TNWA 2HPJA 3SFDA 4QX8B 4ZS3A 3CX7B 2X0LB 4ASKA 3CQXC 4IL4A 2D2SA 4CI1B 4IE5A 2QVAA 2E9XD 2CBJA 4M1PA 5FL0A 3JC6C 1V9DA 4GYSA 2JQKA 4UV8B 5A1LA 3CX6B 4IE4A 4K0KT 2BBHA 2XQAA 1HF8A 2V7MA 3IA3A 3Q5XA 5FXWA 1M7KA 4CXYA 2N1GA 2BS3A 2ACZA 4WW0A 2HN2A 3P50A 1WR6A 4O4LE 2ES0A 2YDSA 4CXWA 3ETVA 5AQNB 1IZNB 3KV4A 4X64T 1US7B 4KP3C 1OEDC 4AKIA 5ABEA 4ILUA 4PFPA 1Z8UA 3DP7A 4JI6T 4FJOA 3QB5K 1J1JA 2WY2A 3LFMA 1J5ET 4H9NC 2H3RA 4PW8A 4TX5A 5LMUT 2CXDA 3UU5A 3AA7B 3B13A 3AE7A 3GMIA 2ODVA 1D0ZA 1ZEEA 2WM9A 3N9NA 3BQLA 5AQRB 5L3DB 5FY7A 4UIGA 3C51A 3AE5A 1KK7A 3PUVF 4B6XA 2MTQA 2NW7A 4HKAA 4LFCT 3RX6A 3FZMB 3SS1A 2X9HA 4ILBA 4F6RC 4Z90A 4YJ3E 3PURA 5LJMA 2V6YB 4JLEA 2LEHA 5LGUB 2H89A 3AA1B 1MMDA 2XSAA 3SRZA 3ZJ1A 3U78A 2WCAA 2K3WA 2JRKA 2UUBT 2PFVA 2KMFA 2K24A 4U2YA 1WLXA 4DR4T 3AA6B 2WWUA 4IE0A 3OPCA 2V7LA 3A8YC 1SUMB 5ABFA 2LKHA 5DABA 1ZHCA 1N32T 4H63V 4A97A 4CN4A 4YHHT 4TUYE 3PUQA 4DV6T 4GKJT 4KHPT 3L3PA 1YW0A 2G0UA 3RH3A 4DV1T 3O1JA 3CX8B 1WFDA 3Q5EA 4LF8T 3AA0B 2YINA 3ABVA 4LMKA 4H9QC 3ZLIA 4O4IE 3UFGA 1NENA 2JMHA 4U3CA 5J1GA 4EGWA 3I1AA 1SA0E 4U7IA 3RIFA 3LK2B 2B76A 4CI2B 1MIYA 5JR9A 3ANWB 4DBQA 4DNDA 1FMVA 1H7CA 2LOSA 2EHOA 4HFHA 3VRAA 4V1Av 3F57A 3VR9A 3RQUA 4IIJE 2L8KA 2W66A 1N36T 3O1IA 4YHJA 5JDQA 3H3MA 2Q9QA 4I43B 5E0OA 4ANJA 3NZQA 2D9DA 2QRXA 2R6GF 3AAIA 1HNWT 3E0ZA 1UCUA 3C4WA 4WBNE 1N34T 4LMJA 3AAEB 4WNKA 3MKDA 2KWHA 3OBVE 2CBIA 2V7IA 1D1CA 3RRCA 4EV6A 4EOZB 5FVKA 2V5DA 3N5LA 2RPAA 3JC6D 3MA9A 4QHOA 3NKZA 4MALA 1NAFA 2X9XA 3HKDE 1YXRA 2J4GA 2YDRA 4TWDA 3AE1A 4BAYB 1E1HB 3UU6A 2LE8A 4OYKA 3P4PA 3PUYF 3HKBE 3P7IA 3R6NA 3ZT5A 2VKHA 3KV5A 4ISSA 3PU8A 5AQIB 4LFAT 2NWBA 3EUHA 3RI5A 4X66T 4ZZCA 3MJXA 4U74A 1HCIA 3B57A 5ABGA 3TLSA 4DV2T 2BZBA 5JDFA 1ZKEA 4DMWA 2LSYA 3HR0A 2XQ3A 2DNXA 2ACXA 4DV7T 1AJ3A 3RHWA 5LG3A 3AXJA 4PFOA 5L3EB 4CQIA 5BR8T 2FJEA 3AVRA 4DV0T 1G8XA 4TNVA 1Y01A 3LG7A 2IW5B 3OKQA 4IDPA 2CCQA 3K3QC 5JREA 3VR8A 4HGAA 1D0YA 3CK6A 4UVBB 4QH4A 2UUCT 1U4QA 4WZXA 2XUEA 2A3DA 4DVDA 1W9RA 5AQUB 2UXXB 2MAWA 3WAKA 2VB6A 4OHFA 4IGUA 4CI3B 4NUVA 4UR9A 5LCYA 3OJAA 3RLFF 1QLBA 3ESLA 1VOMA 3AE9A 4N78D 2FBWA 5FXVA 3WI3A 2LKGA 1L0VA 4P09A 3PV0F 4IREA 5AQTB 4EYUA 2VVNA 1KF6A 1T98A 4EXTA 4MLKA 5AQVB 4JI4T 4X20E 5IUXA 3VRBA 4HFIA 1D1BA 4DBRA 2C5JA 4CXXA 2H7OA 2RA1A 4A5XA 3N2KE 2X67A 4JI7T 2E5VA 4DIDB 2I59A 3PDYA 3N9OA 1OXZA 1WYCA 3C50A 2LOPA 3SFEA 1T8BA 1MNEA 1UK5A 1HTJF 2IMLA 4A56A 4JI3T 2XZEA 5JDHA 4QH1A 2UXNB 2CWOA 3LBXB 1MNDA 1MMNA 5ADXL 2PJQA 4LF9T 2IAKA 3ZSSA 4HWCA 4DV3T 3P4QA 4JI8T 2IC9A 5CB4E 3FZFB 4L9IA 5AQFB 5KX5E 3CMLA 3RC3A 3QC9A 3OYXA 2LLYA 4U2ZA 1FEWA 3ZC0A 4BA9A 4HN9A 5AQOB 4HFBA 4HWIB 5JDMA 3JAEA 4QXBB 2HN1A 1MIVA 4PNIA 2BG9B 4ZI3C 4I50E 3LSVA 5FVLA 2DCFA 5LOVE 4DR1T 5LYJE 3FB2A 4JBWF 2HH7A 2BG9C 4I4TE 4CZZB 4U7YA 2DLRA 4LF7T 3BQIA 4IDQA 4XBFB 5HCMA 4HWDA 2A2FX 3GN5A 4UF0B 2WU2A 5TAOA 3CVRA 4L5GA 4YSYA 4X1YE 5LNKA 2BS4A 1OEDB 3LK3B 1XMQT 2KXPB 3RGLA 2WDRA 3N2GE 2BKOA 4B3ST 1D0XA 3AEAA 1XNRT 3ZCJA 4CN6A 3WAJA 3ETUA 2UUAT 4B3TT 5CFBA 4DV5T 2DWGA 3ZMZB 3UUXB 1XWMA 4B3RT 1I6ZA 1X9BA 2A9UA 1VCTA 4Z8XA 2WAUA 2XAFB 4OX9T 1XNQT 2OV9A 5JR9B 1YQ4A 1FJGT 3ONLC 3KVBA 2HPLA 5EK4A 3FBZA 4ZXLA 3KV6A 5HXHA 3T1HT 5F5WA 2UU9T 5JR9C 4OK0A 3JAFA 5CGMA 3CWZB 2IUBA 5L47A 4PK5A 2QYWA 3N9PA 5L3GB 2KSRA 1G73A 2I6HA 2YK0A 3PTRB 5HXEA 1KNZA 3ZMSB 3ZYKA 3RYCE 2OA5A 4O4JE 5HYAA 2Q9QC 5HAXA 2XQ5A 3PUGA 5IYZE 1S35A 4UVAB 3LK42 4YTNA 4GKKT 5J2TE 3IEEA 4JEUB 5F3JA 5LBQB 2FJDA 3KVAA 5JRCB 4YTPA 3RYIE 1HR0T 5C2TA 5KDMC 4JI1T 4I55E 4JI5T 5LBMA 4JUYA 3MZKB 2GK9A 4JV5T 2PBIA 4OYJA 3RYHE 3C98B 3P4RA 3C4XA 4GYRA 3HA4A 3CKDA 3EI0A 3NVOA 3V5SA 2FJAA 3KBUA 2WP9A 2PTFA 4AISA 2ODUA 2V26A 4H63H 2ZLYA 3FZHB 4AQFA 5F8PA 3B5MA 4UXNB 1MIWA 2L9QA 5EK2A 1SHZC 4EAHA 2LM9A 5C3JA 2V7JA 4KI0F 5HEGA 2X68A 2YN6A 3E22E 2JQHA 4HEAA 2BS2A 3Q9DA 3EABA 4LFBT 1BR1A 2Y6XA 4ZI7E 2XQ8A 4QWNB 2E5LT 4AIUA 4CN1A 3AE2A 4UVCB 5GONE 1HG5A 2DL1A 2X9WA 4UEMA 5H6RB 1X79A 2XTLA 2L3LA 3ZT6A 3I0QA 3EDUA 2WQYA 3AECA 4E7SA 4PK6A 3UTKA 2XAQB 5LHIB 3RIUC 4X62T 4OFZA 4KMCA 4ZZBA 4TN7B 3M65A 2KLQA 3ZMTB 3N2OA 4IL9A 5ETWA 1BR0A 4WBOA 3LJCA 4Q25A 2MPKA 4DUYT 2WZHA 1LVFA 1IJ5A 4ZI3D 3AEBA 3Q5WA 2NR4A 2VL8A 3TLVA 4U72A 2CWYA 3GA8A 2NW8A 2ZM0A 4J2CA 4GOUA 4QXHB 2BVMA 3CPZA 5AQLB 1JNZA 4BJMA 5HEOA 3MACA 2H88A 2XPKA 5LB7B 3ZYMA 3P4WA 4PK4A 4LF4T 4P0AA 1ZP0A 2KWIB 4IDNA 4XZCA 3AE3A 2XY8B 2Z6EA 5EZYE 1WCRA 3Q2MA 3ZYLA 3UUMA 2K5BB 1KNPA 3OVUA 4FI5A 4IHJE 2JJ9A 5HXSA 3HL6A 2QA7A 4TZ4C 1ZOYA 5IHYA 2OLTA 4IE6A 3PUSA 3CQGB 4EIWA 3AEFA 4WYVA 1FMWA 3UQ7A 2XQ4A 2WMNA 4ERRA 1BR2A 2D0TA 2WDVA 3OYZA 1HFAA 2VASA 4AQYT 2LSIA 3RQWA 3ZJ2A 1W09A 2ZM8A 3ZCIA 2LJLA 1XMOT 3MK7C 1YKEB 3FXDB 4YY3T 4JEHB 3AVSA 5HXCA 3PUXF 4ILCA 3O4XE 2WMOA 2VKDA 1KEYA 5L2LA 3FHNA 3AE6A 3I9YA 4HFCA 4DR6T 2E9XA 1VCSA 2XQYA 4YLHA 4P0BA 1Z0PA 5LA6E 1XZYA 4XAXB 3RF1A 1B7TA 1YKHB 1LVKA 2UXDT 3U3IA 1DU2A 2W2UA 3NRYA 2XM1A 3VKHA 2ZM2A 3F2EA 4NXMT 2VWAA 5AQJB 1HNXT 1NWMX 3UT5E 2XQ9A 2WZIA 4HE8A 4QKNA 2W4XA 3KDSE 2XQ7A 2D0UA 4BJNA 4G63A 2JIWA 1T72A 5LXTE 2DI4A 2CRBA 3TLUA 3ZEFB 3UULA 1IBKT 3J9X1 3ZN1B 2D5UA 4KX6A 1ZV4X 4TV9E 5HEJA 2BG9E 2KINB 2C5KT 2LT3A 3H3AA 2WS3A 3SWHA 4ISTA 5JH7E 3RKOA 4JI2T 2W63A 5AQMB 3AEEA 4ZS2A 4AXPA 4EZ4A 3K1SA 5LJNA 2J1DG 3EVYA 2VK9A 1N33T 1XDPA 3FZLB 5KMGP 3HKCE 2BKPA 4H9OC 4PJJA 5LGTB 5DQWA 4YT0A 3AAAB 3N9MA 2LSGA 5HWXA 1J5WA 5KXJA 3PJAJ 1OEDE 3X1DA 3W15B 1OWAA 4O2AE 3O9XA 3HI2A 2SPCA 2MBGA 2QGSA 3UUBA 4DV4T 3I0OA 1UGOA 4P1NA 3PE0A 2ZMAA 2NTXA 4JYAT 2XASB 5LMNT 3MXZA 1CHUA 5EK3A 3ZKRA 2CPTA 4PAGA 5ABFB 3KFWX 3IBPA 1YQ3A 4C90A 1R8IA 4YTMA 5FMNA 4H9RC 4QX7B 4AQGA 2YU2A 3C64A 3CIRA 1W0AA 3QB5A 2V5CA 3UUNA 4ZI2C 5HEHA 5CA1E 5CJ5A 2XHEB 2BVLA 3D0TA 2WSSV 2XAJB 3UU3A 1MMGA 3F31A 2CXFA 3L09A 2YU1A 4AKRB 1Y64B 3UFEA 4YSXA 3I9WA 5FKYA 2YEVC 5L4HA 1WRDA 3GWHA 4ADZA 4DMVA 4AQFC 3AB3B 3L8RA 1IJ6A 2M6IA 2C0SA 3RKGA 1CUNA 4Z91A 3UQ4A 1NEKA 4HFEA 1IBLT 2YDQA 2VL0A 4ZEYA 2XJ7A 4KHZF 4E7ZA 2X51A 2EHOB 2LSKA 4I0UA 4O8SA 2HHHT 5LHHB 3NWIA 4GK5E 4UELA 1UX5A 3ZMUB 3K3NA 3AE8A 5AFUL 1SE7A 3IHRA 5J2UE 2IDOB 2IHR1 2EHOC 2W0GA 4EB6E 1LKXA 2JMKA 5HCJA 2Q9QB 3RC8A 3LBXA 5FL1A 3EDVA 5JQGE 2YKSA 2XQ6A 2BKNA 2MOZA 1WYBA 2FJBA 4AKHA 2WU5A 3VHLA 2DWKA 2CLYB 5FP3A 2W61A 2WDQA 3ZSTA 3QK6A 2M67A 4O4HE 1VRBA 4KUMB 4NPPA 2X0YA 2E8IA 2VQFT 2CLYC 2K9AA 1MMAA 2JQQA 2LRKA 2W00A 5DJQC 4LMLA 2BG9A 2NOXA 4DUZT 4DR2T 2C5IT 4F8HA 3TLTA 1HNZT 4JI0T 3CQCB 1U5PA 1LRZA 3BK9A 2NTYA 3KV9A 3ZT7A 2CM0A 3NBXX 3A5XA 2AXDS 2KNDA 4LF6T 5AQGB 4UF0A 5HWYA 4TV8E 1OEDA 4UV9B 4C91A 1KFYA 4DR3T 4H9SE 5LP6E 4QXCB 2E2AA 3AXJB 5HXRA 4PJMA 5AQSB 4YSZA 2UXBT 2W67A 2LRLA 3N9QA 3L39A 4HWHA 2WWVA 4X1KE 4DO0A 2H7VC 3K8PC 3EHZA 1O3XA 3R84B 4HFVA 2NW9A 4AKLA 2A72A 2CXLA 4GIWA 3FXEB 2XAGB 4MFRA 4DR7T 1W0BA 2BBJA 2X0HA 5LGNB 2N9DA 4NXNT 3UU8A 3JADA 1UX4A 1HS7A 3IF8B 1S94A 2E9XB 4TWFA 1E7PA 1HG2A 4AKGA 4ZOLE 1JNRA 3P4SA 4IDZA 3A7MA 4X1IE 2XAHB 2IIUA 2V1DB 3S4UA 2CHOA 2E9XC 4HWFA 2N2NA 1IAPA 3ZMVB 2FUPA 2V6YA 4EEDA 2CMRA 5ABHA 2XSBA 2IC6A 4QH5A 2JPFA 5H6QB 1M62A 2M6BA 4U33A 2K48A 5LHGB 1I94T 5FYMA 5HEUA 4EYYR 2Y8DA 3VU7H 3QOFA 4ZI2D 5JTGA 4COFA 3O1HA 4HTEA 4PJNA 3VKGA 2WB5A 5JRCA 4EZHA 2AE9A 3K3OA 3E08A 5JDNA 4ILAA 3ZN0B 1BR4A 5IWAT 3DJBA 4PJLA 4HFDA 4AI6A 3G06A 2VKJA 4YXDA 3V5UA 3AEGA 1UUSA 2KT9A 3ZC1A 2LHNA 4MBQA 1HX8A 4GK0E 5AQKB 5FXXA 1HX1B 5FXZA 1UURA 1WR0A 3RIAA 5L3BB 2CE7A 2PG8A 4NIQA 3H37A 2EHOD 4KBMB 1EZ3A 4L0RA 3PU3A 5JDLA 2J47A 1E2AA 2Y48B 2XM2A 4IE7A 5J0ZA 4YFSA 5L4EA 2VURA 2YOEA 3ANWA 4X5TA 5M4YA 3RIUA 2VVSA 3M3ZB 5FNVE 5AQPB 2P9BA 4DR5T 2CEAA 2DHRA 3HKEE 3RPUA 3PUAA 4IT4A 3P8CD 5L3FB 2Q9QD 3JCFA 4H9PC 5CA0E 5BMVE 4ZHQE 5LG4A 1KNRA 2UXCT 1GQEA 3C4ZA 3GN5B 2BDEA 2WBLA 3Q5DA 3ONXA 5FY1A 4O2BE 2J62A 1QUUA 2MYSA 2VKOA 4YJ2E
chains in the Genus database with same CATH topology
5IWAT 4JI8T 4JI1T 4JI5T 4DUYT 4DV1T 4B3RT 1IBKT 4AQYT 3T1YT 4JV5T 4LF8T 3OTOT 2VQFT 4OX9T 4LFCT 1XMOT 1XNQT 4JI2T 4DR7T 1FJGT 4YY3T 4NXNT 4DUZT 1N33T 4DR2T 4K0KT 2ZM6T 3T1HT 1IBLT 2UU9T 4LFAT 4JI0T 1HNZT 4X66T 4LF4T 4DR1T 4DR6T 4B3MT 4JI4T 4DV2T 4LFBT 2UUBT 2E5LT 4LF7T 2HHHT 1N36T 1IBMT 4JI7T 4DR5T 4LF6T 4DR4T 4X64T 4LF5T 2UXDT 4DV4T 4DV7T 1I94T 4DR3T 1HNWT 5BR8T 4JI6T 4JYAT 1XMQT 4DV0T 2UXCT 1N34T 4JI3T 5LMNT 4NXMT 4X62T 2F4VT 2VQET 4GKKT 4B3ST 1N32T 2UXBT 1HNXT 1XNRT 1J5ET 4X65T 4YHHT 5LMUT 2UUCT 4DV6T 2UUAT 4GKJT 4LF9T 1HR0T 4KHPT 4B3TT 4DV5T 4DV3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA T;  4JI8 T;  4JI1 T;  4JI5 T;  4DUY T;  4DV1 T;  4B3R T;  1IBK T;  4AQY T;  3T1Y T;  4JV5 T;  4LF8 T;  3OTO T;  2VQF T;  4OX9 T;  4LFC T;  1XMO T;  1XNQ T;  4JI2 T;  4DR7 T;  1FJG T;  4YY3 T;  4NXN T;  4DUZ T;  1N33 T;  4DR2 T;  4K0K T;  2ZM6 T;  3T1H T;  1IBL T;  2UU9 T;  4LFA T;  4JI0 T;  1HNZ T;  4X66 T;  4LF4 T;  4DR1 T;  4DR6 T;  4B3M T;  4JI4 T;  4DV2 T;  4LFB T;  2UUB T;  2E5L T;  4LF7 T;  2HHH T;  1N36 T;  1IBM T;  4JI7 T;  4DR5 T;  4LF6 T;  4DR4 T;  4X64 T;  4LF5 T;  2UXD T;  4DV4 T;  4DV7 T;  1I94 T;  4DR3 T;  1HNW T;  5BR8 T;  4JI6 T;  4JYA T;  1XMQ T;  4DV0 T;  2UXC T;  1N34 T;  4JI3 T;  5LMN T;  4NXM T;  4X62 T;  2F4V T;  2VQE T;  4GKK T;  4B3S T;  1N32 T;  2UXB T;  1HNX T;  1XNR T;  1J5E T;  4X65 T;  4YHH T;  5LMU T;  2UUC T;  4DV6 T;  2UUA T;  4GKJ T;  4LF9 T;  1HR0 T;  4KHP T;  4B3T T;  4DV5 T;  4DV3 T; 
#chains in the Genus database with same CATH topology
 5AQH B;  3ONJ A;  3T1Y T;  2CA5 A;  5C8Y E;  3OTO T;  4NUU A;  3FBL A;  5JDG A;  3UU4 A;  1D1A A;  2W62 A;  1YD8 G;  5L3C B;  3QNU A;  3SOL A;  2ZM6 T;  3DTO A;  1XDO A;  3AED A;  1FIO A;  2V8S V;  2RP4 A;  3FZK B;  3AE4 A;  3LDQ B;  3BQK A;  2V6X A;  5JVD E;  3QUJ A;  4K0U A;  4B3M T;  3PUZ F;  4G2A A;  3EAM A;  3KIN B;  3PJA A;  3TLW A;  2LSJ A;  2X9Y A;  3NRX A;  1IBM T;  4TWH A;  2B1E A;  4LF5 T;  2I0M A;  3TKL B;  1QSD A;  2KZ7 B;  3J7Y q;  2V7K A;  5DQV A;  2CHN A;  2F4V T;  2VQE T;  3T8O A;  5AQQ B;  3NZP A;  2JQ9 A;  4X65 T;  4MHC A;  3ZPO A;  4U31 A;  2X66 A;  4EEB A;  2NP9 A;  3KBT A;  4IDO A;  2LHR A;  3PUW F;  3RRW A;  4A98 A;  1T7S A;  3RYF E;  2LM2 A;  3N9L A;  5FY0 A;  4TNW A;  2HPJ A;  3SFD A;  4QX8 B;  4ZS3 A;  3CX7 B;  2X0L B;  4ASK A;  3CQX C;  4IL4 A;  2D2S A;  4CI1 B;  4IE5 A;  2QVA A;  2E9X D;  2CBJ A;  4M1P A;  5FL0 A;  3JC6 C;  1V9D A;  4GYS A;  2JQK A;  4UV8 B;  5A1L A;  3CX6 B;  4IE4 A;  4K0K T;  2BBH A;  2XQA A;  1HF8 A;  2V7M A;  3IA3 A;  3Q5X A;  5FXW A;  1M7K A;  4CXY A;  2N1G A;  2BS3 A;  2ACZ A;  4WW0 A;  2HN2 A;  3P50 A;  1WR6 A;  4O4L E;  2ES0 A;  2YDS A;  4CXW A;  3ETV A;  5AQN B;  1IZN B;  3KV4 A;  4X64 T;  1US7 B;  4KP3 C;  1OED C;  4AKI A;  5ABE A;  4ILU A;  4PFP A;  1Z8U A;  3DP7 A;  4JI6 T;  4FJO A;  3QB5 K;  1J1J A;  2WY2 A;  3LFM A;  1J5E T;  4H9N C;  2H3R A;  4PW8 A;  4TX5 A;  5LMU T;  2CXD A;  3UU5 A;  3AA7 B;  3B13 A;  3AE7 A;  3GMI A;  2ODV A;  1D0Z A;  1ZEE A;  2WM9 A;  3N9N A;  3BQL A;  5AQR B;  5L3D B;  5FY7 A;  4UIG A;  3C51 A;  3AE5 A;  1KK7 A;  3PUV F;  4B6X A;  2MTQ A;  2NW7 A;  4HKA A;  4LFC T;  3RX6 A;  3FZM B;  3SS1 A;  2X9H A;  4ILB A;  4F6R C;  4Z90 A;  4YJ3 E;  3PUR A;  5LJM A;  2V6Y B;  4JLE A;  2LEH A;  5LGU B;  2H89 A;  3AA1 B;  1MMD A;  2XSA A;  3SRZ A;  3ZJ1 A;  3U78 A;  2WCA A;  2K3W A;  2JRK A;  2UUB T;  2PFV A;  2KMF A;  2K24 A;  4U2Y A;  1WLX A;  4DR4 T;  3AA6 B;  2WWU A;  4IE0 A;  3OPC A;  2V7L A;  3A8Y C;  1SUM B;  5ABF A;  2LKH A;  5DAB A;  1ZHC A;  1N32 T;  4H63 V;  4A97 A;  4CN4 A;  4YHH T;  4TUY E;  3PUQ A;  4DV6 T;  4GKJ T;  4KHP T;  3L3P A;  1YW0 A;  2G0U A;  3RH3 A;  4DV1 T;  3O1J A;  3CX8 B;  1WFD A;  3Q5E A;  4LF8 T;  3AA0 B;  2YIN A;  3ABV A;  4LMK A;  4H9Q C;  3ZLI A;  4O4I E;  3UFG A;  1NEN A;  2JMH A;  4U3C A;  5J1G A;  4EGW A;  3I1A A;  1SA0 E;  4U7I A;  3RIF A;  3LK2 B;  2B76 A;  4CI2 B;  1MIY A;  5JR9 A;  3ANW B;  4DBQ A;  4DND A;  1FMV A;  1H7C A;  2LOS A;  2EHO A;  4HFH A;  3VRA A;  4V1A v;  3F57 A;  3VR9 A;  3RQU A;  4IIJ E;  2L8K A;  2W66 A;  1N36 T;  3O1I A;  4YHJ A;  5JDQ A;  3H3M A;  2Q9Q A;  4I43 B;  5E0O A;  4ANJ A;  3NZQ A;  2D9D A;  2QRX A;  2R6G F;  3AAI A;  1HNW T;  3E0Z A;  1UCU A;  3C4W A;  4WBN E;  1N34 T;  4LMJ A;  3AAE B;  4WNK A;  3MKD A;  2KWH A;  3OBV E;  2CBI A;  2V7I A;  1D1C A;  3RRC A;  4EV6 A;  4EOZ B;  5FVK A;  2V5D A;  3N5L A;  2RPA A;  3JC6 D;  3MA9 A;  4QHO A;  3NKZ A;  4MAL A;  1NAF A;  2X9X A;  3HKD E;  1YXR A;  2J4G A;  2YDR A;  4TWD A;  3AE1 A;  4BAY B;  1E1H B;  3UU6 A;  2LE8 A;  4OYK A;  3P4P A;  3PUY F;  3HKB E;  3P7I A;  3R6N A;  3ZT5 A;  2VKH A;  3KV5 A;  4ISS A;  3PU8 A;  5AQI B;  4LFA T;  2NWB A;  3EUH A;  3RI5 A;  4X66 T;  4ZZC A;  3MJX A;  4U74 A;  1HCI A;  3B57 A;  5ABG A;  3TLS A;  4DV2 T;  2BZB A;  5JDF A;  1ZKE A;  4DMW A;  2LSY A;  3HR0 A;  2XQ3 A;  2DNX A;  2ACX A;  4DV7 T;  1AJ3 A;  3RHW A;  5LG3 A;  3AXJ A;  4PFO A;  5L3E B;  4CQI A;  5BR8 T;  2FJE A;  3AVR A;  4DV0 T;  1G8X A;  4TNV A;  1Y01 A;  3LG7 A;  2IW5 B;  3OKQ A;  4IDP A;  2CCQ A;  3K3Q C;  5JRE A;  3VR8 A;  4HGA A;  1D0Y A;  3CK6 A;  4UVB B;  4QH4 A;  2UUC T;  1U4Q A;  4WZX A;  2XUE A;  2A3D A;  4DVD A;  1W9R A;  5AQU B;  2UXX B;  2MAW A;  3WAK A;  2VB6 A;  4OHF A;  4IGU A;  4CI3 B;  4NUV A;  4UR9 A;  5LCY A;  3OJA A;  3RLF F;  1QLB A;  3ESL A;  1VOM A;  3AE9 A;  4N78 D;  2FBW A;  5FXV A;  3WI3 A;  2LKG A;  1L0V A;  4P09 A;  3PV0 F;  4IRE A;  5AQT B;  4EYU A;  2VVN A;  1KF6 A;  1T98 A;  4EXT A;  4MLK A;  5AQV B;  4JI4 T;  4X20 E;  5IUX A;  3VRB A;  4HFI A;  1D1B A;  4DBR A;  2C5J A;  4CXX A;  2H7O A;  2RA1 A;  4A5X A;  3N2K E;  2X67 A;  4JI7 T;  2E5V A;  4DID B;  2I59 A;  3PDY A;  3N9O A;  1OXZ A;  1WYC A;  3C50 A;  2LOP A;  3SFE A;  1T8B A;  1MNE A;  1UK5 A;  1HTJ F;  2IML A;  4A56 A;  4JI3 T;  2XZE A;  5JDH A;  4QH1 A;  2UXN B;  2CWO A;  3LBX B;  1MND A;  1MMN A;  5ADX L;  2PJQ A;  4LF9 T;  2IAK A;  3ZSS A;  4HWC A;  4DV3 T;  3P4Q A;  4JI8 T;  2IC9 A;  5CB4 E;  3FZF B;  4L9I A;  5AQF B;  5KX5 E;  3CML A;  3RC3 A;  3QC9 A;  3OYX A;  2LLY A;  4U2Z A;  1FEW A;  3ZC0 A;  4BA9 A;  4HN9 A;  5AQO B;  4HFB A;  4HWI B;  5JDM A;  3JAE A;  4QXB B;  2HN1 A;  1MIV A;  4PNI A;  2BG9 B;  4ZI3 C;  4I50 E;  3LSV A;  5FVL A;  2DCF A;  5LOV E;  4DR1 T;  5LYJ E;  3FB2 A;  4JBW F;  2HH7 A;  2BG9 C;  4I4T E;  4CZZ B;  4U7Y A;  2DLR A;  4LF7 T;  3BQI A;  4IDQ A;  4XBF B;  5HCM A;  4HWD A;  2A2F X;  3GN5 A;  4UF0 B;  2WU2 A;  5TAO A;  3CVR A;  4L5G A;  4YSY A;  4X1Y E;  5LNK A;  2BS4 A;  1OED B;  3LK3 B;  1XMQ T;  2KXP B;  3RGL A;  2WDR A;  3N2G E;  2BKO A;  4B3S T;  1D0X A;  3AEA A;  1XNR T;  3ZCJ A;  4CN6 A;  3WAJ A;  3ETU A;  2UUA T;  4B3T T;  5CFB A;  4DV5 T;  2DWG A;  3ZMZ B;  3UUX B;  1XWM A;  4B3R T;  1I6Z A;  1X9B A;  2A9U A;  1VCT A;  4Z8X A;  2WAU A;  2XAF B;  4OX9 T;  1XNQ T;  2OV9 A;  5JR9 B;  1YQ4 A;  1FJG T;  3ONL C;  3KVB A;  2HPL A;  5EK4 A;  3FBZ A;  4ZXL A;  3KV6 A;  5HXH A;  3T1H T;  5F5W A;  2UU9 T;  5JR9 C;  4OK0 A;  3JAF A;  5CGM A;  3CWZ B;  2IUB A;  5L47 A;  4PK5 A;  2QYW A;  3N9P A;  5L3G B;  2KSR A;  1G73 A;  2I6H A;  2YK0 A;  3PTR B;  5HXE A;  1KNZ A;  3ZMS B;  3ZYK A;  3RYC E;  2OA5 A;  4O4J E;  5HYA A;  2Q9Q C;  5HAX A;  2XQ5 A;  3PUG A;  5IYZ E;  1S35 A;  4UVA B;  3LK4 2;  4YTN A;  4GKK T;  5J2T E;  3IEE A;  4JEU B;  5F3J A;  5LBQ B;  2FJD A;  3KVA A;  5JRC B;  4YTP A;  3RYI E;  1HR0 T;  5C2T A;  5KDM C;  4JI1 T;  4I55 E;  4JI5 T;  5LBM A;  4JUY A;  3MZK B;  2GK9 A;  4JV5 T;  2PBI A;  4OYJ A;  3RYH E;  3C98 B;  3P4R A;  3C4X A;  4GYR A;  3HA4 A;  3CKD A;  3EI0 A;  3NVO A;  3V5S A;  2FJA A;  3KBU A;  2WP9 A;  2PTF A;  4AIS A;  2ODU A;  2V26 A;  4H63 H;  2ZLY A;  3FZH B;  4AQF A;  5F8P A;  3B5M A;  4UXN B;  1MIW A;  2L9Q A;  5EK2 A;  1SHZ C;  4EAH A;  2LM9 A;  5C3J A;  2V7J A;  4KI0 F;  5HEG A;  2X68 A;  2YN6 A;  3E22 E;  2JQH A;  4HEA A;  2BS2 A;  3Q9D A;  3EAB A;  4LFB T;  1BR1 A;  2Y6X A;  4ZI7 E;  2XQ8 A;  4QWN B;  2E5L T;  4AIU A;  4CN1 A;  3AE2 A;  4UVC B;  5GON E;  1HG5 A;  2DL1 A;  2X9W A;  4UEM A;  5H6R B;  1X79 A;  2XTL A;  2L3L A;  3ZT6 A;  3I0Q A;  3EDU A;  2WQY A;  3AEC A;  4E7S A;  4PK6 A;  3UTK A;  2XAQ B;  5LHI B;  3RIU C;  4X62 T;  4OFZ A;  4KMC A;  4ZZB A;  4TN7 B;  3M65 A;  2KLQ A;  3ZMT B;  3N2O A;  4IL9 A;  5ETW A;  1BR0 A;  4WBO A;  3LJC A;  4Q25 A;  2MPK A;  4DUY T;  2WZH A;  1LVF A;  1IJ5 A;  4ZI3 D;  3AEB A;  3Q5W A;  2NR4 A;  2VL8 A;  3TLV A;  4U72 A;  2CWY A;  3GA8 A;  2NW8 A;  2ZM0 A;  4J2C A;  4GOU A;  4QXH B;  2BVM A;  3CPZ A;  5AQL B;  1JNZ A;  4BJM A;  5HEO A;  3MAC A;  2H88 A;  2XPK A;  5LB7 B;  3ZYM A;  3P4W A;  4PK4 A;  4LF4 T;  4P0A A;  1ZP0 A;  2KWI B;  4IDN A;  4XZC A;  3AE3 A;  2XY8 B;  2Z6E A;  5EZY E;  1WCR A;  3Q2M A;  3ZYL A;  3UUM A;  2K5B B;  1KNP A;  3OVU A;  4FI5 A;  4IHJ E;  2JJ9 A;  5HXS A;  3HL6 A;  2QA7 A;  4TZ4 C;  1ZOY A;  5IHY A;  2OLT A;  4IE6 A;  3PUS A;  3CQG B;  4EIW A;  3AEF A;  4WYV A;  1FMW A;  3UQ7 A;  2XQ4 A;  2WMN A;  4ERR A;  1BR2 A;  2D0T A;  2WDV A;  3OYZ A;  1HFA A;  2VAS A;  4AQY T;  2LSI A;  3RQW A;  3ZJ2 A;  1W09 A;  2ZM8 A;  3ZCI A;  2LJL A;  1XMO T;  3MK7 C;  1YKE B;  3FXD B;  4YY3 T;  4JEH B;  3AVS A;  5HXC A;  3PUX F;  4ILC A;  3O4X E;  2WMO A;  2VKD A;  1KEY A;  5L2L A;  3FHN A;  3AE6 A;  3I9Y A;  4HFC A;  4DR6 T;  2E9X A;  1VCS A;  2XQY A;  4YLH A;  4P0B A;  1Z0P A;  5LA6 E;  1XZY A;  4XAX B;  3RF1 A;  1B7T A;  1YKH B;  1LVK A;  2UXD T;  3U3I A;  1DU2 A;  2W2U A;  3NRY A;  2XM1 A;  3VKH A;  2ZM2 A;  3F2E A;  4NXM T;  2VWA A;  5AQJ B;  1HNX T;  1NWM X;  3UT5 E;  2XQ9 A;  2WZI A;  4HE8 A;  4QKN A;  2W4X A;  3KDS E;  2XQ7 A;  2D0U A;  4BJN A;  4G63 A;  2JIW A;  1T72 A;  5LXT E;  2DI4 A;  2CRB A;  3TLU A;  3ZEF B;  3UUL A;  1IBK T;  3J9X 1;  3ZN1 B;  2D5U A;  4KX6 A;  1ZV4 X;  4TV9 E;  5HEJ A;  2BG9 E;  2KIN B;  2C5K T;  2LT3 A;  3H3A A;  2WS3 A;  3SWH A;  4IST A;  5JH7 E;  3RKO A;  4JI2 T;  2W63 A;  5AQM B;  3AEE A;  4ZS2 A;  4AXP A;  4EZ4 A;  3K1S A;  5LJN A;  2J1D G;  3EVY A;  2VK9 A;  1N33 T;  1XDP A;  3FZL B;  5KMG P;  3HKC E;  2BKP A;  4H9O C;  4PJJ A;  5LGT B;  5DQW A;  4YT0 A;  3AAA B;  3N9M A;  2LSG A;  5HWX A;  1J5W A;  5KXJ A;  3PJA J;  1OED E;  3X1D A;  3W15 B;  1OWA A;  4O2A E;  3O9X A;  3HI2 A;  2SPC A;  2MBG A;  2QGS A;  3UUB A;  4DV4 T;  3I0O A;  1UGO A;  4P1N A;  3PE0 A;  2ZMA A;  2NTX A;  4JYA T;  2XAS B;  5LMN T;  3MXZ A;  1CHU A;  5EK3 A;  3ZKR A;  2CPT A;  4PAG A;  5ABF B;  3KFW X;  3IBP A;  1YQ3 A;  4C90 A;  1R8I A;  4YTM A;  5FMN A;  4H9R C;  4QX7 B;  4AQG A;  2YU2 A;  3C64 A;  3CIR A;  1W0A A;  3QB5 A;  2V5C A;  3UUN A;  4ZI2 C;  5HEH A;  5CA1 E;  5CJ5 A;  2XHE B;  2BVL A;  3D0T A;  2WSS V;  2XAJ B;  3UU3 A;  1MMG A;  3F31 A;  2CXF A;  3L09 A;  2YU1 A;  4AKR B;  1Y64 B;  3UFE A;  4YSX A;  3I9W A;  5FKY A;  2YEV C;  5L4H A;  1WRD A;  3GWH A;  4ADZ A;  4DMV A;  4AQF C;  3AB3 B;  3L8R A;  1IJ6 A;  2M6I A;  2C0S A;  3RKG A;  1CUN A;  4Z91 A;  3UQ4 A;  1NEK A;  4HFE A;  1IBL T;  2YDQ A;  2VL0 A;  4ZEY A;  2XJ7 A;  4KHZ F;  4E7Z A;  2X51 A;  2EHO B;  2LSK A;  4I0U A;  4O8S A;  2HHH T;  5LHH B;  3NWI A;  4GK5 E;  4UEL A;  1UX5 A;  3ZMU B;  3K3N A;  3AE8 A;  5AFU L;  1SE7 A;  3IHR A;  5J2U E;  2IDO B;  2IHR 1;  2EHO C;  2W0G A;  4EB6 E;  1LKX A;  2JMK A;  5HCJ A;  2Q9Q B;  3RC8 A;  3LBX A;  5FL1 A;  3EDV A;  5JQG E;  2YKS A;  2XQ6 A;  2BKN A;  2MOZ A;  1WYB A;  2FJB A;  4AKH A;  2WU5 A;  3VHL A;  2DWK A;  2CLY B;  5FP3 A;  2W61 A;  2WDQ A;  3ZST A;  3QK6 A;  2M67 A;  4O4H E;  1VRB A;  4KUM B;  4NPP A;  2X0Y A;  2E8I A;  2VQF T;  2CLY C;  2K9A A;  1MMA A;  2JQQ A;  2LRK A;  2W00 A;  5DJQ C;  4LML A;  2BG9 A;  2NOX A;  4DUZ T;  4DR2 T;  2C5I T;  4F8H A;  3TLT A;  1HNZ T;  4JI0 T;  3CQC B;  1U5P A;  1LRZ A;  3BK9 A;  2NTY A;  3KV9 A;  3ZT7 A;  2CM0 A;  3NBX X;  3A5X A;  2AXD S;  2KND A;  4LF6 T;  5AQG B;  4UF0 A;  5HWY A;  4TV8 E;  1OED A;  4UV9 B;  4C91 A;  1KFY A;  4DR3 T;  4H9S E;  5LP6 E;  4QXC B;  2E2A A;  3AXJ B;  5HXR A;  4PJM A;  5AQS B;  4YSZ A;  2UXB T;  2W67 A;  2LRL A;  3N9Q A;  3L39 A;  4HWH A;  2WWV A;  4X1K E;  4DO0 A;  2H7V C;  3K8P C;  3EHZ A;  1O3X A;  3R84 B;  4HFV A;  2NW9 A;  4AKL A;  2A72 A;  2CXL A;  4GIW A;  3FXE B;  2XAG B;  4MFR A;  4DR7 T;  1W0B A;  2BBJ A;  2X0H A;  5LGN B;  2N9D A;  4NXN T;  3UU8 A;  3JAD A;  1UX4 A;  1HS7 A;  3IF8 B;  1S94 A;  2E9X B;  4TWF A;  1E7P A;  1HG2 A;  4AKG A;  4ZOL E;  1JNR A;  3P4S A;  4IDZ A;  3A7M A;  4X1I E;  2XAH B;  2IIU A;  2V1D B;  3S4U A;  2CHO A;  2E9X C;  4HWF A;  2N2N A;  1IAP A;  3ZMV B;  2FUP A;  2V6Y A;  4EED A;  2CMR A;  5ABH A;  2XSB A;  2IC6 A;  4QH5 A;  2JPF A;  5H6Q B;  1M62 A;  2M6B A;  4U33 A;  2K48 A;  5LHG B;  1I94 T;  5FYM A;  5HEU A;  4EYY R;  2Y8D A;  3VU7 H;  3QOF A;  4ZI2 D;  5JTG A;  4COF A;  3O1H A;  4HTE A;  4PJN A;  3VKG A;  2WB5 A;  5JRC A;  4EZH A;  2AE9 A;  3K3O A;  3E08 A;  5JDN A;  4ILA A;  3ZN0 B;  1BR4 A;  5IWA T;  3DJB A;  4PJL A;  4HFD A;  4AI6 A;  3G06 A;  2VKJ A;  4YXD A;  3V5U A;  3AEG A;  1UUS A;  2KT9 A;  3ZC1 A;  2LHN A;  4MBQ A;  1HX8 A;  4GK0 E;  5AQK B;  5FXX A;  1HX1 B;  5FXZ A;  1UUR A;  1WR0 A;  3RIA A;  5L3B B;  2CE7 A;  2PG8 A;  4NIQ A;  3H37 A;  2EHO D;  4KBM B;  1EZ3 A;  4L0R A;  3PU3 A;  5JDL A;  2J47 A;  1E2A A;  2Y48 B;  2XM2 A;  4IE7 A;  5J0Z A;  4YFS A;  5L4E A;  2VUR A;  2YOE A;  3ANW A;  4X5T A;  5M4Y A;  3RIU A;  2VVS A;  3M3Z B;  5FNV E;  5AQP B;  2P9B A;  4DR5 T;  2CEA A;  2DHR A;  3HKE E;  3RPU A;  3PUA A;  4IT4 A;  3P8C D;  5L3F B;  2Q9Q D;  3JCF A;  4H9P C;  5CA0 E;  5BMV E;  4ZHQ E;  5LG4 A;  1KNR A;  2UXC T;  1GQE A;  3C4Z A;  3GN5 B;  2BDE A;  2WBL A;  3Q5D A;  3ONX A;  5FY1 A;  4O2B E;  2J62 A;  1QUU A;  2MYS A;  2VKO A;  4YJ2 E; 
#chains in the Genus database with same CATH homology
 5IWA T;  4JI8 T;  4JI1 T;  4JI5 T;  4DUY T;  4DV1 T;  4B3R T;  1IBK T;  4AQY T;  3T1Y T;  4JV5 T;  4LF8 T;  3OTO T;  2VQF T;  4OX9 T;  4LFC T;  1XMO T;  1XNQ T;  4JI2 T;  4DR7 T;  1FJG T;  4YY3 T;  4NXN T;  4DUZ T;  1N33 T;  4DR2 T;  4K0K T;  2ZM6 T;  3T1H T;  1IBL T;  2UU9 T;  4LFA T;  4JI0 T;  1HNZ T;  4X66 T;  4LF4 T;  4DR1 T;  4DR6 T;  4B3M T;  4JI4 T;  4DV2 T;  4LFB T;  2UUB T;  2E5L T;  4LF7 T;  2HHH T;  1N36 T;  1IBM T;  4JI7 T;  4DR5 T;  4LF6 T;  4DR4 T;  4X64 T;  4LF5 T;  2UXD T;  4DV4 T;  4DV7 T;  1I94 T;  4DR3 T;  1HNW T;  5BR8 T;  4JI6 T;  4JYA T;  1XMQ T;  4DV0 T;  2UXC T;  1N34 T;  4JI3 T;  5LMN T;  4NXM T;  4X62 T;  2F4V T;  2VQE T;  4GKK T;  4B3S T;  1N32 T;  2UXB T;  1HNX T;  1XNR T;  1J5E T;  4X65 T;  4YHH T;  5LMU T;  2UUC T;  4DV6 T;  2UUA T;  4GKJ T;  4LF9 T;  1HR0 T;  4KHP T;  4B3T T;  4DV5 T;  4DV3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...