2F4VT

30s ribosome + designer antibiotic
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2f4vT00
4DV6T 1HNWT 5LMUT 4X64T 4X65T 4DV4T 4B3TT 4JI2T 4NXMT 4JI1T 4YY3T 4DV5T 3T1YT 2HHHT 4JI7T 2UXBT 4B3MT 1IBKT 4LFCT 4DR2T 1N33T 4B3ST 4LF8T 2F4VT 4DUYT 4LF5T 2E5LT 5BR8T 1XNRT 2UXCT 4LFBT 4KHPT 1HNXT 3OTOT 2UUCT 4YHHT 4LF9T 4DUZT 4AQYT 4DR7T 4DV2T 2UU9T 4DR3T 1N32T 1XMOT 4GKJT 1XNQT 1FJGT 4DR5T 2ZM6T 4LF4T 4DR1T 1I94T 1XMQT 1HNZT 4LF7T 4DV0T 4DV1T 5IWAT 4DV3T 4OX9T 4JV5T 1J5ET 4JI3T 2VQET 5LMNT 2UXDT 4LFAT 1N34T 1IBMT 2VQFT 3T1HT 4NXNT 1HR0T 4JI8T 4GKKT 2UUAT 4X66T 4X62T 4JI0T 4B3RT 1N36T 4JI4T 4DR4T 2UUBT 4DR6T 4DV7T 4JI6T 4JYAT 1IBLT 4K0KT 4LF6T 4JI5T
chains in the Genus database with same CATH superfamily
2LLYA 3LK42 4MHCA 3KBTA 4NUUA 4TNWA 4AIUA 3RX6A 4PK5A 4E7SA 2IHR1 3AXJA 4DV6T 4QXHB 4AISA 2J47A 3VR9A 1WLXA 1HNWT 1VOMA 3RRCA 2UXNB 3I0OA 4IDPA 4DV4T 4UVAB 2CLYC 3W15B 4CXWA 3KVBA 3C4XA 3WAKA 3T8OA 5JR9C 3O4XE 2YDRA 4ILBA 2LEHA 2WSSV 3FZKB 5AQKB 3VRAA 2C5KT 2E9XA 2XQ6A 3DP7A 2BBJA 1H7CA 2K48A 2VURA 3QC9A 4IL4A 2I0MA 1R8IA 3AVRA 3AEBA 4UV8B 4YHJA 4YTPA 5JDGA 4DV5T 2XM2A 3SOLA 2OLTA 1VRBA 3T1YT 1OEDB 1S35A 5LB7B 5L3CB 4HFHA 4PK4A 3KV4A 4EYUA 4YJ2E 5JR9B 1JNRA 3I1AA 3PJAA 5F5WA 5JRCA 1UGOA 2WBLA 4H9SE 4A5XA 1E7PA 2G0UA 4L0RA 4ADZA 4QWNB 2FJBA 3N5LA 5AQLB 2GK9A 1NEKA 3PURA 1YKEB 4EYYR 2YN6A 4IHJE 3AXJB 4IDQA 2V6YB 4UR9A 4AQGA 3NKZA 3ONJA 3RQWA 5CFBA 3C4WA 3PU8A 4EXTA 4X1YE 3AEDA 2JIWA 1BR4A 3QNUA 2HPJA 3UU5A 4DIDB 3AA6B 2DHRA 4L5GA 4LFBT 3QOFA 2WWUA 4O2AE 2LRLA 2HH7A 2A9UA 3ONLC 5AQHB 5KMGP 4U3CA 4XZCA 5L3BB 4HGAA 2V7LA 2E9XC 4BJNA 2ODUA 3K3NA 4FJOA 4HE8A 3MK7C 2M6IA 5LBQB 4DV2T 3AA0B 2UU9T 3PUQA 4OHFA 2W67A 2MAWA 3LBXB 2LKGA 4Z8XA 1HX8A 5LBMA 4COFA 5JDNA 4O4HE 1XMOT 3NBXX 4X1KE 3PV0F 3CQGB 4YSZA 4CN4A 4EB6E 3JADA 5BMVE 5LHIB 3ABVA 2AE9A 2H3RA 4KI0F 2XQ5A 3C64A 5IHYA 3ZEFB 4Z91A 5HXCA 3UU4A 2KSRA 5ABFA 3AEFA 3BQLA 5F8PA 2BKOA 4DNDA 4OK0A 1L0VA 1MIYA 4DR1T 3JAFA 4ZS2A 2BKNA 1YKHB 3HKCE 1CUNA 4CQIA 5HCMA 4B6XA 4ISSA 5FXWA 3N2KE 2H88A 4DVDA 2NW9A 1XMQT 1HNZT 3JC6C 4LF7T 2XTLA 4TX5A 5FL1A 4DV1T 1YD8G 2YU2A 3ANWB 4PJMA 1FEWA 2ZMAA 4NPPA 1HS7A 2V6YA 1SA0E 3NRXA 5FXZA 1W0BA 5L3GB 5LG4A 3Q2MA 4OX9T 4V1Av 2W61A 2W00A 3AAEB 3Q5DA 4H9QC 2BS2A 2NW8A 3K8PC 4Z90A 3KBUA 4EEDA 4PAGA 3QK6A 5HXEA 3PTRB 1WYCA 1MMNA 3ETVA 1US7B 3SWHA 1KK7A 3UUXB 2V5DA 3HR0A 4EV6A 2VQET 2DWGA 4KP3C 2UXDT 3L39A 5JQGE 4G2AA 3ZMUB 1U5PA 5JR9A 4LFAT 4IREA 1AJ3A 2LOSA 3E0ZA 1N34T 3P8CD 4P1NA 2BVLA 4PJJA 4QXCB 1OEDE 3ZYMA 4TWDA 3C4ZA 3NZQA 2XAGB 4IE7A 4J2CA 1KF6A 1MMAA 4I4TE 4QH5A 3IEEA 4ILCA 3LK2B 3PDYA 4JUYA 1WRDA 2X9HA 5LG3A 3AA1B 3NVOA 4PNIA 4F8HA 3ZSTA 2L9QA 4O2BE 3UUNA 3FB2A 3N2GE 3ZCJA 3UTKA 1UX5A 4TZ4C 4YFSA 3C98B 5DQWA 2YKSA 5L4HA 5AQFB 5AQGB 4IDNA 5GONE 1HF8A 4JI4T 2XJ7A 3LBXA 1Y64B 2R6GF 3J9X1 3U3IA 3QB5K 3PUSA 3OYZA 4DV7T 3RIAA 2D5UA 4JLEA 5LGUB 4DR6T 1ZP0A 2A72A 3F31A 1IBLT 2ACXA 2K3WA 2AXDS 1NENA 4KX6A 4JI5T 5FXVA 3UFEA 5KX5E 3O1JA 2M67A 2QGSA 1UURA 2W0GA 4HN9A 2BG9C 2DI4A 2LM9A 1T7SA 2E9XD 2PTFA 5JDMA 3D0TA 2V7IA 4F6RC 5LGNB 5LMUT 1T8BA 3ZMZB 4X65T 4EIWA 4ANJA 5JRCB 2RP4A 4NUVA 2KWIB 2KINB 4TNVA 5ABGA 4JI2T 5LNKA 5HAXA 5FKYA 3BQKA 1W0AA 3CQCB 3PJAJ 1EZ3A 1IAPA 3AE7A 1LRZA 2JJ9A 4EEBA 4CN1A 2B76A 5HCJA 4E7ZA 4JI1T 3NWIA 3RIUC 1UUSA 3KDSE 4U2ZA 5EK4A 4DMVA 2UXBT 1NAFA 3LSVA 4P0AA 3N9NA 2QA7A 3EUHA 4TN7B 5HXRA 2HN1A 3VU7H 2MYSA 1N33T 3VR8A 1KFYA 2FJDA 3MACA 4ISTA 3AAIA 2NOXA 4B3ST 2IAKA 2YOEA 2H89A 3Q5EA 2LM2A 4IL9A 2B1EA 2J4GA 1XDPA 2IC9A 3P4WA 4H9NC 3R6NA 2F4VT 4GK5E 4HWDA 3GWHA 3TLTA 2VB6A 4UVBB 3AEGA 4XBFB 1UK5A 5CA0E 5L47A 5AQUB 2XSBA 3AE5A 3ESLA 4UV9B 5J2UE 1OWAA 2LHNA 2Q9QD 3Q5XA 2D2SA 2OA5A 3FZFB 1Z0PA 5HXSA 4I50E 1HNXT 2CWYA 3KV9A 3P7IA 2V7KA 4H9OC 4WZXA 3ZKRA 3OTOT 2UUCT 2WAUA 2VK9A 4KUMB 2JRKA 4AXPA 4TV9E 5IYZE 2KLQA 4DUZT 4AQYT 1CHUA 1X9BA 3PUGA 4LF8T 3N2OA 4AKRB 2KNDA 4DR3T 2CEAA 4JBWF 4O4JE 4QKNA 3GN5B 2LE8A 3EI0A 5JVDE 4YSXA 2C5JA 2XQ3A 1KNZA 2XQ8A 5EK2A 3I9YA 3N9PA 1GQEA 4AQFC 2WDVA 4HWCA 4NIQA 2WDRA 2LSKA 4ZOLE 3FZLB 1D1AA 2ZM6T 3N9QA 4EOZB 5KDMC 3AEEA 4PW8A 2IC6A 2V1DB 1D0YA 2VASA 1XZYA 2RA1A 3L8RA 3TKLB 3HA4A 5DJQC 1I94T 4EZ4A 2OV9A 3Q9DA 1U4QA 4HFBA 1Z8UA 3FBZA 3UQ4A 1XWMA 4PFPA 1IJ5A 5AQTB 2P9BA 2V26A 3IF8B 5A1LA 2XQAA 2Q9QC 1HX1B 1M7KA 2WZHA 2XAFB 3B5MA 3IBPA 5FP3A 3MZKB 2XAQB 2LSJA 5FXXA 4BAYB 3AB3B 3V5SA 5IWAT 4WBOA 2ZM2A 5L4EA 4IIJE 1OEDA 2K5BB 5FVKA 2ZLYA 4KHZF 4TV8E 4JYAT 2CA5A 3C50A 3ZJ2A 3AE6A 3ZC1A 1G8XA 5LMNT 1J5WA 2H7OA 4PK6A 4ZZBA 2N1GA 1BR1A 4ILAA 5AQQB 3ZCIA 5IUXA 4HEAA 5C2TA 3NRYA 3UU3A 4HFCA 3MA9A 4DO0A 4NXNT 3AE8A 5CA1E 2DLRA 1YQ3A 2PJQA 2A2FX 2DCFA 2XSAA 4JI8T 3RLFF 4X66T 3TLUA 3RRWA 3UU8A 1YXRA 2XY8B 3OYXA 3SFEA 4X62T 2QYWA 2BG9E 2Y48B 5FMNA 5LCYA 4EAHA 3HKDE 2WZIA 2V7MA 3RH3A 3EAMA 1S94A 5F3JA 4AKHA 5CB4E 4DR4T 2VWAA 2UUBT 2WQYA 3LDQB 3KV5A 3PUZF 4PJLA 4U7IA 3AVSA 2CM0A 3FZMB 4ZS3A 2EHOD 5AQNB 2SPCA 2EHOC 3RYIE 2X9YA 2JQ9A 3KFWX 3MJXA 5JDHA 3WI3A 4WYVA 3PUXF 3X1DA 3C51A 4ZEYA 5J2TE 3A5XA 3CPZA 3VKHA 2YINA 2X9XA 3KVAA 5DQVA 2CWOA 5AQIB 3KV6A 4TWHA 5J1GA 2X51A 3RIFA 4TUYE 2VKJA 1YW0A 3GMIA 5ADXL 3CX6B 5LJNA 4B3TT 1KEYA 3F2EA 4HWHA 4UVCB 2L8KA 5LJMA 3O1IA 4ASKA 4ZI7E 4YY3T 1LVFA 5FY7A 3TLSA 4QX7B 1SHZC 3ZJ1A 1YQ4A 3JAEA 5FY0A 2HHHT 4B3MT 4JI7T 2ODVA 3OJAA 4EGWA 2LHRA 1WFDA 2X0HA 3IA3A 4O8SA 1VCSA 3ZN1B 3CKDA 4YTNA 5JTGA 4DR2T 5HWXA 3GN5A 1D1BA 3FXDB 1BR2A 4P0BA 5LA6E 2WMOA 5LHHB 3UUBA 4JEHB 3RYFE 3ZPOA 3CX8B 4PFOA 4CXXA 4DUYT 2KWHA 2X66A 3LJCA 2CXFA 1V9DA 4LF5T 2E5LT 1ZV4X 3P4SA 4AKGA 4ERRA 2JQHA 3PU3A 4QX8B 4DBRA 2LSYA 4YSYA 3UUMA 3L3PA 1W9RA 4IE6A 3H3AA 2ZM0A 2I59A 2IDOB 2IMLA 5C8YE 1KNRA 2LT3A 3GA8A 3ONXA 2X67A 1WR6A 3B13A 2BZBA 3PE0A 4MALA 4O4LE 3G06A 4U74A 3H3MA 1WCRA 2FUPA 3MKDA 3N9MA 5HWYA 3U78A 3ZSSA 4WBNE 5HXHA 5LP6E 4ZI2C 3O9XA 2Y6XA 3OPCA 2IUBA 3RQUA 3E22E 3HL6A 4FI5A 5AQJB 3OVUA 4UXNB 1X79A 4HTEA 2YK0A 4HFIA 1FJGT 2W2UA 3EDUA 4L9IA 2Z6EA 3UU6A 4DR5T 1BR0A 3Q5WA 2D0UA 2EHOA 2X0YA 2LOPA 2MTQA 4QH1A 4X1IE 2C0SA 4I43B 4A56A 3RC3A 4LF4T 3CK6A 4HWIB 1J1JA 3AE9A 4LMLA 4C91A 4PJNA 3AA7B 5EZYE 4AKIA 2QRXA 3VRBA 3EABA 3BQIA 3AE2A 4DBQA 1MNEA 1MMDA 2BDEA 2XASB 3AE3A 4JEUB 4KMCA 1UCUA 3EVYA 1W09A 4TWFA 3K1SA 3M3ZB 3R84B 3S4UA 3ZT6A 2CHOA 2JQQA 3CX7B 2BS3A 2V8SV 2NR4A 2DL1A 2CCQA 2XPKA 2YDQA 3RYHE 2PFVA 3V5UA 4AKLA 1HG5A 4ZZCA 1ZEEA 3AE1A 4JV5T 4IT4A 1J5ET 5AQRB 1QUUA 3O1HA 4UF0A 5HEOA 2XQYA 1O3XA 1IZNB 3AEAA 5DABA 4AI6A 2KXPB 5HYAA 3EDVA 3CQXC 2PG8A 3PUWF 5HEJA 4CI3B 2NP9A 1FIOA 3P50A 5L3DB 5AQPB 5AQVB 4K0UA 2W66A 4CN6A 2NWBA 3P4PA 1B7TA 1D0XA 4ILUA 4YTMA 1HR0T 4UIGA 2LJLA 4X5TA 3AE4A 3I9WA 5ABEA 4YT0A 2UUAT 3ANWA 1QSDA 1JNZA 2Q9QA 3A7MA 3QB5A 2WMNA 3HKEE 3RC8A 4IGUA 2C5IT 1SE7A 3QUJA 2NTXA 5L2LA 3E08A 4LMKA 3EHZA 1D1CA 3TLVA 1UX4A 1T72A 3ETUA 1WYBA 1MIWA 5L3FB 2DWKA 4QXBB 3OBVE 4DV3T 2WU5A 1FMVA 2QVAA 1N36T 2JMHA 2W62A 2XHEB 2J1DG 2E9XB 2WDQA 4JI6T 3LK3B 3J7Yq 4K0KT 2V6XA 3FBLA 3F57A 4A98A 2XQ9A 1LKXA 4ZHQE 5LXTE 1DU2A 2LKHA 4H63V 2E2AA 5ETWA 4AQFA 4YXDA 3PUAA 5EK3A 4N78D 2V5CA 2WS3A 4CI2B 2ES0A 3I0QA 4UEMA 5HEHA 1I6ZA 2BG9B 5H6RB 1HG2A 1FMWA 4H63H 2IIUA 2VKHA 4WW0A 4X64T 3MXZA 4U33A 1ZKEA 4QHOA 2MOZA 4X20E 4MLKA 1IJ6A 4NXMT 2BBHA 4UF0B 2YU1A 2HPLA 2JQKA 5E0OA 2K24A 3JCFA 2CE7A 4CZZB 1D0ZA 4IDZA 2K9AA 2CBJA 2JPFA 1OEDC 2VVNA 3P4QA 3UFGA 4BJMA 5JH7E 1IBKT 4LFCT 1HCIA 4ZI3D 4P09A 4CI1B 4XAXB 2JMKA 3RGLA 3UULA 3SS1A 3K3QC 3P4RA 2I6HA 4ZI3C 3UT5E 5KXJA 4IE5A 2KMFA 2VVSA 4U72A 2FBWA 3ZLIA 4GIWA 4GOUA 2CLYB 1SUMB 1WR0A 2CPTA 3H37A 3LG7A 3HKBE 4G63A 2Y8DA 4GYSA 4H9PC 1ZOYA 3RPUA 1LVKA 4GK0E 5BR8T 1XNRT 3ZYLA 2UXCT 2KZ7B 4KHPT 5AFUL 3RIUA 2H7VC 3FZHB 2VL8A 3PUVF 1E2AA 1T98A 3JC6D 4A97A 5L3EB 2BVMA 3PUYF 5C3JA 3KINB 5LGTB 4YHHT 2LRKA 4MFRA 4LF9T 4OYJA 4M1PA 5HEGA 2Q9QB 5M4YA 2RPAA 3A8YC 4O4IE 3B57A 3RHWA 2XAHB 3DTOA 2UXXB 4BA9A 2ACZA 1N32T 2W63A 4IE0A 5JDQA 4Q25A 4GKJT 2XAJB 2FJEA 1XNQT 3CVRA 3SFDA 2A3DA 1M62A 1ZHCA 1Y01A 2L3LA 5AQOB 2XZEA 4ZXLA 3UQ7A 2N9DA 4HFVA 2CXLA 2CHNA 2XUEA 4HFDA 2IW5B 3AECA 1KNPA 4HKAA 5FNVE 5LYJE 2E8IA 4OFZA 5CGMA 3ZC0A 4GYRA 1MMGA 4LMJA 2X9WA 2WCAA 2WP9A 3RYCE 5FYMA 3RF1A 3WAJA 2NTYA 4DV0T 3ZYKA 2MPKA 2CMRA 2D0TA 5JDFA 4DR7T 2VKOA 3VKGA 3AAAB 2CRBA 5FL0A 5JDLA 4LF6T 2XM1A 4WNKA 2VL0A 2NW7A 4C90A 4EZHA 1OXZA 2ZM8A 2WU2A 3FHNA 3ZMTB 2WY2A 1VCTA 3RKGA 2M6BA 1MIVA 1HFAA 3SRZA 3ZMVB 3RI5A 4YLHA 5ABFB 2D9DA 3TLWA 3FXEB 3VHLA 4JI3T 3N9LA 3HI2A 2LSGA 2PBIA 2X0LB 2BKPA 2CXDA 3DJBA 3K3OA 4I0UA 5LOVE 4OYKA 5HEUA 4DMWA 4CXYA 2N2NA 4HWFA 2BS4A 1HTJF 2YEVC 3LFMA 3ZN0B 5ABHA 5JREA 1NWMX 2W4XA 2MBGA 5TAOA 4IE4A 2VQFT 1IBMT 3T1HT 4U7YA 4UELA 2FJAA 3CIRA 3BK9A 3CWZB 3L09A 5J0ZA 5AQSB 4I55E 3M65A 2BG9A 4KBMB 5FVLA 4YJ3E 5AQMB 1G73A 4GKKT 2HN2A 3OKQA 5CJ5A 2XQ4A 2E5VA 3ZT7A 4MBQA 2WWVA 4JI0T 2EHOB 2KT9A 1QLBA 2XQ7A 4B3RT 2LSIA 3IHRA 5H6QB 3NZPA 4QH4A 2X68A 1MNDA 2WM9A 4HFEA 2VKDA 4U31A 4IDOA 2CBIA 3RKOA 2DNXA 3N9OA 4H9RC 1E1HB 2J62A 2WB5A 2V7JA 1XDOA 4U2YA 4ZI2D 2YDSA 5FY1A 3ZMSB 3CMLA 3ZT5A 5LHGB
chains in the Genus database with same CATH topology
4DV6T 1HNWT 5LMUT 4X64T 4X65T 4DV4T 4B3TT 4JI2T 4NXMT 4JI1T 4YY3T 4DV5T 3T1YT 2HHHT 4JI7T 2UXBT 4B3MT 1IBKT 4LFCT 4DR2T 1N33T 4B3ST 4LF8T 2F4VT 4DUYT 4LF5T 2E5LT 5BR8T 1XNRT 2UXCT 4LFBT 4KHPT 1HNXT 3OTOT 2UUCT 4YHHT 4LF9T 4DUZT 4AQYT 4DR7T 4DV2T 2UU9T 4DR3T 1N32T 1XMOT 4GKJT 1XNQT 1FJGT 4DR5T 2ZM6T 4LF4T 4DR1T 1I94T 1XMQT 1HNZT 4LF7T 4DV0T 4DV1T 5IWAT 4DV3T 4OX9T 4JV5T 1J5ET 4JI3T 2VQET 5LMNT 2UXDT 4LFAT 1N34T 1IBMT 2VQFT 3T1HT 4NXNT 1HR0T 4JI8T 4GKKT 2UUAT 4X66T 4X62T 4JI0T 4B3RT 1N36T 4JI4T 4DR4T 2UUBT 4DR6T 4DV7T 4JI6T 4JYAT 1IBLT 4K0KT 4LF6T 4JI5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 T;  1HNW T;  5LMU T;  4X64 T;  4X65 T;  4DV4 T;  4B3T T;  4JI2 T;  4NXM T;  4JI1 T;  4YY3 T;  4DV5 T;  3T1Y T;  2HHH T;  4JI7 T;  2UXB T;  4B3M T;  1IBK T;  4LFC T;  4DR2 T;  1N33 T;  4B3S T;  4LF8 T;  2F4V T;  4DUY T;  4LF5 T;  2E5L T;  5BR8 T;  1XNR T;  2UXC T;  4LFB T;  4KHP T;  1HNX T;  3OTO T;  2UUC T;  4YHH T;  4LF9 T;  4DUZ T;  4AQY T;  4DR7 T;  4DV2 T;  2UU9 T;  4DR3 T;  1N32 T;  1XMO T;  4GKJ T;  1XNQ T;  1FJG T;  4DR5 T;  2ZM6 T;  4LF4 T;  4DR1 T;  1I94 T;  1XMQ T;  1HNZ T;  4LF7 T;  4DV0 T;  4DV1 T;  5IWA T;  4DV3 T;  4OX9 T;  4JV5 T;  1J5E T;  4JI3 T;  2VQE T;  5LMN T;  2UXD T;  4LFA T;  1N34 T;  1IBM T;  2VQF T;  3T1H T;  4NXN T;  1HR0 T;  4JI8 T;  4GKK T;  2UUA T;  4X66 T;  4X62 T;  4JI0 T;  4B3R T;  1N36 T;  4JI4 T;  4DR4 T;  2UUB T;  4DR6 T;  4DV7 T;  4JI6 T;  4JYA T;  1IBL T;  4K0K T;  4LF6 T;  4JI5 T; 
#chains in the Genus database with same CATH topology
 2LLY A;  3LK4 2;  4MHC A;  3KBT A;  4NUU A;  4TNW A;  4AIU A;  3RX6 A;  4PK5 A;  4E7S A;  2IHR 1;  3AXJ A;  4DV6 T;  4QXH B;  4AIS A;  2J47 A;  3VR9 A;  1WLX A;  1HNW T;  1VOM A;  3RRC A;  2UXN B;  3I0O A;  4IDP A;  4DV4 T;  4UVA B;  2CLY C;  3W15 B;  4CXW A;  3KVB A;  3C4X A;  3WAK A;  3T8O A;  5JR9 C;  3O4X E;  2YDR A;  4ILB A;  2LEH A;  2WSS V;  3FZK B;  5AQK B;  3VRA A;  2C5K T;  2E9X A;  2XQ6 A;  3DP7 A;  2BBJ A;  1H7C A;  2K48 A;  2VUR A;  3QC9 A;  4IL4 A;  2I0M A;  1R8I A;  3AVR A;  3AEB A;  4UV8 B;  4YHJ A;  4YTP A;  5JDG A;  4DV5 T;  2XM2 A;  3SOL A;  2OLT A;  1VRB A;  3T1Y T;  1OED B;  1S35 A;  5LB7 B;  5L3C B;  4HFH A;  4PK4 A;  3KV4 A;  4EYU A;  4YJ2 E;  5JR9 B;  1JNR A;  3I1A A;  3PJA A;  5F5W A;  5JRC A;  1UGO A;  2WBL A;  4H9S E;  4A5X A;  1E7P A;  2G0U A;  4L0R A;  4ADZ A;  4QWN B;  2FJB A;  3N5L A;  5AQL B;  2GK9 A;  1NEK A;  3PUR A;  1YKE B;  4EYY R;  2YN6 A;  4IHJ E;  3AXJ B;  4IDQ A;  2V6Y B;  4UR9 A;  4AQG A;  3NKZ A;  3ONJ A;  3RQW A;  5CFB A;  3C4W A;  3PU8 A;  4EXT A;  4X1Y E;  3AED A;  2JIW A;  1BR4 A;  3QNU A;  2HPJ A;  3UU5 A;  4DID B;  3AA6 B;  2DHR A;  4L5G A;  4LFB T;  3QOF A;  2WWU A;  4O2A E;  2LRL A;  2HH7 A;  2A9U A;  3ONL C;  5AQH B;  5KMG P;  4U3C A;  4XZC A;  5L3B B;  4HGA A;  2V7L A;  2E9X C;  4BJN A;  2ODU A;  3K3N A;  4FJO A;  4HE8 A;  3MK7 C;  2M6I A;  5LBQ B;  4DV2 T;  3AA0 B;  2UU9 T;  3PUQ A;  4OHF A;  2W67 A;  2MAW A;  3LBX B;  2LKG A;  4Z8X A;  1HX8 A;  5LBM A;  4COF A;  5JDN A;  4O4H E;  1XMO T;  3NBX X;  4X1K E;  3PV0 F;  3CQG B;  4YSZ A;  4CN4 A;  4EB6 E;  3JAD A;  5BMV E;  5LHI B;  3ABV A;  2AE9 A;  2H3R A;  4KI0 F;  2XQ5 A;  3C64 A;  5IHY A;  3ZEF B;  4Z91 A;  5HXC A;  3UU4 A;  2KSR A;  5ABF A;  3AEF A;  3BQL A;  5F8P A;  2BKO A;  4DND A;  4OK0 A;  1L0V A;  1MIY A;  4DR1 T;  3JAF A;  4ZS2 A;  2BKN A;  1YKH B;  3HKC E;  1CUN A;  4CQI A;  5HCM A;  4B6X A;  4ISS A;  5FXW A;  3N2K E;  2H88 A;  4DVD A;  2NW9 A;  1XMQ T;  1HNZ T;  3JC6 C;  4LF7 T;  2XTL A;  4TX5 A;  5FL1 A;  4DV1 T;  1YD8 G;  2YU2 A;  3ANW B;  4PJM A;  1FEW A;  2ZMA A;  4NPP A;  1HS7 A;  2V6Y A;  1SA0 E;  3NRX A;  5FXZ A;  1W0B A;  5L3G B;  5LG4 A;  3Q2M A;  4OX9 T;  4V1A v;  2W61 A;  2W00 A;  3AAE B;  3Q5D A;  4H9Q C;  2BS2 A;  2NW8 A;  3K8P C;  4Z90 A;  3KBU A;  4EED A;  4PAG A;  3QK6 A;  5HXE A;  3PTR B;  1WYC A;  1MMN A;  3ETV A;  1US7 B;  3SWH A;  1KK7 A;  3UUX B;  2V5D A;  3HR0 A;  4EV6 A;  2VQE T;  2DWG A;  4KP3 C;  2UXD T;  3L39 A;  5JQG E;  4G2A A;  3ZMU B;  1U5P A;  5JR9 A;  4LFA T;  4IRE A;  1AJ3 A;  2LOS A;  3E0Z A;  1N34 T;  3P8C D;  4P1N A;  2BVL A;  4PJJ A;  4QXC B;  1OED E;  3ZYM A;  4TWD A;  3C4Z A;  3NZQ A;  2XAG B;  4IE7 A;  4J2C A;  1KF6 A;  1MMA A;  4I4T E;  4QH5 A;  3IEE A;  4ILC A;  3LK2 B;  3PDY A;  4JUY A;  1WRD A;  2X9H A;  5LG3 A;  3AA1 B;  3NVO A;  4PNI A;  4F8H A;  3ZST A;  2L9Q A;  4O2B E;  3UUN A;  3FB2 A;  3N2G E;  3ZCJ A;  3UTK A;  1UX5 A;  4TZ4 C;  4YFS A;  3C98 B;  5DQW A;  2YKS A;  5L4H A;  5AQF B;  5AQG B;  4IDN A;  5GON E;  1HF8 A;  4JI4 T;  2XJ7 A;  3LBX A;  1Y64 B;  2R6G F;  3J9X 1;  3U3I A;  3QB5 K;  3PUS A;  3OYZ A;  4DV7 T;  3RIA A;  2D5U A;  4JLE A;  5LGU B;  4DR6 T;  1ZP0 A;  2A72 A;  3F31 A;  1IBL T;  2ACX A;  2K3W A;  2AXD S;  1NEN A;  4KX6 A;  4JI5 T;  5FXV A;  3UFE A;  5KX5 E;  3O1J A;  2M67 A;  2QGS A;  1UUR A;  2W0G A;  4HN9 A;  2BG9 C;  2DI4 A;  2LM9 A;  1T7S A;  2E9X D;  2PTF A;  5JDM A;  3D0T A;  2V7I A;  4F6R C;  5LGN B;  5LMU T;  1T8B A;  3ZMZ B;  4X65 T;  4EIW A;  4ANJ A;  5JRC B;  2RP4 A;  4NUV A;  2KWI B;  2KIN B;  4TNV A;  5ABG A;  4JI2 T;  5LNK A;  5HAX A;  5FKY A;  3BQK A;  1W0A A;  3CQC B;  3PJA J;  1EZ3 A;  1IAP A;  3AE7 A;  1LRZ A;  2JJ9 A;  4EEB A;  4CN1 A;  2B76 A;  5HCJ A;  4E7Z A;  4JI1 T;  3NWI A;  3RIU C;  1UUS A;  3KDS E;  4U2Z A;  5EK4 A;  4DMV A;  2UXB T;  1NAF A;  3LSV A;  4P0A A;  3N9N A;  2QA7 A;  3EUH A;  4TN7 B;  5HXR A;  2HN1 A;  3VU7 H;  2MYS A;  1N33 T;  3VR8 A;  1KFY A;  2FJD A;  3MAC A;  4IST A;  3AAI A;  2NOX A;  4B3S T;  2IAK A;  2YOE A;  2H89 A;  3Q5E A;  2LM2 A;  4IL9 A;  2B1E A;  2J4G A;  1XDP A;  2IC9 A;  3P4W A;  4H9N C;  3R6N A;  2F4V T;  4GK5 E;  4HWD A;  3GWH A;  3TLT A;  2VB6 A;  4UVB B;  3AEG A;  4XBF B;  1UK5 A;  5CA0 E;  5L47 A;  5AQU B;  2XSB A;  3AE5 A;  3ESL A;  4UV9 B;  5J2U E;  1OWA A;  2LHN A;  2Q9Q D;  3Q5X A;  2D2S A;  2OA5 A;  3FZF B;  1Z0P A;  5HXS A;  4I50 E;  1HNX T;  2CWY A;  3KV9 A;  3P7I A;  2V7K A;  4H9O C;  4WZX A;  3ZKR A;  3OTO T;  2UUC T;  2WAU A;  2VK9 A;  4KUM B;  2JRK A;  4AXP A;  4TV9 E;  5IYZ E;  2KLQ A;  4DUZ T;  4AQY T;  1CHU A;  1X9B A;  3PUG A;  4LF8 T;  3N2O A;  4AKR B;  2KND A;  4DR3 T;  2CEA A;  4JBW F;  4O4J E;  4QKN A;  3GN5 B;  2LE8 A;  3EI0 A;  5JVD E;  4YSX A;  2C5J A;  2XQ3 A;  1KNZ A;  2XQ8 A;  5EK2 A;  3I9Y A;  3N9P A;  1GQE A;  4AQF C;  2WDV A;  4HWC A;  4NIQ A;  2WDR A;  2LSK A;  4ZOL E;  3FZL B;  1D1A A;  2ZM6 T;  3N9Q A;  4EOZ B;  5KDM C;  3AEE A;  4PW8 A;  2IC6 A;  2V1D B;  1D0Y A;  2VAS A;  1XZY A;  2RA1 A;  3L8R A;  3TKL B;  3HA4 A;  5DJQ C;  1I94 T;  4EZ4 A;  2OV9 A;  3Q9D A;  1U4Q A;  4HFB A;  1Z8U A;  3FBZ A;  3UQ4 A;  1XWM A;  4PFP A;  1IJ5 A;  5AQT B;  2P9B A;  2V26 A;  3IF8 B;  5A1L A;  2XQA A;  2Q9Q C;  1HX1 B;  1M7K A;  2WZH A;  2XAF B;  3B5M A;  3IBP A;  5FP3 A;  3MZK B;  2XAQ B;  2LSJ A;  5FXX A;  4BAY B;  3AB3 B;  3V5S A;  5IWA T;  4WBO A;  2ZM2 A;  5L4E A;  4IIJ E;  1OED A;  2K5B B;  5FVK A;  2ZLY A;  4KHZ F;  4TV8 E;  4JYA T;  2CA5 A;  3C50 A;  3ZJ2 A;  3AE6 A;  3ZC1 A;  1G8X A;  5LMN T;  1J5W A;  2H7O A;  4PK6 A;  4ZZB A;  2N1G A;  1BR1 A;  4ILA A;  5AQQ B;  3ZCI A;  5IUX A;  4HEA A;  5C2T A;  3NRY A;  3UU3 A;  4HFC A;  3MA9 A;  4DO0 A;  4NXN T;  3AE8 A;  5CA1 E;  2DLR A;  1YQ3 A;  2PJQ A;  2A2F X;  2DCF A;  2XSA A;  4JI8 T;  3RLF F;  4X66 T;  3TLU A;  3RRW A;  3UU8 A;  1YXR A;  2XY8 B;  3OYX A;  3SFE A;  4X62 T;  2QYW A;  2BG9 E;  2Y48 B;  5FMN A;  5LCY A;  4EAH A;  3HKD E;  2WZI A;  2V7M A;  3RH3 A;  3EAM A;  1S94 A;  5F3J A;  4AKH A;  5CB4 E;  4DR4 T;  2VWA A;  2UUB T;  2WQY A;  3LDQ B;  3KV5 A;  3PUZ F;  4PJL A;  4U7I A;  3AVS A;  2CM0 A;  3FZM B;  4ZS3 A;  2EHO D;  5AQN B;  2SPC A;  2EHO C;  3RYI E;  2X9Y A;  2JQ9 A;  3KFW X;  3MJX A;  5JDH A;  3WI3 A;  4WYV A;  3PUX F;  3X1D A;  3C51 A;  4ZEY A;  5J2T E;  3A5X A;  3CPZ A;  3VKH A;  2YIN A;  2X9X A;  3KVA A;  5DQV A;  2CWO A;  5AQI B;  3KV6 A;  4TWH A;  5J1G A;  2X51 A;  3RIF A;  4TUY E;  2VKJ A;  1YW0 A;  3GMI A;  5ADX L;  3CX6 B;  5LJN A;  4B3T T;  1KEY A;  3F2E A;  4HWH A;  4UVC B;  2L8K A;  5LJM A;  3O1I A;  4ASK A;  4ZI7 E;  4YY3 T;  1LVF A;  5FY7 A;  3TLS A;  4QX7 B;  1SHZ C;  3ZJ1 A;  1YQ4 A;  3JAE A;  5FY0 A;  2HHH T;  4B3M T;  4JI7 T;  2ODV A;  3OJA A;  4EGW A;  2LHR A;  1WFD A;  2X0H A;  3IA3 A;  4O8S A;  1VCS A;  3ZN1 B;  3CKD A;  4YTN A;  5JTG A;  4DR2 T;  5HWX A;  3GN5 A;  1D1B A;  3FXD B;  1BR2 A;  4P0B A;  5LA6 E;  2WMO A;  5LHH B;  3UUB A;  4JEH B;  3RYF E;  3ZPO A;  3CX8 B;  4PFO A;  4CXX A;  4DUY T;  2KWH A;  2X66 A;  3LJC A;  2CXF A;  1V9D A;  4LF5 T;  2E5L T;  1ZV4 X;  3P4S A;  4AKG A;  4ERR A;  2JQH A;  3PU3 A;  4QX8 B;  4DBR A;  2LSY A;  4YSY A;  3UUM A;  3L3P A;  1W9R A;  4IE6 A;  3H3A A;  2ZM0 A;  2I59 A;  2IDO B;  2IML A;  5C8Y E;  1KNR A;  2LT3 A;  3GA8 A;  3ONX A;  2X67 A;  1WR6 A;  3B13 A;  2BZB A;  3PE0 A;  4MAL A;  4O4L E;  3G06 A;  4U74 A;  3H3M A;  1WCR A;  2FUP A;  3MKD A;  3N9M A;  5HWY A;  3U78 A;  3ZSS A;  4WBN E;  5HXH A;  5LP6 E;  4ZI2 C;  3O9X A;  2Y6X A;  3OPC A;  2IUB A;  3RQU A;  3E22 E;  3HL6 A;  4FI5 A;  5AQJ B;  3OVU A;  4UXN B;  1X79 A;  4HTE A;  2YK0 A;  4HFI A;  1FJG T;  2W2U A;  3EDU A;  4L9I A;  2Z6E A;  3UU6 A;  4DR5 T;  1BR0 A;  3Q5W A;  2D0U A;  2EHO A;  2X0Y A;  2LOP A;  2MTQ A;  4QH1 A;  4X1I E;  2C0S A;  4I43 B;  4A56 A;  3RC3 A;  4LF4 T;  3CK6 A;  4HWI B;  1J1J A;  3AE9 A;  4LML A;  4C91 A;  4PJN A;  3AA7 B;  5EZY E;  4AKI A;  2QRX A;  3VRB A;  3EAB A;  3BQI A;  3AE2 A;  4DBQ A;  1MNE A;  1MMD A;  2BDE A;  2XAS B;  3AE3 A;  4JEU B;  4KMC A;  1UCU A;  3EVY A;  1W09 A;  4TWF A;  3K1S A;  3M3Z B;  3R84 B;  3S4U A;  3ZT6 A;  2CHO A;  2JQQ A;  3CX7 B;  2BS3 A;  2V8S V;  2NR4 A;  2DL1 A;  2CCQ A;  2XPK A;  2YDQ A;  3RYH E;  2PFV A;  3V5U A;  4AKL A;  1HG5 A;  4ZZC A;  1ZEE A;  3AE1 A;  4JV5 T;  4IT4 A;  1J5E T;  5AQR B;  1QUU A;  3O1H A;  4UF0 A;  5HEO A;  2XQY A;  1O3X A;  1IZN B;  3AEA A;  5DAB A;  4AI6 A;  2KXP B;  5HYA A;  3EDV A;  3CQX C;  2PG8 A;  3PUW F;  5HEJ A;  4CI3 B;  2NP9 A;  1FIO A;  3P50 A;  5L3D B;  5AQP B;  5AQV B;  4K0U A;  2W66 A;  4CN6 A;  2NWB A;  3P4P A;  1B7T A;  1D0X A;  4ILU A;  4YTM A;  1HR0 T;  4UIG A;  2LJL A;  4X5T A;  3AE4 A;  3I9W A;  5ABE A;  4YT0 A;  2UUA T;  3ANW A;  1QSD A;  1JNZ A;  2Q9Q A;  3A7M A;  3QB5 A;  2WMN A;  3HKE E;  3RC8 A;  4IGU A;  2C5I T;  1SE7 A;  3QUJ A;  2NTX A;  5L2L A;  3E08 A;  4LMK A;  3EHZ A;  1D1C A;  3TLV A;  1UX4 A;  1T72 A;  3ETU A;  1WYB A;  1MIW A;  5L3F B;  2DWK A;  4QXB B;  3OBV E;  4DV3 T;  2WU5 A;  1FMV A;  2QVA A;  1N36 T;  2JMH A;  2W62 A;  2XHE B;  2J1D G;  2E9X B;  2WDQ A;  4JI6 T;  3LK3 B;  3J7Y q;  4K0K T;  2V6X A;  3FBL A;  3F57 A;  4A98 A;  2XQ9 A;  1LKX A;  4ZHQ E;  5LXT E;  1DU2 A;  2LKH A;  4H63 V;  2E2A A;  5ETW A;  4AQF A;  4YXD A;  3PUA A;  5EK3 A;  4N78 D;  2V5C A;  2WS3 A;  4CI2 B;  2ES0 A;  3I0Q A;  4UEM A;  5HEH A;  1I6Z A;  2BG9 B;  5H6R B;  1HG2 A;  1FMW A;  4H63 H;  2IIU A;  2VKH A;  4WW0 A;  4X64 T;  3MXZ A;  4U33 A;  1ZKE A;  4QHO A;  2MOZ A;  4X20 E;  4MLK A;  1IJ6 A;  4NXM T;  2BBH A;  4UF0 B;  2YU1 A;  2HPL A;  2JQK A;  5E0O A;  2K24 A;  3JCF A;  2CE7 A;  4CZZ B;  1D0Z A;  4IDZ A;  2K9A A;  2CBJ A;  2JPF A;  1OED C;  2VVN A;  3P4Q A;  3UFG A;  4BJM A;  5JH7 E;  1IBK T;  4LFC T;  1HCI A;  4ZI3 D;  4P09 A;  4CI1 B;  4XAX B;  2JMK A;  3RGL A;  3UUL A;  3SS1 A;  3K3Q C;  3P4R A;  2I6H A;  4ZI3 C;  3UT5 E;  5KXJ A;  4IE5 A;  2KMF A;  2VVS A;  4U72 A;  2FBW A;  3ZLI A;  4GIW A;  4GOU A;  2CLY B;  1SUM B;  1WR0 A;  2CPT A;  3H37 A;  3LG7 A;  3HKB E;  4G63 A;  2Y8D A;  4GYS A;  4H9P C;  1ZOY A;  3RPU A;  1LVK A;  4GK0 E;  5BR8 T;  1XNR T;  3ZYL A;  2UXC T;  2KZ7 B;  4KHP T;  5AFU L;  3RIU A;  2H7V C;  3FZH B;  2VL8 A;  3PUV F;  1E2A A;  1T98 A;  3JC6 D;  4A97 A;  5L3E B;  2BVM A;  3PUY F;  5C3J A;  3KIN B;  5LGT B;  4YHH T;  2LRK A;  4MFR A;  4LF9 T;  4OYJ A;  4M1P A;  5HEG A;  2Q9Q B;  5M4Y A;  2RPA A;  3A8Y C;  4O4I E;  3B57 A;  3RHW A;  2XAH B;  3DTO A;  2UXX B;  4BA9 A;  2ACZ A;  1N32 T;  2W63 A;  4IE0 A;  5JDQ A;  4Q25 A;  4GKJ T;  2XAJ B;  2FJE A;  1XNQ T;  3CVR A;  3SFD A;  2A3D A;  1M62 A;  1ZHC A;  1Y01 A;  2L3L A;  5AQO B;  2XZE A;  4ZXL A;  3UQ7 A;  2N9D A;  4HFV A;  2CXL A;  2CHN A;  2XUE A;  4HFD A;  2IW5 B;  3AEC A;  1KNP A;  4HKA A;  5FNV E;  5LYJ E;  2E8I A;  4OFZ A;  5CGM A;  3ZC0 A;  4GYR A;  1MMG A;  4LMJ A;  2X9W A;  2WCA A;  2WP9 A;  3RYC E;  5FYM A;  3RF1 A;  3WAJ A;  2NTY A;  4DV0 T;  3ZYK A;  2MPK A;  2CMR A;  2D0T A;  5JDF A;  4DR7 T;  2VKO A;  3VKG A;  3AAA B;  2CRB A;  5FL0 A;  5JDL A;  4LF6 T;  2XM1 A;  4WNK A;  2VL0 A;  2NW7 A;  4C90 A;  4EZH A;  1OXZ A;  2ZM8 A;  2WU2 A;  3FHN A;  3ZMT B;  2WY2 A;  1VCT A;  3RKG A;  2M6B A;  1MIV A;  1HFA A;  3SRZ A;  3ZMV B;  3RI5 A;  4YLH A;  5ABF B;  2D9D A;  3TLW A;  3FXE B;  3VHL A;  4JI3 T;  3N9L A;  3HI2 A;  2LSG A;  2PBI A;  2X0L B;  2BKP A;  2CXD A;  3DJB A;  3K3O A;  4I0U A;  5LOV E;  4OYK A;  5HEU A;  4DMW A;  4CXY A;  2N2N A;  4HWF A;  2BS4 A;  1HTJ F;  2YEV C;  3LFM A;  3ZN0 B;  5ABH A;  5JRE A;  1NWM X;  2W4X A;  2MBG A;  5TAO A;  4IE4 A;  2VQF T;  1IBM T;  3T1H T;  4U7Y A;  4UEL A;  2FJA A;  3CIR A;  3BK9 A;  3CWZ B;  3L09 A;  5J0Z A;  5AQS B;  4I55 E;  3M65 A;  2BG9 A;  4KBM B;  5FVL A;  4YJ3 E;  5AQM B;  1G73 A;  4GKK T;  2HN2 A;  3OKQ A;  5CJ5 A;  2XQ4 A;  2E5V A;  3ZT7 A;  4MBQ A;  2WWV A;  4JI0 T;  2EHO B;  2KT9 A;  1QLB A;  2XQ7 A;  4B3R T;  2LSI A;  3IHR A;  5H6Q B;  3NZP A;  4QH4 A;  2X68 A;  1MND A;  2WM9 A;  4HFE A;  2VKD A;  4U31 A;  4IDO A;  2CBI A;  3RKO A;  2DNX A;  3N9O A;  4H9R C;  1E1H B;  2J62 A;  2WB5 A;  2V7J A;  1XDO A;  4U2Y A;  4ZI2 D;  2YDS A;  5FY1 A;  3ZMS B;  3CML A;  3ZT5 A;  5LHG B; 
#chains in the Genus database with same CATH homology
 4DV6 T;  1HNW T;  5LMU T;  4X64 T;  4X65 T;  4DV4 T;  4B3T T;  4JI2 T;  4NXM T;  4JI1 T;  4YY3 T;  4DV5 T;  3T1Y T;  2HHH T;  4JI7 T;  2UXB T;  4B3M T;  1IBK T;  4LFC T;  4DR2 T;  1N33 T;  4B3S T;  4LF8 T;  2F4V T;  4DUY T;  4LF5 T;  2E5L T;  5BR8 T;  1XNR T;  2UXC T;  4LFB T;  4KHP T;  1HNX T;  3OTO T;  2UUC T;  4YHH T;  4LF9 T;  4DUZ T;  4AQY T;  4DR7 T;  4DV2 T;  2UU9 T;  4DR3 T;  1N32 T;  1XMO T;  4GKJ T;  1XNQ T;  1FJG T;  4DR5 T;  2ZM6 T;  4LF4 T;  4DR1 T;  1I94 T;  1XMQ T;  1HNZ T;  4LF7 T;  4DV0 T;  4DV1 T;  5IWA T;  4DV3 T;  4OX9 T;  4JV5 T;  1J5E T;  4JI3 T;  2VQE T;  5LMN T;  2UXD T;  4LFA T;  1N34 T;  1IBM T;  2VQF T;  3T1H T;  4NXN T;  1HR0 T;  4JI8 T;  4GKK T;  2UUA T;  4X66 T;  4X62 T;  4JI0 T;  4B3R T;  1N36 T;  4JI4 T;  4DR4 T;  2UUB T;  4DR6 T;  4DV7 T;  4JI6 T;  4JYA T;  1IBL T;  4K0K T;  4LF6 T;  4JI5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...