2F4VT

30s ribosome + designer antibiotic
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2f4vT00
4GKKT 4DV7T 2UUCT 4DR2T 1HNZT 4JI2T 4LF6T 1I94T 4LFBT 4B3RT 4AQYT 4YY3T 4B3MT 2VQFT 4K0KT 4DV3T 4JI8T 4JI7T 3OTOT 4DR5T 4X64T 4LFAT 1IBMT 1FJGT 4KHPT 4JI0T 4DV6T 5LMNT 1XNQT 1N32T 1XNRT 1HR0T 5BR8T 1HNWT 4DV2T 4JI4T 4DUZT 4LF9T 4OX9T 1XMOT 4LF5T 4DV1T 4X65T 4NXMT 4B3ST 4JI5T 4X62T 4YHHT 4DV4T 1XMQT 4NXNT 4LF8T 4LF7T 4JV5T 2UUBT 4DV5T 4DR6T 2ZM6T 4JI1T 4DUYT 2UXBT 2UUAT 4B3TT 4DR7T 2UU9T 2UXDT 4DR4T 2UXCT 5LMUT 1N36T 1N33T 1N34T 2E5LT 4GKJT 1HNXT 4X66T 4LF4T 3T1YT 2F4VT 4JYAT 3T1HT 1IBKT 4LFCT 1J5ET 4DR1T 4JI3T 2VQET 4JI6T 5IWAT 4DV0T 4DR3T 2HHHT 1IBLT
chains in the Genus database with same CATH superfamily
5HYAA 2V6YA 4YTPA 2X0HA 4WW0A 2XPKA 5FXXA 4IE7A 4KP3C 4UEMA 2CPTA 1Z8UA 2CM0A 1MIYA 4MHCA 4JI8T 3ZYKA 2IC9A 2LSKA 2VURA 2BS3A 5L3EB 5LXTE 1XNQT 4ASKA 3K8PC 4O4LE 4U33A 4Z90A 1MMAA 2NR4A 5FY0A 1ZP0A 4HGAA 1KEYA 3PTRB 3HKBE 4NXMT 3RQUA 1XWMA 2CWOA 5FKYA 3LFMA 1MMNA 4LF7T 5ADXL 5AFUL 2B1EA 3ZN0B 1MNEA 4DR7T 4P1NA 2CBJA 3RYCE 2LHRA 3RYFE 2XAJB 2IW5B 2NOXA 2JMKA 2XQ8A 1G73A 3B57A 1X79A 5HEJA 3CQGB 3ABVA 1QLBA 3A8YC 4DVDA 4DR1T 3C4XA 1HTJF 2Q9QB 2BS4A 4YLHA 2PG8A 5FY7A 4PJLA 2C5KT 3C4ZA 2AE9A 3OPCA 3VR9A 2AXDS 1T98A 2H7OA 4GK0E 5HEGA 3FHNA 3PUZF 1MNDA 3MA9A 2WM9A 3BQIA 3NZQA 3RRWA 1T8BA 2R6GF 4O4IE 3AE8A 4TNWA 5LHIB 1R8IA 3OTOT 4DR5T 3AXJA 4YJ2E 3PU3A 5HXEA 1YQ3A 1VRBA 4V1Av 4TV8E 2BG9C 4TX5A 3UTKA 3N9MA 5HXSA 2BVLA 2XM1A 1N32T 3VRAA 5FNVE 3K3QC 4X65T 5DJQC 4OYJA 2WAUA 5J1GA 3UU8A 2H3RA 3MXZA 4U2ZA 4DUYT 1OEDB 2CRBA 3N9OA 2QRXA 2MOZA 3SOLA 1W0BA 3QOFA 2MYSA 4QKNA 1MIWA 4CXYA 2BS2A 2HPLA 4P0BA 1L0VA 2E5LT 4DMWA 3E0ZA 4H9SE 4IE5A 4HFBA 1KNZA 1GQEA 1E2AA 4BAYB 3SWHA 4DR3T 5LA6E 2V5CA 4COFA 3TLUA 4AQFC 2LM2A 3RKOA 4GKKT 2NTXA 3KINB 4IE6A 3KV9A 1CUNA 1HS7A 3O1HA 1NAFA 4NPPA 2VQFT 5AQSB 4ZI2D 3HR0A 3NBXX 4JEUB 3RLFF 3O9XA 3F2EA 5LP6E 2N1GA 3PUWF 2CE7A 5FYMA 3I9WA 4EV6A 5F3JA 3AVSA 2V7IA 4IL4A 3M3ZB 3ZYLA 2E2AA 2WZHA 5BR8T 3ETUA 3EVYA 4LF5T 4QH5A 2XQ7A 4B3ST 2ODUA 5AQKB 4LF8T 3ANWB 1FEWA 5LCYA 5AQJB 2LE8A 3HKCE 3VKHA 2XJ7A 2CHOA 3O1JA 1O3XA 2LOSA 2K24A 3R6NA 5EK2A 3AB3B 2YDSA 4HTEA 3KDSE 4X66T 3AEEA 5JRCB 3UU3A 5ABGA 3N9PA 5HXHA 3AE3A 3AE6A 2ACZA 2A3DA 1M62A 5JQGE 2WU5A 4ZZCA 4CI3B 3CVRA 5LHHB 3RIUA 3QB5A 2WZIA 2Y8DA 2LRKA 2BKNA 4B3MT 2LRLA 2BKOA 5E0OA 3ZMSB 3P4RA 3KVBA 3I0OA 2W4XA 2LSJA 2X9XA 2C5JA 2IUBA 4IT4A 3I9YA 5BMVE 5JR9B 3H37A 5L4EA 2N9DA 4EZHA 3H3AA 2D9DA 2GK9A 3TLTA 4DUZT 2KXPB 2BZBA 4HWIB 4CZZB 2KINB 3JAFA 3ZLIA 1WLXA 3NRXA 1IAPA 4HKAA 5AQOB 4CN6A 2M67A 3V5SA 3WI3A 3EDUA 3SFDA 5LNKA 2Q9QD 5FP3A 1W09A 4A97A 3I1AA 2C0SA 4TZ4C 4PFOA 5AQTB 3ZT7A 2W61A 2LKGA 2E5VA 1UX5A 3N2KE 4E7ZA 2XAGB 2JPFA 5M4YA 4JI6T 5TAOA 2EHOA 2OLTA 5AQVB 3RYHE 3LK2B 5H6RB 2XAHB 1LRZA 3PDYA 1YXRA 1U4QA 4NUVA 3N9QA 1SUMB 3UFGA 4LF6T 1I94T 5L4HA 2VKHA 3NVOA 4FJOA 3MZKB 3ZMVB 2CXFA 1BR2A 1QSDA 4UVAB 4U3CA 3ZSTA 1D1BA 2WU2A 5C2TA 2NW9A 2XSBA 4ZHQE 4JBWF 4JLEA 4QXCB 3UU4A 1IJ5A 2FJBA 2VL8A 1XNRT 2LT3A 5AQLB 4CN4A 5KXJA 2ZLYA 4ILCA 3RHWA 4IL9A 1XMOT 2V6XA 2WMNA 4NUUA 1XMQT 1VCSA 2WBLA 1MMGA 1WCRA 2V8SV 4FI5A 4HFIA 4O2BE 3AA1B 3UU6A 3RC8A 5DQWA 2E8IA 4HE8A 1OWAA 2RA1A 2DL1A 2FUPA 1D0XA 4CI1B 4DR4T 4IIJE 3AEFA 2LSIA 3CQXC 4UELA 4ILBA 2WMOA 3RF1A 4JYAT 2VK9A 3E22E 2XTLA 3FXEB 1HCIA 3U78A 4OK0A 5C3JA 4ISTA 2VQET 5FVKA 3Q5WA 3UULA 1IZNB 3VHLA 3MKDA 3FZLB 3OKQA 2NWBA 1IBLT 4QX8B 3K3OA 1OEDE 5LYJE 4EB6E 4WZXA 5HEUA 2V7LA 4AQYT 3CX6B 2L3LA 4WNKA 4H9RC 3P4SA 2PFVA 2X9WA 2BG9B 4L0RA 2V26A 5J2UE 2KT9A 3RC3A 3ONXA 4ZZBA 4F6RC 3UQ4A 1V9DA 3FBZA 2VKJA 2L9QA 1LKXA 2L8KA 2ACXA 5AQGB 3DP7A 2IHR1 4EEDA 2J62A 4YHHT 4NXNT 3AE1A 4MFRA 3MJXA 2CCQA 2A72A 3QUJA 2W62A 3KV6A 5JVDE 2UXBT 3JC6C 3HKDE 2W00A 5LMUT 4O4HE 2ES0A 3Q5EA 4CN1A 3EHZA 3AE5A 4QH1A 1Y01A 4YFSA 4GKJT 2X68A 2WDRA 2UXNB 5FVLA 3DTOA 3UUMA 3RIUC 2VKOA 2E9XA 3R84B 4N78D 3FZMB 4B6XA 2JJ9A 4CXXA 3ZEFB 1UUSA 4YJ3E 3HI2A 3U3IA 3C4WA 1YKHB 3CKDA 4DBRA 3RIAA 2YKSA 4HWCA 4B3RT 3AA0B 2FBWA 4Z8XA 4AQGA 4K0KT 2KSRA 1J1JA 4ANJA 3P4PA 5AQUB 3Q5XA 4DV6T 3G06A 2I6HA 3FBLA 4O8SA 4PJJA 4HN9A 4PW8A 1AJ3A 4PJNA 4E7SA 5HEHA 4DV2T 4GOUA 5JREA 1Z0PA 3RI5A 1BR0A 4UF0B 3A5XA 2V5DA 3SFEA 3EAMA 1W9RA 2X66A 2ZM6T 3WAJA 4H63V 5LHGB 2W63A 4EOZB 1S94A 2PTFA 2RP4A 1HG5A 2BKPA 3J7Yq 2NTYA 5L3FB 1HNXT 1E7PA 1FMVA 2FJAA 2YDQA 4G63A 2EHOC 1IBKT 3FZFB 2KWIB 1U5PA 3UUXB 3ZJ2A 2V6YB 4MLKA 4QHOA 5JDMA 1HX1B 2XQ6A 4HFHA 4DV0T 5FXVA 3UU5A 2VASA 4YHJA 3P4QA 3JC6D 2MAWA 3ZMTB 3HL6A 3EDVA 1HNZT 2X0LB 4LFBT 1D1AA 2J47A 3ZJ1A 5AQRB 4DV3T 4IE0A 5LB7B 4TV9E 4AISA 2CBIA 2JQQA 2K48A 2YOEA 3V5UA 4LMKA 5HCMA 2D2SA 2KLQA 2Z6EA 1ZOYA 4IREA 3K3NA 2DHRA 4PJMA 4P0AA 4MBQA 2LEHA 1KF6A 3P50A 1ZKEA 2CHNA 3AAIA 2YU2A 3KFWX 1N36T 2V7JA 1UGOA 5HAXA 4EEBA 4GYSA 3RH3A 4OHFA 2LHNA 2CMRA 4LMLA 3BK9A 3OBVE 3ZYMA 3ZMZB 3AE9A 5LG4A 4ADZA 4X5TA 5DABA 2B76A 2J4GA 3ZPOA 3CX8B 4CXWA 5L47A 3AXJB 4EAHA 4DR2T 3JAEA 4EIWA 2DI4A 1WFDA 2UXXB 3L8RA 2DNXA 4I55E 5ABFA 2LJLA 2CEAA 4JI7T 3PUGA 4UIGA 2P9BA 1IBMT 2PBIA 2WWUA 3PJAA 5HXCA 2WY2A 1ZEEA 4QWNB 4XAXB 2H7VC 2HN2A 1HNWT 2NP9A 3LJCA 2BBHA 5HXRA 1LVKA 1US7B 1HFAA 5LJMA 2BVMA 2K9AA 3M65A 2XAQB 4H63H 2UUBT 2I59A 2JQKA 3BQKA 4IDZA 1ZV4X 4I50E 4U7IA 2WWVA 3UFEA 2WB5A 3PU8A 3NWIA 4DNDA 3C98B 2QA7A 3ZN1B 4LMJA 3RYIE 2BG9E 4EYUA 2E9XC 4HWDA 3GN5A 5CB4E 3FXDB 4PK6A 3A7MA 2OV9A 2J1DG 4U72A 3LBXA 2BDEA 2XZEA 1T72A 3QC9A 4JUYA 3QNUA 1KNRA 1W0AA 2CWYA 3EI0A 4YY3T 2DWGA 2JRKA 4PAGA 5ABEA 3K1SA 4AIUA 2XUEA 5CJ5A 3LK3B 3Q5DA 3MK7C 5FXWA 2XAFB 3TLSA 2YDRA 4IHJE 1CHUA 2W0GA 3AEBA 5KMGP 4LF9T 3ZSSA 4DV1T 4UV8B 5J2TE 4G2AA 3OYXA 3Q2MA 4IDQA 3KV4A 5EZYE 5LGUB 3N5LA 4O2AE 3EABA 3L09A 4TWFA 4QX7B 4WYVA 2WSSV 4EXTA 3DJBA 2A9UA 4U31A 1UCUA 4QXHB 4I0UA 3W15B 5CA0E 3T1YT 3PUXF 1SE7A 2VVSA 1OXZA 5HEOA 3ZC1A 2ZM8A 5FY1A 4UXNB 2Y6XA 2CXLA 2XQYA 3QB5K 3AA7B 5FXZA 4EYYR 4AKRB 5AQMB 2XQ5A 4GIWA 2KNDA 5L3BB 2Q9QA 3C64A 1LVFA 2E9XD 4YXDA 1J5WA 2CXDA 3S4UA 4XBFB 2XSAA 5AQPB 5F8PA 4ILAA 4X1IE 4ZEYA 4IE4A 2KZ7B 4DO0A 5KX5E 3LDQB 3JCFA 3ONLC 2G0UA 1JNZA 4ILUA 5L3DB 3KV5A 2LOPA 4O4JE 1NEKA 4TNVA 2YEVC 3KBUA 4A5XA 2WQYA 3LSVA 3O1IA 4JI1T 1EZ3A 2X9HA 4YTNA 4YTMA 2LSYA 4PK4A 3GWHA 5L2LA 4QH4A 1N33T 4C91A 4KX6A 5IUXA 2EHOB 3PUYF 2X51A 1OEDA 4X20E 5DQVA 3ZCJA 4TWDA 4PNIA 4CI2B 3HKEE 3CQCB 5EK4A 3GA8A 3PUAA 1BR4A 5JDLA 2DWKA 2OA5A 5IWAT 2X0YA 3UUBA 2KWHA 2LLYA 3ZCIA 3L39A 4ZI7E 3TLWA 4J2CA 2QGSA 4A56A 2DCFA 3C50A 4ZS3A 5LBQB 5CGMA 4L9IA 2WDQA 5JH7E 3PURA 4L5GA 4UVCB 2YU1A 3OYZA 3IHRA 2M6IA 3RRCA 2CLYC 4TN7B 4AKHA 2XQAA 1NWMX 2SPCA 2WDVA 2LSGA 4UV9B 4ZI2C 3IA3A 1IJ6A 4IDPA 5FMNA 5JTGA 4EGWA 2UUAT 2I0MA 4AKIA 2WS3A 5HCJA 3ZT6A 2C5IT 4KMCA 3QK6A 5HWXA 1YW0A 5C8YE 3ONJA 2H88A 3ANWA 2DLRA 2ZMAA 4IGUA 4LF4T 3AEAA 3IEEA 3Q9DA 4HFEA 3RGLA 3WAKA 4KUMB 3SRZA 2CA5A 4TUYE 1HX8A 2VB6A 4C90A 3P4WA 1B7TA 1WRDA 4ZOLE 2Y48B 2QYWA 5JRCA 1BR1A 3H3MA 3AE7A 4JEHB 4ZI3C 4Q25A 4JI2T 5AQIB 3C51A 3AVRA 2VKDA 3LK42 4PFPA 4HFDA 5JDQA 4LFAT 3VKGA 2XM2A 3VR8A 4MALA 3ETVA 2IC6A 5LMNT 2MBGA 4BJMA 4DBQA 4WBOA 2VVNA 4HWFA 1HR0T 4A98A 2VL0A 4U7YA 4H9NC 3FZKB 3AEDA 4X62T 5JR9A 2LM9A 5FL1A 4I4TE 5FL0A 4JV5T 1YD8G 2XHEB 3RX6A 3UT5E 4B3TT 2UU9T 3BQLA 2D0UA 4YSZA 2E9XB 4H9PC 5KDMC 1FIOA 3L3PA 2ODVA 4BA9A 2V7KA 4X1YE 2XQ9A 3N2GE 3OJAA 4HEAA 4JI3T 2Q9QC 2XASB 2HHHT 4QXBB 3ZT5A 2MPKA 3X1DA 4X1KE 4F8HA 3ESLA 5A1LA 1T7SA 3T8OA 3P8CD 3TKLB 3EUHA 4PK5A 3ZC0A 3PUSA 2VWAA 2NW8A 4M1PA 4JI0T 2W2UA 4KHZF 1HF8A 3B13A 1G8XA 4K0UA 4JI4T 4OX9T 4ZXLA 2LKHA 4ZI3D 4XZCA 4U2YA 2PJQA 1NENA 3PJAJ 2EHOD 5AQQB 4DV5T 4UVBB 1Y64B 3NZPA 1UX4A 2HPJA 2ZM2A 1DU2A 2UXDT 3PUQA 4ISSA 1OEDC 3PV0F 2UXCT 1ZHCA 3D0TA 3F57A 1D1CA 3OVUA 5GONE 1QUUA 3RPUA 3LG7A 2M6BA 1WR0A 4IDOA 3AE4A 2D0TA 2F4VT 2IAKA 3AA6B 3T1HT 3AE2A 5L3GB 2XQ4A 3MACA 4IDNA 1VOMA 1KFYA 1VCTA 2IMLA 3P7IA 5CFBA 2N2NA 1WYCA 3NKZA 3UUNA 1UK5A 4AKLA 2MTQA 2K5BB 2UUCT 4UR9A 1YKEB 5AQFB 3E08A 1MIVA 5IHYA 5HWYA 4NIQA 2KMFA 4ERRA 2WCAA 3RKGA 1FMWA 3J9X1 4X64T 2JQHA 1FJGT 4KHPT 3CPZA 4DMVA 2X67A 4HFVA 1HG2A 1XZYA 2IDOB 4OYKA 3HA4A 2ZM0A 2BG9A 1I6ZA 3F31A 3CX7B 2HH7A 2XQ3A 4JI5T 5LBMA 3PUVF 4HWHA 1SA0E 3IF8B 2X9YA 5LJNA 2XY8B 5H6QB 4H9OC 5ABHA 2FJEA 1E1HB 5LGNB 1WR6A 2IIUA 2FJDA 4YSXA 5ETWA 3PE0A 2QVAA 4YSYA 3ZKRA 1N34T 3JADA 5CA1E 3VU7H 1KK7A 1S35A 3KVAA 5EK3A 5F5WA 3N9NA 4LFCT 5L3CB 2JIWA 1JNRA 5LG3A 1WYBA 3UQ7A 3IBPA 3I0QA 2NW7A 3RIFA 1D0ZA 2YN6A 4CQIA 2WP9A 3CMLA 5ABFB 1YQ4A 5JDGA 2JQ9A 2W66A 3RQWA 4DV7T 4BJNA 4H9QC 3AEGA 4AQFA 4EZ4A 2W67A 4AI6A 4AKGA 5JDNA 2K3WA 2YK0A 2CLYB 2BBJA 5J0ZA 2V1DB 3B5MA 3CK6A 4DIDB 1UURA 4HFCA 5LOVE 5JR9C 1SHZC 3SS1A 3AAEB 5AQHB 3GMIA 2RPAA 2V7MA 3KBTA 4WBNE 3N2OA 4DV4T 3TLVA 5AQNB 1MMDA 2D5UA 3O4XE 3ZMUB 3CWZB 4DR6T 4I43B 3GN5B 4YT0A 2YINA 3AAAB 3FZHB 3N9LA 4ZS2A 3VRBA 4UF0A 5JDFA 1XDOA 1D0YA 1X9BA 4GK5E 4KI0F 4KBMB 3LBXB 5JDHA 2H89A 4OFZA 1KNPA 1J5ET 4GYRA 5LGTB 4AXPA 3AECA 2HN1A 3FB2A 4TWHA 5IYZE 3NRYA 2JMHA 1M7KA 1H7CA 4P09A 3CIRA 2A2FX 4Z91A 1XDPA 4U74A
chains in the Genus database with same CATH topology
4GKKT 4DV7T 2UUCT 4DR2T 1HNZT 4JI2T 4LF6T 1I94T 4LFBT 4B3RT 4AQYT 4YY3T 4B3MT 2VQFT 4K0KT 4DV3T 4JI8T 4JI7T 3OTOT 4DR5T 4X64T 4LFAT 1IBMT 1FJGT 4KHPT 4JI0T 4DV6T 5LMNT 1XNQT 1N32T 1XNRT 1HR0T 5BR8T 1HNWT 4DV2T 4JI4T 4DUZT 4LF9T 4OX9T 1XMOT 4LF5T 4DV1T 4X65T 4NXMT 4B3ST 4JI5T 4X62T 4YHHT 4DV4T 1XMQT 4NXNT 4LF8T 4LF7T 4JV5T 2UUBT 4DV5T 4DR6T 2ZM6T 4JI1T 4DUYT 2UXBT 2UUAT 4B3TT 4DR7T 2UU9T 2UXDT 4DR4T 2UXCT 5LMUT 1N36T 1N33T 1N34T 2E5LT 4GKJT 1HNXT 4X66T 4LF4T 3T1YT 2F4VT 4JYAT 3T1HT 1IBKT 4LFCT 1J5ET 4DR1T 4JI3T 2VQET 4JI6T 5IWAT 4DV0T 4DR3T 2HHHT 1IBLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK T;  4DV7 T;  2UUC T;  4DR2 T;  1HNZ T;  4JI2 T;  4LF6 T;  1I94 T;  4LFB T;  4B3R T;  4AQY T;  4YY3 T;  4B3M T;  2VQF T;  4K0K T;  4DV3 T;  4JI8 T;  4JI7 T;  3OTO T;  4DR5 T;  4X64 T;  4LFA T;  1IBM T;  1FJG T;  4KHP T;  4JI0 T;  4DV6 T;  5LMN T;  1XNQ T;  1N32 T;  1XNR T;  1HR0 T;  5BR8 T;  1HNW T;  4DV2 T;  4JI4 T;  4DUZ T;  4LF9 T;  4OX9 T;  1XMO T;  4LF5 T;  4DV1 T;  4X65 T;  4NXM T;  4B3S T;  4JI5 T;  4X62 T;  4YHH T;  4DV4 T;  1XMQ T;  4NXN T;  4LF8 T;  4LF7 T;  4JV5 T;  2UUB T;  4DV5 T;  4DR6 T;  2ZM6 T;  4JI1 T;  4DUY T;  2UXB T;  2UUA T;  4B3T T;  4DR7 T;  2UU9 T;  2UXD T;  4DR4 T;  2UXC T;  5LMU T;  1N36 T;  1N33 T;  1N34 T;  2E5L T;  4GKJ T;  1HNX T;  4X66 T;  4LF4 T;  3T1Y T;  2F4V T;  4JYA T;  3T1H T;  1IBK T;  4LFC T;  1J5E T;  4DR1 T;  4JI3 T;  2VQE T;  4JI6 T;  5IWA T;  4DV0 T;  4DR3 T;  2HHH T;  1IBL T; 
#chains in the Genus database with same CATH topology
 5HYA A;  2V6Y A;  4YTP A;  2X0H A;  4WW0 A;  2XPK A;  5FXX A;  4IE7 A;  4KP3 C;  4UEM A;  2CPT A;  1Z8U A;  2CM0 A;  1MIY A;  4MHC A;  4JI8 T;  3ZYK A;  2IC9 A;  2LSK A;  2VUR A;  2BS3 A;  5L3E B;  5LXT E;  1XNQ T;  4ASK A;  3K8P C;  4O4L E;  4U33 A;  4Z90 A;  1MMA A;  2NR4 A;  5FY0 A;  1ZP0 A;  4HGA A;  1KEY A;  3PTR B;  3HKB E;  4NXM T;  3RQU A;  1XWM A;  2CWO A;  5FKY A;  3LFM A;  1MMN A;  4LF7 T;  5ADX L;  5AFU L;  2B1E A;  3ZN0 B;  1MNE A;  4DR7 T;  4P1N A;  2CBJ A;  3RYC E;  2LHR A;  3RYF E;  2XAJ B;  2IW5 B;  2NOX A;  2JMK A;  2XQ8 A;  1G73 A;  3B57 A;  1X79 A;  5HEJ A;  3CQG B;  3ABV A;  1QLB A;  3A8Y C;  4DVD A;  4DR1 T;  3C4X A;  1HTJ F;  2Q9Q B;  2BS4 A;  4YLH A;  2PG8 A;  5FY7 A;  4PJL A;  2C5K T;  3C4Z A;  2AE9 A;  3OPC A;  3VR9 A;  2AXD S;  1T98 A;  2H7O A;  4GK0 E;  5HEG A;  3FHN A;  3PUZ F;  1MND A;  3MA9 A;  2WM9 A;  3BQI A;  3NZQ A;  3RRW A;  1T8B A;  2R6G F;  4O4I E;  3AE8 A;  4TNW A;  5LHI B;  1R8I A;  3OTO T;  4DR5 T;  3AXJ A;  4YJ2 E;  3PU3 A;  5HXE A;  1YQ3 A;  1VRB A;  4V1A v;  4TV8 E;  2BG9 C;  4TX5 A;  3UTK A;  3N9M A;  5HXS A;  2BVL A;  2XM1 A;  1N32 T;  3VRA A;  5FNV E;  3K3Q C;  4X65 T;  5DJQ C;  4OYJ A;  2WAU A;  5J1G A;  3UU8 A;  2H3R A;  3MXZ A;  4U2Z A;  4DUY T;  1OED B;  2CRB A;  3N9O A;  2QRX A;  2MOZ A;  3SOL A;  1W0B A;  3QOF A;  2MYS A;  4QKN A;  1MIW A;  4CXY A;  2BS2 A;  2HPL A;  4P0B A;  1L0V A;  2E5L T;  4DMW A;  3E0Z A;  4H9S E;  4IE5 A;  4HFB A;  1KNZ A;  1GQE A;  1E2A A;  4BAY B;  3SWH A;  4DR3 T;  5LA6 E;  2V5C A;  4COF A;  3TLU A;  4AQF C;  2LM2 A;  3RKO A;  4GKK T;  2NTX A;  3KIN B;  4IE6 A;  3KV9 A;  1CUN A;  1HS7 A;  3O1H A;  1NAF A;  4NPP A;  2VQF T;  5AQS B;  4ZI2 D;  3HR0 A;  3NBX X;  4JEU B;  3RLF F;  3O9X A;  3F2E A;  5LP6 E;  2N1G A;  3PUW F;  2CE7 A;  5FYM A;  3I9W A;  4EV6 A;  5F3J A;  3AVS A;  2V7I A;  4IL4 A;  3M3Z B;  3ZYL A;  2E2A A;  2WZH A;  5BR8 T;  3ETU A;  3EVY A;  4LF5 T;  4QH5 A;  2XQ7 A;  4B3S T;  2ODU A;  5AQK B;  4LF8 T;  3ANW B;  1FEW A;  5LCY A;  5AQJ B;  2LE8 A;  3HKC E;  3VKH A;  2XJ7 A;  2CHO A;  3O1J A;  1O3X A;  2LOS A;  2K24 A;  3R6N A;  5EK2 A;  3AB3 B;  2YDS A;  4HTE A;  3KDS E;  4X66 T;  3AEE A;  5JRC B;  3UU3 A;  5ABG A;  3N9P A;  5HXH A;  3AE3 A;  3AE6 A;  2ACZ A;  2A3D A;  1M62 A;  5JQG E;  2WU5 A;  4ZZC A;  4CI3 B;  3CVR A;  5LHH B;  3RIU A;  3QB5 A;  2WZI A;  2Y8D A;  2LRK A;  2BKN A;  4B3M T;  2LRL A;  2BKO A;  5E0O A;  3ZMS B;  3P4R A;  3KVB A;  3I0O A;  2W4X A;  2LSJ A;  2X9X A;  2C5J A;  2IUB A;  4IT4 A;  3I9Y A;  5BMV E;  5JR9 B;  3H37 A;  5L4E A;  2N9D A;  4EZH A;  3H3A A;  2D9D A;  2GK9 A;  3TLT A;  4DUZ T;  2KXP B;  2BZB A;  4HWI B;  4CZZ B;  2KIN B;  3JAF A;  3ZLI A;  1WLX A;  3NRX A;  1IAP A;  4HKA A;  5AQO B;  4CN6 A;  2M67 A;  3V5S A;  3WI3 A;  3EDU A;  3SFD A;  5LNK A;  2Q9Q D;  5FP3 A;  1W09 A;  4A97 A;  3I1A A;  2C0S A;  4TZ4 C;  4PFO A;  5AQT B;  3ZT7 A;  2W61 A;  2LKG A;  2E5V A;  1UX5 A;  3N2K E;  4E7Z A;  2XAG B;  2JPF A;  5M4Y A;  4JI6 T;  5TAO A;  2EHO A;  2OLT A;  5AQV B;  3RYH E;  3LK2 B;  5H6R B;  2XAH B;  1LRZ A;  3PDY A;  1YXR A;  1U4Q A;  4NUV A;  3N9Q A;  1SUM B;  3UFG A;  4LF6 T;  1I94 T;  5L4H A;  2VKH A;  3NVO A;  4FJO A;  3MZK B;  3ZMV B;  2CXF A;  1BR2 A;  1QSD A;  4UVA B;  4U3C A;  3ZST A;  1D1B A;  2WU2 A;  5C2T A;  2NW9 A;  2XSB A;  4ZHQ E;  4JBW F;  4JLE A;  4QXC B;  3UU4 A;  1IJ5 A;  2FJB A;  2VL8 A;  1XNR T;  2LT3 A;  5AQL B;  4CN4 A;  5KXJ A;  2ZLY A;  4ILC A;  3RHW A;  4IL9 A;  1XMO T;  2V6X A;  2WMN A;  4NUU A;  1XMQ T;  1VCS A;  2WBL A;  1MMG A;  1WCR A;  2V8S V;  4FI5 A;  4HFI A;  4O2B E;  3AA1 B;  3UU6 A;  3RC8 A;  5DQW A;  2E8I A;  4HE8 A;  1OWA A;  2RA1 A;  2DL1 A;  2FUP A;  1D0X A;  4CI1 B;  4DR4 T;  4IIJ E;  3AEF A;  2LSI A;  3CQX C;  4UEL A;  4ILB A;  2WMO A;  3RF1 A;  4JYA T;  2VK9 A;  3E22 E;  2XTL A;  3FXE B;  1HCI A;  3U78 A;  4OK0 A;  5C3J A;  4IST A;  2VQE T;  5FVK A;  3Q5W A;  3UUL A;  1IZN B;  3VHL A;  3MKD A;  3FZL B;  3OKQ A;  2NWB A;  1IBL T;  4QX8 B;  3K3O A;  1OED E;  5LYJ E;  4EB6 E;  4WZX A;  5HEU A;  2V7L A;  4AQY T;  3CX6 B;  2L3L A;  4WNK A;  4H9R C;  3P4S A;  2PFV A;  2X9W A;  2BG9 B;  4L0R A;  2V26 A;  5J2U E;  2KT9 A;  3RC3 A;  3ONX A;  4ZZB A;  4F6R C;  3UQ4 A;  1V9D A;  3FBZ A;  2VKJ A;  2L9Q A;  1LKX A;  2L8K A;  2ACX A;  5AQG B;  3DP7 A;  2IHR 1;  4EED A;  2J62 A;  4YHH T;  4NXN T;  3AE1 A;  4MFR A;  3MJX A;  2CCQ A;  2A72 A;  3QUJ A;  2W62 A;  3KV6 A;  5JVD E;  2UXB T;  3JC6 C;  3HKD E;  2W00 A;  5LMU T;  4O4H E;  2ES0 A;  3Q5E A;  4CN1 A;  3EHZ A;  3AE5 A;  4QH1 A;  1Y01 A;  4YFS A;  4GKJ T;  2X68 A;  2WDR A;  2UXN B;  5FVL A;  3DTO A;  3UUM A;  3RIU C;  2VKO A;  2E9X A;  3R84 B;  4N78 D;  3FZM B;  4B6X A;  2JJ9 A;  4CXX A;  3ZEF B;  1UUS A;  4YJ3 E;  3HI2 A;  3U3I A;  3C4W A;  1YKH B;  3CKD A;  4DBR A;  3RIA A;  2YKS A;  4HWC A;  4B3R T;  3AA0 B;  2FBW A;  4Z8X A;  4AQG A;  4K0K T;  2KSR A;  1J1J A;  4ANJ A;  3P4P A;  5AQU B;  3Q5X A;  4DV6 T;  3G06 A;  2I6H A;  3FBL A;  4O8S A;  4PJJ A;  4HN9 A;  4PW8 A;  1AJ3 A;  4PJN A;  4E7S A;  5HEH A;  4DV2 T;  4GOU A;  5JRE A;  1Z0P A;  3RI5 A;  1BR0 A;  4UF0 B;  3A5X A;  2V5D A;  3SFE A;  3EAM A;  1W9R A;  2X66 A;  2ZM6 T;  3WAJ A;  4H63 V;  5LHG B;  2W63 A;  4EOZ B;  1S94 A;  2PTF A;  2RP4 A;  1HG5 A;  2BKP A;  3J7Y q;  2NTY A;  5L3F B;  1HNX T;  1E7P A;  1FMV A;  2FJA A;  2YDQ A;  4G63 A;  2EHO C;  1IBK T;  3FZF B;  2KWI B;  1U5P A;  3UUX B;  3ZJ2 A;  2V6Y B;  4MLK A;  4QHO A;  5JDM A;  1HX1 B;  2XQ6 A;  4HFH A;  4DV0 T;  5FXV A;  3UU5 A;  2VAS A;  4YHJ A;  3P4Q A;  3JC6 D;  2MAW A;  3ZMT B;  3HL6 A;  3EDV A;  1HNZ T;  2X0L B;  4LFB T;  1D1A A;  2J47 A;  3ZJ1 A;  5AQR B;  4DV3 T;  4IE0 A;  5LB7 B;  4TV9 E;  4AIS A;  2CBI A;  2JQQ A;  2K48 A;  2YOE A;  3V5U A;  4LMK A;  5HCM A;  2D2S A;  2KLQ A;  2Z6E A;  1ZOY A;  4IRE A;  3K3N A;  2DHR A;  4PJM A;  4P0A A;  4MBQ A;  2LEH A;  1KF6 A;  3P50 A;  1ZKE A;  2CHN A;  3AAI A;  2YU2 A;  3KFW X;  1N36 T;  2V7J A;  1UGO A;  5HAX A;  4EEB A;  4GYS A;  3RH3 A;  4OHF A;  2LHN A;  2CMR A;  4LML A;  3BK9 A;  3OBV E;  3ZYM A;  3ZMZ B;  3AE9 A;  5LG4 A;  4ADZ A;  4X5T A;  5DAB A;  2B76 A;  2J4G A;  3ZPO A;  3CX8 B;  4CXW A;  5L47 A;  3AXJ B;  4EAH A;  4DR2 T;  3JAE A;  4EIW A;  2DI4 A;  1WFD A;  2UXX B;  3L8R A;  2DNX A;  4I55 E;  5ABF A;  2LJL A;  2CEA A;  4JI7 T;  3PUG A;  4UIG A;  2P9B A;  1IBM T;  2PBI A;  2WWU A;  3PJA A;  5HXC A;  2WY2 A;  1ZEE A;  4QWN B;  4XAX B;  2H7V C;  2HN2 A;  1HNW T;  2NP9 A;  3LJC A;  2BBH A;  5HXR A;  1LVK A;  1US7 B;  1HFA A;  5LJM A;  2BVM A;  2K9A A;  3M65 A;  2XAQ B;  4H63 H;  2UUB T;  2I59 A;  2JQK A;  3BQK A;  4IDZ A;  1ZV4 X;  4I50 E;  4U7I A;  2WWV A;  3UFE A;  2WB5 A;  3PU8 A;  3NWI A;  4DND A;  3C98 B;  2QA7 A;  3ZN1 B;  4LMJ A;  3RYI E;  2BG9 E;  4EYU A;  2E9X C;  4HWD A;  3GN5 A;  5CB4 E;  3FXD B;  4PK6 A;  3A7M A;  2OV9 A;  2J1D G;  4U72 A;  3LBX A;  2BDE A;  2XZE A;  1T72 A;  3QC9 A;  4JUY A;  3QNU A;  1KNR A;  1W0A A;  2CWY A;  3EI0 A;  4YY3 T;  2DWG A;  2JRK A;  4PAG A;  5ABE A;  3K1S A;  4AIU A;  2XUE A;  5CJ5 A;  3LK3 B;  3Q5D A;  3MK7 C;  5FXW A;  2XAF B;  3TLS A;  2YDR A;  4IHJ E;  1CHU A;  2W0G A;  3AEB A;  5KMG P;  4LF9 T;  3ZSS A;  4DV1 T;  4UV8 B;  5J2T E;  4G2A A;  3OYX A;  3Q2M A;  4IDQ A;  3KV4 A;  5EZY E;  5LGU B;  3N5L A;  4O2A E;  3EAB A;  3L09 A;  4TWF A;  4QX7 B;  4WYV A;  2WSS V;  4EXT A;  3DJB A;  2A9U A;  4U31 A;  1UCU A;  4QXH B;  4I0U A;  3W15 B;  5CA0 E;  3T1Y T;  3PUX F;  1SE7 A;  2VVS A;  1OXZ A;  5HEO A;  3ZC1 A;  2ZM8 A;  5FY1 A;  4UXN B;  2Y6X A;  2CXL A;  2XQY A;  3QB5 K;  3AA7 B;  5FXZ A;  4EYY R;  4AKR B;  5AQM B;  2XQ5 A;  4GIW A;  2KND A;  5L3B B;  2Q9Q A;  3C64 A;  1LVF A;  2E9X D;  4YXD A;  1J5W A;  2CXD A;  3S4U A;  4XBF B;  2XSA A;  5AQP B;  5F8P A;  4ILA A;  4X1I E;  4ZEY A;  4IE4 A;  2KZ7 B;  4DO0 A;  5KX5 E;  3LDQ B;  3JCF A;  3ONL C;  2G0U A;  1JNZ A;  4ILU A;  5L3D B;  3KV5 A;  2LOP A;  4O4J E;  1NEK A;  4TNV A;  2YEV C;  3KBU A;  4A5X A;  2WQY A;  3LSV A;  3O1I A;  4JI1 T;  1EZ3 A;  2X9H A;  4YTN A;  4YTM A;  2LSY A;  4PK4 A;  3GWH A;  5L2L A;  4QH4 A;  1N33 T;  4C91 A;  4KX6 A;  5IUX A;  2EHO B;  3PUY F;  2X51 A;  1OED A;  4X20 E;  5DQV A;  3ZCJ A;  4TWD A;  4PNI A;  4CI2 B;  3HKE E;  3CQC B;  5EK4 A;  3GA8 A;  3PUA A;  1BR4 A;  5JDL A;  2DWK A;  2OA5 A;  5IWA T;  2X0Y A;  3UUB A;  2KWH A;  2LLY A;  3ZCI A;  3L39 A;  4ZI7 E;  3TLW A;  4J2C A;  2QGS A;  4A56 A;  2DCF A;  3C50 A;  4ZS3 A;  5LBQ B;  5CGM A;  4L9I A;  2WDQ A;  5JH7 E;  3PUR A;  4L5G A;  4UVC B;  2YU1 A;  3OYZ A;  3IHR A;  2M6I A;  3RRC A;  2CLY C;  4TN7 B;  4AKH A;  2XQA A;  1NWM X;  2SPC A;  2WDV A;  2LSG A;  4UV9 B;  4ZI2 C;  3IA3 A;  1IJ6 A;  4IDP A;  5FMN A;  5JTG A;  4EGW A;  2UUA T;  2I0M A;  4AKI A;  2WS3 A;  5HCJ A;  3ZT6 A;  2C5I T;  4KMC A;  3QK6 A;  5HWX A;  1YW0 A;  5C8Y E;  3ONJ A;  2H88 A;  3ANW A;  2DLR A;  2ZMA A;  4IGU A;  4LF4 T;  3AEA A;  3IEE A;  3Q9D A;  4HFE A;  3RGL A;  3WAK A;  4KUM B;  3SRZ A;  2CA5 A;  4TUY E;  1HX8 A;  2VB6 A;  4C90 A;  3P4W A;  1B7T A;  1WRD A;  4ZOL E;  2Y48 B;  2QYW A;  5JRC A;  1BR1 A;  3H3M A;  3AE7 A;  4JEH B;  4ZI3 C;  4Q25 A;  4JI2 T;  5AQI B;  3C51 A;  3AVR A;  2VKD A;  3LK4 2;  4PFP A;  4HFD A;  5JDQ A;  4LFA T;  3VKG A;  2XM2 A;  3VR8 A;  4MAL A;  3ETV A;  2IC6 A;  5LMN T;  2MBG A;  4BJM A;  4DBQ A;  4WBO A;  2VVN A;  4HWF A;  1HR0 T;  4A98 A;  2VL0 A;  4U7Y A;  4H9N C;  3FZK B;  3AED A;  4X62 T;  5JR9 A;  2LM9 A;  5FL1 A;  4I4T E;  5FL0 A;  4JV5 T;  1YD8 G;  2XHE B;  3RX6 A;  3UT5 E;  4B3T T;  2UU9 T;  3BQL A;  2D0U A;  4YSZ A;  2E9X B;  4H9P C;  5KDM C;  1FIO A;  3L3P A;  2ODV A;  4BA9 A;  2V7K A;  4X1Y E;  2XQ9 A;  3N2G E;  3OJA A;  4HEA A;  4JI3 T;  2Q9Q C;  2XAS B;  2HHH T;  4QXB B;  3ZT5 A;  2MPK A;  3X1D A;  4X1K E;  4F8H A;  3ESL A;  5A1L A;  1T7S A;  3T8O A;  3P8C D;  3TKL B;  3EUH A;  4PK5 A;  3ZC0 A;  3PUS A;  2VWA A;  2NW8 A;  4M1P A;  4JI0 T;  2W2U A;  4KHZ F;  1HF8 A;  3B13 A;  1G8X A;  4K0U A;  4JI4 T;  4OX9 T;  4ZXL A;  2LKH A;  4ZI3 D;  4XZC A;  4U2Y A;  2PJQ A;  1NEN A;  3PJA J;  2EHO D;  5AQQ B;  4DV5 T;  4UVB B;  1Y64 B;  3NZP A;  1UX4 A;  2HPJ A;  2ZM2 A;  1DU2 A;  2UXD T;  3PUQ A;  4ISS A;  1OED C;  3PV0 F;  2UXC T;  1ZHC A;  3D0T A;  3F57 A;  1D1C A;  3OVU A;  5GON E;  1QUU A;  3RPU A;  3LG7 A;  2M6B A;  1WR0 A;  4IDO A;  3AE4 A;  2D0T A;  2F4V T;  2IAK A;  3AA6 B;  3T1H T;  3AE2 A;  5L3G B;  2XQ4 A;  3MAC A;  4IDN A;  1VOM A;  1KFY A;  1VCT A;  2IML A;  3P7I A;  5CFB A;  2N2N A;  1WYC A;  3NKZ A;  3UUN A;  1UK5 A;  4AKL A;  2MTQ A;  2K5B B;  2UUC T;  4UR9 A;  1YKE B;  5AQF B;  3E08 A;  1MIV A;  5IHY A;  5HWY A;  4NIQ A;  2KMF A;  4ERR A;  2WCA A;  3RKG A;  1FMW A;  3J9X 1;  4X64 T;  2JQH A;  1FJG T;  4KHP T;  3CPZ A;  4DMV A;  2X67 A;  4HFV A;  1HG2 A;  1XZY A;  2IDO B;  4OYK A;  3HA4 A;  2ZM0 A;  2BG9 A;  1I6Z A;  3F31 A;  3CX7 B;  2HH7 A;  2XQ3 A;  4JI5 T;  5LBM A;  3PUV F;  4HWH A;  1SA0 E;  3IF8 B;  2X9Y A;  5LJN A;  2XY8 B;  5H6Q B;  4H9O C;  5ABH A;  2FJE A;  1E1H B;  5LGN B;  1WR6 A;  2IIU A;  2FJD A;  4YSX A;  5ETW A;  3PE0 A;  2QVA A;  4YSY A;  3ZKR A;  1N34 T;  3JAD A;  5CA1 E;  3VU7 H;  1KK7 A;  1S35 A;  3KVA A;  5EK3 A;  5F5W A;  3N9N A;  4LFC T;  5L3C B;  2JIW A;  1JNR A;  5LG3 A;  1WYB A;  3UQ7 A;  3IBP A;  3I0Q A;  2NW7 A;  3RIF A;  1D0Z A;  2YN6 A;  4CQI A;  2WP9 A;  3CML A;  5ABF B;  1YQ4 A;  5JDG A;  2JQ9 A;  2W66 A;  3RQW A;  4DV7 T;  4BJN A;  4H9Q C;  3AEG A;  4AQF A;  4EZ4 A;  2W67 A;  4AI6 A;  4AKG A;  5JDN A;  2K3W A;  2YK0 A;  2CLY B;  2BBJ A;  5J0Z A;  2V1D B;  3B5M A;  3CK6 A;  4DID B;  1UUR A;  4HFC A;  5LOV E;  5JR9 C;  1SHZ C;  3SS1 A;  3AAE B;  5AQH B;  3GMI A;  2RPA A;  2V7M A;  3KBT A;  4WBN E;  3N2O A;  4DV4 T;  3TLV A;  5AQN B;  1MMD A;  2D5U A;  3O4X E;  3ZMU B;  3CWZ B;  4DR6 T;  4I43 B;  3GN5 B;  4YT0 A;  2YIN A;  3AAA B;  3FZH B;  3N9L A;  4ZS2 A;  3VRB A;  4UF0 A;  5JDF A;  1XDO A;  1D0Y A;  1X9B A;  4GK5 E;  4KI0 F;  4KBM B;  3LBX B;  5JDH A;  2H89 A;  4OFZ A;  1KNP A;  1J5E T;  4GYR A;  5LGT B;  4AXP A;  3AEC A;  2HN1 A;  3FB2 A;  4TWH A;  5IYZ E;  3NRY A;  2JMH A;  1M7K A;  1H7C A;  4P09 A;  3CIR A;  2A2F X;  4Z91 A;  1XDP A;  4U74 A; 
#chains in the Genus database with same CATH homology
 4GKK T;  4DV7 T;  2UUC T;  4DR2 T;  1HNZ T;  4JI2 T;  4LF6 T;  1I94 T;  4LFB T;  4B3R T;  4AQY T;  4YY3 T;  4B3M T;  2VQF T;  4K0K T;  4DV3 T;  4JI8 T;  4JI7 T;  3OTO T;  4DR5 T;  4X64 T;  4LFA T;  1IBM T;  1FJG T;  4KHP T;  4JI0 T;  4DV6 T;  5LMN T;  1XNQ T;  1N32 T;  1XNR T;  1HR0 T;  5BR8 T;  1HNW T;  4DV2 T;  4JI4 T;  4DUZ T;  4LF9 T;  4OX9 T;  1XMO T;  4LF5 T;  4DV1 T;  4X65 T;  4NXM T;  4B3S T;  4JI5 T;  4X62 T;  4YHH T;  4DV4 T;  1XMQ T;  4NXN T;  4LF8 T;  4LF7 T;  4JV5 T;  2UUB T;  4DV5 T;  4DR6 T;  2ZM6 T;  4JI1 T;  4DUY T;  2UXB T;  2UUA T;  4B3T T;  4DR7 T;  2UU9 T;  2UXD T;  4DR4 T;  2UXC T;  5LMU T;  1N36 T;  1N33 T;  1N34 T;  2E5L T;  4GKJ T;  1HNX T;  4X66 T;  4LF4 T;  3T1Y T;  2F4V T;  4JYA T;  3T1H T;  1IBK T;  4LFC T;  1J5E T;  4DR1 T;  4JI3 T;  2VQE T;  4JI6 T;  5IWA T;  4DV0 T;  4DR3 T;  2HHH T;  1IBL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...