2F4VT

30s ribosome + designer antibiotic
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2f4vT00
5BR8T 4NXMT 4LFAT 4DR1T 3T1YT 4X64T 4JI1T 1N32T 4JI2T 4X66T 2HHHT 4LF7T 1N34T 4LF5T 4LF6T 1IBMT 4LFCT 5LMUT 4B3RT 4DUZT 4X65T 4DR7T 4DUYT 1HNZT 4YHHT 1XMOT 2UXBT 4B3ST 4JI4T 4JI8T 4JI0T 2VQFT 4JYAT 4LF4T 1N36T 2UXDT 4DV2T 1J5ET 4JV5T 4GKKT 2VQET 4LFBT 5IWAT 4DR5T 2UUBT 4JI6T 3T1HT 4NXNT 1FJGT 1XNRT 4K0KT 4DV4T 4AQYT 4LF8T 4DV1T 3OTOT 4JI5T 4LF9T 4DR3T 4YY3T 5LMNT 4OX9T 1N33T 2ZM6T 4DV6T 4X62T 4DR4T 4B3TT 4DR6T 1IBKT 1HNWT 4JI3T 2E5LT 2F4VT 2UUAT 1HR0T 1IBLT 2UUCT 2UU9T 2UXCT 4GKJT 4DV3T 1I94T 1HNXT 4JI7T 4DR2T 4B3MT 4DV0T 1XMQT 4DV5T 1XNQT 4KHPT 4DV7T
chains in the Genus database with same CATH superfamily
2EHOB 3F31A 4BJMA 2LSJA 2ACXA 1J5WA 4AKGA 3FZFB 4UVAB 4DO0A 3U3IA 4A5XA 4ILUA 3N9OA 3UUXB 3RF1A 5LOVE 3L39A 2X0HA 2UXBT 1LVKA 3K8PC 3OYXA 2WDVA 4L9IA 3AE2A 3C51A 1NENA 2BVMA 2W4XA 3SRZA 2KINB 3KVBA 3LBXA 1U4QA 4HWCA 2VKDA 2H7VC 5FKYA 4HWDA 1KF6A 3VR9A 3NBXX 2VB6A 2LE8A 4G63A 3EHZA 2R6GF 5HWXA 2VVNA 3UU6A 4P0AA 4EZ4A 3ZMZB 3CKDA 5HXCA 3QUJA 1MIVA 5JQGE 2EHOD 2QYWA 3BQIA 4TWHA 2VURA 3RIAA 4MBQA 4U2YA 1XMQT 4HN9A 5JDLA 4DV5T 3Q5WA 3A7MA 3CQXC 3ESLA 5L47A 4OK0A 2IC9A 5EK3A 3HKDE 2BG9E 1D1CA 4UVCB 4YSZA 4LF7T 2V7MA 3I1AA 2JQHA 5ETWA 3VU7H 1WFDA 2LHRA 1HF8A 3AAAB 5ABGA 3EVYA 4AKLA 5AQQB 3PUSA 3UUNA 3AB3B 5AQVB 2PFVA 2RP4A 3AAEB 1D0ZA 1NAFA 2JMHA 2BG9B 4CI3B 1T72A 3Q5EA 4DR5T 4GYSA 3B13A 4CQIA 2WZHA 4OFZA 5HWYA 2LSGA 3PV0F 2K5BB 5HXRA 3D0TA 4AQYT 3FXEB 4LF8T 4A98A 2OLTA 1I6ZA 2D0TA 1O3XA 4A56A 2MBGA 3VKGA 2IIUA 5GONE 3N2OA 2CXFA 1AJ3A 2QGSA 4QKNA 4JI3T 4EEDA 2LM9A 1JNRA 3RYIE 3UU8A 3O4XE 4HWHA 1HNXT 5HEGA 1HFAA 1KEYA 1MMAA 5AFUL 5AQJB 2MPKA 4H9NC 3AE4A 2V7IA 4EIWA 5DJQC 4YJ2E 4JLEA 2WDRA 4H9SE 5BR8T 3R84B 2M6IA 2P9BA 3AAIA 2DWGA 3QC9A 3AA7B 2YEVC 3KDSE 5JDNA 2V8SV 3AEBA 5C8YE 2AE9A 3P4WA 3ZMTB 3ZJ1A 5HXHA 3ANWA 3BK9A 3N2GE 2VQET 2K3WA 2XAJB 5C3JA 2LRLA 4YJ3E 3P4QA 5AQHB 4GOUA 5EK4A 3HL6A 1M62A 5LGNB 2LSKA 3L3PA 2DWKA 2FBWA 4JI5T 3N9QA 3KV9A 3CWZB 2FJBA 4J2CA 3B57A 4IGUA 4IHJE 2X0YA 3RX6A 2RPAA 5AQFB 4QXCB 4EOZB 2DI4A 4ZI2D 2W66A 1KFYA 3HKCE 5CB4E 3HR0A 2LLYA 4UEMA 2QRXA 3V5SA 1DU2A 3QB5A 4DV3T 4BAYB 2CXLA 3O1JA 2J1DG 3AXJB 2NW9A 2JRKA 5JR9C 2VL0A 4H63V 2XQAA 3BQKA 2KT9A 1XDOA 4AKHA 4ILCA 4ZS2A 5TAOA 5DQWA 3LK3B 1MNDA 3MA9A 1YKHB 1YD8G 5J1GA 4ZI3C 3U78A 3AE3A 2XZEA 2XM2A 2C0SA 3SFDA 3LG7A 4I0UA 3RKOA 3IEEA 1SUMB 3ZC1A 4YXDA 3A8YC 2XSAA 3UFEA 4U7IA 2DCFA 3ZT6A 4GK0E 1J5ET 5IWAT 2UUBT 2YINA 3H3MA 1HG5A 3OKQA 3T1HT 2X0LB 1CHUA 4NXNT 3WAKA 2LSYA 1QSDA 4HKAA 2BKNA 4ZZBA 2BS4A 2A3DA 3ZCJA 1MIYA 3KV4A 3ZPOA 3CMLA 4YY3T 4CXXA 3AECA 4HEAA 1HX8A 4O4HE 3P4RA 3M65A 4I43B 2WDQA 2E5VA 4AKIA 5LCYA 1MIWA 4E7ZA 4IDPA 2NW7A 5L3EB 4ANJA 2VL8A 3IA3A 3LDQB 3UUBA 4CN6A 1OEDE 4GKJT 4HFDA 3CX7B 2V7JA 1E2AA 3RGLA 1T8BA 2WS3A 5EZYE 2HN1A 4DV7T 4QHOA 1SE7A 2WU2A 5AQUB 3GA8A 2FUPA 3Q2MA 2ACZA 2E9XC 3AA0B 4CI2B 1OEDB 3E22E 3ZT5A 2W67A 3RHWA 5L3FB 5LNKA 4B3RT 4X1KE 5FNVE 5AQMB 4WBNE 4YHHT 1XMOT 1UUSA 3N9NA 5LJMA 2KNDA 4NPPA 5F5WA 3RKGA 2J62A 4EB6E 2BKOA 4IT4A 1WLXA 4AQFA 3ZMVB 3RIUA 4V1Av 3E08A 4Z91A 4Q25A 2IC6A 3NRXA 2NR4A 3ZYLA 2WMOA 1LVFA 2V6YB 5E0OA 2YK0A 2GK9A 5IYZE 3S4UA 2SPCA 4KHZF 4H9PC 4PJJA 2XQ7A 2IAKA 2WM9A 1CUNA 1FMWA 5DQVA 3PUYF 2V5DA 3C4WA 1Y01A 1US7B 5ABHA 3EI0A 4OYJA 2PJQA 5ABFB 1ZEEA 3LSVA 4X64T 4ZI3D 3EDVA 1N32T 3AEGA 4X66T 2XPKA 3DP7A 2K48A 4UV9B 3FZHB 5CA1E 4YT0A 4MLKA 2XAGB 5LP6E 1S35A 4HTEA 3ZYKA 4UF0A 2XQ5A 3VRAA 1ZV4X 2KSRA 2V6XA 2XQ8A 1U5PA 2WP9A 4GKKT 2Z6EA 3EDUA 4TV8E 5CJ5A 3KVAA 4ZXLA 3PJAA 5JDHA 2LRKA 5FMNA 2Q9QA 4HWIB 3NVOA 3X1DA 2KMFA 2BG9C 2WQYA 2MOZA 3RRWA 1HS7A 3PUAA 4HGAA 2IW5B 1HNWT 2WSSV 2X9HA 4U74A 3P7IA 3L8RA 1NEKA 4IE4A 2OA5A 2ZM2A 1HR0T 2WWUA 4H9RC 4NUVA 4TZ4C 4M1PA 2VK9A 3ZMUB 5JDMA 4CZZB 5F8PA 2K24A 4DR2T 3AE9A 4DV0T 3ETVA 4PK4A 5LMUT 1IZNB 4ZZCA 2E9XD 2XQ3A 4JI2T 1VCTA 4ZI2C 4DNDA 4NIQA 4XBFB 2JQ9A 5LHGB 2BS3A 3CQCB 4B3ST 2CWOA 4JI4T 4JI0T 4JYAT 3N9LA 1N36T 3PTRB 4IDOA 2CEAA 2M6BA 2BBJA 4PJMA 4WZXA 3RQUA 2LKGA 3UU4A 1WR6A 2LM2A 4UV8B 2CBIA 1BR1A 1KK7A 2LSIA 3CVRA 3IF8B 2WAUA 5FXWA 3L09A 3K3OA 4KUMB 1M7KA 2W63A 4DR6T 1UCUA 2JJ9A 3ZCIA 2Y8DA 2LJLA 3CX8B 3RIFA 1VCSA 2LOPA 3WI3A 3LK2B 4GIWA 3K1SA 2ZLYA 1MMNA 3IBPA 4KP3C 3KBTA 4TWFA 2WCAA 4ZHQE 4QH4A 1WRDA 1XDPA 4YTMA 3RYCE 3MKDA 5CGMA 5JRCA 5AQLB 4GYRA 4LF6T 4F6RC 2X66A 4LFCT 3VR8A 3LK42 4DUZT 5BMVE 2X9YA 4YSYA 4EEBA 5LG3A 5JREA 2A9UA 5J2UE 5LJNA 4L0RA 4JUYA 4HFIA 5HXSA 1ZOYA 1VOMA 2CA5A 2Q9QB 5AQOB 5JTGA 2LHNA 3ZT7A 3K3QC 2IUBA 3K3NA 2BS2A 3JC6D 2K9AA 2ZM0A 2WBLA 5JR9A 3FZLB 4IREA 3HA4A 3ZSTA 4EV6A 4B3TT 1KNZA 2VKOA 3P50A 3LBXB 4PJLA 3RC3A 4C90A 5J2TE 3HKEE 2W2UA 3ETUA 2F4VT 5FY7A 2XY8B 4YHJA 2NP9A 3TLWA 4ZS3A 2G0UA 4PFOA 5L3GB 4JI7T 4IDNA 5FXZA 3OPCA 3EAMA 2JQQA 3CPZA 4TWDA 3NZPA 4CI1B 5FL1A 1XNQT 3BQLA 3C4ZA 2BDEA 4DBQA 4DVDA 4EXTA 3PUWF 1ZHCA 4JEUB 5L4EA 2CXDA 4L5GA 1HX1B 1T7SA 3OVUA 4H63H 2A2FX 2DL1A 2NTYA 3AEFA 3GN5A 3ZN0B 1HG2A 1D1BA 3RQWA 3MACA 1UGOA 1OEDC 4UR9A 2XQ9A 2H88A 4COFA 3CQGB 1R8IA 1BR0A 1FMVA 4Z90A 1WYCA 1FJGT 3RRCA 1XNRT 1W0AA 2XSBA 5AQIB 2CHNA 3OTOT 2CPTA 4O2AE 4U7YA 4AKRB 4OX9T 2YN6A 4KI0F 5HEHA 2PBIA 4ASKA 5H6QB 5FXXA 3A5XA 2IMLA 4IE0A 2JIWA 2D9DA 3DTOA 5JH7E 4BA9A 2XASB 2CRBA 2KXPB 4QH5A 2DLRA 4U33A 2LKHA 2Y6XA 2EHOA 5A1LA 2D2SA 3FHNA 2DNXA 3UULA 5L2LA 1YQ3A 3JAFA 5AQKB 3H37A 1Y64B 3PUZF 4EYUA 4O4IE 4EGWA 2XQ4A 3NRYA 1IBMT 2DHRA 1Z0PA 2XAFB 3I9WA 3EABA 4Z8XA 4DUYT 2CBJA 1Z8UA 4EZHA 2VQFT 2BKPA 2VWAA 2MTQA 2B1EA 2QA7A 5AQTB 4WBOA 5J0ZA 4KMCA 3WAJA 5HXEA 3ANWB 1H7CA 3FB2A 4H9OC 4DV4T 1WR0A 3ZKRA 3Q9DA 3AE5A 3C98B 5LYJE 3T8OA 1G73A 3MXZA 1X79A 1LRZA 4IE5A 2YDRA 2E8IA 2UUAT 3QB5K 3AEAA 3CK6A 3PUQA 3KV5A 1QUUA 4ERRA 1MNEA 2UXCT 1YW0A 2CE7A 3N5LA 3AEEA 3GMIA 4PJNA 4P1NA 4TN7B 2BVLA 1UX4A 2X51A 3C64A 4KHPT 3LJCA 1ZP0A 3AE8A 5FL0A 3EUHA 5C2TA 4NXMT 4LFAT 2VVSA 4O2BE 5EK2A 2N1GA 3GN5B 2HHHT 1W0BA 4LF5T 2N9DA 1KNPA 4DR7T 2BG9A 3ONLC 2XJ7A 5HCJA 3RYHE 3P8CD 3RYFE 1XZYA 2J4GA 4MFRA 5IHYA 4AISA 4DV2T 4ISTA 4AI6A 4IIJE 2C5KT 4IE6A 4JI6T 4LMJA 5FVKA 4TNVA 3P4PA 4PK6A 3RIUC 5KDMC 2HPJA 2CM0A 3CIRA 3CX6B 4DV6T 1SA0E 3FBLA 2IHR1 2HH7A 2WZIA 3B5MA 3UQ4A 1IBKT 3TLVA 4WYVA 3JADA 3FZMB 3SWHA 1E1HB 3ZLIA 1FIOA 3QNUA 2V5CA 4FI5A 3KFWX 4F8HA 3ZYMA 3JC6C 4G2AA 4QWNB 3Q5DA 5LHIB 5LGUB 4JEHB 3PUVF 2X67A 2VASA 3PU3A 3N9PA 4QX8B 3FZKB 2I59A 5DABA 1MMGA 2YDQA 3UUMA 5FVLA 3ZC0A 2MAWA 1QLBA 3O1IA 3NZQA 4XAXB 1UURA 3PURA 2CLYB 2NW8A 2NOXA 2X9XA 2UXDT 1T98A 2XAHB 1YKEB 1S94A 3PU8A 3UU5A 1SHZC 4U3CA 4H9QC 4X5TA 3E0ZA 5FP3A 4DMVA 4KX6A 4PFPA 1V9DA 3VHLA 4QH1A 5L3DB 4YFSA 1W09A 2Q9QC 2CCQA 3N9MA 3ZMSB 3I0QA 3ONJA 4E7SA 3O9XA 5LBMA 5LHHB 4YTPA 3ZJ2A 5LGTB 5F3JA 2FJDA 4TV9E 2VKHA 3AXJA 5KXJA 1WCRA 2X68A 1I94T 5AQNB 4PNIA 3M3ZB 2LT3A 2I0MA 4UELA 1YQ4A 4CXWA 1D0XA 2JMKA 3PJAJ 3PUGA 5HEJA 2A72A 2MYSA 4PAGA 2WB5A 2KWHA 5HAXA 4JI1T 2I6HA 2M67A 2W61A 4LMLA 2HPLA 2X9WA 3H3AA 3QK6A 4IDQA 4P0BA 3RI5A 3J9X1 2CMRA 2XQYA 4DBRA 1J1JA 3AE1A 5KX5E 4ADZA 5AQRB 4JI8T 3VKHA 5JDQA 4PW8A 2C5JA 3UT5E 2KLQA 3RPUA 4UF0B 4ILAA 5IUXA 4HE8A 3AEDA 2JPFA 1X9BA 5CA0E 4K0KT 3O1HA 4AXPA 1KNRA 3SS1A 4UIGA 4LF9T 3F2EA 2JQKA 2W0GA 4X62T 3OBVE 4WW0A 2IDOB 3KINB 3V5UA 1HTJF 1IAPA 2C5IT 2V1DB 4I50E 1UX5A 4UVBB 4ISSA 3NWIA 2V26A 2CHOA 4K0UA 2UU9T 2WMNA 4HWFA 4IE7A 2W00A 5L3BB 3AA6B 2LEHA 2E2AA 3UFGA 1OEDA 2FJAA 2XQ6A 4LMKA 2WU5A 2RA1A 5AQSB 2UXXB 4X65T 1E7PA 3C4XA 2H89A 2D0UA 1IJ6A 3ABVA 2PTFA 4X20E 5LA6E 1D0YA 2YOEA 2YU2A 3SOLA 4JV5T 4LFBT 4HFEA 4EAHA 3UQ7A 1BR2A 4QX7B 3UTKA 2V6YA 5H6RB 3TLSA 2UXNB 2Q9QD 3GWHA 4GK5E 4BJNA 2XHEB 4DV1T 1MMDA 3OYZA 2YU1A 2QVAA 3PUXF 4ZOLE 4HFBA 2ZM6T 1N33T 4TNWA 4DR4T 3QOFA 3IHRA 4MALA 2PG8A 1JNZA 2WWVA 3OJAA 4JBWF 3RC8A 2LOSA 3HI2A 3J7Yq 1WYBA 4P09A 2Y48B 4N78D 5FY0A 1G8XA 4OHFA 3ZEFB 5ABFA 4B3MT 5ADXL 4PK5A 4CN1A 5JDFA 3NKZA 2FJEA 4I4TE 2E9XA 3I0OA 4C91A 4I55E 1BR4A 3PE0A 2ODVA 4DR1T 3T1YT 5L3CB 2NWBA 4YLHA 3ZSSA 4TUYE 3AVRA 3W15B 2XTLA 4X1YE 1NWMX 3AE6A 1ZKEA 2ZMAA 5LBQB 1HNZT 1IJ5A 3LFMA 3MK7C 5JRCB 2L8KA 3KV6A 2V7KA 4A97A 3AE7A 3ONXA 2H3RA 1YXRA 1L0VA 5AQGB 3N2KE 3UU3A 4AIUA 2B76A 2D5UA 2ZM8A 1B7TA 2BZBA 3SFEA 4U2ZA 2ODUA 3Q5XA 2V7LA 4X1IE 4DR3T 1EZ3A 3ZN1B 5HYAA 5LMNT 5KMGP 2OV9A 3DJBA 5JDGA 2VKJA 4TX5A 3HKBE 3JAEA 4WNKA 5FXVA 4DMWA 4XZCA 4HFVA 5JR9B 2N2NA 4O4JE 3FBZA 4YTNA 3I9YA 4O8SA 3TLUA 5HEUA 5HCMA 5JVDE 2AXDS 2HN2A 4B6XA 2YDSA 2XAQB 3JCFA 1D1AA 2EHOC 4O4LE 4IL4A 3TLTA 5LXTE 5HEOA 2WY2A 3C50A 5ABEA 2XM1A 4CN4A 3MZKB 1N34T 3TKLB 4FJOA 5CFBA 1XWMA 2H7OA 3R6NA 3F57A 4DIDB 5LG4A 2J47A 5M4YA 3G06A 1GQEA 2ES0A 4LF4T 4NUUA 2L9QA 3VRBA 4HFHA 1HCIA 2W62A 4CXYA 3KBUA 1OXZA 3RH3A 2NTXA 5LB7B 5FYMA 1VRBA 1LKXA 3FXDB 2YKSA 4OYKA 4U31A 5FY1A 2CLYC 2KWIB 2BBHA 1FEWA 4EYYR 4QXBB 3MJXA 5AQPB 2L3LA 4U72A 4HFCA 4MHCA 3AVSA 4AQFC 5L4HA 1UK5A 4KBMB 2CWYA 4IL9A 4IDZA 1OWAA 2E5LT 4ZI7E 3P4SA 3PDYA 1IBLT 3RLFF 2UUCT 2KZ7B 4ILBA 4UXNB 2E9XB 4QXHB 1W9RA 4YSXA 4AQGA 2XUEA 3AA1B 4ZEYA
chains in the Genus database with same CATH topology
5BR8T 4NXMT 4LFAT 4DR1T 3T1YT 4X64T 4JI1T 1N32T 4JI2T 4X66T 2HHHT 4LF7T 1N34T 4LF5T 4LF6T 1IBMT 4LFCT 5LMUT 4B3RT 4DUZT 4X65T 4DR7T 4DUYT 1HNZT 4YHHT 1XMOT 2UXBT 4B3ST 4JI4T 4JI8T 4JI0T 2VQFT 4JYAT 4LF4T 1N36T 2UXDT 4DV2T 1J5ET 4JV5T 4GKKT 2VQET 4LFBT 5IWAT 4DR5T 2UUBT 4JI6T 3T1HT 4NXNT 1FJGT 1XNRT 4K0KT 4DV4T 4AQYT 4LF8T 4DV1T 3OTOT 4JI5T 4LF9T 4DR3T 4YY3T 5LMNT 4OX9T 1N33T 2ZM6T 4DV6T 4X62T 4DR4T 4B3TT 4DR6T 1IBKT 1HNWT 4JI3T 2E5LT 2F4VT 2UUAT 1HR0T 1IBLT 2UUCT 2UU9T 2UXCT 4GKJT 4DV3T 1I94T 1HNXT 4JI7T 4DR2T 4B3MT 4DV0T 1XMQT 4DV5T 1XNQT 4KHPT 4DV7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 T;  4NXM T;  4LFA T;  4DR1 T;  3T1Y T;  4X64 T;  4JI1 T;  1N32 T;  4JI2 T;  4X66 T;  2HHH T;  4LF7 T;  1N34 T;  4LF5 T;  4LF6 T;  1IBM T;  4LFC T;  5LMU T;  4B3R T;  4DUZ T;  4X65 T;  4DR7 T;  4DUY T;  1HNZ T;  4YHH T;  1XMO T;  2UXB T;  4B3S T;  4JI4 T;  4JI8 T;  4JI0 T;  2VQF T;  4JYA T;  4LF4 T;  1N36 T;  2UXD T;  4DV2 T;  1J5E T;  4JV5 T;  4GKK T;  2VQE T;  4LFB T;  5IWA T;  4DR5 T;  2UUB T;  4JI6 T;  3T1H T;  4NXN T;  1FJG T;  1XNR T;  4K0K T;  4DV4 T;  4AQY T;  4LF8 T;  4DV1 T;  3OTO T;  4JI5 T;  4LF9 T;  4DR3 T;  4YY3 T;  5LMN T;  4OX9 T;  1N33 T;  2ZM6 T;  4DV6 T;  4X62 T;  4DR4 T;  4B3T T;  4DR6 T;  1IBK T;  1HNW T;  4JI3 T;  2E5L T;  2F4V T;  2UUA T;  1HR0 T;  1IBL T;  2UUC T;  2UU9 T;  2UXC T;  4GKJ T;  4DV3 T;  1I94 T;  1HNX T;  4JI7 T;  4DR2 T;  4B3M T;  4DV0 T;  1XMQ T;  4DV5 T;  1XNQ T;  4KHP T;  4DV7 T; 
#chains in the Genus database with same CATH topology
 2EHO B;  3F31 A;  4BJM A;  2LSJ A;  2ACX A;  1J5W A;  4AKG A;  3FZF B;  4UVA B;  4DO0 A;  3U3I A;  4A5X A;  4ILU A;  3N9O A;  3UUX B;  3RF1 A;  5LOV E;  3L39 A;  2X0H A;  2UXB T;  1LVK A;  3K8P C;  3OYX A;  2WDV A;  4L9I A;  3AE2 A;  3C51 A;  1NEN A;  2BVM A;  2W4X A;  3SRZ A;  2KIN B;  3KVB A;  3LBX A;  1U4Q A;  4HWC A;  2VKD A;  2H7V C;  5FKY A;  4HWD A;  1KF6 A;  3VR9 A;  3NBX X;  2VB6 A;  2LE8 A;  4G63 A;  3EHZ A;  2R6G F;  5HWX A;  2VVN A;  3UU6 A;  4P0A A;  4EZ4 A;  3ZMZ B;  3CKD A;  5HXC A;  3QUJ A;  1MIV A;  5JQG E;  2EHO D;  2QYW A;  3BQI A;  4TWH A;  2VUR A;  3RIA A;  4MBQ A;  4U2Y A;  1XMQ T;  4HN9 A;  5JDL A;  4DV5 T;  3Q5W A;  3A7M A;  3CQX C;  3ESL A;  5L47 A;  4OK0 A;  2IC9 A;  5EK3 A;  3HKD E;  2BG9 E;  1D1C A;  4UVC B;  4YSZ A;  4LF7 T;  2V7M A;  3I1A A;  2JQH A;  5ETW A;  3VU7 H;  1WFD A;  2LHR A;  1HF8 A;  3AAA B;  5ABG A;  3EVY A;  4AKL A;  5AQQ B;  3PUS A;  3UUN A;  3AB3 B;  5AQV B;  2PFV A;  2RP4 A;  3AAE B;  1D0Z A;  1NAF A;  2JMH A;  2BG9 B;  4CI3 B;  1T72 A;  3Q5E A;  4DR5 T;  4GYS A;  3B13 A;  4CQI A;  2WZH A;  4OFZ A;  5HWY A;  2LSG A;  3PV0 F;  2K5B B;  5HXR A;  3D0T A;  4AQY T;  3FXE B;  4LF8 T;  4A98 A;  2OLT A;  1I6Z A;  2D0T A;  1O3X A;  4A56 A;  2MBG A;  3VKG A;  2IIU A;  5GON E;  3N2O A;  2CXF A;  1AJ3 A;  2QGS A;  4QKN A;  4JI3 T;  4EED A;  2LM9 A;  1JNR A;  3RYI E;  3UU8 A;  3O4X E;  4HWH A;  1HNX T;  5HEG A;  1HFA A;  1KEY A;  1MMA A;  5AFU L;  5AQJ B;  2MPK A;  4H9N C;  3AE4 A;  2V7I A;  4EIW A;  5DJQ C;  4YJ2 E;  4JLE A;  2WDR A;  4H9S E;  5BR8 T;  3R84 B;  2M6I A;  2P9B A;  3AAI A;  2DWG A;  3QC9 A;  3AA7 B;  2YEV C;  3KDS E;  5JDN A;  2V8S V;  3AEB A;  5C8Y E;  2AE9 A;  3P4W A;  3ZMT B;  3ZJ1 A;  5HXH A;  3ANW A;  3BK9 A;  3N2G E;  2VQE T;  2K3W A;  2XAJ B;  5C3J A;  2LRL A;  4YJ3 E;  3P4Q A;  5AQH B;  4GOU A;  5EK4 A;  3HL6 A;  1M62 A;  5LGN B;  2LSK A;  3L3P A;  2DWK A;  2FBW A;  4JI5 T;  3N9Q A;  3KV9 A;  3CWZ B;  2FJB A;  4J2C A;  3B57 A;  4IGU A;  4IHJ E;  2X0Y A;  3RX6 A;  2RPA A;  5AQF B;  4QXC B;  4EOZ B;  2DI4 A;  4ZI2 D;  2W66 A;  1KFY A;  3HKC E;  5CB4 E;  3HR0 A;  2LLY A;  4UEM A;  2QRX A;  3V5S A;  1DU2 A;  3QB5 A;  4DV3 T;  4BAY B;  2CXL A;  3O1J A;  2J1D G;  3AXJ B;  2NW9 A;  2JRK A;  5JR9 C;  2VL0 A;  4H63 V;  2XQA A;  3BQK A;  2KT9 A;  1XDO A;  4AKH A;  4ILC A;  4ZS2 A;  5TAO A;  5DQW A;  3LK3 B;  1MND A;  3MA9 A;  1YKH B;  1YD8 G;  5J1G A;  4ZI3 C;  3U78 A;  3AE3 A;  2XZE A;  2XM2 A;  2C0S A;  3SFD A;  3LG7 A;  4I0U A;  3RKO A;  3IEE A;  1SUM B;  3ZC1 A;  4YXD A;  3A8Y C;  2XSA A;  3UFE A;  4U7I A;  2DCF A;  3ZT6 A;  4GK0 E;  1J5E T;  5IWA T;  2UUB T;  2YIN A;  3H3M A;  1HG5 A;  3OKQ A;  3T1H T;  2X0L B;  1CHU A;  4NXN T;  3WAK A;  2LSY A;  1QSD A;  4HKA A;  2BKN A;  4ZZB A;  2BS4 A;  2A3D A;  3ZCJ A;  1MIY A;  3KV4 A;  3ZPO A;  3CML A;  4YY3 T;  4CXX A;  3AEC A;  4HEA A;  1HX8 A;  4O4H E;  3P4R A;  3M65 A;  4I43 B;  2WDQ A;  2E5V A;  4AKI A;  5LCY A;  1MIW A;  4E7Z A;  4IDP A;  2NW7 A;  5L3E B;  4ANJ A;  2VL8 A;  3IA3 A;  3LDQ B;  3UUB A;  4CN6 A;  1OED E;  4GKJ T;  4HFD A;  3CX7 B;  2V7J A;  1E2A A;  3RGL A;  1T8B A;  2WS3 A;  5EZY E;  2HN1 A;  4DV7 T;  4QHO A;  1SE7 A;  2WU2 A;  5AQU B;  3GA8 A;  2FUP A;  3Q2M A;  2ACZ A;  2E9X C;  3AA0 B;  4CI2 B;  1OED B;  3E22 E;  3ZT5 A;  2W67 A;  3RHW A;  5L3F B;  5LNK A;  4B3R T;  4X1K E;  5FNV E;  5AQM B;  4WBN E;  4YHH T;  1XMO T;  1UUS A;  3N9N A;  5LJM A;  2KND A;  4NPP A;  5F5W A;  3RKG A;  2J62 A;  4EB6 E;  2BKO A;  4IT4 A;  1WLX A;  4AQF A;  3ZMV B;  3RIU A;  4V1A v;  3E08 A;  4Z91 A;  4Q25 A;  2IC6 A;  3NRX A;  2NR4 A;  3ZYL A;  2WMO A;  1LVF A;  2V6Y B;  5E0O A;  2YK0 A;  2GK9 A;  5IYZ E;  3S4U A;  2SPC A;  4KHZ F;  4H9P C;  4PJJ A;  2XQ7 A;  2IAK A;  2WM9 A;  1CUN A;  1FMW A;  5DQV A;  3PUY F;  2V5D A;  3C4W A;  1Y01 A;  1US7 B;  5ABH A;  3EI0 A;  4OYJ A;  2PJQ A;  5ABF B;  1ZEE A;  3LSV A;  4X64 T;  4ZI3 D;  3EDV A;  1N32 T;  3AEG A;  4X66 T;  2XPK A;  3DP7 A;  2K48 A;  4UV9 B;  3FZH B;  5CA1 E;  4YT0 A;  4MLK A;  2XAG B;  5LP6 E;  1S35 A;  4HTE A;  3ZYK A;  4UF0 A;  2XQ5 A;  3VRA A;  1ZV4 X;  2KSR A;  2V6X A;  2XQ8 A;  1U5P A;  2WP9 A;  4GKK T;  2Z6E A;  3EDU A;  4TV8 E;  5CJ5 A;  3KVA A;  4ZXL A;  3PJA A;  5JDH A;  2LRK A;  5FMN A;  2Q9Q A;  4HWI B;  3NVO A;  3X1D A;  2KMF A;  2BG9 C;  2WQY A;  2MOZ A;  3RRW A;  1HS7 A;  3PUA A;  4HGA A;  2IW5 B;  1HNW T;  2WSS V;  2X9H A;  4U74 A;  3P7I A;  3L8R A;  1NEK A;  4IE4 A;  2OA5 A;  2ZM2 A;  1HR0 T;  2WWU A;  4H9R C;  4NUV A;  4TZ4 C;  4M1P A;  2VK9 A;  3ZMU B;  5JDM A;  4CZZ B;  5F8P A;  2K24 A;  4DR2 T;  3AE9 A;  4DV0 T;  3ETV A;  4PK4 A;  5LMU T;  1IZN B;  4ZZC A;  2E9X D;  2XQ3 A;  4JI2 T;  1VCT A;  4ZI2 C;  4DND A;  4NIQ A;  4XBF B;  2JQ9 A;  5LHG B;  2BS3 A;  3CQC B;  4B3S T;  2CWO A;  4JI4 T;  4JI0 T;  4JYA T;  3N9L A;  1N36 T;  3PTR B;  4IDO A;  2CEA A;  2M6B A;  2BBJ A;  4PJM A;  4WZX A;  3RQU A;  2LKG A;  3UU4 A;  1WR6 A;  2LM2 A;  4UV8 B;  2CBI A;  1BR1 A;  1KK7 A;  2LSI A;  3CVR A;  3IF8 B;  2WAU A;  5FXW A;  3L09 A;  3K3O A;  4KUM B;  1M7K A;  2W63 A;  4DR6 T;  1UCU A;  2JJ9 A;  3ZCI A;  2Y8D A;  2LJL A;  3CX8 B;  3RIF A;  1VCS A;  2LOP A;  3WI3 A;  3LK2 B;  4GIW A;  3K1S A;  2ZLY A;  1MMN A;  3IBP A;  4KP3 C;  3KBT A;  4TWF A;  2WCA A;  4ZHQ E;  4QH4 A;  1WRD A;  1XDP A;  4YTM A;  3RYC E;  3MKD A;  5CGM A;  5JRC A;  5AQL B;  4GYR A;  4LF6 T;  4F6R C;  2X66 A;  4LFC T;  3VR8 A;  3LK4 2;  4DUZ T;  5BMV E;  2X9Y A;  4YSY A;  4EEB A;  5LG3 A;  5JRE A;  2A9U A;  5J2U E;  5LJN A;  4L0R A;  4JUY A;  4HFI A;  5HXS A;  1ZOY A;  1VOM A;  2CA5 A;  2Q9Q B;  5AQO B;  5JTG A;  2LHN A;  3ZT7 A;  3K3Q C;  2IUB A;  3K3N A;  2BS2 A;  3JC6 D;  2K9A A;  2ZM0 A;  2WBL A;  5JR9 A;  3FZL B;  4IRE A;  3HA4 A;  3ZST A;  4EV6 A;  4B3T T;  1KNZ A;  2VKO A;  3P50 A;  3LBX B;  4PJL A;  3RC3 A;  4C90 A;  5J2T E;  3HKE E;  2W2U A;  3ETU A;  2F4V T;  5FY7 A;  2XY8 B;  4YHJ A;  2NP9 A;  3TLW A;  4ZS3 A;  2G0U A;  4PFO A;  5L3G B;  4JI7 T;  4IDN A;  5FXZ A;  3OPC A;  3EAM A;  2JQQ A;  3CPZ A;  4TWD A;  3NZP A;  4CI1 B;  5FL1 A;  1XNQ T;  3BQL A;  3C4Z A;  2BDE A;  4DBQ A;  4DVD A;  4EXT A;  3PUW F;  1ZHC A;  4JEU B;  5L4E A;  2CXD A;  4L5G A;  1HX1 B;  1T7S A;  3OVU A;  4H63 H;  2A2F X;  2DL1 A;  2NTY A;  3AEF A;  3GN5 A;  3ZN0 B;  1HG2 A;  1D1B A;  3RQW A;  3MAC A;  1UGO A;  1OED C;  4UR9 A;  2XQ9 A;  2H88 A;  4COF A;  3CQG B;  1R8I A;  1BR0 A;  1FMV A;  4Z90 A;  1WYC A;  1FJG T;  3RRC A;  1XNR T;  1W0A A;  2XSB A;  5AQI B;  2CHN A;  3OTO T;  2CPT A;  4O2A E;  4U7Y A;  4AKR B;  4OX9 T;  2YN6 A;  4KI0 F;  5HEH A;  2PBI A;  4ASK A;  5H6Q B;  5FXX A;  3A5X A;  2IML A;  4IE0 A;  2JIW A;  2D9D A;  3DTO A;  5JH7 E;  4BA9 A;  2XAS B;  2CRB A;  2KXP B;  4QH5 A;  2DLR A;  4U33 A;  2LKH A;  2Y6X A;  2EHO A;  5A1L A;  2D2S A;  3FHN A;  2DNX A;  3UUL A;  5L2L A;  1YQ3 A;  3JAF A;  5AQK B;  3H37 A;  1Y64 B;  3PUZ F;  4EYU A;  4O4I E;  4EGW A;  2XQ4 A;  3NRY A;  1IBM T;  2DHR A;  1Z0P A;  2XAF B;  3I9W A;  3EAB A;  4Z8X A;  4DUY T;  2CBJ A;  1Z8U A;  4EZH A;  2VQF T;  2BKP A;  2VWA A;  2MTQ A;  2B1E A;  2QA7 A;  5AQT B;  4WBO A;  5J0Z A;  4KMC A;  3WAJ A;  5HXE A;  3ANW B;  1H7C A;  3FB2 A;  4H9O C;  4DV4 T;  1WR0 A;  3ZKR A;  3Q9D A;  3AE5 A;  3C98 B;  5LYJ E;  3T8O A;  1G73 A;  3MXZ A;  1X79 A;  1LRZ A;  4IE5 A;  2YDR A;  2E8I A;  2UUA T;  3QB5 K;  3AEA A;  3CK6 A;  3PUQ A;  3KV5 A;  1QUU A;  4ERR A;  1MNE A;  2UXC T;  1YW0 A;  2CE7 A;  3N5L A;  3AEE A;  3GMI A;  4PJN A;  4P1N A;  4TN7 B;  2BVL A;  1UX4 A;  2X51 A;  3C64 A;  4KHP T;  3LJC A;  1ZP0 A;  3AE8 A;  5FL0 A;  3EUH A;  5C2T A;  4NXM T;  4LFA T;  2VVS A;  4O2B E;  5EK2 A;  2N1G A;  3GN5 B;  2HHH T;  1W0B A;  4LF5 T;  2N9D A;  1KNP A;  4DR7 T;  2BG9 A;  3ONL C;  2XJ7 A;  5HCJ A;  3RYH E;  3P8C D;  3RYF E;  1XZY A;  2J4G A;  4MFR A;  5IHY A;  4AIS A;  4DV2 T;  4IST A;  4AI6 A;  4IIJ E;  2C5K T;  4IE6 A;  4JI6 T;  4LMJ A;  5FVK A;  4TNV A;  3P4P A;  4PK6 A;  3RIU C;  5KDM C;  2HPJ A;  2CM0 A;  3CIR A;  3CX6 B;  4DV6 T;  1SA0 E;  3FBL A;  2IHR 1;  2HH7 A;  2WZI A;  3B5M A;  3UQ4 A;  1IBK T;  3TLV A;  4WYV A;  3JAD A;  3FZM B;  3SWH A;  1E1H B;  3ZLI A;  1FIO A;  3QNU A;  2V5C A;  4FI5 A;  3KFW X;  4F8H A;  3ZYM A;  3JC6 C;  4G2A A;  4QWN B;  3Q5D A;  5LHI B;  5LGU B;  4JEH B;  3PUV F;  2X67 A;  2VAS A;  3PU3 A;  3N9P A;  4QX8 B;  3FZK B;  2I59 A;  5DAB A;  1MMG A;  2YDQ A;  3UUM A;  5FVL A;  3ZC0 A;  2MAW A;  1QLB A;  3O1I A;  3NZQ A;  4XAX B;  1UUR A;  3PUR A;  2CLY B;  2NW8 A;  2NOX A;  2X9X A;  2UXD T;  1T98 A;  2XAH B;  1YKE B;  1S94 A;  3PU8 A;  3UU5 A;  1SHZ C;  4U3C A;  4H9Q C;  4X5T A;  3E0Z A;  5FP3 A;  4DMV A;  4KX6 A;  4PFP A;  1V9D A;  3VHL A;  4QH1 A;  5L3D B;  4YFS A;  1W09 A;  2Q9Q C;  2CCQ A;  3N9M A;  3ZMS B;  3I0Q A;  3ONJ A;  4E7S A;  3O9X A;  5LBM A;  5LHH B;  4YTP A;  3ZJ2 A;  5LGT B;  5F3J A;  2FJD A;  4TV9 E;  2VKH A;  3AXJ A;  5KXJ A;  1WCR A;  2X68 A;  1I94 T;  5AQN B;  4PNI A;  3M3Z B;  2LT3 A;  2I0M A;  4UEL A;  1YQ4 A;  4CXW A;  1D0X A;  2JMK A;  3PJA J;  3PUG A;  5HEJ A;  2A72 A;  2MYS A;  4PAG A;  2WB5 A;  2KWH A;  5HAX A;  4JI1 T;  2I6H A;  2M67 A;  2W61 A;  4LML A;  2HPL A;  2X9W A;  3H3A A;  3QK6 A;  4IDQ A;  4P0B A;  3RI5 A;  3J9X 1;  2CMR A;  2XQY A;  4DBR A;  1J1J A;  3AE1 A;  5KX5 E;  4ADZ A;  5AQR B;  4JI8 T;  3VKH A;  5JDQ A;  4PW8 A;  2C5J A;  3UT5 E;  2KLQ A;  3RPU A;  4UF0 B;  4ILA A;  5IUX A;  4HE8 A;  3AED A;  2JPF A;  1X9B A;  5CA0 E;  4K0K T;  3O1H A;  4AXP A;  1KNR A;  3SS1 A;  4UIG A;  4LF9 T;  3F2E A;  2JQK A;  2W0G A;  4X62 T;  3OBV E;  4WW0 A;  2IDO B;  3KIN B;  3V5U A;  1HTJ F;  1IAP A;  2C5I T;  2V1D B;  4I50 E;  1UX5 A;  4UVB B;  4ISS A;  3NWI A;  2V26 A;  2CHO A;  4K0U A;  2UU9 T;  2WMN A;  4HWF A;  4IE7 A;  2W00 A;  5L3B B;  3AA6 B;  2LEH A;  2E2A A;  3UFG A;  1OED A;  2FJA A;  2XQ6 A;  4LMK A;  2WU5 A;  2RA1 A;  5AQS B;  2UXX B;  4X65 T;  1E7P A;  3C4X A;  2H89 A;  2D0U A;  1IJ6 A;  3ABV A;  2PTF A;  4X20 E;  5LA6 E;  1D0Y A;  2YOE A;  2YU2 A;  3SOL A;  4JV5 T;  4LFB T;  4HFE A;  4EAH A;  3UQ7 A;  1BR2 A;  4QX7 B;  3UTK A;  2V6Y A;  5H6R B;  3TLS A;  2UXN B;  2Q9Q D;  3GWH A;  4GK5 E;  4BJN A;  2XHE B;  4DV1 T;  1MMD A;  3OYZ A;  2YU1 A;  2QVA A;  3PUX F;  4ZOL E;  4HFB A;  2ZM6 T;  1N33 T;  4TNW A;  4DR4 T;  3QOF A;  3IHR A;  4MAL A;  2PG8 A;  1JNZ A;  2WWV A;  3OJA A;  4JBW F;  3RC8 A;  2LOS A;  3HI2 A;  3J7Y q;  1WYB A;  4P09 A;  2Y48 B;  4N78 D;  5FY0 A;  1G8X A;  4OHF A;  3ZEF B;  5ABF A;  4B3M T;  5ADX L;  4PK5 A;  4CN1 A;  5JDF A;  3NKZ A;  2FJE A;  4I4T E;  2E9X A;  3I0O A;  4C91 A;  4I55 E;  1BR4 A;  3PE0 A;  2ODV A;  4DR1 T;  3T1Y T;  5L3C B;  2NWB A;  4YLH A;  3ZSS A;  4TUY E;  3AVR A;  3W15 B;  2XTL A;  4X1Y E;  1NWM X;  3AE6 A;  1ZKE A;  2ZMA A;  5LBQ B;  1HNZ T;  1IJ5 A;  3LFM A;  3MK7 C;  5JRC B;  2L8K A;  3KV6 A;  2V7K A;  4A97 A;  3AE7 A;  3ONX A;  2H3R A;  1YXR A;  1L0V A;  5AQG B;  3N2K E;  3UU3 A;  4AIU A;  2B76 A;  2D5U A;  2ZM8 A;  1B7T A;  2BZB A;  3SFE A;  4U2Z A;  2ODU A;  3Q5X A;  2V7L A;  4X1I E;  4DR3 T;  1EZ3 A;  3ZN1 B;  5HYA A;  5LMN T;  5KMG P;  2OV9 A;  3DJB A;  5JDG A;  2VKJ A;  4TX5 A;  3HKB E;  3JAE A;  4WNK A;  5FXV A;  4DMW A;  4XZC A;  4HFV A;  5JR9 B;  2N2N A;  4O4J E;  3FBZ A;  4YTN A;  3I9Y A;  4O8S A;  3TLU A;  5HEU A;  5HCM A;  5JVD E;  2AXD S;  2HN2 A;  4B6X A;  2YDS A;  2XAQ B;  3JCF A;  1D1A A;  2EHO C;  4O4L E;  4IL4 A;  3TLT A;  5LXT E;  5HEO A;  2WY2 A;  3C50 A;  5ABE A;  2XM1 A;  4CN4 A;  3MZK B;  1N34 T;  3TKL B;  4FJO A;  5CFB A;  1XWM A;  2H7O A;  3R6N A;  3F57 A;  4DID B;  5LG4 A;  2J47 A;  5M4Y A;  3G06 A;  1GQE A;  2ES0 A;  4LF4 T;  4NUU A;  2L9Q A;  3VRB A;  4HFH A;  1HCI A;  2W62 A;  4CXY A;  3KBU A;  1OXZ A;  3RH3 A;  2NTX A;  5LB7 B;  5FYM A;  1VRB A;  1LKX A;  3FXD B;  2YKS A;  4OYK A;  4U31 A;  5FY1 A;  2CLY C;  2KWI B;  2BBH A;  1FEW A;  4EYY R;  4QXB B;  3MJX A;  5AQP B;  2L3L A;  4U72 A;  4HFC A;  4MHC A;  3AVS A;  4AQF C;  5L4H A;  1UK5 A;  4KBM B;  2CWY A;  4IL9 A;  4IDZ A;  1OWA A;  2E5L T;  4ZI7 E;  3P4S A;  3PDY A;  1IBL T;  3RLF F;  2UUC T;  2KZ7 B;  4ILB A;  4UXN B;  2E9X B;  4QXH B;  1W9R A;  4YSX A;  4AQG A;  2XUE A;  3AA1 B;  4ZEY A; 
#chains in the Genus database with same CATH homology
 5BR8 T;  4NXM T;  4LFA T;  4DR1 T;  3T1Y T;  4X64 T;  4JI1 T;  1N32 T;  4JI2 T;  4X66 T;  2HHH T;  4LF7 T;  1N34 T;  4LF5 T;  4LF6 T;  1IBM T;  4LFC T;  5LMU T;  4B3R T;  4DUZ T;  4X65 T;  4DR7 T;  4DUY T;  1HNZ T;  4YHH T;  1XMO T;  2UXB T;  4B3S T;  4JI4 T;  4JI8 T;  4JI0 T;  2VQF T;  4JYA T;  4LF4 T;  1N36 T;  2UXD T;  4DV2 T;  1J5E T;  4JV5 T;  4GKK T;  2VQE T;  4LFB T;  5IWA T;  4DR5 T;  2UUB T;  4JI6 T;  3T1H T;  4NXN T;  1FJG T;  1XNR T;  4K0K T;  4DV4 T;  4AQY T;  4LF8 T;  4DV1 T;  3OTO T;  4JI5 T;  4LF9 T;  4DR3 T;  4YY3 T;  5LMN T;  4OX9 T;  1N33 T;  2ZM6 T;  4DV6 T;  4X62 T;  4DR4 T;  4B3T T;  4DR6 T;  1IBK T;  1HNW T;  4JI3 T;  2E5L T;  2F4V T;  2UUA T;  1HR0 T;  1IBL T;  2UUC T;  2UU9 T;  2UXC T;  4GKJ T;  4DV3 T;  1I94 T;  1HNX T;  4JI7 T;  4DR2 T;  4B3M T;  4DV0 T;  1XMQ T;  4DV5 T;  1XNQ T;  4KHP T;  4DV7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...