3CPZA

Crystal structure of var2csa dbl3x domain in the presence of dodecasaccharide of csa
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
349
structure length
297
Chain Sequence
IRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDKGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNSIFNGDECGVSPPTGNDEDQSVSWFKEWGEQFCIERLRYEQNIREACTIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Erythrocyte membrane protein 1
publication title Structure of the DBL3x domain of pregnancy-associated malaria protein VAR2CSA complexed with chondroitin sulfate A.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 82
structure length 297
sequence length 349
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cpzA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3cpzA02
3CMLA 2YK0A 2XU0A 2Y8DA 3BQLA 4NUUA 5F3JA 4YFSA 3CPZA 3RRCA 2WAUA 4NUVA 3BQIA 3C64A 3BQKA
chains in the Genus database with same CATH superfamily
2HHHT 4F52A 2D0UA 4KP3C 3ONJA 4AKHA 2DHRA 3N2GE 2NWBA 3F2EA 1X9BA 3B57A 4F8HA 4TZ4C 5FP3A 1N33T 2K3WA 1KNRA 5LOVE 1OEDA 5JQGE 4UXNB 2JMHA 4UF0A 4ZS2A 2BG9B 4KBMB 4OYKA 3PJAJ 3CQGB 4C90A 3AE9A 4YSZA 5TAOA 3UUNA 3FXEB 1FMVA 3T1YT 2WU2A 5HEJA 1Z0PA 5JR9A 4YSYA 5BR8T 4H63H 4JUYA 3KV5A 1HG5A 3KBTA 3N5LA 5EZYE 2N9DA 2WZKA 4DR2T 2M67A 2KXPB 4O2AE 4B3MT 3C4XA 2CXLA 2RP4A 2LEHA 2VKJA 1N32T 4LF8T 1D1BA 3VRAA 2CEAA 1YQ4A 2JQQA 1IBKT 1UURA 5HEUA 4HKAA 3AE1A 3MACA 3KBUA 2CRBA 4Z8XA 3UFEA 3OPCA 4UR9A 1BR0A 1OEDC 4GKKT 4DUZT 4PFOA 5ABHA 2XHEB 3VR9A 3FHNA 1KEYA 4GYSA 4IDPA 2W00A 2WDVA 3N9PA 3CMLA 3T8OA 2D5UA 4ILBA 4HWIB 4BJMA 1Y64B 2BBHA 3RIAA 3EHZA 3O1HA 4TNVA 1N36T 4HFBA 4ZS3A 4DIDB 3RYFE 3RC3A 3KFWX 3N9NA 3GA8A 3LK42 3Q5DA 2F4VT 3I1AA 4TN7B 3RKOA 4IE0A 3U78A 2H7OA 4PAGA 4IE4A 4P0BA 2DL1A 2ZM6T 3EDUA 2W62A 3OYZA 3OBVE 4JI6T 4WBOA 2X66A 2WWVA 3ONLC 4HFCA 4UEMA 4PW8A 3UQ7A 1MIYA 3ZSTA 3UTKA 4WYVA 5FXZA 4P5OA 2WSSV 2AE9A 2YU1A 1G8XA 4X1YE 4IREA 2MTQA 2LSKA 2PJQA 4X65T 2CWYA 3B5MA 3ZC1A 4DUYT 1SA0E 4U74A 3QC9A 2DWGA 5J0ZA 3KVAA 2JIWA 1YKEB 1W9RA 5CA0E 1LRZA 3AB3B 1QUUA 5JR9B 4PK4A 4GK0E 2WBLA 2LSJA 2W4XA 3CWZB 4LFBT 2IDOB 2MAWA 3HKBE 4F6RC 2LSIA 1FIOA 3P4SA 1S35A 1NENA 4HGAA 1U6GA 2XAHB 4PFPA 4L0RA 3LFMA 4K0UA 1QSDA 2WQYA 4YHJA 5CB4E 2EHOB 1HCIA 1T8BA 5L3CB 1LDKA 4HWDA 3BQLA 5LA6E 2L9QA 4TV9E 3AAIA 3WAKA 2BKNA 2ZLYA 4HWCA 2NR4A 5LG3A 4EXTA 2LKGA 4CN4A 4IIJE 2UUCT 3V5UA 5F5WA 4YLHA 3AE5A 2I0MA 3ZT7A 3P50A 2Q9QB 3L09A 2CLYB 4WQOD 5GONE 4Z90A 4O4HE 3RYHE 5L4HA 5AQVB 2LLYA 3OYXA 3HI2A 2IW5B 4DR4T 1X79A 2LM2A 4Z91A 3FBZA 3RIFA 2YK0A 5AQNB 2BS2A 4AQFC 2X9HA 2I59A 1WYBA 3LK2B 4WZXA 2BS3A 1U5PA 1XWMA 4X1KE 4LFAT 4U31A 2JQHA 3DP7A 2OA5A 2XQYA 2YN6A 4TUYE 4N9F3 2KNDA 3C4ZA 1VCSA 1L0VA 1EZ3A 1GQEA 5JDHA 4JI8T 2XY8B 3NKZA 3EABA 3ZEFB 2CMRA 2YKSA 1D1AA 4J2CA 1ZV4X 5KX5E 5IUXA 2VKHA 1YD8G 3RHWA 3DJBA 4DBQA 3I0QA 4ZI3C 5LBQB 1US7B 3SOLA 3QNUA 2HH7A 3MZKB 5C3JA 3ZYMA 5BMVE 4ISSA 2A72A 3AEBA 2LE8A 2H89A 1IAPA 5J2UE 3RF1A 1YQ3A 4Q25A 5FY1A 3ANWA 1XDOA 4AQYT 3I9YA 3P8CD 3PU8A 4DV6T 2X0YA 4QKNA 4EEDA 1LDKB 4L5GA 4H9PC 3W15B 4EIWA 4IDNA 5HWXA 1MMNA 2FJDA 2P9BA 3OKQA 4DR1T 1XNQT 4TWDA 2FBWA 3AE4A 2QVAA 4DR6T 5ABFA 4EGWA 2V6YA 1MNDA 2BVLA 1IBMT 1J1JA 4JI4T 2E9XB 3DQVC 2ZM2A 1OWAA 2KWIB 3ZC0A 3CIRA 2EHOD 1OEDE 5A1LA 2CHNA 2C5IT 1KK7A 3H3MA 1Z8UA 2V6XA 2YOEA 4ZHQE 4B3TT 3ABVA 4YTPA 3ETUA 4UELA 3P4QA 5JREA 4DBRA 5FL1A 3J9X1 3L8RA 4CI2B 2UXXB 2Q9QD 2VURA 4AP2B 4JI7T 1D0ZA 3HR0A 3ZN0B 4KHZF 3P7IA 2LRKA 3CQCB 3H3AA 1WR6A 2BG9C 5JRCA 2Y6XA 2WMOA 3IA3A 5IWAT 5FKYA 4U2YA 3CX8B 1UX4A 2V7IA 2ZM0A 3NVOA 3UQ4A 2X68A 2HPLA 3Q2MA 1UGOA 1FJGT 4IE5A 5AQTB 3UU8A 3GN5A 2IC6A 4ZEYA 5HYAA 4ISTA 3UT5E 2KLQA 5HAXA 3AE3A 5JTGA 3N9QA 1R8IA 1D0YA 3A5XA 1J5WA 3HKEE 1D0XA 4X66T 2FJBA 3AE7A 2LSYA 3PURA 2D0TA 5DQWA 3P4PA 2VQET 4ILAA 3CVRA 4PJMA 3O1IA 5E0OA 4EZHA 2WMNA 3CX6B 1ZKEA 4ILUA 4QX8B 3UU3A 3ANWB 3Q5EA 4UVBB 3S4UA 5CFBA 4PK5A 4QXCB 2D9DA 3V5SA 2BKPA 2WS3A 3RIUA 1YXRA 3MJXA 2VK9A 2KSRA 1NEKA 5FVLA 2V7JA 1H7CA 2LJLA 4UVCB 5LP6E 1HR0T 4CN1A 1MIWA 1MMAA 1WRDA 4YHHT 2A3DA 5ABFB 4LF6T 3UFGA 3WAJA 4YTNA 2NTYA 3C98B 1BR2A 4JGHD 2WP9A 1HTJF 5LJMA 3LBXA 5LCYA 2WDRA 4AISA 4HFDA 5AFUL 3IBPA 3F31A 5JDFA 3AE2A 5LYJE 2DCFA 4TNWA 1SE7A 3I9WA 2LHRA 3C64A 4ZXLA 3AEFA 4KX6A 4GK5E 2V7LA 4NXMT 3BQIA 3A8YC 5LHIB 4H9RC 2YDRA 2E9XD 3B13A 4L9IA 3QOFA 3MKDA 1SHZC 4I4TE 2XU0A 4FI5A 3TLWA 3RIUC 3ZMSB 4EOZB 5JRCB 3QK6A 1XZYA 4IE7A 2VKDA 2V7KA 4YY3T 3QB5K 1VCTA 3RLFF 3U3IA 1JNZA 2WCAA 4ZI2D 4AKLA 3TLVA 2PTFA 3UUMA 1MMGA 3MXZA 2BBJA 3MK7C 3VR8A 4YXDA 5L3BB 4PJJA 5FL0A 4MALA 3NZQA 2XM2A 4APFB 4X20E 4CZZB 4ZZCA 3GMIA 2KINB 1OXZA 3C4WA 4QH4A 2BVMA 4X1IE 5EK4A 5CJ5A 2EHOC 3M3ZB 3ZLIA 4IHJE 1OEDB 3N2KE 2A2FX 3AXJA 4IDOA 2C0SA 5AQKB 4UF0B 3LDQB 2DLRA 4I43B 2ZMAA 1ZOYA 3DTOA 3PUQA 4H9OC 3N9MA 5HXEA 2XQ9A 4ERRA 4YJ2E 2W61A 2Q9QC 3HKCE 1HS7A 3IHRA 2KMFA 2KT9A 2X67A 2UU9T 1HNZT 1QLBA 4GYRA 3MA9A 4A56A 4AQFA 3CKDA 1M62A 3H37A 1IBLT 2W0GA 4A98A 1B7TA 2K24A 2W2UA 4DV5T 2JJ9A 2H88A 3RX6A 3K3QC 4MHCA 2XTLA 3E22E 3LBXB 4WNKA 4JYAT 2V1DB 3JC6D 2DNXA 2UXDT 3O1JA 4EEBA 1Y01A 3P4RA 2UUBT 2SPCA 4GOUA 3OVUA 2E5VA 3JCFA 2HN1A 2D2SA 3Q9DA 2CXDA 3L39A 3OTOT 5HCJA 1KFYA 5CA1E 4C91A 3FZHB 4PNIA 2XQ6A 2QA7A 4A97A 3R84B 4YTMA 2C5KT 2XQ5A 5L47A 3PUGA 2PG8A 4H63V 5KDMC 2XASB 2CHOA 2E8IA 3EUHA 4E7SA 2RA1A 3CK6A 2DWKA 1ZP0A 2N2NA 2BG9E 3RC8A 3VKGA 4O4JE 4CXXA 2JQKA 5AQOB 1VRBA 3LJCA 1T72A 2WZHA 5F3JA 2J1DG 3AAAB 4LF4T 5AQIB 5LGTB 2LOPA 1MIVA 2LT3A 4GIWA 5FYMA 4LFCT 4LMKA 2WAUA 2VQFT 3ZMTB 2ODUA 4LF9T 3AE8A 5IHYA 3AXJB 4LF5T 2MOZA 2X9WA 2PFVA 2C5JA 2G0UA 4JI0T 3HA4A 1HNWT 3FB2A 3SWHA 2LKHA 3K3OA 4COFA 4U33A 2V8SV 1LVKA 3AA0B 5AQMB 3PDYA 2E9XC 3VHLA 4KI0F 5HEOA 2XQ7A 4TWFA 3RGLA 1XNRT 4EZ4A 1FMWA 4NUUA 3SFEA 3SRZA 1WR0A 3PUVF 2CPTA 3P4WA 4OYJA 1YKHB 3KINB 2R6GF 4HTEA 3AEEA 2VASA 2QYWA 4QHOA 5F8PA 2H7VC 4DMVA 4IL4A 1T7SA 4B3ST 4KMCA 4YFSA 2CCQA 3ZT6A 1KNZA 3RH3A 3PTRB 3PUZF 2BG9A 1W09A 2VL8A 2W66A 3KDSE 4DO0A 3NRXA 4OFZA 1WYCA 5JDLA 3IF8B 2N1GA 2XQ4A 3C51A 1O3XA 3EAMA 4U3CA 1WCRA 5HXRA 4TX5A 2VB6A 4HE8A 3ZSSA 4YT0A 5C2TA 3UU4A 3UUBA 2VWAA 5AQJB 1VOMA 5LB7B 3X1DA 2AXDS 2XZEA 3R6NA 4B6XA 2BZBA 2X0HA 3AAEB 4MFRA 5L3EB 3N9OA 3T1HT 3TKLB 3Q5XA 2B1EA 4LMJA 4IDZA 1XDPA 4I0UA 4ZZBA 3ESLA 1V9DA 3QUJA 2VVSA 2BS4A 1FEWA 4A5XA 4LF7T 3AE6A 3KVBA 3PV0F 3J7Yq 4DMWA 2X51A 5FMNA 5FXVA 2WDQA 2E5LT 5KXJA 5JH7E 5FXWA 5KMGP 3AEDA 4P0AA 3PUAA 5DJQC 4QH1A 5LMNT 4ASKA 4PJNA 4BAYB 1ZEEA 2DI4A 1E1HB 4HEAA 2CM0A 3AVRA 5FVKA 1U4QA 4EYUA 4AKGA 4AIUA 4A64A 4QH5A 5LJNA 4JI1T 4NIQA 3RYIE 4HWHA 2KZ7B 2JMKA 4OHFA 1CHUA 2M6BA 4X62T 4JI3T 4IE6A 3PE0A 2LSGA 2LRLA 5AQFB 2ODVA 3ZMZB 2K5BB 5AQLB 5AQPB 2YDSA 3ZMVB 2WWUA 5JVDE 4ADZA 5IYZE 1WFDA 3I0OA 4DV7T 3VRBA 4NXNT 4X64T 1W0AA 5JDNA 4ILCA 3VU7H 4I55E 1YW0A 3ZMUB 4AQGA 3AA1B 4IDQA 2VVNA 2FJEA 2IAKA 5HXSA 1E7PA 4QXBB 5LGUB 4BJNA 1MMDA 4PJLA 3K3NA 3JAFA 4NUVA 4V1Av 5DABA 2V6YB 1XMOT 4DV4T 3ZN1B 1J5ET 4BA9A 5HXHA 3FZKB 4XBFB 3UULA 2L8KA 3ONXA 1IJ5A 1HNXT 1CUNA 2CBIA 1S94A 3HL6A 4N78D 4DV1T 3GWHA 3TLTA 2EHOA 3EI0A 5CGMA 2UXCT 4TWHA 2YDQA 4O8SA 3K1SA 5EK3A 4JI5T 3O9XA 3N9LA 2VL0A 2RPAA 1LKXA 2XM1A 4DV0T 3AA7B 2XQ8A 4PK6A 5LBMA 3UU5A 3FZLB 2B76A 4YJ3E 4ZI3D 5ETWA 2NTXA 2Q9QA 3JADA 3L3PA 3RQWA 4JEHB 2QGSA 4H9QC 4NPPA 4ZI7E 5L4EA 4JLEA 3NZPA 5HCMA 4JV5T 1IZNB 3ZT5A 5JR9C 3FBLA 2CA5A 5LMUT 2YEVC 2XSAA 2W63A 3GN5B 3K8PC 1LVFA 2HPJA 2V26A 2Y8DA 2I6HA 5H6QB 5LNKA 4G2AA 3E08A 1XMQT 2J62A 1KF6A 3OJAA 5JDGA 3JAEA 3RKGA 3UU6A 1N34T 3PJAA 4P09A 2UXBT 1D1CA 4OK0A 2CBJA 4KUMB 2LM9A 4IGUA 4IT4A 2IMLA 4E7ZA 4O4LE 4EYYR 3F57A 4U2ZA 5HEHA 4IL9A 3RRWA 4AI6A 2K48A 2Z6EA 3ETVA 4B3RT 4DNDA 1IJ6A 4UIGA 4U7IA 5J2TE 3QB5A 2K9AA 3LSVA 1ZHCA 1G73A 4AKIA 2CLYC 3ZCJA 4XAXB 1W0BA 2JPFA 2NW7A 3EDVA 3CX7B 5M4YA 2LOSA 2XJ7A 3WI3A 2CE7A 4M1PA 4JBWF 3BK9A 4U7YA 1SUMB 5HEGA 2XAFB 2E2AA 5FXXA 1HF8A 2Y48B 2MYSA 2WB5A 3ZYKA 4AKRB 4EV6A 2YINA 3DPLC 2H3RA 1HX8A 1DU2A 4P1NA 2CWOA 4EAHA 2WU5A 5FY0A 2KWHA 2BKOA 1BR1A 2OLTA 1WLXA 4EB6E 3SFDA 4O4IE 2L3LA 2FJAA 1HX1B 3KV6A 3Q5WA 4DR5T 4HFEA 3EVYA 3IEEA 4DVDA 2XSBA 4CN6A 4U72A 4CI3B 5AQSB 2E9XA 4ANJA 3VKHA 4I50E 1NAFA 1M7KA 5L3DB 3PUSA 4G63A 3UUXB 2J47A 2HN2A 4DV3T 4JI2T 2IUBA 4TV8E 3PUWF 4QX7B 3CQXC 2QRXA 2NOXA 3AA6B 3D0TA 2WZIA 2XUEA 1HFAA 4UV8B 2BDEA 5FY7A 3AEAA 3PU3A 2IC9A 2XAGB 4DR7T 4MBQA 4LMLA 4UV9B 5JDQA 4X5TA 4O2BE 1NWMX 4AXPA 1MNEA 4JEUB 2YU2A 3ZJ1A 3TLSA 3CPZA 3ZPOA 5JDMA 4CI1B 4CQIA 2A9UA 1T98A 4HXIB 4CXWA 4HFHA 4HWFA 4QWNB 4H9NC 3RRCA 4K0KT 3O4XE 2V7MA 3ZCIA 3RYCE 5J1GA 5FNVE 5C8YE 1I6ZA 2V5DA 2OV9A 4WBNE 5ADXL 4OX9T 5AQHB 5L3FB 2W67A 2WM9A 5H6RB 5AQQB 2XAJB 2VKOA 4DV2T 3FZMB 3RTRA 2NW8A 2IHR1 4H9SE 3AECA 5LGNB 2PBIA 4GKJT 3TLUA 4ZI2C 2V5CA 2GK9A 2ZM8A 3E0ZA 1LDJA 2ACXA 4WW0A 2M6IA 2LHNA 4QXHB 1I94T 1KNPA 4HFIA 3G06A 3M65A 5ABGA 3KV4A 3ZJ2A 4UVAB 2UXNB 3AEGA 3ZYLA 5DQVA 5LHHB 5ABEA 1E2AA 3C50A 5AQRB 1UX5A 4HN9A 3AVSA 3NBXX 5HXCA 4FJOA 1UUSA 3FXDB 5LG4A 3PUYF 2MBGA 2X9XA 2X9YA 4HFVA 4MLKA 1UK5A 3KV9A 2XPKA 5HWYA 1BR4A 2FUPA 2JRKA 3N2OA 1JNRA 3LK3B 2MPKA 5L2LA 5L3GB 3BQKA 2NW9A 1UCUA 3NWIA 5AQGB 2NP9A 3RPUA 2CXFA 3RQUA 3RI5A 2ES0A 4XZCA 5AQUB 2XAQB 2XQAA 3JC6C 2X0LB 1AJ3A 2UUAT 2XQ3A 2JQ9A 2IIUA 3NRYA 2ACZA 3LG7A 3PUXF 1HG2A 3FZFB 4DR3T 5EK2A 5LHGB 3HKDE 2WY2A 3ZKRA 3A7MA 4KHPT 3SS1A 4YSXA 4ZOLE 4CXYA 2J4GA 5LXTE
chains in the Genus database with same CATH topology
2CA5A 3P8CD 2QA7A 2D0UA 4KP3C 3PU8A 3R84B 2YEVC 2W63A 3GN5B 4AKHA 2DHRA 3K8PC 1LVFA 4QKNA 2HPJA 2NWBA 2C5KT 3N2GE 2V26A 4L5GA 4H9PC 3F2EA 3W15B 4EIWA 5HWXA 2Y8DA 3B57A 4TZ4C 1MMNA 5FP3A 5H6QB 5LNKA 2P9BA 5LOVE 3OKQA 5JQGE 4G2AA 4UXNB 3E08A 3PUGA 2PG8A 3OJAA 5JDGA 2JMHA 4H63V 5KDMC 4UF0A 4ZS2A 2XASB 2E8IA 3EUHA 4KBMB 4OYKA 3CQGB 4C90A 4P09A 4E7SA 1D1CA 2RA1A 4OK0A 2DWKA 5TAOA 2N2NA 4KUMB 1MNDA 2BVLA 3RC8A 2LM9A 3FXEB 3UUNA 1FMVA 4IGUA 4O4JE 3VKGA 2E9XB 4CXXA 4E7ZA 2ZM2A 1OWAA 2KWIB 3ZC0A 4O4LE 4EYYR 1Z0PA 2EHOD 5JR9A 1VRBA 3LJCA 5A1LA 3F57A 4AI6A 2C5IT 3RRWA 5F3JA 1KK7A 2J1DG 2K48A 2Z6EA 3ETVA 4H63H 4DNDA 1IJ6A 4UIGA 3AAAB 4JUYA 5J2TE 3KV5A 1HG5A 2K9AA 3KBTA 4ZHQE 3N5LA 1ZHCA 3ETUA 1G73A 5EZYE 2N9DA 4UELA 4AKIA 5LGTB 2LOPA 1MIVA 2CLYC 2LT3A 3ZCJA 2M67A 4DBRA 5JREA 4GIWA 5FYMA 2KXPB 3J9X1 4O2AE 4XAXB 2JPFA 4CI2B 2NW7A 2WAUA 2UXXB 3C4XA 3ZMTB 2ODUA 2Q9QD 3EDVA 3CX7B 2CXLA 2RP4A 5M4YA 2LOSA 5IHYA 3WI3A 2LEHA 2VKJA 1D1BA 2CE7A 1D0ZA 2CEAA 2MOZA 2JQQA 2X9WA 3HR0A 4M1PA 3ZN0B 2PFVA 3BK9A 3P7IA 2C5JA 2G0UA 4HKAA 3HA4A 2XAFB 5FXXA 3MACA 3FB2A 1HF8A 3CQCB 3KBUA 3SWHA 3H3AA 1WR6A 2Y48B 5JRCA 2Y6XA 3K3OA 4Z8XA 3UFEA 2MYSA 2WMOA 3AA0B 1LVKA 3CX8B 1BR0A 2V7IA 1UX4A 3PDYA 2E9XC 3VHLA 4PFOA 3ZYKA 4AKRB 2ZM0A 2X68A 2HPLA 2YINA 2XHEB 3Q2MA 4EZ4A 2H3RA 1HX8A 4IE5A 3FHNA 1FMWA 4NUUA 3SRZA 2CWOA 4EAHA 3GN5A 5FY0A 2KWHA 2IC6A 4GYSA 2W00A 5HYAA 1BR1A 3N9PA 4ISTA 3CMLA 4OYJA 1YKHB 3KINB 3T8OA 2D5UA 4HTEA 1WLXA 4EB6E 2VASA 2KLQA 3UT5E 4O4IE 5HAXA 4BJMA 4QHOA 5F8PA 2H7VC 1Y64B 4DMVA 2L3LA 3N9QA 3O1HA 1D0YA 3A5XA 4KMCA 4YFSA 2CCQA 3KV6A 3Q5WA 4ZS3A 3HKEE 3RYFE 1D0XA 3EVYA 3RC3A 3KFWX 3RH3A 1KNZA 3N9NA 3IEEA 3PTRB 3GA8A 3LK42 2LSYA 4DVDA 3PURA 2D0TA 3I1AA 5DQWA 4TN7B 3RKOA 4IE0A 2VL8A 3U78A 2H7OA 4PAGA 4IE4A 4U72A 4CI3B 3KDSE 4P0BA 4DO0A 3CVRA 3NRXA 2E9XA 4OFZA 4PJMA 4ANJA 3EDUA 1WYCA 2W62A 3O1IA 3IF8B 3OYZA 3OBVE 5JDLA 3VKHA 2N1GA 4WBOA 4I50E 5E0OA 4EZHA 2X66A 1NAFA 2WMNA 3C51A 3CX6B 3PUSA 1O3XA 5L3DB 4G63A 3UUXB 1ZKEA 4ILUA 4QX8B 5HXRA 3ANWB 4UEMA 4TX5A 2VB6A 4UVBB 3S4UA 4PW8A 4PK5A 4HE8A 1MIYA 4QXCB 4QX7B 4TV8E 3CQXC 2NOXA 3V5SA 3AA6B 3D0TA 3UTKA 2XUEA 2VWAA 1HFAA 1VOMA 3MJXA 2VK9A 5FXZA 4UV8B 2BDEA 3R6NA 4B6XA 2BZBA 5FY7A 2WSSV 3AAEB 2V7JA 1H7CA 4MFRA 2YU1A 3PU3A 2IC9A 5L3EB 1G8XA 3N9OA 2LJLA 2XAGB 4X1YE 3TKLB 3Q5XA 4UVCB 5LP6E 2B1EA 2MTQA 2LSKA 2PJQA 1MIWA 4MBQA 1MMAA 2CWYA 3ZC1A 1SA0E 1WRDA 4IDZA 4UV9B 5JDQA 2A3DA 4O2BE 4U74A 3WAJA 1NWMX 3QC9A 2DWGA 4AXPA 3ESLA 1MNEA 3KVAA 4JEUB 1YKEB 2YU2A 2NTYA 1V9DA 3ZJ1A 3C98B 5CA0E 1LRZA 3QUJA 1BR2A 3AB3B 3CPZA 3ZPOA 5JDMA 1HTJF 1QUUA 1FEWA 5LJMA 4CI1B 3LBXA 5JR9B 4PK4A 4GK0E 5LCYA 2WBLA 4CQIA 1T98A 2LSJA 4CXWA 5AFUL 3IBPA 3KVBA 3J7Yq 3F31A 5JDFA 3CWZB 4DMWA 3HKBE 4QWNB 5LYJE 2DCFA 2X51A 4F6RC 5FMNA 2LSIA 1FIOA 1S35A 4H9NC 3RRCA 5FXVA 3I9WA 4HGAA 3O4XE 2LHRA 2V7MA 3C64A 3ZCIA 3RYCE 5JH7E 5J1GA 2XAHB 4PFPA 5FXWA 5KMGP 4GK5E 2V7LA 4L0RA 5FNVE 3BQIA 5LHIB 4H9RC 3LFMA 4K0UA 5C8YE 4P0AA 3PUAA 5DJQC 1QSDA 4ASKA 4PJNA 4BAYB 2E9XD 1ZEEA 2DI4A 1E1HB 3B13A 4HEAA 4L9IA 2CM0A 4YHJA 5CB4E 4WBNE 5ADXL 3AVRA 2EHOB 3MKDA 5L3FB 1HCIA 5L3CB 3BQLA 5LA6E 1U4QA 2L9QA 4EYUA 4TV9E 2WM9A 4AKGA 5H6RB 3AAIA 1SHZC 2XAJB 2VKOA 4I4TE 2XU0A 3WAKA 4FI5A 2ZLYA 5LJNA 2NW8A 3ZMSB 4EOZB 3RYIE 4H9SE 5JRCB 5LGNB 3QK6A 2KZ7B 4EXTA 2JMKA 4OHFA 2PBIA 4IE7A 2VKDA 2V7KA 4IIJE 4ZI2C 3V5UA 4IE6A 4YLHA 2GK9A 2ZM8A 2Q9QB 3L09A 2CLYB 3E0ZA 3PE0A 2LSGA 5GONE 3U3IA 4ZI2D 4O4HE 4AKLA 3UUMA 3RYHE 1MMGA 2ODVA 2ACXA 3ZMZB 2K5BB 3MXZA 3MK7C 4WW0A 5L3BB 4PJJA 3OYXA 3HI2A 2LHNA 4MALA 3ZMVB 2WWUA 2IW5B 4QXHB 3NZQA 5JVDE 4ADZA 5IYZE 1X79A 3M65A 3I0OA 3KV4A 3ZJ2A 4X20E 3FBZA 4CZZB 4UVAB 2UXNB 2YK0A 3ZYLA 5JDNA 5DQVA 5LHHB 4AQFC 3GMIA 2KINB 1OXZA 3C4WA 3VU7H 3C50A 4I55E 1YW0A 2BVMA 3ZMUB 4X1IE 1UX5A 2X9HA 5EK4A 4AQGA 4HN9A 3AA1B 2EHOC 3ZLIA 4IHJE 2I59A 1WYBA 3AVSA 2IAKA 3LK2B 3NBXX 3N2KE 5HXSA 2A2FX 4QXBB 5HXCA 1U5PA 5LGUB 4BJNA 2C0SA 1MMDA 4PJLA 4X1KE 4FJOA 3FXDB 3K3NA 4UF0B 4I43B 2DLRA 4NUVA 4V1Av 5LG4A 3DP7A 5DABA 2ZMAA 2OA5A 2XQYA 2MBGA 2X9XA 2X9YA 4TUYE 3DTOA 3PUQA 4H9OC 2KNDA 3N9MA 5HXEA 4ERRA 4HFVA 4MLKA 3C4ZA 4YJ2E 2W61A 3ZN1B 3KV9A 4BA9A 5HWYA 5HXHA 1BR4A 1EZ3A 2Q9QC 5JDHA 2JRKA 4XBFB 3N2OA 3HKCE 1HS7A 3UULA 3IHRA 2L8KA 2KMFA 3ONXA 2KT9A 1IJ5A 3LK3B 5L2LA 2X67A 1CUNA 5L3GB 4GYRA 3MA9A 4A56A 3BQKA 4AQFA 3CKDA 2NW9A 3HL6A 1S94A 1UCUA 4N78D 3H37A 3ZEFB 3GWHA 2CMRA 1D1AA 3RPUA 2NP9A 2CXFA 4J2CA 2W0GA 2EHOA 1ZV4X 5KX5E 2ES0A 4XZCA 1B7TA 2K24A 4O8SA 2VKHA 5EK3A 2XAQB 2JJ9A 3O9XA 3N9LA 3RX6A 3JC6C 1YD8G 3K3QC 4MHCA 2XTLA 2X0LB 3DJBA 3E22E 1LKXA 4DBQA 3I0QA 1AJ3A 4ZI3C 5LBQB 3AA7B 3LBXB 4WNKA 1US7B 3SOLA 4PK6A 5LBMA 2V1DB 3JC6D 2DNXA 3O1JA 3NRYA 2HH7A 3LG7A 3MZKB 4YJ3E 4ZI3D 5ETWA 3ZYMA 1HG2A 5BMVE 2SPCA 2NTXA 2Q9QA 4GOUA 3L3PA 4ISSA 2A72A 2LE8A 5EK2A 2D2SA 5LHGB 3HKDE 4JEHB 1IAPA 3Q9DA 2CXDA 2QGSA 4H9QC 5J2UE 4ZI7E 5CA1E 4JLEA 4C91A 3NZPA 5FY1A 3ANWA 3SS1A 4ZOLE 1IZNB 5JR9C 3FBLA 4CXYA 4PNIA 3I9YA 5LXTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CML A;  2YK0 A;  2XU0 A;  2Y8D A;  3BQL A;  4NUU A;  5F3J A;  4YFS A;  3CPZ A;  3RRC A;  2WAU A;  4NUV A;  3BQI A;  3C64 A;  3BQK A; 
#chains in the Genus database with same CATH topology
 2HHH T;  4F52 A;  2D0U A;  4KP3 C;  3ONJ A;  4AKH A;  2DHR A;  3N2G E;  2NWB A;  3F2E A;  1X9B A;  3B57 A;  4F8H A;  4TZ4 C;  5FP3 A;  1N33 T;  2K3W A;  1KNR A;  5LOV E;  1OED A;  5JQG E;  4UXN B;  2JMH A;  4UF0 A;  4ZS2 A;  2BG9 B;  4KBM B;  4OYK A;  3PJA J;  3CQG B;  4C90 A;  3AE9 A;  4YSZ A;  5TAO A;  3UUN A;  3FXE B;  1FMV A;  3T1Y T;  2WU2 A;  5HEJ A;  1Z0P A;  5JR9 A;  4YSY A;  5BR8 T;  4H63 H;  4JUY A;  3KV5 A;  1HG5 A;  3KBT A;  3N5L A;  5EZY E;  2N9D A;  2WZK A;  4DR2 T;  2M67 A;  2KXP B;  4O2A E;  4B3M T;  3C4X A;  2CXL A;  2RP4 A;  2LEH A;  2VKJ A;  1N32 T;  4LF8 T;  1D1B A;  3VRA A;  2CEA A;  1YQ4 A;  2JQQ A;  1IBK T;  1UUR A;  5HEU A;  4HKA A;  3AE1 A;  3MAC A;  3KBU A;  2CRB A;  4Z8X A;  3UFE A;  3OPC A;  4UR9 A;  1BR0 A;  1OED C;  4GKK T;  4DUZ T;  4PFO A;  5ABH A;  2XHE B;  3VR9 A;  3FHN A;  1KEY A;  4GYS A;  4IDP A;  2W00 A;  2WDV A;  3N9P A;  3CML A;  3T8O A;  2D5U A;  4ILB A;  4HWI B;  4BJM A;  1Y64 B;  2BBH A;  3RIA A;  3EHZ A;  3O1H A;  4TNV A;  1N36 T;  4HFB A;  4ZS3 A;  4DID B;  3RYF E;  3RC3 A;  3KFW X;  3N9N A;  3GA8 A;  3LK4 2;  3Q5D A;  2F4V T;  3I1A A;  4TN7 B;  3RKO A;  4IE0 A;  3U78 A;  2H7O A;  4PAG A;  4IE4 A;  4P0B A;  2DL1 A;  2ZM6 T;  3EDU A;  2W62 A;  3OYZ A;  3OBV E;  4JI6 T;  4WBO A;  2X66 A;  2WWV A;  3ONL C;  4HFC A;  4UEM A;  4PW8 A;  3UQ7 A;  1MIY A;  3ZST A;  3UTK A;  4WYV A;  5FXZ A;  4P5O A;  2WSS V;  2AE9 A;  2YU1 A;  1G8X A;  4X1Y E;  4IRE A;  2MTQ A;  2LSK A;  2PJQ A;  4X65 T;  2CWY A;  3B5M A;  3ZC1 A;  4DUY T;  1SA0 E;  4U74 A;  3QC9 A;  2DWG A;  5J0Z A;  3KVA A;  2JIW A;  1YKE B;  1W9R A;  5CA0 E;  1LRZ A;  3AB3 B;  1QUU A;  5JR9 B;  4PK4 A;  4GK0 E;  2WBL A;  2LSJ A;  2W4X A;  3CWZ B;  4LFB T;  2IDO B;  2MAW A;  3HKB E;  4F6R C;  2LSI A;  1FIO A;  3P4S A;  1S35 A;  1NEN A;  4HGA A;  1U6G A;  2XAH B;  4PFP A;  4L0R A;  3LFM A;  4K0U A;  1QSD A;  2WQY A;  4YHJ A;  5CB4 E;  2EHO B;  1HCI A;  1T8B A;  5L3C B;  1LDK A;  4HWD A;  3BQL A;  5LA6 E;  2L9Q A;  4TV9 E;  3AAI A;  3WAK A;  2BKN A;  2ZLY A;  4HWC A;  2NR4 A;  5LG3 A;  4EXT A;  2LKG A;  4CN4 A;  4IIJ E;  2UUC T;  3V5U A;  5F5W A;  4YLH A;  3AE5 A;  2I0M A;  3ZT7 A;  3P50 A;  2Q9Q B;  3L09 A;  2CLY B;  4WQO D;  5GON E;  4Z90 A;  4O4H E;  3RYH E;  5L4H A;  5AQV B;  2LLY A;  3OYX A;  3HI2 A;  2IW5 B;  4DR4 T;  1X79 A;  2LM2 A;  4Z91 A;  3FBZ A;  3RIF A;  2YK0 A;  5AQN B;  2BS2 A;  4AQF C;  2X9H A;  2I59 A;  1WYB A;  3LK2 B;  4WZX A;  2BS3 A;  1U5P A;  1XWM A;  4X1K E;  4LFA T;  4U31 A;  2JQH A;  3DP7 A;  2OA5 A;  2XQY A;  2YN6 A;  4TUY E;  4N9F 3;  2KND A;  3C4Z A;  1VCS A;  1L0V A;  1EZ3 A;  1GQE A;  5JDH A;  4JI8 T;  2XY8 B;  3NKZ A;  3EAB A;  3ZEF B;  2CMR A;  2YKS A;  1D1A A;  4J2C A;  1ZV4 X;  5KX5 E;  5IUX A;  2VKH A;  1YD8 G;  3RHW A;  3DJB A;  4DBQ A;  3I0Q A;  4ZI3 C;  5LBQ B;  1US7 B;  3SOL A;  3QNU A;  2HH7 A;  3MZK B;  5C3J A;  3ZYM A;  5BMV E;  4ISS A;  2A72 A;  3AEB A;  2LE8 A;  2H89 A;  1IAP A;  5J2U E;  3RF1 A;  1YQ3 A;  4Q25 A;  5FY1 A;  3ANW A;  1XDO A;  4AQY T;  3I9Y A;  3P8C D;  3PU8 A;  4DV6 T;  2X0Y A;  4QKN A;  4EED A;  1LDK B;  4L5G A;  4H9P C;  3W15 B;  4EIW A;  4IDN A;  5HWX A;  1MMN A;  2FJD A;  2P9B A;  3OKQ A;  4DR1 T;  1XNQ T;  4TWD A;  2FBW A;  3AE4 A;  2QVA A;  4DR6 T;  5ABF A;  4EGW A;  2V6Y A;  1MND A;  2BVL A;  1IBM T;  1J1J A;  4JI4 T;  2E9X B;  3DQV C;  2ZM2 A;  1OWA A;  2KWI B;  3ZC0 A;  3CIR A;  2EHO D;  1OED E;  5A1L A;  2CHN A;  2C5I T;  1KK7 A;  3H3M A;  1Z8U A;  2V6X A;  2YOE A;  4ZHQ E;  4B3T T;  3ABV A;  4YTP A;  3ETU A;  4UEL A;  3P4Q A;  5JRE A;  4DBR A;  5FL1 A;  3J9X 1;  3L8R A;  4CI2 B;  2UXX B;  2Q9Q D;  2VUR A;  4AP2 B;  4JI7 T;  1D0Z A;  3HR0 A;  3ZN0 B;  4KHZ F;  3P7I A;  2LRK A;  3CQC B;  3H3A A;  1WR6 A;  2BG9 C;  5JRC A;  2Y6X A;  2WMO A;  3IA3 A;  5IWA T;  5FKY A;  4U2Y A;  3CX8 B;  1UX4 A;  2V7I A;  2ZM0 A;  3NVO A;  3UQ4 A;  2X68 A;  2HPL A;  3Q2M A;  1UGO A;  1FJG T;  4IE5 A;  5AQT B;  3UU8 A;  3GN5 A;  2IC6 A;  4ZEY A;  5HYA A;  4IST A;  3UT5 E;  2KLQ A;  5HAX A;  3AE3 A;  5JTG A;  3N9Q A;  1R8I A;  1D0Y A;  3A5X A;  1J5W A;  3HKE E;  1D0X A;  4X66 T;  2FJB A;  3AE7 A;  2LSY A;  3PUR A;  2D0T A;  5DQW A;  3P4P A;  2VQE T;  4ILA A;  3CVR A;  4PJM A;  3O1I A;  5E0O A;  4EZH A;  2WMN A;  3CX6 B;  1ZKE A;  4ILU A;  4QX8 B;  3UU3 A;  3ANW B;  3Q5E A;  4UVB B;  3S4U A;  5CFB A;  4PK5 A;  4QXC B;  2D9D A;  3V5S A;  2BKP A;  2WS3 A;  3RIU A;  1YXR A;  3MJX A;  2VK9 A;  2KSR A;  1NEK A;  5FVL A;  2V7J A;  1H7C A;  2LJL A;  4UVC B;  5LP6 E;  1HR0 T;  4CN1 A;  1MIW A;  1MMA A;  1WRD A;  4YHH T;  2A3D A;  5ABF B;  4LF6 T;  3UFG A;  3WAJ A;  4YTN A;  2NTY A;  3C98 B;  1BR2 A;  4JGH D;  2WP9 A;  1HTJ F;  5LJM A;  3LBX A;  5LCY A;  2WDR A;  4AIS A;  4HFD A;  5AFU L;  3IBP A;  3F31 A;  5JDF A;  3AE2 A;  5LYJ E;  2DCF A;  4TNW A;  1SE7 A;  3I9W A;  2LHR A;  3C64 A;  4ZXL A;  3AEF A;  4KX6 A;  4GK5 E;  2V7L A;  4NXM T;  3BQI A;  3A8Y C;  5LHI B;  4H9R C;  2YDR A;  2E9X D;  3B13 A;  4L9I A;  3QOF A;  3MKD A;  1SHZ C;  4I4T E;  2XU0 A;  4FI5 A;  3TLW A;  3RIU C;  3ZMS B;  4EOZ B;  5JRC B;  3QK6 A;  1XZY A;  4IE7 A;  2VKD A;  2V7K A;  4YY3 T;  3QB5 K;  1VCT A;  3RLF F;  3U3I A;  1JNZ A;  2WCA A;  4ZI2 D;  4AKL A;  3TLV A;  2PTF A;  3UUM A;  1MMG A;  3MXZ A;  2BBJ A;  3MK7 C;  3VR8 A;  4YXD A;  5L3B B;  4PJJ A;  5FL0 A;  4MAL A;  3NZQ A;  2XM2 A;  4APF B;  4X20 E;  4CZZ B;  4ZZC A;  3GMI A;  2KIN B;  1OXZ A;  3C4W A;  4QH4 A;  2BVM A;  4X1I E;  5EK4 A;  5CJ5 A;  2EHO C;  3M3Z B;  3ZLI A;  4IHJ E;  1OED B;  3N2K E;  2A2F X;  3AXJ A;  4IDO A;  2C0S A;  5AQK B;  4UF0 B;  3LDQ B;  2DLR A;  4I43 B;  2ZMA A;  1ZOY A;  3DTO A;  3PUQ A;  4H9O C;  3N9M A;  5HXE A;  2XQ9 A;  4ERR A;  4YJ2 E;  2W61 A;  2Q9Q C;  3HKC E;  1HS7 A;  3IHR A;  2KMF A;  2KT9 A;  2X67 A;  2UU9 T;  1HNZ T;  1QLB A;  4GYR A;  3MA9 A;  4A56 A;  4AQF A;  3CKD A;  1M62 A;  3H37 A;  1IBL T;  2W0G A;  4A98 A;  1B7T A;  2K24 A;  2W2U A;  4DV5 T;  2JJ9 A;  2H88 A;  3RX6 A;  3K3Q C;  4MHC A;  2XTL A;  3E22 E;  3LBX B;  4WNK A;  4JYA T;  2V1D B;  3JC6 D;  2DNX A;  2UXD T;  3O1J A;  4EEB A;  1Y01 A;  3P4R A;  2UUB T;  2SPC A;  4GOU A;  3OVU A;  2E5V A;  3JCF A;  2HN1 A;  2D2S A;  3Q9D A;  2CXD A;  3L39 A;  3OTO T;  5HCJ A;  1KFY A;  5CA1 E;  4C91 A;  3FZH B;  4PNI A;  2XQ6 A;  2QA7 A;  4A97 A;  3R84 B;  4YTM A;  2C5K T;  2XQ5 A;  5L47 A;  3PUG A;  2PG8 A;  4H63 V;  5KDM C;  2XAS B;  2CHO A;  2E8I A;  3EUH A;  4E7S A;  2RA1 A;  3CK6 A;  2DWK A;  1ZP0 A;  2N2N A;  2BG9 E;  3RC8 A;  3VKG A;  4O4J E;  4CXX A;  2JQK A;  5AQO B;  1VRB A;  3LJC A;  1T72 A;  2WZH A;  5F3J A;  2J1D G;  3AAA B;  4LF4 T;  5AQI B;  5LGT B;  2LOP A;  1MIV A;  2LT3 A;  4GIW A;  5FYM A;  4LFC T;  4LMK A;  2WAU A;  2VQF T;  3ZMT B;  2ODU A;  4LF9 T;  3AE8 A;  5IHY A;  3AXJ B;  4LF5 T;  2MOZ A;  2X9W A;  2PFV A;  2C5J A;  2G0U A;  4JI0 T;  3HA4 A;  1HNW T;  3FB2 A;  3SWH A;  2LKH A;  3K3O A;  4COF A;  4U33 A;  2V8S V;  1LVK A;  3AA0 B;  5AQM B;  3PDY A;  2E9X C;  3VHL A;  4KI0 F;  5HEO A;  2XQ7 A;  4TWF A;  3RGL A;  1XNR T;  4EZ4 A;  1FMW A;  4NUU A;  3SFE A;  3SRZ A;  1WR0 A;  3PUV F;  2CPT A;  3P4W A;  4OYJ A;  1YKH B;  3KIN B;  2R6G F;  4HTE A;  3AEE A;  2VAS A;  2QYW A;  4QHO A;  5F8P A;  2H7V C;  4DMV A;  4IL4 A;  1T7S A;  4B3S T;  4KMC A;  4YFS A;  2CCQ A;  3ZT6 A;  1KNZ A;  3RH3 A;  3PTR B;  3PUZ F;  2BG9 A;  1W09 A;  2VL8 A;  2W66 A;  3KDS E;  4DO0 A;  3NRX A;  4OFZ A;  1WYC A;  5JDL A;  3IF8 B;  2N1G A;  2XQ4 A;  3C51 A;  1O3X A;  3EAM A;  4U3C A;  1WCR A;  5HXR A;  4TX5 A;  2VB6 A;  4HE8 A;  3ZSS A;  4YT0 A;  5C2T A;  3UU4 A;  3UUB A;  2VWA A;  5AQJ B;  1VOM A;  5LB7 B;  3X1D A;  2AXD S;  2XZE A;  3R6N A;  4B6X A;  2BZB A;  2X0H A;  3AAE B;  4MFR A;  5L3E B;  3N9O A;  3T1H T;  3TKL B;  3Q5X A;  2B1E A;  4LMJ A;  4IDZ A;  1XDP A;  4I0U A;  4ZZB A;  3ESL A;  1V9D A;  3QUJ A;  2VVS A;  2BS4 A;  1FEW A;  4A5X A;  4LF7 T;  3AE6 A;  3KVB A;  3PV0 F;  3J7Y q;  4DMW A;  2X51 A;  5FMN A;  5FXV A;  2WDQ A;  2E5L T;  5KXJ A;  5JH7 E;  5FXW A;  5KMG P;  3AED A;  4P0A A;  3PUA A;  5DJQ C;  4QH1 A;  5LMN T;  4ASK A;  4PJN A;  4BAY B;  1ZEE A;  2DI4 A;  1E1H B;  4HEA A;  2CM0 A;  3AVR A;  5FVK A;  1U4Q A;  4EYU A;  4AKG A;  4AIU A;  4A64 A;  4QH5 A;  5LJN A;  4JI1 T;  4NIQ A;  3RYI E;  4HWH A;  2KZ7 B;  2JMK A;  4OHF A;  1CHU A;  2M6B A;  4X62 T;  4JI3 T;  4IE6 A;  3PE0 A;  2LSG A;  2LRL A;  5AQF B;  2ODV A;  3ZMZ B;  2K5B B;  5AQL B;  5AQP B;  2YDS A;  3ZMV B;  2WWU A;  5JVD E;  4ADZ A;  5IYZ E;  1WFD A;  3I0O A;  4DV7 T;  3VRB A;  4NXN T;  4X64 T;  1W0A A;  5JDN A;  4ILC A;  3VU7 H;  4I55 E;  1YW0 A;  3ZMU B;  4AQG A;  3AA1 B;  4IDQ A;  2VVN A;  2FJE A;  2IAK A;  5HXS A;  1E7P A;  4QXB B;  5LGU B;  4BJN A;  1MMD A;  4PJL A;  3K3N A;  3JAF A;  4NUV A;  4V1A v;  5DAB A;  2V6Y B;  1XMO T;  4DV4 T;  3ZN1 B;  1J5E T;  4BA9 A;  5HXH A;  3FZK B;  4XBF B;  3UUL A;  2L8K A;  3ONX A;  1IJ5 A;  1HNX T;  1CUN A;  2CBI A;  1S94 A;  3HL6 A;  4N78 D;  4DV1 T;  3GWH A;  3TLT A;  2EHO A;  3EI0 A;  5CGM A;  2UXC T;  4TWH A;  2YDQ A;  4O8S A;  3K1S A;  5EK3 A;  4JI5 T;  3O9X A;  3N9L A;  2VL0 A;  2RPA A;  1LKX A;  2XM1 A;  4DV0 T;  3AA7 B;  2XQ8 A;  4PK6 A;  5LBM A;  3UU5 A;  3FZL B;  2B76 A;  4YJ3 E;  4ZI3 D;  5ETW A;  2NTX A;  2Q9Q A;  3JAD A;  3L3P A;  3RQW A;  4JEH B;  2QGS A;  4H9Q C;  4NPP A;  4ZI7 E;  5L4E A;  4JLE A;  3NZP A;  5HCM A;  4JV5 T;  1IZN B;  3ZT5 A;  5JR9 C;  3FBL A;  2CA5 A;  5LMU T;  2YEV C;  2XSA A;  2W63 A;  3GN5 B;  3K8P C;  1LVF A;  2HPJ A;  2V26 A;  2Y8D A;  2I6H A;  5H6Q B;  5LNK A;  4G2A A;  3E08 A;  1XMQ T;  2J62 A;  1KF6 A;  3OJA A;  5JDG A;  3JAE A;  3RKG A;  3UU6 A;  1N34 T;  3PJA A;  4P09 A;  2UXB T;  1D1C A;  4OK0 A;  2CBJ A;  4KUM B;  2LM9 A;  4IGU A;  4IT4 A;  2IML A;  4E7Z A;  4O4L E;  4EYY R;  3F57 A;  4U2Z A;  5HEH A;  4IL9 A;  3RRW A;  4AI6 A;  2K48 A;  2Z6E A;  3ETV A;  4B3R T;  4DND A;  1IJ6 A;  4UIG A;  4U7I A;  5J2T E;  3QB5 A;  2K9A A;  3LSV A;  1ZHC A;  1G73 A;  4AKI A;  2CLY C;  3ZCJ A;  4XAX B;  1W0B A;  2JPF A;  2NW7 A;  3EDV A;  3CX7 B;  5M4Y A;  2LOS A;  2XJ7 A;  3WI3 A;  2CE7 A;  4M1P A;  4JBW F;  3BK9 A;  4U7Y A;  1SUM B;  5HEG A;  2XAF B;  2E2A A;  5FXX A;  1HF8 A;  2Y48 B;  2MYS A;  2WB5 A;  3ZYK A;  4AKR B;  4EV6 A;  2YIN A;  3DPL C;  2H3R A;  1HX8 A;  1DU2 A;  4P1N A;  2CWO A;  4EAH A;  2WU5 A;  5FY0 A;  2KWH A;  2BKO A;  1BR1 A;  2OLT A;  1WLX A;  4EB6 E;  3SFD A;  4O4I E;  2L3L A;  2FJA A;  1HX1 B;  3KV6 A;  3Q5W A;  4DR5 T;  4HFE A;  3EVY A;  3IEE A;  4DVD A;  2XSB A;  4CN6 A;  4U72 A;  4CI3 B;  5AQS B;  2E9X A;  4ANJ A;  3VKH A;  4I50 E;  1NAF A;  1M7K A;  5L3D B;  3PUS A;  4G63 A;  3UUX B;  2J47 A;  2HN2 A;  4DV3 T;  4JI2 T;  2IUB A;  4TV8 E;  3PUW F;  4QX7 B;  3CQX C;  2QRX A;  2NOX A;  3AA6 B;  3D0T A;  2WZI A;  2XUE A;  1HFA A;  4UV8 B;  2BDE A;  5FY7 A;  3AEA A;  3PU3 A;  2IC9 A;  2XAG B;  4DR7 T;  4MBQ A;  4LML A;  4UV9 B;  5JDQ A;  4X5T A;  4O2B E;  1NWM X;  4AXP A;  1MNE A;  4JEU B;  2YU2 A;  3ZJ1 A;  3TLS A;  3CPZ A;  3ZPO A;  5JDM A;  4CI1 B;  4CQI A;  2A9U A;  1T98 A;  4HXI B;  4CXW A;  4HFH A;  4HWF A;  4QWN B;  4H9N C;  3RRC A;  4K0K T;  3O4X E;  2V7M A;  3ZCI A;  3RYC E;  5J1G A;  5FNV E;  5C8Y E;  1I6Z A;  2V5D A;  2OV9 A;  4WBN E;  5ADX L;  4OX9 T;  5AQH B;  5L3F B;  2W67 A;  2WM9 A;  5H6R B;  5AQQ B;  2XAJ B;  2VKO A;  4DV2 T;  3FZM B;  3RTR A;  2NW8 A;  2IHR 1;  4H9S E;  3AEC A;  5LGN B;  2PBI A;  4GKJ T;  3TLU A;  4ZI2 C;  2V5C A;  2GK9 A;  2ZM8 A;  3E0Z A;  1LDJ A;  2ACX A;  4WW0 A;  2M6I A;  2LHN A;  4QXH B;  1I94 T;  1KNP A;  4HFI A;  3G06 A;  3M65 A;  5ABG A;  3KV4 A;  3ZJ2 A;  4UVA B;  2UXN B;  3AEG A;  3ZYL A;  5DQV A;  5LHH B;  5ABE A;  1E2A A;  3C50 A;  5AQR B;  1UX5 A;  4HN9 A;  3AVS A;  3NBX X;  5HXC A;  4FJO A;  1UUS A;  3FXD B;  5LG4 A;  3PUY F;  2MBG A;  2X9X A;  2X9Y A;  4HFV A;  4MLK A;  1UK5 A;  3KV9 A;  2XPK A;  5HWY A;  1BR4 A;  2FUP A;  2JRK A;  3N2O A;  1JNR A;  3LK3 B;  2MPK A;  5L2L A;  5L3G B;  3BQK A;  2NW9 A;  1UCU A;  3NWI A;  5AQG B;  2NP9 A;  3RPU A;  2CXF A;  3RQU A;  3RI5 A;  2ES0 A;  4XZC A;  5AQU B;  2XAQ B;  2XQA A;  3JC6 C;  2X0L B;  1AJ3 A;  2UUA T;  2XQ3 A;  2JQ9 A;  2IIU A;  3NRY A;  2ACZ A;  3LG7 A;  3PUX F;  1HG2 A;  3FZF B;  4DR3 T;  5EK2 A;  5LHG B;  3HKD E;  2WY2 A;  3ZKR A;  3A7M A;  4KHP T;  3SS1 A;  4YSX A;  4ZOL E;  4CXY A;  2J4G A;  5LXT E; 
#chains in the Genus database with same CATH homology
 2CA5 A;  3P8C D;  2QA7 A;  2D0U A;  4KP3 C;  3PU8 A;  3R84 B;  2YEV C;  2W63 A;  3GN5 B;  4AKH A;  2DHR A;  3K8P C;  1LVF A;  4QKN A;  2HPJ A;  2NWB A;  2C5K T;  3N2G E;  2V26 A;  4L5G A;  4H9P C;  3F2E A;  3W15 B;  4EIW A;  5HWX A;  2Y8D A;  3B57 A;  4TZ4 C;  1MMN A;  5FP3 A;  5H6Q B;  5LNK A;  2P9B A;  5LOV E;  3OKQ A;  5JQG E;  4G2A A;  4UXN B;  3E08 A;  3PUG A;  2PG8 A;  3OJA A;  5JDG A;  2JMH A;  4H63 V;  5KDM C;  4UF0 A;  4ZS2 A;  2XAS B;  2E8I A;  3EUH A;  4KBM B;  4OYK A;  3CQG B;  4C90 A;  4P09 A;  4E7S A;  1D1C A;  2RA1 A;  4OK0 A;  2DWK A;  5TAO A;  2N2N A;  4KUM B;  1MND A;  2BVL A;  3RC8 A;  2LM9 A;  3FXE B;  3UUN A;  1FMV A;  4IGU A;  4O4J E;  3VKG A;  2E9X B;  4CXX A;  4E7Z A;  2ZM2 A;  1OWA A;  2KWI B;  3ZC0 A;  4O4L E;  4EYY R;  1Z0P A;  2EHO D;  5JR9 A;  1VRB A;  3LJC A;  5A1L A;  3F57 A;  4AI6 A;  2C5I T;  3RRW A;  5F3J A;  1KK7 A;  2J1D G;  2K48 A;  2Z6E A;  3ETV A;  4H63 H;  4DND A;  1IJ6 A;  4UIG A;  3AAA B;  4JUY A;  5J2T E;  3KV5 A;  1HG5 A;  2K9A A;  3KBT A;  4ZHQ E;  3N5L A;  1ZHC A;  3ETU A;  1G73 A;  5EZY E;  2N9D A;  4UEL A;  4AKI A;  5LGT B;  2LOP A;  1MIV A;  2CLY C;  2LT3 A;  3ZCJ A;  2M67 A;  4DBR A;  5JRE A;  4GIW A;  5FYM A;  2KXP B;  3J9X 1;  4O2A E;  4XAX B;  2JPF A;  4CI2 B;  2NW7 A;  2WAU A;  2UXX B;  3C4X A;  3ZMT B;  2ODU A;  2Q9Q D;  3EDV A;  3CX7 B;  2CXL A;  2RP4 A;  5M4Y A;  2LOS A;  5IHY A;  3WI3 A;  2LEH A;  2VKJ A;  1D1B A;  2CE7 A;  1D0Z A;  2CEA A;  2MOZ A;  2JQQ A;  2X9W A;  3HR0 A;  4M1P A;  3ZN0 B;  2PFV A;  3BK9 A;  3P7I A;  2C5J A;  2G0U A;  4HKA A;  3HA4 A;  2XAF B;  5FXX A;  3MAC A;  3FB2 A;  1HF8 A;  3CQC B;  3KBU A;  3SWH A;  3H3A A;  1WR6 A;  2Y48 B;  5JRC A;  2Y6X A;  3K3O A;  4Z8X A;  3UFE A;  2MYS A;  2WMO A;  3AA0 B;  1LVK A;  3CX8 B;  1BR0 A;  2V7I A;  1UX4 A;  3PDY A;  2E9X C;  3VHL A;  4PFO A;  3ZYK A;  4AKR B;  2ZM0 A;  2X68 A;  2HPL A;  2YIN A;  2XHE B;  3Q2M A;  4EZ4 A;  2H3R A;  1HX8 A;  4IE5 A;  3FHN A;  1FMW A;  4NUU A;  3SRZ A;  2CWO A;  4EAH A;  3GN5 A;  5FY0 A;  2KWH A;  2IC6 A;  4GYS A;  2W00 A;  5HYA A;  1BR1 A;  3N9P A;  4IST A;  3CML A;  4OYJ A;  1YKH B;  3KIN B;  3T8O A;  2D5U A;  4HTE A;  1WLX A;  4EB6 E;  2VAS A;  2KLQ A;  3UT5 E;  4O4I E;  5HAX A;  4BJM A;  4QHO A;  5F8P A;  2H7V C;  1Y64 B;  4DMV A;  2L3L A;  3N9Q A;  3O1H A;  1D0Y A;  3A5X A;  4KMC A;  4YFS A;  2CCQ A;  3KV6 A;  3Q5W A;  4ZS3 A;  3HKE E;  3RYF E;  1D0X A;  3EVY A;  3RC3 A;  3KFW X;  3RH3 A;  1KNZ A;  3N9N A;  3IEE A;  3PTR B;  3GA8 A;  3LK4 2;  2LSY A;  4DVD A;  3PUR A;  2D0T A;  3I1A A;  5DQW A;  4TN7 B;  3RKO A;  4IE0 A;  2VL8 A;  3U78 A;  2H7O A;  4PAG A;  4IE4 A;  4U72 A;  4CI3 B;  3KDS E;  4P0B A;  4DO0 A;  3CVR A;  3NRX A;  2E9X A;  4OFZ A;  4PJM A;  4ANJ A;  3EDU A;  1WYC A;  2W62 A;  3O1I A;  3IF8 B;  3OYZ A;  3OBV E;  5JDL A;  3VKH A;  2N1G A;  4WBO A;  4I50 E;  5E0O A;  4EZH A;  2X66 A;  1NAF A;  2WMN A;  3C51 A;  3CX6 B;  3PUS A;  1O3X A;  5L3D B;  4G63 A;  3UUX B;  1ZKE A;  4ILU A;  4QX8 B;  5HXR A;  3ANW B;  4UEM A;  4TX5 A;  2VB6 A;  4UVB B;  3S4U A;  4PW8 A;  4PK5 A;  4HE8 A;  1MIY A;  4QXC B;  4QX7 B;  4TV8 E;  3CQX C;  2NOX A;  3V5S A;  3AA6 B;  3D0T A;  3UTK A;  2XUE A;  2VWA A;  1HFA A;  1VOM A;  3MJX A;  2VK9 A;  5FXZ A;  4UV8 B;  2BDE A;  3R6N A;  4B6X A;  2BZB A;  5FY7 A;  2WSS V;  3AAE B;  2V7J A;  1H7C A;  4MFR A;  2YU1 A;  3PU3 A;  2IC9 A;  5L3E B;  1G8X A;  3N9O A;  2LJL A;  2XAG B;  4X1Y E;  3TKL B;  3Q5X A;  4UVC B;  5LP6 E;  2B1E A;  2MTQ A;  2LSK A;  2PJQ A;  1MIW A;  4MBQ A;  1MMA A;  2CWY A;  3ZC1 A;  1SA0 E;  1WRD A;  4IDZ A;  4UV9 B;  5JDQ A;  2A3D A;  4O2B E;  4U74 A;  3WAJ A;  1NWM X;  3QC9 A;  2DWG A;  4AXP A;  3ESL A;  1MNE A;  3KVA A;  4JEU B;  1YKE B;  2YU2 A;  2NTY A;  1V9D A;  3ZJ1 A;  3C98 B;  5CA0 E;  1LRZ A;  3QUJ A;  1BR2 A;  3AB3 B;  3CPZ A;  3ZPO A;  5JDM A;  1HTJ F;  1QUU A;  1FEW A;  5LJM A;  4CI1 B;  3LBX A;  5JR9 B;  4PK4 A;  4GK0 E;  5LCY A;  2WBL A;  4CQI A;  1T98 A;  2LSJ A;  4CXW A;  5AFU L;  3IBP A;  3KVB A;  3J7Y q;  3F31 A;  5JDF A;  3CWZ B;  4DMW A;  3HKB E;  4QWN B;  5LYJ E;  2DCF A;  2X51 A;  4F6R C;  5FMN A;  2LSI A;  1FIO A;  1S35 A;  4H9N C;  3RRC A;  5FXV A;  3I9W A;  4HGA A;  3O4X E;  2LHR A;  2V7M A;  3C64 A;  3ZCI A;  3RYC E;  5JH7 E;  5J1G A;  2XAH B;  4PFP A;  5FXW A;  5KMG P;  4GK5 E;  2V7L A;  4L0R A;  5FNV E;  3BQI A;  5LHI B;  4H9R C;  3LFM A;  4K0U A;  5C8Y E;  4P0A A;  3PUA A;  5DJQ C;  1QSD A;  4ASK A;  4PJN A;  4BAY B;  2E9X D;  1ZEE A;  2DI4 A;  1E1H B;  3B13 A;  4HEA A;  4L9I A;  2CM0 A;  4YHJ A;  5CB4 E;  4WBN E;  5ADX L;  3AVR A;  2EHO B;  3MKD A;  5L3F B;  1HCI A;  5L3C B;  3BQL A;  5LA6 E;  1U4Q A;  2L9Q A;  4EYU A;  4TV9 E;  2WM9 A;  4AKG A;  5H6R B;  3AAI A;  1SHZ C;  2XAJ B;  2VKO A;  4I4T E;  2XU0 A;  3WAK A;  4FI5 A;  2ZLY A;  5LJN A;  2NW8 A;  3ZMS B;  4EOZ B;  3RYI E;  4H9S E;  5JRC B;  5LGN B;  3QK6 A;  2KZ7 B;  4EXT A;  2JMK A;  4OHF A;  2PBI A;  4IE7 A;  2VKD A;  2V7K A;  4IIJ E;  4ZI2 C;  3V5U A;  4IE6 A;  4YLH A;  2GK9 A;  2ZM8 A;  2Q9Q B;  3L09 A;  2CLY B;  3E0Z A;  3PE0 A;  2LSG A;  5GON E;  3U3I A;  4ZI2 D;  4O4H E;  4AKL A;  3UUM A;  3RYH E;  1MMG A;  2ODV A;  2ACX A;  3ZMZ B;  2K5B B;  3MXZ A;  3MK7 C;  4WW0 A;  5L3B B;  4PJJ A;  3OYX A;  3HI2 A;  2LHN A;  4MAL A;  3ZMV B;  2WWU A;  2IW5 B;  4QXH B;  3NZQ A;  5JVD E;  4ADZ A;  5IYZ E;  1X79 A;  3M65 A;  3I0O A;  3KV4 A;  3ZJ2 A;  4X20 E;  3FBZ A;  4CZZ B;  4UVA B;  2UXN B;  2YK0 A;  3ZYL A;  5JDN A;  5DQV A;  5LHH B;  4AQF C;  3GMI A;  2KIN B;  1OXZ A;  3C4W A;  3VU7 H;  3C50 A;  4I55 E;  1YW0 A;  2BVM A;  3ZMU B;  4X1I E;  1UX5 A;  2X9H A;  5EK4 A;  4AQG A;  4HN9 A;  3AA1 B;  2EHO C;  3ZLI A;  4IHJ E;  2I59 A;  1WYB A;  3AVS A;  2IAK A;  3LK2 B;  3NBX X;  3N2K E;  5HXS A;  2A2F X;  4QXB B;  5HXC A;  1U5P A;  5LGU B;  4BJN A;  2C0S A;  1MMD A;  4PJL A;  4X1K E;  4FJO A;  3FXD B;  3K3N A;  4UF0 B;  4I43 B;  2DLR A;  4NUV A;  4V1A v;  5LG4 A;  3DP7 A;  5DAB A;  2ZMA A;  2OA5 A;  2XQY A;  2MBG A;  2X9X A;  2X9Y A;  4TUY E;  3DTO A;  3PUQ A;  4H9O C;  2KND A;  3N9M A;  5HXE A;  4ERR A;  4HFV A;  4MLK A;  3C4Z A;  4YJ2 E;  2W61 A;  3ZN1 B;  3KV9 A;  4BA9 A;  5HWY A;  5HXH A;  1BR4 A;  1EZ3 A;  2Q9Q C;  5JDH A;  2JRK A;  4XBF B;  3N2O A;  3HKC E;  1HS7 A;  3UUL A;  3IHR A;  2L8K A;  2KMF A;  3ONX A;  2KT9 A;  1IJ5 A;  3LK3 B;  5L2L A;  2X67 A;  1CUN A;  5L3G B;  4GYR A;  3MA9 A;  4A56 A;  3BQK A;  4AQF A;  3CKD A;  2NW9 A;  3HL6 A;  1S94 A;  1UCU A;  4N78 D;  3H37 A;  3ZEF B;  3GWH A;  2CMR A;  1D1A A;  3RPU A;  2NP9 A;  2CXF A;  4J2C A;  2W0G A;  2EHO A;  1ZV4 X;  5KX5 E;  2ES0 A;  4XZC A;  1B7T A;  2K24 A;  4O8S A;  2VKH A;  5EK3 A;  2XAQ B;  2JJ9 A;  3O9X A;  3N9L A;  3RX6 A;  3JC6 C;  1YD8 G;  3K3Q C;  4MHC A;  2XTL A;  2X0L B;  3DJB A;  3E22 E;  1LKX A;  4DBQ A;  3I0Q A;  1AJ3 A;  4ZI3 C;  5LBQ B;  3AA7 B;  3LBX B;  4WNK A;  1US7 B;  3SOL A;  4PK6 A;  5LBM A;  2V1D B;  3JC6 D;  2DNX A;  3O1J A;  3NRY A;  2HH7 A;  3LG7 A;  3MZK B;  4YJ3 E;  4ZI3 D;  5ETW A;  3ZYM A;  1HG2 A;  5BMV E;  2SPC A;  2NTX A;  2Q9Q A;  4GOU A;  3L3P A;  4ISS A;  2A72 A;  2LE8 A;  5EK2 A;  2D2S A;  5LHG B;  3HKD E;  4JEH B;  1IAP A;  3Q9D A;  2CXD A;  2QGS A;  4H9Q C;  5J2U E;  4ZI7 E;  5CA1 E;  4JLE A;  4C91 A;  3NZP A;  5FY1 A;  3ANW A;  3SS1 A;  4ZOL E;  1IZN B;  5JR9 C;  3FBL A;  4CXY A;  4PNI A;  3I9Y A;  5LXT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...