2LM9A

The nmr structure of a major allergen from dust mite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
96
structure length
96
Chain Sequence
NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Blo t 21 allergen
publication title NMR structure and IgE epitopes of Blo t 21, a major dust mite allergen from Blomia tropicalis
pubmed doi rcsb
source organism Blomia tropicalis
total genus 42
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lm9A00
2JRKA 2LM9A 2JMHA
chains in the Genus database with same CATH superfamily
4NIQA 4HWCA 5HXEA 4GK0E 5LXTE 1S94A 3HI2A 1GQEA 3UU3A 3O1IA 5FMNA 5CGMA 1ZV4X 1HNZT 5FXXA 5LMUT 4JEUB 4X62T 5ABGA 4E7SA 2XAFB 2EHOA 2D0UA 3PUYF 1W09A 5AQSB 1T8BA 4GYSA 5HXSA 4HFVA 2H7OA 2W67A 4LMKA 3ESLA 2KNDA 1E7PA 1XNRT 4KBMB 2LT3A 3KBUA 2BVMA 4CI2B 4DR7T 3C4ZA 4X65T 1R8IA 2XQ8A 5JDFA 3K3OA 3PUSA 2CM0A 1U5PA 3AA0B 3ZN1B 2DWKA 1SUMB 1NEKA 3ABVA 2JJ9A 1HX1B 4ANJA 2H3RA 5AQIB 2CWOA 3RC8A 2VK9A 2V8SV 4ISSA 2VWAA 2K9AA 3ZCJA 5F3JA 4ZS2A 5LB7B 5LGUB 1XDPA 1QLBA 4AQGA 3N9QA 3K3QC 4ZOLE 2W4XA 2YK0A 3X1DA 3PUQA 2VB6A 3UTKA 4LF6T 3C98B 4JI5T 3TLUA 4KHZF 1DU2A 4EYUA 3Q5DA 1BR1A 4DMWA 5HWXA 1O3XA 2V5DA 4C91A 4IDNA 3RX6A 1LVFA 5KMGP 2N2NA 2UXDT 2CXDA 4CXXA 4JI2T 1G8XA 3V5SA 2CLYC 3RKOA 4I50E 1UCUA 1UX5A 4J2CA 1HS7A 2UXXB 3U78A 3LBXA 2YN6A 4X66T 2PBIA 2XSAA 4DR5T 4UV9B 3RYIE 3PUAA 5FXWA 3GN5A 4TX5A 3SFDA 3JC6C 1ZHCA 2DLRA 2FJEA 3EI0A 5JREA 3AE7A 2A2FX 4IHJE 4XZCA 3FBZA 2LSGA 2Q9QC 3ZYMA 3ZPOA 3N9PA 2I59A 4LMJA 2CWYA 2MYSA 5AQRB 1EZ3A 1HX8A 2BG9E 4NUVA 4H9QC 3CQCB 2HHHT 1I6ZA 2FJAA 3OJAA 3HKDE 4ISTA 4H63H 1D0XA 4K0KT 2WAUA 2KINB 2NTXA 4EXTA 4PK6A 3CVRA 4CN6A 5HYAA 1XNQT 1FMVA 5ETWA 2XM1A 3TLSA 4TZ4C 3QOFA 5ABFB 3AXJB 3FZFB 5JR9C 4G2AA 4TWFA 2OA5A 3RQWA 3HKBE 2R6GF 1W9RA 5DQVA 5ADXL 3W15B 2BKNA 3ETVA 4GKJT 2ZM0A 4HKAA 4YY3T 5HEHA 2QA7A 5LMNT 1HNWT 2CPTA 4ERRA 1WRDA 3I1AA 3CWZB 2ZLYA 4X20E 2X67A 1SE7A 2WM9A 4PJLA 4Z8XA 3QNUA 2V1DB 4O4HE 2K5BB 5CJ5A 4YLHA 2WU5A 4YHHT 1UX4A 3B57A 3UFEA 3VKHA 5HAXA 2JMHA 3ZC1A 2XPKA 3O9XA 3I0QA 4BAYB 2Q9QA 4YT0A 2BG9B 2RPAA 3AE2A 3N2KE 4P09A 1FIOA 2DCFA 4QWNB 4IE5A 4IDQA 1XMOT 3OKQA 3ONJA 4NXMT 4ZI2D 3Q9DA 3EDVA 4ZI7E 2WBLA 2DHRA 2JMKA 3AB3B 1IJ5A 3E22E 1KNPA 5KXJA 1WCRA 4GK5E 4YHJA 4IGUA 5JR9A 1J1JA 1W0AA 4WNKA 5TAOA 3UQ4A 3ZMTB 4YXDA 4IE7A 2H89A 3SS1A 4EV6A 4HWFA 1VRBA 4HWIB 2WWUA 1CUNA 3LFMA 3UT5E 4TN7B 1YKEB 4KMCA 5C3JA 5LG3A 3JC6D 4JEHB 4CN4A 2PJQA 4LMLA 3MZKB 3ZLIA 5LYJE 1X79A 4H9RC 5AQPB 1LRZA 2LKHA 4H63V 4PJJA 3HKEE 1NAFA 4ZS3A 2XQ5A 1LKXA 4UXNB 2HPLA 4DO0A 4KX6A 2ZM6T 2JQKA 3PJAJ 2D2SA 4UVCB 5LCYA 1HG2A 2XAHB 5JDMA 3RLFF 1FEWA 3O1JA 4AQFC 4DV3T 2WWVA 3RI5A 2LRLA 4JI6T 2MPKA 5AQQB 5ABEA 2PFVA 2XQYA 2IC6A 2ZM2A 2RP4A 2X51A 4AKHA 5AQLB 4JI4T 3N9NA 3OPCA 5AQMB 4COFA 5AQTB 2X0LB 3HKCE 3P50A 5CFBA 1Z0PA 4EIWA 2RA1A 2IHR1 3VR8A 3P8CD 1UGOA 5AQJB 3CQXC 2XAJB 3AEGA 1CHUA 3AEFA 3AEAA 4GOUA 2JQQA 2CMRA 2YU2A 2WDRA 4HGAA 3GMIA 1YKHB 1OEDE 3ZEFB 5JH7E 2B1EA 3B13A 2E9XC 2UU9T 1OEDA 3BQLA 2VKJA 3A7MA 1Z8UA 3PUWF 4IL4A 5JRCA 4A56A 2V5CA 2X68A 4QXCB 2BBJA 4V1Av 3AE1A 3JAEA 2E5VA 2K48A 4G63A 3OTOT 2BVLA 4EZHA 3T1HT 3KV5A 4ZZBA 2NR4A 2MAWA 1D1AA 4OYKA 3EVYA 5HEUA 2VKOA 2CCQA 1ZEEA 3AE8A 4X1KE 5F8PA 4M1PA 5LG4A 4AQFA 2XAGB 1D0ZA 4QHOA 2WB5A 4F6RC 2UUAT 4PFPA 3BQIA 4JBWF 3UFGA 3QB5K 3HL6A 5LOVE 3F31A 1KFYA 3RH3A 4CN1A 4LFBT 3VKGA 4UF0A 4OFZA 1YW0A 3PDYA 2XJ7A 5JDGA 2LSKA 4NXNT 4QH1A 3P4PA 2W0GA 4HFDA 3TKLB 4B6XA 4ZEYA 1T72A 3IF8B 3MK7C 3LSVA 1YD8G 3ZMUB 3M3ZB 5LGNB 1L0VA 1YQ4A 4B3TT 1VCSA 3P4QA 1OEDB 2HPJA 4ZI3C 2NW8A 1FJGT 3Q5EA 5IHYA 4DBRA 2E9XA 5L3EB 2LM9A 4UR9A 3FZKB 5J0ZA 2D5UA 1E1HB 3QUJA 2XAQB 3NZPA 2W63A 4ZI2C 4PJMA 5LP6E 3N2GE 4HTEA 4AKGA 5AQHB 4LF5T 1KNRA 2CHNA 4QX8B 2I6HA 5HEOA 3F2EA 1HNXT 4AXPA 5HXRA 4BJMA 4Z90A 3AEDA 2XQ4A 4WYVA 3KV4A 3C51A 5J1GA 4JI1T 3UUBA 4MBQA 1IBMT 2EHOB 4IE6A 2KLQA 3RC3A 2KZ7B 1D1BA 2V7IA 2LOPA 4QKNA 4O2AE 5L4EA 3HA4A 2XUEA 4QH4A 4LF7T 2XQ7A 4L5GA 4NUUA 4UF0B 5L3FB 4LFCT 4IL9A 5A1LA 1KK7A 4UIGA 1AJ3A 5JDNA 2WMOA 2ACXA 4X1IE 2W66A 5FXZA 5FY0A 3PUZF 5L2LA 3J7Yq 3I9WA 3EUHA 2LEHA 1J5ET 5CA0E 2H7VC 1KF6A 3GWHA 1Y64B 4UELA 2IW5B 3RIFA 2NP9A 4XAXB 2E9XD 5AQGB 2ODUA 4EOZB 2P9BA 2D0TA 2VQFT 2J4GA 2IUBA 2SPCA 2J47A 3UUNA 2CRBA 1UUSA 4QX7B 4JV5T 3ZCIA 3UU6A 4DVDA 2OLTA 2UUCT 5GONE 4UVAB 3KV6A 3RPUA 4L0RA 3N5LA 3LK3B 3RYCE 2XM2A 4U7YA 3CX7B 4O4LE 1UK5A 2XQ3A 4U7IA 2Y8DA 3AAIA 2L9QA 3ZKRA 3O1HA 4DIDB 5EK2A 3VRAA 2OV9A 3N9LA 2QRXA 4TWHA 4WBOA 4F8HA 3G06A 2FJBA 3UU4A 3LBXB 2G0UA 2X9XA 3PUVF 4DV5T 5HWYA 2XTLA 1KEYA 3M65A 3UUXB 5IYZE 3S4UA 1T7SA 3GN5B 2WZHA 2E8IA 3AE5A 2XASB 3RRCA 2NW7A 5AQNB 3ONXA 3RIAA 2I0MA 5IWAT 1S35A 5JTGA 1ZKEA 5LBQB 3DTOA 3P4SA 3C64A 2LSYA 5L3CB 4HFIA 1XMQT 4ZI3D 4N78D 4ILUA 3GA8A 1HTJF 4AKRB 2VVSA 4DV0T 4DUZT 5FVLA 3BQKA 4PK4A 1HR0T 4ADZA 3ZT5A 4DR6T 2NOXA 5L3DB 5BR8T 2FBWA 3EAMA 4UVBB 2W00A 4HFBA 5E0OA 5C2TA 2VQET 1HFAA 1V9DA 2J1DG 2Z6EA 4GIWA 4H9PC 3ZYLA 1Y01A 2ZMAA 4B3ST 3NBXX 5H6QB 2X9WA 3AVRA 2BZBA 2IC9A 2VKHA 1WLXA 2LE8A 2YDRA 3NZQA 3LK42 4DR1T 3DJBA 5CA1E 3K8PC 5BMVE 2VASA 2CLYB 2X9HA 4E7ZA 5AQFB 3RRWA 3P4RA 4HWHA 2V7LA 5HEJA 5J2TE 2CA5A 4EEDA 3NRXA 4IIJE 4A5XA 2YOEA 1KNZA 3CMLA 5LBMA 4AKIA 3MKDA 2H88A 4P1NA 5JDLA 4PNIA 3T1YT 4X64T 3P7IA 1BR4A 3WI3A 1W0BA 5AQKB 3PU3A 3AEBA 2LRKA 2Q9QB 3ZJ1A 4LF8T 2UXBT 2V26A 2VURA 4DR4T 4A98A 3CK6A 3AVSA 3PTRB 3KDSE 2QYWA 1ZOYA 3KBTA 2WQYA 3CKDA 3ZMVB 2V7JA 4I55E 2J62A 2LSJA 2MBGA 3OYXA 4YJ2E 5C8YE 4JI8T 5FYMA 1BR0A 2BS3A 4X5TA 2A72A 2KWIB 5LA6E 1T98A 3AE4A 3ZMZB 4U74A 3MJXA 1WR0A 2WZIA 4YJ3E 3E08A 4CI1B 3C4XA 1MMGA 5AFUL 3ANWA 3QK6A 5JR9B 1XDOA 3FXDB 4O2BE 5LNKA 3K3NA 4L9IA 1MIYA 1US7B 2X0YA 5KX5E 1X9BA 1H7CA 4B3MT 1QSDA 2X0HA 3Q2MA 1B7TA 2LJLA 5DJQC 4U3CA 5HEGA 3FHNA 2LHNA 2PTFA 4TNVA 3ZMSB 4I0UA 4AKLA 4Z91A 2BDEA 3MACA 4H9OC 5AQVB 2IAKA 4YTNA 1MMDA 3A5XA 4OK0A 3UQ7A 4O8SA 3FB2A 4UV8B 1HG5A 1XZYA 2LSIA 2ZM8A 2XZEA 3PV0F 2JQHA 2CHOA 3VR9A 2ES0A 2W2UA 1NENA 4DR3T 4O4IE 5DQWA 4EZ4A 3TLWA 3ETUA 3AAAB 2UUBT 3H3MA 5ABHA 4CZZB 3PURA 4EGWA 4TV9E 3KINB 4IT4A 4JLEA 2KT9A 4OYJA 2AXDS 2YINA 3KFWX 3ANWB 3RHWA 2BS2A 3K1SA 5FNVE 5HXCA 4WBNE 3ZSTA 4HE8A 2W62A 4I43B 3L3PA 3ZJ2A 3AA1B 3VHLA 3FZMB 5FXVA 3UUMA 4BA9A 5EZYE 1WYBA 3B5MA 5H6RB 4FI5A 1IZNB 1QUUA 3EHZA 4WZXA 3ZN0B 3PUGA 3L09A 4ILAA 5HXHA 5LHHB 3TLVA 5L4HA 2HN1A 3F57A 2BG9C 3U3IA 3V5UA 3WAKA 2BKOA 4CI3B 3J9X1 4EEBA 5JRCB 2IIUA 4BJNA 1OXZA 4MFRA 3SFEA 3N2OA 3AA6B 4P0AA 5LHIB 5F5WA 3H3AA 1HCIA 4MHCA 3FZLB 2YU1A 1VOMA 4LF4T 4PJNA 1U4QA 2C5IT 2C5JA 5ABFA 4IE0A 4JI3T 3AXJA 1HF8A 4DV6T 4IDPA 2EHOD 2KXPB 3NWIA 2Y6XA 3PE0A 3OYZA 1J5WA 2V7MA 2WP9A 5AQUB 1YQ3A 4ZHQE 2YKSA 2GK9A 3TLTA 2L3LA 4QH5A 4DV1T 3WAJA 2UXCT 3UU8A 2CBJA 2CXFA 4AQYT 1WFDA 2V6YA 2WU2A 3ZT6A 3EABA 2W61A 4FJOA 2UXNB 1JNRA 4HFCA 2IMLA 1UURA 5FY7A 3AE9A 2BKPA 2JPFA 1N36T 4P0BA 3A8YC 5EK4A 4YTPA 3RGLA 2ACZA 4A97A 1ZP0A 5L3BB 4C90A 4DV7T 4IREA 5CB4E 4EAHA 4MLKA 4YFSA 5FP3A 1SA0E 3RYFE 3LG7A 2C0SA 3RYHE 2NW9A 4NPPA 4KI0F 2E9XB 4YSXA 4U2YA 4CQIA 1VCTA 4DR2T 3HR0A 2KMFA 2BG9A 1OWAA 2C5KT 2LKGA 4YTMA 4QXBB 3CPZA 2HH7A 2KSRA 1N33T 3RIUC 1MIWA 4KUMB 4ASKA 1E2AA 3IBPA 1N32T 4MALA 1D1CA 3ZT7A 3I0OA 3NVOA 4KHPT 3H37A 2QVAA 2CEAA 2DL1A 3AE6A 4I4TE 2WCAA 5HCJA 2WS3A 2B76A 1JNZA 3JAFA 4H9SE 2V6YB 4JUYA 4HFHA 3Q5WA 3MXZA 2A3DA 3IEEA 5M4YA 2XHEB 2QGSA 2PG8A 3MA9A 3AAEB 4DNDA 1MNDA 5FL0A 3KVBA 4UEMA 3PUXF 3QB5A 1I94T 4YSYA 3I9YA 4DV4T 2X9YA 4PFOA 3T8OA 3N9MA 2A9UA 2E5LT 2K24A 4K0UA 3D0TA 2N9DA 2XQ9A 2MTQA 4HN9A 5LGTB 1IAPA 4IDZA 2DNXA 1XWMA 3O4XE 4XBFB 4HWDA 3RQUA 3ZC0A 1NWMX 2KWHA 4KP3C 4X1YE 4U2ZA 3VRBA 5LJMA 2XY8B 4OHFA 4DMVA 5JQGE 2NTYA 2WMNA 2WDVA 2VL8A 2N1GA 3LK2B 3JADA 3L39A 2JIWA 2V7KA 4B3RT 2CXLA 1G73A 4TV8E 2FUPA 1M62A 3FZHB 3RIUA 5FY1A 3PJAA 2K3WA 5DABA 3FBLA 4ZXLA 2XSBA 3IHRA 3KV9A 4DUYT 3CX8B 3ZYKA 1FMWA 3VU7H 3L8RA 2MOZA 4PK5A 4LFAT 2XQ6A 4OX9T 2JRKA 2YEVC 2AE9A 4EYYR 2M6BA 1IJ6A 4AI6A 2JQ9A 3NRYA 4IDOA 1OEDC 4JYAT 3C50A 2XQAA 3BK9A 5IUXA 3KVAA 3IA3A 4QXHB 3N9OA 3NKZA 2L8KA 3OVUA 4U33A 3UULA 2Q9QD 4DBQA 2M67A 5JDHA 2ODVA 3AECA 4TNWA 1LVKA 3RF1A 2D9DA 3P4WA 5HCMA 4IE4A 2DWGA 5L47A 1MMAA 5L3GB 3DP7A 2VL0A 1M7KA 3CX6B 3SOLA 4JI7T 4ILCA 2WDQA 1WYCA 2LOSA 5JVDE 4GYRA 2CE7A 2YDQA 4PAGA 3AE3A 3QC9A 4HFEA 3LDQB 4GKKT 3EDUA 2EHOC 3LJCA 5JDQA 5LHGB 3ONLC 4U72A 4JI0T 2YDSA 4AISA 3JCFA 3Q5XA 2CBIA 4O4JE 2BS4A 3SWHA 1WR6A 4HEAA 3R6NA 2Y48B 5KDMC 4AIUA 3OBVE 5AQOB 2E2AA 2FJDA 4Q25A 4TUYE 2VKDA 4EB6E 3CQGB 2M6IA 3AEEA 2WSSV 3C4WA 3SRZA 1IBKT 2LM2A 2HN2A 3AA7B 3UU5A 3PU8A 3ZSSA 4LF9T 1SHZC 1BR2A 2LLYA 1N34T 5LJNA 4U31A 2WY2A 1D0YA 5FKYA 4DV2T 1MIVA 2DI4A 2IDOB 4WW0A 2NWBA 1MMNA 2X66A 4TWDA 3CIRA 1IBLT 4ZZCA 5FL1A 2V6XA 4CXYA 1YXRA 3RKGA 2LHRA 2F4VT 2VVNA 5EK3A 5J2UE 3FXEB 4YSZA 4H9NC 4ILBA 4PW8A 2BBHA 5FVKA 3E0ZA 3R84B 1MNEA 4CXWA
chains in the Genus database with same CATH topology
2V7MA 3HKEE 2E8IA 4ZHQE 1NAFA 2XASB 3RRCA 4ZS3A 2NW7A 5HXEA 2GK9A 4GK0E 5LXTE 2L3LA 1S94A 3HI2A 3ONXA 3WAJA 1LKXA 4UXNB 2HPLA 3O1IA 5FMNA 4DO0A 1ZV4X 2CXFA 5FXXA 4JEUB 2D2SA 2W61A 4E7SA 2XAFB 1S35A 4FJOA 2UXNB 4UVCB 1ZKEA 5LBQB 5LCYA 2EHOA 2D0UA 3DTOA 1HG2A 3C64A 5FY7A 2XAHB 5JDMA 1FEWA 2LSYA 3O1JA 4GYSA 5HXSA 4AQFC 4HFVA 2JPFA 5L3CB 4P0BA 5EK4A 4ZI3D 2H7OA 3ESLA 2KNDA 2PFVA 2XQYA 4N78D 4KBMB 2LT3A 4ILUA 5L3BB 4C90A 3KBUA 2IC6A 2BVMA 2ZM2A 3GA8A 1HTJF 4CI2B 4AKRB 2RP4A 2X51A 4AKHA 5CB4E 3N9NA 4EAHA 4MLKA 3C4ZA 3BQKA 4PK4A 2X0LB 4YFSA 5FP3A 4ADZA 5JDFA 3K3OA 2NOXA 3HKCE 1SA0E 5L3DB 3RYFE 3LG7A 2C0SA 3RYHE 3PUSA 2NW9A 2CM0A 1U5PA 4UVBB 3AA0B 1Z0PA 4EIWA 3ZN1B 2E9XB 2RA1A 4CQIA 2DWKA 2W00A 2JJ9A 4ANJA 2H3RA 3HR0A 2KMFA 3P8CD 5E0OA 1OWAA 2C5KT 2CWOA 3RC8A 2VK9A 3CQXC 1V9DA 1HFAA 2J1DG 2XAJB 4ISSA 4QXBB 2Z6EA 2VWAA 4GIWA 4H9PC 3ZYLA 2K9AA 2ZMAA 3ZCJA 4GOUA 5F3JA 4ZS2A 2JQQA 3NBXX 5H6QB 5LGUB 2CMRA 2X9WA 3CPZA 2HH7A 3AVRA 2YU2A 4AQGA 4HGAA 3GMIA 3N9QA 2BZBA 3K3QC 1MIWA 1YKHB 4ZOLE 2IC9A 4KUMB 2VKHA 1WLXA 2LE8A 2YK0A 3PUQA 4ASKA 3NZQA 3ZEFB 3LK42 5JH7E 2B1EA 3B13A 2VB6A 2E9XC 3DJBA 5CA1E 3IBPA 3K8PC 5BMVE 2VASA 3BQLA 2VKJA 2CLYB 2X9HA 4E7ZA 3RRWA 4MALA 3UTKA 1D1CA 2V7LA 3I0OA 5J2TE 2CA5A 3C98B 5JRCA 3H37A 3NRXA 4IIJE 1KNZA 4EYUA 4A56A 1BR1A 4DMWA 5HWXA 3CMLA 5LBMA 2CEAA 2X68A 4I4TE 1O3XA 4QXCB 4AKIA 4V1Av 4C91A 3MKDA 5JDLA 4PNIA 3RX6A 1LVFA 2K48A 4H9SE 4G63A 3P7IA 1BR4A 4JUYA 5KMGP 2BVLA 3WI3A 2N2NA 3PU3A 3Q5WA 3MXZA 2CXDA 4EZHA 4CXXA 2A3DA 3KV5A 2Q9QB 3IEEA 5M4YA 3ZJ1A 1G8XA 2XHEB 3V5SA 2V26A 2CLYC 3RKOA 4I50E 2QGSA 2PG8A 1D1AA 4OYKA 1UCUA 1UX5A 3AVSA 3AAEB 3EVYA 3MA9A 2VKOA 2UXXB 2CCQA 3KDSE 3PTRB 1MNDA 4DNDA 1HS7A 3KVBA 4UEMA 3U78A 3LBXA 3KBTA 1ZEEA 3CKDA 3ZMVB 2V7JA 4X1KE 5F8PA 2PBIA 4I55E 4M1PA 5LG4A 2LSJA 2MBGA 3OYXA 4UV9B 3I9YA 4AQFA 4YJ2E 2XAGB 1D0ZA 3RYIE 3PUAA 5C8YE 5FXWA 2X9YA 4PFOA 5FYMA 3GN5A 3T8OA 1BR0A 3N9MA 4QHOA 4TX5A 4F6RC 3JC6C 4PFPA 3BQIA 1ZHCA 2DLRA 2A72A 2K24A 5JREA 3HL6A 5LOVE 2KWIB 5LA6E 2A2FX 3D0TA 1T98A 4IHJE 4K0UA 2N9DA 3F31A 3ZMZB 3RH3A 2MTQA 4XZCA 3FBZA 4HN9A 4U74A 5LGTB 3VKGA 1IAPA 2LSGA 3MJXA 2Q9QC 4UF0A 4OFZA 4IDZA 3ZYMA 1YW0A 2DNXA 3PDYA 3O4XE 3ZPOA 4XBFB 5JDGA 3N9PA 2LSKA 2I59A 3E08A 4YJ3E 4CI1B 3ZC0A 2CWYA 3C4XA 1NWMX 2KWHA 2MYSA 1MMGA 4KP3C 5AFUL 1EZ3A 1HX8A 2W0GA 3ANWA 4X1YE 3QK6A 3TKLB 4NUVA 5JR9B 4H9QC 5LJMA 3FXDB 4OHFA 3CQCB 4O2BE 4DMVA 4B6XA 5JQGE 3IF8B 3MK7C 5LNKA 1YD8G 2NTYA 3ZMUB 2WMNA 3K3NA 4L9IA 2VL8A 1MIYA 2N1GA 1US7B 3LK2B 3OJAA 5LGNB 2V7KA 3HKDE 4ISTA 4H63H 5KX5E 1D0XA 2WAUA 2CXLA 2KINB 1G73A 2NTXA 1H7CA 4TV8E 4EXTA 4PK6A 3CVRA 5FY1A 1QSDA 2HPJA 5HYAA 3Q2MA 4ZI3C 2NW8A 1FMVA 5ETWA 1B7TA 5DABA 3FBLA 4TZ4C 2LJLA 5DJQC 5IHYA 4DBRA 3IHRA 2E9XA 3FHNA 2LM9A 5L3EB 3KV9A 2LHNA 3CX8B 4G2AA 3ZMSB 5JR9C 3ZYKA 1FMWA 3VU7H 4AKLA 2BDEA 2OA5A 2MOZA 2D5UA 3MACA 4H9OC 4PK5A 3HKBE 1E1HB 2IAKA 3QUJA 2JRKA 2YEVC 2XAQB 4EYYR 3NZPA 1MMDA 2W63A 4ZI2C 4PJMA 5LP6E 3A5XA 4OK0A 3N2GE 5DQVA 4HTEA 4AKGA 1IJ6A 4QX8B 5ADXL 3W15B 3ETVA 3F2EA 4AI6A 4O8SA 3NRYA 4AXPA 3FB2A 2ZM0A 4HKAA 3C50A 5HXRA 3BK9A 2QA7A 4BJMA 3KVAA 4UV8B 4ERRA 1HG5A 4QXHB 3KV4A 2LSIA 1WRDA 3N9OA 3C51A 5J1GA 2L8KA 3CWZB 2ZLYA 3I1AA 4MBQA 2ZM8A 2EHOB 4X20E 2X67A 3UULA 2Q9QD 4DBQA 2M67A 4IE6A 2KLQA 3RC3A 5JDHA 2ODVA 2WM9A 4PJLA 1D1BA 1LVKA 2ES0A 2KZ7B 4J2CA 2V7IA 4Z8XA 2V1DB 2LOPA 4O4IE 4IE4A 4O4HE 2DWGA 4QKNA 1MMAA 2K5BB 4O2AE 5L3GB 4YLHA 3DP7A 5DQWA 4EZ4A 3CX6B 3HA4A 2XUEA 3SOLA 4L5GA 3ETUA 4NUUA 1WYCA 3AAAB 2LOSA 5JVDE 4UF0B 4GYRA 5L3FB 2CE7A 1UX4A 5A1LA 1KK7A 3B57A 4UIGA 1AJ3A 3UFEA 3VKHA 5HAXA 4CZZB 3PURA 4PAGA 2WMOA 5JDNA 2JMHA 2ACXA 4X1IE 4TV9E 3ZC1A 3KINB 4JLEA 3QC9A 5FXZA 3O9XA 5FY0A 3I0QA 2KT9A 4OYJA 4BAYB 5L2LA 3J7Yq 2YINA 3KFWX 2Q9QA 3ANWB 3EDUA 2EHOC 3I9WA 3EUHA 2LEHA 5FNVE 3LJCA 5HXCA 4WBNE 5CA0E 5JDQA 2H7VC 5LHGB 4U72A 3GWHA 4HE8A 1Y64B 4UELA 2W62A 4I43B 3L3PA 2IW5B 3Q5XA 3ZJ2A 3AA1B 2NP9A 3N2KE 4XAXB 4P09A 2E9XD 3VHLA 1FIOA 4O4JE 2DCFA 4QWNB 5FXVA 4IE5A 2ODUA 3SWHA 4EOZB 3UUMA 4BA9A 1WR6A 5EZYE 1WYBA 3OKQA 4HEAA 2P9BA 2Y48B 3R6NA 5H6RB 5KDMC 2D0TA 2SPCA 4FI5A 1IZNB 1QUUA 3UUNA 4ZI2D 3Q9DA 3EDVA 3OBVE 3ZN0B 4ZI7E 3PUGA 4QX7B 2WBLA 2DHRA 3L09A 2JMKA 3ZCIA 3AB3B 5HXHA 5LHHB 1IJ5A 4TUYE 2VKDA 3E22E 4EB6E 3CQGB 3F57A 4DVDA 2WSSV 3C4WA 3V5UA 3U3IA 3WAKA 3SRZA 4GK5E 4YHJA 4CI3B 3AA7B 3PU8A 3J9X1 5JRCB 4IGUA 1SHZC 1BR2A 5GONE 5JR9A 4UVAB 3KV6A 3RPUA 1OXZA 4BJNA 4MFRA 4WNKA 5LJNA 4L0RA 3N5LA 3LK3B 3RYCE 5TAOA 1D0YA 3ZMTB 1MIVA 2DI4A 4IE7A 3CX7B 3N2OA 3SS1A 4O4LE 2NWBA 3AA6B 4WW0A 1MMNA 4P0AA 2X66A 2Y8DA 3AAIA 5LHIB 2L9QA 3H3AA 1HCIA 3O1HA 4MHCA 4CXYA 5EK2A 1VRBA 2LHRA 2YU1A 5EK3A 1VOMA 1CUNA 2WWUA 5J2UE 3LFMA 4PJNA 3UT5E 1U4QA 3N9LA 2C5IT 3FXEB 4TN7B 1YKEB 4KMCA 4WBOA 4H9NC 3JC6D 2C5JA 4JEHB 2PJQA 4IE0A 4PW8A 3MZKB 3LBXB 2G0UA 3E0ZA 1HF8A 2X9XA 5HWYA 3ZLIA 3R84B 5LYJE 2EHOD 1X79A 1MNEA 4H9RC 1LRZA 2XTLA 3M65A 3UUXB 2KXPB 5IYZE 3S4UA 3GN5B 2Y6XA 4CXWA 3PE0A 4H63V 3OYZA 4PJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRK A;  2LM9 A;  2JMH A; 
#chains in the Genus database with same CATH topology
 4NIQ A;  4HWC A;  5HXE A;  4GK0 E;  5LXT E;  1S94 A;  3HI2 A;  1GQE A;  3UU3 A;  3O1I A;  5FMN A;  5CGM A;  1ZV4 X;  1HNZ T;  5FXX A;  5LMU T;  4JEU B;  4X62 T;  5ABG A;  4E7S A;  2XAF B;  2EHO A;  2D0U A;  3PUY F;  1W09 A;  5AQS B;  1T8B A;  4GYS A;  5HXS A;  4HFV A;  2H7O A;  2W67 A;  4LMK A;  3ESL A;  2KND A;  1E7P A;  1XNR T;  4KBM B;  2LT3 A;  3KBU A;  2BVM A;  4CI2 B;  4DR7 T;  3C4Z A;  4X65 T;  1R8I A;  2XQ8 A;  5JDF A;  3K3O A;  3PUS A;  2CM0 A;  1U5P A;  3AA0 B;  3ZN1 B;  2DWK A;  1SUM B;  1NEK A;  3ABV A;  2JJ9 A;  1HX1 B;  4ANJ A;  2H3R A;  5AQI B;  2CWO A;  3RC8 A;  2VK9 A;  2V8S V;  4ISS A;  2VWA A;  2K9A A;  3ZCJ A;  5F3J A;  4ZS2 A;  5LB7 B;  5LGU B;  1XDP A;  1QLB A;  4AQG A;  3N9Q A;  3K3Q C;  4ZOL E;  2W4X A;  2YK0 A;  3X1D A;  3PUQ A;  2VB6 A;  3UTK A;  4LF6 T;  3C98 B;  4JI5 T;  3TLU A;  4KHZ F;  1DU2 A;  4EYU A;  3Q5D A;  1BR1 A;  4DMW A;  5HWX A;  1O3X A;  2V5D A;  4C91 A;  4IDN A;  3RX6 A;  1LVF A;  5KMG P;  2N2N A;  2UXD T;  2CXD A;  4CXX A;  4JI2 T;  1G8X A;  3V5S A;  2CLY C;  3RKO A;  4I50 E;  1UCU A;  1UX5 A;  4J2C A;  1HS7 A;  2UXX B;  3U78 A;  3LBX A;  2YN6 A;  4X66 T;  2PBI A;  2XSA A;  4DR5 T;  4UV9 B;  3RYI E;  3PUA A;  5FXW A;  3GN5 A;  4TX5 A;  3SFD A;  3JC6 C;  1ZHC A;  2DLR A;  2FJE A;  3EI0 A;  5JRE A;  3AE7 A;  2A2F X;  4IHJ E;  4XZC A;  3FBZ A;  2LSG A;  2Q9Q C;  3ZYM A;  3ZPO A;  3N9P A;  2I59 A;  4LMJ A;  2CWY A;  2MYS A;  5AQR B;  1EZ3 A;  1HX8 A;  2BG9 E;  4NUV A;  4H9Q C;  3CQC B;  2HHH T;  1I6Z A;  2FJA A;  3OJA A;  3HKD E;  4IST A;  4H63 H;  1D0X A;  4K0K T;  2WAU A;  2KIN B;  2NTX A;  4EXT A;  4PK6 A;  3CVR A;  4CN6 A;  5HYA A;  1XNQ T;  1FMV A;  5ETW A;  2XM1 A;  3TLS A;  4TZ4 C;  3QOF A;  5ABF B;  3AXJ B;  3FZF B;  5JR9 C;  4G2A A;  4TWF A;  2OA5 A;  3RQW A;  3HKB E;  2R6G F;  1W9R A;  5DQV A;  5ADX L;  3W15 B;  2BKN A;  3ETV A;  4GKJ T;  2ZM0 A;  4HKA A;  4YY3 T;  5HEH A;  2QA7 A;  5LMN T;  1HNW T;  2CPT A;  4ERR A;  1WRD A;  3I1A A;  3CWZ B;  2ZLY A;  4X20 E;  2X67 A;  1SE7 A;  2WM9 A;  4PJL A;  4Z8X A;  3QNU A;  2V1D B;  4O4H E;  2K5B B;  5CJ5 A;  4YLH A;  2WU5 A;  4YHH T;  1UX4 A;  3B57 A;  3UFE A;  3VKH A;  5HAX A;  2JMH A;  3ZC1 A;  2XPK A;  3O9X A;  3I0Q A;  4BAY B;  2Q9Q A;  4YT0 A;  2BG9 B;  2RPA A;  3AE2 A;  3N2K E;  4P09 A;  1FIO A;  2DCF A;  4QWN B;  4IE5 A;  4IDQ A;  1XMO T;  3OKQ A;  3ONJ A;  4NXM T;  4ZI2 D;  3Q9D A;  3EDV A;  4ZI7 E;  2WBL A;  2DHR A;  2JMK A;  3AB3 B;  1IJ5 A;  3E22 E;  1KNP A;  5KXJ A;  1WCR A;  4GK5 E;  4YHJ A;  4IGU A;  5JR9 A;  1J1J A;  1W0A A;  4WNK A;  5TAO A;  3UQ4 A;  3ZMT B;  4YXD A;  4IE7 A;  2H89 A;  3SS1 A;  4EV6 A;  4HWF A;  1VRB A;  4HWI B;  2WWU A;  1CUN A;  3LFM A;  3UT5 E;  4TN7 B;  1YKE B;  4KMC A;  5C3J A;  5LG3 A;  3JC6 D;  4JEH B;  4CN4 A;  2PJQ A;  4LML A;  3MZK B;  3ZLI A;  5LYJ E;  1X79 A;  4H9R C;  5AQP B;  1LRZ A;  2LKH A;  4H63 V;  4PJJ A;  3HKE E;  1NAF A;  4ZS3 A;  2XQ5 A;  1LKX A;  4UXN B;  2HPL A;  4DO0 A;  4KX6 A;  2ZM6 T;  2JQK A;  3PJA J;  2D2S A;  4UVC B;  5LCY A;  1HG2 A;  2XAH B;  5JDM A;  3RLF F;  1FEW A;  3O1J A;  4AQF C;  4DV3 T;  2WWV A;  3RI5 A;  2LRL A;  4JI6 T;  2MPK A;  5AQQ B;  5ABE A;  2PFV A;  2XQY A;  2IC6 A;  2ZM2 A;  2RP4 A;  2X51 A;  4AKH A;  5AQL B;  4JI4 T;  3N9N A;  3OPC A;  5AQM B;  4COF A;  5AQT B;  2X0L B;  3HKC E;  3P50 A;  5CFB A;  1Z0P A;  4EIW A;  2RA1 A;  2IHR 1;  3VR8 A;  3P8C D;  1UGO A;  5AQJ B;  3CQX C;  2XAJ B;  3AEG A;  1CHU A;  3AEF A;  3AEA A;  4GOU A;  2JQQ A;  2CMR A;  2YU2 A;  2WDR A;  4HGA A;  3GMI A;  1YKH B;  1OED E;  3ZEF B;  5JH7 E;  2B1E A;  3B13 A;  2E9X C;  2UU9 T;  1OED A;  3BQL A;  2VKJ A;  3A7M A;  1Z8U A;  3PUW F;  4IL4 A;  5JRC A;  4A56 A;  2V5C A;  2X68 A;  4QXC B;  2BBJ A;  4V1A v;  3AE1 A;  3JAE A;  2E5V A;  2K48 A;  4G63 A;  3OTO T;  2BVL A;  4EZH A;  3T1H T;  3KV5 A;  4ZZB A;  2NR4 A;  2MAW A;  1D1A A;  4OYK A;  3EVY A;  5HEU A;  2VKO A;  2CCQ A;  1ZEE A;  3AE8 A;  4X1K E;  5F8P A;  4M1P A;  5LG4 A;  4AQF A;  2XAG B;  1D0Z A;  4QHO A;  2WB5 A;  4F6R C;  2UUA T;  4PFP A;  3BQI A;  4JBW F;  3UFG A;  3QB5 K;  3HL6 A;  5LOV E;  3F31 A;  1KFY A;  3RH3 A;  4CN1 A;  4LFB T;  3VKG A;  4UF0 A;  4OFZ A;  1YW0 A;  3PDY A;  2XJ7 A;  5JDG A;  2LSK A;  4NXN T;  4QH1 A;  3P4P A;  2W0G A;  4HFD A;  3TKL B;  4B6X A;  4ZEY A;  1T72 A;  3IF8 B;  3MK7 C;  3LSV A;  1YD8 G;  3ZMU B;  3M3Z B;  5LGN B;  1L0V A;  1YQ4 A;  4B3T T;  1VCS A;  3P4Q A;  1OED B;  2HPJ A;  4ZI3 C;  2NW8 A;  1FJG T;  3Q5E A;  5IHY A;  4DBR A;  2E9X A;  5L3E B;  2LM9 A;  4UR9 A;  3FZK B;  5J0Z A;  2D5U A;  1E1H B;  3QUJ A;  2XAQ B;  3NZP A;  2W63 A;  4ZI2 C;  4PJM A;  5LP6 E;  3N2G E;  4HTE A;  4AKG A;  5AQH B;  4LF5 T;  1KNR A;  2CHN A;  4QX8 B;  2I6H A;  5HEO A;  3F2E A;  1HNX T;  4AXP A;  5HXR A;  4BJM A;  4Z90 A;  3AED A;  2XQ4 A;  4WYV A;  3KV4 A;  3C51 A;  5J1G A;  4JI1 T;  3UUB A;  4MBQ A;  1IBM T;  2EHO B;  4IE6 A;  2KLQ A;  3RC3 A;  2KZ7 B;  1D1B A;  2V7I A;  2LOP A;  4QKN A;  4O2A E;  5L4E A;  3HA4 A;  2XUE A;  4QH4 A;  4LF7 T;  2XQ7 A;  4L5G A;  4NUU A;  4UF0 B;  5L3F B;  4LFC T;  4IL9 A;  5A1L A;  1KK7 A;  4UIG A;  1AJ3 A;  5JDN A;  2WMO A;  2ACX A;  4X1I E;  2W66 A;  5FXZ A;  5FY0 A;  3PUZ F;  5L2L A;  3J7Y q;  3I9W A;  3EUH A;  2LEH A;  1J5E T;  5CA0 E;  2H7V C;  1KF6 A;  3GWH A;  1Y64 B;  4UEL A;  2IW5 B;  3RIF A;  2NP9 A;  4XAX B;  2E9X D;  5AQG B;  2ODU A;  4EOZ B;  2P9B A;  2D0T A;  2VQF T;  2J4G A;  2IUB A;  2SPC A;  2J47 A;  3UUN A;  2CRB A;  1UUS A;  4QX7 B;  4JV5 T;  3ZCI A;  3UU6 A;  4DVD A;  2OLT A;  2UUC T;  5GON E;  4UVA B;  3KV6 A;  3RPU A;  4L0R A;  3N5L A;  3LK3 B;  3RYC E;  2XM2 A;  4U7Y A;  3CX7 B;  4O4L E;  1UK5 A;  2XQ3 A;  4U7I A;  2Y8D A;  3AAI A;  2L9Q A;  3ZKR A;  3O1H A;  4DID B;  5EK2 A;  3VRA A;  2OV9 A;  3N9L A;  2QRX A;  4TWH A;  4WBO A;  4F8H A;  3G06 A;  2FJB A;  3UU4 A;  3LBX B;  2G0U A;  2X9X A;  3PUV F;  4DV5 T;  5HWY A;  2XTL A;  1KEY A;  3M65 A;  3UUX B;  5IYZ E;  3S4U A;  1T7S A;  3GN5 B;  2WZH A;  2E8I A;  3AE5 A;  2XAS B;  3RRC A;  2NW7 A;  5AQN B;  3ONX A;  3RIA A;  2I0M A;  5IWA T;  1S35 A;  5JTG A;  1ZKE A;  5LBQ B;  3DTO A;  3P4S A;  3C64 A;  2LSY A;  5L3C B;  4HFI A;  1XMQ T;  4ZI3 D;  4N78 D;  4ILU A;  3GA8 A;  1HTJ F;  4AKR B;  2VVS A;  4DV0 T;  4DUZ T;  5FVL A;  3BQK A;  4PK4 A;  1HR0 T;  4ADZ A;  3ZT5 A;  4DR6 T;  2NOX A;  5L3D B;  5BR8 T;  2FBW A;  3EAM A;  4UVB B;  2W00 A;  4HFB A;  5E0O A;  5C2T A;  2VQE T;  1HFA A;  1V9D A;  2J1D G;  2Z6E A;  4GIW A;  4H9P C;  3ZYL A;  1Y01 A;  2ZMA A;  4B3S T;  3NBX X;  5H6Q B;  2X9W A;  3AVR A;  2BZB A;  2IC9 A;  2VKH A;  1WLX A;  2LE8 A;  2YDR A;  3NZQ A;  3LK4 2;  4DR1 T;  3DJB A;  5CA1 E;  3K8P C;  5BMV E;  2VAS A;  2CLY B;  2X9H A;  4E7Z A;  5AQF B;  3RRW A;  3P4R A;  4HWH A;  2V7L A;  5HEJ A;  5J2T E;  2CA5 A;  4EED A;  3NRX A;  4IIJ E;  4A5X A;  2YOE A;  1KNZ A;  3CML A;  5LBM A;  4AKI A;  3MKD A;  2H88 A;  4P1N A;  5JDL A;  4PNI A;  3T1Y T;  4X64 T;  3P7I A;  1BR4 A;  3WI3 A;  1W0B A;  5AQK B;  3PU3 A;  3AEB A;  2LRK A;  2Q9Q B;  3ZJ1 A;  4LF8 T;  2UXB T;  2V26 A;  2VUR A;  4DR4 T;  4A98 A;  3CK6 A;  3AVS A;  3PTR B;  3KDS E;  2QYW A;  1ZOY A;  3KBT A;  2WQY A;  3CKD A;  3ZMV B;  2V7J A;  4I55 E;  2J62 A;  2LSJ A;  2MBG A;  3OYX A;  4YJ2 E;  5C8Y E;  4JI8 T;  5FYM A;  1BR0 A;  2BS3 A;  4X5T A;  2A72 A;  2KWI B;  5LA6 E;  1T98 A;  3AE4 A;  3ZMZ B;  4U74 A;  3MJX A;  1WR0 A;  2WZI A;  4YJ3 E;  3E08 A;  4CI1 B;  3C4X A;  1MMG A;  5AFU L;  3ANW A;  3QK6 A;  5JR9 B;  1XDO A;  3FXD B;  4O2B E;  5LNK A;  3K3N A;  4L9I A;  1MIY A;  1US7 B;  2X0Y A;  5KX5 E;  1X9B A;  1H7C A;  4B3M T;  1QSD A;  2X0H A;  3Q2M A;  1B7T A;  2LJL A;  5DJQ C;  4U3C A;  5HEG A;  3FHN A;  2LHN A;  2PTF A;  4TNV A;  3ZMS B;  4I0U A;  4AKL A;  4Z91 A;  2BDE A;  3MAC A;  4H9O C;  5AQV B;  2IAK A;  4YTN A;  1MMD A;  3A5X A;  4OK0 A;  3UQ7 A;  4O8S A;  3FB2 A;  4UV8 B;  1HG5 A;  1XZY A;  2LSI A;  2ZM8 A;  2XZE A;  3PV0 F;  2JQH A;  2CHO A;  3VR9 A;  2ES0 A;  2W2U A;  1NEN A;  4DR3 T;  4O4I E;  5DQW A;  4EZ4 A;  3TLW A;  3ETU A;  3AAA B;  2UUB T;  3H3M A;  5ABH A;  4CZZ B;  3PUR A;  4EGW A;  4TV9 E;  3KIN B;  4IT4 A;  4JLE A;  2KT9 A;  4OYJ A;  2AXD S;  2YIN A;  3KFW X;  3ANW B;  3RHW A;  2BS2 A;  3K1S A;  5FNV E;  5HXC A;  4WBN E;  3ZST A;  4HE8 A;  2W62 A;  4I43 B;  3L3P A;  3ZJ2 A;  3AA1 B;  3VHL A;  3FZM B;  5FXV A;  3UUM A;  4BA9 A;  5EZY E;  1WYB A;  3B5M A;  5H6R B;  4FI5 A;  1IZN B;  1QUU A;  3EHZ A;  4WZX A;  3ZN0 B;  3PUG A;  3L09 A;  4ILA A;  5HXH A;  5LHH B;  3TLV A;  5L4H A;  2HN1 A;  3F57 A;  2BG9 C;  3U3I A;  3V5U A;  3WAK A;  2BKO A;  4CI3 B;  3J9X 1;  4EEB A;  5JRC B;  2IIU A;  4BJN A;  1OXZ A;  4MFR A;  3SFE A;  3N2O A;  3AA6 B;  4P0A A;  5LHI B;  5F5W A;  3H3A A;  1HCI A;  4MHC A;  3FZL B;  2YU1 A;  1VOM A;  4LF4 T;  4PJN A;  1U4Q A;  2C5I T;  2C5J A;  5ABF A;  4IE0 A;  4JI3 T;  3AXJ A;  1HF8 A;  4DV6 T;  4IDP A;  2EHO D;  2KXP B;  3NWI A;  2Y6X A;  3PE0 A;  3OYZ A;  1J5W A;  2V7M A;  2WP9 A;  5AQU B;  1YQ3 A;  4ZHQ E;  2YKS A;  2GK9 A;  3TLT A;  2L3L A;  4QH5 A;  4DV1 T;  3WAJ A;  2UXC T;  3UU8 A;  2CBJ A;  2CXF A;  4AQY T;  1WFD A;  2V6Y A;  2WU2 A;  3ZT6 A;  3EAB A;  2W61 A;  4FJO A;  2UXN B;  1JNR A;  4HFC A;  2IML A;  1UUR A;  5FY7 A;  3AE9 A;  2BKP A;  2JPF A;  1N36 T;  4P0B A;  3A8Y C;  5EK4 A;  4YTP A;  3RGL A;  2ACZ A;  4A97 A;  1ZP0 A;  5L3B B;  4C90 A;  4DV7 T;  4IRE A;  5CB4 E;  4EAH A;  4MLK A;  4YFS A;  5FP3 A;  1SA0 E;  3RYF E;  3LG7 A;  2C0S A;  3RYH E;  2NW9 A;  4NPP A;  4KI0 F;  2E9X B;  4YSX A;  4U2Y A;  4CQI A;  1VCT A;  4DR2 T;  3HR0 A;  2KMF A;  2BG9 A;  1OWA A;  2C5K T;  2LKG A;  4YTM A;  4QXB B;  3CPZ A;  2HH7 A;  2KSR A;  1N33 T;  3RIU C;  1MIW A;  4KUM B;  4ASK A;  1E2A A;  3IBP A;  1N32 T;  4MAL A;  1D1C A;  3ZT7 A;  3I0O A;  3NVO A;  4KHP T;  3H37 A;  2QVA A;  2CEA A;  2DL1 A;  3AE6 A;  4I4T E;  2WCA A;  5HCJ A;  2WS3 A;  2B76 A;  1JNZ A;  3JAF A;  4H9S E;  2V6Y B;  4JUY A;  4HFH A;  3Q5W A;  3MXZ A;  2A3D A;  3IEE A;  5M4Y A;  2XHE B;  2QGS A;  2PG8 A;  3MA9 A;  3AAE B;  4DND A;  1MND A;  5FL0 A;  3KVB A;  4UEM A;  3PUX F;  3QB5 A;  1I94 T;  4YSY A;  3I9Y A;  4DV4 T;  2X9Y A;  4PFO A;  3T8O A;  3N9M A;  2A9U A;  2E5L T;  2K24 A;  4K0U A;  3D0T A;  2N9D A;  2XQ9 A;  2MTQ A;  4HN9 A;  5LGT B;  1IAP A;  4IDZ A;  2DNX A;  1XWM A;  3O4X E;  4XBF B;  4HWD A;  3RQU A;  3ZC0 A;  1NWM X;  2KWH A;  4KP3 C;  4X1Y E;  4U2Z A;  3VRB A;  5LJM A;  2XY8 B;  4OHF A;  4DMV A;  5JQG E;  2NTY A;  2WMN A;  2WDV A;  2VL8 A;  2N1G A;  3LK2 B;  3JAD A;  3L39 A;  2JIW A;  2V7K A;  4B3R T;  2CXL A;  1G73 A;  4TV8 E;  2FUP A;  1M62 A;  3FZH B;  3RIU A;  5FY1 A;  3PJA A;  2K3W A;  5DAB A;  3FBL A;  4ZXL A;  2XSB A;  3IHR A;  3KV9 A;  4DUY T;  3CX8 B;  3ZYK A;  1FMW A;  3VU7 H;  3L8R A;  2MOZ A;  4PK5 A;  4LFA T;  2XQ6 A;  4OX9 T;  2JRK A;  2YEV C;  2AE9 A;  4EYY R;  2M6B A;  1IJ6 A;  4AI6 A;  2JQ9 A;  3NRY A;  4IDO A;  1OED C;  4JYA T;  3C50 A;  2XQA A;  3BK9 A;  5IUX A;  3KVA A;  3IA3 A;  4QXH B;  3N9O A;  3NKZ A;  2L8K A;  3OVU A;  4U33 A;  3UUL A;  2Q9Q D;  4DBQ A;  2M67 A;  5JDH A;  2ODV A;  3AEC A;  4TNW A;  1LVK A;  3RF1 A;  2D9D A;  3P4W A;  5HCM A;  4IE4 A;  2DWG A;  5L47 A;  1MMA A;  5L3G B;  3DP7 A;  2VL0 A;  1M7K A;  3CX6 B;  3SOL A;  4JI7 T;  4ILC A;  2WDQ A;  1WYC A;  2LOS A;  5JVD E;  4GYR A;  2CE7 A;  2YDQ A;  4PAG A;  3AE3 A;  3QC9 A;  4HFE A;  3LDQ B;  4GKK T;  3EDU A;  2EHO C;  3LJC A;  5JDQ A;  5LHG B;  3ONL C;  4U72 A;  4JI0 T;  2YDS A;  4AIS A;  3JCF A;  3Q5X A;  2CBI A;  4O4J E;  2BS4 A;  3SWH A;  1WR6 A;  4HEA A;  3R6N A;  2Y48 B;  5KDM C;  4AIU A;  3OBV E;  5AQO B;  2E2A A;  2FJD A;  4Q25 A;  4TUY E;  2VKD A;  4EB6 E;  3CQG B;  2M6I A;  3AEE A;  2WSS V;  3C4W A;  3SRZ A;  1IBK T;  2LM2 A;  2HN2 A;  3AA7 B;  3UU5 A;  3PU8 A;  3ZSS A;  4LF9 T;  1SHZ C;  1BR2 A;  2LLY A;  1N34 T;  5LJN A;  4U31 A;  2WY2 A;  1D0Y A;  5FKY A;  4DV2 T;  1MIV A;  2DI4 A;  2IDO B;  4WW0 A;  2NWB A;  1MMN A;  2X66 A;  4TWD A;  3CIR A;  1IBL T;  4ZZC A;  5FL1 A;  2V6X A;  4CXY A;  1YXR A;  3RKG A;  2LHR A;  2F4V T;  2VVN A;  5EK3 A;  5J2U E;  3FXE B;  4YSZ A;  4H9N C;  4ILB A;  4PW8 A;  2BBH A;  5FVK A;  3E0Z A;  3R84 B;  1MNE A;  4CXW A; 
#chains in the Genus database with same CATH homology
 2V7M A;  3HKE E;  2E8I A;  4ZHQ E;  1NAF A;  2XAS B;  3RRC A;  4ZS3 A;  2NW7 A;  5HXE A;  2GK9 A;  4GK0 E;  5LXT E;  2L3L A;  1S94 A;  3HI2 A;  3ONX A;  3WAJ A;  1LKX A;  4UXN B;  2HPL A;  3O1I A;  5FMN A;  4DO0 A;  1ZV4 X;  2CXF A;  5FXX A;  4JEU B;  2D2S A;  2W61 A;  4E7S A;  2XAF B;  1S35 A;  4FJO A;  2UXN B;  4UVC B;  1ZKE A;  5LBQ B;  5LCY A;  2EHO A;  2D0U A;  3DTO A;  1HG2 A;  3C64 A;  5FY7 A;  2XAH B;  5JDM A;  1FEW A;  2LSY A;  3O1J A;  4GYS A;  5HXS A;  4AQF C;  4HFV A;  2JPF A;  5L3C B;  4P0B A;  5EK4 A;  4ZI3 D;  2H7O A;  3ESL A;  2KND A;  2PFV A;  2XQY A;  4N78 D;  4KBM B;  2LT3 A;  4ILU A;  5L3B B;  4C90 A;  3KBU A;  2IC6 A;  2BVM A;  2ZM2 A;  3GA8 A;  1HTJ F;  4CI2 B;  4AKR B;  2RP4 A;  2X51 A;  4AKH A;  5CB4 E;  3N9N A;  4EAH A;  4MLK A;  3C4Z A;  3BQK A;  4PK4 A;  2X0L B;  4YFS A;  5FP3 A;  4ADZ A;  5JDF A;  3K3O A;  2NOX A;  3HKC E;  1SA0 E;  5L3D B;  3RYF E;  3LG7 A;  2C0S A;  3RYH E;  3PUS A;  2NW9 A;  2CM0 A;  1U5P A;  4UVB B;  3AA0 B;  1Z0P A;  4EIW A;  3ZN1 B;  2E9X B;  2RA1 A;  4CQI A;  2DWK A;  2W00 A;  2JJ9 A;  4ANJ A;  2H3R A;  3HR0 A;  2KMF A;  3P8C D;  5E0O A;  1OWA A;  2C5K T;  2CWO A;  3RC8 A;  2VK9 A;  3CQX C;  1V9D A;  1HFA A;  2J1D G;  2XAJ B;  4ISS A;  4QXB B;  2Z6E A;  2VWA A;  4GIW A;  4H9P C;  3ZYL A;  2K9A A;  2ZMA A;  3ZCJ A;  4GOU A;  5F3J A;  4ZS2 A;  2JQQ A;  3NBX X;  5H6Q B;  5LGU B;  2CMR A;  2X9W A;  3CPZ A;  2HH7 A;  3AVR A;  2YU2 A;  4AQG A;  4HGA A;  3GMI A;  3N9Q A;  2BZB A;  3K3Q C;  1MIW A;  1YKH B;  4ZOL E;  2IC9 A;  4KUM B;  2VKH A;  1WLX A;  2LE8 A;  2YK0 A;  3PUQ A;  4ASK A;  3NZQ A;  3ZEF B;  3LK4 2;  5JH7 E;  2B1E A;  3B13 A;  2VB6 A;  2E9X C;  3DJB A;  5CA1 E;  3IBP A;  3K8P C;  5BMV E;  2VAS A;  3BQL A;  2VKJ A;  2CLY B;  2X9H A;  4E7Z A;  3RRW A;  4MAL A;  3UTK A;  1D1C A;  2V7L A;  3I0O A;  5J2T E;  2CA5 A;  3C98 B;  5JRC A;  3H37 A;  3NRX A;  4IIJ E;  1KNZ A;  4EYU A;  4A56 A;  1BR1 A;  4DMW A;  5HWX A;  3CML A;  5LBM A;  2CEA A;  2X68 A;  4I4T E;  1O3X A;  4QXC B;  4AKI A;  4V1A v;  4C91 A;  3MKD A;  5JDL A;  4PNI A;  3RX6 A;  1LVF A;  2K48 A;  4H9S E;  4G63 A;  3P7I A;  1BR4 A;  4JUY A;  5KMG P;  2BVL A;  3WI3 A;  2N2N A;  3PU3 A;  3Q5W A;  3MXZ A;  2CXD A;  4EZH A;  4CXX A;  2A3D A;  3KV5 A;  2Q9Q B;  3IEE A;  5M4Y A;  3ZJ1 A;  1G8X A;  2XHE B;  3V5S A;  2V26 A;  2CLY C;  3RKO A;  4I50 E;  2QGS A;  2PG8 A;  1D1A A;  4OYK A;  1UCU A;  1UX5 A;  3AVS A;  3AAE B;  3EVY A;  3MA9 A;  2VKO A;  2UXX B;  2CCQ A;  3KDS E;  3PTR B;  1MND A;  4DND A;  1HS7 A;  3KVB A;  4UEM A;  3U78 A;  3LBX A;  3KBT A;  1ZEE A;  3CKD A;  3ZMV B;  2V7J A;  4X1K E;  5F8P A;  2PBI A;  4I55 E;  4M1P A;  5LG4 A;  2LSJ A;  2MBG A;  3OYX A;  4UV9 B;  3I9Y A;  4AQF A;  4YJ2 E;  2XAG B;  1D0Z A;  3RYI E;  3PUA A;  5C8Y E;  5FXW A;  2X9Y A;  4PFO A;  5FYM A;  3GN5 A;  3T8O A;  1BR0 A;  3N9M A;  4QHO A;  4TX5 A;  4F6R C;  3JC6 C;  4PFP A;  3BQI A;  1ZHC A;  2DLR A;  2A72 A;  2K24 A;  5JRE A;  3HL6 A;  5LOV E;  2KWI B;  5LA6 E;  2A2F X;  3D0T A;  1T98 A;  4IHJ E;  4K0U A;  2N9D A;  3F31 A;  3ZMZ B;  3RH3 A;  2MTQ A;  4XZC A;  3FBZ A;  4HN9 A;  4U74 A;  5LGT B;  3VKG A;  1IAP A;  2LSG A;  3MJX A;  2Q9Q C;  4UF0 A;  4OFZ A;  4IDZ A;  3ZYM A;  1YW0 A;  2DNX A;  3PDY A;  3O4X E;  3ZPO A;  4XBF B;  5JDG A;  3N9P A;  2LSK A;  2I59 A;  3E08 A;  4YJ3 E;  4CI1 B;  3ZC0 A;  2CWY A;  3C4X A;  1NWM X;  2KWH A;  2MYS A;  1MMG A;  4KP3 C;  5AFU L;  1EZ3 A;  1HX8 A;  2W0G A;  3ANW A;  4X1Y E;  3QK6 A;  3TKL B;  4NUV A;  5JR9 B;  4H9Q C;  5LJM A;  3FXD B;  4OHF A;  3CQC B;  4O2B E;  4DMV A;  4B6X A;  5JQG E;  3IF8 B;  3MK7 C;  5LNK A;  1YD8 G;  2NTY A;  3ZMU B;  2WMN A;  3K3N A;  4L9I A;  2VL8 A;  1MIY A;  2N1G A;  1US7 B;  3LK2 B;  3OJA A;  5LGN B;  2V7K A;  3HKD E;  4IST A;  4H63 H;  5KX5 E;  1D0X A;  2WAU A;  2CXL A;  2KIN B;  1G73 A;  2NTX A;  1H7C A;  4TV8 E;  4EXT A;  4PK6 A;  3CVR A;  5FY1 A;  1QSD A;  2HPJ A;  5HYA A;  3Q2M A;  4ZI3 C;  2NW8 A;  1FMV A;  5ETW A;  1B7T A;  5DAB A;  3FBL A;  4TZ4 C;  2LJL A;  5DJQ C;  5IHY A;  4DBR A;  3IHR A;  2E9X A;  3FHN A;  2LM9 A;  5L3E B;  3KV9 A;  2LHN A;  3CX8 B;  4G2A A;  3ZMS B;  5JR9 C;  3ZYK A;  1FMW A;  3VU7 H;  4AKL A;  2BDE A;  2OA5 A;  2MOZ A;  2D5U A;  3MAC A;  4H9O C;  4PK5 A;  3HKB E;  1E1H B;  2IAK A;  3QUJ A;  2JRK A;  2YEV C;  2XAQ B;  4EYY R;  3NZP A;  1MMD A;  2W63 A;  4ZI2 C;  4PJM A;  5LP6 E;  3A5X A;  4OK0 A;  3N2G E;  5DQV A;  4HTE A;  4AKG A;  1IJ6 A;  4QX8 B;  5ADX L;  3W15 B;  3ETV A;  3F2E A;  4AI6 A;  4O8S A;  3NRY A;  4AXP A;  3FB2 A;  2ZM0 A;  4HKA A;  3C50 A;  5HXR A;  3BK9 A;  2QA7 A;  4BJM A;  3KVA A;  4UV8 B;  4ERR A;  1HG5 A;  4QXH B;  3KV4 A;  2LSI A;  1WRD A;  3N9O A;  3C51 A;  5J1G A;  2L8K A;  3CWZ B;  2ZLY A;  3I1A A;  4MBQ A;  2ZM8 A;  2EHO B;  4X20 E;  2X67 A;  3UUL A;  2Q9Q D;  4DBQ A;  2M67 A;  4IE6 A;  2KLQ A;  3RC3 A;  5JDH A;  2ODV A;  2WM9 A;  4PJL A;  1D1B A;  1LVK A;  2ES0 A;  2KZ7 B;  4J2C A;  2V7I A;  4Z8X A;  2V1D B;  2LOP A;  4O4I E;  4IE4 A;  4O4H E;  2DWG A;  4QKN A;  1MMA A;  2K5B B;  4O2A E;  5L3G B;  4YLH A;  3DP7 A;  5DQW A;  4EZ4 A;  3CX6 B;  3HA4 A;  2XUE A;  3SOL A;  4L5G A;  3ETU A;  4NUU A;  1WYC A;  3AAA B;  2LOS A;  5JVD E;  4UF0 B;  4GYR A;  5L3F B;  2CE7 A;  1UX4 A;  5A1L A;  1KK7 A;  3B57 A;  4UIG A;  1AJ3 A;  3UFE A;  3VKH A;  5HAX A;  4CZZ B;  3PUR A;  4PAG A;  2WMO A;  5JDN A;  2JMH A;  2ACX A;  4X1I E;  4TV9 E;  3ZC1 A;  3KIN B;  4JLE A;  3QC9 A;  5FXZ A;  3O9X A;  5FY0 A;  3I0Q A;  2KT9 A;  4OYJ A;  4BAY B;  5L2L A;  3J7Y q;  2YIN A;  3KFW X;  2Q9Q A;  3ANW B;  3EDU A;  2EHO C;  3I9W A;  3EUH A;  2LEH A;  5FNV E;  3LJC A;  5HXC A;  4WBN E;  5CA0 E;  5JDQ A;  2H7V C;  5LHG B;  4U72 A;  3GWH A;  4HE8 A;  1Y64 B;  4UEL A;  2W62 A;  4I43 B;  3L3P A;  2IW5 B;  3Q5X A;  3ZJ2 A;  3AA1 B;  2NP9 A;  3N2K E;  4XAX B;  4P09 A;  2E9X D;  3VHL A;  1FIO A;  4O4J E;  2DCF A;  4QWN B;  5FXV A;  4IE5 A;  2ODU A;  3SWH A;  4EOZ B;  3UUM A;  4BA9 A;  1WR6 A;  5EZY E;  1WYB A;  3OKQ A;  4HEA A;  2P9B A;  2Y48 B;  3R6N A;  5H6R B;  5KDM C;  2D0T A;  2SPC A;  4FI5 A;  1IZN B;  1QUU A;  3UUN A;  4ZI2 D;  3Q9D A;  3EDV A;  3OBV E;  3ZN0 B;  4ZI7 E;  3PUG A;  4QX7 B;  2WBL A;  2DHR A;  3L09 A;  2JMK A;  3ZCI A;  3AB3 B;  5HXH A;  5LHH B;  1IJ5 A;  4TUY E;  2VKD A;  3E22 E;  4EB6 E;  3CQG B;  3F57 A;  4DVD A;  2WSS V;  3C4W A;  3V5U A;  3U3I A;  3WAK A;  3SRZ A;  4GK5 E;  4YHJ A;  4CI3 B;  3AA7 B;  3PU8 A;  3J9X 1;  5JRC B;  4IGU A;  1SHZ C;  1BR2 A;  5GON E;  5JR9 A;  4UVA B;  3KV6 A;  3RPU A;  1OXZ A;  4BJN A;  4MFR A;  4WNK A;  5LJN A;  4L0R A;  3N5L A;  3LK3 B;  3RYC E;  5TAO A;  1D0Y A;  3ZMT B;  1MIV A;  2DI4 A;  4IE7 A;  3CX7 B;  3N2O A;  3SS1 A;  4O4L E;  2NWB A;  3AA6 B;  4WW0 A;  1MMN A;  4P0A A;  2X66 A;  2Y8D A;  3AAI A;  5LHI B;  2L9Q A;  3H3A A;  1HCI A;  3O1H A;  4MHC A;  4CXY A;  5EK2 A;  1VRB A;  2LHR A;  2YU1 A;  5EK3 A;  1VOM A;  1CUN A;  2WWU A;  5J2U E;  3LFM A;  4PJN A;  3UT5 E;  1U4Q A;  3N9L A;  2C5I T;  3FXE B;  4TN7 B;  1YKE B;  4KMC A;  4WBO A;  4H9N C;  3JC6 D;  2C5J A;  4JEH B;  2PJQ A;  4IE0 A;  4PW8 A;  3MZK B;  3LBX B;  2G0U A;  3E0Z A;  1HF8 A;  2X9X A;  5HWY A;  3ZLI A;  3R84 B;  5LYJ E;  2EHO D;  1X79 A;  1MNE A;  4H9R C;  1LRZ A;  2XTL A;  3M65 A;  3UUX B;  2KXP B;  5IYZ E;  3S4U A;  3GN5 B;  2Y6X A;  4CXW A;  3PE0 A;  4H63 V;  3OYZ A;  4PJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...