2LM9A

The nmr structure of a major allergen from dust mite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
96
structure length
96
Chain Sequence
NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure and IgE epitopes of Blo t 21, a major dust mite allergen from Blomia tropicalis
pubmed doi rcsb
source organism Blomia tropicalis
molecule tags Allergen
molecule keywords Blo t 21 allergen
total genus 42
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lm9A00
2LM9A 2JMHA 2JRKA
chains in the Genus database with same CATH superfamily
4JI4T 1HF8A 3L09A 2XHEB 3MXZA 1I6ZA 2XQYA 2NR4A 4TWHA 4WZXA 4X1YE 2Q9QB 4OK0A 4MALA 4H9QC 3ZN0B 3HL6A 4DV6T 1V9DA 2KNDA 3BQKA 3NKZA 3O4XE 4TNWA 3K3QC 5LYJE 1IBMT 5L3EB 1AJ3A 2C5JA 3JC6C 3OBVE 1BR4A 2CCQA 5DJQC 5AQSB 3FZFB 3RI5A 3RIAA 5L3BB 1YQ4A 3NWIA 1KNRA 3ZJ1A 1HG2A 3EVYA 1KK7A 2FBWA 5EK3A 2FJEA 5TAOA 2WSSV 2KT9A 3UUMA 4CN4A 1IJ6A 3K1SA 3VR9A 4GIWA 3P50A 2K9AA 1I94T 4DBRA 4AI6A 4PJJA 4HWFA 4YSXA 4TX5A 3ZMUB 5CFBA 1KEYA 2PJQA 4G2AA 2DWGA 4AKGA 5LG3A 5IWAT 4DV7T 4DMWA 3IF8B 3BQIA 3P4PA 1IJ5A 4PW8A 1DU2A 4ZI3D 4KI0F 3BK9A 2FJAA 2NW7A 2VL0A 3RX6A 3TKLB 5FMNA 4TWFA 2V5DA 1NENA 2XQ5A 4IE6A 4ILUA 4ZOLE 1J5ET 5LHHB 4JUYA 3OTOT 2E5LT 2KXPB 3HKCE 2UXCT 1OXZA 2LM9A 3PU8A 2H7VC 4U31A 1OEDB 4L9IA 2DNXA 4ADZA 4DR5T 2A72A 2BKNA 4NXNT 2LSYA 4DR2T 5HCMA 2LRLA 2WCAA 3C4WA 2NP9A 4YFSA 1IBKT 1Y01A 3ZMVB 1H7CA 4CN1A 4YT0A 1HX1B 3PE0A 3GN5B 4XBFB 2ODVA 2FJDA 2JPFA 4ZHQE 2UUCT 3HA4A 3ETVA 5HCJA 2Q9QA 4KP3C 4CI3B 1N36T 2F4VT 4N78D 2V7LA 3G06A 3GN5A 3K3NA 5FXZA 3DTOA 5H6RB 5FL1A 3O9XA 3H3MA 2B76A 3AE1A 3E08A 4KUMB 3C4XA 3ZMSB 2VWAA 2X68A 2YDSA 3EUHA 3FBZA 4EAHA 2WB5A 1YD8G 4MLKA 3VKGA 3KBTA 4PNIA 3CKDA 4ILCA 3VRBA 2X9WA 3P7IA 4O4JE 3AE8A 2UUBT 5LJNA 1M7KA 4ISSA 2VKOA 1JNZA 2J1DG 4Z91A 5FYMA 3ZSSA 5EZYE 1GQEA 2BKOA 5EK4A 3ZN1B 5J2TE 3FXEB 2NW9A 2CXFA 3DJBA 5ABEA 1CUNA 3KDSE 5BMVE 4JI5T 4AKIA 3PUYF 4P1NA 2CXLA 2X9HA 4IL4A 3EHZA 4DVDA 4U3CA 1D1CA 2W0GA 2IHR1 3ZLIA 3LK42 4TV8E 4AKRB 4UF0A 4DV1T 2XM2A 3GWHA 2XTLA 3N5LA 5CB4E 4IREA 2Q9QC 3FZMB 4JI8T 3I9WA 4H9NC 4HEAA 3I0QA 2XSBA 1HX8A 2JQKA 1XNRT 5HXHA 5JRCA 4ZS3A 2D0UA 2CLYC 3L39A 4ANJA 4XAXB 2V6YA 2H7OA 4CI1B 2HH7A 2JRKA 2XAGB 3NRYA 2K24A 3MA9A 3PUQA 4WW0A 4F6RC 4HFHA 3R84B 3O1JA 2DI4A 3ONXA 3Q9DA 4HFVA 1MNDA 2DHRA 2I0MA 2M6BA 4ZZBA 3ZJ2A 3JAFA 3V5SA 2OA5A 3ZYKA 4EOZB 2L9QA 4UV9B 2YU1A 3AEBA 5L4HA 2W67A 5HWYA 3J7Yq 4KBMB 1D0ZA 3HR0A 5AQKB 5C2TA 5ETWA 3GA8A 5J1GA 4WBNE 2EHOA 3M3ZB 2VKDA 2CLYB 2LSIA 2D2SA 1KF6A 5CJ5A 2CBIA 1FEWA 2N2NA 2YDQA 2J62A 2QRXA 1WFDA 3NZQA 4YTMA 2CBJA 1WYCA 3ONLC 5AQUB 5FY0A 2LSKA 5CA1E 4DR7T 3AXJA 5J0ZA 2WZIA 2KZ7B 4PK4A 5FY7A 1E1HB 5DQVA 2G0UA 2WM9A 3U78A 2UU9T 4MBQA 4WBOA 2QYWA 3FZLB 4LF4T 1U5PA 2W61A 4IHJE 2V8SV 2NW8A 2LJLA 2WY2A 2YEVC 4TN7B 4AIUA 4PJLA 5KXJA 3C98B 3CMLA 4O4HE 2HN1A 3SS1A 4EXTA 3RRCA 3ANWA 5JR9A 4ZI2D 2IW5B 1ZEEA 3PUGA 4ZXLA 2BBJA 3I1AA 4KHZF 2D9DA 3S4UA 4C91A 2VQFT 3CPZA 2JQHA 4LFCT 4PK6A 1WRDA 5LOVE 5KX5E 1CHUA 2X0LB 4LF5T 2XPKA 2WDRA 2ACZA 2LSGA 4GOUA 3RRWA 3VR8A 5AQRB 4LF8T 1LVFA 3MACA 5DQWA 1J1JA 1VOMA 3LK2B 4NXMT 2IC6A 3KFWX 3UU4A 4YY3T 5JVDE 4LFBT 2HPJA 2V5CA 3CX6B 3ONJA 3OPCA 3P8CD 4NUVA 3A7MA 2WDVA 2WMOA 5AQGB 3EDVA 3FZHB 4UVBB 4DV3T 4OX9T 1NAFA 5HEOA 4IT4A 1L0VA 2CEAA 2IIUA 4Z8XA 2Y8DA 4IDOA 4JEUB 5FL0A 3FB2A 5FY1A 2XZEA 3QOFA 4A97A 3NZPA 2EHOD 3HKEE 3AEAA 2H88A 3QNUA 4HWDA 4O2AE 4YXDA 5LG4A 3Q5DA 1NWMX 1XDOA 4JI7T 2CWOA 4COFA 3N9LA 4U7YA 4IGUA 2V7JA 3AE7A 2X51A 4UV8B 3TLVA 1W0AA 1IBLT 2MPKA 4ZI2C 1HNXT 3UU6A 3LBXB 1FIOA 2PTFA 3P4WA 4ILAA 3UU3A 5DABA 4YLHA 1M62A 2P9BA 4ZI3C 4JV5T 3LJCA 1Z8UA 2FJBA 3K8PC 3PTRB 5HWXA 2MOZA 2XAFB 3AEFA 2AXDS 3B13A 2CE7A 2D0TA 2DLRA 2X0YA 1UGOA 3HI2A 2LKGA 5AFUL 4P09A 1BR1A 3ZMTB 3Q5XA 2LSJA 5LCYA 3UQ4A 1YQ3A 3SOLA 3ZKRA 3UQ7A 4WYVA 3KV9A 4X1KE 4CXYA 2VURA 4X65T 2WU2A 1W9RA 2W00A 3ETUA 5AQQB 4KX6A 3MK7C 2MYSA 1HS7A 2WU5A 2W62A 2LRKA 4HWCA 3VKHA 4ZI7E 3KV4A 5AQFB 5JH7E 3AE2A 5LHIB 3TLWA 4YJ2E 3RF1A 1W09A 3N2OA 2A2FX 3PURA 3CQCB 4NPPA 3RKGA 5JDNA 4U2YA 2XASB 3AECA 2VVSA 3QB5A 4AXPA 4CN6A 5LXTE 4JYAT 4EIWA 4PJMA 3C51A 3CQGB 3AEGA 2ZM6T 2E2AA 4E7SA 3PJAA 3OVUA 2WBLA 3PUXF 3RYFE 2CA5A 2VQET 3AXJB 4DR3T 2JMKA 4YHHT 1D1AA 3OYZA 4G63A 5JDFA 3VHLA 4UXNB 4H9PC 3E22E 5C3JA 3TLSA 5FP3A 3PUVF 2BKPA 2R6GF 2LOPA 3FHNA 3NBXX 4HN9A 5AQJB 3RYIE 3CVRA 4M1PA 4DIDB 3X1DA 3C50A 2JQ9A 1T7SA 4EYYR 1D1BA 2KINB 2A3DA 2PFVA 4IDQA 4L5GA 4O8SA 1HG5A 4TV9E 4CXWA 2Y48B 2KMFA 2A9UA 1UK5A 3RH3A 2CRBA 5L3GB 2XAQB 5JDMA 5LP6E 2ZM2A 2E5VA 4YHJA 1YW0A 4AISA 5FVKA 5CGMA 4OFZA 1HNZT 4HWHA 3N9NA 2EHOC 4H63H 1XNQT 2Q9QD 3P4RA 4TUYE 3E0ZA 5IYZE 2WZHA 4B3MT 1VCSA 1KNZA 2BVMA 2LLYA 4IE5A 2XQ7A 4KMCA 5F5WA 1MIYA 2CMRA 5ABFA 5L3CB 4HTEA 4LF7T 3I0OA 4B3RT 5LHGB 1WLXA 3CWZB 3RPUA 3ZT6A 3HKBE 4JI3T 1LVKA 3OKQA 1LRZA 4UELA 2UXBT 4ISTA 5L3FB 3CIRA 3T8OA 1MMNA 2HPLA 1QUUA 1BR2A 2NTYA 3AAEB 2QGSA 2V26A 2LOSA 1Z0PA 2XAHB 5C8YE 1OWAA 1Y64B 4E7ZA 4DUZT 4H9OC 4LF9T 2NWBA 2JIWA 2N1GA 3UFEA 1KNPA 5GONE 5HXEA 2KLQA 3CQXC 3UULA 3VRAA 4DNDA 3PDYA 3QK6A 1HR0T 4HFDA 4A98A 5JREA 4AKLA 2BZBA 2ZM0A 2ODUA 4UVCB 3LG7A 3UU5A 3RQWA 4EV6A 1MIVA 3L8RA 4TWDA 4UF0B 4EB6E 2ACXA 3KBUA 4IE4A 3QB5K 3RIUA 2KWHA 2BBHA 3PJAJ 4DV5T 4NUUA 1YKEB 3SFDA 1O3XA 1G73A 4OYKA 5E0OA 2LM2A 4QXBB 3BQLA 4JI2T 4AQFC 5ADXL 4UVAB 2C5IT 3AE3A 2XQ6A 1WR6A 4J2CA 3R6NA 3AE4A 3RHWA 5AQVB 3T1HT 5LBQB 3PUSA 4QH5A 3ZT5A 5HYAA 3AB3B 4YJ3E 5JRCB 1D0XA 4TNVA 3EAMA 4CZZB 4CXXA 2IUBA 2YN6A 3ZPOA 5M4YA 4DV4T 3T1YT 4JI0T 4NIQA 3IEEA 3EABA 3PV0F 4I43B 2MAWA 1E7PA 4WNKA 3OJAA 4JEHB 5HEGA 2W2UA 3KV6A 2IAKA 2I6HA 2XQ8A 3KVAA 2IMLA 3JC6D 4O2BE 5AQIB 5JDLA 2H89A 1ZHCA 4EGWA 2BS3A 3P4SA 4IDNA 1J5WA 3AAAB 4X62T 4GK0E 2Y6XA 3ABVA 4FI5A 3N9OA 4YTPA 3FBLA 4MHCA 5JTGA 4DR1T 5AQPB 5FVLA 3SWHA 3N2GE 2YK0A 2V7KA 5FXXA 3ZC1A 2ZLYA 5F3JA 4A5XA 3C4ZA 1E2AA 1SE7A 2W63A 4I50E 5HEJA 2LHNA 2CPTA 4PFOA 3PU3A 5FXWA 4QX8B 3L3PA 3MZKB 3QC9A 4EZHA 2HN2A 4QH4A 4IDPA 3ESLA 4BAYB 5IHYA 1US7B 2BS4A 2X9XA 3PUZF 2DWKA 2K5BB 2X9YA 3UT5E 1W0BA 3AA6B 5IUXA 2HHHT 2UUAT 1N32T 2JMHA 2RA1A 2XQAA 4LMKA 3FZKB 2C5KT 3Q5WA 5AQMB 2XSAA 4HGAA 1T8BA 5ABGA 2KWIB 4EZ4A 1MMAA 3O1HA 4KHPT 1UX5A 5JDGA 5AQTB 5J2UE 2W66A 4QHOA 1XMQT 2QVAA 5AQOB 3AA7B 3ANWB 3MJXA 5KDMC 2LE8A 2UXNB 2BS2A 1YXRA 1UURA 3Q2MA 5H6QB 3CX7B 3I9YA 4CQIA 3RKOA 1MNEA 2V6YB 1VCTA 3DP7A 4QH1A 5A1LA 1HCIA 1U4QA 2CHOA 3KVBA 5LA6E 2L3LA 3RIFA 4DO0A 2XQ3A 2J47A 2Z6EA 4I0UA 2LT3A 4I4TE 4U33A 4UIGA 2OV9A 4U74A 4CI2B 4LF6T 1ZOYA 3C64A 2CM0A 5HXRA 4O4IE 4JI6T 2K48A 4UEMA 5EK2A 3CK6A 1WR0A 4F8HA 3JAEA 3B5MA 1ZKEA 1FMWA 4AQFA 2X66A 3VU7H 3NVOA 4IE7A 4EYUA 3AVSA 5CA0E 2X0HA 3WI3A 4QXCB 2FUPA 3J9X1 4DV0T 4DV2T 4JBWF 5L2LA 2D5UA 4DUYT 2H3RA 3AE9A 4DMVA 1D0YA 2XJ7A 5HAXA 5KMGP 2WS3A 3LDQB 4HFBA 4X66T 4DR4T 3AA0B 3LSVA 4O4LE 2V7IA 3UU8A 3CX8B 2WDQA 2BG9A 2E9XB 2LKHA 4GK5E 4B6XA 3IBPA 4HFIA 3ZMZB 2YU2A 2YOEA 4H9SE 3N2KE 5F8PA 5FXVA 2V1DB 3RGLA 3RIUC 2VKHA 3GMIA 1ZP0A 4PJNA 2MTQA 3AE5A 1SUMB 3ZYMA 5LBMA 4YTNA 3RC8A 1G8XA 2X67A 4DBQA 4GKJT 4LMLA 5LMNT 1XDPA 2ES0A 3HKDE 3UFGA 4PK5A 3UTKA 1T98A 3LFMA 3UUNA 2VK9A 2YDRA 3OYXA 2BDEA 3F57A 4IDZA 4BA9A 2YINA 4IE0A 4P0AA 4QKNA 3LK3B 3FXDB 1N34T 3RQUA 3U3IA 4HWIB 4DR6T 3PUAA 3N9QA 2E9XD 4MFRA 5ABHA 4JI1T 1XMOT 3F31A 4X5TA 1FMVA 2OLTA 5AQHB 3KINB 3KV5A 2QA7A 4X1IE 1XWMA 5LB7B 4ZZCA 4OYJA 4Q25A 3TLUA 3AEDA 4U2ZA 5JDHA 1MMDA 1HNWT 2I59A 4AQGA 3RLFF 1FJGT 2VVNA 4YSYA 4AQYT 1X79A 4X64T 4GKKT 2AE9A 2JQQA 3MKDA 2BVLA 4ASKA 2E8IA 2E9XC 5LGNB 4HFEA 3PUWF 1HFAA 1S94A 4L0RA 1IZNB 1UX4A 4QX7B 2PBIA 2SPCA 3H37A 4C90A 1SA0E 2J4GA 3AEEA 5HXCA 4BJMA 4IIJE 3ZT7A 4FJOA 3LBXA 2VASA 3AA1B 2XQ9A 1UUSA 4HE8A 2IC9A 3P4QA 2ZMAA 3D0TA 4OHFA 4PAGA 2JJ9A 3ZCIA 1S35A 2BG9B 2E9XA 3A8YC 4U72A 4B3ST 4H63V 2LHRA 2V6XA 2DCFA 4JLEA 2C0SA 2XY8B 3O1IA 4ZEYA 1T72A 2IDOB 1R8IA 2VB6A 4IL9A 4XZCA 2V7MA 5AQLB 3AVRA 4UR9A 3UUBA 4YSZA 3NRXA 4X20E 5FKYA 3M65A 5JQGE 4EEBA 1SHZC 2GK9A 3ZSTA 3UUXB 3ZCJA 2M67A 3B57A 2B1EA 4PFPA 2L8KA 1X9BA 1OEDC 2NOXA 4HKAA 2CXDA 3SFEA 5JR9B 4U7IA 3WAJA 1EZ3A 1HTJF 5HEHA 2MBGA 1NEKA 2PG8A 2WWUA 4QXHB 1JNRA 2CWYA 3K3OA 4ZS2A 2CHNA 3WAKA 4AKHA 3EDUA 2XM1A 4K0KT 1QSDA 3H3AA 4TZ4C 3W15B 4EEDA 3JADA 5LNKA 5ABFB 3Q5EA 1B7TA 2RPAA 3V5UA 4LFAT 5LJMA 4B3TT 2WAUA 1BR0A 2LEHA 1QLBA 2WWVA 1IAPA 3QUJA 3RYCE 2BG9C 3F2EA 4A56A 2W4XA 1OEDE 2XAJB 2K3WA 3N9PA 5LGUB 2UXXB 2EHOB 5HEUA 3A5XA 3RYHE 2VKJA 5L3DB 1WCRA 1ZV4X 5LGTB 1N33T 3TLTA 1VRBA 1XZYA 3AAIA 2DL1A 3AE6A 5JDQA 3IHRA 4ILBA 5AQNB 4V1Av 2YKSA 4GYSA 2KSRA 2NTXA 2XUEA 5HXSA 5FNVE 1MIWA 5JR9C 3JCFA 2BG9E 3IA3A 4ERRA 1WYBA 5L47A 2UXDT 1MMGA 1YKHB 2VL8A 3N9MA 4I55E 2N9DA 3ZC0A 2RP4A 1OEDA 1LKXA 4P0BA 2ZM8A 2WMNA 4H9RC 3RC3A 3EI0A 4K0UA 4QWNB 1KFYA 3SRZA 3ZYLA 4Z90A 4BJNA 4GYRA 5BR8T 2XQ4A 2WP9A 2WQYA 5L4EA 5LMUT 3ZEFB 4LMJA 4HFCA 2M6IA 1UCUA
chains in the Genus database with same CATH topology
1HF8A 3L09A 2XHEB 3MXZA 2XQYA 4X1YE 2Q9QB 4OK0A 4MALA 4H9QC 3ZN0B 3HL6A 1V9DA 2KNDA 3BQKA 3O4XE 5LYJE 3K3QC 5L3EB 1AJ3A 2C5JA 3JC6C 3OBVE 1BR4A 2CCQA 5DJQC 5L3BB 3ZJ1A 1HG2A 3EVYA 1KK7A 5EK3A 5TAOA 2WSSV 2KT9A 3UUMA 1IJ6A 4GIWA 2K9AA 4AI6A 4PJJA 4TX5A 3ZMUB 2PJQA 4G2AA 2DWGA 4AKGA 4DMWA 3IF8B 3BQIA 1IJ5A 4PW8A 4ZI3D 3BK9A 2NW7A 3TKLB 3RX6A 5FMNA 4ZOLE 4IE6A 4ILUA 5LHHB 4JUYA 2KXPB 3HKCE 1OXZA 2LM9A 3PU8A 2H7VC 4L9IA 2DNXA 4ADZA 2A72A 2LSYA 3C4WA 4YFSA 2NP9A 3ZMVB 1H7CA 3PE0A 3GN5B 4XBFB 2ODVA 2JPFA 4ZHQE 3HA4A 3ETVA 2Q9QA 4KP3C 4N78D 2V7LA 3GN5A 3K3NA 5FXZA 3DTOA 5H6RB 3O9XA 4KUMB 3E08A 3ZMSB 3C4XA 2VWAA 2X68A 3EUHA 3FBZA 4EAHA 1YD8G 4MLKA 3VKGA 3KBTA 4PNIA 3CKDA 2X9WA 3P7IA 4O4JE 5LJNA 5FYMA 4ISSA 2VKOA 2J1DG 3ZEFB 5EZYE 3ZN1B 5J2TE 5EK4A 3FXEB 2NW9A 2CXFA 3DJBA 1CUNA 3KDSE 4AKIA 2CXLA 2X9HA 4DVDA 1D1CA 2W0GA 3ZLIA 3LK42 4TV8E 4AKRB 4UF0A 3GWHA 2XTLA 3N5LA 5CB4E 2Q9QC 3I9WA 4H9NC 4HEAA 3I0QA 1HX8A 5HXHA 5JRCA 4ZS3A 2D0UA 2CLYC 4ANJA 4XAXB 4CI1B 2H7OA 2HH7A 2JRKA 2XAGB 3NRYA 2K24A 3MA9A 3PUQA 4WW0A 4F6RC 3R84B 3O1JA 2DI4A 3ONXA 3Q9DA 4HFVA 1MNDA 2DHRA 3ZJ2A 3V5SA 2OA5A 3ZYKA 4EOZB 2L9QA 4UV9B 2YU1A 5HWYA 3J7Yq 4KBMB 1D0ZA 3HR0A 5ETWA 3GA8A 5J1GA 4WBNE 2EHOA 2VKDA 2CLYB 2LSIA 2D2SA 1FEWA 2N2NA 5BMVE 3NZQA 5FY0A 1WYCA 5CA1E 2LSKA 2KZ7B 4PK4A 5FY7A 1E1HB 5DQVA 2G0UA 2WM9A 3U78A 4MBQA 4WBOA 1U5PA 2W61A 4IHJE 2YEVC 2NW8A 2LJLA 4TN7B 4DBRA 4PJLA 3C98B 3CMLA 4O4HE 3SS1A 4EXTA 3RRCA 3ANWA 5JR9A 4ZI2D 2IW5B 1ZEEA 3PUGA 3I1AA 3S4UA 4C91A 3CPZA 4PK6A 1WRDA 5LOVE 5KX5E 2X0LB 2LSGA 4GOUA 3RRWA 1LVFA 3MACA 5DQWA 1VOMA 3LK2B 2IC6A 3KFWX 5JVDE 2HPJA 3CX6B 3P8CD 4NUVA 2WMOA 3EDVA 4UVBB 1NAFA 2CEAA 4Z8XA 2Y8DA 4JEUB 3FB2A 5FY1A 3NZPA 2EHOD 3HKEE 4O2AE 5LG4A 1NWMX 2CWOA 3N9LA 4IGUA 2V7JA 4UV8B 2X51A 4ZI2C 3LBXB 1FIOA 5DABA 4YLHA 4ZI3C 2P9BA 3LJCA 3PTRB 3K8PC 5HWXA 2MOZA 2XAFB 3B13A 3HI2A 2CE7A 2D0TA 2DLRA 5AFUL 4P09A 1BR1A 3ZMTB 3Q5XA 2LSJA 5LCYA 3SOLA 3KV9A 4X1KE 4CXYA 2W00A 3ETUA 3MK7C 2MYSA 1HS7A 2W62A 3VKHA 4ZI7E 3KV4A 5JH7E 5LHIB 3PURA 3N2OA 2A2FX 3CQCB 5JDNA 2XASB 4AXPA 5LXTE 4EIWA 4PJMA 3C51A 3CQGB 4E7SA 2WBLA 3RYFE 2CA5A 2JMKA 1D1AA 3OYZA 4G63A 5JDFA 3VHLA 4UXNB 4H9PC 3E22E 5FP3A 2LOPA 3FHNA 3NBXX 4HN9A 3RYIE 5F3JA 3CVRA 4M1PA 4EYYR 5JDLA 3C50A 1D1BA 2KINB 2A3DA 2PFVA 4O8SA 4L5GA 4TV9E 1HG5A 4CXWA 2Y48B 2KMFA 3RH3A 5LP6E 5L3GB 2XAQB 5JDMA 2ZM2A 4YHJA 1YW0A 4OFZA 3N9NA 2EHOC 4H63H 2Q9QD 4TUYE 3E0ZA 5IYZE 1KNZA 2BVMA 4IE5A 4KMCA 1MIYA 2CMRA 5L3CB 4HTEA 3I0OA 5LHGB 1WLXA 3CWZB 3RPUA 3HKBE 1LVKA 3OKQA 1LRZA 4UELA 4ISTA 5L3FB 3T8OA 1MMNA 2HPLA 1QUUA 1BR2A 2NTYA 3AAEB 2QGSA 2V26A 2LOSA 1Z0PA 2XAHB 5C8YE 1OWAA 1Y64B 4E7ZA 4H9OC 2NWBA 2N1GA 3UFEA 5GONE 5HXEA 2KLQA 3CQXC 3UULA 4DNDA 3PDYA 3QK6A 5JREA 4AKLA 2BZBA 2ZM0A 2ODUA 4UVCB 3LG7A 1MIVA 4EB6E 4UF0B 2ACXA 3KBUA 4IE4A 2KWHA 4NUUA 1YKEB 1O3XA 1G73A 4OYKA 5E0OA 4QXBB 3BQLA 4AQFC 5ADXL 4UVAB 2C5IT 4J2CA 3R6NA 1WR6A 5LBQB 3PUSA 5HYAA 3AB3B 4YJ3E 5JRCB 1D0XA 4CZZB 4CXXA 3ZPOA 3IEEA 4I43B 4WNKA 3OJAA 4JEHB 3KV6A 2IAKA 4O2BE 3KVAA 3JC6D 1ZHCA 3AAAB 4GK0E 2Y6XA 4FI5A 3N9OA 3FBLA 4MHCA 3SWHA 3N2GE 2YK0A 2V7KA 5FXXA 3ZC1A 2ZLYA 3C4ZA 2W63A 4I50E 2LHNA 4PFOA 5FXWA 3PU3A 4EZHA 4QX8B 3L3PA 3MZKB 3QC9A 4BAYB 3ESLA 5M4YA 5IHYA 1US7B 2X9XA 2DWKA 2K5BB 2X9YA 3UT5E 3AA6B 2JMHA 2RA1A 2C5KT 3Q5WA 4HGAA 4EZ4A 2KWIB 1MMAA 3O1HA 1UX5A 5JDGA 5J2UE 4QHOA 3AA7B 3ANWB 3MJXA 5KDMC 2LE8A 2UXNB 3Q2MA 5H6QB 3CX7B 3I9YA 4CQIA 3RKOA 1MNEA 3DP7A 5A1LA 1HCIA 1U4QA 3KVBA 5LA6E 2L3LA 4DO0A 2Z6EA 2LT3A 4I4TE 4UIGA 4U74A 4CI2B 3C64A 2CM0A 5HXRA 4O4IE 2K48A 4UEMA 5EK2A 1ZKEA 1FMWA 4AQFA 2X66A 3VU7H 4IE7A 4EYUA 3AVSA 5CA0E 3WI3A 4QXCB 3J9X1 5L2LA 2D5UA 2H3RA 4DMVA 1D0YA 5HAXA 5KMGP 3AA0B 4O4LE 2V7IA 3CX8B 2E9XB 4GK5E 4B6XA 3IBPA 3ZMZB 2YU2A 4H9SE 5F8PA 3N2KE 5FXVA 2V1DB 2VKHA 3GMIA 4PJNA 2MTQA 3ZYMA 5LBMA 3RC8A 1G8XA 2X67A 4DBQA 2ES0A 3HKDE 4CI3B 3UTKA 4PK5A 3UUNA 1T98A 3LFMA 4BA9A 2VK9A 3OYXA 2BDEA 3F57A 4IDZA 4P0AA 2YINA 4IE0A 4QKNA 3LK3B 3FXDB 3U3IA 3PUAA 3N9QA 2E9XD 4MFRA 3F31A 1FMVA 3KINB 3KV5A 2QA7A 4X1IE 4OYJA 5JDHA 1MMDA 2I59A 4AQGA 1X79A 2JQQA 3MKDA 2BVLA 4ASKA 2E8IA 2E9XC 5LGNB 4L0RA 1HFAA 1S94A 4QX7B 1IZNB 1UX4A 2PBIA 2SPCA 3H37A 4C90A 1SA0E 4BJMA 5HXCA 4IIJE 4FJOA 3LBXA 2VASA 3AA1B 4HE8A 2IC9A 3ZCIA 2ZMAA 3D0TA 4OHFA 4PAGA 2JJ9A 1S35A 2E9XA 4U72A 4H63V 2LHRA 4JLEA 2DCFA 2C0SA 3O1IA 2VB6A 4XZCA 2V7MA 3AVRA 3NRXA 4X20E 5JQGE 3M65A 1SHZC 2GK9A 3UUXB 3ZCJA 2M67A 3B57A 2B1EA 4PFPA 2L8KA 2NOXA 4HKAA 5JR9B 5LJMA 2CXDA 3WAJA 1EZ3A 1HTJF 2MBGA 2PG8A 4YJ2E 2WWUA 4QXHB 4ZS2A 2CWYA 3K3OA 3WAKA 4AKHA 3EDUA 1QSDA 3H3AA 4TZ4C 3W15B 5LNKA 1B7TA 3V5UA 2WAUA 1BR0A 2LEHA 1IAPA 3QUJA 3RYCE 3F2EA 4A56A 2XAJB 3N9PA 5LGUB 2UXXB 2EHOB 3RYHE 3A5XA 2VKJA 5L3DB 1ZV4X 5LGTB 5JDQA 1VRBA 3AAIA 3IHRA 4V1Av 4GYSA 2NTXA 2XUEA 5HXSA 5FNVE 1MIWA 5JR9C 4ERRA 1WYBA 1MMGA 1YKHB 2VL8A 3N9MA 4I55E 2N9DA 3ZC0A 2RP4A 1LKXA 4P0BA 2ZM8A 2WMNA 4H9RC 3RC3A 4K0UA 4QWNB 3SRZA 3ZYLA 4BJNA 4GYRA 1UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM9 A;  2JMH A;  2JRK A; 
#chains in the Genus database with same CATH topology
 4JI4 T;  1HF8 A;  3L09 A;  2XHE B;  3MXZ A;  1I6Z A;  2XQY A;  2NR4 A;  4TWH A;  4WZX A;  4X1Y E;  2Q9Q B;  4OK0 A;  4MAL A;  4H9Q C;  3ZN0 B;  3HL6 A;  4DV6 T;  1V9D A;  2KND A;  3BQK A;  3NKZ A;  3O4X E;  4TNW A;  3K3Q C;  5LYJ E;  1IBM T;  5L3E B;  1AJ3 A;  2C5J A;  3JC6 C;  3OBV E;  1BR4 A;  2CCQ A;  5DJQ C;  5AQS B;  3FZF B;  3RI5 A;  3RIA A;  5L3B B;  1YQ4 A;  3NWI A;  1KNR A;  3ZJ1 A;  1HG2 A;  3EVY A;  1KK7 A;  2FBW A;  5EK3 A;  2FJE A;  5TAO A;  2WSS V;  2KT9 A;  3UUM A;  4CN4 A;  1IJ6 A;  3K1S A;  3VR9 A;  4GIW A;  3P50 A;  2K9A A;  1I94 T;  4DBR A;  4AI6 A;  4PJJ A;  4HWF A;  4YSX A;  4TX5 A;  3ZMU B;  5CFB A;  1KEY A;  2PJQ A;  4G2A A;  2DWG A;  4AKG A;  5LG3 A;  5IWA T;  4DV7 T;  4DMW A;  3IF8 B;  3BQI A;  3P4P A;  1IJ5 A;  4PW8 A;  1DU2 A;  4ZI3 D;  4KI0 F;  3BK9 A;  2FJA A;  2NW7 A;  2VL0 A;  3RX6 A;  3TKL B;  5FMN A;  4TWF A;  2V5D A;  1NEN A;  2XQ5 A;  4IE6 A;  4ILU A;  4ZOL E;  1J5E T;  5LHH B;  4JUY A;  3OTO T;  2E5L T;  2KXP B;  3HKC E;  2UXC T;  1OXZ A;  2LM9 A;  3PU8 A;  2H7V C;  4U31 A;  1OED B;  4L9I A;  2DNX A;  4ADZ A;  4DR5 T;  2A72 A;  2BKN A;  4NXN T;  2LSY A;  4DR2 T;  5HCM A;  2LRL A;  2WCA A;  3C4W A;  2NP9 A;  4YFS A;  1IBK T;  1Y01 A;  3ZMV B;  1H7C A;  4CN1 A;  4YT0 A;  1HX1 B;  3PE0 A;  3GN5 B;  4XBF B;  2ODV A;  2FJD A;  2JPF A;  4ZHQ E;  2UUC T;  3HA4 A;  3ETV A;  5HCJ A;  2Q9Q A;  4KP3 C;  4CI3 B;  1N36 T;  2F4V T;  4N78 D;  2V7L A;  3G06 A;  3GN5 A;  3K3N A;  5FXZ A;  3DTO A;  5H6R B;  5FL1 A;  3O9X A;  3H3M A;  2B76 A;  3AE1 A;  3E08 A;  4KUM B;  3C4X A;  3ZMS B;  2VWA A;  2X68 A;  2YDS A;  3EUH A;  3FBZ A;  4EAH A;  2WB5 A;  1YD8 G;  4MLK A;  3VKG A;  3KBT A;  4PNI A;  3CKD A;  4ILC A;  3VRB A;  2X9W A;  3P7I A;  4O4J E;  3AE8 A;  2UUB T;  5LJN A;  1M7K A;  4ISS A;  2VKO A;  1JNZ A;  2J1D G;  4Z91 A;  5FYM A;  3ZSS A;  5EZY E;  1GQE A;  2BKO A;  5EK4 A;  3ZN1 B;  5J2T E;  3FXE B;  2NW9 A;  2CXF A;  3DJB A;  5ABE A;  1CUN A;  3KDS E;  5BMV E;  4JI5 T;  4AKI A;  3PUY F;  4P1N A;  2CXL A;  2X9H A;  4IL4 A;  3EHZ A;  4DVD A;  4U3C A;  1D1C A;  2W0G A;  2IHR 1;  3ZLI A;  3LK4 2;  4TV8 E;  4AKR B;  4UF0 A;  4DV1 T;  2XM2 A;  3GWH A;  2XTL A;  3N5L A;  5CB4 E;  4IRE A;  2Q9Q C;  3FZM B;  4JI8 T;  3I9W A;  4H9N C;  4HEA A;  3I0Q A;  2XSB A;  1HX8 A;  2JQK A;  1XNR T;  5HXH A;  5JRC A;  4ZS3 A;  2D0U A;  2CLY C;  3L39 A;  4ANJ A;  4XAX B;  2V6Y A;  2H7O A;  4CI1 B;  2HH7 A;  2JRK A;  2XAG B;  3NRY A;  2K24 A;  3MA9 A;  3PUQ A;  4WW0 A;  4F6R C;  4HFH A;  3R84 B;  3O1J A;  2DI4 A;  3ONX A;  3Q9D A;  4HFV A;  1MND A;  2DHR A;  2I0M A;  2M6B A;  4ZZB A;  3ZJ2 A;  3JAF A;  3V5S A;  2OA5 A;  3ZYK A;  4EOZ B;  2L9Q A;  4UV9 B;  2YU1 A;  3AEB A;  5L4H A;  2W67 A;  5HWY A;  3J7Y q;  4KBM B;  1D0Z A;  3HR0 A;  5AQK B;  5C2T A;  5ETW A;  3GA8 A;  5J1G A;  4WBN E;  2EHO A;  3M3Z B;  2VKD A;  2CLY B;  2LSI A;  2D2S A;  1KF6 A;  5CJ5 A;  2CBI A;  1FEW A;  2N2N A;  2YDQ A;  2J62 A;  2QRX A;  1WFD A;  3NZQ A;  4YTM A;  2CBJ A;  1WYC A;  3ONL C;  5AQU B;  5FY0 A;  2LSK A;  5CA1 E;  4DR7 T;  3AXJ A;  5J0Z A;  2WZI A;  2KZ7 B;  4PK4 A;  5FY7 A;  1E1H B;  5DQV A;  2G0U A;  2WM9 A;  3U78 A;  2UU9 T;  4MBQ A;  4WBO A;  2QYW A;  3FZL B;  4LF4 T;  1U5P A;  2W61 A;  4IHJ E;  2V8S V;  2NW8 A;  2LJL A;  2WY2 A;  2YEV C;  4TN7 B;  4AIU A;  4PJL A;  5KXJ A;  3C98 B;  3CML A;  4O4H E;  2HN1 A;  3SS1 A;  4EXT A;  3RRC A;  3ANW A;  5JR9 A;  4ZI2 D;  2IW5 B;  1ZEE A;  3PUG A;  4ZXL A;  2BBJ A;  3I1A A;  4KHZ F;  2D9D A;  3S4U A;  4C91 A;  2VQF T;  3CPZ A;  2JQH A;  4LFC T;  4PK6 A;  1WRD A;  5LOV E;  5KX5 E;  1CHU A;  2X0L B;  4LF5 T;  2XPK A;  2WDR A;  2ACZ A;  2LSG A;  4GOU A;  3RRW A;  3VR8 A;  5AQR B;  4LF8 T;  1LVF A;  3MAC A;  5DQW A;  1J1J A;  1VOM A;  3LK2 B;  4NXM T;  2IC6 A;  3KFW X;  3UU4 A;  4YY3 T;  5JVD E;  4LFB T;  2HPJ A;  2V5C A;  3CX6 B;  3ONJ A;  3OPC A;  3P8C D;  4NUV A;  3A7M A;  2WDV A;  2WMO A;  5AQG B;  3EDV A;  3FZH B;  4UVB B;  4DV3 T;  4OX9 T;  1NAF A;  5HEO A;  4IT4 A;  1L0V A;  2CEA A;  2IIU A;  4Z8X A;  2Y8D A;  4IDO A;  4JEU B;  5FL0 A;  3FB2 A;  5FY1 A;  2XZE A;  3QOF A;  4A97 A;  3NZP A;  2EHO D;  3HKE E;  3AEA A;  2H88 A;  3QNU A;  4HWD A;  4O2A E;  4YXD A;  5LG4 A;  3Q5D A;  1NWM X;  1XDO A;  4JI7 T;  2CWO A;  4COF A;  3N9L A;  4U7Y A;  4IGU A;  2V7J A;  3AE7 A;  2X51 A;  4UV8 B;  3TLV A;  1W0A A;  1IBL T;  2MPK A;  4ZI2 C;  1HNX T;  3UU6 A;  3LBX B;  1FIO A;  2PTF A;  3P4W A;  4ILA A;  3UU3 A;  5DAB A;  4YLH A;  1M62 A;  2P9B A;  4ZI3 C;  4JV5 T;  3LJC A;  1Z8U A;  2FJB A;  3K8P C;  3PTR B;  5HWX A;  2MOZ A;  2XAF B;  3AEF A;  2AXD S;  3B13 A;  2CE7 A;  2D0T A;  2DLR A;  2X0Y A;  1UGO A;  3HI2 A;  2LKG A;  5AFU L;  4P09 A;  1BR1 A;  3ZMT B;  3Q5X A;  2LSJ A;  5LCY A;  3UQ4 A;  1YQ3 A;  3SOL A;  3ZKR A;  3UQ7 A;  4WYV A;  3KV9 A;  4X1K E;  4CXY A;  2VUR A;  4X65 T;  2WU2 A;  1W9R A;  2W00 A;  3ETU A;  5AQQ B;  4KX6 A;  3MK7 C;  2MYS A;  1HS7 A;  2WU5 A;  2W62 A;  2LRK A;  4HWC A;  3VKH A;  4ZI7 E;  3KV4 A;  5AQF B;  5JH7 E;  3AE2 A;  5LHI B;  3TLW A;  4YJ2 E;  3RF1 A;  1W09 A;  3N2O A;  2A2F X;  3PUR A;  3CQC B;  4NPP A;  3RKG A;  5JDN A;  4U2Y A;  2XAS B;  3AEC A;  2VVS A;  3QB5 A;  4AXP A;  4CN6 A;  5LXT E;  4JYA T;  4EIW A;  4PJM A;  3C51 A;  3CQG B;  3AEG A;  2ZM6 T;  2E2A A;  4E7S A;  3PJA A;  3OVU A;  2WBL A;  3PUX F;  3RYF E;  2CA5 A;  2VQE T;  3AXJ B;  4DR3 T;  2JMK A;  4YHH T;  1D1A A;  3OYZ A;  4G63 A;  5JDF A;  3VHL A;  4UXN B;  4H9P C;  3E22 E;  5C3J A;  3TLS A;  5FP3 A;  3PUV F;  2BKP A;  2R6G F;  2LOP A;  3FHN A;  3NBX X;  4HN9 A;  5AQJ B;  3RYI E;  3CVR A;  4M1P A;  4DID B;  3X1D A;  3C50 A;  2JQ9 A;  1T7S A;  4EYY R;  1D1B A;  2KIN B;  2A3D A;  2PFV A;  4IDQ A;  4L5G A;  4O8S A;  1HG5 A;  4TV9 E;  4CXW A;  2Y48 B;  2KMF A;  2A9U A;  1UK5 A;  3RH3 A;  2CRB A;  5L3G B;  2XAQ B;  5JDM A;  5LP6 E;  2ZM2 A;  2E5V A;  4YHJ A;  1YW0 A;  4AIS A;  5FVK A;  5CGM A;  4OFZ A;  1HNZ T;  4HWH A;  3N9N A;  2EHO C;  4H63 H;  1XNQ T;  2Q9Q D;  3P4R A;  4TUY E;  3E0Z A;  5IYZ E;  2WZH A;  4B3M T;  1VCS A;  1KNZ A;  2BVM A;  2LLY A;  4IE5 A;  2XQ7 A;  4KMC A;  5F5W A;  1MIY A;  2CMR A;  5ABF A;  5L3C B;  4HTE A;  4LF7 T;  3I0O A;  4B3R T;  5LHG B;  1WLX A;  3CWZ B;  3RPU A;  3ZT6 A;  3HKB E;  4JI3 T;  1LVK A;  3OKQ A;  1LRZ A;  4UEL A;  2UXB T;  4IST A;  5L3F B;  3CIR A;  3T8O A;  1MMN A;  2HPL A;  1QUU A;  1BR2 A;  2NTY A;  3AAE B;  2QGS A;  2V26 A;  2LOS A;  1Z0P A;  2XAH B;  5C8Y E;  1OWA A;  1Y64 B;  4E7Z A;  4DUZ T;  4H9O C;  4LF9 T;  2NWB A;  2JIW A;  2N1G A;  3UFE A;  1KNP A;  5GON E;  5HXE A;  2KLQ A;  3CQX C;  3UUL A;  3VRA A;  4DND A;  3PDY A;  3QK6 A;  1HR0 T;  4HFD A;  4A98 A;  5JRE A;  4AKL A;  2BZB A;  2ZM0 A;  2ODU A;  4UVC B;  3LG7 A;  3UU5 A;  3RQW A;  4EV6 A;  1MIV A;  3L8R A;  4TWD A;  4UF0 B;  4EB6 E;  2ACX A;  3KBU A;  4IE4 A;  3QB5 K;  3RIU A;  2KWH A;  2BBH A;  3PJA J;  4DV5 T;  4NUU A;  1YKE B;  3SFD A;  1O3X A;  1G73 A;  4OYK A;  5E0O A;  2LM2 A;  4QXB B;  3BQL A;  4JI2 T;  4AQF C;  5ADX L;  4UVA B;  2C5I T;  3AE3 A;  2XQ6 A;  1WR6 A;  4J2C A;  3R6N A;  3AE4 A;  3RHW A;  5AQV B;  3T1H T;  5LBQ B;  3PUS A;  4QH5 A;  3ZT5 A;  5HYA A;  3AB3 B;  4YJ3 E;  5JRC B;  1D0X A;  4TNV A;  3EAM A;  4CZZ B;  4CXX A;  2IUB A;  2YN6 A;  3ZPO A;  5M4Y A;  4DV4 T;  3T1Y T;  4JI0 T;  4NIQ A;  3IEE A;  3EAB A;  3PV0 F;  4I43 B;  2MAW A;  1E7P A;  4WNK A;  3OJA A;  4JEH B;  5HEG A;  2W2U A;  3KV6 A;  2IAK A;  2I6H A;  2XQ8 A;  3KVA A;  2IML A;  3JC6 D;  4O2B E;  5AQI B;  5JDL A;  2H89 A;  1ZHC A;  4EGW A;  2BS3 A;  3P4S A;  4IDN A;  1J5W A;  3AAA B;  4X62 T;  4GK0 E;  2Y6X A;  3ABV A;  4FI5 A;  3N9O A;  4YTP A;  3FBL A;  4MHC A;  5JTG A;  4DR1 T;  5AQP B;  5FVL A;  3SWH A;  3N2G E;  2YK0 A;  2V7K A;  5FXX A;  3ZC1 A;  2ZLY A;  5F3J A;  4A5X A;  3C4Z A;  1E2A A;  1SE7 A;  2W63 A;  4I50 E;  5HEJ A;  2LHN A;  2CPT A;  4PFO A;  3PU3 A;  5FXW A;  4QX8 B;  3L3P A;  3MZK B;  3QC9 A;  4EZH A;  2HN2 A;  4QH4 A;  4IDP A;  3ESL A;  4BAY B;  5IHY A;  1US7 B;  2BS4 A;  2X9X A;  3PUZ F;  2DWK A;  2K5B B;  2X9Y A;  3UT5 E;  1W0B A;  3AA6 B;  5IUX A;  2HHH T;  2UUA T;  1N32 T;  2JMH A;  2RA1 A;  2XQA A;  4LMK A;  3FZK B;  2C5K T;  3Q5W A;  5AQM B;  2XSA A;  4HGA A;  1T8B A;  5ABG A;  2KWI B;  4EZ4 A;  1MMA A;  3O1H A;  4KHP T;  1UX5 A;  5JDG A;  5AQT B;  5J2U E;  2W66 A;  4QHO A;  1XMQ T;  2QVA A;  5AQO B;  3AA7 B;  3ANW B;  3MJX A;  5KDM C;  2LE8 A;  2UXN B;  2BS2 A;  1YXR A;  1UUR A;  3Q2M A;  5H6Q B;  3CX7 B;  3I9Y A;  4CQI A;  3RKO A;  1MNE A;  2V6Y B;  1VCT A;  3DP7 A;  4QH1 A;  5A1L A;  1HCI A;  1U4Q A;  2CHO A;  3KVB A;  5LA6 E;  2L3L A;  3RIF A;  4DO0 A;  2XQ3 A;  2J47 A;  2Z6E A;  4I0U A;  2LT3 A;  4I4T E;  4U33 A;  4UIG A;  2OV9 A;  4U74 A;  4CI2 B;  4LF6 T;  1ZOY A;  3C64 A;  2CM0 A;  5HXR A;  4O4I E;  4JI6 T;  2K48 A;  4UEM A;  5EK2 A;  3CK6 A;  1WR0 A;  4F8H A;  3JAE A;  3B5M A;  1ZKE A;  1FMW A;  4AQF A;  2X66 A;  3VU7 H;  3NVO A;  4IE7 A;  4EYU A;  3AVS A;  5CA0 E;  2X0H A;  3WI3 A;  4QXC B;  2FUP A;  3J9X 1;  4DV0 T;  4DV2 T;  4JBW F;  5L2L A;  2D5U A;  4DUY T;  2H3R A;  3AE9 A;  4DMV A;  1D0Y A;  2XJ7 A;  5HAX A;  5KMG P;  2WS3 A;  3LDQ B;  4HFB A;  4X66 T;  4DR4 T;  3AA0 B;  3LSV A;  4O4L E;  2V7I A;  3UU8 A;  3CX8 B;  2WDQ A;  2BG9 A;  2E9X B;  2LKH A;  4GK5 E;  4B6X A;  3IBP A;  4HFI A;  3ZMZ B;  2YU2 A;  2YOE A;  4H9S E;  3N2K E;  5F8P A;  5FXV A;  2V1D B;  3RGL A;  3RIU C;  2VKH A;  3GMI A;  1ZP0 A;  4PJN A;  2MTQ A;  3AE5 A;  1SUM B;  3ZYM A;  5LBM A;  4YTN A;  3RC8 A;  1G8X A;  2X67 A;  4DBQ A;  4GKJ T;  4LML A;  5LMN T;  1XDP A;  2ES0 A;  3HKD E;  3UFG A;  4PK5 A;  3UTK A;  1T98 A;  3LFM A;  3UUN A;  2VK9 A;  2YDR A;  3OYX A;  2BDE A;  3F57 A;  4IDZ A;  4BA9 A;  2YIN A;  4IE0 A;  4P0A A;  4QKN A;  3LK3 B;  3FXD B;  1N34 T;  3RQU A;  3U3I A;  4HWI B;  4DR6 T;  3PUA A;  3N9Q A;  2E9X D;  4MFR A;  5ABH A;  4JI1 T;  1XMO T;  3F31 A;  4X5T A;  1FMV A;  2OLT A;  5AQH B;  3KIN B;  3KV5 A;  2QA7 A;  4X1I E;  1XWM A;  5LB7 B;  4ZZC A;  4OYJ A;  4Q25 A;  3TLU A;  3AED A;  4U2Z A;  5JDH A;  1MMD A;  1HNW T;  2I59 A;  4AQG A;  3RLF F;  1FJG T;  2VVN A;  4YSY A;  4AQY T;  1X79 A;  4X64 T;  4GKK T;  2AE9 A;  2JQQ A;  3MKD A;  2BVL A;  4ASK A;  2E8I A;  2E9X C;  5LGN B;  4HFE A;  3PUW F;  1HFA A;  1S94 A;  4L0R A;  1IZN B;  1UX4 A;  4QX7 B;  2PBI A;  2SPC A;  3H37 A;  4C90 A;  1SA0 E;  2J4G A;  3AEE A;  5HXC A;  4BJM A;  4IIJ E;  3ZT7 A;  4FJO A;  3LBX A;  2VAS A;  3AA1 B;  2XQ9 A;  1UUS A;  4HE8 A;  2IC9 A;  3P4Q A;  2ZMA A;  3D0T A;  4OHF A;  4PAG A;  2JJ9 A;  3ZCI A;  1S35 A;  2BG9 B;  2E9X A;  3A8Y C;  4U72 A;  4B3S T;  4H63 V;  2LHR A;  2V6X A;  2DCF A;  4JLE A;  2C0S A;  2XY8 B;  3O1I A;  4ZEY A;  1T72 A;  2IDO B;  1R8I A;  2VB6 A;  4IL9 A;  4XZC A;  2V7M A;  5AQL B;  3AVR A;  4UR9 A;  3UUB A;  4YSZ A;  3NRX A;  4X20 E;  5FKY A;  3M65 A;  5JQG E;  4EEB A;  1SHZ C;  2GK9 A;  3ZST A;  3UUX B;  3ZCJ A;  2M67 A;  3B57 A;  2B1E A;  4PFP A;  2L8K A;  1X9B A;  1OED C;  2NOX A;  4HKA A;  2CXD A;  3SFE A;  5JR9 B;  4U7I A;  3WAJ A;  1EZ3 A;  1HTJ F;  5HEH A;  2MBG A;  1NEK A;  2PG8 A;  2WWU A;  4QXH B;  1JNR A;  2CWY A;  3K3O A;  4ZS2 A;  2CHN A;  3WAK A;  4AKH A;  3EDU A;  2XM1 A;  4K0K T;  1QSD A;  3H3A A;  4TZ4 C;  3W15 B;  4EED A;  3JAD A;  5LNK A;  5ABF B;  3Q5E A;  1B7T A;  2RPA A;  3V5U A;  4LFA T;  5LJM A;  4B3T T;  2WAU A;  1BR0 A;  2LEH A;  1QLB A;  2WWV A;  1IAP A;  3QUJ A;  3RYC E;  2BG9 C;  3F2E A;  4A56 A;  2W4X A;  1OED E;  2XAJ B;  2K3W A;  3N9P A;  5LGU B;  2UXX B;  2EHO B;  5HEU A;  3A5X A;  3RYH E;  2VKJ A;  5L3D B;  1WCR A;  1ZV4 X;  5LGT B;  1N33 T;  3TLT A;  1VRB A;  1XZY A;  3AAI A;  2DL1 A;  3AE6 A;  5JDQ A;  3IHR A;  4ILB A;  5AQN B;  4V1A v;  2YKS A;  4GYS A;  2KSR A;  2NTX A;  2XUE A;  5HXS A;  5FNV E;  1MIW A;  5JR9 C;  3JCF A;  2BG9 E;  3IA3 A;  4ERR A;  1WYB A;  5L47 A;  2UXD T;  1MMG A;  1YKH B;  2VL8 A;  3N9M A;  4I55 E;  2N9D A;  3ZC0 A;  2RP4 A;  1OED A;  1LKX A;  4P0B A;  2ZM8 A;  2WMN A;  4H9R C;  3RC3 A;  3EI0 A;  4K0U A;  4QWN B;  1KFY A;  3SRZ A;  3ZYL A;  4Z90 A;  4BJN A;  4GYR A;  5BR8 T;  2XQ4 A;  2WP9 A;  2WQY A;  5L4E A;  5LMU T;  3ZEF B;  4LMJ A;  4HFC A;  2M6I A;  1UCU A; 
#chains in the Genus database with same CATH homology
 1HF8 A;  3L09 A;  2XHE B;  3MXZ A;  2XQY A;  4X1Y E;  2Q9Q B;  4OK0 A;  4MAL A;  4H9Q C;  3ZN0 B;  3HL6 A;  1V9D A;  2KND A;  3BQK A;  3O4X E;  5LYJ E;  3K3Q C;  5L3E B;  1AJ3 A;  2C5J A;  3JC6 C;  3OBV E;  1BR4 A;  2CCQ A;  5DJQ C;  5L3B B;  3ZJ1 A;  1HG2 A;  3EVY A;  1KK7 A;  5EK3 A;  5TAO A;  2WSS V;  2KT9 A;  3UUM A;  1IJ6 A;  4GIW A;  2K9A A;  4AI6 A;  4PJJ A;  4TX5 A;  3ZMU B;  2PJQ A;  4G2A A;  2DWG A;  4AKG A;  4DMW A;  3IF8 B;  3BQI A;  1IJ5 A;  4PW8 A;  4ZI3 D;  3BK9 A;  2NW7 A;  3TKL B;  3RX6 A;  5FMN A;  4ZOL E;  4IE6 A;  4ILU A;  5LHH B;  4JUY A;  2KXP B;  3HKC E;  1OXZ A;  2LM9 A;  3PU8 A;  2H7V C;  4L9I A;  2DNX A;  4ADZ A;  2A72 A;  2LSY A;  3C4W A;  4YFS A;  2NP9 A;  3ZMV B;  1H7C A;  3PE0 A;  3GN5 B;  4XBF B;  2ODV A;  2JPF A;  4ZHQ E;  3HA4 A;  3ETV A;  2Q9Q A;  4KP3 C;  4N78 D;  2V7L A;  3GN5 A;  3K3N A;  5FXZ A;  3DTO A;  5H6R B;  3O9X A;  4KUM B;  3E08 A;  3ZMS B;  3C4X A;  2VWA A;  2X68 A;  3EUH A;  3FBZ A;  4EAH A;  1YD8 G;  4MLK A;  3VKG A;  3KBT A;  4PNI A;  3CKD A;  2X9W A;  3P7I A;  4O4J E;  5LJN A;  5FYM A;  4ISS A;  2VKO A;  2J1D G;  3ZEF B;  5EZY E;  3ZN1 B;  5J2T E;  5EK4 A;  3FXE B;  2NW9 A;  2CXF A;  3DJB A;  1CUN A;  3KDS E;  4AKI A;  2CXL A;  2X9H A;  4DVD A;  1D1C A;  2W0G A;  3ZLI A;  3LK4 2;  4TV8 E;  4AKR B;  4UF0 A;  3GWH A;  2XTL A;  3N5L A;  5CB4 E;  2Q9Q C;  3I9W A;  4H9N C;  4HEA A;  3I0Q A;  1HX8 A;  5HXH A;  5JRC A;  4ZS3 A;  2D0U A;  2CLY C;  4ANJ A;  4XAX B;  4CI1 B;  2H7O A;  2HH7 A;  2JRK A;  2XAG B;  3NRY A;  2K24 A;  3MA9 A;  3PUQ A;  4WW0 A;  4F6R C;  3R84 B;  3O1J A;  2DI4 A;  3ONX A;  3Q9D A;  4HFV A;  1MND A;  2DHR A;  3ZJ2 A;  3V5S A;  2OA5 A;  3ZYK A;  4EOZ B;  2L9Q A;  4UV9 B;  2YU1 A;  5HWY A;  3J7Y q;  4KBM B;  1D0Z A;  3HR0 A;  5ETW A;  3GA8 A;  5J1G A;  4WBN E;  2EHO A;  2VKD A;  2CLY B;  2LSI A;  2D2S A;  1FEW A;  2N2N A;  5BMV E;  3NZQ A;  5FY0 A;  1WYC A;  5CA1 E;  2LSK A;  2KZ7 B;  4PK4 A;  5FY7 A;  1E1H B;  5DQV A;  2G0U A;  2WM9 A;  3U78 A;  4MBQ A;  4WBO A;  1U5P A;  2W61 A;  4IHJ E;  2YEV C;  2NW8 A;  2LJL A;  4TN7 B;  4DBR A;  4PJL A;  3C98 B;  3CML A;  4O4H E;  3SS1 A;  4EXT A;  3RRC A;  3ANW A;  5JR9 A;  4ZI2 D;  2IW5 B;  1ZEE A;  3PUG A;  3I1A A;  3S4U A;  4C91 A;  3CPZ A;  4PK6 A;  1WRD A;  5LOV E;  5KX5 E;  2X0L B;  2LSG A;  4GOU A;  3RRW A;  1LVF A;  3MAC A;  5DQW A;  1VOM A;  3LK2 B;  2IC6 A;  3KFW X;  5JVD E;  2HPJ A;  3CX6 B;  3P8C D;  4NUV A;  2WMO A;  3EDV A;  4UVB B;  1NAF A;  2CEA A;  4Z8X A;  2Y8D A;  4JEU B;  3FB2 A;  5FY1 A;  3NZP A;  2EHO D;  3HKE E;  4O2A E;  5LG4 A;  1NWM X;  2CWO A;  3N9L A;  4IGU A;  2V7J A;  4UV8 B;  2X51 A;  4ZI2 C;  3LBX B;  1FIO A;  5DAB A;  4YLH A;  4ZI3 C;  2P9B A;  3LJC A;  3PTR B;  3K8P C;  5HWX A;  2MOZ A;  2XAF B;  3B13 A;  3HI2 A;  2CE7 A;  2D0T A;  2DLR A;  5AFU L;  4P09 A;  1BR1 A;  3ZMT B;  3Q5X A;  2LSJ A;  5LCY A;  3SOL A;  3KV9 A;  4X1K E;  4CXY A;  2W00 A;  3ETU A;  3MK7 C;  2MYS A;  1HS7 A;  2W62 A;  3VKH A;  4ZI7 E;  3KV4 A;  5JH7 E;  5LHI B;  3PUR A;  3N2O A;  2A2F X;  3CQC B;  5JDN A;  2XAS B;  4AXP A;  5LXT E;  4EIW A;  4PJM A;  3C51 A;  3CQG B;  4E7S A;  2WBL A;  3RYF E;  2CA5 A;  2JMK A;  1D1A A;  3OYZ A;  4G63 A;  5JDF A;  3VHL A;  4UXN B;  4H9P C;  3E22 E;  5FP3 A;  2LOP A;  3FHN A;  3NBX X;  4HN9 A;  3RYI E;  5F3J A;  3CVR A;  4M1P A;  4EYY R;  5JDL A;  3C50 A;  1D1B A;  2KIN B;  2A3D A;  2PFV A;  4O8S A;  4L5G A;  4TV9 E;  1HG5 A;  4CXW A;  2Y48 B;  2KMF A;  3RH3 A;  5LP6 E;  5L3G B;  2XAQ B;  5JDM A;  2ZM2 A;  4YHJ A;  1YW0 A;  4OFZ A;  3N9N A;  2EHO C;  4H63 H;  2Q9Q D;  4TUY E;  3E0Z A;  5IYZ E;  1KNZ A;  2BVM A;  4IE5 A;  4KMC A;  1MIY A;  2CMR A;  5L3C B;  4HTE A;  3I0O A;  5LHG B;  1WLX A;  3CWZ B;  3RPU A;  3HKB E;  1LVK A;  3OKQ A;  1LRZ A;  4UEL A;  4IST A;  5L3F B;  3T8O A;  1MMN A;  2HPL A;  1QUU A;  1BR2 A;  2NTY A;  3AAE B;  2QGS A;  2V26 A;  2LOS A;  1Z0P A;  2XAH B;  5C8Y E;  1OWA A;  1Y64 B;  4E7Z A;  4H9O C;  2NWB A;  2N1G A;  3UFE A;  5GON E;  5HXE A;  2KLQ A;  3CQX C;  3UUL A;  4DND A;  3PDY A;  3QK6 A;  5JRE A;  4AKL A;  2BZB A;  2ZM0 A;  2ODU A;  4UVC B;  3LG7 A;  1MIV A;  4EB6 E;  4UF0 B;  2ACX A;  3KBU A;  4IE4 A;  2KWH A;  4NUU A;  1YKE B;  1O3X A;  1G73 A;  4OYK A;  5E0O A;  4QXB B;  3BQL A;  4AQF C;  5ADX L;  4UVA B;  2C5I T;  4J2C A;  3R6N A;  1WR6 A;  5LBQ B;  3PUS A;  5HYA A;  3AB3 B;  4YJ3 E;  5JRC B;  1D0X A;  4CZZ B;  4CXX A;  3ZPO A;  3IEE A;  4I43 B;  4WNK A;  3OJA A;  4JEH B;  3KV6 A;  2IAK A;  4O2B E;  3KVA A;  3JC6 D;  1ZHC A;  3AAA B;  4GK0 E;  2Y6X A;  4FI5 A;  3N9O A;  3FBL A;  4MHC A;  3SWH A;  3N2G E;  2YK0 A;  2V7K A;  5FXX A;  3ZC1 A;  2ZLY A;  3C4Z A;  2W63 A;  4I50 E;  2LHN A;  4PFO A;  5FXW A;  3PU3 A;  4EZH A;  4QX8 B;  3L3P A;  3MZK B;  3QC9 A;  4BAY B;  3ESL A;  5M4Y A;  5IHY A;  1US7 B;  2X9X A;  2DWK A;  2K5B B;  2X9Y A;  3UT5 E;  3AA6 B;  2JMH A;  2RA1 A;  2C5K T;  3Q5W A;  4HGA A;  4EZ4 A;  2KWI B;  1MMA A;  3O1H A;  1UX5 A;  5JDG A;  5J2U E;  4QHO A;  3AA7 B;  3ANW B;  3MJX A;  5KDM C;  2LE8 A;  2UXN B;  3Q2M A;  5H6Q B;  3CX7 B;  3I9Y A;  4CQI A;  3RKO A;  1MNE A;  3DP7 A;  5A1L A;  1HCI A;  1U4Q A;  3KVB A;  5LA6 E;  2L3L A;  4DO0 A;  2Z6E A;  2LT3 A;  4I4T E;  4UIG A;  4U74 A;  4CI2 B;  3C64 A;  2CM0 A;  5HXR A;  4O4I E;  2K48 A;  4UEM A;  5EK2 A;  1ZKE A;  1FMW A;  4AQF A;  2X66 A;  3VU7 H;  4IE7 A;  4EYU A;  3AVS A;  5CA0 E;  3WI3 A;  4QXC B;  3J9X 1;  5L2L A;  2D5U A;  2H3R A;  4DMV A;  1D0Y A;  5HAX A;  5KMG P;  3AA0 B;  4O4L E;  2V7I A;  3CX8 B;  2E9X B;  4GK5 E;  4B6X A;  3IBP A;  3ZMZ B;  2YU2 A;  4H9S E;  5F8P A;  3N2K E;  5FXV A;  2V1D B;  2VKH A;  3GMI A;  4PJN A;  2MTQ A;  3ZYM A;  5LBM A;  3RC8 A;  1G8X A;  2X67 A;  4DBQ A;  2ES0 A;  3HKD E;  4CI3 B;  3UTK A;  4PK5 A;  3UUN A;  1T98 A;  3LFM A;  4BA9 A;  2VK9 A;  3OYX A;  2BDE A;  3F57 A;  4IDZ A;  4P0A A;  2YIN A;  4IE0 A;  4QKN A;  3LK3 B;  3FXD B;  3U3I A;  3PUA A;  3N9Q A;  2E9X D;  4MFR A;  3F31 A;  1FMV A;  3KIN B;  3KV5 A;  2QA7 A;  4X1I E;  4OYJ A;  5JDH A;  1MMD A;  2I59 A;  4AQG A;  1X79 A;  2JQQ A;  3MKD A;  2BVL A;  4ASK A;  2E8I A;  2E9X C;  5LGN B;  4L0R A;  1HFA A;  1S94 A;  4QX7 B;  1IZN B;  1UX4 A;  2PBI A;  2SPC A;  3H37 A;  4C90 A;  1SA0 E;  4BJM A;  5HXC A;  4IIJ E;  4FJO A;  3LBX A;  2VAS A;  3AA1 B;  4HE8 A;  2IC9 A;  3ZCI A;  2ZMA A;  3D0T A;  4OHF A;  4PAG A;  2JJ9 A;  1S35 A;  2E9X A;  4U72 A;  4H63 V;  2LHR A;  4JLE A;  2DCF A;  2C0S A;  3O1I A;  2VB6 A;  4XZC A;  2V7M A;  3AVR A;  3NRX A;  4X20 E;  5JQG E;  3M65 A;  1SHZ C;  2GK9 A;  3UUX B;  3ZCJ A;  2M67 A;  3B57 A;  2B1E A;  4PFP A;  2L8K A;  2NOX A;  4HKA A;  5JR9 B;  5LJM A;  2CXD A;  3WAJ A;  1EZ3 A;  1HTJ F;  2MBG A;  2PG8 A;  4YJ2 E;  2WWU A;  4QXH B;  4ZS2 A;  2CWY A;  3K3O A;  3WAK A;  4AKH A;  3EDU A;  1QSD A;  3H3A A;  4TZ4 C;  3W15 B;  5LNK A;  1B7T A;  3V5U A;  2WAU A;  1BR0 A;  2LEH A;  1IAP A;  3QUJ A;  3RYC E;  3F2E A;  4A56 A;  2XAJ B;  3N9P A;  5LGU B;  2UXX B;  2EHO B;  3RYH E;  3A5X A;  2VKJ A;  5L3D B;  1ZV4 X;  5LGT B;  5JDQ A;  1VRB A;  3AAI A;  3IHR A;  4V1A v;  4GYS A;  2NTX A;  2XUE A;  5HXS A;  5FNV E;  1MIW A;  5JR9 C;  4ERR A;  1WYB A;  1MMG A;  1YKH B;  2VL8 A;  3N9M A;  4I55 E;  2N9D A;  3ZC0 A;  2RP4 A;  1LKX A;  4P0B A;  2ZM8 A;  2WMN A;  4H9R C;  3RC3 A;  4K0U A;  4QWN B;  3SRZ A;  3ZYL A;  4BJN A;  4GYR A;  1UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...