2LM9A

The nmr structure of a major allergen from dust mite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
96
structure length
96
Chain Sequence
b'NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blo t 21 allergen
publication title NMR structure and IgE epitopes of Blo t 21, a major dust mite allergen from Blomia tropicalis
pubmed doi rcsb
source organism Blomia tropicalis
molecule tags Allergen
total genus 42
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lm9A00
2JMHA 2JRKA 2LM9A
chains in the Genus database with same CATH superfamily
4IL4A 4YY3T 3CK6A 3B13A 3ONJA 1FJGT 4EXTA 4P0AA 1ZOYA 4P0BA 3F31A 3DJBA 3FXEB 3C64A 2JJ9A 1UUSA 2KNDA 3EVYA 1HG2A 3SFEA 1HTJF 4ANJA 2NOXA 4DNDA 2X68A 2LKGA 2LSGA 3AE5A 1LVKA 1UX4A 3V5SA 3K3OA 2Q9QB 3KVBA 4H9SE 2XSBA 4EAHA 3NBXX 3KV5A 3LFMA 3EDUA 5AQHB 2WY2A 3QOFA 3BQKA 1AJ3A 1HF8A 4GIWA 4H9PC 3MZKB 1BR0A 2DLRA 4B3MT 1OXZA 4Z8XA 3FHNA 4EV6A 1ZKEA 2LHNA 2X9XA 3Q9DA 2WZIA 4ILUA 3OKQA 5HXCA 2UUAT 3AE6A 4WW0A 1VOMA 2L3LA 2KSRA 4QH1A 2MTQA 4U31A 4EYYR 4P1NA 2PG8A 3AE7A 2JQ9A 2BDEA 3E22E 4DR1T 4O2AE 5JRCA 4ZHQE 5FP3A 3E08A 2UUBT 3CMLA 3RC3A 3FZMB 2CRBA 3BQIA 3PV0F 4MBQA 1WYBA 3OBVE 2X51A 5AQTB 3JAEA 5JTGA 2E9XD 2XM2A 5CB4E 2ACXA 4OX9T 4TN7B 3C98B 5HXRA 2LM9A 4UVCB 3ZMZB 2YK0A 5CA1E 1D1CA 2WDRA 4KHZF 2LOSA 2XQ5A 1HS7A 3EUHA 3O9XA 4HFCA 5HEOA 4UR9A 2CXFA 3NZPA 3LK2B 4JI1T 1SUMB 2E9XB 4HE8A 3J7Yq 4WBOA 5CFBA 2IAKA 3G06A 3RRCA 3N5LA 2JMKA 3RQUA 5HXHA 2UXXB 1UX5A 2B1EA 3LK3B 4MALA 1V9DA 5LHHB 2V7JA 2WQYA 5LXTE 2UXDT 2YU1A 3GWHA 2W2UA 1BR4A 3WAKA 4QXHB 1VCTA 3PU3A 1XZYA 3UU3A 5E0OA 3W15B 4LMLA 4C90A 5JDGA 2LSYA 5BR8T 5IWAT 1T8BA 4LMJA 4AQFC 2VL0A 4AIUA 4COFA 2VB6A 2UXBT 3PUQA 1E1HB 2CM0A 3M3ZB 2RP4A 4Z91A 4H63H 4UVBB 3FZFB 5IHYA 2W66A 5LGUB 5AQFB 2XASB 5LMNT 1L0VA 4NUVA 4JEHB 3NRYA 3PJAA 5HCMA 3CIRA 2Y8DA 2VKJA 4TX5A 5DQWA 1BR2A 4LF4T 5HEJA 4TUYE 4I4TE 4YHHT 3AE9A 2JRKA 5J0ZA 1XNQT 5FL1A 4IL9A 3TKLB 4GK5E 3K3QC 2MPKA 2XJ7A 3KBTA 1VCSA 4YSYA 2E9XC 5F8PA 2H7OA 1IAPA 2V1DB 2F4VT 2RPAA 2HHHT 4U72A 3GN5A 3ESLA 1ZEEA 3UUMA 3HKCE 3C4XA 4HWIB 2C5IT 2P9BA 4HFEA 4M1PA 4MLKA 2K5BB 1NAFA 3ETVA 2EHOB 2D0UA 4L5GA 4ZI2C 2V7KA 4JLEA 2YDSA 5LHIB 5HXEA 5JVDE 3PDYA 2VVSA 4PFPA 1XNRT 4OYKA 3L39A 3EDVA 3UUXB 3ONXA 4LF6T 2N1GA 2BKNA 1D0YA 2WWUA 3B57A 5LBMA 2V6XA 4AKLA 3KVAA 4DV3T 2XAHB 1U4QA 2WMNA 3KINB 4CI1B 1M7KA 2WZHA 3ETUA 1XMOT 1FMVA 4TWHA 4V1Av 2QYWA 4TNVA 3FZHB 5M4YA 2BVMA 5JREA 2XHEB 4HWDA 3P4PA 5AQKB 2XPKA 4EZHA 4AKIA 1IJ5A 5FXXA 3MXZA 3LSVA 4YTPA 1H7CA 2DL1A 3VKGA 3MJXA 3U3IA 2VURA 4EB6E 2PTFA 3Q5WA 1LRZA 4DBRA 4AQYT 2DCFA 5JH7E 3VRBA 3ZT6A 1E7PA 5L3FB 3S4UA 3ZJ2A 2VK9A 2Z6EA 3P8CD 4CQIA 5C2TA 1E2AA 5F5WA 1XWMA 2KZ7B 3PE0A 4WYVA 2B76A 3HR0A 2KLQA 2XY8B 2IC6A 1HFAA 1Y64B 4EZ4A 1J5WA 4FJOA 3H3AA 5DQVA 4DV5T 1NENA 4FI5A 5L4HA 1OEDE 4KMCA 5ABHA 2W62A 5FYMA 3AA0B 1T7SA 3TLTA 4ZI7E 2WDVA 4HWHA 4AQGA 2CCQA 4DR2T 1Z8UA 5TAOA 3ZYLA 5LGNB 3CX8B 1O3XA 3ZEFB 1IBMT 4MHCA 2FUPA 2YN6A 3RQWA 2VASA 2BS2A 1J5ET 3X1DA 2XQ7A 4UV9B 5DABA 3ZKRA 5JRCB 2BVLA 1YKHB 1QSDA 3TLUA 5BMVE 3UU6A 3A5XA 3A7MA 4DV4T 4O4HE 5AQUB 3AECA 3AEGA 4HFDA 1M62A 3JADA 5FY1A 3UU4A 5AQMB 4K0UA 2XM1A 2BG9E 5HXSA 2XQ3A 4L0RA 5ABEA 2KWHA 2CBJA 2K3WA 2ZM6T 3ONLC 4DR4T 3CWZB 1SHZC 5CGMA 3R6NA 4K0KT 3AE4A 2AXDS 4YTNA 1XDOA 3HKDE 3FZLB 4Z90A 4AKHA 2V5DA 4LMKA 5LA6E 2JMHA 5J2UE 4DBQA 5AQSB 3F2EA 3AEBA 3OTOT 2CHNA 4IHJE 3RPUA 4PJLA 5ABFA 5AQVB 2CWYA 3CPZA 3N9MA 3SRZA 2WWVA 2HN2A 2X66A 2ZM2A 3CKDA 3TLVA 1N36T 3UTKA 3BK9A 3IHRA 3Q5DA 3MK7C 4UF0A 4YT0A 1FIOA 5LG4A 4IDOA 1HCIA 4O4IE 1OEDA 4LFBT 1JNRA 1QUUA 4AI6A 4NXNT 5LYJE 3PUAA 2LRKA 2RA1A 4ADZA 5EK3A 3DP7A 4O4JE 1N33T 4KUMB 2L9QA 4E7SA 1S35A 4DO0A 4KHPT 4PK5A 5DJQC 4A97A 2LSJA 3BQLA 5LP6E 2E5VA 3CQXC 1CUNA 3B5MA 1OWAA 4WZXA 4ISSA 1IBKT 2IUBA 3M65A 3HA4A 3KV9A 4GOUA 1MNEA 3CQCB 2KMFA 3AE8A 3N2OA 5LMUT 2WB5A 2C0SA 2XQ4A 5J2TE 1UCUA 2Y6XA 2LRLA 3DTOA 3RC8A 4TV9E 2A72A 5FXZA 3PUSA 2XUEA 5A1LA 2I0MA 3ZSTA 2BG9A 1HNXT 1WYCA 4A5XA 2R6GF 4PK6A 2BBJA 3UUBA 4PJMA 1MMAA 3AAAB 3ZMSB 1QLBA 2NP9A 3ZSSA 2A3DA 3RIFA 3GN5B 2WSSV 4ZOLE 1WR0A 3GMIA 3KBUA 3I9YA 2LM2A 1G73A 2A2FX 4GYRA 3K3NA 4HEAA 2XSAA 4O4LE 3Q5EA 4X62T 4X64T 3QB5K 2WU2A 4YJ3E 2X9HA 3ZYMA 3UULA 2X9WA 4P09A 4LF8T 3MKDA 2NW7A 5EZYE 2E5LT 4BA9A 3RYHE 3H3MA 2YDRA 2W0GA 4ERRA 4TNWA 4I50E 3PURA 2DI4A 2V7LA 5C3JA 3VR9A 3EAMA 1N32T 4I43B 3I1AA 3LBXB 4HTEA 1MIWA 5H6RB 3WAJA 3UUNA 3VKHA 4UIGA 2NTXA 2VKHA 2JQQA 1ZHCA 4CI3B 4X1KE 4X5TA 4JUYA 2C5JA 1KFYA 4PAGA 2XQ8A 2UUCT 3CVRA 4DUYT 2BZBA 2NW9A 1YQ4A 2JPFA 1MNDA 1ZV4X 4BJNA 1S94A 4HWFA 5JQGE 4QH4A 1EZ3A 1WLXA 4YLHA 3RX6A 3HKBE 4JV5T 5JDNA 4DIDB 3T1HT 3HL6A 3RGLA 4F6RC 3AA7B 5H6QB 4U33A 5LJMA 2XAGB 4CN4A 1BR1A 2PBIA 4B3ST 5LHGB 2H7VC 3JC6D 3ZJ1A 4JYAT 2M67A 5LG3A 4HKAA 4NXMT 3RYCE 2X0LB 4HFBA 3T8OA 3PUXF 3NZQA 2BBHA 3HI2A 2CA5A 1MIVA 4HFHA 3KDSE 2AE9A 3TLWA 5L3GB 4KBMB 1WFDA 3O1HA 4QWNB 3AE2A 1NWMX 2CHOA 3UFGA 3ZN0B 3RKOA 4LF7T 2LOPA 2XQYA 5FY7A 1MIYA 4JI4T 1JNZA 3AA6B 1R8IA 2LSIA 1HG5A 4ZI3D 2CMRA 2X67A 4IGUA 4CI2B 4XAXB 2LKHA 3GA8A 3LBXA 4U7IA 5HCJA 2K48A 3IBPA 2XQ9A 5AQLB 4DR6T 2FJAA 4DMVA 1J1JA 4X1YE 2CEAA 2LSKA 4IE4A 3N9OA 2PFVA 4PW8A 4JI6T 1W0AA 3N9QA 4HGAA 5FXVA 5LB7B 3AB3B 1GQEA 5FL0A 4J2CA 3I0OA 3OYXA 3N2GE 3RF1A 1FMWA 4DR7T 3AEFA 3OYZA 3LDQB 4IT4A 2H88A 1KNZA 4YSZA 3N2KE 3ZN1B 4DVDA 3KV4A 3PUYF 1DU2A 1FEWA 4JEUB 4WBNE 2I6HA 4QXCB 1VRBA 5AFUL 2D9DA 5JDQA 3O1IA 4EYUA 5L3EB 2FJBA 2LHRA 3EI0A 4IDZA 4E7ZA 2XZEA 2LJLA 2MBGA 1YW0A 2J47A 3AVSA 1HX8A 5JR9A 4IIJE 5HYAA 1X79A 4CXXA 3PTRB 4NUUA 4EEBA 4OHFA 5FKYA 1N34T 3P4WA 4DV1T 1B7TA 4AXPA 2NTYA 3V5UA 3D0TA 5HEUA 1MMDA 5CJ5A 4YHJA 5ABGA 2WP9A 5ABFB 2YINA 2BKOA 4IE5A 2BKPA 3OPCA 3FB2A 5JDHA 1T72A 5LGTB 3AXJA 3JC6C 2XAJB 1KNRA 3N9LA 3IF8B 3H37A 3O1JA 3RIUA 1KEYA 5AQRB 5HWXA 4B3RT 2YOEA 2E8IA 4UF0B 2WAUA 3I0QA 2YU2A 3LJCA 5KMGP 1OEDB 5L47A 4B3TT 3L09A 2J4GA 2WMOA 5HEHA 4JI7T 2GK9A 4U7YA 2HPLA 4KP3C 5FVKA 2DWGA 4ZS2A 4IE6A 4U74A 4X20E 2V8SV 5EK4A 4ILCA 4I0UA 1WRDA 2NWBA 1XDPA 3RKGA 5L3BB 4HFIA 1SA0E 4X1IE 4UELA 2N2NA 4U2ZA 1NEKA 4ASKA 5HWYA 2Q9QD 4OK0A 1XMQT 3L3PA 4TZ4C 4EOZB 2NR4A 5J1GA 2ODUA 2V6YA 4ILBA 2M6IA 2BG9B 3HKEE 4UEMA 1IJ6A 4KX6A 3UQ4A 2FJEA 2VQFT 2KXPB 2UU9T 5L4EA 2DNXA 2ZLYA 3NWIA 2A9UA 3RLFF 2MYSA 2MAWA 2H89A 3SFDA 5JDMA 4BAYB 4G2AA 3RYIE 1D0ZA 4IDPA 4YFSA 2CLYB 3F57A 2FJDA 2VWAA 4ZZBA 1WCRA 4BJMA 4GYSA 5GONE 1U5PA 2WS3A 4IREA 4ILAA 4DV6T 4TWFA 2I59A 2VVNA 2J1DG 1OEDC 2PJQA 4UV8B 3JAFA 2X0HA 2D5UA 4X65T 2DHRA 4WNKA 2LT3A 2JQHA 4IE7A 2QGSA 3QC9A 3AAEB 1IBLT 1KNPA 3O4XE 2IIUA 2C5KT 3NRXA 3A8YC 4PJNA 5KXJA 3ANWA 2BS4A 4EEDA 3NKZA 3C4WA 2ZM8A 5LOVE 3IA3A 3AAIA 5KDMC 4LF9T 3P4QA 1KK7A 2CBIA 2CWOA 4H9NC 2J62A 2G0UA 2XTLA 3L8RA 4PFOA 3RRWA 2D2SA 5C8YE 2BG9C 3N9NA 2V7MA 2VQET 4GKKT 1KF6A 4YTMA 3ZMUB 4HFVA 3ZT7A 3AA1B 3LG7A 3ZCJA 3MACA 5KX5E 4Q25A 2QVAA 4O2BE 5FXWA 5F3JA 3C50A 3PUWF 2D0TA 1UK5A 2QRXA 1SE7A 4ZI2D 2Q9QC 3ZYKA 5LBQB 2UXNB 4G63A 3AEEA 2CLYC 3UT5E 2NW8A 2Q9QA 3UU5A 3VHLA 2X0YA 1LKXA 4JI2T 4HWCA 2WM9A 4TV8E 4DV7T 4IDQA 3ZT5A 4CN1A 4AKGA 3KV6A 4QX8B 4IDNA 2Y48B 1MMNA 3VR8A 2LEHA 4PNIA 3U78A 4LFCT 3PJAJ 3ABVA 4CN6A 3I9WA 1HNZT 2IC9A 4HN9A 3C4ZA 4UVAB 3P7IA 5AQOB 2VL8A 4DMWA 4OYJA 3Q5XA 2VKOA 5LNKA 5CA0E 2WBLA 2XQAA 4U2YA 5L3CB 4XZCA 4I55E 5LJNA 2OLTA 3FXDB 4A98A 3WI3A 3ZPOA 3RI5A 2W63A 4AQFA 4N78D 3OVUA 4H9OC 3CX7B 3FBLA 4MFRA 3IEEA 3EABA 5FVLA 4UXNB 3PU8A 4YSXA 3AEAA 1D1BA 2V7IA 2WDQA 1HNWT 5FY0A 3E0ZA 3RIAA 2V26A 3UQ7A 2EHOD 2V5CA 4IE0A 2WU5A 4QXBB 2CE7A 4QX7B 2IDOB 5JR9B 1YD8G 4H63V 4XBFB 4QKNA 2YEVC 2HN1A 3SS1A 3AE1A 4U3CA 1HR0T 2XAFB 4PJJA 2IHR1 4O8SA 2E9XA 1D1AA 3K1SA 4H9RC 3RH3A 2CXLA 4NPPA 1US7B 4JI5T 3QNUA 5HAXA 3N9PA 3CX6B 3AXJB 2YDQA 4F8HA 3ZC0A 2QA7A 2JQKA 3RHWA 3P4RA 2W4XA 5HEGA 2ACZA 1WR6A 3J9X1 2LE8A 1LVFA 2FBWA 4GKJT 1W9RA 2X9YA 2CXDA 1CHUA 4KI0F 4CXWA 3ZLIA 4ISTA 1X9BA 4JBWF 1IZNB 2ZM0A 3C51A 4H9QC 4AKRB 2CPTA 2MOZA 3P4SA 1YKEB 3PUVF 3QUJA 5L2LA 2HPJA 2N9DA 3P50A 3JCFA 3VRAA 4QH5A 4DV2T 2SPCA 3NVOA 5AQPB 2L8KA 1MMGA 3ZC1A 3LK42 4TWDA 3KFWX 3VU7H 5ADXL 3SWHA 3Q2MA 4DR3T 2HH7A 4EIWA 3PUGA 2K9AA 4ZZCA 2V6YB 4LF5T 4EGWA 5JR9C 5FNVE 2DWKA 3K8PC 5IUXA 2OV9A 2KT9A 1W0BA 4B6XA 4A56A 1I94T 4ZS3A 4QHOA 4X66T 1I6ZA 2LLYA 3FBZA 2WCAA 5L3DB 2ODVA 3FZKB 5AQJB 1ZP0A 1W09A 4C91A 2ES0A 5AQQB 2OA5A 4PK4A 5LCYA 3UFEA 2IW5B 3UU8A 2EHOC 3PUZF 4ZXLA 2M6BA 3OJAA 3EHZA 1UURA 3R84B 4CXYA 5JDFA 3RIUC 2EHOA 3AVRA 5FMNA 4JI0T 4ZEYA 3QK6A 3ZMTB 3SOLA 3QB5A 2UXCT 3AE3A 1HX1B 5JDLA 4YXDA 4DV0T 2XAQB 4GK0E 1YXRA 2IMLA 2W67A 2KINB 1Y01A 4LFAT 4CZZB 4DUZT 2ZMAA 5AQNB 2JIWA 1T98A 4ZI3C 1Z0PA 3AEDA 4JI8T 2E2AA 3ZCIA 1UGOA 3CQGB 3ANWB 1YQ3A 3TLSA 2BS3A 1D0XA 5AQIB 1G8XA 4NIQA 4JI3T 2W61A 4DR5T 3RYFE 2H3RA 3ZMVB 2KWIB 5IYZE 2YKSA 5EK2A 4YJ2E 2XQ6A 3MA9A 2W00A 4L9IA 2VKDA 5ETWA 5AQGB 3T1YT 4AISA 4OFZA 2K24A
chains in the Genus database with same CATH topology
5JDNA 3LG7A 3ZCJA 3B13A 4EXTA 1H7CA 3HL6A 3MACA 4F6RC 3AA7B 5KX5E 3VKGA 3MJXA 5H6QB 3U3IA 4P0AA 4EB6E 5LJMA 4O2BE 4P0BA 2XAGB 3F31A 3DJBA 3FXEB 3Q5WA 1BR1A 1LRZA 5FXWA 4DBRA 5F3JA 2PBIA 5LHGB 2H7VC 2DCFA 3C64A 2JJ9A 5JH7E 3JC6D 3ZJ1A 5L3FB 2KNDA 3C50A 1HG2A 2D0TA 3EVYA 1HTJF 2M67A 4ANJA 2NOXA 4DNDA 3S4UA 2X68A 4HKAA 2LSGA 3RYCE 4ZI2D 3ZJ2A 1LVKA 1UX4A 2Q9QC 2VK9A 3V5SA 2Z6EA 3ZYKA 3K3OA 5LBQB 2UXNB 3P8CD 4G63A 4CQIA 2CLYC 2Q9QB 2X0LB 3UT5E 3KVBA 2NW8A 2Q9QA 3T8OA 4H9SE 3VHLA 2KZ7B 4EAHA 1LKXA 3PE0A 3NZQA 2WM9A 3HI2A 2CA5A 4TV8E 3HR0A 1MIVA 3NBXX 2KLQA 3KV5A 3LFMA 3EDUA 3KDSE 5L3GB 3BQKA 4KBMB 2IC6A 3O1HA 4QWNB 1AJ3A 1HFAA 1HF8A 3KV6A 4GIWA 1Y64B 4QX8B 4AKGA 1NWMX 4EZ4A 4FJOA 4H9PC 3H3AA 3MZKB 5DQVA 1BR0A 2DLRA 2Y48B 1MMNA 1OXZA 3ZN0B 4Z8XA 3FHNA 3RKOA 2LOPA 4FI5A 2XQYA 2LEHA 4PNIA 3U78A 5FY7A 1MIYA 4KMCA 3AA6B 2LSIA 1ZKEA 2W62A 2LHNA 5FYMA 3AA0B 2X9XA 1HG5A 4ZI3D 4ZI7E 3I9WA 2CMRA 3Q9DA 2X67A 4IGUA 4ILUA 3OKQA 4CI2B 4XAXB 4AQGA 2CCQA 5HXCA 2IC9A 3GA8A 4HN9A 5TAOA 3LBXA 3ZYLA 3C4ZA 4WW0A 5LGNB 1VOMA 3CX8B 1O3XA 4UVAB 3P7IA 2K48A 3ZEFB 4MHCA 2L3LA 3IBPA 2VASA 2VL8A 4DMWA 4OYJA 3Q5XA 2MTQA 4DMVA 4X1YE 4EYYR 2VKOA 5LNKA 2PG8A 2CEAA 5CA0E 2LSKA 4UV9B 5DABA 2BDEA 2WBLA 4IE4A 3N9OA 3E22E 5L3CB 2PFVA 4XZCA 5JRCB 4PW8A 2BVLA 4I55E 3N9QA 4HGAA 5LJNA 5FXVA 1YKHB 1QSDA 3AB3B 3FXDB 4O2AE 4ZHQE 5JRCA 5BMVE 3WI3A 3A5XA 5FP3A 3ZPOA 4O4HE 4J2CA 3E08A 3I0OA 3CMLA 3RC3A 2W63A 4AQFA 3OYXA 3N2GE 4N78D 3BQIA 4MBQA 1WYBA 5FY1A 4H9OC 3CX7B 1FMWA 4K0UA 5J2TE 3FBLA 3OBVE 2X51A 4MFRA 3IEEA 3OYZA 1KNZA 5HXSA 2E9XD 4UXNB 3N2KE 4L0RA 3ZN1B 5CB4E 2ACXA 4DVDA 2KWHA 3PU8A 3KV4A 4TN7B 3C98B 5HXRA 1FEWA 1D1BA 2LM9A 4JEUB 4WBNE 4QXCB 1VRBA 4UVCB 2V7IA 5AFUL 3ZMZB 3CWZB 5JDQA 5FY0A 3E0ZA 2YK0A 5CA1E 1SHZC 2V26A 3O1IA 4EYUA 1D1CA 5L3EB 2EHOD 3R6NA 2LHRA 4IDZA 2LOSA 4IE0A 4E7ZA 1HS7A 4QXBB 2LJLA 2MBGA 1YW0A 2CE7A 4QX7B 3AVSA 3EUHA 3HKDE 3O9XA 5JR9B 1YD8G 1HX8A 4H63V 4AKHA 5JR9A 4IIJE 5HYAA 2CXFA 4XBFB 5LA6E 1X79A 4QKNA 2JMHA 5J2UE 2YEVC 4CXXA 3SS1A 4DBQA 3PTRB 4NUUA 4OHFA 2XAFB 3NZPA 1B7TA 4AXPA 3F2EA 4PJJA 2NTYA 3LK2B 3V5UA 3D0TA 4O8SA 2E9XB 1MMDA 4HE8A 3J7Yq 2E9XA 1D1AA 4WBOA 4H9RC 3RH3A 4YHJA 4IHJE 3RPUA 2CXLA 1US7B 4PJLA 5HAXA 2YINA 3N9PA 4IE5A 2IAKA 3RRCA 3N5LA 2JMKA 5HXHA 3FB2A 2UXXB 2CWYA 3CPZA 5JDHA 3CX6B 3N9MA 3SRZA 1UX5A 2B1EA 3LK3B 4MALA 2X66A 1V9DA 2ZM2A 3CKDA 5LHHB 5LGTB 3JC6C 3ZC0A 2QA7A 2XAJB 3N9LA 2V7JA 3IF8B 3UTKA 3H37A 3O1JA 5LXTE 2YU1A 1WR6A 3J9X1 3GWHA 3BK9A 3IHRA 2LE8A 5HWXA 1LVFA 1BR4A 3WAKA 4QXHB 3MK7C 2E8IA 4UF0B 3PU3A 4UF0A 2X9YA 2CXDA 2WAUA 3I0QA 1FIOA 5LG4A 2YU2A 3LJCA 4CXWA 3ZLIA 4ISTA 5KMGP 5E0OA 3W15B 1IZNB 2ZM0A 4C90A 5JDGA 3L09A 1HCIA 4O4IE 2LSYA 1QUUA 3C51A 4H9QC 4AKRB 4AI6A 5LYJE 3PUAA 4ADZA 2RA1A 2MOZA 1YKEB 5EK3A 3QUJA 5L2LA 2WMOA 3DP7A 4O4JE 4AQFC 2HPJA 4KUMB 2L9QA 2GK9A 2N9DA 4E7SA 1S35A 4DO0A 4PK5A 2HPLA 4KP3C 2DWGA 4ZS2A 4IE6A 2VB6A 4U74A 4X20E 5DJQC 3PUQA 1E1HB 2CM0A 2LSJA 5EK4A 3BQLA 2RP4A 4H63H 4UVBB 2SPCA 5LP6E 3CQXC 5IHYA 5LGUB 1CUNA 1OWAA 2L8KA 2XASB 4ISSA 1WRDA 4NUVA 1MMGA 2NWBA 4JEHB 3M65A 3NRYA 3ZC1A 3HA4A 3KV9A 4GOUA 3LK42 1MNEA 3KFWX 3CQCB 5L3BB 3VU7H 2Y8DA 5ADXL 1SA0E 3SWHA 2KMFA 4X1IE 4UELA 3Q2MA 2N2NA 3N2OA 2C0SA 4ASKA 5HWYA 2Q9QD 2HH7A 1UCUA 2VKJA 4OK0A 3PUGA 2Y6XA 3DTOA 4TX5A 5DQWA 4EIWA 1BR2A 3L3PA 3RC8A 4TV9E 2A72A 2K9AA 5FXZA 3PUSA 4TUYE 4I4TE 4TZ4C 5J1GA 4EOZB 2XUEA 5A1LA 2ODUA 3HKEE 5JR9C 5FNVE 2JRKA 4UEMA 1IJ6A 2DWKA 3K8PC 1WYCA 3TKLB 4GK5E 3K3QC 4PK6A 4PJMA 2KT9A 4B6XA 3KBTA 4A56A 4ZS3A 1MMAA 4QHOA 3AAAB 3ZMSB 2NP9A 2E9XC 2KXPB 5F8PA 2H7OA 2A3DA 2DNXA 2ZLYA 1IAPA 2V1DB 3FBZA 5L3DB 3GN5B 2WSSV 2ODVA 2MYSA 4U72A 3GN5A 4ZOLE 3ESLA 5JDMA 3GMIA 1ZEEA 2ES0A 4BAYB 4C91A 3KBUA 4G2AA 3UUMA 3HKCE 3I9YA 3C4XA 1G73A 2C5IT 2A2FX 2OA5A 4PK4A 5LCYA 3RYIE 3UFEA 2IW5B 2EHOC 2P9BA 1D0ZA 3K3NA 4GYRA 4HEAA 4M1PA 4YFSA 3OJAA 4MLKA 2K5BB 1NAFA 2CLYB 4O4LE 3ETVA 2EHOB 3F57A 5JDFA 3R84B 4CXYA 2EHOA 2D0UA 3AVRA 2VWAA 5FMNA 4L5GA 4ZI2C 3QK6A 4BJMA 3ZMTB 2V7KA 4GYSA 4JLEA 3SOLA 4YJ3E 5GONE 2X9HA 3ZYMA 3UULA 2X9WA 1U5PA 5JDLA 4P09A 3MKDA 2I59A 2J1DG 5LHIB 2NW7A 5EZYE 2XAQB 4GK0E 5JVDE 5HXEA 2PJQA 3PDYA 4UV8B 4PFPA 4BA9A 3RYHE 2D5UA 4OYKA 2KINB 2W0GA 2DHRA 4ERRA 3EDVA 4I50E 3PURA 2DI4A 2V7LA 4WNKA 3UUXB 4I43B 2LT3A 3I1AA 3LBXB 3ONXA 4IE7A 2N1GA 2QGSA 3QC9A 3AAEB 1MIWA 2ZMAA 4HTEA 4CZZB 5H6RB 1D0YA 3O4XE 3WAJA 3UUNA 1T98A 2C5KT 2WWUA 3NRXA 4UIGA 2NTXA 4ZI3C 3VKHA 2VKHA 3B57A 1Z0PA 2JQQA 1ZHCA 3MXZA 5LBMA 4PJNA 4CI3B 4X1KE 4JUYA 2C5JA 4AKLA 3KVAA 3ZCIA 3CQGB 3ANWB 2XAHB 3ANWA 4PAGA 1U4QA 2WMNA 3KINB 1D0XA 3C4WA 2ZM8A 3CVRA 5LOVE 4CI1B 1G8XA 2BZBA 2NW9A 2W61A 3ETUA 2JPFA 3AAIA 1MNDA 2H3RA 3RYFE 3ZMVB 1ZV4X 4BJNA 5KDMC 1FMVA 2KWIB 4V1Av 5IYZE 1S94A 5JQGE 1KK7A 2CWOA 4H9NC 5EK2A 2G0UA 2XTLA 4PFOA 5M4YA 3RRWA 4YJ2E 2BVMA 5JREA 2XHEB 3MA9A 2D2SA 5C8YE 2W00A 3N9NA 4L9IA 4EZHA 2VKDA 5ETWA 4AKIA 1EZ3A 1WLXA 4YLHA 2V7MA 1IJ5A 5FXXA 3RX6A 4OFZA 2K24A 3HKBE 3ZMUB 4HFVA 3AA1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMH A;  2JRK A;  2LM9 A; 
#chains in the Genus database with same CATH topology
 4IL4 A;  4YY3 T;  3CK6 A;  3B13 A;  3ONJ A;  1FJG T;  4EXT A;  4P0A A;  1ZOY A;  4P0B A;  3F31 A;  3DJB A;  3FXE B;  3C64 A;  2JJ9 A;  1UUS A;  2KND A;  3EVY A;  1HG2 A;  3SFE A;  1HTJ F;  4ANJ A;  2NOX A;  4DND A;  2X68 A;  2LKG A;  2LSG A;  3AE5 A;  1LVK A;  1UX4 A;  3V5S A;  3K3O A;  2Q9Q B;  3KVB A;  4H9S E;  2XSB A;  4EAH A;  3NBX X;  3KV5 A;  3LFM A;  3EDU A;  5AQH B;  2WY2 A;  3QOF A;  3BQK A;  1AJ3 A;  1HF8 A;  4GIW A;  4H9P C;  3MZK B;  1BR0 A;  2DLR A;  4B3M T;  1OXZ A;  4Z8X A;  3FHN A;  4EV6 A;  1ZKE A;  2LHN A;  2X9X A;  3Q9D A;  2WZI A;  4ILU A;  3OKQ A;  5HXC A;  2UUA T;  3AE6 A;  4WW0 A;  1VOM A;  2L3L A;  2KSR A;  4QH1 A;  2MTQ A;  4U31 A;  4EYY R;  4P1N A;  2PG8 A;  3AE7 A;  2JQ9 A;  2BDE A;  3E22 E;  4DR1 T;  4O2A E;  5JRC A;  4ZHQ E;  5FP3 A;  3E08 A;  2UUB T;  3CML A;  3RC3 A;  3FZM B;  2CRB A;  3BQI A;  3PV0 F;  4MBQ A;  1WYB A;  3OBV E;  2X51 A;  5AQT B;  3JAE A;  5JTG A;  2E9X D;  2XM2 A;  5CB4 E;  2ACX A;  4OX9 T;  4TN7 B;  3C98 B;  5HXR A;  2LM9 A;  4UVC B;  3ZMZ B;  2YK0 A;  5CA1 E;  1D1C A;  2WDR A;  4KHZ F;  2LOS A;  2XQ5 A;  1HS7 A;  3EUH A;  3O9X A;  4HFC A;  5HEO A;  4UR9 A;  2CXF A;  3NZP A;  3LK2 B;  4JI1 T;  1SUM B;  2E9X B;  4HE8 A;  3J7Y q;  4WBO A;  5CFB A;  2IAK A;  3G06 A;  3RRC A;  3N5L A;  2JMK A;  3RQU A;  5HXH A;  2UXX B;  1UX5 A;  2B1E A;  3LK3 B;  4MAL A;  1V9D A;  5LHH B;  2V7J A;  2WQY A;  5LXT E;  2UXD T;  2YU1 A;  3GWH A;  2W2U A;  1BR4 A;  3WAK A;  4QXH B;  1VCT A;  3PU3 A;  1XZY A;  3UU3 A;  5E0O A;  3W15 B;  4LML A;  4C90 A;  5JDG A;  2LSY A;  5BR8 T;  5IWA T;  1T8B A;  4LMJ A;  4AQF C;  2VL0 A;  4AIU A;  4COF A;  2VB6 A;  2UXB T;  3PUQ A;  1E1H B;  2CM0 A;  3M3Z B;  2RP4 A;  4Z91 A;  4H63 H;  4UVB B;  3FZF B;  5IHY A;  2W66 A;  5LGU B;  5AQF B;  2XAS B;  5LMN T;  1L0V A;  4NUV A;  4JEH B;  3NRY A;  3PJA A;  5HCM A;  3CIR A;  2Y8D A;  2VKJ A;  4TX5 A;  5DQW A;  1BR2 A;  4LF4 T;  5HEJ A;  4TUY E;  4I4T E;  4YHH T;  3AE9 A;  2JRK A;  5J0Z A;  1XNQ T;  5FL1 A;  4IL9 A;  3TKL B;  4GK5 E;  3K3Q C;  2MPK A;  2XJ7 A;  3KBT A;  1VCS A;  4YSY A;  2E9X C;  5F8P A;  2H7O A;  1IAP A;  2V1D B;  2F4V T;  2RPA A;  2HHH T;  4U72 A;  3GN5 A;  3ESL A;  1ZEE A;  3UUM A;  3HKC E;  3C4X A;  4HWI B;  2C5I T;  2P9B A;  4HFE A;  4M1P A;  4MLK A;  2K5B B;  1NAF A;  3ETV A;  2EHO B;  2D0U A;  4L5G A;  4ZI2 C;  2V7K A;  4JLE A;  2YDS A;  5LHI B;  5HXE A;  5JVD E;  3PDY A;  2VVS A;  4PFP A;  1XNR T;  4OYK A;  3L39 A;  3EDV A;  3UUX B;  3ONX A;  4LF6 T;  2N1G A;  2BKN A;  1D0Y A;  2WWU A;  3B57 A;  5LBM A;  2V6X A;  4AKL A;  3KVA A;  4DV3 T;  2XAH B;  1U4Q A;  2WMN A;  3KIN B;  4CI1 B;  1M7K A;  2WZH A;  3ETU A;  1XMO T;  1FMV A;  4TWH A;  4V1A v;  2QYW A;  4TNV A;  3FZH B;  5M4Y A;  2BVM A;  5JRE A;  2XHE B;  4HWD A;  3P4P A;  5AQK B;  2XPK A;  4EZH A;  4AKI A;  1IJ5 A;  5FXX A;  3MXZ A;  3LSV A;  4YTP A;  1H7C A;  2DL1 A;  3VKG A;  3MJX A;  3U3I A;  2VUR A;  4EB6 E;  2PTF A;  3Q5W A;  1LRZ A;  4DBR A;  4AQY T;  2DCF A;  5JH7 E;  3VRB A;  3ZT6 A;  1E7P A;  5L3F B;  3S4U A;  3ZJ2 A;  2VK9 A;  2Z6E A;  3P8C D;  4CQI A;  5C2T A;  1E2A A;  5F5W A;  1XWM A;  2KZ7 B;  3PE0 A;  4WYV A;  2B76 A;  3HR0 A;  2KLQ A;  2XY8 B;  2IC6 A;  1HFA A;  1Y64 B;  4EZ4 A;  1J5W A;  4FJO A;  3H3A A;  5DQV A;  4DV5 T;  1NEN A;  4FI5 A;  5L4H A;  1OED E;  4KMC A;  5ABH A;  2W62 A;  5FYM A;  3AA0 B;  1T7S A;  3TLT A;  4ZI7 E;  2WDV A;  4HWH A;  4AQG A;  2CCQ A;  4DR2 T;  1Z8U A;  5TAO A;  3ZYL A;  5LGN B;  3CX8 B;  1O3X A;  3ZEF B;  1IBM T;  4MHC A;  2FUP A;  2YN6 A;  3RQW A;  2VAS A;  2BS2 A;  1J5E T;  3X1D A;  2XQ7 A;  4UV9 B;  5DAB A;  3ZKR A;  5JRC B;  2BVL A;  1YKH B;  1QSD A;  3TLU A;  5BMV E;  3UU6 A;  3A5X A;  3A7M A;  4DV4 T;  4O4H E;  5AQU B;  3AEC A;  3AEG A;  4HFD A;  1M62 A;  3JAD A;  5FY1 A;  3UU4 A;  5AQM B;  4K0U A;  2XM1 A;  2BG9 E;  5HXS A;  2XQ3 A;  4L0R A;  5ABE A;  2KWH A;  2CBJ A;  2K3W A;  2ZM6 T;  3ONL C;  4DR4 T;  3CWZ B;  1SHZ C;  5CGM A;  3R6N A;  4K0K T;  3AE4 A;  2AXD S;  4YTN A;  1XDO A;  3HKD E;  3FZL B;  4Z90 A;  4AKH A;  2V5D A;  4LMK A;  5LA6 E;  2JMH A;  5J2U E;  4DBQ A;  5AQS B;  3F2E A;  3AEB A;  3OTO T;  2CHN A;  4IHJ E;  3RPU A;  4PJL A;  5ABF A;  5AQV B;  2CWY A;  3CPZ A;  3N9M A;  3SRZ A;  2WWV A;  2HN2 A;  2X66 A;  2ZM2 A;  3CKD A;  3TLV A;  1N36 T;  3UTK A;  3BK9 A;  3IHR A;  3Q5D A;  3MK7 C;  4UF0 A;  4YT0 A;  1FIO A;  5LG4 A;  4IDO A;  1HCI A;  4O4I E;  1OED A;  4LFB T;  1JNR A;  1QUU A;  4AI6 A;  4NXN T;  5LYJ E;  3PUA A;  2LRK A;  2RA1 A;  4ADZ A;  5EK3 A;  3DP7 A;  4O4J E;  1N33 T;  4KUM B;  2L9Q A;  4E7S A;  1S35 A;  4DO0 A;  4KHP T;  4PK5 A;  5DJQ C;  4A97 A;  2LSJ A;  3BQL A;  5LP6 E;  2E5V A;  3CQX C;  1CUN A;  3B5M A;  1OWA A;  4WZX A;  4ISS A;  1IBK T;  2IUB A;  3M65 A;  3HA4 A;  3KV9 A;  4GOU A;  1MNE A;  3CQC B;  2KMF A;  3AE8 A;  3N2O A;  5LMU T;  2WB5 A;  2C0S A;  2XQ4 A;  5J2T E;  1UCU A;  2Y6X A;  2LRL A;  3DTO A;  3RC8 A;  4TV9 E;  2A72 A;  5FXZ A;  3PUS A;  2XUE A;  5A1L A;  2I0M A;  3ZST A;  2BG9 A;  1HNX T;  1WYC A;  4A5X A;  2R6G F;  4PK6 A;  2BBJ A;  3UUB A;  4PJM A;  1MMA A;  3AAA B;  3ZMS B;  1QLB A;  2NP9 A;  3ZSS A;  2A3D A;  3RIF A;  3GN5 B;  2WSS V;  4ZOL E;  1WR0 A;  3GMI A;  3KBU A;  3I9Y A;  2LM2 A;  1G73 A;  2A2F X;  4GYR A;  3K3N A;  4HEA A;  2XSA A;  4O4L E;  3Q5E A;  4X62 T;  4X64 T;  3QB5 K;  2WU2 A;  4YJ3 E;  2X9H A;  3ZYM A;  3UUL A;  2X9W A;  4P09 A;  4LF8 T;  3MKD A;  2NW7 A;  5EZY E;  2E5L T;  4BA9 A;  3RYH E;  3H3M A;  2YDR A;  2W0G A;  4ERR A;  4TNW A;  4I50 E;  3PUR A;  2DI4 A;  2V7L A;  5C3J A;  3VR9 A;  3EAM A;  1N32 T;  4I43 B;  3I1A A;  3LBX B;  4HTE A;  1MIW A;  5H6R B;  3WAJ A;  3UUN A;  3VKH A;  4UIG A;  2NTX A;  2VKH A;  2JQQ A;  1ZHC A;  4CI3 B;  4X1K E;  4X5T A;  4JUY A;  2C5J A;  1KFY A;  4PAG A;  2XQ8 A;  2UUC T;  3CVR A;  4DUY T;  2BZB A;  2NW9 A;  1YQ4 A;  2JPF A;  1MND A;  1ZV4 X;  4BJN A;  1S94 A;  4HWF A;  5JQG E;  4QH4 A;  1EZ3 A;  1WLX A;  4YLH A;  3RX6 A;  3HKB E;  4JV5 T;  5JDN A;  4DID B;  3T1H T;  3HL6 A;  3RGL A;  4F6R C;  3AA7 B;  5H6Q B;  4U33 A;  5LJM A;  2XAG B;  4CN4 A;  1BR1 A;  2PBI A;  4B3S T;  5LHG B;  2H7V C;  3JC6 D;  3ZJ1 A;  4JYA T;  2M67 A;  5LG3 A;  4HKA A;  4NXM T;  3RYC E;  2X0L B;  4HFB A;  3T8O A;  3PUX F;  3NZQ A;  2BBH A;  3HI2 A;  2CA5 A;  1MIV A;  4HFH A;  3KDS E;  2AE9 A;  3TLW A;  5L3G B;  4KBM B;  1WFD A;  3O1H A;  4QWN B;  3AE2 A;  1NWM X;  2CHO A;  3UFG A;  3ZN0 B;  3RKO A;  4LF7 T;  2LOP A;  2XQY A;  5FY7 A;  1MIY A;  4JI4 T;  1JNZ A;  3AA6 B;  1R8I A;  2LSI A;  1HG5 A;  4ZI3 D;  2CMR A;  2X67 A;  4IGU A;  4CI2 B;  4XAX B;  2LKH A;  3GA8 A;  3LBX A;  4U7I A;  5HCJ A;  2K48 A;  3IBP A;  2XQ9 A;  5AQL B;  4DR6 T;  2FJA A;  4DMV A;  1J1J A;  4X1Y E;  2CEA A;  2LSK A;  4IE4 A;  3N9O A;  2PFV A;  4PW8 A;  4JI6 T;  1W0A A;  3N9Q A;  4HGA A;  5FXV A;  5LB7 B;  3AB3 B;  1GQE A;  5FL0 A;  4J2C A;  3I0O A;  3OYX A;  3N2G E;  3RF1 A;  1FMW A;  4DR7 T;  3AEF A;  3OYZ A;  3LDQ B;  4IT4 A;  2H88 A;  1KNZ A;  4YSZ A;  3N2K E;  3ZN1 B;  4DVD A;  3KV4 A;  3PUY F;  1DU2 A;  1FEW A;  4JEU B;  4WBN E;  2I6H A;  4QXC B;  1VRB A;  5AFU L;  2D9D A;  5JDQ A;  3O1I A;  4EYU A;  5L3E B;  2FJB A;  2LHR A;  3EI0 A;  4IDZ A;  4E7Z A;  2XZE A;  2LJL A;  2MBG A;  1YW0 A;  2J47 A;  3AVS A;  1HX8 A;  5JR9 A;  4IIJ E;  5HYA A;  1X79 A;  4CXX A;  3PTR B;  4NUU A;  4EEB A;  4OHF A;  5FKY A;  1N34 T;  3P4W A;  4DV1 T;  1B7T A;  4AXP A;  2NTY A;  3V5U A;  3D0T A;  5HEU A;  1MMD A;  5CJ5 A;  4YHJ A;  5ABG A;  2WP9 A;  5ABF B;  2YIN A;  2BKO A;  4IE5 A;  2BKP A;  3OPC A;  3FB2 A;  5JDH A;  1T72 A;  5LGT B;  3AXJ A;  3JC6 C;  2XAJ B;  1KNR A;  3N9L A;  3IF8 B;  3H37 A;  3O1J A;  3RIU A;  1KEY A;  5AQR B;  5HWX A;  4B3R T;  2YOE A;  2E8I A;  4UF0 B;  2WAU A;  3I0Q A;  2YU2 A;  3LJC A;  5KMG P;  1OED B;  5L47 A;  4B3T T;  3L09 A;  2J4G A;  2WMO A;  5HEH A;  4JI7 T;  2GK9 A;  4U7Y A;  2HPL A;  4KP3 C;  5FVK A;  2DWG A;  4ZS2 A;  4IE6 A;  4U74 A;  4X20 E;  2V8S V;  5EK4 A;  4ILC A;  4I0U A;  1WRD A;  2NWB A;  1XDP A;  3RKG A;  5L3B B;  4HFI A;  1SA0 E;  4X1I E;  4UEL A;  2N2N A;  4U2Z A;  1NEK A;  4ASK A;  5HWY A;  2Q9Q D;  4OK0 A;  1XMQ T;  3L3P A;  4TZ4 C;  4EOZ B;  2NR4 A;  5J1G A;  2ODU A;  2V6Y A;  4ILB A;  2M6I A;  2BG9 B;  3HKE E;  4UEM A;  1IJ6 A;  4KX6 A;  3UQ4 A;  2FJE A;  2VQF T;  2KXP B;  2UU9 T;  5L4E A;  2DNX A;  2ZLY A;  3NWI A;  2A9U A;  3RLF F;  2MYS A;  2MAW A;  2H89 A;  3SFD A;  5JDM A;  4BAY B;  4G2A A;  3RYI E;  1D0Z A;  4IDP A;  4YFS A;  2CLY B;  3F57 A;  2FJD A;  2VWA A;  4ZZB A;  1WCR A;  4BJM A;  4GYS A;  5GON E;  1U5P A;  2WS3 A;  4IRE A;  4ILA A;  4DV6 T;  4TWF A;  2I59 A;  2VVN A;  2J1D G;  1OED C;  2PJQ A;  4UV8 B;  3JAF A;  2X0H A;  2D5U A;  4X65 T;  2DHR A;  4WNK A;  2LT3 A;  2JQH A;  4IE7 A;  2QGS A;  3QC9 A;  3AAE B;  1IBL T;  1KNP A;  3O4X E;  2IIU A;  2C5K T;  3NRX A;  3A8Y C;  4PJN A;  5KXJ A;  3ANW A;  2BS4 A;  4EED A;  3NKZ A;  3C4W A;  2ZM8 A;  5LOV E;  3IA3 A;  3AAI A;  5KDM C;  4LF9 T;  3P4Q A;  1KK7 A;  2CBI A;  2CWO A;  4H9N C;  2J62 A;  2G0U A;  2XTL A;  3L8R A;  4PFO A;  3RRW A;  2D2S A;  5C8Y E;  2BG9 C;  3N9N A;  2V7M A;  2VQE T;  4GKK T;  1KF6 A;  4YTM A;  3ZMU B;  4HFV A;  3ZT7 A;  3AA1 B;  3LG7 A;  3ZCJ A;  3MAC A;  5KX5 E;  4Q25 A;  2QVA A;  4O2B E;  5FXW A;  5F3J A;  3C50 A;  3PUW F;  2D0T A;  1UK5 A;  2QRX A;  1SE7 A;  4ZI2 D;  2Q9Q C;  3ZYK A;  5LBQ B;  2UXN B;  4G63 A;  3AEE A;  2CLY C;  3UT5 E;  2NW8 A;  2Q9Q A;  3UU5 A;  3VHL A;  2X0Y A;  1LKX A;  4JI2 T;  4HWC A;  2WM9 A;  4TV8 E;  4DV7 T;  4IDQ A;  3ZT5 A;  4CN1 A;  4AKG A;  3KV6 A;  4QX8 B;  4IDN A;  2Y48 B;  1MMN A;  3VR8 A;  2LEH A;  4PNI A;  3U78 A;  4LFC T;  3PJA J;  3ABV A;  4CN6 A;  3I9W A;  1HNZ T;  2IC9 A;  4HN9 A;  3C4Z A;  4UVA B;  3P7I A;  5AQO B;  2VL8 A;  4DMW A;  4OYJ A;  3Q5X A;  2VKO A;  5LNK A;  5CA0 E;  2WBL A;  2XQA A;  4U2Y A;  5L3C B;  4XZC A;  4I55 E;  5LJN A;  2OLT A;  3FXD B;  4A98 A;  3WI3 A;  3ZPO A;  3RI5 A;  2W63 A;  4AQF A;  4N78 D;  3OVU A;  4H9O C;  3CX7 B;  3FBL A;  4MFR A;  3IEE A;  3EAB A;  5FVL A;  4UXN B;  3PU8 A;  4YSX A;  3AEA A;  1D1B A;  2V7I A;  2WDQ A;  1HNW T;  5FY0 A;  3E0Z A;  3RIA A;  2V26 A;  3UQ7 A;  2EHO D;  2V5C A;  4IE0 A;  2WU5 A;  4QXB B;  2CE7 A;  4QX7 B;  2IDO B;  5JR9 B;  1YD8 G;  4H63 V;  4XBF B;  4QKN A;  2YEV C;  2HN1 A;  3SS1 A;  3AE1 A;  4U3C A;  1HR0 T;  2XAF B;  4PJJ A;  2IHR 1;  4O8S A;  2E9X A;  1D1A A;  3K1S A;  4H9R C;  3RH3 A;  2CXL A;  4NPP A;  1US7 B;  4JI5 T;  3QNU A;  5HAX A;  3N9P A;  3CX6 B;  3AXJ B;  2YDQ A;  4F8H A;  3ZC0 A;  2QA7 A;  2JQK A;  3RHW A;  3P4R A;  2W4X A;  5HEG A;  2ACZ A;  1WR6 A;  3J9X 1;  2LE8 A;  1LVF A;  2FBW A;  4GKJ T;  1W9R A;  2X9Y A;  2CXD A;  1CHU A;  4KI0 F;  4CXW A;  3ZLI A;  4IST A;  1X9B A;  4JBW F;  1IZN B;  2ZM0 A;  3C51 A;  4H9Q C;  4AKR B;  2CPT A;  2MOZ A;  3P4S A;  1YKE B;  3PUV F;  3QUJ A;  5L2L A;  2HPJ A;  2N9D A;  3P50 A;  3JCF A;  3VRA A;  4QH5 A;  4DV2 T;  2SPC A;  3NVO A;  5AQP B;  2L8K A;  1MMG A;  3ZC1 A;  3LK4 2;  4TWD A;  3KFW X;  3VU7 H;  5ADX L;  3SWH A;  3Q2M A;  4DR3 T;  2HH7 A;  4EIW A;  3PUG A;  2K9A A;  4ZZC A;  2V6Y B;  4LF5 T;  4EGW A;  5JR9 C;  5FNV E;  2DWK A;  3K8P C;  5IUX A;  2OV9 A;  2KT9 A;  1W0B A;  4B6X A;  4A56 A;  1I94 T;  4ZS3 A;  4QHO A;  4X66 T;  1I6Z A;  2LLY A;  3FBZ A;  2WCA A;  5L3D B;  2ODV A;  3FZK B;  5AQJ B;  1ZP0 A;  1W09 A;  4C91 A;  2ES0 A;  5AQQ B;  2OA5 A;  4PK4 A;  5LCY A;  3UFE A;  2IW5 B;  3UU8 A;  2EHO C;  3PUZ F;  4ZXL A;  2M6B A;  3OJA A;  3EHZ A;  1UUR A;  3R84 B;  4CXY A;  5JDF A;  3RIU C;  2EHO A;  3AVR A;  5FMN A;  4JI0 T;  4ZEY A;  3QK6 A;  3ZMT B;  3SOL A;  3QB5 A;  2UXC T;  3AE3 A;  1HX1 B;  5JDL A;  4YXD A;  4DV0 T;  2XAQ B;  4GK0 E;  1YXR A;  2IML A;  2W67 A;  2KIN B;  1Y01 A;  4LFA T;  4CZZ B;  4DUZ T;  2ZMA A;  5AQN B;  2JIW A;  1T98 A;  4ZI3 C;  1Z0P A;  3AED A;  4JI8 T;  2E2A A;  3ZCI A;  1UGO A;  3CQG B;  3ANW B;  1YQ3 A;  3TLS A;  2BS3 A;  1D0X A;  5AQI B;  1G8X A;  4NIQ A;  4JI3 T;  2W61 A;  4DR5 T;  3RYF E;  2H3R A;  3ZMV B;  2KWI B;  5IYZ E;  2YKS A;  5EK2 A;  4YJ2 E;  2XQ6 A;  3MA9 A;  2W00 A;  4L9I A;  2VKD A;  5ETW A;  5AQG B;  3T1Y T;  4AIS A;  4OFZ A;  2K24 A; 
#chains in the Genus database with same CATH homology
 5JDN A;  3LG7 A;  3ZCJ A;  3B13 A;  4EXT A;  1H7C A;  3HL6 A;  3MAC A;  4F6R C;  3AA7 B;  5KX5 E;  3VKG A;  3MJX A;  5H6Q B;  3U3I A;  4P0A A;  4EB6 E;  5LJM A;  4O2B E;  4P0B A;  2XAG B;  3F31 A;  3DJB A;  3FXE B;  3Q5W A;  1BR1 A;  1LRZ A;  5FXW A;  4DBR A;  5F3J A;  2PBI A;  5LHG B;  2H7V C;  2DCF A;  3C64 A;  2JJ9 A;  5JH7 E;  3JC6 D;  3ZJ1 A;  5L3F B;  2KND A;  3C50 A;  1HG2 A;  2D0T A;  3EVY A;  1HTJ F;  2M67 A;  4ANJ A;  2NOX A;  4DND A;  3S4U A;  2X68 A;  4HKA A;  2LSG A;  3RYC E;  4ZI2 D;  3ZJ2 A;  1LVK A;  1UX4 A;  2Q9Q C;  2VK9 A;  3V5S A;  2Z6E A;  3ZYK A;  3K3O A;  5LBQ B;  2UXN B;  3P8C D;  4G63 A;  4CQI A;  2CLY C;  2Q9Q B;  2X0L B;  3UT5 E;  3KVB A;  2NW8 A;  2Q9Q A;  3T8O A;  4H9S E;  3VHL A;  2KZ7 B;  4EAH A;  1LKX A;  3PE0 A;  3NZQ A;  2WM9 A;  3HI2 A;  2CA5 A;  4TV8 E;  3HR0 A;  1MIV A;  3NBX X;  2KLQ A;  3KV5 A;  3LFM A;  3EDU A;  3KDS E;  5L3G B;  3BQK A;  4KBM B;  2IC6 A;  3O1H A;  4QWN B;  1AJ3 A;  1HFA A;  1HF8 A;  3KV6 A;  4GIW A;  1Y64 B;  4QX8 B;  4AKG A;  1NWM X;  4EZ4 A;  4FJO A;  4H9P C;  3H3A A;  3MZK B;  5DQV A;  1BR0 A;  2DLR A;  2Y48 B;  1MMN A;  1OXZ A;  3ZN0 B;  4Z8X A;  3FHN A;  3RKO A;  2LOP A;  4FI5 A;  2XQY A;  2LEH A;  4PNI A;  3U78 A;  5FY7 A;  1MIY A;  4KMC A;  3AA6 B;  2LSI A;  1ZKE A;  2W62 A;  2LHN A;  5FYM A;  3AA0 B;  2X9X A;  1HG5 A;  4ZI3 D;  4ZI7 E;  3I9W A;  2CMR A;  3Q9D A;  2X67 A;  4IGU A;  4ILU A;  3OKQ A;  4CI2 B;  4XAX B;  4AQG A;  2CCQ A;  5HXC A;  2IC9 A;  3GA8 A;  4HN9 A;  5TAO A;  3LBX A;  3ZYL A;  3C4Z A;  4WW0 A;  5LGN B;  1VOM A;  3CX8 B;  1O3X A;  4UVA B;  3P7I A;  2K48 A;  3ZEF B;  4MHC A;  2L3L A;  3IBP A;  2VAS A;  2VL8 A;  4DMW A;  4OYJ A;  3Q5X A;  2MTQ A;  4DMV A;  4X1Y E;  4EYY R;  2VKO A;  5LNK A;  2PG8 A;  2CEA A;  5CA0 E;  2LSK A;  4UV9 B;  5DAB A;  2BDE A;  2WBL A;  4IE4 A;  3N9O A;  3E22 E;  5L3C B;  2PFV A;  4XZC A;  5JRC B;  4PW8 A;  2BVL A;  4I55 E;  3N9Q A;  4HGA A;  5LJN A;  5FXV A;  1YKH B;  1QSD A;  3AB3 B;  3FXD B;  4O2A E;  4ZHQ E;  5JRC A;  5BMV E;  3WI3 A;  3A5X A;  5FP3 A;  3ZPO A;  4O4H E;  4J2C A;  3E08 A;  3I0O A;  3CML A;  3RC3 A;  2W63 A;  4AQF A;  3OYX A;  3N2G E;  4N78 D;  3BQI A;  4MBQ A;  1WYB A;  5FY1 A;  4H9O C;  3CX7 B;  1FMW A;  4K0U A;  5J2T E;  3FBL A;  3OBV E;  2X51 A;  4MFR A;  3IEE A;  3OYZ A;  1KNZ A;  5HXS A;  2E9X D;  4UXN B;  3N2K E;  4L0R A;  3ZN1 B;  5CB4 E;  2ACX A;  4DVD A;  2KWH A;  3PU8 A;  3KV4 A;  4TN7 B;  3C98 B;  5HXR A;  1FEW A;  1D1B A;  2LM9 A;  4JEU B;  4WBN E;  4QXC B;  1VRB A;  4UVC B;  2V7I A;  5AFU L;  3ZMZ B;  3CWZ B;  5JDQ A;  5FY0 A;  3E0Z A;  2YK0 A;  5CA1 E;  1SHZ C;  2V26 A;  3O1I A;  4EYU A;  1D1C A;  5L3E B;  2EHO D;  3R6N A;  2LHR A;  4IDZ A;  2LOS A;  4IE0 A;  4E7Z A;  1HS7 A;  4QXB B;  2LJL A;  2MBG A;  1YW0 A;  2CE7 A;  4QX7 B;  3AVS A;  3EUH A;  3HKD E;  3O9X A;  5JR9 B;  1YD8 G;  1HX8 A;  4H63 V;  4AKH A;  5JR9 A;  4IIJ E;  5HYA A;  2CXF A;  4XBF B;  5LA6 E;  1X79 A;  4QKN A;  2JMH A;  5J2U E;  2YEV C;  4CXX A;  3SS1 A;  4DBQ A;  3PTR B;  4NUU A;  4OHF A;  2XAF B;  3NZP A;  1B7T A;  4AXP A;  3F2E A;  4PJJ A;  2NTY A;  3LK2 B;  3V5U A;  3D0T A;  4O8S A;  2E9X B;  1MMD A;  4HE8 A;  3J7Y q;  2E9X A;  1D1A A;  4WBO A;  4H9R C;  3RH3 A;  4YHJ A;  4IHJ E;  3RPU A;  2CXL A;  1US7 B;  4PJL A;  5HAX A;  2YIN A;  3N9P A;  4IE5 A;  2IAK A;  3RRC A;  3N5L A;  2JMK A;  5HXH A;  3FB2 A;  2UXX B;  2CWY A;  3CPZ A;  5JDH A;  3CX6 B;  3N9M A;  3SRZ A;  1UX5 A;  2B1E A;  3LK3 B;  4MAL A;  2X66 A;  1V9D A;  2ZM2 A;  3CKD A;  5LHH B;  5LGT B;  3JC6 C;  3ZC0 A;  2QA7 A;  2XAJ B;  3N9L A;  2V7J A;  3IF8 B;  3UTK A;  3H37 A;  3O1J A;  5LXT E;  2YU1 A;  1WR6 A;  3J9X 1;  3GWH A;  3BK9 A;  3IHR A;  2LE8 A;  5HWX A;  1LVF A;  1BR4 A;  3WAK A;  4QXH B;  3MK7 C;  2E8I A;  4UF0 B;  3PU3 A;  4UF0 A;  2X9Y A;  2CXD A;  2WAU A;  3I0Q A;  1FIO A;  5LG4 A;  2YU2 A;  3LJC A;  4CXW A;  3ZLI A;  4IST A;  5KMG P;  5E0O A;  3W15 B;  1IZN B;  2ZM0 A;  4C90 A;  5JDG A;  3L09 A;  1HCI A;  4O4I E;  2LSY A;  1QUU A;  3C51 A;  4H9Q C;  4AKR B;  4AI6 A;  5LYJ E;  3PUA A;  4ADZ A;  2RA1 A;  2MOZ A;  1YKE B;  5EK3 A;  3QUJ A;  5L2L A;  2WMO A;  3DP7 A;  4O4J E;  4AQF C;  2HPJ A;  4KUM B;  2L9Q A;  2GK9 A;  2N9D A;  4E7S A;  1S35 A;  4DO0 A;  4PK5 A;  2HPL A;  4KP3 C;  2DWG A;  4ZS2 A;  4IE6 A;  2VB6 A;  4U74 A;  4X20 E;  5DJQ C;  3PUQ A;  1E1H B;  2CM0 A;  2LSJ A;  5EK4 A;  3BQL A;  2RP4 A;  4H63 H;  4UVB B;  2SPC A;  5LP6 E;  3CQX C;  5IHY A;  5LGU B;  1CUN A;  1OWA A;  2L8K A;  2XAS B;  4ISS A;  1WRD A;  4NUV A;  1MMG A;  2NWB A;  4JEH B;  3M65 A;  3NRY A;  3ZC1 A;  3HA4 A;  3KV9 A;  4GOU A;  3LK4 2;  1MNE A;  3KFW X;  3CQC B;  5L3B B;  3VU7 H;  2Y8D A;  5ADX L;  1SA0 E;  3SWH A;  2KMF A;  4X1I E;  4UEL A;  3Q2M A;  2N2N A;  3N2O A;  2C0S A;  4ASK A;  5HWY A;  2Q9Q D;  2HH7 A;  1UCU A;  2VKJ A;  4OK0 A;  3PUG A;  2Y6X A;  3DTO A;  4TX5 A;  5DQW A;  4EIW A;  1BR2 A;  3L3P A;  3RC8 A;  4TV9 E;  2A72 A;  2K9A A;  5FXZ A;  3PUS A;  4TUY E;  4I4T E;  4TZ4 C;  5J1G A;  4EOZ B;  2XUE A;  5A1L A;  2ODU A;  3HKE E;  5JR9 C;  5FNV E;  2JRK A;  4UEM A;  1IJ6 A;  2DWK A;  3K8P C;  1WYC A;  3TKL B;  4GK5 E;  3K3Q C;  4PK6 A;  4PJM A;  2KT9 A;  4B6X A;  3KBT A;  4A56 A;  4ZS3 A;  1MMA A;  4QHO A;  3AAA B;  3ZMS B;  2NP9 A;  2E9X C;  2KXP B;  5F8P A;  2H7O A;  2A3D A;  2DNX A;  2ZLY A;  1IAP A;  2V1D B;  3FBZ A;  5L3D B;  3GN5 B;  2WSS V;  2ODV A;  2MYS A;  4U72 A;  3GN5 A;  4ZOL E;  3ESL A;  5JDM A;  3GMI A;  1ZEE A;  2ES0 A;  4BAY B;  4C91 A;  3KBU A;  4G2A A;  3UUM A;  3HKC E;  3I9Y A;  3C4X A;  1G73 A;  2C5I T;  2A2F X;  2OA5 A;  4PK4 A;  5LCY A;  3RYI E;  3UFE A;  2IW5 B;  2EHO C;  2P9B A;  1D0Z A;  3K3N A;  4GYR A;  4HEA A;  4M1P A;  4YFS A;  3OJA A;  4MLK A;  2K5B B;  1NAF A;  2CLY B;  4O4L E;  3ETV A;  2EHO B;  3F57 A;  5JDF A;  3R84 B;  4CXY A;  2EHO A;  2D0U A;  3AVR A;  2VWA A;  5FMN A;  4L5G A;  4ZI2 C;  3QK6 A;  4BJM A;  3ZMT B;  2V7K A;  4GYS A;  4JLE A;  3SOL A;  4YJ3 E;  5GON E;  2X9H A;  3ZYM A;  3UUL A;  2X9W A;  1U5P A;  5JDL A;  4P09 A;  3MKD A;  2I59 A;  2J1D G;  5LHI B;  2NW7 A;  5EZY E;  2XAQ B;  4GK0 E;  5JVD E;  5HXE A;  2PJQ A;  3PDY A;  4UV8 B;  4PFP A;  4BA9 A;  3RYH E;  2D5U A;  4OYK A;  2KIN B;  2W0G A;  2DHR A;  4ERR A;  3EDV A;  4I50 E;  3PUR A;  2DI4 A;  2V7L A;  4WNK A;  3UUX B;  4I43 B;  2LT3 A;  3I1A A;  3LBX B;  3ONX A;  4IE7 A;  2N1G A;  2QGS A;  3QC9 A;  3AAE B;  1MIW A;  2ZMA A;  4HTE A;  4CZZ B;  5H6R B;  1D0Y A;  3O4X E;  3WAJ A;  3UUN A;  1T98 A;  2C5K T;  2WWU A;  3NRX A;  4UIG A;  2NTX A;  4ZI3 C;  3VKH A;  2VKH A;  3B57 A;  1Z0P A;  2JQQ A;  1ZHC A;  3MXZ A;  5LBM A;  4PJN A;  4CI3 B;  4X1K E;  4JUY A;  2C5J A;  4AKL A;  3KVA A;  3ZCI A;  3CQG B;  3ANW B;  2XAH B;  3ANW A;  4PAG A;  1U4Q A;  2WMN A;  3KIN B;  1D0X A;  3C4W A;  2ZM8 A;  3CVR A;  5LOV E;  4CI1 B;  1G8X A;  2BZB A;  2NW9 A;  2W61 A;  3ETU A;  2JPF A;  3AAI A;  1MND A;  2H3R A;  3RYF E;  3ZMV B;  1ZV4 X;  4BJN A;  5KDM C;  1FMV A;  2KWI B;  4V1A v;  5IYZ E;  1S94 A;  5JQG E;  1KK7 A;  2CWO A;  4H9N C;  5EK2 A;  2G0U A;  2XTL A;  4PFO A;  5M4Y A;  3RRW A;  4YJ2 E;  2BVM A;  5JRE A;  2XHE B;  3MA9 A;  2D2S A;  5C8Y E;  2W00 A;  3N9N A;  4L9I A;  4EZH A;  2VKD A;  5ETW A;  4AKI A;  1EZ3 A;  1WLX A;  4YLH A;  2V7M A;  1IJ5 A;  5FXX A;  3RX6 A;  4OFZ A;  2K24 A;  3HKB E;  3ZMU B;  4HFV A;  3AA1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...