2LM9A

The nmr structure of a major allergen from dust mite
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
96
structure length
96
Chain Sequence
NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blo t 21 allergen
publication title NMR structure and IgE epitopes of Blo t 21, a major dust mite allergen from Blomia tropicalis
pubmed doi rcsb
source organism Blomia tropicalis
molecule tags Allergen
total genus 42
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lm9A00
2JMHA 2JRKA 2LM9A
chains in the Genus database with same CATH superfamily
1KNZA 4JEUB 2FJAA 3P4SA 1W0BA 2WDQA 3VR9A 5LXTE 2CLYB 3LK3B 2P9BA 3HI2A 2IAKA 2E8IA 3EAMA 3FBLA 3Q9DA 3ZC0A 3CKDA 2Z6EA 5JQGE 2JIWA 2CWOA 4UV8B 2OLTA 2W61A 5FY1A 2J62A 3ZJ1A 2UXNB 5JREA 4HFIA 1J1JA 3LFMA 5LGUB 3GN5B 3N2OA 5AQGB 5JDLA 1D1AA 2LKGA 3ONLC 5AQQB 4IE4A 1S35A 3RQWA 3UTKA 4ZHQE 5LP6E 5HXSA 4DUYT 5FY7A 4WYVA 3RRWA 2HN1A 3BK9A 4YTPA 3RX6A 5HEHA 3HKDE 3A7MA 2EHOB 3I9WA 5DJQC 2WMOA 2X9YA 4TWHA 3PDYA 4P1NA 3PUXF 4Z90A 5FXWA 2X66A 4COFA 1QLBA 3C51A 4EYUA 1WYCA 1D1BA 4X64T 2YDQA 1KF6A 1U5PA 3OYXA 2HPLA 3SFDA 2A9UA 1V9DA 1YXRA 2IW5B 5LB7B 4TZ4C 2XAFB 4IDZA 4PK4A 3K3QC 4O4JE 5IUXA 3MA9A 2VWAA 2Q9QB 2PJQA 1UUSA 5KXJA 3N9NA 2DL1A 5HYAA 1Z8UA 1I6ZA 5CA0E 2ACXA 2WAUA 2YU2A 1D0YA 4AXPA 3UQ7A 2D0TA 1W0AA 3RIUA 5ABFA 3N9MA 2M67A 4O4LE 2Y8DA 4P09A 2XPKA 1IJ6A 4WBNE 3ZMVB 1CUNA 3H3MA 3QC9A 4HGAA 2CHOA 3MACA 3UU5A 1Y64B 2V7LA 2CLYC 1XMOT 2NTXA 4QH4A 3ZJ2A 2MAWA 2XAHB 4NUUA 2GK9A 5CJ5A 1N33T 1OEDA 4TX5A 4YT0A 1QUUA 4MALA 4YLHA 3LJCA 2W67A 2FJEA 5JTGA 3ZT6A 5FNVE 5EK4A 2V1DB 4IE0A 3KV5A 5L3CB 2V6XA 4F6RC 1IBKT 4G2AA 3WI3A 4ZEYA 2A72A 4LMKA 2JQ9A 3C4XA 3ZC1A 2X67A 3O1IA 4LF8T 3JADA 4WW0A 4ISSA 3E22E 1UK5A 5CB4E 5HXHA 1KEYA 3OKQA 5BR8T 3ETUA 2CHNA 5LG4A 5FL1A 2V7IA 1NWMX 2PTFA 3LK42 4JI7T 1ZOYA 2EHOC 5ABHA 5C3JA 1Y01A 3AE5A 2KWHA 3FXDB 2AE9A 3DP7A 3UULA 3CIRA 3CX6B 1LRZA 2J4GA 3IF8B 3PUAA 4MHCA 4QWNB 1W9RA 2XHEB 2WSSV 4KMCA 3AA0B 1IJ5A 3PJAJ 4DV1T 2XQ6A 1VCSA 3ONXA 4PW8A 3EHZA 3U78A 2LEHA 2BS3A 3FZFB 4DV4T 4I55E 3SFEA 2LOSA 1DU2A 3C64A 3LG7A 1AJ3A 3P7IA 2EHOD 4U33A 4C90A 4H63H 3ZT7A 4IDNA 4EGWA 3PUYF 4ILUA 3IBPA 4BJMA 1S94A 3F31A 3KBUA 2E5LT 2KMFA 3R6NA 5LJMA 3OVUA 1T8BA 3TLUA 2B1EA 4PJMA 2YDRA 4HWIB 2V26A 3UU4A 5LHGB 2XM1A 4HFCA 5KMGP 2E5VA 3RYCE 4KX6A 5ABFB 2CE7A 5LHHB 3NRXA 1E1HB 2V5CA 2XAJB 3MZKB 4IDOA 2CWYA 3UUMA 3HKBE 1OEDB 2D2SA 4QX7B 5LGNB 4C91A 5HAXA 3V5UA 3AEDA 1HG2A 4YSXA 5LHIB 2VQFT 4X1YE 3AEGA 5CA1E 3T1YT 3KV4A 2H3RA 3ZKRA 3ZCJA 3ZSSA 2K5BB 4GYSA 3TLWA 4AQGA 1Z0PA 5AQKB 1HTJF 5FKYA 3FBZA 4JYAT 2VKDA 3ZSTA 2VVSA 2WDVA 4DV3T 2Y48B 4UVAB 4UIGA 4BJNA 3I1AA 1UX4A 3WAJA 4DR4T 3RHWA 2YINA 4PAGA 1ZKEA 1BR1A 3NKZA 5ADXL 3VKHA 4ZXLA 3QK6A 1NEKA 2FJBA 5FXZA 4CXWA 4NIQA 1WR6A 2XQ3A 2V7JA 1IZNB 4HFVA 1IBLT 3KV6A 3SS1A 3AEFA 2CCQA 3AE7A 4EAHA 2BZBA 4H9RC 2FBWA 2VK9A 3ZMTB 4ZS3A 5HEJA 2VURA 3ZPOA 5A1LA 1XDPA 4JI2T 4Q25A 4U72A 5AFUL 2V7MA 3RQUA 3CMLA 3PV0F 4H9SE 2CEAA 1YQ3A 1JNRA 3NWIA 4AQFA 2WWUA 4J2CA 1HNWT 4DBRA 4JI4T 4JI1T 1UCUA 4IL9A 1YQ4A 4QXHB 4UV9B 2X0HA 2WU5A 3TLVA 5HWXA 3AA6B 1ZEEA 4ASKA 1FIOA 2UXXB 2WB5A 1E7PA 4TWFA 4AI6A 4PK6A 4B3MT 1WCRA 4I4TE 3ZMUB 1OEDC 2Q9QA 2WP9A 2JQQA 3AVSA 2NTYA 4CN6A 4HFEA 4UEMA 5FL0A 5ABGA 4UXNB 1XNQT 2BKPA 3GA8A 2J47A 4LFAT 4U31A 1N34T 4N78D 2XQ5A 4Z91A 2PG8A 2ES0A 2RPAA 3FB2A 2OA5A 5HXRA 4TUYE 2W00A 2DWKA 4G63A 4KHZF 3QB5K 3LDQB 3RI5A 4ZZBA 3CQCB 4A56A 1SHZC 1MMNA 3PU8A 5J1GA 2X68A 3E0ZA 4GIWA 4L5GA 1X79A 4KUMB 5JDNA 4JV5T 3CWZB 2VB6A 2BG9E 4XBFB 4ZOLE 3T8OA 2X51A 2X9HA 1EZ3A 4ERRA 2K48A 3DTOA 1VOMA 4UELA 3J7Yq 4OYJA 3AEEA 1MMGA 3RIFA 4ADZA 4I0UA 4EYYR 3VHLA 4IIJE 5LGTB 3TLTA 3G06A 2I6HA 3M3ZB 2CRBA 2PFVA 5KX5E 3ZCIA 2LSJA 2IMLA 4XZCA 2C5KT 1LVFA 4OFZA 3B57A 2KNDA 4OHFA 2W66A 4UR9A 1T72A 4QHOA 4X1KE 2V6YA 3O1JA 2PBIA 4GK0E 4ZI2C 1WLXA 3AAIA 3P4WA 5HEOA 4ILCA 5ABEA 3RLFF 4PNIA 2E9XA 4TN7B 5HEUA 5JH7E 2UUCT 4HFDA 4DR2T 4CI2B 4KI0F 3Q5DA 2QVAA 2D5UA 4TNVA 3F2EA 1VRBA 2YKSA 3PE0A 1BR4A 4ZI2D 4B3TT 4HWDA 2RP4A 5HCMA 2XM2A 4MLKA 4UF0A 1GQEA 2W0GA 2LM2A 3VR8A 4H9OC 3I0QA 1NAFA 4OK0A 3O1HA 3EABA 3TKLB 3K3OA 2A2FX 3N2GE 1OWAA 1N36T 4DR1T 2XQ4A 3UUBA 3R84B 5L3EB 4AKIA 1SE7A 4IGUA 2H89A 2XQ9A 2WZIA 4JI3T 3PURA 2XUEA 2D9DA 2IC9A 3NBXX 4LF9T 2LLYA 2HPJA 4DR7T 4EEBA 4IREA 4IL4A 4DV0T 2WS3A 2M6IA 2ZM8A 1XZYA 3S4UA 4HTEA 1L0VA 1G73A 4WNKA 1G8XA 4CN1A 3O4XE 3MK7C 1HF8A 3OPCA 5IHYA 4AKLA 3OJAA 2G0UA 2J1DG 5JDHA 4PJNA 5CFBA 4X62T 1W09A 2KXPB 2H7VC 4YHHT 5AQLB 5M4YA 5EK2A 3C50A 1YD8G 1J5WA 2CBIA 4YJ2E 4U7YA 4WBOA 5AQNB 4NPPA 4AQFC 2BS2A 4GK5E 3N9PA 5TAOA 4X1IE 5L3FB 4GKKT 3AE1A 3AE6A 2V6YB 3N9LA 2JMKA 2VVNA 1D1CA 2KLQA 3O9XA 4QXCB 3HL6A 2XSAA 1BR0A 5CGMA 3OTOT 2E9XB 2XASB 3GWHA 5LNKA 2XQAA 2E2AA 2Q9QC 3PUWF 2L9QA 3B13A 4TNWA 3UU3A 3AECA 2K3WA 1WR0A 5FVKA 3RC8A 4DR5T 1X9BA 5JDFA 2ODVA 4A98A 3L8RA 3ZN0B 5FYMA 3AB3B 1FJGT 2LRLA 3CVRA 2IIUA 3X1DA 5EZYE 4PJJA 2VASA 4UF0B 1FMWA 1XNRT 2Q9QD 5JRCA 2LJLA 3PUQA 2DCFA 3RC3A 3QUJA 2MOZA 2ZM0A 3AXJA 4O4IE 5AQTB 5F8PA 3AE9A 2W62A 2YN6A 3UU8A 2QYWA 2BBJA 2YOEA 3ETVA 3AE3A 4AQYT 5JDGA 5GONE 4JI8T 4DMWA 2MTQA 2LM9A 4HWHA 4JBWF 3QB5A 3ANWA 1HNZT 3K1SA 3P50A 3RKGA 5FP3A 2UU9T 3KINB 4PK5A 4IE6A 3EI0A 4HWCA 2X9XA 4AISA 4A97A 5FMNA 2YU1A 2CPTA 3KDSE 1CHUA 2LT3A 2IHR1 3VRBA 2HH7A 1LKXA 3C4ZA 1XDOA 2DHRA 3RYHE 2YEVC 4QH5A 3P4QA 5AQIB 1MNEA 4GOUA 3BQLA 4HFBA 2MBGA 2LHRA 2LE8A 3ZYLA 3ABVA 4HN9A 2OV9A 5L3DB 4LF6T 1JNZA 3KV9A 2XAQB 4LF5T 3NZPA 2LRKA 2L8KA 3Q5WA 3JC6C 1NENA 5AQVB 2E9XC 4ISTA 3OBVE 4AIUA 4U74A 3RKOA 3EUHA 2IC6A 4K0KT 4AKGA 3ZEFB 3AAAB 3U3IA 2NW8A 2WDRA 3P4RA 2NW9A 3AA1B 4O4HE 2BBHA 3HKCE 1KNPA 1HFAA 2XJ7A 3RGLA 5AQMB 2AXDS 2W2UA 4EXTA 3VKGA 4YXDA 3M65A 3JC6D 3C98B 2CA5A 5C8YE 2JJ9A 5J2TE 5FXVA 4V1Av 2VKJA 5JRCB 4ZS2A 2WU2A 2C0SA 2WY2A 3I9YA 4LMJA 3K3NA 4H9PC 3RH3A 4CI1B 5LMUT 3AXJB 4P0AA 4EZHA 1O3XA 4EIWA 4YSZA 3CQGB 2XTLA 3F57A 3KVAA 1OXZA 5FVLA 3CX7B 5F5WA 5LCYA 2LSYA 2DNXA 2DI4A 3Q5EA 4GYRA 1UURA 4MFRA 4KBMB 5ETWA 3ANWB 4JUYA 1R8IA 3N2KE 4ILBA 3H3AA 3N5LA 2ZMAA 2VKHA 4EV6A 3UQ4A 3FXEB 4LF4T 4K0UA 5FY0A 4UVBB 4HWFA 3H37A 2VKOA 4IHJE 1XMQT 4KHPT 4U3CA 2BS4A 5AQJB 2YDSA 3KBTA 2D0UA 4I50E 3PUGA 2CBJA 1D0ZA 2X0YA 3AE4A 2V7KA 5JVDE 4DBQA 3L3PA 1QSDA 3QOFA 3C4WA 2VL0A 1HS7A 3A8YC 3T1HT 4AKHA 2JQKA 4LFBT 2FJDA 1KFYA 3P8CD 3AE2A 1KK7A 3AA7B 1I94T 4DV2T 4DV7T 4NXMT 2UUBT 4CN4A 4QX8B 2RA1A 1OEDE 5HEGA 2CXFA 1HG5A 3PTRB 5LA6E 3UUXB 3IHRA 4HE8A 4OYKA 3ZMZB 4H9NC 2LHNA 3EVYA 4WZXA 2X0LB 2JRKA 4L0RA 3LBXA 4YTNA 4IDPA 3K8PC 4O2AE 5AQRB 2W63A 3GMIA 2XSBA 3HA4A 4DIDB 4MBQA 2F4VT 3ONJA 3JAFA 3SRZA 5LOVE 1XWMA 4H9QC 4DV6T 3L39A 3HR0A 4TV8E 4ILAA 2XQ7A 3NRYA 5LBQB 4HKAA 2BKNA 4DMVA 4ZI3C 3PUZF 4TV9E 5L4HA 5H6RB 4FI5A 2LSIA 3PU3A 3P4PA 4CI3B 1BR2A 1D0XA 3MXZA 2V5DA 2L3LA 1T98A 3AEBA 5DABA 5LMNT 2WBLA 4CQIA 2WWVA 4JI0T 5HWYA 2X9WA 5HCJA 3WAKA 4F8HA 4BA9A 3IEEA 2BG9A 5AQOB 5JR9A 3CX8B 4HEAA 2N9DA 5AQFB 4ANJA 4ZI3D 5L47A 5AQSB 4E7SA 3A5XA 2UXDT 2VQET 2VL8A 5AQPB 1HX8A 4LMLA 1HCIA 3FHNA 4DO0A 1UGOA 3UFGA 3ZLIA 3ZYKA 3SWHA 2H88A 2M6BA 2Y6XA 4IE7A 3D0TA 5IWAT 4JI5T 2A3DA 2K24A 3UU6A 3EDVA 2CXDA 5LG3A 1IAPA 3IA3A 2KZ7B 3Q2MA 5E0OA 1FEWA 1US7B 2BVLA 4FJOA 2NOXA 2WZHA 4TWDA 1WFDA 4CXXA 2HHHT 4NUVA 4YFSA 5L3GB 2KSRA 3CQXC 2LSKA 5LBMA 5H6QB 4Z8XA 3LK2B 4X66T 4ZZCA 3RRCA 3LSVA 2KINB 3ZN1B 3J9X1 4IDQA 2MYSA 4X5TA 2UUAT 3LBXB 3BQIA 2XQYA 1LVKA 2ZM6T 3JCFA 4B6XA 1IBMT 1YKEB 2KWIB 3PUSA 3NZQA 5FXXA 2ODUA 4O2BE 1M62A 3KVBA 5LYJE 3RYFE 4CXYA 2N2NA 4PFOA 3UT5E 3HKEE 4YTMA 4NXNT 4DVDA 5C2TA 2DWGA 2XY8B 5F3JA 4YY3T 2SPCA 1HR0T 1H7CA 2JMHA 2LOPA 4QKNA 4YJ3E 4XAXB 4EB6E 2IDOB 1YKHB 4JI6T 1M7KA 2UXBT 2BG9B 3L09A 2NR4A 3AVRA 4A5XA 5JR9B 1SUMB 4LF7T 2BKOA 4ZI7E 3ZMSB 2I59A 4O8SA 1WYBA 5HXCA 1ZV4X 2H7OA 1T7SA 5JDMA 4U2ZA 4EOZB 5L2LA 3JAEA 3ZYMA 4EEDA 5L3BB 2BDEA 3N9QA 4P0BA 4JLEA 1N32T 3RYIE 2XZEA 3SOLA 2I0MA 4UVCB 4QXBB 2JQHA 2C5JA 5L4EA 3UUNA 4JEHB 1WRDA 4AKRB 3BQKA 2ZLYA 2QGSA 2UXCT 3MJXA 2WCAA 1MMDA 2N1GA 4E7ZA 3QNUA 2WQYA 5DQWA 3FZMB 4DNDA 4I43B 2NP9A 3I0OA 5LJNA 4DR6T 4EZ4A 5AQHB 4U2YA 3UFEA 2W4XA 4YSYA 4M1PA 3KFWX 1B7TA 4DR3T 3ZT5A 3FZKB 3AEAA 2NWBA 3N9OA 3Q5XA 3ESLA 2R6GF 4IT4A 2CM0A 4B3ST 3V5SA 2DLRA 2C5IT 3E08A 1MMAA 2CXLA 2V8SV 3RF1A 5DQVA 3MKDA 5BMVE 5AQUB 2CMRA 3FZHB 2IUBA 3GN5A 4LFCT 3CK6A 1J5ET 1ZP0A 1MNDA 3B5MA 1E2AA 3PJAA 3TLSA 2XAGB 5KDMC 4DV5T 1HX1B 2K9AA 4B3RT 2NW7A 4BAYB 2FUPA 3VRAA 1FMVA 2BVMA 4OX9T 2QA7A 4CZZB 2EHOA 4IE5A 4QH1A 3RPUA 3W15B 1UX5A 4PJLA 2E9XD 3AE8A 5J0ZA 1MIWA 2BG9C 3VU7H 1MIVA 2JPFA 5JR9C 3RIUC 5J2UE 3EDUA 1U4QA 2ACZA 2XQ8A 4X65T 4KP3C 2YK0A 1VCTA 1SA0E 3PUVF 2QRXA 5JDQA 3AAEB 2WM9A 3CPZA 3FZLB 2LSGA 3OYZA 4H63V 4GKJT 1YW0A 4L9IA 4HFHA 2B76A 2WMNA 4YHJA 4U7IA 1KNRA 5IYZE 5HXEA 4PFPA 2MPKA 4X20E 5EK3A 3RIAA 3NVOA 2HN2A 4DUZT 2LKHA 2KT9A 1HNXT 1ZHCA 3DJBA 2ZM2A 1MIYA
chains in the Genus database with same CATH topology
2LSIA 3PU3A 4CI3B 3N9LA 1KNZA 2JMKA 4JEUB 1BR2A 1D0XA 5ADXL 3MXZA 1D1CA 2KLQA 3O9XA 4QXCB 3VKHA 3QK6A 2L3LA 3HL6A 1BR0A 1T98A 5DABA 5LXTE 2WBLA 4CQIA 2CLYB 5FXZA 2E9XB 2XASB 3GWHA 5HWYA 2X9WA 3WAKA 5LNKA 3LK3B 2P9BA 4CXWA 2Q9QC 4BA9A 1WR6A 3IEEA 2L9QA 3B13A 3HI2A 2IAKA 2V7JA 5JR9A 3CX8B 3RC8A 2E8IA 4HEAA 1IZNB 2N9DA 4ANJA 3FBLA 5JDFA 4ZI3D 3Q9DA 2ODVA 4HFVA 3ZC0A 3CKDA 2Z6EA 5JQGE 4E7SA 3A5XA 2CWOA 3KV6A 4UV8B 3SS1A 2CCQA 3ZN0B 5FYMA 2VL8A 3AB3B 2W61A 4EAHA 5FY1A 1HX8A 2BZBA 4H9RC 2VK9A 3CVRA 3ZMTB 1HCIA 3ZJ1A 3FHNA 4DO0A 3ZLIA 2UXNB 4ZS3A 5JREA 3ZYKA 5EZYE 3SWHA 4PJJA 2Y6XA 4IE7A 3D0TA 3LFMA 2VASA 4UF0B 3ZPOA 5A1LA 2A3DA 5LGUB 1FMWA 2K24A 2Q9QD 3GN5B 3N2OA 4U72A 5AFUL 3EDVA 5JRCA 2CXDA 2V7MA 1D1AA 3CMLA 5JDLA 2LJLA 4H9SE 2CEAA 3PUQA 1IAPA 4IE4A 4AQFA 1S35A 2DCFA 2WWUA 3RC3A 3QUJA 2MOZA 2ZM0A 4J2CA 3UTKA 4ZHQE 5LP6E 5HXSA 5FY7A 2KZ7B 4DBRA 3Q2MA 3RRWA 3BK9A 1UCUA 5E0OA 4O4IE 3RX6A 1FEWA 1US7B 4QXHB 4UV9B 2BVLA 3HKDE 5F8PA 2W62A 4FJOA 5HWXA 2NOXA 2EHOB 3AA6B 1ZEEA 3I9WA 5DJQC 3ETVA 4ASKA 1FIOA 2WMOA 2X9YA 4CXXA 2UXXB 3PDYA 5JDGA 5GONE 4NUVA 4YFSA 5FXWA 4AI6A 4PK6A 2X66A 4I4TE 3ZMUB 4DMWA 5L3GB 2MTQA 2Q9QA 2LM9A 3CQXC 2JQQA 3AVSA 2LSKA 2NTYA 3ANWA 3C51A 5LBMA 5FP3A 4EYUA 1WYCA 1D1BA 5H6QB 4UEMA 3KINB 4PK5A 4UXNB 1U5PA 3OYXA 4Z8XA 4IE6A 3LK2B 2X9XA 2HPLA 3RRCA 3GA8A 2KINB 3ZN1B 3J9X1 2MYSA 1V9DA 3LBXB 3BQIA 5FMNA 2YU1A 2XQYA 3KDSE 4N78D 2IW5B 4TZ4C 1LVKA 2LT3A 2PG8A 2XAFB 4IDZA 2ES0A 4B6XA 4PK4A 2HH7A 3K3QC 4O4JE 1YKEB 3MA9A 3FB2A 1LKXA 2KWIB 2OA5A 3C4ZA 2VWAA 2Q9QB 3PUSA 3NZQA 5HXRA 2PJQA 5FXXA 2ODUA 2DHRA 4TUYE 2W00A 2DWKA 3N9NA 4G63A 4O2BE 3RYHE 2YEVC 3KVBA 5LYJE 5HYAA 5CA0E 2ACXA 3RYFE 2WAUA 4CXYA 2YU2A 1MNEA 4GOUA 2N2NA 3BQLA 4PFOA 1D0YA 2MBGA 3UT5E 4AXPA 2LHRA 2LE8A 3HKEE 2D0TA 3ZYLA 4HN9A 4DVDA 3CQCB 3N9MA 2M67A 4O4LE 2Y8DA 4P09A 4A56A 5L3DB 1IJ6A 2DWGA 4WBNE 3ZMVB 3KV9A 1SHZC 1MMNA 2XAQB 3PU8A 5J1GA 1CUNA 5F3JA 2X68A 3NZPA 3QC9A 3E0ZA 2SPCA 4HGAA 2L8KA 1H7CA 3MACA 3Q5WA 4GIWA 3JC6C 4L5GA 2JMHA 1Y64B 2LOPA 4QKNA 1X79A 2V7LA 2CLYC 4KUMB 5JDNA 2E9XC 4ISTA 2NTXA 3OBVE 3ZJ2A 4YJ3E 4XAXB 4U74A 3RKOA 2XAHB 3CWZB 4EB6E 3EUHA 2GK9A 2VB6A 4NUUA 2IC6A 4XBFB 4ZOLE 4AKGA 3ZEFB 1YKHB 3AAAB 3T8OA 4TX5A 1QUUA 2X51A 2X9HA 3L09A 3AVRA 4MALA 2NW8A 3LJCA 4YLHA 3U3IA 1EZ3A 4ERRA 5JR9B 2NW9A 3AA1B 2K48A 3DTOA 4ZI7E 4O4HE 3ZMSB 2I59A 3HKCE 5FNVE 5EK4A 1HFAA 1VOMA 4O8SA 2V1DB 4UELA 4IE0A 3J7Yq 4OYJA 1MMGA 3KV5A 1WYBA 4ADZA 5L3CB 5HXCA 4EYYR 4F6RC 1ZV4X 2H7OA 4IIJE 3VHLA 4EXTA 5LGTB 3VKGA 5JDMA 4EOZB 4G2AA 5L2LA 3M65A 3WI3A 3JC6D 3C98B 2A72A 3ZYMA 3C4XA 3ZC1A 2X67A 5L3BB 2PFVA 3O1IA 2BDEA 5KX5E 2CA5A 3ZCIA 3N9QA 4P0BA 5C8YE 2JJ9A 4JLEA 4WW0A 2LSJA 3RYIE 3SOLA 4ISSA 5J2TE 3E22E 4UVCB 5FXVA 4QXBB 4V1Av 4XZCA 2C5KT 2C5JA 2VKJA 5JRCB 5CB4E 3UUNA 5HXHA 4JEHB 4ZS2A 1WRDA 4AKRB 3BQKA 1LVFA 2ZLYA 2QGSA 4OFZA 3B57A 3OKQA 3MJXA 2KNDA 4OHFA 1MMDA 2C0SA 2N1GA 3ETUA 4QHOA 5LG4A 2V7IA 3I9YA 4E7ZA 1NWMX 3K3NA 4X1KE 4H9PC 3LK42 3O1JA 3RH3A 4CI1B 2PBIA 4GK0E 4ZI2C 5DQWA 1WLXA 3AAIA 2EHOC 4P0AA 4DNDA 4EZHA 1O3XA 4EIWA 2KWHA 4I43B 3CQGB 3FXDB 3DP7A 3UULA 2NP9A 2XTLA 3CX6B 3F57A 3KVAA 1OXZA 1LRZA 3IF8B 4PNIA 3PUAA 4C91A 4MHCA 3I0OA 3CX7B 4QWNB 2E9XA 5LJNA 2XHEB 5LCYA 4TN7B 4EZ4A 5JH7E 3UFEA 2LSYA 2WSSV 2DNXA 2DI4A 4KMCA 3AA0B 1IJ5A 4GYRA 4MFRA 4KBMB 4M1PA 3KFWX 1B7TA 4CI2B 3ONXA 3ANWB 4JUYA 5ETWA 4PW8A 3U78A 2LEHA 4I55E 2D5UA 3N2KE 2LOSA 2NWBA 3F2EA 3C64A 3LG7A 3N9OA 3Q5XA 1AJ3A 1VRBA 3H3AA 3N5LA 3P7IA 2ZMAA 3ESLA 3PE0A 1BR4A 4ZI2D 2VKHA 2CM0A 2EHOD 3V5SA 4C90A 2RP4A 4H63H 2DLRA 3FXEB 2C5IT 3E08A 1MMAA 2CXLA 5DQVA 3MKDA 4K0UA 4ILUA 5BMVE 2CMRA 3IBPA 4UVBB 5FY0A 3H37A 2VKOA 4IHJE 4BJMA 1S94A 3F31A 3KBUA 2KMFA 4MLKA 3R6NA 4UF0A 5LJMA 3GN5A 2W0GA 4H9OC 3I0QA 1NAFA 4OK0A 2B1EA 4PJMA 3O1HA 1MNDA 3KBTA 2D0UA 4I50E 3PUGA 3TKLB 1D0ZA 2V7KA 3K3OA 5JVDE 2A2FX 4DBQA 3N2GE 3L3PA 1OWAA 2XAGB 1QSDA 2V26A 5LHGB 5KDMC 2K9AA 5KMGP 3R84B 5L3EB 3C4WA 4AKIA 1HS7A 4IGUA 2NW7A 3RYCE 4BAYB 4AKHA 3PURA 2CE7A 3P8CD 2XUEA 1FMVA 2IC9A 2BVMA 3NBXX 2QA7A 4CZZB 1KK7A 2EHOA 4IE5A 3AA7B 2HPJA 5LHHB 3NRXA 1E1HB 3RPUA 3W15B 1UX5A 4PJLA 4QX8B 2XAJB 3MZKB 2E9XD 2RA1A 2ZM8A 1MIWA 3S4UA 2CWYA 2CXFA 3UUMA 1HG5A 3PTRB 5LA6E 3VU7H 3UUXB 1MIVA 2JPFA 3IHRA 5JR9C 3HKBE 4HTEA 4HE8A 1G73A 4WNKA 4OYKA 1G8XA 5J2UE 2D2SA 3EDUA 3O4XE 4QX7B 5LGNB 1U4QA 3MK7C 1HF8A 3ZMZB 4H9NC 5HAXA 2LHNA 3OJAA 5IHYA 3EVYA 3V5UA 2G0UA 4AKLA 2X0LB 1HG2A 4KP3C 5LHIB 4X1YE 2YK0A 2JRKA 2J1DG 5JDHA 1SA0E 5CA1E 4L0RA 4PJNA 3KV4A 2H3RA 1BR1A 3LBXA 5JDQA 3AAEB 2WM9A 3K8PC 2KXPB 3CPZA 4O2AE 2H7VC 3ZCJA 2W63A 3GMIA 2K5BB 2LSGA 3HA4A 3OYZA 5M4YA 4GYSA 4H63V 4AQGA 1YW0A 1Z0PA 4MBQA 4L9IA 5EK2A 1HTJF 3C50A 3SRZA 5LOVE 1YD8G 3FBZA 4H9QC 2VKDA 2WMNA 4YJ2E 4YHJA 3HR0A 4TV8E 4WBOA 5IYZE 4AQFC 4GK5E 3NRYA 4PFPA 5HXEA 2Y48B 3N9PA 4X20E 4UVAB 4UIGA 5EK3A 5LBQB 5TAOA 4HKAA 4BJNA 3I1AA 1UX4A 4DMVA 4X1IE 4ZI3C 3WAJA 2KT9A 5L3FB 4TV9E 2YINA 1ZHCA 3DJBA 5H6RB 4FI5A 4PAGA 1ZKEA 2ZM2A 1MIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMH A;  2JRK A;  2LM9 A; 
#chains in the Genus database with same CATH topology
 1KNZ A;  4JEU B;  2FJA A;  3P4S A;  1W0B A;  2WDQ A;  3VR9 A;  5LXT E;  2CLY B;  3LK3 B;  2P9B A;  3HI2 A;  2IAK A;  2E8I A;  3EAM A;  3FBL A;  3Q9D A;  3ZC0 A;  3CKD A;  2Z6E A;  5JQG E;  2JIW A;  2CWO A;  4UV8 B;  2OLT A;  2W61 A;  5FY1 A;  2J62 A;  3ZJ1 A;  2UXN B;  5JRE A;  4HFI A;  1J1J A;  3LFM A;  5LGU B;  3GN5 B;  3N2O A;  5AQG B;  5JDL A;  1D1A A;  2LKG A;  3ONL C;  5AQQ B;  4IE4 A;  1S35 A;  3RQW A;  3UTK A;  4ZHQ E;  5LP6 E;  5HXS A;  4DUY T;  5FY7 A;  4WYV A;  3RRW A;  2HN1 A;  3BK9 A;  4YTP A;  3RX6 A;  5HEH A;  3HKD E;  3A7M A;  2EHO B;  3I9W A;  5DJQ C;  2WMO A;  2X9Y A;  4TWH A;  3PDY A;  4P1N A;  3PUX F;  4Z90 A;  5FXW A;  2X66 A;  4COF A;  1QLB A;  3C51 A;  4EYU A;  1WYC A;  1D1B A;  4X64 T;  2YDQ A;  1KF6 A;  1U5P A;  3OYX A;  2HPL A;  3SFD A;  2A9U A;  1V9D A;  1YXR A;  2IW5 B;  5LB7 B;  4TZ4 C;  2XAF B;  4IDZ A;  4PK4 A;  3K3Q C;  4O4J E;  5IUX A;  3MA9 A;  2VWA A;  2Q9Q B;  2PJQ A;  1UUS A;  5KXJ A;  3N9N A;  2DL1 A;  5HYA A;  1Z8U A;  1I6Z A;  5CA0 E;  2ACX A;  2WAU A;  2YU2 A;  1D0Y A;  4AXP A;  3UQ7 A;  2D0T A;  1W0A A;  3RIU A;  5ABF A;  3N9M A;  2M67 A;  4O4L E;  2Y8D A;  4P09 A;  2XPK A;  1IJ6 A;  4WBN E;  3ZMV B;  1CUN A;  3H3M A;  3QC9 A;  4HGA A;  2CHO A;  3MAC A;  3UU5 A;  1Y64 B;  2V7L A;  2CLY C;  1XMO T;  2NTX A;  4QH4 A;  3ZJ2 A;  2MAW A;  2XAH B;  4NUU A;  2GK9 A;  5CJ5 A;  1N33 T;  1OED A;  4TX5 A;  4YT0 A;  1QUU A;  4MAL A;  4YLH A;  3LJC A;  2W67 A;  2FJE A;  5JTG A;  3ZT6 A;  5FNV E;  5EK4 A;  2V1D B;  4IE0 A;  3KV5 A;  5L3C B;  2V6X A;  4F6R C;  1IBK T;  4G2A A;  3WI3 A;  4ZEY A;  2A72 A;  4LMK A;  2JQ9 A;  3C4X A;  3ZC1 A;  2X67 A;  3O1I A;  4LF8 T;  3JAD A;  4WW0 A;  4ISS A;  3E22 E;  1UK5 A;  5CB4 E;  5HXH A;  1KEY A;  3OKQ A;  5BR8 T;  3ETU A;  2CHN A;  5LG4 A;  5FL1 A;  2V7I A;  1NWM X;  2PTF A;  3LK4 2;  4JI7 T;  1ZOY A;  2EHO C;  5ABH A;  5C3J A;  1Y01 A;  3AE5 A;  2KWH A;  3FXD B;  2AE9 A;  3DP7 A;  3UUL A;  3CIR A;  3CX6 B;  1LRZ A;  2J4G A;  3IF8 B;  3PUA A;  4MHC A;  4QWN B;  1W9R A;  2XHE B;  2WSS V;  4KMC A;  3AA0 B;  1IJ5 A;  3PJA J;  4DV1 T;  2XQ6 A;  1VCS A;  3ONX A;  4PW8 A;  3EHZ A;  3U78 A;  2LEH A;  2BS3 A;  3FZF B;  4DV4 T;  4I55 E;  3SFE A;  2LOS A;  1DU2 A;  3C64 A;  3LG7 A;  1AJ3 A;  3P7I A;  2EHO D;  4U33 A;  4C90 A;  4H63 H;  3ZT7 A;  4IDN A;  4EGW A;  3PUY F;  4ILU A;  3IBP A;  4BJM A;  1S94 A;  3F31 A;  3KBU A;  2E5L T;  2KMF A;  3R6N A;  5LJM A;  3OVU A;  1T8B A;  3TLU A;  2B1E A;  4PJM A;  2YDR A;  4HWI B;  2V26 A;  3UU4 A;  5LHG B;  2XM1 A;  4HFC A;  5KMG P;  2E5V A;  3RYC E;  4KX6 A;  5ABF B;  2CE7 A;  5LHH B;  3NRX A;  1E1H B;  2V5C A;  2XAJ B;  3MZK B;  4IDO A;  2CWY A;  3UUM A;  3HKB E;  1OED B;  2D2S A;  4QX7 B;  5LGN B;  4C91 A;  5HAX A;  3V5U A;  3AED A;  1HG2 A;  4YSX A;  5LHI B;  2VQF T;  4X1Y E;  3AEG A;  5CA1 E;  3T1Y T;  3KV4 A;  2H3R A;  3ZKR A;  3ZCJ A;  3ZSS A;  2K5B B;  4GYS A;  3TLW A;  4AQG A;  1Z0P A;  5AQK B;  1HTJ F;  5FKY A;  3FBZ A;  4JYA T;  2VKD A;  3ZST A;  2VVS A;  2WDV A;  4DV3 T;  2Y48 B;  4UVA B;  4UIG A;  4BJN A;  3I1A A;  1UX4 A;  3WAJ A;  4DR4 T;  3RHW A;  2YIN A;  4PAG A;  1ZKE A;  1BR1 A;  3NKZ A;  5ADX L;  3VKH A;  4ZXL A;  3QK6 A;  1NEK A;  2FJB A;  5FXZ A;  4CXW A;  4NIQ A;  1WR6 A;  2XQ3 A;  2V7J A;  1IZN B;  4HFV A;  1IBL T;  3KV6 A;  3SS1 A;  3AEF A;  2CCQ A;  3AE7 A;  4EAH A;  2BZB A;  4H9R C;  2FBW A;  2VK9 A;  3ZMT B;  4ZS3 A;  5HEJ A;  2VUR A;  3ZPO A;  5A1L A;  1XDP A;  4JI2 T;  4Q25 A;  4U72 A;  5AFU L;  2V7M A;  3RQU A;  3CML A;  3PV0 F;  4H9S E;  2CEA A;  1YQ3 A;  1JNR A;  3NWI A;  4AQF A;  2WWU A;  4J2C A;  1HNW T;  4DBR A;  4JI4 T;  4JI1 T;  1UCU A;  4IL9 A;  1YQ4 A;  4QXH B;  4UV9 B;  2X0H A;  2WU5 A;  3TLV A;  5HWX A;  3AA6 B;  1ZEE A;  4ASK A;  1FIO A;  2UXX B;  2WB5 A;  1E7P A;  4TWF A;  4AI6 A;  4PK6 A;  4B3M T;  1WCR A;  4I4T E;  3ZMU B;  1OED C;  2Q9Q A;  2WP9 A;  2JQQ A;  3AVS A;  2NTY A;  4CN6 A;  4HFE A;  4UEM A;  5FL0 A;  5ABG A;  4UXN B;  1XNQ T;  2BKP A;  3GA8 A;  2J47 A;  4LFA T;  4U31 A;  1N34 T;  4N78 D;  2XQ5 A;  4Z91 A;  2PG8 A;  2ES0 A;  2RPA A;  3FB2 A;  2OA5 A;  5HXR A;  4TUY E;  2W00 A;  2DWK A;  4G63 A;  4KHZ F;  3QB5 K;  3LDQ B;  3RI5 A;  4ZZB A;  3CQC B;  4A56 A;  1SHZ C;  1MMN A;  3PU8 A;  5J1G A;  2X68 A;  3E0Z A;  4GIW A;  4L5G A;  1X79 A;  4KUM B;  5JDN A;  4JV5 T;  3CWZ B;  2VB6 A;  2BG9 E;  4XBF B;  4ZOL E;  3T8O A;  2X51 A;  2X9H A;  1EZ3 A;  4ERR A;  2K48 A;  3DTO A;  1VOM A;  4UEL A;  3J7Y q;  4OYJ A;  3AEE A;  1MMG A;  3RIF A;  4ADZ A;  4I0U A;  4EYY R;  3VHL A;  4IIJ E;  5LGT B;  3TLT A;  3G06 A;  2I6H A;  3M3Z B;  2CRB A;  2PFV A;  5KX5 E;  3ZCI A;  2LSJ A;  2IML A;  4XZC A;  2C5K T;  1LVF A;  4OFZ A;  3B57 A;  2KND A;  4OHF A;  2W66 A;  4UR9 A;  1T72 A;  4QHO A;  4X1K E;  2V6Y A;  3O1J A;  2PBI A;  4GK0 E;  4ZI2 C;  1WLX A;  3AAI A;  3P4W A;  5HEO A;  4ILC A;  5ABE A;  3RLF F;  4PNI A;  2E9X A;  4TN7 B;  5HEU A;  5JH7 E;  2UUC T;  4HFD A;  4DR2 T;  4CI2 B;  4KI0 F;  3Q5D A;  2QVA A;  2D5U A;  4TNV A;  3F2E A;  1VRB A;  2YKS A;  3PE0 A;  1BR4 A;  4ZI2 D;  4B3T T;  4HWD A;  2RP4 A;  5HCM A;  2XM2 A;  4MLK A;  4UF0 A;  1GQE A;  2W0G A;  2LM2 A;  3VR8 A;  4H9O C;  3I0Q A;  1NAF A;  4OK0 A;  3O1H A;  3EAB A;  3TKL B;  3K3O A;  2A2F X;  3N2G E;  1OWA A;  1N36 T;  4DR1 T;  2XQ4 A;  3UUB A;  3R84 B;  5L3E B;  4AKI A;  1SE7 A;  4IGU A;  2H89 A;  2XQ9 A;  2WZI A;  4JI3 T;  3PUR A;  2XUE A;  2D9D A;  2IC9 A;  3NBX X;  4LF9 T;  2LLY A;  2HPJ A;  4DR7 T;  4EEB A;  4IRE A;  4IL4 A;  4DV0 T;  2WS3 A;  2M6I A;  2ZM8 A;  1XZY A;  3S4U A;  4HTE A;  1L0V A;  1G73 A;  4WNK A;  1G8X A;  4CN1 A;  3O4X E;  3MK7 C;  1HF8 A;  3OPC A;  5IHY A;  4AKL A;  3OJA A;  2G0U A;  2J1D G;  5JDH A;  4PJN A;  5CFB A;  4X62 T;  1W09 A;  2KXP B;  2H7V C;  4YHH T;  5AQL B;  5M4Y A;  5EK2 A;  3C50 A;  1YD8 G;  1J5W A;  2CBI A;  4YJ2 E;  4U7Y A;  4WBO A;  5AQN B;  4NPP A;  4AQF C;  2BS2 A;  4GK5 E;  3N9P A;  5TAO A;  4X1I E;  5L3F B;  4GKK T;  3AE1 A;  3AE6 A;  2V6Y B;  3N9L A;  2JMK A;  2VVN A;  1D1C A;  2KLQ A;  3O9X A;  4QXC B;  3HL6 A;  2XSA A;  1BR0 A;  5CGM A;  3OTO T;  2E9X B;  2XAS B;  3GWH A;  5LNK A;  2XQA A;  2E2A A;  2Q9Q C;  3PUW F;  2L9Q A;  3B13 A;  4TNW A;  3UU3 A;  3AEC A;  2K3W A;  1WR0 A;  5FVK A;  3RC8 A;  4DR5 T;  1X9B A;  5JDF A;  2ODV A;  4A98 A;  3L8R A;  3ZN0 B;  5FYM A;  3AB3 B;  1FJG T;  2LRL A;  3CVR A;  2IIU A;  3X1D A;  5EZY E;  4PJJ A;  2VAS A;  4UF0 B;  1FMW A;  1XNR T;  2Q9Q D;  5JRC A;  2LJL A;  3PUQ A;  2DCF A;  3RC3 A;  3QUJ A;  2MOZ A;  2ZM0 A;  3AXJ A;  4O4I E;  5AQT B;  5F8P A;  3AE9 A;  2W62 A;  2YN6 A;  3UU8 A;  2QYW A;  2BBJ A;  2YOE A;  3ETV A;  3AE3 A;  4AQY T;  5JDG A;  5GON E;  4JI8 T;  4DMW A;  2MTQ A;  2LM9 A;  4HWH A;  4JBW F;  3QB5 A;  3ANW A;  1HNZ T;  3K1S A;  3P50 A;  3RKG A;  5FP3 A;  2UU9 T;  3KIN B;  4PK5 A;  4IE6 A;  3EI0 A;  4HWC A;  2X9X A;  4AIS A;  4A97 A;  5FMN A;  2YU1 A;  2CPT A;  3KDS E;  1CHU A;  2LT3 A;  2IHR 1;  3VRB A;  2HH7 A;  1LKX A;  3C4Z A;  1XDO A;  2DHR A;  3RYH E;  2YEV C;  4QH5 A;  3P4Q A;  5AQI B;  1MNE A;  4GOU A;  3BQL A;  4HFB A;  2MBG A;  2LHR A;  2LE8 A;  3ZYL A;  3ABV A;  4HN9 A;  2OV9 A;  5L3D B;  4LF6 T;  1JNZ A;  3KV9 A;  2XAQ B;  4LF5 T;  3NZP A;  2LRK A;  2L8K A;  3Q5W A;  3JC6 C;  1NEN A;  5AQV B;  2E9X C;  4IST A;  3OBV E;  4AIU A;  4U74 A;  3RKO A;  3EUH A;  2IC6 A;  4K0K T;  4AKG A;  3ZEF B;  3AAA B;  3U3I A;  2NW8 A;  2WDR A;  3P4R A;  2NW9 A;  3AA1 B;  4O4H E;  2BBH A;  3HKC E;  1KNP A;  1HFA A;  2XJ7 A;  3RGL A;  5AQM B;  2AXD S;  2W2U A;  4EXT A;  3VKG A;  4YXD A;  3M65 A;  3JC6 D;  3C98 B;  2CA5 A;  5C8Y E;  2JJ9 A;  5J2T E;  5FXV A;  4V1A v;  2VKJ A;  5JRC B;  4ZS2 A;  2WU2 A;  2C0S A;  2WY2 A;  3I9Y A;  4LMJ A;  3K3N A;  4H9P C;  3RH3 A;  4CI1 B;  5LMU T;  3AXJ B;  4P0A A;  4EZH A;  1O3X A;  4EIW A;  4YSZ A;  3CQG B;  2XTL A;  3F57 A;  3KVA A;  1OXZ A;  5FVL A;  3CX7 B;  5F5W A;  5LCY A;  2LSY A;  2DNX A;  2DI4 A;  3Q5E A;  4GYR A;  1UUR A;  4MFR A;  4KBM B;  5ETW A;  3ANW B;  4JUY A;  1R8I A;  3N2K E;  4ILB A;  3H3A A;  3N5L A;  2ZMA A;  2VKH A;  4EV6 A;  3UQ4 A;  3FXE B;  4LF4 T;  4K0U A;  5FY0 A;  4UVB B;  4HWF A;  3H37 A;  2VKO A;  4IHJ E;  1XMQ T;  4KHP T;  4U3C A;  2BS4 A;  5AQJ B;  2YDS A;  3KBT A;  2D0U A;  4I50 E;  3PUG A;  2CBJ A;  1D0Z A;  2X0Y A;  3AE4 A;  2V7K A;  5JVD E;  4DBQ A;  3L3P A;  1QSD A;  3QOF A;  3C4W A;  2VL0 A;  1HS7 A;  3A8Y C;  3T1H T;  4AKH A;  2JQK A;  4LFB T;  2FJD A;  1KFY A;  3P8C D;  3AE2 A;  1KK7 A;  3AA7 B;  1I94 T;  4DV2 T;  4DV7 T;  4NXM T;  2UUB T;  4CN4 A;  4QX8 B;  2RA1 A;  1OED E;  5HEG A;  2CXF A;  1HG5 A;  3PTR B;  5LA6 E;  3UUX B;  3IHR A;  4HE8 A;  4OYK A;  3ZMZ B;  4H9N C;  2LHN A;  3EVY A;  4WZX A;  2X0L B;  2JRK A;  4L0R A;  3LBX A;  4YTN A;  4IDP A;  3K8P C;  4O2A E;  5AQR B;  2W63 A;  3GMI A;  2XSB A;  3HA4 A;  4DID B;  4MBQ A;  2F4V T;  3ONJ A;  3JAF A;  3SRZ A;  5LOV E;  1XWM A;  4H9Q C;  4DV6 T;  3L39 A;  3HR0 A;  4TV8 E;  4ILA A;  2XQ7 A;  3NRY A;  5LBQ B;  4HKA A;  2BKN A;  4DMV A;  4ZI3 C;  3PUZ F;  4TV9 E;  5L4H A;  5H6R B;  4FI5 A;  2LSI A;  3PU3 A;  3P4P A;  4CI3 B;  1BR2 A;  1D0X A;  3MXZ A;  2V5D A;  2L3L A;  1T98 A;  3AEB A;  5DAB A;  5LMN T;  2WBL A;  4CQI A;  2WWV A;  4JI0 T;  5HWY A;  2X9W A;  5HCJ A;  3WAK A;  4F8H A;  4BA9 A;  3IEE A;  2BG9 A;  5AQO B;  5JR9 A;  3CX8 B;  4HEA A;  2N9D A;  5AQF B;  4ANJ A;  4ZI3 D;  5L47 A;  5AQS B;  4E7S A;  3A5X A;  2UXD T;  2VQE T;  2VL8 A;  5AQP B;  1HX8 A;  4LML A;  1HCI A;  3FHN A;  4DO0 A;  1UGO A;  3UFG A;  3ZLI A;  3ZYK A;  3SWH A;  2H88 A;  2M6B A;  2Y6X A;  4IE7 A;  3D0T A;  5IWA T;  4JI5 T;  2A3D A;  2K24 A;  3UU6 A;  3EDV A;  2CXD A;  5LG3 A;  1IAP A;  3IA3 A;  2KZ7 B;  3Q2M A;  5E0O A;  1FEW A;  1US7 B;  2BVL A;  4FJO A;  2NOX A;  2WZH A;  4TWD A;  1WFD A;  4CXX A;  2HHH T;  4NUV A;  4YFS A;  5L3G B;  2KSR A;  3CQX C;  2LSK A;  5LBM A;  5H6Q B;  4Z8X A;  3LK2 B;  4X66 T;  4ZZC A;  3RRC A;  3LSV A;  2KIN B;  3ZN1 B;  3J9X 1;  4IDQ A;  2MYS A;  4X5T A;  2UUA T;  3LBX B;  3BQI A;  2XQY A;  1LVK A;  2ZM6 T;  3JCF A;  4B6X A;  1IBM T;  1YKE B;  2KWI B;  3PUS A;  3NZQ A;  5FXX A;  2ODU A;  4O2B E;  1M62 A;  3KVB A;  5LYJ E;  3RYF E;  4CXY A;  2N2N A;  4PFO A;  3UT5 E;  3HKE E;  4YTM A;  4NXN T;  4DVD A;  5C2T A;  2DWG A;  2XY8 B;  5F3J A;  4YY3 T;  2SPC A;  1HR0 T;  1H7C A;  2JMH A;  2LOP A;  4QKN A;  4YJ3 E;  4XAX B;  4EB6 E;  2IDO B;  1YKH B;  4JI6 T;  1M7K A;  2UXB T;  2BG9 B;  3L09 A;  2NR4 A;  3AVR A;  4A5X A;  5JR9 B;  1SUM B;  4LF7 T;  2BKO A;  4ZI7 E;  3ZMS B;  2I59 A;  4O8S A;  1WYB A;  5HXC A;  1ZV4 X;  2H7O A;  1T7S A;  5JDM A;  4U2Z A;  4EOZ B;  5L2L A;  3JAE A;  3ZYM A;  4EED A;  5L3B B;  2BDE A;  3N9Q A;  4P0B A;  4JLE A;  1N32 T;  3RYI E;  2XZE A;  3SOL A;  2I0M A;  4UVC B;  4QXB B;  2JQH A;  2C5J A;  5L4E A;  3UUN A;  4JEH B;  1WRD A;  4AKR B;  3BQK A;  2ZLY A;  2QGS A;  2UXC T;  3MJX A;  2WCA A;  1MMD A;  2N1G A;  4E7Z A;  3QNU A;  2WQY A;  5DQW A;  3FZM B;  4DND A;  4I43 B;  2NP9 A;  3I0O A;  5LJN A;  4DR6 T;  4EZ4 A;  5AQH B;  4U2Y A;  3UFE A;  2W4X A;  4YSY A;  4M1P A;  3KFW X;  1B7T A;  4DR3 T;  3ZT5 A;  3FZK B;  3AEA A;  2NWB A;  3N9O A;  3Q5X A;  3ESL A;  2R6G F;  4IT4 A;  2CM0 A;  4B3S T;  3V5S A;  2DLR A;  2C5I T;  3E08 A;  1MMA A;  2CXL A;  2V8S V;  3RF1 A;  5DQV A;  3MKD A;  5BMV E;  5AQU B;  2CMR A;  3FZH B;  2IUB A;  3GN5 A;  4LFC T;  3CK6 A;  1J5E T;  1ZP0 A;  1MND A;  3B5M A;  1E2A A;  3PJA A;  3TLS A;  2XAG B;  5KDM C;  4DV5 T;  1HX1 B;  2K9A A;  4B3R T;  2NW7 A;  4BAY B;  2FUP A;  3VRA A;  1FMV A;  2BVM A;  4OX9 T;  2QA7 A;  4CZZ B;  2EHO A;  4IE5 A;  4QH1 A;  3RPU A;  3W15 B;  1UX5 A;  4PJL A;  2E9X D;  3AE8 A;  5J0Z A;  1MIW A;  2BG9 C;  3VU7 H;  1MIV A;  2JPF A;  5JR9 C;  3RIU C;  5J2U E;  3EDU A;  1U4Q A;  2ACZ A;  2XQ8 A;  4X65 T;  4KP3 C;  2YK0 A;  1VCT A;  1SA0 E;  3PUV F;  2QRX A;  5JDQ A;  3AAE B;  2WM9 A;  3CPZ A;  3FZL B;  2LSG A;  3OYZ A;  4H63 V;  4GKJ T;  1YW0 A;  4L9I A;  4HFH A;  2B76 A;  2WMN A;  4YHJ A;  4U7I A;  1KNR A;  5IYZ E;  5HXE A;  4PFP A;  2MPK A;  4X20 E;  5EK3 A;  3RIA A;  3NVO A;  2HN2 A;  4DUZ T;  2LKH A;  2KT9 A;  1HNX T;  1ZHC A;  3DJB A;  2ZM2 A;  1MIY A; 
#chains in the Genus database with same CATH homology
 2LSI A;  3PU3 A;  4CI3 B;  3N9L A;  1KNZ A;  2JMK A;  4JEU B;  1BR2 A;  1D0X A;  5ADX L;  3MXZ A;  1D1C A;  2KLQ A;  3O9X A;  4QXC B;  3VKH A;  3QK6 A;  2L3L A;  3HL6 A;  1BR0 A;  1T98 A;  5DAB A;  5LXT E;  2WBL A;  4CQI A;  2CLY B;  5FXZ A;  2E9X B;  2XAS B;  3GWH A;  5HWY A;  2X9W A;  3WAK A;  5LNK A;  3LK3 B;  2P9B A;  4CXW A;  2Q9Q C;  4BA9 A;  1WR6 A;  3IEE A;  2L9Q A;  3B13 A;  3HI2 A;  2IAK A;  2V7J A;  5JR9 A;  3CX8 B;  3RC8 A;  2E8I A;  4HEA A;  1IZN B;  2N9D A;  4ANJ A;  3FBL A;  5JDF A;  4ZI3 D;  3Q9D A;  2ODV A;  4HFV A;  3ZC0 A;  3CKD A;  2Z6E A;  5JQG E;  4E7S A;  3A5X A;  2CWO A;  3KV6 A;  4UV8 B;  3SS1 A;  2CCQ A;  3ZN0 B;  5FYM A;  2VL8 A;  3AB3 B;  2W61 A;  4EAH A;  5FY1 A;  1HX8 A;  2BZB A;  4H9R C;  2VK9 A;  3CVR A;  3ZMT B;  1HCI A;  3ZJ1 A;  3FHN A;  4DO0 A;  3ZLI A;  2UXN B;  4ZS3 A;  5JRE A;  3ZYK A;  5EZY E;  3SWH A;  4PJJ A;  2Y6X A;  4IE7 A;  3D0T A;  3LFM A;  2VAS A;  4UF0 B;  3ZPO A;  5A1L A;  2A3D A;  5LGU B;  1FMW A;  2K24 A;  2Q9Q D;  3GN5 B;  3N2O A;  4U72 A;  5AFU L;  3EDV A;  5JRC A;  2CXD A;  2V7M A;  1D1A A;  3CML A;  5JDL A;  2LJL A;  4H9S E;  2CEA A;  3PUQ A;  1IAP A;  4IE4 A;  4AQF A;  1S35 A;  2DCF A;  2WWU A;  3RC3 A;  3QUJ A;  2MOZ A;  2ZM0 A;  4J2C A;  3UTK A;  4ZHQ E;  5LP6 E;  5HXS A;  5FY7 A;  2KZ7 B;  4DBR A;  3Q2M A;  3RRW A;  3BK9 A;  1UCU A;  5E0O A;  4O4I E;  3RX6 A;  1FEW A;  1US7 B;  4QXH B;  4UV9 B;  2BVL A;  3HKD E;  5F8P A;  2W62 A;  4FJO A;  5HWX A;  2NOX A;  2EHO B;  3AA6 B;  1ZEE A;  3I9W A;  5DJQ C;  3ETV A;  4ASK A;  1FIO A;  2WMO A;  2X9Y A;  4CXX A;  2UXX B;  3PDY A;  5JDG A;  5GON E;  4NUV A;  4YFS A;  5FXW A;  4AI6 A;  4PK6 A;  2X66 A;  4I4T E;  3ZMU B;  4DMW A;  5L3G B;  2MTQ A;  2Q9Q A;  2LM9 A;  3CQX C;  2JQQ A;  3AVS A;  2LSK A;  2NTY A;  3ANW A;  3C51 A;  5LBM A;  5FP3 A;  4EYU A;  1WYC A;  1D1B A;  5H6Q B;  4UEM A;  3KIN B;  4PK5 A;  4UXN B;  1U5P A;  3OYX A;  4Z8X A;  4IE6 A;  3LK2 B;  2X9X A;  2HPL A;  3RRC A;  3GA8 A;  2KIN B;  3ZN1 B;  3J9X 1;  2MYS A;  1V9D A;  3LBX B;  3BQI A;  5FMN A;  2YU1 A;  2XQY A;  3KDS E;  4N78 D;  2IW5 B;  4TZ4 C;  1LVK A;  2LT3 A;  2PG8 A;  2XAF B;  4IDZ A;  2ES0 A;  4B6X A;  4PK4 A;  2HH7 A;  3K3Q C;  4O4J E;  1YKE B;  3MA9 A;  3FB2 A;  1LKX A;  2KWI B;  2OA5 A;  3C4Z A;  2VWA A;  2Q9Q B;  3PUS A;  3NZQ A;  5HXR A;  2PJQ A;  5FXX A;  2ODU A;  2DHR A;  4TUY E;  2W00 A;  2DWK A;  3N9N A;  4G63 A;  4O2B E;  3RYH E;  2YEV C;  3KVB A;  5LYJ E;  5HYA A;  5CA0 E;  2ACX A;  3RYF E;  2WAU A;  4CXY A;  2YU2 A;  1MNE A;  4GOU A;  2N2N A;  3BQL A;  4PFO A;  1D0Y A;  2MBG A;  3UT5 E;  4AXP A;  2LHR A;  2LE8 A;  3HKE E;  2D0T A;  3ZYL A;  4HN9 A;  4DVD A;  3CQC B;  3N9M A;  2M67 A;  4O4L E;  2Y8D A;  4P09 A;  4A56 A;  5L3D B;  1IJ6 A;  2DWG A;  4WBN E;  3ZMV B;  3KV9 A;  1SHZ C;  1MMN A;  2XAQ B;  3PU8 A;  5J1G A;  1CUN A;  5F3J A;  2X68 A;  3NZP A;  3QC9 A;  3E0Z A;  2SPC A;  4HGA A;  2L8K A;  1H7C A;  3MAC A;  3Q5W A;  4GIW A;  3JC6 C;  4L5G A;  2JMH A;  1Y64 B;  2LOP A;  4QKN A;  1X79 A;  2V7L A;  2CLY C;  4KUM B;  5JDN A;  2E9X C;  4IST A;  2NTX A;  3OBV E;  3ZJ2 A;  4YJ3 E;  4XAX B;  4U74 A;  3RKO A;  2XAH B;  3CWZ B;  4EB6 E;  3EUH A;  2GK9 A;  2VB6 A;  4NUU A;  2IC6 A;  4XBF B;  4ZOL E;  4AKG A;  3ZEF B;  1YKH B;  3AAA B;  3T8O A;  4TX5 A;  1QUU A;  2X51 A;  2X9H A;  3L09 A;  3AVR A;  4MAL A;  2NW8 A;  3LJC A;  4YLH A;  3U3I A;  1EZ3 A;  4ERR A;  5JR9 B;  2NW9 A;  3AA1 B;  2K48 A;  3DTO A;  4ZI7 E;  4O4H E;  3ZMS B;  2I59 A;  3HKC E;  5FNV E;  5EK4 A;  1HFA A;  1VOM A;  4O8S A;  2V1D B;  4UEL A;  4IE0 A;  3J7Y q;  4OYJ A;  1MMG A;  3KV5 A;  1WYB A;  4ADZ A;  5L3C B;  5HXC A;  4EYY R;  4F6R C;  1ZV4 X;  2H7O A;  4IIJ E;  3VHL A;  4EXT A;  5LGT B;  3VKG A;  5JDM A;  4EOZ B;  4G2A A;  5L2L A;  3M65 A;  3WI3 A;  3JC6 D;  3C98 B;  2A72 A;  3ZYM A;  3C4X A;  3ZC1 A;  2X67 A;  5L3B B;  2PFV A;  3O1I A;  2BDE A;  5KX5 E;  2CA5 A;  3ZCI A;  3N9Q A;  4P0B A;  5C8Y E;  2JJ9 A;  4JLE A;  4WW0 A;  2LSJ A;  3RYI E;  3SOL A;  4ISS A;  5J2T E;  3E22 E;  4UVC B;  5FXV A;  4QXB B;  4V1A v;  4XZC A;  2C5K T;  2C5J A;  2VKJ A;  5JRC B;  5CB4 E;  3UUN A;  5HXH A;  4JEH B;  4ZS2 A;  1WRD A;  4AKR B;  3BQK A;  1LVF A;  2ZLY A;  2QGS A;  4OFZ A;  3B57 A;  3OKQ A;  3MJX A;  2KND A;  4OHF A;  1MMD A;  2C0S A;  2N1G A;  3ETU A;  4QHO A;  5LG4 A;  2V7I A;  3I9Y A;  4E7Z A;  1NWM X;  3K3N A;  4X1K E;  4H9P C;  3LK4 2;  3O1J A;  3RH3 A;  4CI1 B;  2PBI A;  4GK0 E;  4ZI2 C;  5DQW A;  1WLX A;  3AAI A;  2EHO C;  4P0A A;  4DND A;  4EZH A;  1O3X A;  4EIW A;  2KWH A;  4I43 B;  3CQG B;  3FXD B;  3DP7 A;  3UUL A;  2NP9 A;  2XTL A;  3CX6 B;  3F57 A;  3KVA A;  1OXZ A;  1LRZ A;  3IF8 B;  4PNI A;  3PUA A;  4C91 A;  4MHC A;  3I0O A;  3CX7 B;  4QWN B;  2E9X A;  5LJN A;  2XHE B;  5LCY A;  4TN7 B;  4EZ4 A;  5JH7 E;  3UFE A;  2LSY A;  2WSS V;  2DNX A;  2DI4 A;  4KMC A;  3AA0 B;  1IJ5 A;  4GYR A;  4MFR A;  4KBM B;  4M1P A;  3KFW X;  1B7T A;  4CI2 B;  3ONX A;  3ANW B;  4JUY A;  5ETW A;  4PW8 A;  3U78 A;  2LEH A;  4I55 E;  2D5U A;  3N2K E;  2LOS A;  2NWB A;  3F2E A;  3C64 A;  3LG7 A;  3N9O A;  3Q5X A;  1AJ3 A;  1VRB A;  3H3A A;  3N5L A;  3P7I A;  2ZMA A;  3ESL A;  3PE0 A;  1BR4 A;  4ZI2 D;  2VKH A;  2CM0 A;  2EHO D;  3V5S A;  4C90 A;  2RP4 A;  4H63 H;  2DLR A;  3FXE B;  2C5I T;  3E08 A;  1MMA A;  2CXL A;  5DQV A;  3MKD A;  4K0U A;  4ILU A;  5BMV E;  2CMR A;  3IBP A;  4UVB B;  5FY0 A;  3H37 A;  2VKO A;  4IHJ E;  4BJM A;  1S94 A;  3F31 A;  3KBU A;  2KMF A;  4MLK A;  3R6N A;  4UF0 A;  5LJM A;  3GN5 A;  2W0G A;  4H9O C;  3I0Q A;  1NAF A;  4OK0 A;  2B1E A;  4PJM A;  3O1H A;  1MND A;  3KBT A;  2D0U A;  4I50 E;  3PUG A;  3TKL B;  1D0Z A;  2V7K A;  3K3O A;  5JVD E;  2A2F X;  4DBQ A;  3N2G E;  3L3P A;  1OWA A;  2XAG B;  1QSD A;  2V26 A;  5LHG B;  5KDM C;  2K9A A;  5KMG P;  3R84 B;  5L3E B;  3C4W A;  4AKI A;  1HS7 A;  4IGU A;  2NW7 A;  3RYC E;  4BAY B;  4AKH A;  3PUR A;  2CE7 A;  3P8C D;  2XUE A;  1FMV A;  2IC9 A;  2BVM A;  3NBX X;  2QA7 A;  4CZZ B;  1KK7 A;  2EHO A;  4IE5 A;  3AA7 B;  2HPJ A;  5LHH B;  3NRX A;  1E1H B;  3RPU A;  3W15 B;  1UX5 A;  4PJL A;  4QX8 B;  2XAJ B;  3MZK B;  2E9X D;  2RA1 A;  2ZM8 A;  1MIW A;  3S4U A;  2CWY A;  2CXF A;  3UUM A;  1HG5 A;  3PTR B;  5LA6 E;  3VU7 H;  3UUX B;  1MIV A;  2JPF A;  3IHR A;  5JR9 C;  3HKB E;  4HTE A;  4HE8 A;  1G73 A;  4WNK A;  4OYK A;  1G8X A;  5J2U E;  2D2S A;  3EDU A;  3O4X E;  4QX7 B;  5LGN B;  1U4Q A;  3MK7 C;  1HF8 A;  3ZMZ B;  4H9N C;  5HAX A;  2LHN A;  3OJA A;  5IHY A;  3EVY A;  3V5U A;  2G0U A;  4AKL A;  2X0L B;  1HG2 A;  4KP3 C;  5LHI B;  4X1Y E;  2YK0 A;  2JRK A;  2J1D G;  5JDH A;  1SA0 E;  5CA1 E;  4L0R A;  4PJN A;  3KV4 A;  2H3R A;  1BR1 A;  3LBX A;  5JDQ A;  3AAE B;  2WM9 A;  3K8P C;  2KXP B;  3CPZ A;  4O2A E;  2H7V C;  3ZCJ A;  2W63 A;  3GMI A;  2K5B B;  2LSG A;  3HA4 A;  3OYZ A;  5M4Y A;  4GYS A;  4H63 V;  4AQG A;  1YW0 A;  1Z0P A;  4MBQ A;  4L9I A;  5EK2 A;  1HTJ F;  3C50 A;  3SRZ A;  5LOV E;  1YD8 G;  3FBZ A;  4H9Q C;  2VKD A;  2WMN A;  4YJ2 E;  4YHJ A;  3HR0 A;  4TV8 E;  4WBO A;  5IYZ E;  4AQF C;  4GK5 E;  3NRY A;  4PFP A;  5HXE A;  2Y48 B;  3N9P A;  4X20 E;  4UVA B;  4UIG A;  5EK3 A;  5LBQ B;  5TAO A;  4HKA A;  4BJN A;  3I1A A;  1UX4 A;  4DMV A;  4X1I E;  4ZI3 C;  3WAJ A;  2KT9 A;  5L3F B;  4TV9 E;  2YIN A;  1ZHC A;  3DJB A;  5H6R B;  4FI5 A;  4PAG A;  1ZKE A;  2ZM2 A;  1MIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...