2CLYC

Subcomplex of the stator of bovine mitochondrial atp synthase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Structure of the Stator of the Mitochondrial ATP Synthase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords ATP SYNTHASE B CHAIN, MITOCHONDRIAL
total genus 15
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2clyC01
2WSSV 2CLYC
chains in the Genus database with same CATH superfamily
3RYHE 4DMWA 5L47A 2E9XD 5AQMB 3JAEA 4TN7B 4CXXA 4H9QC 4Z91A 4ZHQE 3VKHA 1KNZA 3MA9A 3LDQB 3TLSA 2KT9A 3UTKA 4HWDA 5LA6E 2K5BB 2NTYA 2XUEA 2ZM8A 2K9AA 3ANWB 2W00A 1B7TA 2LHNA 4O4HE 4PW8A 3ZCJA 4CN1A 2E5LT 3B5MA 2CLYB 3EI0A 1E1HB 2A2FX 2BVMA 4FI5A 4PK5A 4YTMA 3MZKB 3RC8A 3AEAA 4ZEYA 4JI0T 5HEUA 5LGNB 3J7Yq 3TLUA 4ZI2D 5AQQB 4KHPT 3RLFF 4NIQA 4ZZBA 3CK6A 1YQ3A 2A72A 2VQET 3RHWA 2LM2A 2XAGB 2YN6A 4UVBB 3RX6A 2M67A 1US7B 2X9HA 4JI4T 5FL0A 4ZI3D 3C4WA 4JV5T 4TWHA 4I50E 1HX1B 2A3DA 2AXDS 3K3OA 1N34T 1BR2A 3N9MA 4HTEA 5F8PA 5HYAA 1XWMA 2CMRA 2JIWA 5LXTE 3VR8A 4H9NC 2UUAT 2UXXB 4H9RC 4PJMA 1VCTA 3PTRB 2WMNA 1S35A 3Q5WA 4GYSA 4EAHA 4OK0A 4EGWA 2KWIB 3LK42 4YFSA 4FJOA 4B3RT 3WAKA 3Q5EA 4E7SA 4U33A 3ZMVB 2WY2A 5IUXA 1M62A 3UUNA 4WW0A 4L5GA 5KDMC 4JEUB 4IT4A 2KZ7B 3MACA 5AQPB 4QWNB 4TUYE 2HPJA 1KEYA 4YHJA 3ZT7A 5IWAT 5ABFB 3UT5E 1NEKA 4AQGA 4LF7T 4PAGA 4WBOA 5EK3A 1Y64B 2R6GF 2IAKA 3E08A 5CA1E 5KX5E 5JRCA 3RQUA 1X9BA 5DQWA 4K0KT 2CLYC 2MBGA 2IW5B 4X65T 2WDVA 2E9XB 1NENA 2BG9E 2W66A 2XASB 2AE9A 3O1JA 3PUZF 4IDQA 3ETVA 3AE6A 2V6YB 3KV9A 3UU5A 2H7OA 2MPKA 4EZHA 4UV8B 4JI2T 1N33T 2Z6EA 4H9SE 3HI2A 4AKRB 4GKJT 4DR2T 2NOXA 3SFDA 4C91A 4AI6A 3RKGA 2NP9A 2XPKA 4AIUA 4B3TT 1SUMB 2XM2A 2J62A 3AVSA 2Q9QD 2X9XA 3NRXA 2VASA 1MMDA 2KWHA 4UVCB 5KMGP 1JNRA 4QKNA 2LOPA 3I9WA 4UXNB 5JH7E 2E8IA 3TLWA 3FB2A 5LMNT 5FP3A 3V5SA 2L8KA 5ADXL 4P09A 3UU3A 2CPTA 2Y8DA 2ODVA 3P50A 4KI0F 3RRWA 4DV6T 1J5ET 3QNUA 5LYJE 4ILBA 5LMUT 1XNRT 3ONLC 3NVOA 4YTNA 2L9QA 3NKZA 1NAFA 4QHOA 2IHR1 2J1DG 2LHRA 5BR8T 4LF9T 2LRKA 4YHHT 5AQUB 5JTGA 1HTJF 1ZV4X 3I9YA 4J2CA 3NRYA 2H88A 3UUMA 3ZMTB 4CN6A 3KV4A 4YXDA 2IUBA 1ZEEA 2N1GA 4QH5A 5CJ5A 2N9DA 4IIJE 4ADZA 2XAQB 3AA1B 1XMQT 1HR0T 3AAAB 2ACXA 2BKNA 4H63H 4E7ZA 4ZI7E 2WMOA 4KHZF 5L3DB 2DWKA 3SWHA 3WI3A 1XNQT 4HEAA 4GK0E 3OBVE 2ZM0A 4DV2T 1WYBA 2KNDA 4A98A 4AQFA 5LGUB 2VWAA 4ZS2A 2E9XC 5AQOB 1HS7A 2P9BA 2Q9QB 3OPCA 2Y6XA 2EHOD 1WCRA 5LB7B 2KMFA 1L0VA 1M7KA 3FBLA 5JVDE 5IHYA 3FBZA 5ABEA 4IREA 1MIYA 1IBLT 4JI3T 5C2TA 1MMGA 3N2KE 2KLQA 2VKHA 3N9QA 1IJ6A 2VKJA 4AQFC 2X0HA 3TKLB 2CHNA 2FJEA 2XQ7A 2CBIA 2NTXA 3FZLB 3NWIA 4IDPA 2D9DA 2ZMAA 5DQVA 4U74A 3RPUA 4TZ4C 2QA7A 5LNKA 5FY7A 1HG2A 3UQ4A 3AE2A 2YOEA 5DABA 5FVLA 4AKLA 4IE6A 2JQKA 3ZKRA 3LBXB 3AA6B 3PUXF 4DR5T 2ZM2A 1N36T 4LFCT 5LJMA 2XQ9A 3D0TA 1E2AA 2IMLA 2LSKA 3CVRA 3ZT6A 4XBFB 1W09A 1D1AA 1MMNA 2XZEA 3KBUA 3RYFE 2ZM6T 2BG9A 4JI1T 4NUVA 2WU5A 5L3CB 4JI5T 3UU6A 3AAEB 4EYYR 3X1DA 4N78D 4IE7A 3RIUC 3VKGA 3N9NA 4P1NA 3AE9A 2CEAA 1N32T 3BQLA 1CUNA 3PUSA 5F5WA 3P4RA 3ZJ1A 1IZNB 2QRXA 3FZMB 3PUGA 4O2AE 3ZC0A 2E5VA 5AQHB 5JREA 1T98A 4ZI3C 4Z8XA 2V5CA 3PUVF 4JI6T 3ZN1B 3OVUA 2H7VC 2WQYA 1HCIA 2BKPA 2E2AA 5HCJA 1WR0A 4QH4A 3ZSSA 1G73A 4LMJA 4LMLA 4COFA 2B1EA 3ONJA 4DR6T 3JCFA 1WRDA 1ZOYA 2FJAA 2VURA 3FHNA 4HKAA 3AB3B 2J47A 2YEVC 2Y48B 3GWHA 4PFPA 5IYZE 2NW9A 2NWBA 4UV9B 1R8IA 4I55E 5HEOA 4LMKA 3AXJB 4HFCA 3JC6D 3DP7A 4YSZA 4L9IA 4U7IA 5LG3A 2X9WA 4OX9T 4IE0A 3A7MA 2E9XA 4QX8B 5HXHA 4AKIA 2FUPA 3PUWF 4IL4A 4IE4A 3ZSTA 2MYSA 4DO0A 3GA8A 2VKDA 2FBWA 2M6BA 3RGLA 3RYIE 5L4HA 4BJNA 1FIOA 5FL1A 4WNKA 4DV4T 1SA0E 5JDGA 3ZLIA 3QOFA 3CQGB 3RI5A 5L3BB 4KX6A 2UUBT 2UUCT 4EEBA 2YDRA 4DR3T 4X66T 2YINA 4I43B 4P0AA 3L8RA 3C64A 3PURA 2XQ5A 3ZCIA 2YDQA 2XHEB 4YSYA 1D0XA 4L0RA 1IBKT 4WYVA 3T8OA 2B76A 5FY1A 4CXYA 2XQ4A 1UUSA 1YXRA 3CQCB 3F2EA 2WDRA 3ETUA 2WB5A 5J2TE 3T1YT 2JQ9A 4GYRA 2BBHA 1FEWA 3Q2MA 5HEGA 3VRAA 1QLBA 2WCAA 5JQGE 4B3MT 3E0ZA 5L3FB 2H3RA 5AQLB 4QXBB 2FJBA 2OA5A 1G8XA 5KXJA 2MAWA 3I1AA 3HKDE 1XMOT 3P4QA 3FXEB 4QXCB 2D0TA 5HEHA 5JDMA 4O4JE 4B3ST 3RIUA 3KVAA 4MBQA 4CI1B 2M6IA 2BG9C 2X0YA 2BG9B 2X9YA 1UK5A 2LLYA 2LSJA 3LJCA 3ZN0B 4DR4T 4ZS3A 4AKHA 2LRLA 1YQ4A 2CRBA 3TLTA 4HFVA 3DTOA 5LP6E 3N9OA 5JRCB 4G63A 2UXDT 4YJ3E 1MIVA 2NW7A 2ZLYA 3LBXA 2PBIA 2ODUA 2HN1A 1KNRA 3AA7B 4O4IE 2CXFA 4ERRA 3SS1A 4CXWA 3IA3A 4EXTA 5FXZA 2C5JA 1BR1A 5A1LA 5J1GA 2RPAA 3KBTA 2CXLA 3AXJA 4HE8A 5AQGB 2V1DB 1H7CA 2CWOA 3SRZA 4EOZB 4HWHA 4A5XA 3OKQA 4NXMT 3NBXX 2X0LB 3DJBA 4ZOLE 4TX5A 4X62T 3AE7A 4JBWF 2BDEA 3IF8B 1MNDA 2IC9A 3SFEA 1KNPA 4HFBA 3NZPA 1ZHCA 4PJNA 2DLRA 2ACZA 1UX5A 2UU9T 4WBNE 2I0MA 4YJ2E 2WM9A 4AKGA 2D0UA 2X66A 5JR9B 4JUYA 3K3QC 4JEHB 4KMCA 5ABGA 1W0BA 2XQ3A 4ISSA 3UFEA 2LKGA 3ZMUB 4V1Av 4GOUA 1IJ5A 4DR7T 3CWZB 3PV0F 5LBQB 3TLVA 2CBJA 2W63A 4QXHB 2V7MA 4IE5A 1BR4A 2XQYA 2NW8A 3I0QA 4LF6T 5AQRB 2LSIA 2JJ9A 3FZHB 5AFUL 2GK9A 5L3GB 1QSDA 1UGOA 2NR4A 2VK9A 3ZJ2A 2IC6A 2L3LA 4BJMA 4TV8E 5AQTB 5JR9C 3CX7B 1BR0A 1WYCA 5H6RB 3BQIA 4DV0T 1HF8A 3AEDA 2G0UA 2VL8A 1OXZA 2WWUA 3AEBA 1KF6A 1W9RA 3H3AA 5EZYE 4U7YA 4YY3T 3IHRA 1D0ZA 1QUUA 2A9UA 2LOSA 3P4WA 3RYCE 5HXEA 2KINB 3FXDB 1KK7A 2CWYA 3G06A 4CQIA 1Z0PA 3KFWX 3LFMA 2WZIA 2XQ6A 3N2OA 4OFZA 2XTLA 5ETWA 4ILAA 5C3JA 2C5KT 4GIWA 5JDLA 1DU2A 2BBJA 1E7PA 2FJDA 1J1JA 2W61A 5AQNB 1GQEA 3RIFA 5TAOA 2CCQA 1W0AA 5HEJA 1HNZT 2CE7A 4AXPA 3VR9A 3KDSE 3A8YC 1VOMA 4BA9A 2XSAA 3RQWA 1I6ZA 1T72A 2XQ8A 3QK6A 2WAUA 1UX4A 2SPCA 3MJXA 4DNDA 1U4QA 2HH7A 1Z8UA 1T8BA 1XDOA 1Y01A 2KXPB 2MTQA 2Q9QA 2V6YA 3B13A 3M65A 4PJLA 4UR9A 3HR0A 3HA4A 3HKEE 5JDQA 3PJAA 3PUAA 4I0UA 5LHIB 3AE8A 2XM1A 3AEFA 2XSBA 2EHOC 2C0SA 4TWFA 4PNIA 4IDOA 4IGUA 5H6QB 2K24A 1YKHB 3PU8A 5CA0E 2MOZA 2DHRA 3KINB 2XY8B 2V6XA 4EB6E 4PK6A 4BAYB 4DUYT 2W67A 2QGSA 1X79A 4F8HA 2WZHA 2YU1A 3AEEA 2LE8A 2VB6A 3IEEA 3AE1A 4TWDA 3J9X1 2WU2A 1NWMX 4OHFA 3JADA 3OJAA 3RH3A 3UFGA 3EAMA 3M3ZB 3CX6B 3LSVA 3QB5A 4HFHA 3ESLA 3PU3A 4UVAB 3N2GE 4HWFA 5J2UE 1EZ3A 2V7IA 3EABA 3ZYMA 4DMVA 5F3JA 1V9DA 2WS3A 4HFIA 1XZYA 3JAFA 3K8PC 3ZPOA 4A56A 5L3EB 5CB4E 5EK4A 4YTPA 5FY0A 4ASKA 4DV7T 4EV6A 4X5TA 2PFVA 1MMAA 1OEDC 3ZT5A 3L09A 4X1YE 5JDHA 2JPFA 2V7KA 3HKBE 4Z90A 3U78A 2XAJB 3PJAJ 3I0OA 3JC6C 4IL9A 3K3NA 2RP4A 4KP3C 4A97A 2X51A 3PE0A 1JNZA 5CFBA 2DL1A 2LM9A 3BK9A 5AQKB 3O1HA 3CQXC 3OYZA 4HGAA 3RRCA 4OYJA 3ZYKA 2JQHA 5AQIB 2VQFT 3P4SA 3U3IA 2XAHB 5FMNA 4CI3B 3GMIA 3ONXA 3C4ZA 1MIWA 2V7JA 2V7LA 3H37A 1UCUA 3K1SA 1HFAA 1WR6A 1XDPA 2BVLA 2LEHA 3AE3A 2I59A 3N9PA 4MFRA 3RF1A 4ZI2C 4PFOA 4U3CA 2JMKA 4PJJA 4UF0A 2DCFA 2K48A 3EDUA 2XJ7A 3PUYF 4MHCA 3ZEFB 3IBPA 3HKCE 3MKDA 5ABFA 2CA5A 2XAFB 5FXXA 5L4EA 4M1PA 1YKEB 4K0UA 3AAIA 2I6HA 3C50A 3ZMZB 2W0GA 2UXBT 3EDVA 2LT3A 4KBMB 4DBQA 3RIAA 4EZ4A 3LK3B 2LSYA 2V26A 2JQQA 4DUZT 3QB5K 4GK5E 3AA0B 3AECA 3F57A 2WDQA 1WFDA 3GN5A 3KV6A 2PG8A 1I94T 4IDZA 2HPLA 5LHHB 2BZBA 5HWYA 2VVNA 3CX8B 3S4UA 4UF0B 4EYUA 1LVKA 4YLHA 4JI7T 2J4GA 4B6XA 5FYMA 2X67A 3UUXB 2EHOB 3L3PA 5J0ZA 1IAPA 4O4LE 4X64T 4CZZB 3CMLA 2OLTA 4TNWA 1UURA 3CIRA 4F6RC 4DV1T 2YKSA 1SHZC 2QVAA 3AEGA 4HFDA 2C5IT 5HXCA 1FMVA 1VCSA 1YD8G 2DNXA 2PJQA 4YT0A 3C51A 4PK4A 1T7SA 4AISA 4ISTA 1FMWA 3V5UA 4DV3T 2JMHA 5FKYA 4DR1T 5HXRA 1LRZA 2VVSA 4I4TE 3R84B 4LF5T 3OYXA 4LFAT 1AJ3A 3OTOT 3L39A 3CPZA 3ZMSB 3ANWA 4GKKT 4O2BE 4DBRA 3O9XA 4NUUA 1HG5A 1MNEA 2YDSA 3EHZA 4OYKA 1LKXA 2YU2A 5EK2A 3VU7H 1OEDB 3C98B 2CXDA 1LVFA 5HWXA 2D5UA 3WAJA 4IHJE 4CI2B 4QH1A 2H89A 3ZC1A 3T1HT 4HN9A 2N2NA 2LJLA 4DV5T 1SE7A 3AE5A 3FZFB 2K3WA 4KUMB 2DI4A 4JLEA 3RKOA 4P0BA 4XAXB 2WSSV 2QYWA 2WP9A 4WZXA 5LG4A 4AQYT 5AQJB 3VHLA 1OEDE 3ZYLA 4TV9E 3KV5A 4U72A 5GONE 5LHGB 5M4YA 2V5DA 4UIGA 1U5PA 1ZP0A 3HL6A 2WBLA 1D1BA 1O3XA 4LFBT 2V8SV 4H63V 4H9OC 1IBMT 4HWCA 3UULA 3O1IA 4Q25A 3QC9A 4MLKA 2WWVA 2BS2A 1YW0A 3MK7C 5C8YE 2LSGA 3F31A 5HCMA 2F4VT 3E22E 5FXVA 5L2LA 3RC3A 4IDNA 4U31A 3FZKB 4JYAT 3P7IA 4X1KE 2W4XA 1VRBA 4U2ZA 3R6NA 3Q9DA 3AVRA 3N9LA 5AQSB 3ABVA 4CN4A 5BMVE 5HXSA 1HNXT 4NXNT 5ABHA 1OEDA 1WLXA 5LOVE 5E0OA 2ES0A 3O4XE 4ZZCA 5FNVE 3Q5XA 2IDOB 2OV9A 1CHUA 1HX8A 4YSXA 2XQAA 2BS4A 3LG7A 5AQFB 3PDYA 3P8CD 2W2UA 5LBMA 3P4PA 3H3MA 5JDFA 5LCYA 4MALA 3UU8A 4ANJA 3VRBA 2DWGA 4DVDA 2BKOA 4ZXLA 2CHOA 1S94A 3UUBA 5LJNA 1ZKEA 3Q5DA 5FVKA 5DJQC 4LF8T 2VKOA 3KVBA 3LK2B 3UQ7A 2HHHT 3EVYA 1KFYA 2RA1A 4TNVA 4G2AA 3CKDA 4X20E 2W62A 3QUJA 4X1IE 4ILUA 5AQVB 2BS3A 3W15B 4C90A 4DIDB 3SOLA 4JI8T 3AE4A 1D0YA 5HAXA 1J5WA 3NZQA 5FXWA 2EHOA 3N5LA 3MXZA 2UXNB 3A5XA 2VL0A 2CM0A 2D2SA 2IIUA 2LKHA 3B57A 4U2YA 5JR9A 4NPPA 3EUHA 4H9PC 4ILCA 4EEDA 4XZCA 5CGMA 2Q9QC 1FJGT 1HNWT 3GN5B 3C4XA 4UEMA 2PTFA 4UELA 5JDNA 4LF4T 2UXCT 4QX7B 2YK0A 3BQKA 4EIWA 1D1CA 2X68A 4O8SA 1OWAA 4HWIB 3PUQA 5LGTB 4HFEA 2JRKA 2KSRA 2HN2A 3UU4A
chains in the Genus database with same CATH topology
3RYHE 4DMWA 2E9XD 4TN7B 4CXXA 4H9QC 4ZHQE 1KNZA 3MA9A 2KT9A 3UTKA 5LA6E 2K5BB 2NTYA 2XUEA 2ZM8A 2K9AA 3ANWB 2W00A 1B7TA 2LHNA 4O4HE 4PW8A 3ZCJA 2CLYB 1E1HB 2A2FX 2BVMA 4FI5A 4PK5A 3RC8A 3MZKB 5LGNB 3J7Yq 4ZI2D 2A72A 2XAGB 3RX6A 4UVBB 2M67A 1US7B 2X9HA 4ZI3D 3C4WA 4I50E 2A3DA 3K3OA 1BR2A 3N9MA 4HTEA 5F8PA 5HYAA 2CMRA 5LXTE 4H9NC 2UXXB 4H9RC 4PJMA 3PTRB 2WMNA 1S35A 3Q5WA 4GYSA 4EAHA 4OK0A 2KWIB 3LK42 4YFSA 4FJOA 3WAKA 4E7SA 3ZMVB 3UUNA 4WW0A 4L5GA 5KDMC 4JEUB 2KZ7B 3MACA 4QWNB 4TUYE 2HPJA 4YHJA 3UT5E 4AQGA 4PAGA 4WBOA 5EK3A 1Y64B 3E08A 2IAKA 5CA1E 5KX5E 5JRCA 5DQWA 2CLYC 2MBGA 2IW5B 2E9XB 2XASB 3O1JA 3ETVA 3KV9A 2H7OA 4EZHA 4UV8B 2Z6EA 4H9SE 3HI2A 4AKRB 2NOXA 4AI6A 4C91A 2NP9A 3NRXA 3AVSA 2Q9QD 2X9XA 4UVCB 2VASA 1MMDA 2KWHA 5KMGP 4QKNA 5JH7E 2LOPA 3I9WA 4UXNB 2E8IA 3FB2A 5FP3A 2L8KA 5ADXL 4P09A 2Y8DA 2ODVA 3RRWA 5LYJE 2L9QA 4QHOA 1NAFA 2J1DG 2LHRA 1HTJF 1ZV4X 3I9YA 4J2CA 3NRYA 3ZMTB 3UUMA 1AJ3A 3KV4A 2N1GA 1ZEEA 2N9DA 4IIJE 4ADZA 2XAQB 3AA1B 3AAAB 2ACXA 4H63H 4E7ZA 4ZI7E 2WMOA 5L3DB 2DWKA 3SWHA 3WI3A 4HEAA 4GK0E 3OBVE 2ZM0A 1WYBA 2KNDA 5LGUB 2VWAA 4ZS2A 2E9XC 1HS7A 2P9BA 2Q9QB 2Y6XA 2EHOD 2KMFA 3FBLA 5JVDE 5IHYA 3FBZA 1MIYA 1MMGA 3N2KE 2KLQA 2VKHA 3N9QA 1IJ6A 2VKJA 4AQFC 3TKLB 2NTXA 2ZMAA 5DQVA 4U74A 3RPUA 4TZ4C 2QA7A 5LNKA 1HG2A 5DABA 4AKLA 4IE6A 3LBXB 3AA6B 2ZM2A 5LJMA 3D0TA 2LSKA 3CVRA 4XBFB 1D1AA 1MMNA 3KBUA 3RYFE 4NUVA 5L3CB 3VKGA 3AAEB 4EYYR 4N78D 4IE7A 3N9NA 2CEAA 3BQLA 1CUNA 3PUSA 3ZJ1A 1IZNB 3PUGA 4O2AE 3ZC0A 5JREA 1T98A 4ZI3C 4Z8XA 3ZN1B 2H7VC 1HCIA 1G73A 2B1EA 1WRDA 3FHNA 4HKAA 3AB3B 2YEVC 3GWHA 2Y48B 4PFPA 2NW9A 5IYZE 4AQFA 2NWBA 4UV9B 3JC6D 3DP7A 4L9IA 2X9WA 4IE0A 2E9XA 4QX8B 5HXHA 4AKIA 4DO0A 4IE4A 2MYSA 3GA8A 2VKDA 3RYIE 4BJNA 3VKHA 1FIOA 4WNKA 1SA0E 5JDGA 3ZLIA 3CQGB 4P0AA 2YINA 4I43B 3PURA 3C64A 3ZCIA 2XHEB 1D0XA 4L0RA 3T8OA 4CXYA 5FY1A 3CQCB 3F2EA 5J2TE 3ETUA 4GYRA 1FEWA 3Q2MA 5JQGE 3E0ZA 5L3FB 2H3RA 4QXBB 2OA5A 1G8XA 3I1AA 3HKDE 3FXEB 4QXCB 2D0TA 5JDMA 4O4JE 3KVAA 4MBQA 4CI1B 2X9YA 3ZN0B 2LSJA 3LJCA 4ZS3A 4AKHA 4HFVA 3DTOA 5LP6E 3N9OA 5JRCB 4G63A 4YJ3E 1MIVA 2NW7A 2ZLYA 3LBXA 2PBIA 2ODUA 3AA7B 4O4IE 2CXFA 4ERRA 4CXWA 4EXTA 5FXZA 2C5JA 1BR1A 5A1LA 5J1GA 3KBTA 4HE8A 2CXLA 2V1DB 1H7CA 2CWOA 3SRZA 4EOZB 3OKQA 3NBXX 3DJBA 2X0LB 4ZOLE 4TX5A 2BDEA 3IF8B 1MNDA 2IC9A 3NZPA 1ZHCA 4PJNA 2DLRA 4AKGA 1UX5A 4WBNE 4YJ2E 2WM9A 2D0UA 2X66A 5JR9B 4JUYA 3K3QC 4JEHB 4KMCA 4ISSA 3UFEA 3ZMUB 4V1Av 4GOUA 1IJ5A 3CWZB 5LBQB 2W63A 4QXHB 2V7MA 4IE5A 1BR4A 2XQYA 2NW8A 3I0QA 2LSIA 2JJ9A 5AFUL 5L3GB 2GK9A 1QSDA 2VK9A 3ZJ2A 2IC6A 2L3LA 4BJMA 4TV8E 3CX7B 1BR0A 1WYCA 5H6RB 3BQIA 1HF8A 2G0UA 2VL8A 1OXZA 2WWUA 5EZYE 3H3AA 3IHRA 1D0ZA 1QUUA 2LOSA 3RYCE 5HXEA 2KINB 3FXDB 1KK7A 2CWYA 4CQIA 1Z0PA 3KFWX 3LFMA 3N2OA 4OFZA 5ETWA 2XTLA 5JDLA 2C5KT 4GIWA 2W61A 5TAOA 2CCQA 2CE7A 4AXPA 3KDSE 1VOMA 4BA9A 4DNDA 3QK6A 2WAUA 1UX4A 2SPCA 3MJXA 1U4QA 2HH7A 2MTQA 2Q9QA 4I55E 3SS1A 2KXPB 5C8YE 3M65A 3B13A 5JR9C 5JDQA 4PJLA 5LHIB 3HR0A 3HA4A 3HKEE 3PUAA 2EHOC 2C0SA 4PNIA 5H6QB 4IGUA 2K24A 1YKHB 3PU8A 5CA0E 2MOZA 2DHRA 3KINB 4EB6E 4PK6A 4BAYB 2QGSA 1X79A 2YU1A 2LE8A 2VB6A 3IEEA 3J9X1 1NWMX 4OHFA 3OJAA 3RH3A 4UVAB 5FY7A 3CX6B 3ESLA 3PU3A 5J2UE 3N2GE 1EZ3A 2V7IA 4DMVA 3ZYMA 5F3JA 1V9DA 3K8PC 3ZPOA 4A56A 5CB4E 5EK4A 5FY0A 4ASKA 2PFVA 1MMAA 3L09A 4X1YE 5JDHA 2JPFA 2V7KA 3HKBE 3U78A 2XAJB 3I0OA 3JC6C 3K3NA 2RP4A 4KP3C 2X51A 3PE0A 2LM9A 3BK9A 3O1HA 3CQXC 3OYZA 4HGAA 3RRCA 4OYJA 3ZYKA 3U3IA 2XAHB 5FMNA 4CI3B 3GMIA 3ONXA 3C4ZA 1MIWA 2V7JA 2V7LA 3H37A 1UCUA 1HFAA 1WR6A 2BVLA 2LEHA 4MFRA 5L3BB 2I59A 3N9PA 4ZI2C 4PFOA 2JMKA 4PJJA 4UF0A 2DCFA 2K48A 3EDUA 4MHCA 3ZEFB 3IBPA 3HKCE 3MKDA 2CA5A 2XAFB 5FXXA 5L3EB 4M1PA 1YKEB 4K0UA 3AAIA 3ZMZB 3C50A 2W0GA 3EDVA 2LT3A 4KBMB 4DBQA 4EZ4A 3LK3B 2LSYA 2V26A 2JQQA 4GK5E 3AA0B 3F57A 3GN5A 3KV6A 2PG8A 4IDZA 2HPLA 5LHHB 2BZBA 5HWYA 3S4UA 3CX8B 4UF0B 4EYUA 1LVKA 4YLHA 4B6XA 5FYMA 2X67A 3UUXB 2EHOB 3L3PA 1IAPA 4O4LE 4CZZB 3CMLA 4F6RC 1SHZC 5HXCA 2C5IT 1FMVA 2PJQA 1YD8G 2DNXA 3C51A 4PK4A 4ISTA 1FMWA 3V5UA 2JMHA 5HXRA 1LRZA 4I4TE 3R84B 3OYXA 3CPZA 3ZMSB 3ANWA 4O2BE 4DBRA 3O9XA 4NUUA 1HG5A 1MNEA 4OYKA 1LKXA 2YU2A 5EK2A 3VU7H 3C98B 2CXDA 1LVFA 5HWXA 2D5UA 3WAJA 4IHJE 4CI2B 3ZC1A 4HN9A 2N2NA 2LJLA 4KUMB 3RKOA 2DI4A 4JLEA 4P0BA 4XAXB 2WSSV 5LG4A 3VHLA 3ZYLA 4TV9E 3KV5A 4U72A 5GONE 5LHGB 5M4YA 4UIGA 1U5PA 3HL6A 2WBLA 1D1BA 1O3XA 4H63V 4H9OC 3UULA 3O1IA 3QC9A 4MLKA 1YW0A 3MK7C 2LSGA 3F31A 3E22E 5FXVA 5L2LA 3RC3A 3P7IA 4X1KE 1VRBA 3R6NA 3Q9DA 3AVRA 3N9LA 5BMVE 5HXSA 1WLXA 5LOVE 5E0OA 2ES0A 3O4XE 5FNVE 3Q5XA 1HX8A 3LG7A 3PDYA 3P8CD 5LBMA 5JDFA 5LCYA 4MALA 4ANJA 2DWGA 4DVDA 1S94A 5LJNA 1ZKEA 5DJQC 2VKOA 3KVBA 3LK2B 3EVYA 2RA1A 4G2AA 3CKDA 4X20E 2W62A 3QUJA 4X1IE 4ILUA 3W15B 4C90A 3SOLA 5HAXA 1D0YA 3NZQA 5FXWA 2EHOA 3N5LA 3MXZA 2UXNB 3A5XA 2CM0A 2D2SA 3B57A 5JR9A 3EUHA 4H9PC 4XZCA 2Q9QC 3GN5B 3C4XA 4UEMA 4UELA 5JDNA 4QX7B 2YK0A 3BQKA 4EIWA 1D1CA 2X68A 4O8SA 1OWAA 5LGTB 3PUQA 3V5SA 2JRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS V;  2CLY C; 
#chains in the Genus database with same CATH topology
 3RYH E;  4DMW A;  5L47 A;  2E9X D;  5AQM B;  3JAE A;  4TN7 B;  4CXX A;  4H9Q C;  4Z91 A;  4ZHQ E;  3VKH A;  1KNZ A;  3MA9 A;  3LDQ B;  3TLS A;  2KT9 A;  3UTK A;  4HWD A;  5LA6 E;  2K5B B;  2NTY A;  2XUE A;  2ZM8 A;  2K9A A;  3ANW B;  2W00 A;  1B7T A;  2LHN A;  4O4H E;  4PW8 A;  3ZCJ A;  4CN1 A;  2E5L T;  3B5M A;  2CLY B;  3EI0 A;  1E1H B;  2A2F X;  2BVM A;  4FI5 A;  4PK5 A;  4YTM A;  3MZK B;  3RC8 A;  3AEA A;  4ZEY A;  4JI0 T;  5HEU A;  5LGN B;  3J7Y q;  3TLU A;  4ZI2 D;  5AQQ B;  4KHP T;  3RLF F;  4NIQ A;  4ZZB A;  3CK6 A;  1YQ3 A;  2A72 A;  2VQE T;  3RHW A;  2LM2 A;  2XAG B;  2YN6 A;  4UVB B;  3RX6 A;  2M67 A;  1US7 B;  2X9H A;  4JI4 T;  5FL0 A;  4ZI3 D;  3C4W A;  4JV5 T;  4TWH A;  4I50 E;  1HX1 B;  2A3D A;  2AXD S;  3K3O A;  1N34 T;  1BR2 A;  3N9M A;  4HTE A;  5F8P A;  5HYA A;  1XWM A;  2CMR A;  2JIW A;  5LXT E;  3VR8 A;  4H9N C;  2UUA T;  2UXX B;  4H9R C;  4PJM A;  1VCT A;  3PTR B;  2WMN A;  1S35 A;  3Q5W A;  4GYS A;  4EAH A;  4OK0 A;  4EGW A;  2KWI B;  3LK4 2;  4YFS A;  4FJO A;  4B3R T;  3WAK A;  3Q5E A;  4E7S A;  4U33 A;  3ZMV B;  2WY2 A;  5IUX A;  1M62 A;  3UUN A;  4WW0 A;  4L5G A;  5KDM C;  4JEU B;  4IT4 A;  2KZ7 B;  3MAC A;  5AQP B;  4QWN B;  4TUY E;  2HPJ A;  1KEY A;  4YHJ A;  3ZT7 A;  5IWA T;  5ABF B;  3UT5 E;  1NEK A;  4AQG A;  4LF7 T;  4PAG A;  4WBO A;  5EK3 A;  1Y64 B;  2R6G F;  2IAK A;  3E08 A;  5CA1 E;  5KX5 E;  5JRC A;  3RQU A;  1X9B A;  5DQW A;  4K0K T;  2CLY C;  2MBG A;  2IW5 B;  4X65 T;  2WDV A;  2E9X B;  1NEN A;  2BG9 E;  2W66 A;  2XAS B;  2AE9 A;  3O1J A;  3PUZ F;  4IDQ A;  3ETV A;  3AE6 A;  2V6Y B;  3KV9 A;  3UU5 A;  2H7O A;  2MPK A;  4EZH A;  4UV8 B;  4JI2 T;  1N33 T;  2Z6E A;  4H9S E;  3HI2 A;  4AKR B;  4GKJ T;  4DR2 T;  2NOX A;  3SFD A;  4C91 A;  4AI6 A;  3RKG A;  2NP9 A;  2XPK A;  4AIU A;  4B3T T;  1SUM B;  2XM2 A;  2J62 A;  3AVS A;  2Q9Q D;  2X9X A;  3NRX A;  2VAS A;  1MMD A;  2KWH A;  4UVC B;  5KMG P;  1JNR A;  4QKN A;  2LOP A;  3I9W A;  4UXN B;  5JH7 E;  2E8I A;  3TLW A;  3FB2 A;  5LMN T;  5FP3 A;  3V5S A;  2L8K A;  5ADX L;  4P09 A;  3UU3 A;  2CPT A;  2Y8D A;  2ODV A;  3P50 A;  4KI0 F;  3RRW A;  4DV6 T;  1J5E T;  3QNU A;  5LYJ E;  4ILB A;  5LMU T;  1XNR T;  3ONL C;  3NVO A;  4YTN A;  2L9Q A;  3NKZ A;  1NAF A;  4QHO A;  2IHR 1;  2J1D G;  2LHR A;  5BR8 T;  4LF9 T;  2LRK A;  4YHH T;  5AQU B;  5JTG A;  1HTJ F;  1ZV4 X;  3I9Y A;  4J2C A;  3NRY A;  2H88 A;  3UUM A;  3ZMT B;  4CN6 A;  3KV4 A;  4YXD A;  2IUB A;  1ZEE A;  2N1G A;  4QH5 A;  5CJ5 A;  2N9D A;  4IIJ E;  4ADZ A;  2XAQ B;  3AA1 B;  1XMQ T;  1HR0 T;  3AAA B;  2ACX A;  2BKN A;  4H63 H;  4E7Z A;  4ZI7 E;  2WMO A;  4KHZ F;  5L3D B;  2DWK A;  3SWH A;  3WI3 A;  1XNQ T;  4HEA A;  4GK0 E;  3OBV E;  2ZM0 A;  4DV2 T;  1WYB A;  2KND A;  4A98 A;  4AQF A;  5LGU B;  2VWA A;  4ZS2 A;  2E9X C;  5AQO B;  1HS7 A;  2P9B A;  2Q9Q B;  3OPC A;  2Y6X A;  2EHO D;  1WCR A;  5LB7 B;  2KMF A;  1L0V A;  1M7K A;  3FBL A;  5JVD E;  5IHY A;  3FBZ A;  5ABE A;  4IRE A;  1MIY A;  1IBL T;  4JI3 T;  5C2T A;  1MMG A;  3N2K E;  2KLQ A;  2VKH A;  3N9Q A;  1IJ6 A;  2VKJ A;  4AQF C;  2X0H A;  3TKL B;  2CHN A;  2FJE A;  2XQ7 A;  2CBI A;  2NTX A;  3FZL B;  3NWI A;  4IDP A;  2D9D A;  2ZMA A;  5DQV A;  4U74 A;  3RPU A;  4TZ4 C;  2QA7 A;  5LNK A;  5FY7 A;  1HG2 A;  3UQ4 A;  3AE2 A;  2YOE A;  5DAB A;  5FVL A;  4AKL A;  4IE6 A;  2JQK A;  3ZKR A;  3LBX B;  3AA6 B;  3PUX F;  4DR5 T;  2ZM2 A;  1N36 T;  4LFC T;  5LJM A;  2XQ9 A;  3D0T A;  1E2A A;  2IML A;  2LSK A;  3CVR A;  3ZT6 A;  4XBF B;  1W09 A;  1D1A A;  1MMN A;  2XZE A;  3KBU A;  3RYF E;  2ZM6 T;  2BG9 A;  4JI1 T;  4NUV A;  2WU5 A;  5L3C B;  4JI5 T;  3UU6 A;  3AAE B;  4EYY R;  3X1D A;  4N78 D;  4IE7 A;  3RIU C;  3VKG A;  3N9N A;  4P1N A;  3AE9 A;  2CEA A;  1N32 T;  3BQL A;  1CUN A;  3PUS A;  5F5W A;  3P4R A;  3ZJ1 A;  1IZN B;  2QRX A;  3FZM B;  3PUG A;  4O2A E;  3ZC0 A;  2E5V A;  5AQH B;  5JRE A;  1T98 A;  4ZI3 C;  4Z8X A;  2V5C A;  3PUV F;  4JI6 T;  3ZN1 B;  3OVU A;  2H7V C;  2WQY A;  1HCI A;  2BKP A;  2E2A A;  5HCJ A;  1WR0 A;  4QH4 A;  3ZSS A;  1G73 A;  4LMJ A;  4LML A;  4COF A;  2B1E A;  3ONJ A;  4DR6 T;  3JCF A;  1WRD A;  1ZOY A;  2FJA A;  2VUR A;  3FHN A;  4HKA A;  3AB3 B;  2J47 A;  2YEV C;  2Y48 B;  3GWH A;  4PFP A;  5IYZ E;  2NW9 A;  2NWB A;  4UV9 B;  1R8I A;  4I55 E;  5HEO A;  4LMK A;  3AXJ B;  4HFC A;  3JC6 D;  3DP7 A;  4YSZ A;  4L9I A;  4U7I A;  5LG3 A;  2X9W A;  4OX9 T;  4IE0 A;  3A7M A;  2E9X A;  4QX8 B;  5HXH A;  4AKI A;  2FUP A;  3PUW F;  4IL4 A;  4IE4 A;  3ZST A;  2MYS A;  4DO0 A;  3GA8 A;  2VKD A;  2FBW A;  2M6B A;  3RGL A;  3RYI E;  5L4H A;  4BJN A;  1FIO A;  5FL1 A;  4WNK A;  4DV4 T;  1SA0 E;  5JDG A;  3ZLI A;  3QOF A;  3CQG B;  3RI5 A;  5L3B B;  4KX6 A;  2UUB T;  2UUC T;  4EEB A;  2YDR A;  4DR3 T;  4X66 T;  2YIN A;  4I43 B;  4P0A A;  3L8R A;  3C64 A;  3PUR A;  2XQ5 A;  3ZCI A;  2YDQ A;  2XHE B;  4YSY A;  1D0X A;  4L0R A;  1IBK T;  4WYV A;  3T8O A;  2B76 A;  5FY1 A;  4CXY A;  2XQ4 A;  1UUS A;  1YXR A;  3CQC B;  3F2E A;  2WDR A;  3ETU A;  2WB5 A;  5J2T E;  3T1Y T;  2JQ9 A;  4GYR A;  2BBH A;  1FEW A;  3Q2M A;  5HEG A;  3VRA A;  1QLB A;  2WCA A;  5JQG E;  4B3M T;  3E0Z A;  5L3F B;  2H3R A;  5AQL B;  4QXB B;  2FJB A;  2OA5 A;  1G8X A;  5KXJ A;  2MAW A;  3I1A A;  3HKD E;  1XMO T;  3P4Q A;  3FXE B;  4QXC B;  2D0T A;  5HEH A;  5JDM A;  4O4J E;  4B3S T;  3RIU A;  3KVA A;  4MBQ A;  4CI1 B;  2M6I A;  2BG9 C;  2X0Y A;  2BG9 B;  2X9Y A;  1UK5 A;  2LLY A;  2LSJ A;  3LJC A;  3ZN0 B;  4DR4 T;  4ZS3 A;  4AKH A;  2LRL A;  1YQ4 A;  2CRB A;  3TLT A;  4HFV A;  3DTO A;  5LP6 E;  3N9O A;  5JRC B;  4G63 A;  2UXD T;  4YJ3 E;  1MIV A;  2NW7 A;  2ZLY A;  3LBX A;  2PBI A;  2ODU A;  2HN1 A;  1KNR A;  3AA7 B;  4O4I E;  2CXF A;  4ERR A;  3SS1 A;  4CXW A;  3IA3 A;  4EXT A;  5FXZ A;  2C5J A;  1BR1 A;  5A1L A;  5J1G A;  2RPA A;  3KBT A;  2CXL A;  3AXJ A;  4HE8 A;  5AQG B;  2V1D B;  1H7C A;  2CWO A;  3SRZ A;  4EOZ B;  4HWH A;  4A5X A;  3OKQ A;  4NXM T;  3NBX X;  2X0L B;  3DJB A;  4ZOL E;  4TX5 A;  4X62 T;  3AE7 A;  4JBW F;  2BDE A;  3IF8 B;  1MND A;  2IC9 A;  3SFE A;  1KNP A;  4HFB A;  3NZP A;  1ZHC A;  4PJN A;  2DLR A;  2ACZ A;  1UX5 A;  2UU9 T;  4WBN E;  2I0M A;  4YJ2 E;  2WM9 A;  4AKG A;  2D0U A;  2X66 A;  5JR9 B;  4JUY A;  3K3Q C;  4JEH B;  4KMC A;  5ABG A;  1W0B A;  2XQ3 A;  4ISS A;  3UFE A;  2LKG A;  3ZMU B;  4V1A v;  4GOU A;  1IJ5 A;  4DR7 T;  3CWZ B;  3PV0 F;  5LBQ B;  3TLV A;  2CBJ A;  2W63 A;  4QXH B;  2V7M A;  4IE5 A;  1BR4 A;  2XQY A;  2NW8 A;  3I0Q A;  4LF6 T;  5AQR B;  2LSI A;  2JJ9 A;  3FZH B;  5AFU L;  2GK9 A;  5L3G B;  1QSD A;  1UGO A;  2NR4 A;  2VK9 A;  3ZJ2 A;  2IC6 A;  2L3L A;  4BJM A;  4TV8 E;  5AQT B;  5JR9 C;  3CX7 B;  1BR0 A;  1WYC A;  5H6R B;  3BQI A;  4DV0 T;  1HF8 A;  3AED A;  2G0U A;  2VL8 A;  1OXZ A;  2WWU A;  3AEB A;  1KF6 A;  1W9R A;  3H3A A;  5EZY E;  4U7Y A;  4YY3 T;  3IHR A;  1D0Z A;  1QUU A;  2A9U A;  2LOS A;  3P4W A;  3RYC E;  5HXE A;  2KIN B;  3FXD B;  1KK7 A;  2CWY A;  3G06 A;  4CQI A;  1Z0P A;  3KFW X;  3LFM A;  2WZI A;  2XQ6 A;  3N2O A;  4OFZ A;  2XTL A;  5ETW A;  4ILA A;  5C3J A;  2C5K T;  4GIW A;  5JDL A;  1DU2 A;  2BBJ A;  1E7P A;  2FJD A;  1J1J A;  2W61 A;  5AQN B;  1GQE A;  3RIF A;  5TAO A;  2CCQ A;  1W0A A;  5HEJ A;  1HNZ T;  2CE7 A;  4AXP A;  3VR9 A;  3KDS E;  3A8Y C;  1VOM A;  4BA9 A;  2XSA A;  3RQW A;  1I6Z A;  1T72 A;  2XQ8 A;  3QK6 A;  2WAU A;  1UX4 A;  2SPC A;  3MJX A;  4DND A;  1U4Q A;  2HH7 A;  1Z8U A;  1T8B A;  1XDO A;  1Y01 A;  2KXP B;  2MTQ A;  2Q9Q A;  2V6Y A;  3B13 A;  3M65 A;  4PJL A;  4UR9 A;  3HR0 A;  3HA4 A;  3HKE E;  5JDQ A;  3PJA A;  3PUA A;  4I0U A;  5LHI B;  3AE8 A;  2XM1 A;  3AEF A;  2XSB A;  2EHO C;  2C0S A;  4TWF A;  4PNI A;  4IDO A;  4IGU A;  5H6Q B;  2K24 A;  1YKH B;  3PU8 A;  5CA0 E;  2MOZ A;  2DHR A;  3KIN B;  2XY8 B;  2V6X A;  4EB6 E;  4PK6 A;  4BAY B;  4DUY T;  2W67 A;  2QGS A;  1X79 A;  4F8H A;  2WZH A;  2YU1 A;  3AEE A;  2LE8 A;  2VB6 A;  3IEE A;  3AE1 A;  4TWD A;  3J9X 1;  2WU2 A;  1NWM X;  4OHF A;  3JAD A;  3OJA A;  3RH3 A;  3UFG A;  3EAM A;  3M3Z B;  3CX6 B;  3LSV A;  3QB5 A;  4HFH A;  3ESL A;  3PU3 A;  4UVA B;  3N2G E;  4HWF A;  5J2U E;  1EZ3 A;  2V7I A;  3EAB A;  3ZYM A;  4DMV A;  5F3J A;  1V9D A;  2WS3 A;  4HFI A;  1XZY A;  3JAF A;  3K8P C;  3ZPO A;  4A56 A;  5L3E B;  5CB4 E;  5EK4 A;  4YTP A;  5FY0 A;  4ASK A;  4DV7 T;  4EV6 A;  4X5T A;  2PFV A;  1MMA A;  1OED C;  3ZT5 A;  3L09 A;  4X1Y E;  5JDH A;  2JPF A;  2V7K A;  3HKB E;  4Z90 A;  3U78 A;  2XAJ B;  3PJA J;  3I0O A;  3JC6 C;  4IL9 A;  3K3N A;  2RP4 A;  4KP3 C;  4A97 A;  2X51 A;  3PE0 A;  1JNZ A;  5CFB A;  2DL1 A;  2LM9 A;  3BK9 A;  5AQK B;  3O1H A;  3CQX C;  3OYZ A;  4HGA A;  3RRC A;  4OYJ A;  3ZYK A;  2JQH A;  5AQI B;  2VQF T;  3P4S A;  3U3I A;  2XAH B;  5FMN A;  4CI3 B;  3GMI A;  3ONX A;  3C4Z A;  1MIW A;  2V7J A;  2V7L A;  3H37 A;  1UCU A;  3K1S A;  1HFA A;  1WR6 A;  1XDP A;  2BVL A;  2LEH A;  3AE3 A;  2I59 A;  3N9P A;  4MFR A;  3RF1 A;  4ZI2 C;  4PFO A;  4U3C A;  2JMK A;  4PJJ A;  4UF0 A;  2DCF A;  2K48 A;  3EDU A;  2XJ7 A;  3PUY F;  4MHC A;  3ZEF B;  3IBP A;  3HKC E;  3MKD A;  5ABF A;  2CA5 A;  2XAF B;  5FXX A;  5L4E A;  4M1P A;  1YKE B;  4K0U A;  3AAI A;  2I6H A;  3C50 A;  3ZMZ B;  2W0G A;  2UXB T;  3EDV A;  2LT3 A;  4KBM B;  4DBQ A;  3RIA A;  4EZ4 A;  3LK3 B;  2LSY A;  2V26 A;  2JQQ A;  4DUZ T;  3QB5 K;  4GK5 E;  3AA0 B;  3AEC A;  3F57 A;  2WDQ A;  1WFD A;  3GN5 A;  3KV6 A;  2PG8 A;  1I94 T;  4IDZ A;  2HPL A;  5LHH B;  2BZB A;  5HWY A;  2VVN A;  3CX8 B;  3S4U A;  4UF0 B;  4EYU A;  1LVK A;  4YLH A;  4JI7 T;  2J4G A;  4B6X A;  5FYM A;  2X67 A;  3UUX B;  2EHO B;  3L3P A;  5J0Z A;  1IAP A;  4O4L E;  4X64 T;  4CZZ B;  3CML A;  2OLT A;  4TNW A;  1UUR A;  3CIR A;  4F6R C;  4DV1 T;  2YKS A;  1SHZ C;  2QVA A;  3AEG A;  4HFD A;  2C5I T;  5HXC A;  1FMV A;  1VCS A;  1YD8 G;  2DNX A;  2PJQ A;  4YT0 A;  3C51 A;  4PK4 A;  1T7S A;  4AIS A;  4IST A;  1FMW A;  3V5U A;  4DV3 T;  2JMH A;  5FKY A;  4DR1 T;  5HXR A;  1LRZ A;  2VVS A;  4I4T E;  3R84 B;  4LF5 T;  3OYX A;  4LFA T;  1AJ3 A;  3OTO T;  3L39 A;  3CPZ A;  3ZMS B;  3ANW A;  4GKK T;  4O2B E;  4DBR A;  3O9X A;  4NUU A;  1HG5 A;  1MNE A;  2YDS A;  3EHZ A;  4OYK A;  1LKX A;  2YU2 A;  5EK2 A;  3VU7 H;  1OED B;  3C98 B;  2CXD A;  1LVF A;  5HWX A;  2D5U A;  3WAJ A;  4IHJ E;  4CI2 B;  4QH1 A;  2H89 A;  3ZC1 A;  3T1H T;  4HN9 A;  2N2N A;  2LJL A;  4DV5 T;  1SE7 A;  3AE5 A;  3FZF B;  2K3W A;  4KUM B;  2DI4 A;  4JLE A;  3RKO A;  4P0B A;  4XAX B;  2WSS V;  2QYW A;  2WP9 A;  4WZX A;  5LG4 A;  4AQY T;  5AQJ B;  3VHL A;  1OED E;  3ZYL A;  4TV9 E;  3KV5 A;  4U72 A;  5GON E;  5LHG B;  5M4Y A;  2V5D A;  4UIG A;  1U5P A;  1ZP0 A;  3HL6 A;  2WBL A;  1D1B A;  1O3X A;  4LFB T;  2V8S V;  4H63 V;  4H9O C;  1IBM T;  4HWC A;  3UUL A;  3O1I A;  4Q25 A;  3QC9 A;  4MLK A;  2WWV A;  2BS2 A;  1YW0 A;  3MK7 C;  5C8Y E;  2LSG A;  3F31 A;  5HCM A;  2F4V T;  3E22 E;  5FXV A;  5L2L A;  3RC3 A;  4IDN A;  4U31 A;  3FZK B;  4JYA T;  3P7I A;  4X1K E;  2W4X A;  1VRB A;  4U2Z A;  3R6N A;  3Q9D A;  3AVR A;  3N9L A;  5AQS B;  3ABV A;  4CN4 A;  5BMV E;  5HXS A;  1HNX T;  4NXN T;  5ABH A;  1OED A;  1WLX A;  5LOV E;  5E0O A;  2ES0 A;  3O4X E;  4ZZC A;  5FNV E;  3Q5X A;  2IDO B;  2OV9 A;  1CHU A;  1HX8 A;  4YSX A;  2XQA A;  2BS4 A;  3LG7 A;  5AQF B;  3PDY A;  3P8C D;  2W2U A;  5LBM A;  3P4P A;  3H3M A;  5JDF A;  5LCY A;  4MAL A;  3UU8 A;  4ANJ A;  3VRB A;  2DWG A;  4DVD A;  2BKO A;  4ZXL A;  2CHO A;  1S94 A;  3UUB A;  5LJN A;  1ZKE A;  3Q5D A;  5FVK A;  5DJQ C;  4LF8 T;  2VKO A;  3KVB A;  3LK2 B;  3UQ7 A;  2HHH T;  3EVY A;  1KFY A;  2RA1 A;  4TNV A;  4G2A A;  3CKD A;  4X20 E;  2W62 A;  3QUJ A;  4X1I E;  4ILU A;  5AQV B;  2BS3 A;  3W15 B;  4C90 A;  4DID B;  3SOL A;  4JI8 T;  3AE4 A;  1D0Y A;  5HAX A;  1J5W A;  3NZQ A;  5FXW A;  2EHO A;  3N5L A;  3MXZ A;  2UXN B;  3A5X A;  2VL0 A;  2CM0 A;  2D2S A;  2IIU A;  2LKH A;  3B57 A;  4U2Y A;  5JR9 A;  4NPP A;  3EUH A;  4H9P C;  4ILC A;  4EED A;  4XZC A;  5CGM A;  2Q9Q C;  1FJG T;  1HNW T;  3GN5 B;  3C4X A;  4UEM A;  2PTF A;  4UEL A;  5JDN A;  4LF4 T;  2UXC T;  4QX7 B;  2YK0 A;  3BQK A;  4EIW A;  1D1C A;  2X68 A;  4O8S A;  1OWA A;  4HWI B;  3PUQ A;  5LGT B;  4HFE A;  2JRK A;  2KSR A;  2HN2 A;  3UU4 A; 
#chains in the Genus database with same CATH homology
 3RYH E;  4DMW A;  2E9X D;  4TN7 B;  4CXX A;  4H9Q C;  4ZHQ E;  1KNZ A;  3MA9 A;  2KT9 A;  3UTK A;  5LA6 E;  2K5B B;  2NTY A;  2XUE A;  2ZM8 A;  2K9A A;  3ANW B;  2W00 A;  1B7T A;  2LHN A;  4O4H E;  4PW8 A;  3ZCJ A;  2CLY B;  1E1H B;  2A2F X;  2BVM A;  4FI5 A;  4PK5 A;  3RC8 A;  3MZK B;  5LGN B;  3J7Y q;  4ZI2 D;  2A72 A;  2XAG B;  3RX6 A;  4UVB B;  2M67 A;  1US7 B;  2X9H A;  4ZI3 D;  3C4W A;  4I50 E;  2A3D A;  3K3O A;  1BR2 A;  3N9M A;  4HTE A;  5F8P A;  5HYA A;  2CMR A;  5LXT E;  4H9N C;  2UXX B;  4H9R C;  4PJM A;  3PTR B;  2WMN A;  1S35 A;  3Q5W A;  4GYS A;  4EAH A;  4OK0 A;  2KWI B;  3LK4 2;  4YFS A;  4FJO A;  3WAK A;  4E7S A;  3ZMV B;  3UUN A;  4WW0 A;  4L5G A;  5KDM C;  4JEU B;  2KZ7 B;  3MAC A;  4QWN B;  4TUY E;  2HPJ A;  4YHJ A;  3UT5 E;  4AQG A;  4PAG A;  4WBO A;  5EK3 A;  1Y64 B;  3E08 A;  2IAK A;  5CA1 E;  5KX5 E;  5JRC A;  5DQW A;  2CLY C;  2MBG A;  2IW5 B;  2E9X B;  2XAS B;  3O1J A;  3ETV A;  3KV9 A;  2H7O A;  4EZH A;  4UV8 B;  2Z6E A;  4H9S E;  3HI2 A;  4AKR B;  2NOX A;  4AI6 A;  4C91 A;  2NP9 A;  3NRX A;  3AVS A;  2Q9Q D;  2X9X A;  4UVC B;  2VAS A;  1MMD A;  2KWH A;  5KMG P;  4QKN A;  5JH7 E;  2LOP A;  3I9W A;  4UXN B;  2E8I A;  3FB2 A;  5FP3 A;  2L8K A;  5ADX L;  4P09 A;  2Y8D A;  2ODV A;  3RRW A;  5LYJ E;  2L9Q A;  4QHO A;  1NAF A;  2J1D G;  2LHR A;  1HTJ F;  1ZV4 X;  3I9Y A;  4J2C A;  3NRY A;  3ZMT B;  3UUM A;  1AJ3 A;  3KV4 A;  2N1G A;  1ZEE A;  2N9D A;  4IIJ E;  4ADZ A;  2XAQ B;  3AA1 B;  3AAA B;  2ACX A;  4H63 H;  4E7Z A;  4ZI7 E;  2WMO A;  5L3D B;  2DWK A;  3SWH A;  3WI3 A;  4HEA A;  4GK0 E;  3OBV E;  2ZM0 A;  1WYB A;  2KND A;  5LGU B;  2VWA A;  4ZS2 A;  2E9X C;  1HS7 A;  2P9B A;  2Q9Q B;  2Y6X A;  2EHO D;  2KMF A;  3FBL A;  5JVD E;  5IHY A;  3FBZ A;  1MIY A;  1MMG A;  3N2K E;  2KLQ A;  2VKH A;  3N9Q A;  1IJ6 A;  2VKJ A;  4AQF C;  3TKL B;  2NTX A;  2ZMA A;  5DQV A;  4U74 A;  3RPU A;  4TZ4 C;  2QA7 A;  5LNK A;  1HG2 A;  5DAB A;  4AKL A;  4IE6 A;  3LBX B;  3AA6 B;  2ZM2 A;  5LJM A;  3D0T A;  2LSK A;  3CVR A;  4XBF B;  1D1A A;  1MMN A;  3KBU A;  3RYF E;  4NUV A;  5L3C B;  3VKG A;  3AAE B;  4EYY R;  4N78 D;  4IE7 A;  3N9N A;  2CEA A;  3BQL A;  1CUN A;  3PUS A;  3ZJ1 A;  1IZN B;  3PUG A;  4O2A E;  3ZC0 A;  5JRE A;  1T98 A;  4ZI3 C;  4Z8X A;  3ZN1 B;  2H7V C;  1HCI A;  1G73 A;  2B1E A;  1WRD A;  3FHN A;  4HKA A;  3AB3 B;  2YEV C;  3GWH A;  2Y48 B;  4PFP A;  2NW9 A;  5IYZ E;  4AQF A;  2NWB A;  4UV9 B;  3JC6 D;  3DP7 A;  4L9I A;  2X9W A;  4IE0 A;  2E9X A;  4QX8 B;  5HXH A;  4AKI A;  4DO0 A;  4IE4 A;  2MYS A;  3GA8 A;  2VKD A;  3RYI E;  4BJN A;  3VKH A;  1FIO A;  4WNK A;  1SA0 E;  5JDG A;  3ZLI A;  3CQG B;  4P0A A;  2YIN A;  4I43 B;  3PUR A;  3C64 A;  3ZCI A;  2XHE B;  1D0X A;  4L0R A;  3T8O A;  4CXY A;  5FY1 A;  3CQC B;  3F2E A;  5J2T E;  3ETU A;  4GYR A;  1FEW A;  3Q2M A;  5JQG E;  3E0Z A;  5L3F B;  2H3R A;  4QXB B;  2OA5 A;  1G8X A;  3I1A A;  3HKD E;  3FXE B;  4QXC B;  2D0T A;  5JDM A;  4O4J E;  3KVA A;  4MBQ A;  4CI1 B;  2X9Y A;  3ZN0 B;  2LSJ A;  3LJC A;  4ZS3 A;  4AKH A;  4HFV A;  3DTO A;  5LP6 E;  3N9O A;  5JRC B;  4G63 A;  4YJ3 E;  1MIV A;  2NW7 A;  2ZLY A;  3LBX A;  2PBI A;  2ODU A;  3AA7 B;  4O4I E;  2CXF A;  4ERR A;  4CXW A;  4EXT A;  5FXZ A;  2C5J A;  1BR1 A;  5A1L A;  5J1G A;  3KBT A;  4HE8 A;  2CXL A;  2V1D B;  1H7C A;  2CWO A;  3SRZ A;  4EOZ B;  3OKQ A;  3NBX X;  3DJB A;  2X0L B;  4ZOL E;  4TX5 A;  2BDE A;  3IF8 B;  1MND A;  2IC9 A;  3NZP A;  1ZHC A;  4PJN A;  2DLR A;  4AKG A;  1UX5 A;  4WBN E;  4YJ2 E;  2WM9 A;  2D0U A;  2X66 A;  5JR9 B;  4JUY A;  3K3Q C;  4JEH B;  4KMC A;  4ISS A;  3UFE A;  3ZMU B;  4V1A v;  4GOU A;  1IJ5 A;  3CWZ B;  5LBQ B;  2W63 A;  4QXH B;  2V7M A;  4IE5 A;  1BR4 A;  2XQY A;  2NW8 A;  3I0Q A;  2LSI A;  2JJ9 A;  5AFU L;  5L3G B;  2GK9 A;  1QSD A;  2VK9 A;  3ZJ2 A;  2IC6 A;  2L3L A;  4BJM A;  4TV8 E;  3CX7 B;  1BR0 A;  1WYC A;  5H6R B;  3BQI A;  1HF8 A;  2G0U A;  2VL8 A;  1OXZ A;  2WWU A;  5EZY E;  3H3A A;  3IHR A;  1D0Z A;  1QUU A;  2LOS A;  3RYC E;  5HXE A;  2KIN B;  3FXD B;  1KK7 A;  2CWY A;  4CQI A;  1Z0P A;  3KFW X;  3LFM A;  3N2O A;  4OFZ A;  5ETW A;  2XTL A;  5JDL A;  2C5K T;  4GIW A;  2W61 A;  5TAO A;  2CCQ A;  2CE7 A;  4AXP A;  3KDS E;  1VOM A;  4BA9 A;  4DND A;  3QK6 A;  2WAU A;  1UX4 A;  2SPC A;  3MJX A;  1U4Q A;  2HH7 A;  2MTQ A;  2Q9Q A;  4I55 E;  3SS1 A;  2KXP B;  5C8Y E;  3M65 A;  3B13 A;  5JR9 C;  5JDQ A;  4PJL A;  5LHI B;  3HR0 A;  3HA4 A;  3HKE E;  3PUA A;  2EHO C;  2C0S A;  4PNI A;  5H6Q B;  4IGU A;  2K24 A;  1YKH B;  3PU8 A;  5CA0 E;  2MOZ A;  2DHR A;  3KIN B;  4EB6 E;  4PK6 A;  4BAY B;  2QGS A;  1X79 A;  2YU1 A;  2LE8 A;  2VB6 A;  3IEE A;  3J9X 1;  1NWM X;  4OHF A;  3OJA A;  3RH3 A;  4UVA B;  5FY7 A;  3CX6 B;  3ESL A;  3PU3 A;  5J2U E;  3N2G E;  1EZ3 A;  2V7I A;  4DMV A;  3ZYM A;  5F3J A;  1V9D A;  3K8P C;  3ZPO A;  4A56 A;  5CB4 E;  5EK4 A;  5FY0 A;  4ASK A;  2PFV A;  1MMA A;  3L09 A;  4X1Y E;  5JDH A;  2JPF A;  2V7K A;  3HKB E;  3U78 A;  2XAJ B;  3I0O A;  3JC6 C;  3K3N A;  2RP4 A;  4KP3 C;  2X51 A;  3PE0 A;  2LM9 A;  3BK9 A;  3O1H A;  3CQX C;  3OYZ A;  4HGA A;  3RRC A;  4OYJ A;  3ZYK A;  3U3I A;  2XAH B;  5FMN A;  4CI3 B;  3GMI A;  3ONX A;  3C4Z A;  1MIW A;  2V7J A;  2V7L A;  3H37 A;  1UCU A;  1HFA A;  1WR6 A;  2BVL A;  2LEH A;  4MFR A;  5L3B B;  2I59 A;  3N9P A;  4ZI2 C;  4PFO A;  2JMK A;  4PJJ A;  4UF0 A;  2DCF A;  2K48 A;  3EDU A;  4MHC A;  3ZEF B;  3IBP A;  3HKC E;  3MKD A;  2CA5 A;  2XAF B;  5FXX A;  5L3E B;  4M1P A;  1YKE B;  4K0U A;  3AAI A;  3ZMZ B;  3C50 A;  2W0G A;  3EDV A;  2LT3 A;  4KBM B;  4DBQ A;  4EZ4 A;  3LK3 B;  2LSY A;  2V26 A;  2JQQ A;  4GK5 E;  3AA0 B;  3F57 A;  3GN5 A;  3KV6 A;  2PG8 A;  4IDZ A;  2HPL A;  5LHH B;  2BZB A;  5HWY A;  3S4U A;  3CX8 B;  4UF0 B;  4EYU A;  1LVK A;  4YLH A;  4B6X A;  5FYM A;  2X67 A;  3UUX B;  2EHO B;  3L3P A;  1IAP A;  4O4L E;  4CZZ B;  3CML A;  4F6R C;  1SHZ C;  5HXC A;  2C5I T;  1FMV A;  2PJQ A;  1YD8 G;  2DNX A;  3C51 A;  4PK4 A;  4IST A;  1FMW A;  3V5U A;  2JMH A;  5HXR A;  1LRZ A;  4I4T E;  3R84 B;  3OYX A;  3CPZ A;  3ZMS B;  3ANW A;  4O2B E;  4DBR A;  3O9X A;  4NUU A;  1HG5 A;  1MNE A;  4OYK A;  1LKX A;  2YU2 A;  5EK2 A;  3VU7 H;  3C98 B;  2CXD A;  1LVF A;  5HWX A;  2D5U A;  3WAJ A;  4IHJ E;  4CI2 B;  3ZC1 A;  4HN9 A;  2N2N A;  2LJL A;  4KUM B;  3RKO A;  2DI4 A;  4JLE A;  4P0B A;  4XAX B;  2WSS V;  5LG4 A;  3VHL A;  3ZYL A;  4TV9 E;  3KV5 A;  4U72 A;  5GON E;  5LHG B;  5M4Y A;  4UIG A;  1U5P A;  3HL6 A;  2WBL A;  1D1B A;  1O3X A;  4H63 V;  4H9O C;  3UUL A;  3O1I A;  3QC9 A;  4MLK A;  1YW0 A;  3MK7 C;  2LSG A;  3F31 A;  3E22 E;  5FXV A;  5L2L A;  3RC3 A;  3P7I A;  4X1K E;  1VRB A;  3R6N A;  3Q9D A;  3AVR A;  3N9L A;  5BMV E;  5HXS A;  1WLX A;  5LOV E;  5E0O A;  2ES0 A;  3O4X E;  5FNV E;  3Q5X A;  1HX8 A;  3LG7 A;  3PDY A;  3P8C D;  5LBM A;  5JDF A;  5LCY A;  4MAL A;  4ANJ A;  2DWG A;  4DVD A;  1S94 A;  5LJN A;  1ZKE A;  5DJQ C;  2VKO A;  3KVB A;  3LK2 B;  3EVY A;  2RA1 A;  4G2A A;  3CKD A;  4X20 E;  2W62 A;  3QUJ A;  4X1I E;  4ILU A;  3W15 B;  4C90 A;  3SOL A;  5HAX A;  1D0Y A;  3NZQ A;  5FXW A;  2EHO A;  3N5L A;  3MXZ A;  2UXN B;  3A5X A;  2CM0 A;  2D2S A;  3B57 A;  5JR9 A;  3EUH A;  4H9P C;  4XZC A;  2Q9Q C;  3GN5 B;  3C4X A;  4UEM A;  4UEL A;  5JDN A;  4QX7 B;  2YK0 A;  3BQK A;  4EIW A;  1D1C A;  2X68 A;  4O8S A;  1OWA A;  5LGT B;  3PUQ A;  3V5S A;  2JRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...