2CLYC

Subcomplex of the stator of bovine mitochondrial atp synthase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE B CHAIN, MITOCHONDRIAL
publication title On the Structure of the Stator of the Mitochondrial ATP Synthase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 15
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2clyC01
2WSSV 2CLYC
chains in the Genus database with same CATH superfamily
2J1DG 1KF6A 2X68A 3P4PA 2YU2A 5JR9B 5LMNT 2N9DA 4TV9E 4AKGA 2K24A 1N32T 3NRXA 4LF5T 3ETVA 4P1NA 3VU7H 5F5WA 1BR0A 2CM0A 2XQAA 2A3DA 1MIWA 3EABA 4DUYT 2BDEA 2Q9QD 2YOEA 1R8IA 2C0SA 2FBWA 3B5MA 2CLYB 1J1JA 4YTNA 2BZBA 2MOZA 4DV2T 1QUUA 1M62A 4CI2B 5FYMA 2DWGA 5L4EA 2CBJA 3CX6B 4EZHA 2AE9A 5EK3A 4U2YA 4NPPA 4TWDA 1MMGA 2XZEA 3Q5EA 4TZ4C 4UEMA 1BR2A 3H3AA 2KWIB 2DCFA 5JR9A 4HWDA 4F8HA 3DP7A 5HXEA 4WZXA 4LMLA 3VHLA 1MNEA 4NXMT 3HI2A 3FXEB 3CX8B 5JTGA 5L3CB 3L39A 3ONXA 4E7ZA 4H9PC 2LHRA 3PUYF 4DV7T 3N9MA 5FMNA 5CGMA 3V5SA 3PV0F 2V7MA 1U4QA 5AQJB 5LHGB 4AISA 2XUEA 2UU9T 2X67A 4CXXA 4YJ3E 3Q5XA 3P50A 3FZLB 3R6NA 2W4XA 2MBGA 3HR0A 2WCAA 4EYUA 3HA4A 3JC6C 4O4IE 4MBQA 4HTEA 4X1KE 3RKOA 1T8BA 1HFAA 3KV4A 3ZMZB 1MNDA 2Y48B 2IW5B 4A97A 3TLVA 4ZEYA 4HWFA 4TN7B 3L09A 4EOZB 3HL6A 2BS3A 3C4XA 3KVBA 2D9DA 3CK6A 3AE7A 1W0BA 3P4SA 4CZZB 4H9SE 2ACXA 3ZC0A 3X1DA 2CWOA 5AQSB 3ANWB 2KINB 4PNIA 5C8YE 4JI2T 2H3RA 3PURA 1IBMT 2WS3A 3ZCIA 1AJ3A 3RYCE 3I0OA 3FZKB 3P4WA 4KX6A 2UXNB 2YU1A 2UXDT 4OX9T 4IL4A 4AKLA 4IDPA 4PJMA 3L3PA 4LF4T 2MPKA 4DV0T 2V7IA 4O4LE 2B1EA 2LSIA 4HFEA 2M67A 3AECA 4YSYA 4EV6A 2OA5A 2H7OA 2XQ3A 3RQUA 2XHEB 2X9XA 2XQ7A 3RYHE 2UXXB 4ZI7E 2XAGB 4UV8B 4ILCA 1ZKEA 2DWKA 3ZYLA 4ZI2C 5LGTB 4P0BA 2NTXA 1FIOA 5AQKB 4K0UA 2R6GF 1MMAA 5ETWA 2DHRA 3N9LA 3TLSA 3EDVA 4UV9B 3RKGA 4Z8XA 2UXCT 3I1AA 3B57A 4EYYR 3ANWA 2XAQB 5LYJE 2MTQA 5AQRB 2YN6A 4PJLA 2VVNA 4V1Av 3R84B 3IF8B 3I9WA 4JUYA 3O4XE 1E7PA 3UU5A 3V5UA 1S94A 4B3ST 4AKHA 1U5PA 3J9X1 3W15B 5JH7E 3HKBE 5H6RB 2AXDS 5ADXL 5IWAT 2IAKA 3PJAA 3UFGA 3LDQB 3AE6A 2QGSA 2V6YB 4QH4A 3QB5A 1E1HB 3ZJ2A 3VRAA 3MXZA 5A1LA 2IC6A 4U7YA 5CJ5A 4DV6T 4IHJE 4IE5A 5L3DB 4O4HE 2LLYA 4ZI3D 2CEAA 5JRCB 1E2AA 3NZQA 4XZCA 5CFBA 2VB6A 1UUSA 5KMGP 1WYBA 1OEDC 3KV5A 4LFAT 4TWHA 3KINB 5AQQB 3CVRA 2V5CA 1UGOA 5FY0A 4JI5T 3ZMTB 3LJCA 5JDNA 1YKEB 1V9DA 3PUGA 2YDQA 2V6YA 1Y01A 3N9OA 4HFVA 2IC9A 2W61A 2J47A 4AKIA 2XTLA 3RI5A 5AQOB 4UVBB 2A9UA 4I4TE 4X62T 2HH7A 3K3QC 3PUZF 2ODVA 2H89A 3LBXB 5AQPB 4WNKA 5LG3A 4JI6T 5FKYA 4BA9A 5AFUL 5JRCA 2RA1A 5LJNA 4GK5E 3RIFA 1VCSA 2ZMAA 3LFMA 2JQQA 2DLRA 4EEBA 2WZIA 4U7IA 2L8KA 5FY7A 2V1DB 2NP9A 3JAEA 2WU2A 2XQ4A 3CWZB 1WCRA 1HNWT 5LGNB 2I59A 3Q5DA 2WWUA 4DUZT 4HFDA 1IJ5A 3MA9A 2X66A 3N9NA 4PFPA 2HPJA 2LOSA 5JDMA 2I0MA 5H6QB 3UU4A 2V6XA 3M3ZB 2BKNA 3K8PC 5GONE 3RF1A 4AXPA 1MIYA 2HN1A 2ODUA 2BBHA 3AE5A 4BAYB 4ASKA 4TNWA 1HF8A 4A5XA 3LBXA 4L5GA 2WM9A 1KNRA 5EK4A 3MK7C 3BQKA 2V26A 3RRWA 4ZHQE 3AEAA 2WU5A 4YSXA 3O9XA 1HG5A 2YINA 4J2CA 2YEVC 2XQYA 4IE0A 2A2FX 4NXNT 3QK6A 5BMVE 5AQIB 4MLKA 4L0RA 2XQ9A 5CA1E 2XM2A 3ZKRA 3Q2MA 3UU6A 4YJ2E 2JMHA 2KWHA 2ZM0A 5CB4E 1UCUA 5LP6E 3NWIA 5F8PA 1HNXT 3OJAA 1D0ZA 4XBFB 5FXXA 3PTRB 3LSVA 4YHHT 3PUQA 3LK3B 3JC6D 2CXLA 2YDSA 4X1YE 3ONJA 2JQKA 4U72A 4QHOA 1OEDB 2XSBA 3NZPA 3FHNA 5L3GB 4X20E 3CQGB 4O8SA 2CRBA 3MACA 3PUVF 3SFDA 4A56A 2FUPA 2D0TA 1SE7A 5LB7B 2RP4A 3RYIE 2PBIA 5EZYE 4ANJA 2VURA 4QKNA 3FZFB 5JDLA 4X66T 4JI4T 4A98A 2ZLYA 5AQLB 1XNQT 4JYAT 5FY1A 5FVKA 2XQ5A 4YY3T 2VQET 4HN9A 4CI3B 2L3LA 2YDRA 4JEHB 4PAGA 1FMWA 2HN2A 2PG8A 2XAJB 3O1HA 3C50A 4O4JE 3PDYA 3C98B 2E9XC 2IIUA 1OEDA 5AQUB 1WLXA 3MKDA 4DR4T 3UT5E 2N1GA 4PK5A 2KZ7B 2V7KA 3FZHB 4YLHA 3FZMB 2X51A 4H9NC 2FJDA 4HWCA 3AB3B 4DR1T 3FBLA 3FBZA 1S35A 3FXDB 2UUCT 5AQTB 1IAPA 5AQHB 5L47A 3JADA 1US7B 2LSGA 2JJ9A 3P4QA 4NUUA 2J62A 2LRLA 3RPUA 3KDSE 3EDUA 2X0YA 5LJMA 3ZEFB 4JI3T 3AE3A 3ZJ1A 2PJQA 4HKAA 4C90A 2KNDA 4KHPT 2WB5A 2UUAT 4LFBT 3JCFA 5DABA 3ZMSB 2CBIA 3F31A 4IGUA 3ZYMA 4LMJA 1FEWA 2XAHB 5AQNB 2WAUA 3CX7B 4O2AE 3VR8A 3E08A 5HXCA 5HEHA 4HFCA 2JPFA 1W0AA 4NUVA 4LF6T 3OYXA 3A5XA 3UUBA 4FJOA 3CIRA 3TLWA 4I55E 1O3XA 5LGUB 1YKHB 4PW8A 4KP3C 4IDQA 3AE2A 1IJ6A 3AE1A 2WWVA 1QLBA 2XASB 3UQ4A 2KT9A 2QA7A 3QUJA 2C5KT 3AEGA 1B7TA 1NWMX 4HFBA 4JI0T 3ESLA 1NAFA 2LSYA 3AEFA 4AQFC 4ADZA 1KNPA 3MJXA 3GA8A 5JDQA 1CUNA 1N33T 1FMVA 4IDOA 3P4RA 5L2LA 1D0XA 4GK0E 4DBQA 4P09A 4UIGA 4QXHB 5L3EB 2LHNA 1ZHCA 4LF9T 5HEOA 3AXJB 4DR5T 4DV1T 2FJAA 2WDVA 3AVRA 3OPCA 2YKSA 3RIAA 2WBLA 1WYCA 2W2UA 3U78A 4CQIA 4WBNE 3RIUC 1VCTA 2Y8DA 5KDMC 4UVAB 3N9QA 4I0UA 3UUMA 3SS1A 5C2TA 4B3TT 2W67A 5ABEA 4CXWA 1I94T 1IZNB 4QXBB 2JMKA 4U74A 3ABVA 2IDOB 5FXZA 2E9XB 3L8RA 3GWHA 4DMWA 3IA3A 2E5LT 5HXSA 1H7CA 1EZ3A 3JAFA 4QWNB 3AE8A 3NBXX 5HWXA 2LKHA 2VWAA 2UUBT 5ABGA 1LRZA 3BQIA 2E8IA 2LT3A 5HXRA 4YSZA 5AQFB 2X0HA 3P7IA 2SPCA 2ZM6T 3ZC1A 3ZCJA 2W62A 4OK0A 4H9OC 3O1JA 2DL1A 1J5ET 2A72A 3OVUA 3KVAA 1HTJF 1MIVA 4IDZA 4OYJA 4GYRA 1G8XA 3AXJA 1VRBA 3AAEB 2XQ6A 3I0QA 3PUSA 3K3OA 3VKGA 2CLYC 4COFA 3VKHA 3GN5B 2LM2A 2CE7A 3AEEA 4YHJA 3SFEA 3T8OA 2N2NA 5LOVE 3OYZA 3OTOT 3AVSA 2LSKA 3U3IA 4C91A 1YW0A 1UX4A 2E9XA 3PJAJ 4ISSA 1D1CA 4B3MT 2MAWA 4AKRB 2K5BB 2FJBA 3HKEE 4Z90A 4GYSA 4EXTA 3C64A 4WBOA 2LOPA 3UUNA 2VKOA 1HG2A 3K1SA 1KEYA 3RLFF 3GMIA 5KXJA 2CXDA 3CPZA 4DR7T 5ABHA 1T98A 4KUMB 4ZOLE 3SOLA 3EVYA 2XPKA 3UU3A 3O1IA 1WR0A 4PJNA 1Z8UA 1HCIA 2QVAA 3GN5A 1JNZA 2VL8A 3LK42 3C51A 1DU2A 1X9BA 2K3WA 3AAIA 4HGAA 1WFDA 1YQ3A 2NTYA 4MFRA 1FJGT 3HKCE 4CN6A 2OV9A 4DV4T 5IYZE 4U33A 2WY2A 4IE4A 2VKHA 2XAFB 4IIJE 2KSRA 3QNUA 4WW0A 4P0AA 3NKZA 1T72A 3Q5WA 4HWIB 5C3JA 1HR0T 2I6HA 5HEUA 5HYAA 3IEEA 4DV3T 3WAKA 2WP9A 5E0OA 2HHHT 3C4ZA 3EHZA 3BQLA 4KHZF 2WDQA 5J2TE 1UURA 4MALA 1HX1B 2JRKA 2W00A 1D1AA 3ZT5A 1UX5A 1XDOA 2E9XD 4FI5A 5CA0E 3CKDA 2EHOC 5J0ZA 5FVLA 2OLTA 3HKDE 5JDFA 2JQHA 4QH1A 1IBKT 4YTPA 4DO0A 2CMRA 1GQEA 4I50E 2VQFT 2E5VA 1N36T 1Z0PA 2NOXA 3RHWA 5LHIB 1QSDA 4JI7T 2X9WA 4DBRA 2M6BA 2UXBT 1OEDE 3QOFA 4M1PA 4UXNB 3PUXF 1MMNA 5HWYA 2DNXA 1JNRA 4QX8B 4DR2T 3RIUA 5J1GA 4H9QC 3TLTA 2LM9A 2ES0A 2VVSA 5LMUT 3ZYKA 3OBVE 4HFIA 3NVOA 4GKJT 5LBQB 3SRZA 4ERRA 3IHRA 1SA0E 1HX8A 4IT4A 2CPTA 3E22E 3AA1B 2RPAA 3KV9A 5FXWA 4PJJA 2FJEA 4YT0A 5LG4A 4AQGA 5IHYA 2CHNA 5HCMA 4GKKT 3CQXC 4TNVA 5LCYA 4IDNA 4LMKA 5ABFB 2WQYA 4EEDA 3ZT7A 2CHOA 3S4UA 3PUWF 3T1HT 3ZMVB 3WAJA 3D0TA 2K48A 1XZYA 2HPLA 2KXPB 4DNDA 4U2ZA 4H9RC 4PK6A 1IBLT 2GK9A 3AE4A 1J5WA 1XWMA 4U31A 4ZZCA 4ILAA 2KMFA 4CN4A 4OHFA 3B13A 3AE9A 5HEGA 2IUBA 2NR4A 1XDPA 2BVMA 4ZI2D 2ZM2A 2D5UA 4L9IA 4CI1B 3SWHA 2NW8A 3NRYA 5LXTE 4DR3T 2YK0A 3PE0A 2VKDA 2PFVA 2D2SA 2BBJA 2Q9QC 2BS4A 4JI8T 5DQVA 4CXYA 3ONLC 3T1YT 2F4VT 2CWYA 2BKPA 2ACZA 2LE8A 2XJ7A 5ABFA 5HXHA 4DV5T 2IHR1 3CMLA 1NEKA 2BS2A 2WMOA 2E2AA 4UF0B 5L4HA 1N34T 2ZM8A 5KX5E 2J4GA 2MYSA 1UK5A 3UFEA 4HFHA 5LBMA 4IL9A 3RC8A 4UVCB 4X64T 5HCJA 3ZSTA 2W63A 3VRBA 2X9HA 4JEUB 3KFWX 2V7JA 2V7LA 3ZLIA 5TAOA 1Y64B 1HNZT 2EHOB 2H7VC 1BR4A 4DVDA 1LVFA 4H63V 4TWFA 3F2EA 5DQWA 5AQGB 3AA6B 4ZS2A 4YFSA 4X65T 3H3MA 4Z91A 2PTFA 3P8CD 1X79A 2VKJA 4G63A 2V5DA 2QYWA 3Q9DA 2BG9C 3PUAA 2H88A 4ISTA 3ZMUB 4OFZA 5FL1A 4UF0A 1XNRT 3DJBA 4EGWA 4ZZBA 3QC9A 2V8SV 2WZHA 4TV8E 4NIQA 2NWBA 3UUXB 4LF8T 2CXFA 3RRCA 5JDGA 1BR1A 4AIUA 3AEDA 4BJNA 4B6XA 3EAMA 3AAAB 1LKXA 2D0UA 5IUXA 4B3RT 2KLQA 1ZV4X 2W0GA 5HEJA 2EHOA 1XMQT 5LHHB 3N9PA 3UU8A 4AI6A 4CN1A 2W66A 2VASA 1WRDA 2JQ9A 4K0KT 4JI1T 1XMOT 5FNVE 3MZKB 1T7SA 4YXDA 1M7KA 3RGLA 2WSSV 5JDHA 1HS7A 2VL0A 3AA7B 3KBTA 5JR9C 4ZXLA 4HE8A 4KMCA 4ILBA 5JREA 3C4WA 4MHCA 3DTOA 3UULA 5F3JA 2QRXA 1KFYA 5FXVA 3AA0B 4KBMB 2XSAA 4EAHA 1YQ4A 3VR9A 2JIWA 2BVLA 2LKGA 2Q9QB 3J7Yq 3TKLB 2XM1A 4Q25A 4JLEA 4IE7A 3KBUA 1VOMA 5FL0A 4IREA 3TLUA 2VK9A 3UTKA 4TUYE 4X1IE 4GIWA 4JV5T 4EZ4A 2NW9A 3QB5K 4HEAA 2IMLA 3H37A 1ZP0A 3PU8A 4H63H 1MMDA 4IE6A 1OWAA 2NW7A 4G2AA 3EUHA 3K3NA 2Z6EA 3M65A 4N78D 4UR9A 4ZS3A 3RH3A 3G06A 4E7SA 1D0YA 3N2OA 1I6ZA 2XY8B 3ZT6A 5L3BB 4XAXB 2LRKA 4ILUA 3IBPA 2Y6XA 5HAXA 2L9QA 4GOUA 1NENA 1W09A 4X5TA 2EHOD 4AQYT 5EK2A 2Q9QA 3AEBA 3ZN1B 1YXRA 1D1BA 3ZSSA 3N2KE 4TX5A 4WYVA 1CHUA 1L0VA 3N2GE 4EB6E 2X9YA 2WMNA 5JQGE 2LSJA 3UQ7A 2LJLA 5L3FB 4BJMA 2BG9B 2BG9E 5AQMB 2BKOA 3F57A 4ZI3C 3A8YC 2CA5A 4LFCT 1W9RA 1WR6A 5J2UE 3ZN0B 4DIDB 2C5JA 3ZPOA 2P9BA 1OXZA 2C5IT 3LG7A 2M6IA 4UELA 3E0ZA 5M4YA 3LK2B 4JBWF 2CCQA 3BK9A 3EI0A 4HWHA 1G73A 2XQ8A 3KV6A 5FP3A 3ETUA 2K9AA 1YD8G 1ZEEA 4KI0F 1LVKA 3OKQA 3RC3A 1SUMB 1SHZC 4QXCB 3RX6A 4O2BE 4I43B 4OYKA 1KK7A 4YTMA 1KNZA 5LNKA 4DMVA 4QH5A 4F6RC 3RYFE 2X0LB 2B76A 4U3CA 2WDRA 5JVDE 3N5LA 3PU3A 2G0UA 3FB2A 1ZOYA 3A7MA 4QX7B 4AQFA 3RQWA 5DJQC 4PFOA 5AQVB 4EIWA 4LF7T 4DR6T 2BG9A 3I9YA 5BR8T 3WI3A 5LA6E 2LEHA 4PK4A 2DI4A 3CQCB
chains in the Genus database with same CATH topology
2J1DG 1D0XA 2ZM2A 4GK0E 2D5UA 4DBQA 4AKIA 2X68A 2XTLA 4P09A 2YU2A 4L9IA 5JR9B 4UVBB 2N9DA 3SWHA 4CI1B 4UIGA 4I4TE 2NW8A 4TV9E 3NRYA 2HH7A 3K3QC 4QXHB 4AKGA 2K24A 5LXTE 2ODVA 5L3EB 3NRXA 2LHNA 1ZHCA 2YK0A 2VKDA 3PE0A 2PFVA 3LBXB 3ETVA 2D2SA 3VU7H 2Q9QC 1BR0A 5DQVA 4WNKA 2CM0A 4CXYA 4BA9A 3AVRA 5AFUL 2CWYA 5JRCA 2RA1A 2WBLA 5LJNA 1WYCA 3U78A 4CQIA 4WBNE 4GK5E 2LE8A 2A3DA 2Y8DA 1MIWA 4UVAB 2ZMAA 3LFMA 5KDMC 2JQQA 5HXHA 2DLRA 3N9QA 2BDEA 2Q9QD 3SS1A 3UUMA 2L8KA 2C0SA 3CMLA 4CXWA 5FY7A 2CLYB 2V1DB 2WMOA 2NP9A 2BZBA 1IZNB 2MOZA 4QXBB 2JMKA 3CWZB 4U74A 4UF0B 1QUUA 4CI2B 2I59A 5FYMA 2DWGA 5LGNB 2WWUA 2ZM8A 5FXZA 5KX5E 2E9XB 2MYSA 3GWHA 1IJ5A 3MA9A 4DMWA 3UFEA 3CX6B 4EZHA 5HXSA 1H7CA 1EZ3A 2X66A 5LBMA 3N9NA 4QWNB 4PFPA 2HPJA 3RC8A 2LOSA 5JDMA 3NBXX 5HWXA 4UVCB 5EK3A 2VWAA 5H6QB 2W63A 1LRZA 1MMGA 3BQIA 2E8IA 2LT3A 5GONE 3K8PC 5HXRA 3P7IA 2SPCA 3ZC1A 3ZCJA 4TZ4C 4UEMA 1BR2A 3H3AA 2X9HA 2KWIB 2W62A 4AXPA 1MIYA 4JEUB 3KFWX 2ODUA 2V7JA 2V7LA 3ZLIA 4OK0A 5TAOA 1Y64B 4H9OC 2EHOB 3O1JA 2DCFA 5JR9A 2H7VC 1BR4A 4DVDA 1LVFA 4H63V 2A72A 4BAYB 3KVAA 3DP7A 3F2EA 1HTJF 4ASKA 5HXEA 1MIVA 5DQWA 1HF8A 4IDZA 3LBXA 4L5GA 4OYJA 3AA6B 1MNEA 4GYRA 1G8XA 4ZS2A 2WM9A 3VHLA 4YFSA 1VRBA 3HI2A 3FXEB 3CX8B 5EK4A 3MK7C 3AAEB 3BQKA 2V26A 3I0QA 3P8CD 5L3CB 3PUSA 3RRWA 4ZHQE 1X79A 3K3OA 3ONXA 2VKJA 3VKGA 4E7ZA 4G63A 4H9PC 2CLYC 2LHRA 3Q9DA 3O9XA 3VKHA 3GN5B 2CE7A 3PUAA 4YHJA 3N9MA 4ISTA 3ZMUB 5FMNA 1HG5A 2YINA 4OFZA 4J2CA 2YEVC 3V5SA 2XQYA 2V7MA 3T8OA 1U4QA 4IE0A 2N2NA 5LOVE 2A2FX 3OYZA 4UF0A 5LHGB 3QK6A 5BMVE 2XUEA 3DJBA 3AVSA 4MLKA 2LSKA 4L0RA 3U3IA 4C91A 5CA1E 3QC9A 2X67A 1YW0A 1UX4A 4YJ3E 3Q5XA 4CXXA 2E9XA 4TV8E 4ISSA 1D1CA 2NWBA 3UUXB 3R6NA 2CXFA 3RRCA 3Q2MA 2MBGA 5JDGA 1BR1A 4YJ2E 3HR0A 2JMHA 4AKRB 2KWHA 2K5BB 4EYUA 3HA4A 2ZM0A 3HKEE 5CB4E 1UCUA 3JC6C 4O4IE 5LP6E 4MBQA 4HTEA 4BJNA 5F8PA 4B6XA 4X1KE 3AAAB 1LKXA 3OJAA 4GYSA 3RKOA 4EXTA 1HFAA 2D0UA 1D0ZA 1MNDA 2LOPA 2Y48B 3C64A 2KLQA 1ZV4X 3KV4A 4WBOA 2VKOA 2W0GA 3UUNA 4XBFB 2EHOA 2IW5B 5FXXA 1HG2A 3PTRB 3GMIA 3PUQA 4TN7B 3L09A 3LK3B 4EOZB 3JC6D 2CXLA 2CXDA 5LHHB 4X1YE 3N9PA 4AI6A 3CPZA 3HL6A 1T98A 4KUMB 4ZOLE 2VASA 3SOLA 1WRDA 4U72A 4QHOA 3EVYA 3O1IA 3C4XA 3KVBA 3NZPA 3FHNA 5L3GB 4X20E 4PJNA 3CQGB 4O8SA 3MACA 1HCIA 4A56A 2D0TA 5FNVE 3MZKB 3GN5A 2RP4A 4CZZB 4H9SE 2ACXA 3ZC0A 2WSSV 5JDHA 2VL8A 3LK42 3C51A 1HS7A 3AAIA 3RYIE 2CWOA 4HGAA 2NTYA 3AA7B 2PBIA 3KBTA 4MFRA 5JR9C 3HKCE 5EZYE 4ANJA 4QKNA 3ANWB 2KINB 4HE8A 4KMCA 4PNIA 5IYZE 5C8YE 5JDLA 5JREA 3C4WA 4MHCA 3DTOA 3UULA 5F3JA 2H3RA 3PURA 4IE4A 5FXVA 2VKHA 3AA0B 3ZCIA 4KBMB 2XAFB 4IIJE 1AJ3A 3RYCE 4EAHA 3I0OA 2ZLYA 4WW0A 2UXNB 2YU1A 2BVLA 4P0AA 2Q9QB 3J7Yq 5FY1A 4AKLA 3Q5WA 3L3PA 4PJMA 3TKLB 2V7IA 4JLEA 4O4LE 4IE7A 3KBUA 4HN9A 2B1EA 2LSIA 2M67A 1VOMA 4CI3B 2L3LA 4JEHB 2OA5A 4PAGA 1FMWA 2VK9A 5HYAA 2H7OA 2XHEB 2X9XA 3UTKA 2PG8A 2XAJB 3O1HA 3C50A 3IEEA 4O4JE 4TUYE 3PDYA 4X1IE 3WAKA 3RYHE 2UXXB 4ZI7E 2XAGB 4GIWA 3C98B 2NW9A 4UV8B 4EZ4A 5E0OA 1ZKEA 2E9XC 2DWKA 3C4ZA 3ZYLA 4HEAA 1WLXA 3MKDA 4ZI2C 3UT5E 4P0BA 5LGTB 3H37A 2N1GA 4PK5A 3BQLA 3PU8A 2NTXA 4H63H 1MMDA 1FIOA 2KZ7B 5J2TE 4IE6A 4K0UA 1OWAA 4MALA 2NW7A 1MMAA 4G2AA 2DHRA 2V7KA 3N9LA 5ETWA 3EDVA 2JRKA 2W00A 4UV9B 1D1AA 4YLHA 4Z8XA 3EUHA 3K3NA 2Z6EA 3M65A 1UX5A 4N78D 3I1AA 2E9XD 2X51A 4FI5A 4ZS3A 5CA0E 3CKDA 3B57A 4H9NC 3RH3A 3ZMZB 4EYYR 4E7SA 2EHOC 3AB3B 1D0YA 3N2OA 3FBLA 3ANWA 2XAQB 3HKDE 5LYJE 5JDFA 5L3BB 2MTQA 3FBZA 1S35A 4XAXB 4DO0A 3FXDB 4ILUA 3IBPA 2CMRA 2Y6XA 1IAPA 5HAXA 4PJLA 2L9QA 4V1Av 4GOUA 4I50E 3IF8B 3R84B 3I9WA 4JUYA 3O4XE 1Z0PA 2NOXA 1US7B 2JJ9A 1QSDA 2EHOD 2LSGA 3V5UA 5LHIB 5EK2A 2X9WA 4NUUA 1S94A 4DBRA 2Q9QA 3ZN1B 3RPUA 4AKHA 1D1BA 3KDSE 3EDUA 1U5PA 4M1PA 3N2KE 4TX5A 4UXNB 3J9X1 3W15B 5LJMA 3ZEFB 3HKBE 5H6RB 1MMNA 5JH7E 5HWYA 5ADXL 2DNXA 3N2GE 4QX8B 4EB6E 2IAKA 2X9YA 3ZJ1A 2WMNA 2LSJA 5JQGE 2LJLA 5J1GA 4H9QC 5L3FB 2LM9A 4BJMA 2ES0A 2PJQA 2QGSA 4HKAA 4C90A 2KNDA 3ZYKA 3OBVE 5DABA 5LBQB 3SRZA 3F57A 4ERRA 3IHRA 1SA0E 4ZI3C 3ZMSB 1E1HB 3F31A 3ZJ2A 2CA5A 4IGUA 1HX8A 3ZYMA 1WR6A 1FEWA 3MXZA 5A1LA 5J2UE 3ZN0B 2XAHB 2IC6A 2C5JA 3E22E 3ZPOA 3AA1B 2WAUA 2P9BA 1OXZA 3CX7B 2C5IT 4IHJE 3LG7A 4IE5A 4O2AE 5L3DB 3E08A 4O4HE 4UELA 3KV9A 3E0ZA 5FXWA 4PJJA 5HXCA 5M4YA 3LK2B 4ZI3D 2CEAA 2CCQA 3BK9A 2JPFA 1G73A 4NUVA 3KV6A 5FP3A 3ETUA 2K9AA 5LG4A 5JRCB 4AQGA 3OYXA 3A5XA 5IHYA 1YD8G 4FJOA 1ZEEA 3CQXC 5LCYA 3NZQA 1LVKA 3OKQA 4I55E 1O3XA 1YKHB 3RC3A 5LGUB 1SHZC 4PW8A 4QXCB 4KP3C 4XZCA 3RX6A 4O2BE 2VB6A 1IJ6A 3S4UA 3ZMVB 2XASB 4I43B 4OYKA 1KK7A 2KT9A 5KMGP 3WAJA 1WYBA 3KV5A 1KNZA 3D0TA 2QA7A 2K48A 2HPLA 2KXPB 3QUJA 5LNKA 4DNDA 3KINB 2C5KT 4DMVA 4F6RC 3CVRA 4H9RC 4PK6A 3RYFE 2X0LB 1B7TA 1NWMX 5FY0A 3ESLA 1NAFA 2LSYA 4AQFC 5JVDE 4ADZA 3N5LA 3PU3A 3ZMTB 2G0UA 3FB2A 2GK9A 3LJCA 5JDNA 3MJXA 4QX7B 3GA8A 4AQFA 5JDQA 1YKEB 2KMFA 1CUNA 1V9DA 4OHFA 3B13A 3PUGA 4PFOA 5DJQC 4EIWA 3I9YA 1FMVA 3WI3A 5LA6E 3N9OA 2LEHA 4HFVA 4PK4A 2IC9A 2W61A 2BVMA 4ZI2D 2DI4A 3CQCB 5L2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS V;  2CLY C; 
#chains in the Genus database with same CATH topology
 2J1D G;  1KF6 A;  2X68 A;  3P4P A;  2YU2 A;  5JR9 B;  5LMN T;  2N9D A;  4TV9 E;  4AKG A;  2K24 A;  1N32 T;  3NRX A;  4LF5 T;  3ETV A;  4P1N A;  3VU7 H;  5F5W A;  1BR0 A;  2CM0 A;  2XQA A;  2A3D A;  1MIW A;  3EAB A;  4DUY T;  2BDE A;  2Q9Q D;  2YOE A;  1R8I A;  2C0S A;  2FBW A;  3B5M A;  2CLY B;  1J1J A;  4YTN A;  2BZB A;  2MOZ A;  4DV2 T;  1QUU A;  1M62 A;  4CI2 B;  5FYM A;  2DWG A;  5L4E A;  2CBJ A;  3CX6 B;  4EZH A;  2AE9 A;  5EK3 A;  4U2Y A;  4NPP A;  4TWD A;  1MMG A;  2XZE A;  3Q5E A;  4TZ4 C;  4UEM A;  1BR2 A;  3H3A A;  2KWI B;  2DCF A;  5JR9 A;  4HWD A;  4F8H A;  3DP7 A;  5HXE A;  4WZX A;  4LML A;  3VHL A;  1MNE A;  4NXM T;  3HI2 A;  3FXE B;  3CX8 B;  5JTG A;  5L3C B;  3L39 A;  3ONX A;  4E7Z A;  4H9P C;  2LHR A;  3PUY F;  4DV7 T;  3N9M A;  5FMN A;  5CGM A;  3V5S A;  3PV0 F;  2V7M A;  1U4Q A;  5AQJ B;  5LHG B;  4AIS A;  2XUE A;  2UU9 T;  2X67 A;  4CXX A;  4YJ3 E;  3Q5X A;  3P50 A;  3FZL B;  3R6N A;  2W4X A;  2MBG A;  3HR0 A;  2WCA A;  4EYU A;  3HA4 A;  3JC6 C;  4O4I E;  4MBQ A;  4HTE A;  4X1K E;  3RKO A;  1T8B A;  1HFA A;  3KV4 A;  3ZMZ B;  1MND A;  2Y48 B;  2IW5 B;  4A97 A;  3TLV A;  4ZEY A;  4HWF A;  4TN7 B;  3L09 A;  4EOZ B;  3HL6 A;  2BS3 A;  3C4X A;  3KVB A;  2D9D A;  3CK6 A;  3AE7 A;  1W0B A;  3P4S A;  4CZZ B;  4H9S E;  2ACX A;  3ZC0 A;  3X1D A;  2CWO A;  5AQS B;  3ANW B;  2KIN B;  4PNI A;  5C8Y E;  4JI2 T;  2H3R A;  3PUR A;  1IBM T;  2WS3 A;  3ZCI A;  1AJ3 A;  3RYC E;  3I0O A;  3FZK B;  3P4W A;  4KX6 A;  2UXN B;  2YU1 A;  2UXD T;  4OX9 T;  4IL4 A;  4AKL A;  4IDP A;  4PJM A;  3L3P A;  4LF4 T;  2MPK A;  4DV0 T;  2V7I A;  4O4L E;  2B1E A;  2LSI A;  4HFE A;  2M67 A;  3AEC A;  4YSY A;  4EV6 A;  2OA5 A;  2H7O A;  2XQ3 A;  3RQU A;  2XHE B;  2X9X A;  2XQ7 A;  3RYH E;  2UXX B;  4ZI7 E;  2XAG B;  4UV8 B;  4ILC A;  1ZKE A;  2DWK A;  3ZYL A;  4ZI2 C;  5LGT B;  4P0B A;  2NTX A;  1FIO A;  5AQK B;  4K0U A;  2R6G F;  1MMA A;  5ETW A;  2DHR A;  3N9L A;  3TLS A;  3EDV A;  4UV9 B;  3RKG A;  4Z8X A;  2UXC T;  3I1A A;  3B57 A;  4EYY R;  3ANW A;  2XAQ B;  5LYJ E;  2MTQ A;  5AQR B;  2YN6 A;  4PJL A;  2VVN A;  4V1A v;  3R84 B;  3IF8 B;  3I9W A;  4JUY A;  3O4X E;  1E7P A;  3UU5 A;  3V5U A;  1S94 A;  4B3S T;  4AKH A;  1U5P A;  3J9X 1;  3W15 B;  5JH7 E;  3HKB E;  5H6R B;  2AXD S;  5ADX L;  5IWA T;  2IAK A;  3PJA A;  3UFG A;  3LDQ B;  3AE6 A;  2QGS A;  2V6Y B;  4QH4 A;  3QB5 A;  1E1H B;  3ZJ2 A;  3VRA A;  3MXZ A;  5A1L A;  2IC6 A;  4U7Y A;  5CJ5 A;  4DV6 T;  4IHJ E;  4IE5 A;  5L3D B;  4O4H E;  2LLY A;  4ZI3 D;  2CEA A;  5JRC B;  1E2A A;  3NZQ A;  4XZC A;  5CFB A;  2VB6 A;  1UUS A;  5KMG P;  1WYB A;  1OED C;  3KV5 A;  4LFA T;  4TWH A;  3KIN B;  5AQQ B;  3CVR A;  2V5C A;  1UGO A;  5FY0 A;  4JI5 T;  3ZMT B;  3LJC A;  5JDN A;  1YKE B;  1V9D A;  3PUG A;  2YDQ A;  2V6Y A;  1Y01 A;  3N9O A;  4HFV A;  2IC9 A;  2W61 A;  2J47 A;  4AKI A;  2XTL A;  3RI5 A;  5AQO B;  4UVB B;  2A9U A;  4I4T E;  4X62 T;  2HH7 A;  3K3Q C;  3PUZ F;  2ODV A;  2H89 A;  3LBX B;  5AQP B;  4WNK A;  5LG3 A;  4JI6 T;  5FKY A;  4BA9 A;  5AFU L;  5JRC A;  2RA1 A;  5LJN A;  4GK5 E;  3RIF A;  1VCS A;  2ZMA A;  3LFM A;  2JQQ A;  2DLR A;  4EEB A;  2WZI A;  4U7I A;  2L8K A;  5FY7 A;  2V1D B;  2NP9 A;  3JAE A;  2WU2 A;  2XQ4 A;  3CWZ B;  1WCR A;  1HNW T;  5LGN B;  2I59 A;  3Q5D A;  2WWU A;  4DUZ T;  4HFD A;  1IJ5 A;  3MA9 A;  2X66 A;  3N9N A;  4PFP A;  2HPJ A;  2LOS A;  5JDM A;  2I0M A;  5H6Q B;  3UU4 A;  2V6X A;  3M3Z B;  2BKN A;  3K8P C;  5GON E;  3RF1 A;  4AXP A;  1MIY A;  2HN1 A;  2ODU A;  2BBH A;  3AE5 A;  4BAY B;  4ASK A;  4TNW A;  1HF8 A;  4A5X A;  3LBX A;  4L5G A;  2WM9 A;  1KNR A;  5EK4 A;  3MK7 C;  3BQK A;  2V26 A;  3RRW A;  4ZHQ E;  3AEA A;  2WU5 A;  4YSX A;  3O9X A;  1HG5 A;  2YIN A;  4J2C A;  2YEV C;  2XQY A;  4IE0 A;  2A2F X;  4NXN T;  3QK6 A;  5BMV E;  5AQI B;  4MLK A;  4L0R A;  2XQ9 A;  5CA1 E;  2XM2 A;  3ZKR A;  3Q2M A;  3UU6 A;  4YJ2 E;  2JMH A;  2KWH A;  2ZM0 A;  5CB4 E;  1UCU A;  5LP6 E;  3NWI A;  5F8P A;  1HNX T;  3OJA A;  1D0Z A;  4XBF B;  5FXX A;  3PTR B;  3LSV A;  4YHH T;  3PUQ A;  3LK3 B;  3JC6 D;  2CXL A;  2YDS A;  4X1Y E;  3ONJ A;  2JQK A;  4U72 A;  4QHO A;  1OED B;  2XSB A;  3NZP A;  3FHN A;  5L3G B;  4X20 E;  3CQG B;  4O8S A;  2CRB A;  3MAC A;  3PUV F;  3SFD A;  4A56 A;  2FUP A;  2D0T A;  1SE7 A;  5LB7 B;  2RP4 A;  3RYI E;  2PBI A;  5EZY E;  4ANJ A;  2VUR A;  4QKN A;  3FZF B;  5JDL A;  4X66 T;  4JI4 T;  4A98 A;  2ZLY A;  5AQL B;  1XNQ T;  4JYA T;  5FY1 A;  5FVK A;  2XQ5 A;  4YY3 T;  2VQE T;  4HN9 A;  4CI3 B;  2L3L A;  2YDR A;  4JEH B;  4PAG A;  1FMW A;  2HN2 A;  2PG8 A;  2XAJ B;  3O1H A;  3C50 A;  4O4J E;  3PDY A;  3C98 B;  2E9X C;  2IIU A;  1OED A;  5AQU B;  1WLX A;  3MKD A;  4DR4 T;  3UT5 E;  2N1G A;  4PK5 A;  2KZ7 B;  2V7K A;  3FZH B;  4YLH A;  3FZM B;  2X51 A;  4H9N C;  2FJD A;  4HWC A;  3AB3 B;  4DR1 T;  3FBL A;  3FBZ A;  1S35 A;  3FXD B;  2UUC T;  5AQT B;  1IAP A;  5AQH B;  5L47 A;  3JAD A;  1US7 B;  2LSG A;  2JJ9 A;  3P4Q A;  4NUU A;  2J62 A;  2LRL A;  3RPU A;  3KDS E;  3EDU A;  2X0Y A;  5LJM A;  3ZEF B;  4JI3 T;  3AE3 A;  3ZJ1 A;  2PJQ A;  4HKA A;  4C90 A;  2KND A;  4KHP T;  2WB5 A;  2UUA T;  4LFB T;  3JCF A;  5DAB A;  3ZMS B;  2CBI A;  3F31 A;  4IGU A;  3ZYM A;  4LMJ A;  1FEW A;  2XAH B;  5AQN B;  2WAU A;  3CX7 B;  4O2A E;  3VR8 A;  3E08 A;  5HXC A;  5HEH A;  4HFC A;  2JPF A;  1W0A A;  4NUV A;  4LF6 T;  3OYX A;  3A5X A;  3UUB A;  4FJO A;  3CIR A;  3TLW A;  4I55 E;  1O3X A;  5LGU B;  1YKH B;  4PW8 A;  4KP3 C;  4IDQ A;  3AE2 A;  1IJ6 A;  3AE1 A;  2WWV A;  1QLB A;  2XAS B;  3UQ4 A;  2KT9 A;  2QA7 A;  3QUJ A;  2C5K T;  3AEG A;  1B7T A;  1NWM X;  4HFB A;  4JI0 T;  3ESL A;  1NAF A;  2LSY A;  3AEF A;  4AQF C;  4ADZ A;  1KNP A;  3MJX A;  3GA8 A;  5JDQ A;  1CUN A;  1N33 T;  1FMV A;  4IDO A;  3P4R A;  5L2L A;  1D0X A;  4GK0 E;  4DBQ A;  4P09 A;  4UIG A;  4QXH B;  5L3E B;  2LHN A;  1ZHC A;  4LF9 T;  5HEO A;  3AXJ B;  4DR5 T;  4DV1 T;  2FJA A;  2WDV A;  3AVR A;  3OPC A;  2YKS A;  3RIA A;  2WBL A;  1WYC A;  2W2U A;  3U78 A;  4CQI A;  4WBN E;  3RIU C;  1VCT A;  2Y8D A;  5KDM C;  4UVA B;  3N9Q A;  4I0U A;  3UUM A;  3SS1 A;  5C2T A;  4B3T T;  2W67 A;  5ABE A;  4CXW A;  1I94 T;  1IZN B;  4QXB B;  2JMK A;  4U74 A;  3ABV A;  2IDO B;  5FXZ A;  2E9X B;  3L8R A;  3GWH A;  4DMW A;  3IA3 A;  2E5L T;  5HXS A;  1H7C A;  1EZ3 A;  3JAF A;  4QWN B;  3AE8 A;  3NBX X;  5HWX A;  2LKH A;  2VWA A;  2UUB T;  5ABG A;  1LRZ A;  3BQI A;  2E8I A;  2LT3 A;  5HXR A;  4YSZ A;  5AQF B;  2X0H A;  3P7I A;  2SPC A;  2ZM6 T;  3ZC1 A;  3ZCJ A;  2W62 A;  4OK0 A;  4H9O C;  3O1J A;  2DL1 A;  1J5E T;  2A72 A;  3OVU A;  3KVA A;  1HTJ F;  1MIV A;  4IDZ A;  4OYJ A;  4GYR A;  1G8X A;  3AXJ A;  1VRB A;  3AAE B;  2XQ6 A;  3I0Q A;  3PUS A;  3K3O A;  3VKG A;  2CLY C;  4COF A;  3VKH A;  3GN5 B;  2LM2 A;  2CE7 A;  3AEE A;  4YHJ A;  3SFE A;  3T8O A;  2N2N A;  5LOV E;  3OYZ A;  3OTO T;  3AVS A;  2LSK A;  3U3I A;  4C91 A;  1YW0 A;  1UX4 A;  2E9X A;  3PJA J;  4ISS A;  1D1C A;  4B3M T;  2MAW A;  4AKR B;  2K5B B;  2FJB A;  3HKE E;  4Z90 A;  4GYS A;  4EXT A;  3C64 A;  4WBO A;  2LOP A;  3UUN A;  2VKO A;  1HG2 A;  3K1S A;  1KEY A;  3RLF F;  3GMI A;  5KXJ A;  2CXD A;  3CPZ A;  4DR7 T;  5ABH A;  1T98 A;  4KUM B;  4ZOL E;  3SOL A;  3EVY A;  2XPK A;  3UU3 A;  3O1I A;  1WR0 A;  4PJN A;  1Z8U A;  1HCI A;  2QVA A;  3GN5 A;  1JNZ A;  2VL8 A;  3LK4 2;  3C51 A;  1DU2 A;  1X9B A;  2K3W A;  3AAI A;  4HGA A;  1WFD A;  1YQ3 A;  2NTY A;  4MFR A;  1FJG T;  3HKC E;  4CN6 A;  2OV9 A;  4DV4 T;  5IYZ E;  4U33 A;  2WY2 A;  4IE4 A;  2VKH A;  2XAF B;  4IIJ E;  2KSR A;  3QNU A;  4WW0 A;  4P0A A;  3NKZ A;  1T72 A;  3Q5W A;  4HWI B;  5C3J A;  1HR0 T;  2I6H A;  5HEU A;  5HYA A;  3IEE A;  4DV3 T;  3WAK A;  2WP9 A;  5E0O A;  2HHH T;  3C4Z A;  3EHZ A;  3BQL A;  4KHZ F;  2WDQ A;  5J2T E;  1UUR A;  4MAL A;  1HX1 B;  2JRK A;  2W00 A;  1D1A A;  3ZT5 A;  1UX5 A;  1XDO A;  2E9X D;  4FI5 A;  5CA0 E;  3CKD A;  2EHO C;  5J0Z A;  5FVL A;  2OLT A;  3HKD E;  5JDF A;  2JQH A;  4QH1 A;  1IBK T;  4YTP A;  4DO0 A;  2CMR A;  1GQE A;  4I50 E;  2VQF T;  2E5V A;  1N36 T;  1Z0P A;  2NOX A;  3RHW A;  5LHI B;  1QSD A;  4JI7 T;  2X9W A;  4DBR A;  2M6B A;  2UXB T;  1OED E;  3QOF A;  4M1P A;  4UXN B;  3PUX F;  1MMN A;  5HWY A;  2DNX A;  1JNR A;  4QX8 B;  4DR2 T;  3RIU A;  5J1G A;  4H9Q C;  3TLT A;  2LM9 A;  2ES0 A;  2VVS A;  5LMU T;  3ZYK A;  3OBV E;  4HFI A;  3NVO A;  4GKJ T;  5LBQ B;  3SRZ A;  4ERR A;  3IHR A;  1SA0 E;  1HX8 A;  4IT4 A;  2CPT A;  3E22 E;  3AA1 B;  2RPA A;  3KV9 A;  5FXW A;  4PJJ A;  2FJE A;  4YT0 A;  5LG4 A;  4AQG A;  5IHY A;  2CHN A;  5HCM A;  4GKK T;  3CQX C;  4TNV A;  5LCY A;  4IDN A;  4LMK A;  5ABF B;  2WQY A;  4EED A;  3ZT7 A;  2CHO A;  3S4U A;  3PUW F;  3T1H T;  3ZMV B;  3WAJ A;  3D0T A;  2K48 A;  1XZY A;  2HPL A;  2KXP B;  4DND A;  4U2Z A;  4H9R C;  4PK6 A;  1IBL T;  2GK9 A;  3AE4 A;  1J5W A;  1XWM A;  4U31 A;  4ZZC A;  4ILA A;  2KMF A;  4CN4 A;  4OHF A;  3B13 A;  3AE9 A;  5HEG A;  2IUB A;  2NR4 A;  1XDP A;  2BVM A;  4ZI2 D;  2ZM2 A;  2D5U A;  4L9I A;  4CI1 B;  3SWH A;  2NW8 A;  3NRY A;  5LXT E;  4DR3 T;  2YK0 A;  3PE0 A;  2VKD A;  2PFV A;  2D2S A;  2BBJ A;  2Q9Q C;  2BS4 A;  4JI8 T;  5DQV A;  4CXY A;  3ONL C;  3T1Y T;  2F4V T;  2CWY A;  2BKP A;  2ACZ A;  2LE8 A;  2XJ7 A;  5ABF A;  5HXH A;  4DV5 T;  2IHR 1;  3CML A;  1NEK A;  2BS2 A;  2WMO A;  2E2A A;  4UF0 B;  5L4H A;  1N34 T;  2ZM8 A;  5KX5 E;  2J4G A;  2MYS A;  1UK5 A;  3UFE A;  4HFH A;  5LBM A;  4IL9 A;  3RC8 A;  4UVC B;  4X64 T;  5HCJ A;  3ZST A;  2W63 A;  3VRB A;  2X9H A;  4JEU B;  3KFW X;  2V7J A;  2V7L A;  3ZLI A;  5TAO A;  1Y64 B;  1HNZ T;  2EHO B;  2H7V C;  1BR4 A;  4DVD A;  1LVF A;  4H63 V;  4TWF A;  3F2E A;  5DQW A;  5AQG B;  3AA6 B;  4ZS2 A;  4YFS A;  4X65 T;  3H3M A;  4Z91 A;  2PTF A;  3P8C D;  1X79 A;  2VKJ A;  4G63 A;  2V5D A;  2QYW A;  3Q9D A;  2BG9 C;  3PUA A;  2H88 A;  4IST A;  3ZMU B;  4OFZ A;  5FL1 A;  4UF0 A;  1XNR T;  3DJB A;  4EGW A;  4ZZB A;  3QC9 A;  2V8S V;  2WZH A;  4TV8 E;  4NIQ A;  2NWB A;  3UUX B;  4LF8 T;  2CXF A;  3RRC A;  5JDG A;  1BR1 A;  4AIU A;  3AED A;  4BJN A;  4B6X A;  3EAM A;  3AAA B;  1LKX A;  2D0U A;  5IUX A;  4B3R T;  2KLQ A;  1ZV4 X;  2W0G A;  5HEJ A;  2EHO A;  1XMQ T;  5LHH B;  3N9P A;  3UU8 A;  4AI6 A;  4CN1 A;  2W66 A;  2VAS A;  1WRD A;  2JQ9 A;  4K0K T;  4JI1 T;  1XMO T;  5FNV E;  3MZK B;  1T7S A;  4YXD A;  1M7K A;  3RGL A;  2WSS V;  5JDH A;  1HS7 A;  2VL0 A;  3AA7 B;  3KBT A;  5JR9 C;  4ZXL A;  4HE8 A;  4KMC A;  4ILB A;  5JRE A;  3C4W A;  4MHC A;  3DTO A;  3UUL A;  5F3J A;  2QRX A;  1KFY A;  5FXV A;  3AA0 B;  4KBM B;  2XSA A;  4EAH A;  1YQ4 A;  3VR9 A;  2JIW A;  2BVL A;  2LKG A;  2Q9Q B;  3J7Y q;  3TKL B;  2XM1 A;  4Q25 A;  4JLE A;  4IE7 A;  3KBU A;  1VOM A;  5FL0 A;  4IRE A;  3TLU A;  2VK9 A;  3UTK A;  4TUY E;  4X1I E;  4GIW A;  4JV5 T;  4EZ4 A;  2NW9 A;  3QB5 K;  4HEA A;  2IML A;  3H37 A;  1ZP0 A;  3PU8 A;  4H63 H;  1MMD A;  4IE6 A;  1OWA A;  2NW7 A;  4G2A A;  3EUH A;  3K3N A;  2Z6E A;  3M65 A;  4N78 D;  4UR9 A;  4ZS3 A;  3RH3 A;  3G06 A;  4E7S A;  1D0Y A;  3N2O A;  1I6Z A;  2XY8 B;  3ZT6 A;  5L3B B;  4XAX B;  2LRK A;  4ILU A;  3IBP A;  2Y6X A;  5HAX A;  2L9Q A;  4GOU A;  1NEN A;  1W09 A;  4X5T A;  2EHO D;  4AQY T;  5EK2 A;  2Q9Q A;  3AEB A;  3ZN1 B;  1YXR A;  1D1B A;  3ZSS A;  3N2K E;  4TX5 A;  4WYV A;  1CHU A;  1L0V A;  3N2G E;  4EB6 E;  2X9Y A;  2WMN A;  5JQG E;  2LSJ A;  3UQ7 A;  2LJL A;  5L3F B;  4BJM A;  2BG9 B;  2BG9 E;  5AQM B;  2BKO A;  3F57 A;  4ZI3 C;  3A8Y C;  2CA5 A;  4LFC T;  1W9R A;  1WR6 A;  5J2U E;  3ZN0 B;  4DID B;  2C5J A;  3ZPO A;  2P9B A;  1OXZ A;  2C5I T;  3LG7 A;  2M6I A;  4UEL A;  3E0Z A;  5M4Y A;  3LK2 B;  4JBW F;  2CCQ A;  3BK9 A;  3EI0 A;  4HWH A;  1G73 A;  2XQ8 A;  3KV6 A;  5FP3 A;  3ETU A;  2K9A A;  1YD8 G;  1ZEE A;  4KI0 F;  1LVK A;  3OKQ A;  3RC3 A;  1SUM B;  1SHZ C;  4QXC B;  3RX6 A;  4O2B E;  4I43 B;  4OYK A;  1KK7 A;  4YTM A;  1KNZ A;  5LNK A;  4DMV A;  4QH5 A;  4F6R C;  3RYF E;  2X0L B;  2B76 A;  4U3C A;  2WDR A;  5JVD E;  3N5L A;  3PU3 A;  2G0U A;  3FB2 A;  1ZOY A;  3A7M A;  4QX7 B;  4AQF A;  3RQW A;  5DJQ C;  4PFO A;  5AQV B;  4EIW A;  4LF7 T;  4DR6 T;  2BG9 A;  3I9Y A;  5BR8 T;  3WI3 A;  5LA6 E;  2LEH A;  4PK4 A;  2DI4 A;  3CQC B; 
#chains in the Genus database with same CATH homology
 2J1D G;  1D0X A;  2ZM2 A;  4GK0 E;  2D5U A;  4DBQ A;  4AKI A;  2X68 A;  2XTL A;  4P09 A;  2YU2 A;  4L9I A;  5JR9 B;  4UVB B;  2N9D A;  3SWH A;  4CI1 B;  4UIG A;  4I4T E;  2NW8 A;  4TV9 E;  3NRY A;  2HH7 A;  3K3Q C;  4QXH B;  4AKG A;  2K24 A;  5LXT E;  2ODV A;  5L3E B;  3NRX A;  2LHN A;  1ZHC A;  2YK0 A;  2VKD A;  3PE0 A;  2PFV A;  3LBX B;  3ETV A;  2D2S A;  3VU7 H;  2Q9Q C;  1BR0 A;  5DQV A;  4WNK A;  2CM0 A;  4CXY A;  4BA9 A;  3AVR A;  5AFU L;  2CWY A;  5JRC A;  2RA1 A;  2WBL A;  5LJN A;  1WYC A;  3U78 A;  4CQI A;  4WBN E;  4GK5 E;  2LE8 A;  2A3D A;  2Y8D A;  1MIW A;  4UVA B;  2ZMA A;  3LFM A;  5KDM C;  2JQQ A;  5HXH A;  2DLR A;  3N9Q A;  2BDE A;  2Q9Q D;  3SS1 A;  3UUM A;  2L8K A;  2C0S A;  3CML A;  4CXW A;  5FY7 A;  2CLY B;  2V1D B;  2WMO A;  2NP9 A;  2BZB A;  1IZN B;  2MOZ A;  4QXB B;  2JMK A;  3CWZ B;  4U74 A;  4UF0 B;  1QUU A;  4CI2 B;  2I59 A;  5FYM A;  2DWG A;  5LGN B;  2WWU A;  2ZM8 A;  5FXZ A;  5KX5 E;  2E9X B;  2MYS A;  3GWH A;  1IJ5 A;  3MA9 A;  4DMW A;  3UFE A;  3CX6 B;  4EZH A;  5HXS A;  1H7C A;  1EZ3 A;  2X66 A;  5LBM A;  3N9N A;  4QWN B;  4PFP A;  2HPJ A;  3RC8 A;  2LOS A;  5JDM A;  3NBX X;  5HWX A;  4UVC B;  5EK3 A;  2VWA A;  5H6Q B;  2W63 A;  1LRZ A;  1MMG A;  3BQI A;  2E8I A;  2LT3 A;  5GON E;  3K8P C;  5HXR A;  3P7I A;  2SPC A;  3ZC1 A;  3ZCJ A;  4TZ4 C;  4UEM A;  1BR2 A;  3H3A A;  2X9H A;  2KWI B;  2W62 A;  4AXP A;  1MIY A;  4JEU B;  3KFW X;  2ODU A;  2V7J A;  2V7L A;  3ZLI A;  4OK0 A;  5TAO A;  1Y64 B;  4H9O C;  2EHO B;  3O1J A;  2DCF A;  5JR9 A;  2H7V C;  1BR4 A;  4DVD A;  1LVF A;  4H63 V;  2A72 A;  4BAY B;  3KVA A;  3DP7 A;  3F2E A;  1HTJ F;  4ASK A;  5HXE A;  1MIV A;  5DQW A;  1HF8 A;  4IDZ A;  3LBX A;  4L5G A;  4OYJ A;  3AA6 B;  1MNE A;  4GYR A;  1G8X A;  4ZS2 A;  2WM9 A;  3VHL A;  4YFS A;  1VRB A;  3HI2 A;  3FXE B;  3CX8 B;  5EK4 A;  3MK7 C;  3AAE B;  3BQK A;  2V26 A;  3I0Q A;  3P8C D;  5L3C B;  3PUS A;  3RRW A;  4ZHQ E;  1X79 A;  3K3O A;  3ONX A;  2VKJ A;  3VKG A;  4E7Z A;  4G63 A;  4H9P C;  2CLY C;  2LHR A;  3Q9D A;  3O9X A;  3VKH A;  3GN5 B;  2CE7 A;  3PUA A;  4YHJ A;  3N9M A;  4IST A;  3ZMU B;  5FMN A;  1HG5 A;  2YIN A;  4OFZ A;  4J2C A;  2YEV C;  3V5S A;  2XQY A;  2V7M A;  3T8O A;  1U4Q A;  4IE0 A;  2N2N A;  5LOV E;  2A2F X;  3OYZ A;  4UF0 A;  5LHG B;  3QK6 A;  5BMV E;  2XUE A;  3DJB A;  3AVS A;  4MLK A;  2LSK A;  4L0R A;  3U3I A;  4C91 A;  5CA1 E;  3QC9 A;  2X67 A;  1YW0 A;  1UX4 A;  4YJ3 E;  3Q5X A;  4CXX A;  2E9X A;  4TV8 E;  4ISS A;  1D1C A;  2NWB A;  3UUX B;  3R6N A;  2CXF A;  3RRC A;  3Q2M A;  2MBG A;  5JDG A;  1BR1 A;  4YJ2 E;  3HR0 A;  2JMH A;  4AKR B;  2KWH A;  2K5B B;  4EYU A;  3HA4 A;  2ZM0 A;  3HKE E;  5CB4 E;  1UCU A;  3JC6 C;  4O4I E;  5LP6 E;  4MBQ A;  4HTE A;  4BJN A;  5F8P A;  4B6X A;  4X1K E;  3AAA B;  1LKX A;  3OJA A;  4GYS A;  3RKO A;  4EXT A;  1HFA A;  2D0U A;  1D0Z A;  1MND A;  2LOP A;  2Y48 B;  3C64 A;  2KLQ A;  1ZV4 X;  3KV4 A;  4WBO A;  2VKO A;  2W0G A;  3UUN A;  4XBF B;  2EHO A;  2IW5 B;  5FXX A;  1HG2 A;  3PTR B;  3GMI A;  3PUQ A;  4TN7 B;  3L09 A;  3LK3 B;  4EOZ B;  3JC6 D;  2CXL A;  2CXD A;  5LHH B;  4X1Y E;  3N9P A;  4AI6 A;  3CPZ A;  3HL6 A;  1T98 A;  4KUM B;  4ZOL E;  2VAS A;  3SOL A;  1WRD A;  4U72 A;  4QHO A;  3EVY A;  3O1I A;  3C4X A;  3KVB A;  3NZP A;  3FHN A;  5L3G B;  4X20 E;  4PJN A;  3CQG B;  4O8S A;  3MAC A;  1HCI A;  4A56 A;  2D0T A;  5FNV E;  3MZK B;  3GN5 A;  2RP4 A;  4CZZ B;  4H9S E;  2ACX A;  3ZC0 A;  2WSS V;  5JDH A;  2VL8 A;  3LK4 2;  3C51 A;  1HS7 A;  3AAI A;  3RYI E;  2CWO A;  4HGA A;  2NTY A;  3AA7 B;  2PBI A;  3KBT A;  4MFR A;  5JR9 C;  3HKC E;  5EZY E;  4ANJ A;  4QKN A;  3ANW B;  2KIN B;  4HE8 A;  4KMC A;  4PNI A;  5IYZ E;  5C8Y E;  5JDL A;  5JRE A;  3C4W A;  4MHC A;  3DTO A;  3UUL A;  5F3J A;  2H3R A;  3PUR A;  4IE4 A;  5FXV A;  2VKH A;  3AA0 B;  3ZCI A;  4KBM B;  2XAF B;  4IIJ E;  1AJ3 A;  3RYC E;  4EAH A;  3I0O A;  2ZLY A;  4WW0 A;  2UXN B;  2YU1 A;  2BVL A;  4P0A A;  2Q9Q B;  3J7Y q;  5FY1 A;  4AKL A;  3Q5W A;  3L3P A;  4PJM A;  3TKL B;  2V7I A;  4JLE A;  4O4L E;  4IE7 A;  3KBU A;  4HN9 A;  2B1E A;  2LSI A;  2M67 A;  1VOM A;  4CI3 B;  2L3L A;  4JEH B;  2OA5 A;  4PAG A;  1FMW A;  2VK9 A;  5HYA A;  2H7O A;  2XHE B;  2X9X A;  3UTK A;  2PG8 A;  2XAJ B;  3O1H A;  3C50 A;  3IEE A;  4O4J E;  4TUY E;  3PDY A;  4X1I E;  3WAK A;  3RYH E;  2UXX B;  4ZI7 E;  2XAG B;  4GIW A;  3C98 B;  2NW9 A;  4UV8 B;  4EZ4 A;  5E0O A;  1ZKE A;  2E9X C;  2DWK A;  3C4Z A;  3ZYL A;  4HEA A;  1WLX A;  3MKD A;  4ZI2 C;  3UT5 E;  4P0B A;  5LGT B;  3H37 A;  2N1G A;  4PK5 A;  3BQL A;  3PU8 A;  2NTX A;  4H63 H;  1MMD A;  1FIO A;  2KZ7 B;  5J2T E;  4IE6 A;  4K0U A;  1OWA A;  4MAL A;  2NW7 A;  1MMA A;  4G2A A;  2DHR A;  2V7K A;  3N9L A;  5ETW A;  3EDV A;  2JRK A;  2W00 A;  4UV9 B;  1D1A A;  4YLH A;  4Z8X A;  3EUH A;  3K3N A;  2Z6E A;  3M65 A;  1UX5 A;  4N78 D;  3I1A A;  2E9X D;  2X51 A;  4FI5 A;  4ZS3 A;  5CA0 E;  3CKD A;  3B57 A;  4H9N C;  3RH3 A;  3ZMZ B;  4EYY R;  4E7S A;  2EHO C;  3AB3 B;  1D0Y A;  3N2O A;  3FBL A;  3ANW A;  2XAQ B;  3HKD E;  5LYJ E;  5JDF A;  5L3B B;  2MTQ A;  3FBZ A;  1S35 A;  4XAX B;  4DO0 A;  3FXD B;  4ILU A;  3IBP A;  2CMR A;  2Y6X A;  1IAP A;  5HAX A;  4PJL A;  2L9Q A;  4V1A v;  4GOU A;  4I50 E;  3IF8 B;  3R84 B;  3I9W A;  4JUY A;  3O4X E;  1Z0P A;  2NOX A;  1US7 B;  2JJ9 A;  1QSD A;  2EHO D;  2LSG A;  3V5U A;  5LHI B;  5EK2 A;  2X9W A;  4NUU A;  1S94 A;  4DBR A;  2Q9Q A;  3ZN1 B;  3RPU A;  4AKH A;  1D1B A;  3KDS E;  3EDU A;  1U5P A;  4M1P A;  3N2K E;  4TX5 A;  4UXN B;  3J9X 1;  3W15 B;  5LJM A;  3ZEF B;  3HKB E;  5H6R B;  1MMN A;  5JH7 E;  5HWY A;  5ADX L;  2DNX A;  3N2G E;  4QX8 B;  4EB6 E;  2IAK A;  2X9Y A;  3ZJ1 A;  2WMN A;  2LSJ A;  5JQG E;  2LJL A;  5J1G A;  4H9Q C;  5L3F B;  2LM9 A;  4BJM A;  2ES0 A;  2PJQ A;  2QGS A;  4HKA A;  4C90 A;  2KND A;  3ZYK A;  3OBV E;  5DAB A;  5LBQ B;  3SRZ A;  3F57 A;  4ERR A;  3IHR A;  1SA0 E;  4ZI3 C;  3ZMS B;  1E1H B;  3F31 A;  3ZJ2 A;  2CA5 A;  4IGU A;  1HX8 A;  3ZYM A;  1WR6 A;  1FEW A;  3MXZ A;  5A1L A;  5J2U E;  3ZN0 B;  2XAH B;  2IC6 A;  2C5J A;  3E22 E;  3ZPO A;  3AA1 B;  2WAU A;  2P9B A;  1OXZ A;  3CX7 B;  2C5I T;  4IHJ E;  3LG7 A;  4IE5 A;  4O2A E;  5L3D B;  3E08 A;  4O4H E;  4UEL A;  3KV9 A;  3E0Z A;  5FXW A;  4PJJ A;  5HXC A;  5M4Y A;  3LK2 B;  4ZI3 D;  2CEA A;  2CCQ A;  3BK9 A;  2JPF A;  1G73 A;  4NUV A;  3KV6 A;  5FP3 A;  3ETU A;  2K9A A;  5LG4 A;  5JRC B;  4AQG A;  3OYX A;  3A5X A;  5IHY A;  1YD8 G;  4FJO A;  1ZEE A;  3CQX C;  5LCY A;  3NZQ A;  1LVK A;  3OKQ A;  4I55 E;  1O3X A;  1YKH B;  3RC3 A;  5LGU B;  1SHZ C;  4PW8 A;  4QXC B;  4KP3 C;  4XZC A;  3RX6 A;  4O2B E;  2VB6 A;  1IJ6 A;  3S4U A;  3ZMV B;  2XAS B;  4I43 B;  4OYK A;  1KK7 A;  2KT9 A;  5KMG P;  3WAJ A;  1WYB A;  3KV5 A;  1KNZ A;  3D0T A;  2QA7 A;  2K48 A;  2HPL A;  2KXP B;  3QUJ A;  5LNK A;  4DND A;  3KIN B;  2C5K T;  4DMV A;  4F6R C;  3CVR A;  4H9R C;  4PK6 A;  3RYF E;  2X0L B;  1B7T A;  1NWM X;  5FY0 A;  3ESL A;  1NAF A;  2LSY A;  4AQF C;  5JVD E;  4ADZ A;  3N5L A;  3PU3 A;  3ZMT B;  2G0U A;  3FB2 A;  2GK9 A;  3LJC A;  5JDN A;  3MJX A;  4QX7 B;  3GA8 A;  4AQF A;  5JDQ A;  1YKE B;  2KMF A;  1CUN A;  1V9D A;  4OHF A;  3B13 A;  3PUG A;  4PFO A;  5DJQ C;  4EIW A;  3I9Y A;  1FMV A;  3WI3 A;  5LA6 E;  3N9O A;  2LEH A;  4HFV A;  4PK4 A;  2IC9 A;  2W61 A;  2BVM A;  4ZI2 D;  2DI4 A;  3CQC B;  5L2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...