2CLYC

Subcomplex of the stator of bovine mitochondrial atp synthase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE B CHAIN, MITOCHONDRIAL
publication title On the Structure of the Stator of the Mitochondrial ATP Synthase.
pubmed doi rcsb
source organism Bos taurus
total genus 15
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2clyC01
2WSSV 2CLYC
chains in the Genus database with same CATH superfamily
3RYIE 5AQQB 2PTFA 4LF8T 1NEKA 2VVNA 3UQ7A 3AXJA 2DCFA 4YTMA 4QX7B 2RA1A 4DBQA 4EYUA 1QSDA 1H7CA 3AB3B 3ZJ2A 3VR9A 5L4EA 3AEGA 4AQGA 3HKEE 1SE7A 2BG9A 1SHZC 3NZQA 5F8PA 4YSZA 2K24A 4EYYR 2KZ7B 2KXPB 1KNRA 2KWIB 2XAHB 4YJ2E 2WB5A 5EK2A 2LLYA 4U7YA 4ISSA 4ZS3A 4QKNA 2ZM2A 4HFIA 1MMAA 3KVAA 2H7VC 5EZYE 1W0BA 3GN5A 4IREA 2XQYA 3ETUA 1N32T 5LGUB 3R84B 3EABA 4I50E 2NWBA 5HWYA 1D1BA 2HHHT 4IE0A 2X9YA 4C91A 4Z8XA 5JR9A 4YTNA 1EZ3A 4X65T 2V6YB 4ZI3D 4JV5T 3FB2A 3VHLA 4PAGA 2CWYA 2FJBA 3L8RA 5JR9C 3OTOT 2D0UA 5J0ZA 3JC6D 4DMVA 4JI2T 2IC9A 4A56A 2WS3A 1IJ5A 5HEUA 3SFDA 5EK3A 4F8HA 4DIDB 1KFYA 1I6ZA 5KDMC 4AKRB 2L8KA 2JPFA 3P50A 1UURA 4PK6A 3ZC0A 4EB6E 3RYHE 3AEDA 1OEDB 1ZV4X 2KLQA 2VB6A 1MNEA 2CBJA 2NR4A 3B5MA 3PURA 4DV1T 3PUZF 4TUYE 4ASKA 3P4WA 2V26A 3RLFF 4Z90A 2ZM6T 2ACZA 4AQYT 3RI5A 2A2FX 3NKZA 1IBLT 4U31A 2UXXB 3MKDA 4DO0A 1WLXA 5LJNA 1Y01A 3EI0A 2E5LT 2H3RA 2MYSA 2V5CA 4HFVA 2BKOA 3FXDB 5HXRA 4CI1B 3C98B 5ABGA 3C4WA 1NENA 4CI3B 3E08A 2JRKA 4UV9B 2C0SA 3C64A 3VR8A 4L9IA 3ZLIA 2Q9QB 3RRWA 2X9WA 2XAJB 5LP6E 3V5UA 2XQ9A 4DV3T 3ZMUB 1YQ3A 2VKHA 4JI5T 1XDPA 4U7IA 4B6XA 2PFVA 3O4XE 2K5BB 2ODUA 2XUEA 4PFOA 2LSKA 4JI4T 5JDQA 3L3PA 3RKOA 1MNDA 2YDSA 3CQXC 3RC8A 2VWAA 2W66A 3F31A 3ZC1A 3RPUA 3HI2A 5L3GB 2YKSA 4Z91A 5LBMA 2WDVA 3EVYA 1CHUA 1SUMB 4PK5A 3ESLA 2V8SV 1Y64B 4IIJE 4TWHA 2XQ3A 4TN7B 4HFDA 4I55E 2X0LB 2EHOD 2IC6A 5H6RB 3N2GE 1MIWA 2XJ7A 3M65A 2I0MA 2LE8A 3QB5A 5JH7E 3KBUA 2CHNA 2W67A 3VKGA 1MMGA 5IUXA 1D1AA 1XNQT 1BR1A 3MXZA 5IYZE 4UR9A 2BKPA 2CXDA 3LSVA 4DV4T 3RGLA 3HA4A 2DHRA 2LKHA 4IDOA 2UUAT 3NRYA 4JEHB 4YJ3E 1UGOA 5KXJA 4BJNA 2Z6EA 3AA7B 2V6YA 2LHRA 3TKLB 2CEAA 2LRKA 4QH5A 2CCQA 4EOZB 3QNUA 5HXHA 5A1LA 4DR4T 4CXYA 4JYAT 4IDQA 3ZN0B 5FNVE 4CQIA 3UU5A 5L3EB 2ZLYA 1HX8A 3AE9A 3CX6B 3AEEA 4JI0T 4CI2B 1XDOA 3DTOA 1OEDA 3GN5B 3UQ4A 4OYJA 1E2AA 1US7B 1ZP0A 5LJMA 2K3WA 2WDQA 3ZYKA 1N33T 3EUHA 2QYWA 5JQGE 2IMLA 3UU8A 5IWAT 1HG5A 1OEDC 3CVRA 4KMCA 1E1HB 2WCAA 4YXDA 3FBLA 2ZM8A 5IHYA 3ZN1B 4NIQA 3ETVA 2UUCT 4PJJA 2WY2A 3LK2B 2Y48B 3N9MA 1YKEB 3EHZA 3OBVE 3UUBA 3E22E 5LOVE 1L0VA 3HKBE 1KNPA 4TWFA 4WYVA 5LGTB 3KV4A 1D0YA 5ADXL 3TLWA 3OKQA 4L5GA 4O2AE 4C90A 4PNIA 4DR2T 5HEJA 3J7Yq 5AQOB 2RPAA 2YOEA 4CN6A 4EGWA 4NPPA 4QH1A 1BR0A 4IE5A 3LK42 1J5WA 3IEEA 2V7LA 4JUYA 5AFUL 4YSXA 4QWNB 3MJXA 1HG2A 4N78D 4KX6A 5ABHA 3RYCE 4CZZB 1HX1B 2WWUA 3E0ZA 2C5IT 4JLEA 3UUMA 4YT0A 4DR5T 2Q9QC 4IGUA 2SPCA 3DP7A 4DNDA 5FXXA 1FJGT 3KVBA 1WYCA 2PG8A 4DV2T 3AE3A 1VCTA 5LHIB 3IF8B 5HAXA 1YQ4A 3PE0A 3RHWA 4ADZA 5E0OA 2UU9T 4X1KE 2WSSV 4UV8B 3F2EA 4LF5T 1WYBA 2MOZA 2N1GA 2WP9A 4UIGA 3RC3A 3CQCB 2XY8B 4I4TE 2E9XD 4UXNB 2IHR1 1LVKA 3K3QC 3K3OA 2LOSA 2YU1A 4X20E 3UUNA 3LBXA 4H9OC 2EHOA 1UK5A 4UVAB 2BBJA 3NRXA 2NTXA 4JI7T 2NW9A 4AIUA 3ZMVB 4CN4A 3I9YA 2QA7A 2X66A 5ABFA 3CX8B 2BZBA 5L3DB 3AAEB 3RQUA 5JREA 4P0BA 1NWMX 3VKHA 4X64T 5CB4E 4NUUA 5AQPB 5L3BB 4NXNT 3P4QA 4IL4A 4ZI2D 4TNWA 4KHPT 3RF1A 3F57A 2YN6A 4MLKA 3LK3B 3SFEA 3N5LA 1HNWT 4UVCB 2BG9C 3I0QA 2L3LA 3N9NA 4ZS2A 2XASB 2CRBA 3V5SA 1HFAA 3TLTA 4GYRA 2XAQB 2WMOA 1UUSA 2OV9A 3OYXA 3SWHA 2J62A 2I6HA 5FY1A 3AE1A 5LYJE 4PJMA 5TAOA 2CBIA 1S35A 5LG3A 4AKLA 4GKKT 2X9XA 1IBKT 4YLHA 3K3NA 3ZCIA 5FXVA 4IE6A 1WR0A 4DR7T 2WAUA 4GYSA 4HWDA 4DVDA 3SS1A 3J9X1 1J5ET 4AKGA 1D0ZA 2NOXA 4DR6T 3AE6A 5L3CB 1YD8G 5CA0E 4AQFA 3MZKB 5L2LA 3WAKA 3UULA 4HFEA 3PU3A 5FKYA 2LOPA 3I1AA 4IT4A 3U3IA 3O9XA 3ZT7A 1I94T 3ONXA 2A9UA 5AQIB 3ANWA 4CXWA 3WI3A 5JDFA 5CA1E 4TZ4C 4MBQA 1HR0T 1VOMA 4UF0B 1ZEEA 3RIFA 2H7OA 5LG4A 4OYKA 2MTQA 4ZZCA 1BR2A 1YXRA 2QRXA 4NUVA 1E7PA 2WM9A 1AJ3A 4U2ZA 2BKNA 2F4VT 3OVUA 3KV9A 1MIVA 4WNKA 3FHNA 3ZYMA 2D0TA 4LF7T 4OFZA 4HFCA 2V7MA 4DR3T 3PUVF 5AQLB 3JCFA 5J2UE 4ZI7E 4DUYT 4FI5A 5HXEA 4HWHA 2BVMA 3FZHB 3NZPA 1S94A 1BR4A 2UXNB 3MA9A 3AVRA 5H6QB 4DBRA 4DV0T 4WBOA 4ERRA 2XQ6A 4O4HE 2D9DA 4GK5E 3T8OA 2IDOB 2FJEA 2LJLA 2X0HA 4KUMB 2UXBT 4U3CA 4HWCA 1T72A 3KV5A 3AA6B 5HYAA 4DUZT 2XPKA 1FMVA 1IZNB 5AQVB 1W0AA 4WW0A 4UVBB 1X9BA 2NP9A 2WBLA 3UU3A 1M62A 1G73A 3ABVA 3U78A 2OLTA 4COFA 3AE5A 3H37A 5LCYA 1YW0A 3N9PA 2W62A 2YDRA 3SOLA 2XQAA 4ZEYA 4WZXA 5DJQC 4DMWA 4Q25A 5LGNB 3UTKA 4X62T 3G06A 4HFHA 2KMFA 2LSYA 3AE8A 3UT5E 1XNRT 2VKJA 3PU8A 3PUAA 3RIUA 2J4GA 2CA5A 3FZFB 4O8SA 2VK9A 4GOUA 3UUXB 5AQHB 4YSYA 4H9RC 3ZT5A 2CLYB 2ODVA 3JAEA 3H3MA 4YHHT 3EDUA 3FZMB 3AA0B 4TNVA 2CMRA 4AKHA 2RP4A 1FEWA 2W61A 1T98A 4YFSA 3LBXB 3P8CD 3P4RA 2EHOB 2QGSA 4KHZF 2A3DA 1M7KA 4P09A 3ZMZB 3IHRA 5JDNA 3P4PA 2I59A 4O4JE 2J47A 4HN9A 5FYMA 2BS2A 1R8IA 5ABFB 4G63A 4LF9T 3NVOA 3C50A 3OPCA 2IW5B 3AEAA 2V1DB 3HKDE 3CIRA 4JI8T 3D0TA 4X5TA 1XMOT 2B1EA 2UXDT 4K0UA 1FMWA 2XQ8A 3MACA 3ZKRA 1UX5A 1KEYA 1KF6A 3QK6A 3OJAA 2W0GA 2X68A 4O4LE 4UF0A 2VQFT 2VL0A 4LMJA 4DV5T 2NTYA 4M1PA 3PUYF 3TLUA 5JVDE 2FUPA 4ZI3C 2XHEB 2CXFA 4U74A 4AKIA 2LHNA 4MFRA 5FVKA 1ZHCA 2N9DA 4B3RT 2KNDA 3UFEA 1WFDA 4ILBA 2IAKA 5GONE 2JQ9A 3JC6C 2CXLA 3C4XA 2BS4A 4EIWA 3AE2A 5FP3A 4OK0A 4BAYB 4IDPA 3FXEB 2BVLA 4JI3T 2H89A 1JNZA 2BG9E 2JJ9A 2KWHA 3RH3A 1NAFA 4CN1A 3VRAA 5LBQB 2XM1A 3O1HA 1MMDA 4G2AA 5AQUB 2DWKA 3CQGB 3AAIA 2X9HA 3ANWB 4X66T 2CHOA 2XM2A 1XZYA 5HXCA 4LF6T 5HXSA 3I0OA 3HL6A 3H3AA 3QC9A 3QUJA 4QHOA 5FL0A 4B3MT 5C2TA 2YINA 1N36T 1SA0E 3NWIA 3S4UA 2HPLA 2FJAA 5BMVE 4HEAA 3QB5K 2CWOA 3P4SA 4AI6A 4YY3T 2XTLA 3Q5EA 2XQ7A 2KINB 3BQIA 1D0XA 5FL1A 3PUSA 4ZXLA 3KFWX 2VL8A 4JI1T 3PUGA 3RRCA 4O2BE 3UFGA 4I0UA 4HWIB 4XBFB 3LDQB 4KP3C 2C5KT 4ZOLE 2LSGA 3ZMSB 1VCSA 3AVSA 2LM2A 4V1Av 3N9LA 1JNRA 2JQHA 4DV7T 3JAFA 1OWAA 4HE8A 5LMNT 4H63H 2J1DG 3EAMA 3TLSA 2WU5A 2JQQA 2XAFB 2Y6XA 2XQ4A 2V7IA 5M4YA 2CM0A 1FIOA 5HEHA 4KI0F 4CXXA 2CLYC 3KV6A 5F3JA 5ETWA 4TWDA 4H9NC 4AISA 1IBMT 4LFCT 3N2OA 2E9XB 3N9QA 3FZKB 2LT3A 3PUXF 1U4QA 3AAAB 2EHOC 5AQRB 2UXCT 5LB7B 4PJNA 2BDEA 1IAPA 4P1NA 3FZLB 2AE9A 4HGAA 1HTJF 4HTEA 3ZJ1A 1MMNA 1MIYA 2NW7A 4MHCA 4LF4T 2PJQA 4PK4A 4IE7A 3K8PC 3ZSTA 4QXBB 5AQKB 5C8YE 5AQMB 3I9WA 2CPTA 3X1DA 5JDGA 2WWVA 2DNXA 1WRDA 5JRCA 3LJCA 4ILAA 2M6BA 2A72A 2HN2A 2JMKA 4E7ZA 4L0RA 1B7TA 3GWHA 5HEGA 3Q5XA 2YDQA 2OA5A 4XAXB 5AQTB 3PUQA 4I43B 2BBHA 4KBMB 2MBGA 2JIWA 2D5UA 1T7SA 4H9PC 3ZSSA 1W9RA 5FXWA 2JQKA 2E8IA 3AA1B 2ZM0A 4A97A 1D1CA 4PJLA 4E7SA 3AE7A 2V5DA 4X1YE 4EZ4A 4AQFC 2VKOA 4EEBA 5AQNB 5HCMA 4JI6T 2LEHA 3KINB 2XZEA 3OYZA 2DLRA 1HF8A 3T1HT 1O3XA 2P9BA 3A8YC 4QH4A 3CWZB 4A98A 1X79A 3AE4A 2WZHA 5L4HA 1J1JA 5JDLA 2XSAA 4FJOA 2VVSA 2QVAA 4ILUA 2BS3A 4UELA 2DI4A 2LM9A 2WMNA 3O1IA 2KT9A 4QXHB 1N34T 5EK4A 4EEDA 4EV6A 4U72A 3PUWF 3Q9DA 2Q9QD 2LSJA 5DQVA 5J1GA 2VURA 3N9OA 2X67A 5DABA 1ZOYA 2FJDA 1KK7A 4GIWA 4H63V 3ZEFB 4GK0E 1G8XA 2VKDA 4HFBA 3ZYLA 5LNKA 2WU2A 5BR8T 5AQFB 2W00A 3IBPA 3HR0A 2KSRA 2MAWA 1XMQT 4B3TT 5FVLA 2X51A 1OEDE 4BA9A 4U2YA 2V7KA 2DL1A 5HWXA 4TV9E 1GQEA 3LG7A 2GK9A 3L09A 2E9XA 4QX8B 5DQWA 5JDHA 3WAJA 4UEMA 2HN1A 4U33A 4OX9T 4OHFA 3QOFA 1XWMA 2LSIA 3CK6A 5CJ5A 3KBTA 3PV0F 4LFBT 2V7JA 2E9XC 5KMGP 3KDSE 3P7IA 5L47A 2E2AA 4IDZA 3T1YT 5CFBA 1V9DA 2ES0A 5AQSB 2WQYA 4IDNA 3HKCE 2C5JA 2B76A 3RIUC 3JADA 3VRBA 2DWGA 4J2CA 3EDVA 3Q2MA 3SRZA 4ZHQE 3FBZA 5AQGB 2IIUA 5LMUT 2W2UA 1HCIA 4AXPA 4TV8E 3IA3A 4XZCA 5FY7A 3C51A 4ZI2C 2K9AA 3AXJB 3C4ZA 4YTPA 4IHJE 3RQWA 1W09A 4TX5A 4GKJT 3ZMTB 2VQET 2ZMAA 1HNXT 2YU2A 4K0KT 4O4IE 3ZPOA 2BG9B 3B13A 3CKDA 3PDYA 3A7MA 4B3ST 4BJMA 5J2TE 3AECA 2M6IA 1UCUA 2ACXA 5L3FB 3CMLA 2XAGB 3DJBA 2W63A 4P0AA 5C3JA 3Q5WA 2D2SA 4IE4A 3CPZA 3RYFE 3ZT6A 4X1IE 3ZCJA 1T8BA 2N2NA 2E5VA 5JRCB 3LFMA 5FXZA 3TLVA 1KNZA 3B57A 2L9QA 3BK9A 5HEOA 1Z8UA 2XQ5A 3VU7H 2HPJA 3UU4A 5ABEA 2AXDS 4ILCA 2YK0A 4DV6T 3RKGA 4JEUB 3PJAA 3R6NA 3K1SA 3GMIA 2X0YA 4WBNE 4IL9A 5JTGA 1YKHB 3NBXX 3N2KE 2PBIA 4ANJA 5JR9B 5LXTE 4LMKA 4PFPA 3UU6A 2HH7A 3ONJA 4F6RC 4DR1T 3M3ZB 5LHHB 3PJAJ 1UX4A 4YHJA 5HCJA 1WCRA 1QLBA 2YEVC 4MALA 2Y8DA 3AEBA 3ONLC 4HKAA 5CGMA 5F5WA 4EXTA 4H9SE 2H88A 4LFAT 4JBWF 1QUUA 3BQLA 3RIAA 2VASA 1LRZA 1U5PA 2Q9QA 2WZIA 3Q5DA 3RX6A 2FBWA 2LRLA 3GA8A 2K48A 5JDMA 1LVFA 2V6XA 4EAHA 4PW8A 4HWFA 1LKXA 2UUBT 5FMNA 4ISTA 5LHGB 4NXMT 4EZHA 2LKGA 3A5XA 3AEFA 1DU2A 4QXCB 1HNZT 3CX7B 3W15B 2M67A 3L39A 2MPKA 5FY0A 3O1JA 4ZZBA 2XSBA 3PTRB 1HS7A 3MK7C 2IUBA 3BQKA 2JMHA 1ZKEA 2W4XA 5LA6E 5AQJB 4LMLA 2CE7A 1VRBA 1OXZA 1CUNA 1IJ6A 2G0UA 2WDRA 4H9QC 4A5XA 1WR6A 2NW8A 1Z0PA 5KX5E 2R6GF
chains in the Genus database with same CATH topology
4E7SA 5JQGE 3RYIE 5LGNB 3UTKA 1HG5A 4X1YE 4EZ4A 2KMFA 2VKOA 4AQFC 2LSYA 3CVRA 3UT5E 4KMCA 1E1HB 2VKJA 3PU8A 3PUAA 3FBLA 2ZM8A 2DCFA 5IHYA 3ZN1B 3ETVA 4QX7B 2CA5A 2LEHA 3KINB 2RA1A 4PJJA 4DBQA 4O8SA 1QSDA 2VK9A 1H7CA 4EYUA 4GOUA 3OYZA 3LK2B 2Y48B 3N9MA 2DLRA 3AB3B 1HF8A 3UUXB 1YKEB 3OBVE 3ZJ2A 1O3XA 4H9RC 3E22E 5LOVE 3HKBE 2CLYB 2ODVA 3EDUA 2P9BA 4AQGA 3HKEE 3AA0B 3CWZB 1X79A 5LGTB 3KV4A 1D0YA 5ADXL 2CMRA 4AKHA 3OKQA 2RP4A 1FEWA 2W61A 1T98A 4L5GA 1SHZC 3NZQA 4O2AE 5JDLA 5F8PA 4FJOA 4C90A 4YFSA 4PNIA 4ILUA 3LBXB 3P8CD 4UELA 2DI4A 3J7Yq 2K24A 2EHOB 2LM9A 2QGSA 2WMNA 3O1IA 4EYYR 2KT9A 2A3DA 4QXHB 2KZ7B 4P09A 3ZMZB 2KXPB 3IHRA 5JDNA 1BR0A 2KWIB 4IE5A 3LK42 2XAHB 5EK4A 4YJ2E 3IEEA 2I59A 2V7LA 4JUYA 4O4JE 5AFUL 4U72A 4HN9A 5EK2A 5FYMA 4QWNB 3Q9DA 3MJXA 4ISSA 4G63A 1HG2A 2Q9QD 4N78D 4ZS3A 2LSJA 3C50A 4QKNA 5DQVA 5J1GA 2ZM2A 3RYCE 4CZZB 2WWUA 3E0ZA 2C5IT 3N9OA 4JLEA 1MMAA 3KVAA 2IW5B 2H7VC 3UUMA 2Q9QC 2X67A 5EZYE 2V1DB 3HKDE 5DABA 3GN5A 4IGUA 3D0TA 2SPCA 3DP7A 2B1EA 4DNDA 2XQYA 1KK7A 5FXXA 3ETUA 4GIWA 3KVBA 4K0UA 1WYCA 5LGUB 2PG8A 3R84B 1FMWA 4H63V 3ZEFB 3MACA 1G8XA 2VKDA 4GK0E 4I50E 3ZYLA 5LHIB 5LNKA 1UX5A 2NWBA 2W00A 3IBPA 3HR0A 5HWYA 1D1BA 4IE0A 2X51A 2X9YA 4C91A 4Z8XA 3IF8B 3QK6A 5HAXA 5JR9A 3OJAA 4BA9A 2W0GA 2X68A 4O4LE 4UF0A 1EZ3A 2V7KA 5HWXA 3PE0A 2NTYA 4TV9E 4ZI3D 4ADZA 4M1PA 5E0OA 3FB2A 4X1KE 3VHLA 2WSSV 3LG7A 4PAGA 2GK9A 3L09A 2E9XA 4QX8B 5DQWA 5JVDE 4UV8B 4DMWA 5JDHA 4ZI3C 2CWYA 3F2EA 2XHEB 2CXFA 3WAJA 1WYBA 4U74A 4AKIA 2MOZA 4UEMA 2LHNA 4MFRA 1ZHCA 2N9DA 5JR9C 2N1GA 4UIGA 2KNDA 3RC3A 2D0UA 4OHFA 3CQCB 3UFEA 3JC6D 4DMVA 4I4TE 2IC9A 2LSIA 2E9XD 4A56A 4UXNB 1IJ5A 1LVKA 2IAKA 3KBTA 3K3QC 5GONE 3K3OA 5EK3A 3JC6C 2CXLA 3C4XA 2LOSA 2YU1A 4EIWA 2V7JA 2E9XC 4X20E 3UUNA 3LBXA 5KMGP 4H9OC 2EHOA 3KDSE 3P7IA 5FP3A 5KDMC 4UVAB 2L8KA 4OK0A 4AKRB 2JPFA 4BAYB 3NRXA 4IDZA 2NTXA 4PK6A 3ZC0A 4EB6E 3FXEB 2BVLA 3RYHE 2NW9A 1V9DA 2ES0A 1ZV4X 3ZMVB 2KLQA 2VB6A 1MNEA 2JJ9A 2KWHA 3PURA 3I9YA 3HKCE 2C5JA 3RH3A 2QA7A 1NAFA 2X66A 4TUYE 3CX8B 5LBQB 4ASKA 2BZBA 3AAEB 3O1HA 5L3DB 1MMDA 2DWGA 5JREA 4G2AA 1NWMX 4P0BA 4J2CA 3EDVA 3VKHA 3Q2MA 2DWKA 3SRZA 4ZHQE 3CQGB 5CB4E 2V26A 4NUUA 3AAIA 3FBZA 2X9HA 5L3BB 3ANWB 4ZI2D 3F57A 1HCIA 4AXPA 4MLKA 4TV8E 3LK3B 4XZCA 5FY7A 3N5LA 3C51A 5HXCA 4ZI2C 2A2FX 2K9AA 4UVCB 3C4ZA 3I0QA 2UXXB 5HXSA 3I0OA 3HL6A 3MKDA 4DO0A 2L3LA 3H3AA 3N9NA 3QC9A 4IHJE 4ZS2A 2XASB 3QUJA 1WLXA 4QHOA 5LJNA 2YINA 4TX5A 1SA0E 3V5SA 2H3RA 2MYSA 4HFVA 3S4UA 1HFAA 2HPLA 3ZMTB 2ZMAA 5BMVE 4GYRA 3FXDB 4HEAA 5HXRA 2YU2A 2XAQB 2WMOA 3OYXA 4O4IE 3ZPOA 2CWOA 4CI1B 3C98B 3SWHA 3B13A 3CKDA 4AI6A 2XTLA 3C4WA 4CI3B 3E08A 5FY1A 3PDYA 2KINB 5LYJE 3BQIA 4PJMA 5TAOA 1D0XA 2JRKA 4UV9B 2C0SA 4BJMA 3C64A 1S35A 3PUSA 5J2TE 4L9IA 1UCUA 2ACXA 4AKLA 2X9XA 3ZLIA 5L3FB 3KFWX 2VL8A 3CMLA 2Q9QB 2XAGB 3RRWA 3DJBA 3PUGA 4YLHA 2W63A 3RRCA 4P0AA 2X9WA 3K3NA 2XAJB 4O2BE 3Q5WA 5LP6E 2D2SA 3ZCIA 4XBFB 3V5UA 4KP3C 4IE4A 3CPZA 3RYFE 5FXVA 4X1IE 2C5KT 3ZCJA 4IE6A 4ZOLE 2N2NA 3ZMUB 5JRCB 2VKHA 3LFMA 5FXZA 1KNZA 3B57A 4B6XA 2WAUA 2L9QA 2LSGA 3BK9A 4GYSA 3ZMSB 2PFVA 4DVDA 3SS1A 3J9X1 4AKGA 3O4XE 3AVSA 2K5BB 2ODUA 1D0ZA 2NOXA 2XUEA 4V1Av 5L3CB 4PFOA 3N9LA 1YD8G 3VU7H 2HPJA 4AQFA 3MZKB 5CA0E 2LSKA 5JDQA 5L2LA 3WAKA 3L3PA 1OWAA 3RKOA 1MNDA 3UULA 3CQXC 2YK0A 3RC8A 4HE8A 3PU3A 4JEUB 2VWAA 2LOPA 3I1AA 2J1DG 3F31A 4H63H 3U3IA 3ZC1A 3RPUA 3O9XA 3R6NA 3GMIA 3HI2A 3ONXA 5L3GB 2JQQA 2XAFB 4WBNE 2Y6XA 3ANWA 5LBMA 1YKHB 3NBXX 4CXWA 2V7IA 5M4YA 2CM0A 3WI3A 1FIOA 3N2KE 5JDFA 4CXXA 2PBIA 5CA1E 2CLYC 3EVYA 4TZ4C 3KV6A 4ANJA 4MBQA 5JR9B 5F3JA 5ETWA 1VOMA 5LXTE 4PK5A 3ESLA 4H9NC 4PFPA 4UF0B 2HH7A 1Y64B 4IIJE 4F6RC 1ZEEA 2H7OA 5LHHB 4TN7B 1UX4A 5LG4A 4I55E 4OYKA 2MTQA 4YHJA 1BR2A 2X0LB 3N2OA 2EHOD 4NUVA 2WM9A 2E9XB 2YEVC 3N9QA 4MALA 2IC6A 1AJ3A 2LT3A 2Y8DA 1U4QA 5H6RB 3AAAB 3N2GE 4HKAA 2EHOC 3KV9A 1MIWA 3M65A 4PJNA 2BDEA 1IAPA 1MIVA 4WNKA 4EXTA 4H9SE 3FHNA 2LE8A 3ZYMA 2D0TA 4HGAA 4OFZA 1HTJF 5JH7E 4HTEA 2V7MA 3ZJ1A 3KBUA 1MMNA 1MIYA 2NW7A 5J2UE 3VKGA 1MMGA 4MHCA 4ZI7E 2PJQA 1QUUA 3BQLA 1D1AA 1BR1A 3MXZA 4PK4A 5IYZE 2CXDA 4FI5A 4IE7A 2BVMA 2VASA 5HXEA 3HA4A 1LRZA 3K8PC 2DHRA 1U5PA 2Q9QA 4QXBB 3NZPA 3RX6A 5C8YE 1S94A 3I9WA 3NRYA 4JEHB 3GA8A 1BR4A 4YJ3E 2K48A 5JDMA 1LVFA 5JDGA 4BJNA 2Z6EA 2UXNB 4EAHA 4PW8A 3MA9A 3AVRA 3AA7B 5H6QB 2DNXA 1WRDA 4DBRA 1LKXA 2LHRA 3TKLB 2CEAA 5JRCA 3LJCA 4WBOA 5FMNA 4ERRA 4O4HE 4ISTA 5LHGB 2CCQA 4EOZB 2A72A 4EZHA 5KX5E 4GK5E 3T8OA 5HXHA 3A5XA 2JMKA 4QXCB 2LJLA 5A1LA 3CX7B 4KUMB 3W15B 4CXYA 2M67A 4E7ZA 3KV5A 3AA6B 4L0RA 5FY0A 1B7TA 5HYAA 3GWHA 3Q5XA 3ZN0B 2OA5A 4XAXB 5FNVE 1FMVA 3O1JA 1IZNB 3PUQA 4I43B 4CQIA 3PTRB 1HS7A 4KBMB 3MK7C 3BQKA 4WW0A 4UVBB 5L3EB 2ZLYA 1HX8A 2NP9A 2WBLA 2JMHA 1ZKEA 2MBGA 5LA6E 1G73A 2D5UA 3CX6B 4CI2B 3U78A 4H9PC 5FXWA 2CE7A 3AA1B 2E8IA 1VRBA 3DTOA 3GN5B 2ZM0A 3H37A 4OYJA 5LCYA 1US7B 5LJMA 1D1CA 1OXZA 1CUNA 1YW0A 3N9PA 1IJ6A 2W62A 3SOLA 3ZYKA 2G0UA 5DJQC 4H9QC 1WR6A 2NW8A 1Z0PA 3EUHA 4PJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS V;  2CLY C; 
#chains in the Genus database with same CATH topology
 3RYI E;  5AQQ B;  2PTF A;  4LF8 T;  1NEK A;  2VVN A;  3UQ7 A;  3AXJ A;  2DCF A;  4YTM A;  4QX7 B;  2RA1 A;  4DBQ A;  4EYU A;  1QSD A;  1H7C A;  3AB3 B;  3ZJ2 A;  3VR9 A;  5L4E A;  3AEG A;  4AQG A;  3HKE E;  1SE7 A;  2BG9 A;  1SHZ C;  3NZQ A;  5F8P A;  4YSZ A;  2K24 A;  4EYY R;  2KZ7 B;  2KXP B;  1KNR A;  2KWI B;  2XAH B;  4YJ2 E;  2WB5 A;  5EK2 A;  2LLY A;  4U7Y A;  4ISS A;  4ZS3 A;  4QKN A;  2ZM2 A;  4HFI A;  1MMA A;  3KVA A;  2H7V C;  5EZY E;  1W0B A;  3GN5 A;  4IRE A;  2XQY A;  3ETU A;  1N32 T;  5LGU B;  3R84 B;  3EAB A;  4I50 E;  2NWB A;  5HWY A;  1D1B A;  2HHH T;  4IE0 A;  2X9Y A;  4C91 A;  4Z8X A;  5JR9 A;  4YTN A;  1EZ3 A;  4X65 T;  2V6Y B;  4ZI3 D;  4JV5 T;  3FB2 A;  3VHL A;  4PAG A;  2CWY A;  2FJB A;  3L8R A;  5JR9 C;  3OTO T;  2D0U A;  5J0Z A;  3JC6 D;  4DMV A;  4JI2 T;  2IC9 A;  4A56 A;  2WS3 A;  1IJ5 A;  5HEU A;  3SFD A;  5EK3 A;  4F8H A;  4DID B;  1KFY A;  1I6Z A;  5KDM C;  4AKR B;  2L8K A;  2JPF A;  3P50 A;  1UUR A;  4PK6 A;  3ZC0 A;  4EB6 E;  3RYH E;  3AED A;  1OED B;  1ZV4 X;  2KLQ A;  2VB6 A;  1MNE A;  2CBJ A;  2NR4 A;  3B5M A;  3PUR A;  4DV1 T;  3PUZ F;  4TUY E;  4ASK A;  3P4W A;  2V26 A;  3RLF F;  4Z90 A;  2ZM6 T;  2ACZ A;  4AQY T;  3RI5 A;  2A2F X;  3NKZ A;  1IBL T;  4U31 A;  2UXX B;  3MKD A;  4DO0 A;  1WLX A;  5LJN A;  1Y01 A;  3EI0 A;  2E5L T;  2H3R A;  2MYS A;  2V5C A;  4HFV A;  2BKO A;  3FXD B;  5HXR A;  4CI1 B;  3C98 B;  5ABG A;  3C4W A;  1NEN A;  4CI3 B;  3E08 A;  2JRK A;  4UV9 B;  2C0S A;  3C64 A;  3VR8 A;  4L9I A;  3ZLI A;  2Q9Q B;  3RRW A;  2X9W A;  2XAJ B;  5LP6 E;  3V5U A;  2XQ9 A;  4DV3 T;  3ZMU B;  1YQ3 A;  2VKH A;  4JI5 T;  1XDP A;  4U7I A;  4B6X A;  2PFV A;  3O4X E;  2K5B B;  2ODU A;  2XUE A;  4PFO A;  2LSK A;  4JI4 T;  5JDQ A;  3L3P A;  3RKO A;  1MND A;  2YDS A;  3CQX C;  3RC8 A;  2VWA A;  2W66 A;  3F31 A;  3ZC1 A;  3RPU A;  3HI2 A;  5L3G B;  2YKS A;  4Z91 A;  5LBM A;  2WDV A;  3EVY A;  1CHU A;  1SUM B;  4PK5 A;  3ESL A;  2V8S V;  1Y64 B;  4IIJ E;  4TWH A;  2XQ3 A;  4TN7 B;  4HFD A;  4I55 E;  2X0L B;  2EHO D;  2IC6 A;  5H6R B;  3N2G E;  1MIW A;  2XJ7 A;  3M65 A;  2I0M A;  2LE8 A;  3QB5 A;  5JH7 E;  3KBU A;  2CHN A;  2W67 A;  3VKG A;  1MMG A;  5IUX A;  1D1A A;  1XNQ T;  1BR1 A;  3MXZ A;  5IYZ E;  4UR9 A;  2BKP A;  2CXD A;  3LSV A;  4DV4 T;  3RGL A;  3HA4 A;  2DHR A;  2LKH A;  4IDO A;  2UUA T;  3NRY A;  4JEH B;  4YJ3 E;  1UGO A;  5KXJ A;  4BJN A;  2Z6E A;  3AA7 B;  2V6Y A;  2LHR A;  3TKL B;  2CEA A;  2LRK A;  4QH5 A;  2CCQ A;  4EOZ B;  3QNU A;  5HXH A;  5A1L A;  4DR4 T;  4CXY A;  4JYA T;  4IDQ A;  3ZN0 B;  5FNV E;  4CQI A;  3UU5 A;  5L3E B;  2ZLY A;  1HX8 A;  3AE9 A;  3CX6 B;  3AEE A;  4JI0 T;  4CI2 B;  1XDO A;  3DTO A;  1OED A;  3GN5 B;  3UQ4 A;  4OYJ A;  1E2A A;  1US7 B;  1ZP0 A;  5LJM A;  2K3W A;  2WDQ A;  3ZYK A;  1N33 T;  3EUH A;  2QYW A;  5JQG E;  2IML A;  3UU8 A;  5IWA T;  1HG5 A;  1OED C;  3CVR A;  4KMC A;  1E1H B;  2WCA A;  4YXD A;  3FBL A;  2ZM8 A;  5IHY A;  3ZN1 B;  4NIQ A;  3ETV A;  2UUC T;  4PJJ A;  2WY2 A;  3LK2 B;  2Y48 B;  3N9M A;  1YKE B;  3EHZ A;  3OBV E;  3UUB A;  3E22 E;  5LOV E;  1L0V A;  3HKB E;  1KNP A;  4TWF A;  4WYV A;  5LGT B;  3KV4 A;  1D0Y A;  5ADX L;  3TLW A;  3OKQ A;  4L5G A;  4O2A E;  4C90 A;  4PNI A;  4DR2 T;  5HEJ A;  3J7Y q;  5AQO B;  2RPA A;  2YOE A;  4CN6 A;  4EGW A;  4NPP A;  4QH1 A;  1BR0 A;  4IE5 A;  3LK4 2;  1J5W A;  3IEE A;  2V7L A;  4JUY A;  5AFU L;  4YSX A;  4QWN B;  3MJX A;  1HG2 A;  4N78 D;  4KX6 A;  5ABH A;  3RYC E;  4CZZ B;  1HX1 B;  2WWU A;  3E0Z A;  2C5I T;  4JLE A;  3UUM A;  4YT0 A;  4DR5 T;  2Q9Q C;  4IGU A;  2SPC A;  3DP7 A;  4DND A;  5FXX A;  1FJG T;  3KVB A;  1WYC A;  2PG8 A;  4DV2 T;  3AE3 A;  1VCT A;  5LHI B;  3IF8 B;  5HAX A;  1YQ4 A;  3PE0 A;  3RHW A;  4ADZ A;  5E0O A;  2UU9 T;  4X1K E;  2WSS V;  4UV8 B;  3F2E A;  4LF5 T;  1WYB A;  2MOZ A;  2N1G A;  2WP9 A;  4UIG A;  3RC3 A;  3CQC B;  2XY8 B;  4I4T E;  2E9X D;  4UXN B;  2IHR 1;  1LVK A;  3K3Q C;  3K3O A;  2LOS A;  2YU1 A;  4X20 E;  3UUN A;  3LBX A;  4H9O C;  2EHO A;  1UK5 A;  4UVA B;  2BBJ A;  3NRX A;  2NTX A;  4JI7 T;  2NW9 A;  4AIU A;  3ZMV B;  4CN4 A;  3I9Y A;  2QA7 A;  2X66 A;  5ABF A;  3CX8 B;  2BZB A;  5L3D B;  3AAE B;  3RQU A;  5JRE A;  4P0B A;  1NWM X;  3VKH A;  4X64 T;  5CB4 E;  4NUU A;  5AQP B;  5L3B B;  4NXN T;  3P4Q A;  4IL4 A;  4ZI2 D;  4TNW A;  4KHP T;  3RF1 A;  3F57 A;  2YN6 A;  4MLK A;  3LK3 B;  3SFE A;  3N5L A;  1HNW T;  4UVC B;  2BG9 C;  3I0Q A;  2L3L A;  3N9N A;  4ZS2 A;  2XAS B;  2CRB A;  3V5S A;  1HFA A;  3TLT A;  4GYR A;  2XAQ B;  2WMO A;  1UUS A;  2OV9 A;  3OYX A;  3SWH A;  2J62 A;  2I6H A;  5FY1 A;  3AE1 A;  5LYJ E;  4PJM A;  5TAO A;  2CBI A;  1S35 A;  5LG3 A;  4AKL A;  4GKK T;  2X9X A;  1IBK T;  4YLH A;  3K3N A;  3ZCI A;  5FXV A;  4IE6 A;  1WR0 A;  4DR7 T;  2WAU A;  4GYS A;  4HWD A;  4DVD A;  3SS1 A;  3J9X 1;  1J5E T;  4AKG A;  1D0Z A;  2NOX A;  4DR6 T;  3AE6 A;  5L3C B;  1YD8 G;  5CA0 E;  4AQF A;  3MZK B;  5L2L A;  3WAK A;  3UUL A;  4HFE A;  3PU3 A;  5FKY A;  2LOP A;  3I1A A;  4IT4 A;  3U3I A;  3O9X A;  3ZT7 A;  1I94 T;  3ONX A;  2A9U A;  5AQI B;  3ANW A;  4CXW A;  3WI3 A;  5JDF A;  5CA1 E;  4TZ4 C;  4MBQ A;  1HR0 T;  1VOM A;  4UF0 B;  1ZEE A;  3RIF A;  2H7O A;  5LG4 A;  4OYK A;  2MTQ A;  4ZZC A;  1BR2 A;  1YXR A;  2QRX A;  4NUV A;  1E7P A;  2WM9 A;  1AJ3 A;  4U2Z A;  2BKN A;  2F4V T;  3OVU A;  3KV9 A;  1MIV A;  4WNK A;  3FHN A;  3ZYM A;  2D0T A;  4LF7 T;  4OFZ A;  4HFC A;  2V7M A;  4DR3 T;  3PUV F;  5AQL B;  3JCF A;  5J2U E;  4ZI7 E;  4DUY T;  4FI5 A;  5HXE A;  4HWH A;  2BVM A;  3FZH B;  3NZP A;  1S94 A;  1BR4 A;  2UXN B;  3MA9 A;  3AVR A;  5H6Q B;  4DBR A;  4DV0 T;  4WBO A;  4ERR A;  2XQ6 A;  4O4H E;  2D9D A;  4GK5 E;  3T8O A;  2IDO B;  2FJE A;  2LJL A;  2X0H A;  4KUM B;  2UXB T;  4U3C A;  4HWC A;  1T72 A;  3KV5 A;  3AA6 B;  5HYA A;  4DUZ T;  2XPK A;  1FMV A;  1IZN B;  5AQV B;  1W0A A;  4WW0 A;  4UVB B;  1X9B A;  2NP9 A;  2WBL A;  3UU3 A;  1M62 A;  1G73 A;  3ABV A;  3U78 A;  2OLT A;  4COF A;  3AE5 A;  3H37 A;  5LCY A;  1YW0 A;  3N9P A;  2W62 A;  2YDR A;  3SOL A;  2XQA A;  4ZEY A;  4WZX A;  5DJQ C;  4DMW A;  4Q25 A;  5LGN B;  3UTK A;  4X62 T;  3G06 A;  4HFH A;  2KMF A;  2LSY A;  3AE8 A;  3UT5 E;  1XNR T;  2VKJ A;  3PU8 A;  3PUA A;  3RIU A;  2J4G A;  2CA5 A;  3FZF B;  4O8S A;  2VK9 A;  4GOU A;  3UUX B;  5AQH B;  4YSY A;  4H9R C;  3ZT5 A;  2CLY B;  2ODV A;  3JAE A;  3H3M A;  4YHH T;  3EDU A;  3FZM B;  3AA0 B;  4TNV A;  2CMR A;  4AKH A;  2RP4 A;  1FEW A;  2W61 A;  1T98 A;  4YFS A;  3LBX B;  3P8C D;  3P4R A;  2EHO B;  2QGS A;  4KHZ F;  2A3D A;  1M7K A;  4P09 A;  3ZMZ B;  3IHR A;  5JDN A;  3P4P A;  2I59 A;  4O4J E;  2J47 A;  4HN9 A;  5FYM A;  2BS2 A;  1R8I A;  5ABF B;  4G63 A;  4LF9 T;  3NVO A;  3C50 A;  3OPC A;  2IW5 B;  3AEA A;  2V1D B;  3HKD E;  3CIR A;  4JI8 T;  3D0T A;  4X5T A;  1XMO T;  2B1E A;  2UXD T;  4K0U A;  1FMW A;  2XQ8 A;  3MAC A;  3ZKR A;  1UX5 A;  1KEY A;  1KF6 A;  3QK6 A;  3OJA A;  2W0G A;  2X68 A;  4O4L E;  4UF0 A;  2VQF T;  2VL0 A;  4LMJ A;  4DV5 T;  2NTY A;  4M1P A;  3PUY F;  3TLU A;  5JVD E;  2FUP A;  4ZI3 C;  2XHE B;  2CXF A;  4U74 A;  4AKI A;  2LHN A;  4MFR A;  5FVK A;  1ZHC A;  2N9D A;  4B3R T;  2KND A;  3UFE A;  1WFD A;  4ILB A;  2IAK A;  5GON E;  2JQ9 A;  3JC6 C;  2CXL A;  3C4X A;  2BS4 A;  4EIW A;  3AE2 A;  5FP3 A;  4OK0 A;  4BAY B;  4IDP A;  3FXE B;  2BVL A;  4JI3 T;  2H89 A;  1JNZ A;  2BG9 E;  2JJ9 A;  2KWH A;  3RH3 A;  1NAF A;  4CN1 A;  3VRA A;  5LBQ B;  2XM1 A;  3O1H A;  1MMD A;  4G2A A;  5AQU B;  2DWK A;  3CQG B;  3AAI A;  2X9H A;  3ANW B;  4X66 T;  2CHO A;  2XM2 A;  1XZY A;  5HXC A;  4LF6 T;  5HXS A;  3I0O A;  3HL6 A;  3H3A A;  3QC9 A;  3QUJ A;  4QHO A;  5FL0 A;  4B3M T;  5C2T A;  2YIN A;  1N36 T;  1SA0 E;  3NWI A;  3S4U A;  2HPL A;  2FJA A;  5BMV E;  4HEA A;  3QB5 K;  2CWO A;  3P4S A;  4AI6 A;  4YY3 T;  2XTL A;  3Q5E A;  2XQ7 A;  2KIN B;  3BQI A;  1D0X A;  5FL1 A;  3PUS A;  4ZXL A;  3KFW X;  2VL8 A;  4JI1 T;  3PUG A;  3RRC A;  4O2B E;  3UFG A;  4I0U A;  4HWI B;  4XBF B;  3LDQ B;  4KP3 C;  2C5K T;  4ZOL E;  2LSG A;  3ZMS B;  1VCS A;  3AVS A;  2LM2 A;  4V1A v;  3N9L A;  1JNR A;  2JQH A;  4DV7 T;  3JAF A;  1OWA A;  4HE8 A;  5LMN T;  4H63 H;  2J1D G;  3EAM A;  3TLS A;  2WU5 A;  2JQQ A;  2XAF B;  2Y6X A;  2XQ4 A;  2V7I A;  5M4Y A;  2CM0 A;  1FIO A;  5HEH A;  4KI0 F;  4CXX A;  2CLY C;  3KV6 A;  5F3J A;  5ETW A;  4TWD A;  4H9N C;  4AIS A;  1IBM T;  4LFC T;  3N2O A;  2E9X B;  3N9Q A;  3FZK B;  2LT3 A;  3PUX F;  1U4Q A;  3AAA B;  2EHO C;  5AQR B;  2UXC T;  5LB7 B;  4PJN A;  2BDE A;  1IAP A;  4P1N A;  3FZL B;  2AE9 A;  4HGA A;  1HTJ F;  4HTE A;  3ZJ1 A;  1MMN A;  1MIY A;  2NW7 A;  4MHC A;  4LF4 T;  2PJQ A;  4PK4 A;  4IE7 A;  3K8P C;  3ZST A;  4QXB B;  5AQK B;  5C8Y E;  5AQM B;  3I9W A;  2CPT A;  3X1D A;  5JDG A;  2WWV A;  2DNX A;  1WRD A;  5JRC A;  3LJC A;  4ILA A;  2M6B A;  2A72 A;  2HN2 A;  2JMK A;  4E7Z A;  4L0R A;  1B7T A;  3GWH A;  5HEG A;  3Q5X A;  2YDQ A;  2OA5 A;  4XAX B;  5AQT B;  3PUQ A;  4I43 B;  2BBH A;  4KBM B;  2MBG A;  2JIW A;  2D5U A;  1T7S A;  4H9P C;  3ZSS A;  1W9R A;  5FXW A;  2JQK A;  2E8I A;  3AA1 B;  2ZM0 A;  4A97 A;  1D1C A;  4PJL A;  4E7S A;  3AE7 A;  2V5D A;  4X1Y E;  4EZ4 A;  4AQF C;  2VKO A;  4EEB A;  5AQN B;  5HCM A;  4JI6 T;  2LEH A;  3KIN B;  2XZE A;  3OYZ A;  2DLR A;  1HF8 A;  3T1H T;  1O3X A;  2P9B A;  3A8Y C;  4QH4 A;  3CWZ B;  4A98 A;  1X79 A;  3AE4 A;  2WZH A;  5L4H A;  1J1J A;  5JDL A;  2XSA A;  4FJO A;  2VVS A;  2QVA A;  4ILU A;  2BS3 A;  4UEL A;  2DI4 A;  2LM9 A;  2WMN A;  3O1I A;  2KT9 A;  4QXH B;  1N34 T;  5EK4 A;  4EED A;  4EV6 A;  4U72 A;  3PUW F;  3Q9D A;  2Q9Q D;  2LSJ A;  5DQV A;  5J1G A;  2VUR A;  3N9O A;  2X67 A;  5DAB A;  1ZOY A;  2FJD A;  1KK7 A;  4GIW A;  4H63 V;  3ZEF B;  4GK0 E;  1G8X A;  2VKD A;  4HFB A;  3ZYL A;  5LNK A;  2WU2 A;  5BR8 T;  5AQF B;  2W00 A;  3IBP A;  3HR0 A;  2KSR A;  2MAW A;  1XMQ T;  4B3T T;  5FVL A;  2X51 A;  1OED E;  4BA9 A;  4U2Y A;  2V7K A;  2DL1 A;  5HWX A;  4TV9 E;  1GQE A;  3LG7 A;  2GK9 A;  3L09 A;  2E9X A;  4QX8 B;  5DQW A;  5JDH A;  3WAJ A;  4UEM A;  2HN1 A;  4U33 A;  4OX9 T;  4OHF A;  3QOF A;  1XWM A;  2LSI A;  3CK6 A;  5CJ5 A;  3KBT A;  3PV0 F;  4LFB T;  2V7J A;  2E9X C;  5KMG P;  3KDS E;  3P7I A;  5L47 A;  2E2A A;  4IDZ A;  3T1Y T;  5CFB A;  1V9D A;  2ES0 A;  5AQS B;  2WQY A;  4IDN A;  3HKC E;  2C5J A;  2B76 A;  3RIU C;  3JAD A;  3VRB A;  2DWG A;  4J2C A;  3EDV A;  3Q2M A;  3SRZ A;  4ZHQ E;  3FBZ A;  5AQG B;  2IIU A;  5LMU T;  2W2U A;  1HCI A;  4AXP A;  4TV8 E;  3IA3 A;  4XZC A;  5FY7 A;  3C51 A;  4ZI2 C;  2K9A A;  3AXJ B;  3C4Z A;  4YTP A;  4IHJ E;  3RQW A;  1W09 A;  4TX5 A;  4GKJ T;  3ZMT B;  2VQE T;  2ZMA A;  1HNX T;  2YU2 A;  4K0K T;  4O4I E;  3ZPO A;  2BG9 B;  3B13 A;  3CKD A;  3PDY A;  3A7M A;  4B3S T;  4BJM A;  5J2T E;  3AEC A;  2M6I A;  1UCU A;  2ACX A;  5L3F B;  3CML A;  2XAG B;  3DJB A;  2W63 A;  4P0A A;  5C3J A;  3Q5W A;  2D2S A;  4IE4 A;  3CPZ A;  3RYF E;  3ZT6 A;  4X1I E;  3ZCJ A;  1T8B A;  2N2N A;  2E5V A;  5JRC B;  3LFM A;  5FXZ A;  3TLV A;  1KNZ A;  3B57 A;  2L9Q A;  3BK9 A;  5HEO A;  1Z8U A;  2XQ5 A;  3VU7 H;  2HPJ A;  3UU4 A;  5ABE A;  2AXD S;  4ILC A;  2YK0 A;  4DV6 T;  3RKG A;  4JEU B;  3PJA A;  3R6N A;  3K1S A;  3GMI A;  2X0Y A;  4WBN E;  4IL9 A;  5JTG A;  1YKH B;  3NBX X;  3N2K E;  2PBI A;  4ANJ A;  5JR9 B;  5LXT E;  4LMK A;  4PFP A;  3UU6 A;  2HH7 A;  3ONJ A;  4F6R C;  4DR1 T;  3M3Z B;  5LHH B;  3PJA J;  1UX4 A;  4YHJ A;  5HCJ A;  1WCR A;  1QLB A;  2YEV C;  4MAL A;  2Y8D A;  3AEB A;  3ONL C;  4HKA A;  5CGM A;  5F5W A;  4EXT A;  4H9S E;  2H88 A;  4LFA T;  4JBW F;  1QUU A;  3BQL A;  3RIA A;  2VAS A;  1LRZ A;  1U5P A;  2Q9Q A;  2WZI A;  3Q5D A;  3RX6 A;  2FBW A;  2LRL A;  3GA8 A;  2K48 A;  5JDM A;  1LVF A;  2V6X A;  4EAH A;  4PW8 A;  4HWF A;  1LKX A;  2UUB T;  5FMN A;  4IST A;  5LHG B;  4NXM T;  4EZH A;  2LKG A;  3A5X A;  3AEF A;  1DU2 A;  4QXC B;  1HNZ T;  3CX7 B;  3W15 B;  2M67 A;  3L39 A;  2MPK A;  5FY0 A;  3O1J A;  4ZZB A;  2XSB A;  3PTR B;  1HS7 A;  3MK7 C;  2IUB A;  3BQK A;  2JMH A;  1ZKE A;  2W4X A;  5LA6 E;  5AQJ B;  4LML A;  2CE7 A;  1VRB A;  1OXZ A;  1CUN A;  1IJ6 A;  2G0U A;  2WDR A;  4H9Q C;  4A5X A;  1WR6 A;  2NW8 A;  1Z0P A;  5KX5 E;  2R6G F; 
#chains in the Genus database with same CATH homology
 4E7S A;  5JQG E;  3RYI E;  5LGN B;  3UTK A;  1HG5 A;  4X1Y E;  4EZ4 A;  2KMF A;  2VKO A;  4AQF C;  2LSY A;  3CVR A;  3UT5 E;  4KMC A;  1E1H B;  2VKJ A;  3PU8 A;  3PUA A;  3FBL A;  2ZM8 A;  2DCF A;  5IHY A;  3ZN1 B;  3ETV A;  4QX7 B;  2CA5 A;  2LEH A;  3KIN B;  2RA1 A;  4PJJ A;  4DBQ A;  4O8S A;  1QSD A;  2VK9 A;  1H7C A;  4EYU A;  4GOU A;  3OYZ A;  3LK2 B;  2Y48 B;  3N9M A;  2DLR A;  3AB3 B;  1HF8 A;  3UUX B;  1YKE B;  3OBV E;  3ZJ2 A;  1O3X A;  4H9R C;  3E22 E;  5LOV E;  3HKB E;  2CLY B;  2ODV A;  3EDU A;  2P9B A;  4AQG A;  3HKE E;  3AA0 B;  3CWZ B;  1X79 A;  5LGT B;  3KV4 A;  1D0Y A;  5ADX L;  2CMR A;  4AKH A;  3OKQ A;  2RP4 A;  1FEW A;  2W61 A;  1T98 A;  4L5G A;  1SHZ C;  3NZQ A;  4O2A E;  5JDL A;  5F8P A;  4FJO A;  4C90 A;  4YFS A;  4PNI A;  4ILU A;  3LBX B;  3P8C D;  4UEL A;  2DI4 A;  3J7Y q;  2K24 A;  2EHO B;  2LM9 A;  2QGS A;  2WMN A;  3O1I A;  4EYY R;  2KT9 A;  2A3D A;  4QXH B;  2KZ7 B;  4P09 A;  3ZMZ B;  2KXP B;  3IHR A;  5JDN A;  1BR0 A;  2KWI B;  4IE5 A;  3LK4 2;  2XAH B;  5EK4 A;  4YJ2 E;  3IEE A;  2I59 A;  2V7L A;  4JUY A;  4O4J E;  5AFU L;  4U72 A;  4HN9 A;  5EK2 A;  5FYM A;  4QWN B;  3Q9D A;  3MJX A;  4ISS A;  4G63 A;  1HG2 A;  2Q9Q D;  4N78 D;  4ZS3 A;  2LSJ A;  3C50 A;  4QKN A;  5DQV A;  5J1G A;  2ZM2 A;  3RYC E;  4CZZ B;  2WWU A;  3E0Z A;  2C5I T;  3N9O A;  4JLE A;  1MMA A;  3KVA A;  2IW5 B;  2H7V C;  3UUM A;  2Q9Q C;  2X67 A;  5EZY E;  2V1D B;  3HKD E;  5DAB A;  3GN5 A;  4IGU A;  3D0T A;  2SPC A;  3DP7 A;  2B1E A;  4DND A;  2XQY A;  1KK7 A;  5FXX A;  3ETU A;  4GIW A;  3KVB A;  4K0U A;  1WYC A;  5LGU B;  2PG8 A;  3R84 B;  1FMW A;  4H63 V;  3ZEF B;  3MAC A;  1G8X A;  2VKD A;  4GK0 E;  4I50 E;  3ZYL A;  5LHI B;  5LNK A;  1UX5 A;  2NWB A;  2W00 A;  3IBP A;  3HR0 A;  5HWY A;  1D1B A;  4IE0 A;  2X51 A;  2X9Y A;  4C91 A;  4Z8X A;  3IF8 B;  3QK6 A;  5HAX A;  5JR9 A;  3OJA A;  4BA9 A;  2W0G A;  2X68 A;  4O4L E;  4UF0 A;  1EZ3 A;  2V7K A;  5HWX A;  3PE0 A;  2NTY A;  4TV9 E;  4ZI3 D;  4ADZ A;  4M1P A;  5E0O A;  3FB2 A;  4X1K E;  3VHL A;  2WSS V;  3LG7 A;  4PAG A;  2GK9 A;  3L09 A;  2E9X A;  4QX8 B;  5DQW A;  5JVD E;  4UV8 B;  4DMW A;  5JDH A;  4ZI3 C;  2CWY A;  3F2E A;  2XHE B;  2CXF A;  3WAJ A;  1WYB A;  4U74 A;  4AKI A;  2MOZ A;  4UEM A;  2LHN A;  4MFR A;  1ZHC A;  2N9D A;  5JR9 C;  2N1G A;  4UIG A;  2KND A;  3RC3 A;  2D0U A;  4OHF A;  3CQC B;  3UFE A;  3JC6 D;  4DMV A;  4I4T E;  2IC9 A;  2LSI A;  2E9X D;  4A56 A;  4UXN B;  1IJ5 A;  1LVK A;  2IAK A;  3KBT A;  3K3Q C;  5GON E;  3K3O A;  5EK3 A;  3JC6 C;  2CXL A;  3C4X A;  2LOS A;  2YU1 A;  4EIW A;  2V7J A;  2E9X C;  4X20 E;  3UUN A;  3LBX A;  5KMG P;  4H9O C;  2EHO A;  3KDS E;  3P7I A;  5FP3 A;  5KDM C;  4UVA B;  2L8K A;  4OK0 A;  4AKR B;  2JPF A;  4BAY B;  3NRX A;  4IDZ A;  2NTX A;  4PK6 A;  3ZC0 A;  4EB6 E;  3FXE B;  2BVL A;  3RYH E;  2NW9 A;  1V9D A;  2ES0 A;  1ZV4 X;  3ZMV B;  2KLQ A;  2VB6 A;  1MNE A;  2JJ9 A;  2KWH A;  3PUR A;  3I9Y A;  3HKC E;  2C5J A;  3RH3 A;  2QA7 A;  1NAF A;  2X66 A;  4TUY E;  3CX8 B;  5LBQ B;  4ASK A;  2BZB A;  3AAE B;  3O1H A;  5L3D B;  1MMD A;  2DWG A;  5JRE A;  4G2A A;  1NWM X;  4P0B A;  4J2C A;  3EDV A;  3VKH A;  3Q2M A;  2DWK A;  3SRZ A;  4ZHQ E;  3CQG B;  5CB4 E;  2V26 A;  4NUU A;  3AAI A;  3FBZ A;  2X9H A;  5L3B B;  3ANW B;  4ZI2 D;  3F57 A;  1HCI A;  4AXP A;  4MLK A;  4TV8 E;  3LK3 B;  4XZC A;  5FY7 A;  3N5L A;  3C51 A;  5HXC A;  4ZI2 C;  2A2F X;  2K9A A;  4UVC B;  3C4Z A;  3I0Q A;  2UXX B;  5HXS A;  3I0O A;  3HL6 A;  3MKD A;  4DO0 A;  2L3L A;  3H3A A;  3N9N A;  3QC9 A;  4IHJ E;  4ZS2 A;  2XAS B;  3QUJ A;  1WLX A;  4QHO A;  5LJN A;  2YIN A;  4TX5 A;  1SA0 E;  3V5S A;  2H3R A;  2MYS A;  4HFV A;  3S4U A;  1HFA A;  2HPL A;  3ZMT B;  2ZMA A;  5BMV E;  4GYR A;  3FXD B;  4HEA A;  5HXR A;  2YU2 A;  2XAQ B;  2WMO A;  3OYX A;  4O4I E;  3ZPO A;  2CWO A;  4CI1 B;  3C98 B;  3SWH A;  3B13 A;  3CKD A;  4AI6 A;  2XTL A;  3C4W A;  4CI3 B;  3E08 A;  5FY1 A;  3PDY A;  2KIN B;  5LYJ E;  3BQI A;  4PJM A;  5TAO A;  1D0X A;  2JRK A;  4UV9 B;  2C0S A;  4BJM A;  3C64 A;  1S35 A;  3PUS A;  5J2T E;  4L9I A;  1UCU A;  2ACX A;  4AKL A;  2X9X A;  3ZLI A;  5L3F B;  3KFW X;  2VL8 A;  3CML A;  2Q9Q B;  2XAG B;  3RRW A;  3DJB A;  3PUG A;  4YLH A;  2W63 A;  3RRC A;  4P0A A;  2X9W A;  3K3N A;  2XAJ B;  4O2B E;  3Q5W A;  5LP6 E;  2D2S A;  3ZCI A;  4XBF B;  3V5U A;  4KP3 C;  4IE4 A;  3CPZ A;  3RYF E;  5FXV A;  4X1I E;  2C5K T;  3ZCJ A;  4IE6 A;  4ZOL E;  2N2N A;  3ZMU B;  5JRC B;  2VKH A;  3LFM A;  5FXZ A;  1KNZ A;  3B57 A;  4B6X A;  2WAU A;  2L9Q A;  2LSG A;  3BK9 A;  4GYS A;  3ZMS B;  2PFV A;  4DVD A;  3SS1 A;  3J9X 1;  4AKG A;  3O4X E;  3AVS A;  2K5B B;  2ODU A;  1D0Z A;  2NOX A;  2XUE A;  4V1A v;  5L3C B;  4PFO A;  3N9L A;  1YD8 G;  3VU7 H;  2HPJ A;  4AQF A;  3MZK B;  5CA0 E;  2LSK A;  5JDQ A;  5L2L A;  3WAK A;  3L3P A;  1OWA A;  3RKO A;  1MND A;  3UUL A;  3CQX C;  2YK0 A;  3RC8 A;  4HE8 A;  3PU3 A;  4JEU B;  2VWA A;  2LOP A;  3I1A A;  2J1D G;  3F31 A;  4H63 H;  3U3I A;  3ZC1 A;  3RPU A;  3O9X A;  3R6N A;  3GMI A;  3HI2 A;  3ONX A;  5L3G B;  2JQQ A;  2XAF B;  4WBN E;  2Y6X A;  3ANW A;  5LBM A;  1YKH B;  3NBX X;  4CXW A;  2V7I A;  5M4Y A;  2CM0 A;  3WI3 A;  1FIO A;  3N2K E;  5JDF A;  4CXX A;  2PBI A;  5CA1 E;  2CLY C;  3EVY A;  4TZ4 C;  3KV6 A;  4ANJ A;  4MBQ A;  5JR9 B;  5F3J A;  5ETW A;  1VOM A;  5LXT E;  4PK5 A;  3ESL A;  4H9N C;  4PFP A;  4UF0 B;  2HH7 A;  1Y64 B;  4IIJ E;  4F6R C;  1ZEE A;  2H7O A;  5LHH B;  4TN7 B;  1UX4 A;  5LG4 A;  4I55 E;  4OYK A;  2MTQ A;  4YHJ A;  1BR2 A;  2X0L B;  3N2O A;  2EHO D;  4NUV A;  2WM9 A;  2E9X B;  2YEV C;  3N9Q A;  4MAL A;  2IC6 A;  1AJ3 A;  2LT3 A;  2Y8D A;  1U4Q A;  5H6R B;  3AAA B;  3N2G E;  4HKA A;  2EHO C;  3KV9 A;  1MIW A;  3M65 A;  4PJN A;  2BDE A;  1IAP A;  1MIV A;  4WNK A;  4EXT A;  4H9S E;  3FHN A;  2LE8 A;  3ZYM A;  2D0T A;  4HGA A;  4OFZ A;  1HTJ F;  5JH7 E;  4HTE A;  2V7M A;  3ZJ1 A;  3KBU A;  1MMN A;  1MIY A;  2NW7 A;  5J2U E;  3VKG A;  1MMG A;  4MHC A;  4ZI7 E;  2PJQ A;  1QUU A;  3BQL A;  1D1A A;  1BR1 A;  3MXZ A;  4PK4 A;  5IYZ E;  2CXD A;  4FI5 A;  4IE7 A;  2BVM A;  2VAS A;  5HXE A;  3HA4 A;  1LRZ A;  3K8P C;  2DHR A;  1U5P A;  2Q9Q A;  4QXB B;  3NZP A;  3RX6 A;  5C8Y E;  1S94 A;  3I9W A;  3NRY A;  4JEH B;  3GA8 A;  1BR4 A;  4YJ3 E;  2K48 A;  5JDM A;  1LVF A;  5JDG A;  4BJN A;  2Z6E A;  2UXN B;  4EAH A;  4PW8 A;  3MA9 A;  3AVR A;  3AA7 B;  5H6Q B;  2DNX A;  1WRD A;  4DBR A;  1LKX A;  2LHR A;  3TKL B;  2CEA A;  5JRC A;  3LJC A;  4WBO A;  5FMN A;  4ERR A;  4O4H E;  4IST A;  5LHG B;  2CCQ A;  4EOZ B;  2A72 A;  4EZH A;  5KX5 E;  4GK5 E;  3T8O A;  5HXH A;  3A5X A;  2JMK A;  4QXC B;  2LJL A;  5A1L A;  3CX7 B;  4KUM B;  3W15 B;  4CXY A;  2M67 A;  4E7Z A;  3KV5 A;  3AA6 B;  4L0R A;  5FY0 A;  1B7T A;  5HYA A;  3GWH A;  3Q5X A;  3ZN0 B;  2OA5 A;  4XAX B;  5FNV E;  1FMV A;  3O1J A;  1IZN B;  3PUQ A;  4I43 B;  4CQI A;  3PTR B;  1HS7 A;  4KBM B;  3MK7 C;  3BQK A;  4WW0 A;  4UVB B;  5L3E B;  2ZLY A;  1HX8 A;  2NP9 A;  2WBL A;  2JMH A;  1ZKE A;  2MBG A;  5LA6 E;  1G73 A;  2D5U A;  3CX6 B;  4CI2 B;  3U78 A;  4H9P C;  5FXW A;  2CE7 A;  3AA1 B;  2E8I A;  1VRB A;  3DTO A;  3GN5 B;  2ZM0 A;  3H37 A;  4OYJ A;  5LCY A;  1US7 B;  5LJM A;  1D1C A;  1OXZ A;  1CUN A;  1YW0 A;  3N9P A;  1IJ6 A;  2W62 A;  3SOL A;  3ZYK A;  2G0U A;  5DJQ C;  4H9Q C;  1WR6 A;  2NW8 A;  1Z0P A;  3EUH A;  4PJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...