2CLYC

Subcomplex of the stator of bovine mitochondrial atp synthase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
b'LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE B CHAIN, MITOCHONDRIAL
publication title On the Structure of the Stator of the Mitochondrial ATP Synthase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 15
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2clyC01
2WSSV 2CLYC
chains in the Genus database with same CATH superfamily
2QRXA 2KWIB 1WYCA 5CB4E 3FXEB 4ZI7E 3GA8A 1S94A 3FBZA 3MZKB 1KNZA 4YY3T 1LRZA 3M65A 2HPLA 3EI0A 4HFHA 3HKEE 3AA7B 5JDGA 3PUWF 5FY7A 4H9SE 2DI4A 3SS1A 4DMWA 4EOZB 4O4LE 4Z91A 3ZYMA 3OPCA 4PFOA 2M67A 1XNQT 1T72A 4HWDA 3I9WA 2ZLYA 5AQQB 4TN7B 4OFZA 1YW0A 4PJJA 4CQIA 4IGUA 3ZEFB 2LM9A 1ZP0A 2XSBA 3RX6A 4B3TT 3JAFA 3V5SA 4UF0A 2FJAA 4H9RC 5ABFA 1LKXA 2XQ4A 1MIVA 2WWVA 4KUMB 2KWHA 5J2UE 2BKPA 2MPKA 3H37A 3IBPA 1VRBA 4DBRA 4PJLA 4AKIA 2CXFA 4Z90A 3JC6D 3LFMA 2L9QA 5GONE 4NXMT 2X67A 2N1GA 2K3WA 2YU1A 3AAEB 4JEHB 2JQ9A 1T8BA 3AEBA 2HPJA 4X1KE 3PV0F 1IJ5A 4YFSA 1E2AA 4ZI3C 4YTPA 3ZCJA 2XM2A 5FVKA 4OK0A 5AQNB 2W67A 5JRCB 3F2EA 1E1HB 4P1NA 2XQAA 2XM1A 3A5XA 4DR2T 3N9OA 1UX5A 1WRDA 2WWUA 3CQCB 5LBMA 2XQ9A 4YSZA 3RQWA 1ZV4X 2VQET 4ILUA 2CE7A 5KX5E 1HFAA 4HFCA 3EDUA 4U72A 5JDLA 5IHYA 3RRWA 4DV6T 4IIJE 2XAQB 1NEKA 1UUSA 1R8IA 1D0ZA 3UU8A 4ILAA 3UUBA 3P4PA 4GK0E 3BQLA 5JH7E 1CHUA 1HCIA 2K24A 3RYIE 3ZT6A 2KXPB 3AE4A 4JI0T 2LSYA 1J1JA 4LMLA 3PUYF 2WB5A 3NZPA 3ZT7A 1Z8UA 3HKBE 1XZYA 2BG9E 3JADA 2RPAA 2B76A 3MXZA 2LRLA 2CPTA 4HE8A 5HYAA 4P0BA 2DWGA 5L3FB 1J5ET 3RF1A 4AQYT 4QH4A 5HWYA 4OX9T 2VVNA 5JVDE 2W62A 3WAJA 3ONLC 1NWMX 4HFDA 1T98A 2XJ7A 3DJBA 2NTYA 1XDOA 2DL1A 1IZNB 1YQ4A 1HNWT 4YLHA 4JI2T 4GK5E 2LLYA 3ONJA 4H63V 5BMVE 2XUEA 2I6HA 1FEWA 5LHHB 2V7JA 3D0TA 4UEMA 4CXXA 5ABFB 4AXPA 1YQ3A 5DABA 2Y8DA 4X62T 3ZN0B 3E22E 3A8YC 4HGAA 4ZS2A 1WFDA 1O3XA 4JI3T 2NTXA 5ABHA 4IL9A 4ZI2D 3X1DA 4DV0T 3ZT5A 4B3ST 4QH1A 3B5MA 4EZHA 1HTJF 3L09A 3P4WA 2BKOA 3ETUA 3LBXA 1ZOYA 3P4QA 3WI3A 4JI1T 2V7KA 1MIYA 3N9PA 4DR1T 2UXDT 3UFEA 2SPCA 2V26A 1XMQT 2LM2A 2XY8B 4AQGA 2BDEA 5HCJA 3KV9A 4YXDA 3IF8B 3N9NA 2BS4A 3C64A 1N33T 2ZMAA 3IEEA 2LKHA 2CLYB 5FY0A 1D1CA 3T1YT 3FBLA 5FXZA 2W00A 2WY2A 3FZHB 2ODUA 3OVUA 5DJQC 3LSVA 1OWAA 2V7IA 4UVAB 2J47A 3K3QC 2UXCT 5FKYA 3MA9A 2W0GA 4NIQA 5HWXA 1MMGA 3AEEA 2KINB 4EXTA 4YTNA 3NZQA 2ZM0A 3F31A 5L3DB 1HX8A 4YJ2E 4LF9T 2D2SA 5EK2A 3N9LA 4X65T 4DVDA 2BVLA 3AB3B 2I0MA 4EEBA 1AJ3A 2LHRA 4EIWA 5HEOA 2N2NA 1LVFA 3KINB 3MJXA 3ZPOA 2XAFB 3P4RA 2XTLA 2FJEA 2VVSA 2KMFA 4XZCA 4A5XA 2PFVA 3J7Yq 3BK9A 4U3CA 2KNDA 5CGMA 2L8KA 4WBOA 2CBIA 3QB5K 4JI7T 2CA5A 3A7MA 3C4WA 4QWNB 3U78A 3RC8A 4PK5A 3UUMA 3AE8A 2IW5B 1UX4A 2XAHB 1U4QA 4I0UA 5LNKA 3SWHA 3GMIA 4GKJT 2A72A 2VQFT 4U7YA 5JRCA 5FNVE 5LA6E 3VKHA 4X1IE 2X9XA 1KNPA 3CK6A 1UCUA 2C5KT 2A3DA 3CMLA 3RKOA 2CWOA 3AAAB 5FL1A 3VHLA 4H9PC 5CFBA 1EZ3A 2UUCT 4FI5A 3TLTA 2WU2A 3UULA 3QNUA 3PU8A 1ZEEA 2LJLA 1VOMA 2X9WA 3C4XA 4PNIA 4CI2B 4MALA 5CA1E 4C91A 1DU2A 1GQEA 2CBJA 1ZKEA 2WP9A 2M6BA 2XQ8A 1J5WA 2IHR1 2JIWA 4MBQA 4ZHQE 5LYJE 3NKZA 5L3EB 2VB6A 1HG5A 4U7IA 2Q9QD 4CI1B 3FHNA 3B13A 1BR2A 1HNXT 3S4UA 1MMNA 5LP6E 4H9OC 1WR0A 2NW8A 3VR9A 4DR4T 4CXWA 1V9DA 4E7ZA 3DP7A 3CQGB 2VKDA 2VKHA 5ABGA 5CA0E 3AECA 3PU3A 3NWIA 3JC6C 2K5BB 2MAWA 4UXNB 3AA6B 1Z0PA 2W61A 5FYMA 2XZEA 3AE1A 4ILCA 5J0ZA 4WBNE 2YN6A 2P9BA 4LF5T 1IBMT 1YKHB 3PUXF 3CPZA 3SFDA 5LBQB 2KZ7B 4XBFB 2CLYC 4NUUA 5AQMB 4A98A 2V1DB 1QSDA 4PW8A 1U5PA 4DUYT 4EV6A 2HHHT 3CKDA 3MACA 4PK6A 2JQHA 1E7PA 4K0KT 4WZXA 4KI0F 3K3NA 4IE0A 4JI4T 2PG8A 2XQ5A 5LG4A 2X9YA 1XMOT 5HXSA 3C4ZA 4U33A 3K8PC 4DV1T 4QXHB 2OA5A 4QKNA 5JREA 4OHFA 4MLKA 3AXJB 1N34T 4NPPA 5FL0A 1SUMB 2E5LT 1UURA 3ANWB 1OEDB 4HEAA 5JDQA 3T8OA 2FJBA 2J62A 2XQ3A 3QUJA 1HF8A 4EYYR 3JAEA 5AQHB 4BJMA 4OYKA 5LCYA 1YD8G 1WYBA 3FXDB 4DR5T 2YK0A 3EDVA 2WMOA 5L3GB 3Q2MA 3RC3A 2F4VT 3C51A 4IDNA 5AQOB 5DQWA 3RHWA 2YU2A 2BG9C 3LK3B 5HXRA 5HAXA 4I55E 4BA9A 3IHRA 4GOUA 5AQSB 2G0UA 3SFEA 3G06A 2CRBA 1NAFA 4WNKA 1HX1B 3P8CD 2UXBT 4TX5A 4L0RA 2DWKA 2Z6EA 4DV4T 4JV5T 1M7KA 5AQVB 5FY1A 5H6RB 1VCSA 3W15B 3RPUA 3RI5A 2H7OA 3KVBA 5L4HA 3H3MA 5HXHA 1HNZT 4UV8B 3TLVA 1FMWA 4TV8E 4AKLA 4IDPA 2VL0A 3DTOA 4PFPA 4ZI2C 3BQIA 3I9YA 2BBHA 4JI8T 4HKAA 2Q9QB 5C2TA 3O4XE 3BQKA 2V6YB 2DHRA 4ZEYA 4DV3T 3OJAA 3N9QA 1MMAA 3CWZB 1N36T 3OYZA 2IUBA 4JUYA 4E7SA 3H3AA 5L2LA 3HL6A 5A1LA 2NOXA 3ZYKA 3PDYA 4B3RT 3LK2B 3AEGA 3ZMVB 5LGTB 2WZIA 2WU5A 4HFIA 2EHOD 2E2AA 3KV5A 4YSYA 2ES0A 3O9XA 4YSXA 5AQJB 2HN1A 1IBLT 3Q5DA 4B3MT 4FJOA 2X0YA 5LG3A 3UUXB 5AQRB 3AEAA 5E0OA 4DO0A 2R6GF 2FBWA 1BR4A 1MNEA 3UU5A 2JMKA 2WSSV 2V8SV 3P4SA 1W0AA 2IC6A 1HS7A 3VKGA 2NP9A 2VKOA 3ZSTA 3QK6A 4LF6T 2NW9A 3ZLIA 4A97A 5LB7B 4GIWA 4F6RC 1KFYA 1WLXA 1BR0A 3L3PA 3ZMUB 3WAKA 5L3BB 2JRKA 4LF8T 4IE4A 2ACZA 1OXZA 3O1HA 4LF7T 3V5UA 5JDMA 2LKGA 3F57A 1MNDA 1OEDC 4PK4A 4AKRB 2GK9A 3AE3A 4DR6T 2N9DA 4U74A 4CN6A 2JQKA 4U2YA 3SOLA 4IT4A 1JNZA 5LMNT 2X0LB 4JBWF 4GYRA 4LMJA 5AQFB 3KDSE 2XAJB 4KX6A 5JDNA 3PUVF 2X51A 3PUSA 3N5LA 2E8IA 1FJGT 2QYWA 4HFVA 2XPKA 4KP3C 3HKDE 3ABVA 1X79A 1L0VA 5TAOA 3RRCA 3RYCE 4KHPT 4IDQA 3I0QA 4ZZCA 3FB2A 2ZM2A 2FUPA 1I6ZA 4CN1A 4Q25A 3P7IA 3GWHA 2CWYA 3ONXA 1KF6A 1HG2A 3AXJA 2YDRA 2OLTA 2A2FX 2V5DA 4WW0A 5FXWA 2BG9B 4X1YE 1FIOA 1IAPA 4ZZBA 3ANWA 1OEDA 2C5IT 1QLBA 4I4TE 5JDFA 4N78D 2WZHA 4YHJA 4ANJA 2CEAA 3N2KE 4AKGA 2HN2A 2E9XD 2LHNA 5HEHA 3FZKB 3RIUC 3Q5XA 4B6XA 4DBQA 3PJAA 4X20E 4PAGA 2RA1A 2IAKA 5JTGA 4EZ4A 5FXXA 4IDZA 2Q9QC 3OBVE 5LGNB 3GN5A 2LSGA 1SE7A 2BBJA 4A56A 3Q9DA 1KNRA 4UV9B 1MIWA 1G73A 2RP4A 5HXEA 5CJ5A 2IIUA 2QA7A 1QUUA 2EHOB 2X66A 2C5JA 3ZC1A 4TNVA 2ZM8A 4P09A 5F8PA 2H7VC 2MYSA 5DQVA 2WQYA 4XAXB 4NXNT 3RQUA 3R6NA 3N2OA 1BR1A 1B7TA 1T7SA 4DV7T 4TZ4C 1D0YA 5J1GA 3E08A 4HFEA 5HCMA 1S35A 4COFA 4IDOA 3O1IA 1N32T 2WCAA 5AQUB 2LOSA 1JNRA 5L4EA 1G8XA 4UELA 5KMGP 3FZMB 4UR9A 1D0XA 3RIUA 3ZKRA 2FJDA 2J1DG 2WBLA 3UU6A 1D1BA 3QC9A 5JR9B 4CN4A 3VR8A 2Q9QA 2BKNA 2V6YA 1YXRA 2ACXA 5LMUT 5FVLA 3AEFA 1IJ6A 4JI5T 1UGOA 2QGSA 3R84B 2H88A 4Z8XA 5HEGA 3UT5E 2VK9A 3AA1B 1Y01A 4AKHA 5LHIB 5FXVA 4U2ZA 5KXJA 2UUBT 3N2GE 3AE7A 3I0OA 3ZMZB 1W9RA 3AE5A 1XDPA 2CMRA 4YTMA 1ZHCA 5AFUL 5IUXA 1X9BA 2XQ6A 2YINA 2UUAT 3ZMTB 1CUNA 2K9AA 1Y64B 5F3JA 1I94T 2V7LA 4LFAT 4JLEA 3FZFB 4I50E 3PUAA 4HTEA 4X64T 3FZLB 4DIDB 3CX6B 5FP3A 4PJNA 4DR3T 3KV6A 3SRZA 4G2AA 4O2BE 2LSIA 1WCRA 4JEUB 5ABEA 4ADZA 3ZJ2A 3AVRA 3AA0B 2J4GA 1UK5A 4YHHT 3TLWA 4LFBT 3TLUA 3CQXC 4CI3B 4ZXLA 2YOEA 3TLSA 3GN5B 2W66A 4MHCA 4QHOA 3ZN1B 4OYJA 2A9UA 4IE7A 2E9XB 5LOVE 3K1SA 3ZYLA 4EGWA 3HR0A 2LEHA 3ZC0A 4QX7B 1M62A 5C8YE 4MFRA 4DNDA 4IHJE 4PJMA 4AISA 3LG7A 3L8RA 3ESLA 4KHZF 3E0ZA 3UUNA 2LT3A 1XWMA 2XASB 3OYXA 2PTFA 4ZI3D 3MK7C 3PE0A 5IWAT 4JI6T 4DR7T 2CHOA 5BR8T 3AE2A 2K48A 3C50A 2LSJA 2VASA 4IREA 2LOPA 2BS2A 4ISTA 3QB5A 3OKQA 2BZBA 3VRBA 5EK4A 4EYUA 2EHOC 2AXDS 5H6QB 2NR4A 2JJ9A 2XHEB 2AE9A 4QX8B 2E5VA 1WR6A 2KSRA 5JQGE 3JCFA 3NRYA 3PUQA 3KVAA 3AE6A 5HXCA 4QH5A 4YT0A 1HR0T 4TNWA 3PJAJ 5IYZE 2CCQA 1KK7A 2BG9A 2VWAA 4M1PA 2I59A 4ISSA 4TWDA 3QOFA 4IE5A 5LJNA 4H9NC 2CHNA 5C3JA 4DMVA 3ZJ1A 5JR9C 3M3ZB 2D0TA 3RH3A 2M6IA 4HFBA 2IDOB 3HA4A 1D1AA 1FMVA 3N9MA 4UF0B 2JQQA 2JMHA 2B1EA 2YDQA 5JDHA 3UFGA 4TV9E 5AQIB 1YKEB 3UQ4A 2UU9T 4U31A 1W0BA 4EAHA 2NW7A 2V5CA 5M4YA 5AQLB 3RKGA 4DUZT 3LJCA 2DLRA 4H63H 4O2AE 2EHOA 5ETWA 4ZOLE 2IC9A 3AAIA 3O1JA 2XQYA 4V1Av 3NVOA 3CIRA 2NWBA 4LMKA 2W4XA 3I1AA 1KEYA 5KDMC 4TWHA 2WDQA 3LDQB 2LSKA 2H3RA 2X0HA 5EZYE 5F5WA 5FMNA 2PBIA 2UXNB 2YEVC 3L39A 4L9IA 4X5TA 2X68A 3UTKA 2CM0A 4LF4T 5L47A 1SA0E 3UU4A 3VRAA 3KBTA 3KFWX 4HWHA 1W09A 4C90A 2Y48B 4GKKT 2C0SA 4AI6A 1LVKA 4UVCB 2XQ7A 5EK3A 3PUGA 2VL8A 3MKDA 3RLFF 3ETVA 5JR9A 4DV2T 5LJMA 1SHZC 4UIGA 4IL4A 4G63A 2WMNA 5LXTE 4HWFA 2MBGA 4I43B 5J2TE 3AVSA 2H89A 2YDSA 1MMDA 4F8HA 4O4IE 4H9QC 4EEDA 4IE6A 1IBKT 4L5GA 4QXBB 2L3LA 2DNXA 4TWFA 5HEJA 2WDVA 2IMLA 5AQTB 2OV9A 3RYHE 2CXLA 4K0UA 4QXCB 2BS3A 3PURA 4AQFC 2E9XC 4J2CA 3VU7H 4BJNA 3Q5WA 2YKSA 1OEDE 4AIUA 3EAMA 3K3OA 3PTRB 4ERRA 1H7CA 3Q5EA 5LHGB 4BAYB 3CVRA 3OTOT 2MTQA 4ZS3A 4NUVA 4O8SA 5ADXL 4YJ3E 2KLQA 3AE9A 4X66T 3EABA 2DCFA 3IA3A 4P0AA 3TKLB 4TUYE 3J9X1 3P50A 4DV5T 5HEUA 3AEDA 2PJQA 4WYVA 2D0UA 3RIAA 2WS3A 2W2UA 1NENA 3ZCIA 3C98B 3RGLA 4HWCA 2V6XA 2XSAA 3PUZF 2D5UA 5LGUB 2D9DA 2W63A 2WAUA 4EB6E 2JPFA 5AQPB 2VKJA 4JYAT 2LRKA 3LK42 3ZMSB 4O4JE 4LFCT 2V7MA 2BVMA 2QVAA 2UXXB 4ILBA 4AQFA 5AQGB 2E9XA 3RYFE 2Y6XA 3UU3A 3HKCE 3U3IA 3ZSSA 3HI2A 2VURA 4CXYA 2CXDA 3EHZA 3EUHA 2ZM6T 3B57A 5AQKB 2WM9A 3UQ7A 4KBMB 1XNRT 3T1HT 4CZZB 2ODVA 3KBUA 3LBXB 4HN9A 4ASKA 3EVYA 2WDRA 2LE8A 3NRXA 3KV4A 1VCTA 2XAGB 2MOZA 3RIFA 4O4HE 3CX8B 2X9HA 3NBXX 3CX7B 4HWIB 2HH7A 5L3CB 2KT9A 4GYSA 4UVBB 4KMCA 1US7B
chains in the Genus database with same CATH topology
2KWIB 2LHRA 3ZMVB 5LGTB 4EIWA 1WYCA 3CQXC 5CB4E 2N2NA 1LVFA 3KINB 3FXEB 4CI3B 3MJXA 4ZI7E 2EHOD 3GA8A 1S94A 2XAFB 3ZPOA 2XTLA 3GN5B 3FBZA 2KMFA 3MZKB 3KV5A 4XZCA 4MHCA 4QHOA 2ES0A 3ZN1B 1KNZA 2PFVA 4OYJA 3O9XA 3J7Yq 3BK9A 1LRZA 2E9XB 4IE7A 5LOVE 3M65A 2HPLA 2KNDA 2L8KA 3HKEE 4WBOA 3AA7B 5JDGA 5FY7A 4H9SE 2DI4A 4FJOA 3SS1A 2CA5A 3ZYLA 4DMWA 3HR0A 4EOZB 4O4LE 3C4WA 2LEHA 3ZC0A 4QWNB 4QX7B 5C8YE 4MFRA 3U78A 3ZYMA 3RC8A 4PK5A 3UUMA 4DNDA 4IHJE 4PJMA 2IW5B 1UX4A 3LG7A 4PFOA 3UUXB 2XAHB 2M67A 5E0OA 1U4QA 5LNKA 3ESLA 4DO0A 3E0ZA 3SWHA 2LT3A 1BR4A 3GMIA 3UUNA 2XASB 3OYXA 1MNEA 4ZI3D 3MK7C 3PE0A 3I9WA 2JMKA 2WSSV 2A72A 2ZLYA 2K48A 2IC6A 3C50A 2LSJA 1HS7A 4TN7B 2VASA 4OFZA 1YW0A 5JRCA 2LOPA 2NP9A 3VKGA 2VKOA 5FNVE 4PJJA 4CQIA 4ISTA 3QK6A 5LA6E 4IGUA 3VKHA 2NW9A 3ZEFB 2LM9A 4X1IE 3ZLIA 3RX6A 3OKQA 2BZBA 2X9XA 3V5SA 4UF0A 4H9RC 1LKXA 1MIVA 5EK4A 4GIWA 4EYUA 4F6RC 2EHOC 1UCUA 1WLXA 2C5KT 1BR0A 2A3DA 3L3PA 5H6QB 2JJ9A 2XHEB 3CMLA 4KUMB 2KWHA 5J2UE 3RKOA 3H37A 4QX8B 2CWOA 3ZMUB 1WR6A 3IBPA 1VRBA 3WAKA 4DBRA 3AAAB 4PJLA 5L3BB 4AKIA 2CXFA 3VHLA 2JRKA 5JQGE 3NRYA 3JC6D 3PUQA 4IE4A 3KVAA 1OXZA 3O1HA 4H9PC 5HXCA 3V5UA 5JDMA 3LFMA 1EZ3A 2L9QA 5GONE 3F57A 4FI5A 1MNDA 2X67A 2N1GA 4PK4A 4AKRB 3UULA 3PU8A 1ZEEA 2GK9A 1VOMA 2LJLA 2YU1A 3AAEB 4JEHB 2X9WA 5IYZE 2N9DA 4U74A 3C4XA 2CCQA 1KK7A 4PNIA 2HPJA 4X1KE 2VWAA 4M1PA 2I59A 4CI2B 1IJ5A 3SOLA 4YFSA 4MALA 5CA1E 4ISSA 4C91A 1ZKEA 2X0LB 4GYRA 4ZI3C 4IE5A 3ZCJA 5LJNA 3KDSE 4H9NC 4MBQA 4ZHQE 2XAJB 5LYJE 4OK0A 5JDNA 5L3EB 4DMVA 2X51A 5JRCB 2VB6A 3ZJ1A 3PUSA 5JR9C 1HG5A 2D0TA 3F2EA 3N5LA 3RH3A 1E1HB 2E8IA 2Q9QD 4CI1B 3FHNA 3B13A 4HFVA 3A5XA 3HA4A 4KP3C 1BR2A 3HKDE 1D1AA 1FMVA 3N9MA 4UF0B 2JQQA 1X79A 3S4UA 1MMNA 2JMHA 5LP6E 2B1EA 1UX5A 3N9OA 4H9OC 5TAOA 1WRDA 2NW8A 2WWUA 4TV9E 5JDHA 3CQCB 5LBMA 1YKEB 3RRCA 4CXWA 3RYCE 1V9DA 4E7ZA 1ZV4X 3DP7A 4EAHA 3CQGB 2VKDA 3I0QA 2VKHA 4ILUA 2CE7A 5CA0E 3FB2A 2NW7A 5KX5E 2ZM2A 5M4YA 1HFAA 3PU3A 3LJCA 3EDUA 3JC6C 2K5BB 2DLRA 4H63H 3P7IA 4O2AE 4U72A 2EHOA 5JDLA 3GWHA 5ETWA 4ZOLE 2CWYA 2IC9A 5IHYA 3AAIA 4UXNB 3AA6B 3O1JA 1Z0PA 3ONXA 4IIJE 2XQYA 4V1Av 3RRWA 1HG2A 2XAQB 2W61A 1D0ZA 5FYMA 2NWBA 3I1AA 5KDMC 2A2FX 4WW0A 5FMNA 2LSKA 2H3RA 5EZYE 5FXWA 4WBNE 4GK0E 2P9BA 2PBIA 1YKHB 4X1YE 2UXNB 3BQLA 5JH7E 1FIOA 1HCIA 1IAPA 2YEVC 3ANWA 3CPZA 4L9IA 5LBQB 2K24A 2X68A 3RYIE 2CM0A 2KXPB 2KZ7B 2C5IT 3UTKA 4XBFB 2CLYC 4NUUA 2LSYA 4I4TE 5JDFA 4N78D 2V1DB 1QSDA 1SA0E 4PW8A 1U5PA 4YHJA 2CEAA 3N2KE 4ANJA 4AKGA 2LHNA 2E9XD 3KBTA 3KFWX 3NZPA 3HKBE 3Q5XA 4B6XA 4DBQA 4C90A 4X20E 4PAGA 2RA1A 2IAKA 2Y48B 3CKDA 3MACA 3MXZA 4EZ4A 4PK6A 5FXXA 4IDZA 2C0SA 4AI6A 2Q9QC 1LVKA 4HE8A 4UVCB 5HYAA 5EK3A 4P0BA 3PUGA 3K3NA 2DWGA 4IE0A 2VL8A 3OBVE 3MKDA 5L3FB 5LGNB 2PG8A 3GN5A 3ETVA 2LSGA 5JR9A 5LG4A 5LJMA 2X9YA 1SHZC 4UIGA 4A56A 3Q9DA 4G63A 5HXSA 2WMNA 5LXTE 4UV9B 1MIWA 3C4ZA 1G73A 2RP4A 2MBGA 5HWYA 3K8PC 4I43B 3AVSA 5J2TE 4QXHB 5HXEA 1MMDA 4O4IE 2QA7A 4H9QC 1QUUA 2EHOB 2OA5A 4QKNA 2X66A 4IE6A 5JVDE 2W62A 5JREA 2C5JA 4OHFA 3ZC1A 4L5GA 3WAJA 4MLKA 4QXBB 2L3LA 1NWMX 2ZM8A 1T98A 3DJBA 4P09A 2DNXA 5F8PA 2H7VC 2MYSA 5DQVA 2NTYA 4XAXB 1IZNB 3R6NA 3ANWB 3N2OA 4YLHA 1BR1A 1B7TA 4HEAA 3RYHE 2CXLA 4GK5E 5JDQA 4K0UA 3T8OA 4QXCB 4TZ4C 1D0YA 4H63V 5BMVE 3PURA 2XUEA 5J1GA 4AQFC 3QUJA 3E08A 1HF8A 2E9XC 4J2CA 1FEWA 5LHHB 2V7JA 3VU7H 3D0TA 4UEMA 4EYYR 4CXXA 4BJNA 1S35A 3Q5WA 4AXPA 3O1IA 4BJMA 5DABA 4OYKA 5LCYA 2Y8DA 3K3OA 3PTRB 3ZN0B 2LOSA 4ERRA 3E22E 1YD8G 1H7CA 1WYBA 3FXDB 4HGAA 1G8XA 4UELA 4ZS2A 5KMGP 2YK0A 5LHGB 1D0XA 1O3XA 2J1DG 2WBLA 3EDVA 4BAYB 3CVRA 2NTXA 2WMOA 1D1BA 4ZI2D 5L3GB 3QC9A 5JR9B 2MTQA 3Q2MA 3RC3A 3C51A 4ZS3A 4EZHA 2Q9QA 4NUVA 4O8SA 5DQWA 5ADXL 1HTJF 3L09A 2ACXA 2YU2A 4YJ3E 3LK3B 2KLQA 5HXRA 1IJ6A 3ETUA 3LBXA 5HAXA 2DCFA 4I55E 4BA9A 3WI3A 3IHRA 2QGSA 4GOUA 2G0UA 3R84B 3TKLB 4P0AA 2V7KA 4Z8XA 1MIYA 3N9PA 1NAFA 4WNKA 4TUYE 3J9X1 3P8CD 3UFEA 2VK9A 3AA1B 2SPCA 3UT5E 2V26A 4AKHA 5LHIB 5FXVA 4TX5A 4L0RA 2DWKA 2PJQA 2D0UA 2Z6EA 3ZCIA 3C98B 2D5UA 5LGUB 2W63A 3N2GE 2WAUA 4AQGA 2BDEA 3I0OA 4EB6E 5FY1A 3ZMZB 5H6RB 3KV9A 3W15B 3RPUA 2JPFA 2H7OA 2VKJA 3KVBA 2CMRA 5HXHA 1ZHCA 3IF8B 5AFUL 3LK42 3N9NA 3ZMSB 3C64A 4O4JE 2YINA 2ZMAA 3IEEA 2V7MA 4UV8B 3ZMTB 1CUNA 2K9AA 2CLYB 1Y64B 5F3JA 5FY0A 1FMWA 2BVMA 2UXXB 2V7LA 4TV8E 4AQFA 4AKLA 1D1CA 3DTOA 2E9XA 4JLEA 3FBLA 4PFPA 5FXZA 2Y6XA 2W00A 3HKCE 3RYFE 3U3IA 3HI2A 4I50E 3BQIA 4ZI2C 3I9YA 3PUAA 2ODUA 4CXYA 4HTEA 2CXDA 3EUHA 4HKAA 5DJQC 3CX6B 5FP3A 3B57A 4PJNA 2Q9QB 1OWAA 2WM9A 2V7IA 4KBMB 3O4XE 3KV6A 3BQKA 4UVAB 2DHRA 4CZZB 3SRZA 4G2AA 4O2BE 2LSIA 3OJAA 3N9QA 2ODVA 3KBUA 3K3QC 3LBXB 4HN9A 1MMAA 4ASKA 3EVYA 3MA9A 2W0GA 3CWZB 5HWXA 2LE8A 1MMGA 3NRXA 3KV4A 3OYZA 2XAGB 4JEUB 2MOZA 2KINB 4ADZA 4O4HE 3CX8B 4JUYA 4E7SA 3ZJ2A 4EXTA 3H3AA 3AVRA 3AA0B 5L2LA 2X9HA 3NZQA 3NBXX 3HL6A 3CX7B 2ZM0A 2HH7A 3F31A 5L3CB 5L3DB 5A1LA 2NOXA 2KT9A 1HX8A 3ZYKA 4YJ2E 3PDYA 2D2SA 5EK2A 3N9LA 4DVDA 2BVLA 4GYSA 4UVBB 3LK2B 4KMCA 1US7B 3AB3B 1AJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS V;  2CLY C; 
#chains in the Genus database with same CATH topology
 2QRX A;  2KWI B;  1WYC A;  5CB4 E;  3FXE B;  4ZI7 E;  3GA8 A;  1S94 A;  3FBZ A;  3MZK B;  1KNZ A;  4YY3 T;  1LRZ A;  3M65 A;  2HPL A;  3EI0 A;  4HFH A;  3HKE E;  3AA7 B;  5JDG A;  3PUW F;  5FY7 A;  4H9S E;  2DI4 A;  3SS1 A;  4DMW A;  4EOZ B;  4O4L E;  4Z91 A;  3ZYM A;  3OPC A;  4PFO A;  2M67 A;  1XNQ T;  1T72 A;  4HWD A;  3I9W A;  2ZLY A;  5AQQ B;  4TN7 B;  4OFZ A;  1YW0 A;  4PJJ A;  4CQI A;  4IGU A;  3ZEF B;  2LM9 A;  1ZP0 A;  2XSB A;  3RX6 A;  4B3T T;  3JAF A;  3V5S A;  4UF0 A;  2FJA A;  4H9R C;  5ABF A;  1LKX A;  2XQ4 A;  1MIV A;  2WWV A;  4KUM B;  2KWH A;  5J2U E;  2BKP A;  2MPK A;  3H37 A;  3IBP A;  1VRB A;  4DBR A;  4PJL A;  4AKI A;  2CXF A;  4Z90 A;  3JC6 D;  3LFM A;  2L9Q A;  5GON E;  4NXM T;  2X67 A;  2N1G A;  2K3W A;  2YU1 A;  3AAE B;  4JEH B;  2JQ9 A;  1T8B A;  3AEB A;  2HPJ A;  4X1K E;  3PV0 F;  1IJ5 A;  4YFS A;  1E2A A;  4ZI3 C;  4YTP A;  3ZCJ A;  2XM2 A;  5FVK A;  4OK0 A;  5AQN B;  2W67 A;  5JRC B;  3F2E A;  1E1H B;  4P1N A;  2XQA A;  2XM1 A;  3A5X A;  4DR2 T;  3N9O A;  1UX5 A;  1WRD A;  2WWU A;  3CQC B;  5LBM A;  2XQ9 A;  4YSZ A;  3RQW A;  1ZV4 X;  2VQE T;  4ILU A;  2CE7 A;  5KX5 E;  1HFA A;  4HFC A;  3EDU A;  4U72 A;  5JDL A;  5IHY A;  3RRW A;  4DV6 T;  4IIJ E;  2XAQ B;  1NEK A;  1UUS A;  1R8I A;  1D0Z A;  3UU8 A;  4ILA A;  3UUB A;  3P4P A;  4GK0 E;  3BQL A;  5JH7 E;  1CHU A;  1HCI A;  2K24 A;  3RYI E;  3ZT6 A;  2KXP B;  3AE4 A;  4JI0 T;  2LSY A;  1J1J A;  4LML A;  3PUY F;  2WB5 A;  3NZP A;  3ZT7 A;  1Z8U A;  3HKB E;  1XZY A;  2BG9 E;  3JAD A;  2RPA A;  2B76 A;  3MXZ A;  2LRL A;  2CPT A;  4HE8 A;  5HYA A;  4P0B A;  2DWG A;  5L3F B;  1J5E T;  3RF1 A;  4AQY T;  4QH4 A;  5HWY A;  4OX9 T;  2VVN A;  5JVD E;  2W62 A;  3WAJ A;  3ONL C;  1NWM X;  4HFD A;  1T98 A;  2XJ7 A;  3DJB A;  2NTY A;  1XDO A;  2DL1 A;  1IZN B;  1YQ4 A;  1HNW T;  4YLH A;  4JI2 T;  4GK5 E;  2LLY A;  3ONJ A;  4H63 V;  5BMV E;  2XUE A;  2I6H A;  1FEW A;  5LHH B;  2V7J A;  3D0T A;  4UEM A;  4CXX A;  5ABF B;  4AXP A;  1YQ3 A;  5DAB A;  2Y8D A;  4X62 T;  3ZN0 B;  3E22 E;  3A8Y C;  4HGA A;  4ZS2 A;  1WFD A;  1O3X A;  4JI3 T;  2NTX A;  5ABH A;  4IL9 A;  4ZI2 D;  3X1D A;  4DV0 T;  3ZT5 A;  4B3S T;  4QH1 A;  3B5M A;  4EZH A;  1HTJ F;  3L09 A;  3P4W A;  2BKO A;  3ETU A;  3LBX A;  1ZOY A;  3P4Q A;  3WI3 A;  4JI1 T;  2V7K A;  1MIY A;  3N9P A;  4DR1 T;  2UXD T;  3UFE A;  2SPC A;  2V26 A;  1XMQ T;  2LM2 A;  2XY8 B;  4AQG A;  2BDE A;  5HCJ A;  3KV9 A;  4YXD A;  3IF8 B;  3N9N A;  2BS4 A;  3C64 A;  1N33 T;  2ZMA A;  3IEE A;  2LKH A;  2CLY B;  5FY0 A;  1D1C A;  3T1Y T;  3FBL A;  5FXZ A;  2W00 A;  2WY2 A;  3FZH B;  2ODU A;  3OVU A;  5DJQ C;  3LSV A;  1OWA A;  2V7I A;  4UVA B;  2J47 A;  3K3Q C;  2UXC T;  5FKY A;  3MA9 A;  2W0G A;  4NIQ A;  5HWX A;  1MMG A;  3AEE A;  2KIN B;  4EXT A;  4YTN A;  3NZQ A;  2ZM0 A;  3F31 A;  5L3D B;  1HX8 A;  4YJ2 E;  4LF9 T;  2D2S A;  5EK2 A;  3N9L A;  4X65 T;  4DVD A;  2BVL A;  3AB3 B;  2I0M A;  4EEB A;  1AJ3 A;  2LHR A;  4EIW A;  5HEO A;  2N2N A;  1LVF A;  3KIN B;  3MJX A;  3ZPO A;  2XAF B;  3P4R A;  2XTL A;  2FJE A;  2VVS A;  2KMF A;  4XZC A;  4A5X A;  2PFV A;  3J7Y q;  3BK9 A;  4U3C A;  2KND A;  5CGM A;  2L8K A;  4WBO A;  2CBI A;  3QB5 K;  4JI7 T;  2CA5 A;  3A7M A;  3C4W A;  4QWN B;  3U78 A;  3RC8 A;  4PK5 A;  3UUM A;  3AE8 A;  2IW5 B;  1UX4 A;  2XAH B;  1U4Q A;  4I0U A;  5LNK A;  3SWH A;  3GMI A;  4GKJ T;  2A72 A;  2VQF T;  4U7Y A;  5JRC A;  5FNV E;  5LA6 E;  3VKH A;  4X1I E;  2X9X A;  1KNP A;  3CK6 A;  1UCU A;  2C5K T;  2A3D A;  3CML A;  3RKO A;  2CWO A;  3AAA B;  5FL1 A;  3VHL A;  4H9P C;  5CFB A;  1EZ3 A;  2UUC T;  4FI5 A;  3TLT A;  2WU2 A;  3UUL A;  3QNU A;  3PU8 A;  1ZEE A;  2LJL A;  1VOM A;  2X9W A;  3C4X A;  4PNI A;  4CI2 B;  4MAL A;  5CA1 E;  4C91 A;  1DU2 A;  1GQE A;  2CBJ A;  1ZKE A;  2WP9 A;  2M6B A;  2XQ8 A;  1J5W A;  2IHR 1;  2JIW A;  4MBQ A;  4ZHQ E;  5LYJ E;  3NKZ A;  5L3E B;  2VB6 A;  1HG5 A;  4U7I A;  2Q9Q D;  4CI1 B;  3FHN A;  3B13 A;  1BR2 A;  1HNX T;  3S4U A;  1MMN A;  5LP6 E;  4H9O C;  1WR0 A;  2NW8 A;  3VR9 A;  4DR4 T;  4CXW A;  1V9D A;  4E7Z A;  3DP7 A;  3CQG B;  2VKD A;  2VKH A;  5ABG A;  5CA0 E;  3AEC A;  3PU3 A;  3NWI A;  3JC6 C;  2K5B B;  2MAW A;  4UXN B;  3AA6 B;  1Z0P A;  2W61 A;  5FYM A;  2XZE A;  3AE1 A;  4ILC A;  5J0Z A;  4WBN E;  2YN6 A;  2P9B A;  4LF5 T;  1IBM T;  1YKH B;  3PUX F;  3CPZ A;  3SFD A;  5LBQ B;  2KZ7 B;  4XBF B;  2CLY C;  4NUU A;  5AQM B;  4A98 A;  2V1D B;  1QSD A;  4PW8 A;  1U5P A;  4DUY T;  4EV6 A;  2HHH T;  3CKD A;  3MAC A;  4PK6 A;  2JQH A;  1E7P A;  4K0K T;  4WZX A;  4KI0 F;  3K3N A;  4IE0 A;  4JI4 T;  2PG8 A;  2XQ5 A;  5LG4 A;  2X9Y A;  1XMO T;  5HXS A;  3C4Z A;  4U33 A;  3K8P C;  4DV1 T;  4QXH B;  2OA5 A;  4QKN A;  5JRE A;  4OHF A;  4MLK A;  3AXJ B;  1N34 T;  4NPP A;  5FL0 A;  1SUM B;  2E5L T;  1UUR A;  3ANW B;  1OED B;  4HEA A;  5JDQ A;  3T8O A;  2FJB A;  2J62 A;  2XQ3 A;  3QUJ A;  1HF8 A;  4EYY R;  3JAE A;  5AQH B;  4BJM A;  4OYK A;  5LCY A;  1YD8 G;  1WYB A;  3FXD B;  4DR5 T;  2YK0 A;  3EDV A;  2WMO A;  5L3G B;  3Q2M A;  3RC3 A;  2F4V T;  3C51 A;  4IDN A;  5AQO B;  5DQW A;  3RHW A;  2YU2 A;  2BG9 C;  3LK3 B;  5HXR A;  5HAX A;  4I55 E;  4BA9 A;  3IHR A;  4GOU A;  5AQS B;  2G0U A;  3SFE A;  3G06 A;  2CRB A;  1NAF A;  4WNK A;  1HX1 B;  3P8C D;  2UXB T;  4TX5 A;  4L0R A;  2DWK A;  2Z6E A;  4DV4 T;  4JV5 T;  1M7K A;  5AQV B;  5FY1 A;  5H6R B;  1VCS A;  3W15 B;  3RPU A;  3RI5 A;  2H7O A;  3KVB A;  5L4H A;  3H3M A;  5HXH A;  1HNZ T;  4UV8 B;  3TLV A;  1FMW A;  4TV8 E;  4AKL A;  4IDP A;  2VL0 A;  3DTO A;  4PFP A;  4ZI2 C;  3BQI A;  3I9Y A;  2BBH A;  4JI8 T;  4HKA A;  2Q9Q B;  5C2T A;  3O4X E;  3BQK A;  2V6Y B;  2DHR A;  4ZEY A;  4DV3 T;  3OJA A;  3N9Q A;  1MMA A;  3CWZ B;  1N36 T;  3OYZ A;  2IUB A;  4JUY A;  4E7S A;  3H3A A;  5L2L A;  3HL6 A;  5A1L A;  2NOX A;  3ZYK A;  3PDY A;  4B3R T;  3LK2 B;  3AEG A;  3ZMV B;  5LGT B;  2WZI A;  2WU5 A;  4HFI A;  2EHO D;  2E2A A;  3KV5 A;  4YSY A;  2ES0 A;  3O9X A;  4YSX A;  5AQJ B;  2HN1 A;  1IBL T;  3Q5D A;  4B3M T;  4FJO A;  2X0Y A;  5LG3 A;  3UUX B;  5AQR B;  3AEA A;  5E0O A;  4DO0 A;  2R6G F;  2FBW A;  1BR4 A;  1MNE A;  3UU5 A;  2JMK A;  2WSS V;  2V8S V;  3P4S A;  1W0A A;  2IC6 A;  1HS7 A;  3VKG A;  2NP9 A;  2VKO A;  3ZST A;  3QK6 A;  4LF6 T;  2NW9 A;  3ZLI A;  4A97 A;  5LB7 B;  4GIW A;  4F6R C;  1KFY A;  1WLX A;  1BR0 A;  3L3P A;  3ZMU B;  3WAK A;  5L3B B;  2JRK A;  4LF8 T;  4IE4 A;  2ACZ A;  1OXZ A;  3O1H A;  4LF7 T;  3V5U A;  5JDM A;  2LKG A;  3F57 A;  1MND A;  1OED C;  4PK4 A;  4AKR B;  2GK9 A;  3AE3 A;  4DR6 T;  2N9D A;  4U74 A;  4CN6 A;  2JQK A;  4U2Y A;  3SOL A;  4IT4 A;  1JNZ A;  5LMN T;  2X0L B;  4JBW F;  4GYR A;  4LMJ A;  5AQF B;  3KDS E;  2XAJ B;  4KX6 A;  5JDN A;  3PUV F;  2X51 A;  3PUS A;  3N5L A;  2E8I A;  1FJG T;  2QYW A;  4HFV A;  2XPK A;  4KP3 C;  3HKD E;  3ABV A;  1X79 A;  1L0V A;  5TAO A;  3RRC A;  3RYC E;  4KHP T;  4IDQ A;  3I0Q A;  4ZZC A;  3FB2 A;  2ZM2 A;  2FUP A;  1I6Z A;  4CN1 A;  4Q25 A;  3P7I A;  3GWH A;  2CWY A;  3ONX A;  1KF6 A;  1HG2 A;  3AXJ A;  2YDR A;  2OLT A;  2A2F X;  2V5D A;  4WW0 A;  5FXW A;  2BG9 B;  4X1Y E;  1FIO A;  1IAP A;  4ZZB A;  3ANW A;  1OED A;  2C5I T;  1QLB A;  4I4T E;  5JDF A;  4N78 D;  2WZH A;  4YHJ A;  4ANJ A;  2CEA A;  3N2K E;  4AKG A;  2HN2 A;  2E9X D;  2LHN A;  5HEH A;  3FZK B;  3RIU C;  3Q5X A;  4B6X A;  4DBQ A;  3PJA A;  4X20 E;  4PAG A;  2RA1 A;  2IAK A;  5JTG A;  4EZ4 A;  5FXX A;  4IDZ A;  2Q9Q C;  3OBV E;  5LGN B;  3GN5 A;  2LSG A;  1SE7 A;  2BBJ A;  4A56 A;  3Q9D A;  1KNR A;  4UV9 B;  1MIW A;  1G73 A;  2RP4 A;  5HXE A;  5CJ5 A;  2IIU A;  2QA7 A;  1QUU A;  2EHO B;  2X66 A;  2C5J A;  3ZC1 A;  4TNV A;  2ZM8 A;  4P09 A;  5F8P A;  2H7V C;  2MYS A;  5DQV A;  2WQY A;  4XAX B;  4NXN T;  3RQU A;  3R6N A;  3N2O A;  1BR1 A;  1B7T A;  1T7S A;  4DV7 T;  4TZ4 C;  1D0Y A;  5J1G A;  3E08 A;  4HFE A;  5HCM A;  1S35 A;  4COF A;  4IDO A;  3O1I A;  1N32 T;  2WCA A;  5AQU B;  2LOS A;  1JNR A;  5L4E A;  1G8X A;  4UEL A;  5KMG P;  3FZM B;  4UR9 A;  1D0X A;  3RIU A;  3ZKR A;  2FJD A;  2J1D G;  2WBL A;  3UU6 A;  1D1B A;  3QC9 A;  5JR9 B;  4CN4 A;  3VR8 A;  2Q9Q A;  2BKN A;  2V6Y A;  1YXR A;  2ACX A;  5LMU T;  5FVL A;  3AEF A;  1IJ6 A;  4JI5 T;  1UGO A;  2QGS A;  3R84 B;  2H88 A;  4Z8X A;  5HEG A;  3UT5 E;  2VK9 A;  3AA1 B;  1Y01 A;  4AKH A;  5LHI B;  5FXV A;  4U2Z A;  5KXJ A;  2UUB T;  3N2G E;  3AE7 A;  3I0O A;  3ZMZ B;  1W9R A;  3AE5 A;  1XDP A;  2CMR A;  4YTM A;  1ZHC A;  5AFU L;  5IUX A;  1X9B A;  2XQ6 A;  2YIN A;  2UUA T;  3ZMT B;  1CUN A;  2K9A A;  1Y64 B;  5F3J A;  1I94 T;  2V7L A;  4LFA T;  4JLE A;  3FZF B;  4I50 E;  3PUA A;  4HTE A;  4X64 T;  3FZL B;  4DID B;  3CX6 B;  5FP3 A;  4PJN A;  4DR3 T;  3KV6 A;  3SRZ A;  4G2A A;  4O2B E;  2LSI A;  1WCR A;  4JEU B;  5ABE A;  4ADZ A;  3ZJ2 A;  3AVR A;  3AA0 B;  2J4G A;  1UK5 A;  4YHH T;  3TLW A;  4LFB T;  3TLU A;  3CQX C;  4CI3 B;  4ZXL A;  2YOE A;  3TLS A;  3GN5 B;  2W66 A;  4MHC A;  4QHO A;  3ZN1 B;  4OYJ A;  2A9U A;  4IE7 A;  2E9X B;  5LOV E;  3K1S A;  3ZYL A;  4EGW A;  3HR0 A;  2LEH A;  3ZC0 A;  4QX7 B;  1M62 A;  5C8Y E;  4MFR A;  4DND A;  4IHJ E;  4PJM A;  4AIS A;  3LG7 A;  3L8R A;  3ESL A;  4KHZ F;  3E0Z A;  3UUN A;  2LT3 A;  1XWM A;  2XAS B;  3OYX A;  2PTF A;  4ZI3 D;  3MK7 C;  3PE0 A;  5IWA T;  4JI6 T;  4DR7 T;  2CHO A;  5BR8 T;  3AE2 A;  2K48 A;  3C50 A;  2LSJ A;  2VAS A;  4IRE A;  2LOP A;  2BS2 A;  4IST A;  3QB5 A;  3OKQ A;  2BZB A;  3VRB A;  5EK4 A;  4EYU A;  2EHO C;  2AXD S;  5H6Q B;  2NR4 A;  2JJ9 A;  2XHE B;  2AE9 A;  4QX8 B;  2E5V A;  1WR6 A;  2KSR A;  5JQG E;  3JCF A;  3NRY A;  3PUQ A;  3KVA A;  3AE6 A;  5HXC A;  4QH5 A;  4YT0 A;  1HR0 T;  4TNW A;  3PJA J;  5IYZ E;  2CCQ A;  1KK7 A;  2BG9 A;  2VWA A;  4M1P A;  2I59 A;  4ISS A;  4TWD A;  3QOF A;  4IE5 A;  5LJN A;  4H9N C;  2CHN A;  5C3J A;  4DMV A;  3ZJ1 A;  5JR9 C;  3M3Z B;  2D0T A;  3RH3 A;  2M6I A;  4HFB A;  2IDO B;  3HA4 A;  1D1A A;  1FMV A;  3N9M A;  4UF0 B;  2JQQ A;  2JMH A;  2B1E A;  2YDQ A;  5JDH A;  3UFG A;  4TV9 E;  5AQI B;  1YKE B;  3UQ4 A;  2UU9 T;  4U31 A;  1W0B A;  4EAH A;  2NW7 A;  2V5C A;  5M4Y A;  5AQL B;  3RKG A;  4DUZ T;  3LJC A;  2DLR A;  4H63 H;  4O2A E;  2EHO A;  5ETW A;  4ZOL E;  2IC9 A;  3AAI A;  3O1J A;  2XQY A;  4V1A v;  3NVO A;  3CIR A;  2NWB A;  4LMK A;  2W4X A;  3I1A A;  1KEY A;  5KDM C;  4TWH A;  2WDQ A;  3LDQ B;  2LSK A;  2H3R A;  2X0H A;  5EZY E;  5F5W A;  5FMN A;  2PBI A;  2UXN B;  2YEV C;  3L39 A;  4L9I A;  4X5T A;  2X68 A;  3UTK A;  2CM0 A;  4LF4 T;  5L47 A;  1SA0 E;  3UU4 A;  3VRA A;  3KBT A;  3KFW X;  4HWH A;  1W09 A;  4C90 A;  2Y48 B;  4GKK T;  2C0S A;  4AI6 A;  1LVK A;  4UVC B;  2XQ7 A;  5EK3 A;  3PUG A;  2VL8 A;  3MKD A;  3RLF F;  3ETV A;  5JR9 A;  4DV2 T;  5LJM A;  1SHZ C;  4UIG A;  4IL4 A;  4G63 A;  2WMN A;  5LXT E;  4HWF A;  2MBG A;  4I43 B;  5J2T E;  3AVS A;  2H89 A;  2YDS A;  1MMD A;  4F8H A;  4O4I E;  4H9Q C;  4EED A;  4IE6 A;  1IBK T;  4L5G A;  4QXB B;  2L3L A;  2DNX A;  4TWF A;  5HEJ A;  2WDV A;  2IML A;  5AQT B;  2OV9 A;  3RYH E;  2CXL A;  4K0U A;  4QXC B;  2BS3 A;  3PUR A;  4AQF C;  2E9X C;  4J2C A;  3VU7 H;  4BJN A;  3Q5W A;  2YKS A;  1OED E;  4AIU A;  3EAM A;  3K3O A;  3PTR B;  4ERR A;  1H7C A;  3Q5E A;  5LHG B;  4BAY B;  3CVR A;  3OTO T;  2MTQ A;  4ZS3 A;  4NUV A;  4O8S A;  5ADX L;  4YJ3 E;  2KLQ A;  3AE9 A;  4X66 T;  3EAB A;  2DCF A;  3IA3 A;  4P0A A;  3TKL B;  4TUY E;  3J9X 1;  3P50 A;  4DV5 T;  5HEU A;  3AED A;  2PJQ A;  4WYV A;  2D0U A;  3RIA A;  2WS3 A;  2W2U A;  1NEN A;  3ZCI A;  3C98 B;  3RGL A;  4HWC A;  2V6X A;  2XSA A;  3PUZ F;  2D5U A;  5LGU B;  2D9D A;  2W63 A;  2WAU A;  4EB6 E;  2JPF A;  5AQP B;  2VKJ A;  4JYA T;  2LRK A;  3LK4 2;  3ZMS B;  4O4J E;  4LFC T;  2V7M A;  2BVM A;  2QVA A;  2UXX B;  4ILB A;  4AQF A;  5AQG B;  2E9X A;  3RYF E;  2Y6X A;  3UU3 A;  3HKC E;  3U3I A;  3ZSS A;  3HI2 A;  2VUR A;  4CXY A;  2CXD A;  3EHZ A;  3EUH A;  2ZM6 T;  3B57 A;  5AQK B;  2WM9 A;  3UQ7 A;  4KBM B;  1XNR T;  3T1H T;  4CZZ B;  2ODV A;  3KBU A;  3LBX B;  4HN9 A;  4ASK A;  3EVY A;  2WDR A;  2LE8 A;  3NRX A;  3KV4 A;  1VCT A;  2XAG B;  2MOZ A;  3RIF A;  4O4H E;  3CX8 B;  2X9H A;  3NBX X;  3CX7 B;  4HWI B;  2HH7 A;  5L3C B;  2KT9 A;  4GYS A;  4UVB B;  4KMC A;  1US7 B; 
#chains in the Genus database with same CATH homology
 2KWI B;  2LHR A;  3ZMV B;  5LGT B;  4EIW A;  1WYC A;  3CQX C;  5CB4 E;  2N2N A;  1LVF A;  3KIN B;  3FXE B;  4CI3 B;  3MJX A;  4ZI7 E;  2EHO D;  3GA8 A;  1S94 A;  2XAF B;  3ZPO A;  2XTL A;  3GN5 B;  3FBZ A;  2KMF A;  3MZK B;  3KV5 A;  4XZC A;  4MHC A;  4QHO A;  2ES0 A;  3ZN1 B;  1KNZ A;  2PFV A;  4OYJ A;  3O9X A;  3J7Y q;  3BK9 A;  1LRZ A;  2E9X B;  4IE7 A;  5LOV E;  3M65 A;  2HPL A;  2KND A;  2L8K A;  3HKE E;  4WBO A;  3AA7 B;  5JDG A;  5FY7 A;  4H9S E;  2DI4 A;  4FJO A;  3SS1 A;  2CA5 A;  3ZYL A;  4DMW A;  3HR0 A;  4EOZ B;  4O4L E;  3C4W A;  2LEH A;  3ZC0 A;  4QWN B;  4QX7 B;  5C8Y E;  4MFR A;  3U78 A;  3ZYM A;  3RC8 A;  4PK5 A;  3UUM A;  4DND A;  4IHJ E;  4PJM A;  2IW5 B;  1UX4 A;  3LG7 A;  4PFO A;  3UUX B;  2XAH B;  2M67 A;  5E0O A;  1U4Q A;  5LNK A;  3ESL A;  4DO0 A;  3E0Z A;  3SWH A;  2LT3 A;  1BR4 A;  3GMI A;  3UUN A;  2XAS B;  3OYX A;  1MNE A;  4ZI3 D;  3MK7 C;  3PE0 A;  3I9W A;  2JMK A;  2WSS V;  2A72 A;  2ZLY A;  2K48 A;  2IC6 A;  3C50 A;  2LSJ A;  1HS7 A;  4TN7 B;  2VAS A;  4OFZ A;  1YW0 A;  5JRC A;  2LOP A;  2NP9 A;  3VKG A;  2VKO A;  5FNV E;  4PJJ A;  4CQI A;  4IST A;  3QK6 A;  5LA6 E;  4IGU A;  3VKH A;  2NW9 A;  3ZEF B;  2LM9 A;  4X1I E;  3ZLI A;  3RX6 A;  3OKQ A;  2BZB A;  2X9X A;  3V5S A;  4UF0 A;  4H9R C;  1LKX A;  1MIV A;  5EK4 A;  4GIW A;  4EYU A;  4F6R C;  2EHO C;  1UCU A;  1WLX A;  2C5K T;  1BR0 A;  2A3D A;  3L3P A;  5H6Q B;  2JJ9 A;  2XHE B;  3CML A;  4KUM B;  2KWH A;  5J2U E;  3RKO A;  3H37 A;  4QX8 B;  2CWO A;  3ZMU B;  1WR6 A;  3IBP A;  1VRB A;  3WAK A;  4DBR A;  3AAA B;  4PJL A;  5L3B B;  4AKI A;  2CXF A;  3VHL A;  2JRK A;  5JQG E;  3NRY A;  3JC6 D;  3PUQ A;  4IE4 A;  3KVA A;  1OXZ A;  3O1H A;  4H9P C;  5HXC A;  3V5U A;  5JDM A;  3LFM A;  1EZ3 A;  2L9Q A;  5GON E;  3F57 A;  4FI5 A;  1MND A;  2X67 A;  2N1G A;  4PK4 A;  4AKR B;  3UUL A;  3PU8 A;  1ZEE A;  2GK9 A;  1VOM A;  2LJL A;  2YU1 A;  3AAE B;  4JEH B;  2X9W A;  5IYZ E;  2N9D A;  4U74 A;  3C4X A;  2CCQ A;  1KK7 A;  4PNI A;  2HPJ A;  4X1K E;  2VWA A;  4M1P A;  2I59 A;  4CI2 B;  1IJ5 A;  3SOL A;  4YFS A;  4MAL A;  5CA1 E;  4ISS A;  4C91 A;  1ZKE A;  2X0L B;  4GYR A;  4ZI3 C;  4IE5 A;  3ZCJ A;  5LJN A;  3KDS E;  4H9N C;  4MBQ A;  4ZHQ E;  2XAJ B;  5LYJ E;  4OK0 A;  5JDN A;  5L3E B;  4DMV A;  2X51 A;  5JRC B;  2VB6 A;  3ZJ1 A;  3PUS A;  5JR9 C;  1HG5 A;  2D0T A;  3F2E A;  3N5L A;  3RH3 A;  1E1H B;  2E8I A;  2Q9Q D;  4CI1 B;  3FHN A;  3B13 A;  4HFV A;  3A5X A;  3HA4 A;  4KP3 C;  1BR2 A;  3HKD E;  1D1A A;  1FMV A;  3N9M A;  4UF0 B;  2JQQ A;  1X79 A;  3S4U A;  1MMN A;  2JMH A;  5LP6 E;  2B1E A;  1UX5 A;  3N9O A;  4H9O C;  5TAO A;  1WRD A;  2NW8 A;  2WWU A;  4TV9 E;  5JDH A;  3CQC B;  5LBM A;  1YKE B;  3RRC A;  4CXW A;  3RYC E;  1V9D A;  4E7Z A;  1ZV4 X;  3DP7 A;  4EAH A;  3CQG B;  2VKD A;  3I0Q A;  2VKH A;  4ILU A;  2CE7 A;  5CA0 E;  3FB2 A;  2NW7 A;  5KX5 E;  2ZM2 A;  5M4Y A;  1HFA A;  3PU3 A;  3LJC A;  3EDU A;  3JC6 C;  2K5B B;  2DLR A;  4H63 H;  3P7I A;  4O2A E;  4U72 A;  2EHO A;  5JDL A;  3GWH A;  5ETW A;  4ZOL E;  2CWY A;  2IC9 A;  5IHY A;  3AAI A;  4UXN B;  3AA6 B;  3O1J A;  1Z0P A;  3ONX A;  4IIJ E;  2XQY A;  4V1A v;  3RRW A;  1HG2 A;  2XAQ B;  2W61 A;  1D0Z A;  5FYM A;  2NWB A;  3I1A A;  5KDM C;  2A2F X;  4WW0 A;  5FMN A;  2LSK A;  2H3R A;  5EZY E;  5FXW A;  4WBN E;  4GK0 E;  2P9B A;  2PBI A;  1YKH B;  4X1Y E;  2UXN B;  3BQL A;  5JH7 E;  1FIO A;  1HCI A;  1IAP A;  2YEV C;  3ANW A;  3CPZ A;  4L9I A;  5LBQ B;  2K24 A;  2X68 A;  3RYI E;  2CM0 A;  2KXP B;  2KZ7 B;  2C5I T;  3UTK A;  4XBF B;  2CLY C;  4NUU A;  2LSY A;  4I4T E;  5JDF A;  4N78 D;  2V1D B;  1QSD A;  1SA0 E;  4PW8 A;  1U5P A;  4YHJ A;  2CEA A;  3N2K E;  4ANJ A;  4AKG A;  2LHN A;  2E9X D;  3KBT A;  3KFW X;  3NZP A;  3HKB E;  3Q5X A;  4B6X A;  4DBQ A;  4C90 A;  4X20 E;  4PAG A;  2RA1 A;  2IAK A;  2Y48 B;  3CKD A;  3MAC A;  3MXZ A;  4EZ4 A;  4PK6 A;  5FXX A;  4IDZ A;  2C0S A;  4AI6 A;  2Q9Q C;  1LVK A;  4HE8 A;  4UVC B;  5HYA A;  5EK3 A;  4P0B A;  3PUG A;  3K3N A;  2DWG A;  4IE0 A;  2VL8 A;  3OBV E;  3MKD A;  5L3F B;  5LGN B;  2PG8 A;  3GN5 A;  3ETV A;  2LSG A;  5JR9 A;  5LG4 A;  5LJM A;  2X9Y A;  1SHZ C;  4UIG A;  4A56 A;  3Q9D A;  4G63 A;  5HXS A;  2WMN A;  5LXT E;  4UV9 B;  1MIW A;  3C4Z A;  1G73 A;  2RP4 A;  2MBG A;  5HWY A;  3K8P C;  4I43 B;  3AVS A;  5J2T E;  4QXH B;  5HXE A;  1MMD A;  4O4I E;  2QA7 A;  4H9Q C;  1QUU A;  2EHO B;  2OA5 A;  4QKN A;  2X66 A;  4IE6 A;  5JVD E;  2W62 A;  5JRE A;  2C5J A;  4OHF A;  3ZC1 A;  4L5G A;  3WAJ A;  4MLK A;  4QXB B;  2L3L A;  1NWM X;  2ZM8 A;  1T98 A;  3DJB A;  4P09 A;  2DNX A;  5F8P A;  2H7V C;  2MYS A;  5DQV A;  2NTY A;  4XAX B;  1IZN B;  3R6N A;  3ANW B;  3N2O A;  4YLH A;  1BR1 A;  1B7T A;  4HEA A;  3RYH E;  2CXL A;  4GK5 E;  5JDQ A;  4K0U A;  3T8O A;  4QXC B;  4TZ4 C;  1D0Y A;  4H63 V;  5BMV E;  3PUR A;  2XUE A;  5J1G A;  4AQF C;  3QUJ A;  3E08 A;  1HF8 A;  2E9X C;  4J2C A;  1FEW A;  5LHH B;  2V7J A;  3VU7 H;  3D0T A;  4UEM A;  4EYY R;  4CXX A;  4BJN A;  1S35 A;  3Q5W A;  4AXP A;  3O1I A;  4BJM A;  5DAB A;  4OYK A;  5LCY A;  2Y8D A;  3K3O A;  3PTR B;  3ZN0 B;  2LOS A;  4ERR A;  3E22 E;  1YD8 G;  1H7C A;  1WYB A;  3FXD B;  4HGA A;  1G8X A;  4UEL A;  4ZS2 A;  5KMG P;  2YK0 A;  5LHG B;  1D0X A;  1O3X A;  2J1D G;  2WBL A;  3EDV A;  4BAY B;  3CVR A;  2NTX A;  2WMO A;  1D1B A;  4ZI2 D;  5L3G B;  3QC9 A;  5JR9 B;  2MTQ A;  3Q2M A;  3RC3 A;  3C51 A;  4ZS3 A;  4EZH A;  2Q9Q A;  4NUV A;  4O8S A;  5DQW A;  5ADX L;  1HTJ F;  3L09 A;  2ACX A;  2YU2 A;  4YJ3 E;  3LK3 B;  2KLQ A;  5HXR A;  1IJ6 A;  3ETU A;  3LBX A;  5HAX A;  2DCF A;  4I55 E;  4BA9 A;  3WI3 A;  3IHR A;  2QGS A;  4GOU A;  2G0U A;  3R84 B;  3TKL B;  4P0A A;  2V7K A;  4Z8X A;  1MIY A;  3N9P A;  1NAF A;  4WNK A;  4TUY E;  3J9X 1;  3P8C D;  3UFE A;  2VK9 A;  3AA1 B;  2SPC A;  3UT5 E;  2V26 A;  4AKH A;  5LHI B;  5FXV A;  4TX5 A;  4L0R A;  2DWK A;  2PJQ A;  2D0U A;  2Z6E A;  3ZCI A;  3C98 B;  2D5U A;  5LGU B;  2W63 A;  3N2G E;  2WAU A;  4AQG A;  2BDE A;  3I0O A;  4EB6 E;  5FY1 A;  3ZMZ B;  5H6R B;  3KV9 A;  3W15 B;  3RPU A;  2JPF A;  2H7O A;  2VKJ A;  3KVB A;  2CMR A;  5HXH A;  1ZHC A;  3IF8 B;  5AFU L;  3LK4 2;  3N9N A;  3ZMS B;  3C64 A;  4O4J E;  2YIN A;  2ZMA A;  3IEE A;  2V7M A;  4UV8 B;  3ZMT B;  1CUN A;  2K9A A;  2CLY B;  1Y64 B;  5F3J A;  5FY0 A;  1FMW A;  2BVM A;  2UXX B;  2V7L A;  4TV8 E;  4AQF A;  4AKL A;  1D1C A;  3DTO A;  2E9X A;  4JLE A;  3FBL A;  4PFP A;  5FXZ A;  2Y6X A;  2W00 A;  3HKC E;  3RYF E;  3U3I A;  3HI2 A;  4I50 E;  3BQI A;  4ZI2 C;  3I9Y A;  3PUA A;  2ODU A;  4CXY A;  4HTE A;  2CXD A;  3EUH A;  4HKA A;  5DJQ C;  3CX6 B;  5FP3 A;  3B57 A;  4PJN A;  2Q9Q B;  1OWA A;  2WM9 A;  2V7I A;  4KBM B;  3O4X E;  3KV6 A;  3BQK A;  4UVA B;  2DHR A;  4CZZ B;  3SRZ A;  4G2A A;  4O2B E;  2LSI A;  3OJA A;  3N9Q A;  2ODV A;  3KBU A;  3K3Q C;  3LBX B;  4HN9 A;  1MMA A;  4ASK A;  3EVY A;  3MA9 A;  2W0G A;  3CWZ B;  5HWX A;  2LE8 A;  1MMG A;  3NRX A;  3KV4 A;  3OYZ A;  2XAG B;  4JEU B;  2MOZ A;  2KIN B;  4ADZ A;  4O4H E;  3CX8 B;  4JUY A;  4E7S A;  3ZJ2 A;  4EXT A;  3H3A A;  3AVR A;  3AA0 B;  5L2L A;  2X9H A;  3NZQ A;  3NBX X;  3HL6 A;  3CX7 B;  2ZM0 A;  2HH7 A;  3F31 A;  5L3C B;  5L3D B;  5A1L A;  2NOX A;  2KT9 A;  1HX8 A;  3ZYK A;  4YJ2 E;  3PDY A;  2D2S A;  5EK2 A;  3N9L A;  4DVD A;  2BVL A;  4GYS A;  4UVB B;  3LK2 B;  4KMC A;  1US7 B;  3AB3 B;  1AJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...