2LRKA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Phosphocarrier protein HPr
total genus 39
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrkA00
2V6XA 4A5XA 3K1SA 1WCRA 4U3CA 2V6YB 5FVKA 5FVLA 2A9UA 2LRLA 2RPAA 2WY2A 2XZEA 3ZT7A 2DL1A 5CJ5A 1WFDA 4ZEYA 4U33A 2JQHA 2K3WA 2CPTA 2V6YA 4NIQA 4WZXA 4CN1A 4U2ZA 3ZSSA 3ZSTA 3ZT6A 2W2UA 2JQKA 4U7YA 4U31A 5CGMA 3ZT5A 1WR0A 4CN6A 4P1NA 4U2YA 3EABA 4CN4A 2WWVA 1YXRA 4U7IA 2LRKA 4IT4A 5LB7B 2MPKA 2JQ9A 2CRBA
chains in the Genus database with same CATH superfamily
1YQ4A 3AE5A 5L4HA 4IE7A 3AXJA 3FB2A 3R84B 3ZYLA 2A9UA 2XAFB 3I0OA 2W61A 3AVSA 2K9AA 3O4XE 4KX6A 3WI3A 2VL0A 5AQOB 4XBFB 2CLYC 3AA1B 3AE2A 2YU1A 2WBLA 3LG7A 2XAJB 5LBQB 1NENA 4F8HA 3FXEB 2VKHA 3PUQA 2L9QA 4ZOLE 5HEHA 4KUMB 2B76A 4P0BA 4JI7T 5AQTB 4X1KE 3W15B 3MACA 3CK6A 3UTKA 2G0UA 5AQKB 4U31A 3T1HT 4X65T 3E0ZA 4EYYR 4B3RT 5LGNB 5ABHA 2RA1A 3C4WA 2W0GA 2K5BB 3RQUA 4EOZB 3VKHA 3CX6B 5L3FB 2V8SV 3J9X1 4EEDA 3AB3B 3P4WA 4KHPT 1SUMB 4L5GA 4EYUA 2QVAA 3RYCE 3QB5K 2CRBA 3ETVA 3RYIE 3NZQA 2WCAA 4IL9A 4AQFA 2V6YB 4PJJA 2YDSA 4U72A 4ERRA 4LF9T 1G8XA 1J5WA 5LMUT 5F5WA 2OA5A 2FUPA 1LVKA 2X9YA 4OYKA 4YFSA 1J5ET 3CQXC 1U5PA 3KINB 3UFEA 2HPLA 2ZM6T 4HWFA 4DUYT 2CM0A 1U4QA 4X1YE 4HFBA 4Q25A 1S94A 4QH5A 2EHOC 2VKJA 2D2SA 3T8OA 2V1DB 5LBMA 4COFA 3HKBE 5ABFA 3AA0B 3ZC0A 3B5MA 2L8KA 1WR0A 2XAHB 5CA0E 1KNRA 3RYHE 4G2AA 2XQ3A 4DV6T 5LHHB 2UXCT 2BG9C 1UURA 3CX8B 5JTGA 1B7TA 1HTJF 3N9PA 2JRKA 3VRAA 2UUBT 3EUHA 2FJEA 2E2AA 4HWCA 2XASB 2DNXA 2BVMA 2CXDA 2E9XB 4X5TA 1EZ3A 1UGOA 1ZV4X 4ILCA 4TWDA 4BA9A 5LNKA 1J1JA 2IDOB 4O2BE 4WZXA 3RRCA 4EZ4A 1OXZA 3RIFA 3PUWF 5AQMB 1ZHCA 2B1EA 2CBJA 2W62A 4HWHA 4XAXB 5FY0A 2BKPA 3UUBA 4BJNA 1WYCA 4LF6T 4P09A 1O3XA 4EB6E 2UUAT 5FL0A 2LE8A 4KBMB 5CGMA 3T1YT 2LEHA 2WU5A 2DHRA 3P4PA 2XPKA 3BQIA 4GYRA 5AQRB 5HXRA 3CIRA 4IIJE 2F4VT 2E9XD 3DP7A 2YDRA 4JBWF 3C64A 2YEVC 2HN1A 1Y64B 2JQ9A 2M67A 3KBUA 3ZLIA 5AQGB 1T72A 4DR3T 3LK42 3ZYMA 2XAQB 2RPAA 1UK5A 2C5IT 3AEDA 3F31A 2QYWA 4O4LE 3VR8A 2NW9A 2IC9A 4HFHA 1ZEEA 5LP6E 2BDEA 2XQ9A 5LMNT 4YY3T 3UUXB 3OTOT 3CKDA 4MBQA 4JI1T 3JCFA 2MTQA 4ZI2C 5EK2A 3UUMA 3AE7A 1FIOA 2DWGA 2DWKA 4I55E 1FJGT 1FMWA 2CBIA 4NUUA 1N33T 3FXDB 3AE3A 2V7JA 4PNIA 4TNWA 5TAOA 4ISSA 4DR1T 4IHJE 3QOFA 4PK5A 5GONE 2NP9A 4C90A 4AXPA 2BVLA 3AAIA 4JI5T 3C50A 3HKEE 2LT3A 1HNZT 5IUXA 2PBIA 4ZI7E 1VCSA 3R6NA 4PJMA 2V7IA 3WAKA 4GKKT 2C0SA 5J0ZA 4NXMT 4GYSA 4X20E 2A2FX 2PFVA 2YKSA 2Y48B 3KFWX 2M6IA 4CI1B 3VKGA 2NTYA 3RRWA 1NEKA 1WCRA 2E9XC 2KWHA 2LM9A 2X9XA 2XSAA 1UX4A 2MAWA 3K1SA 5AQQB 1T8BA 2NOXA 2WMOA 1D0XA 4JEHB 5FVKA 3V5UA 2Y8DA 3LFMA 4TX5A 5FL1A 4AKIA 4LFAT 4YHJA 4GOUA 4HFCA 4MALA 3C51A 3J7Yq 3PDYA 5HEGA 1WRDA 2P9BA 2KMFA 2V26A 3GMIA 3C4ZA 3KV4A 4I43B 2CWYA 3GN5A 2XQ7A 2VK9A 2N9DA 3KV6A 2BBJA 1HG2A 1R8IA 2QGSA 3ANWB 3Q5XA 5EK4A 3UUNA 2UXDT 3MK7C 2BS2A 1IAPA 2PTFA 3H3MA 2V5DA 2EHOB 1XNRT 4HKAA 2W00A 3PJAJ 4H9RC 4M1PA 4V1Av 2X0LB 2J1DG 3BK9A 4WBOA 1V9DA 2FJBA 3UT5E 3ZMUB 1KK7A 4CI3B 3JC6C 3MZKB 2BG9E 2CE7A 1W0BA 2NW8A 3A7MA 5ABEA 2MPKA 4QXHB 4ZI2D 5L2LA 2VVNA 4A5XA 4UV8B 4X66T 1JNRA 3CQGB 2OLTA 3NKZA 1QUUA 3NRXA 1ZOYA 3QC9A 2LSGA 4FJOA 3TLTA 5AQNB 2VL8A 1WFDA 1HR0T 1M62A 2YINA 5KMGP 4UR9A 3A5XA 2EHOD 1YQ3A 2HH7A 2LKHA 3FZFB 3ZSSA 4EEBA 3ZSTA 1UUSA 2E5VA 3HI2A 3FBZA 4HFDA 2Q9QA 4O4JE 5EZYE 2KT9A 2WZHA 4U7YA 3SS1A 3EVYA 4HE8A 3S4UA 4MFRA 1S35A 3KDSE 5BMVE 5CB4E 3UULA 1OEDB 2VVSA 1N32T 1KNPA 1ZP0A 5A1LA 1YW0A 4DR4T 1OEDC 2ODUA 1ZKEA 5KXJA 4TWFA 1YKHB 3RLFF 2X67A 5L3GB 5JRCB 1T98A 5IWAT 5LG3A 2CXLA 3D0TA 1MMGA 3FBLA 3RYFE 3UU5A 2WS3A 4JV5T 2OV9A 2IC6A 4JEUB 1D0ZA 1MNEA 2LRLA 3RKOA 5LXTE 4UVAB 2BG9A 2IIUA 5LGUB 2LOSA 4A56A 2V7MA 4IL4A 3N9OA 4AI6A 3IBPA 4DV5T 5FMNA 3IF8B 5C3JA 5ADXL 5HWXA 3QK6A 1BR1A 2W2UA 2BZBA 4IDZA 4AQFC 2BBHA 3PUSA 4G63A 5FXZA 4HTEA 2LHRA 1VOMA 3I0QA 3P8CD 4Z8XA 3ZJ1A 4H9OC 4H9SE 4NUVA 4ZS2A 4H9NC 4YTPA 2X0YA 2BKOA 3PU8A 2XM2A 4X62T 2V5CA 4LFCT 1SE7A 3ABVA 1DU2A 3RKGA 5LG4A 1FMVA 2WQYA 4LMJA 5H6QB 3RIUC 5LJMA 3FHNA 3N5LA 3PUXF 5L3DB 2KINB 1HG5A 3AA7B 5FXVA 3LDQB 3ZMVB 3ZYKA 2PJQA 4O4HE 2YDQA 5FVLA 4LF4T 2Q9QD 2M6BA 4MLKA 3ZMTB 2R6GF 3TLWA 3CPZA 3VR9A 5J2TE 2UU9T 3PU3A 1W09A 4B3TT 3VU7H 4QKNA 2EHOA 5AQLB 4I50E 4Z91A 5AQFB 4EXTA 3G06A 4CN1A 5C2TA 2KZ7B 3MJXA 2E5LT 3TLVA 3Q5DA 3ZPOA 3AAAB 4BAYB 4DV7T 3KV9A 1KF6A 2VWAA 4TZ4C 1I6ZA 3OPCA 3OJAA 4KHZF 1KEYA 3KBTA 3O1HA 3OYZA 3LK3B 4QXBB 3PE0A 3ZN1B 4CXXA 5HAXA 2WAUA 1AJ3A 3DJBA 2YN6A 1M7KA 3UU3A 4XZCA 5F3JA 3RH3A 5DQVA 4U2YA 3TLSA 2I0MA 4PK4A 4IE4A 2CHOA 2HN2A 2VKDA 4K0UA 5DABA 2LRKA 3V5SA 4ZI3D 4A98A 3B13A 5JDHA 3N2OA 5JDLA 2K24A 5HXEA 5JH7E 3O9XA 4B6XA 2ZLYA 3ZCIA 4TV9E 3ZJ2A 2IHR1 1HNWT 2W66A 3H3AA 4IDNA 4TN7B 1WYBA 4JI3T 3PTRB 2WDVA 3K8PC 5HXCA 2W4XA 2XQAA 4U74A 3KVBA 3OYXA 5FP3A 5H6RB 1D0YA 1X9BA 3EI0A 3RC8A 4U33A 4WW0A 1XMQT 4ZXLA 2V6YA 3OBVE 4CZZB 4DV3T 1HFAA 3FZKB 2BKNA 3ONJA 2VB6A 3N9MA 3HKCE 5LCYA 1IBLT 3AEGA 1W0AA 1Z0PA 1HS7A 2X9HA 3UQ7A 2AXDS 3KVAA 4AKRB 2WSSV 3PURA 5AQVB 2H3RA 2X68A 2I59A 2Y6XA 3LBXA 3CQCB 4DV2T 4GKJT 4LFBT 5AFUL 4X1IE 5JQGE 2CEAA 4JI0T 2LOPA 3A8YC 2N1GA 1US7B 3B57A 1Y01A 3ESLA 4YTMA 3QB5A 2MOZA 2XM1A 3Q5EA 3MA9A 4H9PC 3VHLA 2NWBA 4ILUA 4O2AE 5HEJA 2D5UA 5LYJE 2XZEA 4DMVA 3AAEB 3ZEFB 2J62A 5CFBA 4AKGA 3I1AA 3IHRA 5LA6E 3P4SA 3AE9A 3AA6B 3P4RA 3SWHA 3UU4A 5ABGA 4AQGA 4DIDB 3RF1A 4YSYA 2K3WA 2ACZA 3AXJB 2XUEA 4HGAA 5C8YE 4L0RA 4QHOA 2E8IA 5AQJB 4H9QC 4ANJA 4E7ZA 4K0KT 3N9NA 4HFEA 3UQ4A 1FEWA 4GK0E 3F57A 2XAGB 1W9RA 1UCUA 2CA5A 4PJLA 4IE6A 5FY1A 2IAKA 2KLQA 5FYMA 2VASA 4IREA 2QRXA 3L39A 3L3PA 4P1NA 5FY7A 5CA1E 3N9LA 2VURA 1MIYA 4EGWA 3JADA 2E9XA 4F6RC 1XDPA 2XSBA 4IGUA 2ZM2A 5JDFA 3AEEA 2WB5A 3EDVA 3ETUA 3K3OA 3AECA 3JAEA 1SHZC 4H63H 2FJAA 4BJMA 2YOEA 4YSXA 3NZPA 4PJNA 2WY2A 4QX8B 4DV1T 5JDMA 1E7PA 1MMAA 4ZI3C 3RI5A 2VQET 1KNZA 2JQHA 4TUYE 4OHFA 3LSVA 3WAJA 1E1HB 5ABFB 2CHNA 3FZHB 4IDPA 4X64T 4P0AA 4LF8T 3LBXB 5AQUB 4UIGA 5J1GA 5JDQA 5L3CB 3GA8A 4DUZT 4PFPA 1IJ5A 2JQKA 2NR4A 3M65A 1LRZA 4WBNE 5ETWA 1LKXA 2J47A 4WYVA 1UX5A 2K48A 4UVCB 5HEUA 2LSIA 4GK5E 4LMKA 4YT0A 2Z6EA 4ZS3A 4YXDA 4O4IE 3BQLA 4CN4A 1BR0A 3PUYF 4DBRA 2XQ6A 4UF0A 3AEBA 1OEDE 3L09A 3ONXA 4H63V 4YLHA 5LB7B 3RPUA 2LSJA 1VRBA 3RQWA 2CCQA 3ZKRA 4DMWA 4EV6A 4DV0T 4U3CA 4OFZA 2LLYA 4CI2B 1NAFA 1IBKT 1WR6A 3PV0F 3ZMSB 1CHUA 1YKEB 2XQ5A 3FZMB 4AQYT 5HEOA 5CJ5A 2XHEB 2X66A 4ZEYA 4FI5A 2JPFA 3FZLB 3AE6A 5LOVE 4ADZA 3LK2B 4UEMA 2RP4A 3KV5A 3HKDE 4O8SA 4TNVA 5L4EA 2FJDA 4QXCB 2FBWA 3AEFA 2LKGA 3EAMA 2NW7A 2UXXB 3CX7B 1KFYA 3JAFA 5HCJA 3RC3A 3UFGA 3VRBA 3ZCJA 4LF5T 2WU2A 3PUVF 3NWIA 2V7KA 3IA3A 3GWHA 3ZMZB 4CN6A 2A3DA 1E2AA 2MYSA 4ILBA 4WNKA 4DO0A 5JR9B 3OVUA 5JREA 3DTOA 1BR2A 3H37A 4U7IA 4Z90A 3TLUA 4DBQA 3Q5WA 3PUAA 4YTNA 2XJ7A 3M3ZB 3IEEA 1JNZA 5M4YA 3PJAA 5JVDE 1HCIA 2CXFA 2C5JA 3C98B 2UXBT 4OYJA 3MXZA 3E08A 3HA4A 2XTLA 2IUBA 2N2NA 3RIAA 1I94T 4AKLA 1QLBA 5JRCA 2LM2A 2DI4A 2H7VC 4J2CA 2QA7A 4E7SA 2DLRA 4ZZBA 5JDNA 4HWIB 1OEDA 4DV4T 2NTXA 3N2GE 3RIUA 3O1JA 5L3EB 4JI4T 5LHGB 1QSDA 4YHHT 4NXNT 4CXWA 5FKYA 4QWNB 5FXWA 5L3BB 3U3IA 3O1IA 5L47A 2JJ9A 2KXPB 2PG8A 2I6HA 2KWIB 2JMHA 3CWZB 4PAGA 1D1CA 2WM9A 2JIWA 2ZMAA 3X1DA 4JI6T 4AKHA 4LF7T 1H7CA 4IT4A 1IJ6A 1G73A 5DJQC 4DR2T 3TKLB 2HPJA 2BG9B 1XDOA 2V6XA 3ONLC 5FXXA 4ISTA 1SA0E 2ODVA 3SRZA 2H88A 3SFEA 5HYAA 1HX1B 1IZNB 2BS3A 2BS4A 2JMKA 1HX8A 4JUYA 5IHYA 4YJ2E 3UU6A 4DR7T 3PUZF 1LVFA 2WDRA 3N2KE 5AQSB 4NIQA 3RHWA 2LHNA 1MNDA 4ASKA 5LJNA 4AIUA 2LSYA 4NPPA 1Z8UA 1IBMT 4B3MT 2SPCA 1N36T 5HWYA 3UU8A 2D0UA 1BR4A 2DCFA 4I0UA 2V7LA 4IE0A 3LJCA 2A72A 4UXNB 2Q9QC 2ACXA 2VQFT 4EZHA 3QUJA 4GIWA 5JR9A 2Q9QB 2UXNB 1HNXT 2H89A 4DR6T 3U78A 4OK0A 1D1BA 3P4QA 3GN5B 4C91A 4CQIA 2UUCT 4ZHQE 2ES0A 2X51A 3P7IA 1YXRA 5LHIB 4YJ3E 3OKQA 4N78D 1N34T 1MIVA 1YD8G 4I4TE 2WMNA 4ILAA 2JQQA 2WZIA 4IDOA 1XMOT 3P50A 1VCTA 4EAHA 4KP3C 3EHZA 3I9YA 4AISA 4L9IA 3PUGA 4IDQA 1X79A 3L8RA 5KX5E 1HF8A 2DL1A 2W63A 2D0TA 4YSZA 4A97A 5IYZE 3NRYA 4KMCA 4DNDA 3CVRA 5JDGA 3JC6D 5HXSA 2D9DA 1NWMX 2X0HA 4U2ZA 4UELA 4DVDA 1MIWA 3HL6A 1WLXA 4UV9B 2WWUA 4UF0B 2CMRA 2KSRA 2CLYB 5FNVE 2YU2A 4HWDA 1MMNA 2L3LA 5AQIB 3BQKA 2IW5B 1GQEA 1CUNA 3NVOA 4PK6A 5E0OA 3AE8A 4JI2T 3N9QA 3ANWA 3AEAA 2XQ8A 3MKDA 4MHCA 4TV8E 5F8PA 3EABA 5HXHA 1D1AA 5AQPB 2LSKA 4ZZCA 1XZYA 2CPTA 4HN9A 1MMDA 3QNUA 2AE9A 4HEAA 3C4XA 4JYAT 3RX6A 2ZM0A 3RGLA 2KNDA 4HFVA 3ZN0B 3ZT7A 5KDMC 2WDQA 4QH4A 4CXYA 2XQ4A 3HR0A 3EDUA 4PW8A 5HCMA 4LMLA 1XWMA 2H7OA 1OWAA 3SFDA 4HFIA 4DR5T 4JI8T 4TWHA 3SOLA 1T7SA 3I9WA 3ZC1A 4JLEA 3CMLA 2J4GA 2CWOA 2XY8B 3F2EA 5BR8T 3AVRA 5LGTB 5AQHB 5JR9C 2ZM8A 4UVBB 3ZT6A 2LJLA 2MBGA 5DQWA 4OX9T 4EIWA 4B3ST 5J2UE 3Q9DA 2VKOA 3K3QC 2IMLA 3NBXX 3ZT5A 2XQYA 4KI0F 2W67A 3AE1A 2C5KT 2HHHT 3K3NA 3Q2MA 4QH1A 2YK0A 2WP9A 4QX7B 1L0VA 3E22E 4PFOA 5EK3A 2GK9A 4IE5A 2WWVA 3AE4A 1XNQT 2X9WA
chains in the Genus database with same CATH topology
2V6XA 4A5XA 3K1SA 1WCRA 4U3CA 2V6YB 5FVKA 5FVLA 2A9UA 2LRLA 2RPAA 2WY2A 2XZEA 3ZT7A 2DL1A 5CJ5A 1WFDA 4ZEYA 4U33A 2JQHA 2K3WA 2CPTA 2V6YA 4NIQA 4WZXA 4CN1A 4U2ZA 3ZSSA 3ZSTA 3ZT6A 2W2UA 2JQKA 4U7YA 4U31A 5CGMA 3ZT5A 1WR0A 4CN6A 4P1NA 4U2YA 3EABA 4CN4A 2WWVA 1YXRA 4U7IA 2LRKA 4IT4A 5LB7B 2MPKA 2JQ9A 2CRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6X A;  4A5X A;  3K1S A;  1WCR A;  4U3C A;  2V6Y B;  5FVK A;  5FVL A;  2A9U A;  2LRL A;  2RPA A;  2WY2 A;  2XZE A;  3ZT7 A;  2DL1 A;  5CJ5 A;  1WFD A;  4ZEY A;  4U33 A;  2JQH A;  2K3W A;  2CPT A;  2V6Y A;  4NIQ A;  4WZX A;  4CN1 A;  4U2Z A;  3ZSS A;  3ZST A;  3ZT6 A;  2W2U A;  2JQK A;  4U7Y A;  4U31 A;  5CGM A;  3ZT5 A;  1WR0 A;  4CN6 A;  4P1N A;  4U2Y A;  3EAB A;  4CN4 A;  2WWV A;  1YXR A;  4U7I A;  2LRK A;  4IT4 A;  5LB7 B;  2MPK A;  2JQ9 A;  2CRB A; 
#chains in the Genus database with same CATH topology
 1YQ4 A;  3AE5 A;  5L4H A;  4IE7 A;  3AXJ A;  3FB2 A;  3R84 B;  3ZYL A;  2A9U A;  2XAF B;  3I0O A;  2W61 A;  3AVS A;  2K9A A;  3O4X E;  4KX6 A;  3WI3 A;  2VL0 A;  5AQO B;  4XBF B;  2CLY C;  3AA1 B;  3AE2 A;  2YU1 A;  2WBL A;  3LG7 A;  2XAJ B;  5LBQ B;  1NEN A;  4F8H A;  3FXE B;  2VKH A;  3PUQ A;  2L9Q A;  4ZOL E;  5HEH A;  4KUM B;  2B76 A;  4P0B A;  4JI7 T;  5AQT B;  4X1K E;  3W15 B;  3MAC A;  3CK6 A;  3UTK A;  2G0U A;  5AQK B;  4U31 A;  3T1H T;  4X65 T;  3E0Z A;  4EYY R;  4B3R T;  5LGN B;  5ABH A;  2RA1 A;  3C4W A;  2W0G A;  2K5B B;  3RQU A;  4EOZ B;  3VKH A;  3CX6 B;  5L3F B;  2V8S V;  3J9X 1;  4EED A;  3AB3 B;  3P4W A;  4KHP T;  1SUM B;  4L5G A;  4EYU A;  2QVA A;  3RYC E;  3QB5 K;  2CRB A;  3ETV A;  3RYI E;  3NZQ A;  2WCA A;  4IL9 A;  4AQF A;  2V6Y B;  4PJJ A;  2YDS A;  4U72 A;  4ERR A;  4LF9 T;  1G8X A;  1J5W A;  5LMU T;  5F5W A;  2OA5 A;  2FUP A;  1LVK A;  2X9Y A;  4OYK A;  4YFS A;  1J5E T;  3CQX C;  1U5P A;  3KIN B;  3UFE A;  2HPL A;  2ZM6 T;  4HWF A;  4DUY T;  2CM0 A;  1U4Q A;  4X1Y E;  4HFB A;  4Q25 A;  1S94 A;  4QH5 A;  2EHO C;  2VKJ A;  2D2S A;  3T8O A;  2V1D B;  5LBM A;  4COF A;  3HKB E;  5ABF A;  3AA0 B;  3ZC0 A;  3B5M A;  2L8K A;  1WR0 A;  2XAH B;  5CA0 E;  1KNR A;  3RYH E;  4G2A A;  2XQ3 A;  4DV6 T;  5LHH B;  2UXC T;  2BG9 C;  1UUR A;  3CX8 B;  5JTG A;  1B7T A;  1HTJ F;  3N9P A;  2JRK A;  3VRA A;  2UUB T;  3EUH A;  2FJE A;  2E2A A;  4HWC A;  2XAS B;  2DNX A;  2BVM A;  2CXD A;  2E9X B;  4X5T A;  1EZ3 A;  1UGO A;  1ZV4 X;  4ILC A;  4TWD A;  4BA9 A;  5LNK A;  1J1J A;  2IDO B;  4O2B E;  4WZX A;  3RRC A;  4EZ4 A;  1OXZ A;  3RIF A;  3PUW F;  5AQM B;  1ZHC A;  2B1E A;  2CBJ A;  2W62 A;  4HWH A;  4XAX B;  5FY0 A;  2BKP A;  3UUB A;  4BJN A;  1WYC A;  4LF6 T;  4P09 A;  1O3X A;  4EB6 E;  2UUA T;  5FL0 A;  2LE8 A;  4KBM B;  5CGM A;  3T1Y T;  2LEH A;  2WU5 A;  2DHR A;  3P4P A;  2XPK A;  3BQI A;  4GYR A;  5AQR B;  5HXR A;  3CIR A;  4IIJ E;  2F4V T;  2E9X D;  3DP7 A;  2YDR A;  4JBW F;  3C64 A;  2YEV C;  2HN1 A;  1Y64 B;  2JQ9 A;  2M67 A;  3KBU A;  3ZLI A;  5AQG B;  1T72 A;  4DR3 T;  3LK4 2;  3ZYM A;  2XAQ B;  2RPA A;  1UK5 A;  2C5I T;  3AED A;  3F31 A;  2QYW A;  4O4L E;  3VR8 A;  2NW9 A;  2IC9 A;  4HFH A;  1ZEE A;  5LP6 E;  2BDE A;  2XQ9 A;  5LMN T;  4YY3 T;  3UUX B;  3OTO T;  3CKD A;  4MBQ A;  4JI1 T;  3JCF A;  2MTQ A;  4ZI2 C;  5EK2 A;  3UUM A;  3AE7 A;  1FIO A;  2DWG A;  2DWK A;  4I55 E;  1FJG T;  1FMW A;  2CBI A;  4NUU A;  1N33 T;  3FXD B;  3AE3 A;  2V7J A;  4PNI A;  4TNW A;  5TAO A;  4ISS A;  4DR1 T;  4IHJ E;  3QOF A;  4PK5 A;  5GON E;  2NP9 A;  4C90 A;  4AXP A;  2BVL A;  3AAI A;  4JI5 T;  3C50 A;  3HKE E;  2LT3 A;  1HNZ T;  5IUX A;  2PBI A;  4ZI7 E;  1VCS A;  3R6N A;  4PJM A;  2V7I A;  3WAK A;  4GKK T;  2C0S A;  5J0Z A;  4NXM T;  4GYS A;  4X20 E;  2A2F X;  2PFV A;  2YKS A;  2Y48 B;  3KFW X;  2M6I A;  4CI1 B;  3VKG A;  2NTY A;  3RRW A;  1NEK A;  1WCR A;  2E9X C;  2KWH A;  2LM9 A;  2X9X A;  2XSA A;  1UX4 A;  2MAW A;  3K1S A;  5AQQ B;  1T8B A;  2NOX A;  2WMO A;  1D0X A;  4JEH B;  5FVK A;  3V5U A;  2Y8D A;  3LFM A;  4TX5 A;  5FL1 A;  4AKI A;  4LFA T;  4YHJ A;  4GOU A;  4HFC A;  4MAL A;  3C51 A;  3J7Y q;  3PDY A;  5HEG A;  1WRD A;  2P9B A;  2KMF A;  2V26 A;  3GMI A;  3C4Z A;  3KV4 A;  4I43 B;  2CWY A;  3GN5 A;  2XQ7 A;  2VK9 A;  2N9D A;  3KV6 A;  2BBJ A;  1HG2 A;  1R8I A;  2QGS A;  3ANW B;  3Q5X A;  5EK4 A;  3UUN A;  2UXD T;  3MK7 C;  2BS2 A;  1IAP A;  2PTF A;  3H3M A;  2V5D A;  2EHO B;  1XNR T;  4HKA A;  2W00 A;  3PJA J;  4H9R C;  4M1P A;  4V1A v;  2X0L B;  2J1D G;  3BK9 A;  4WBO A;  1V9D A;  2FJB A;  3UT5 E;  3ZMU B;  1KK7 A;  4CI3 B;  3JC6 C;  3MZK B;  2BG9 E;  2CE7 A;  1W0B A;  2NW8 A;  3A7M A;  5ABE A;  2MPK A;  4QXH B;  4ZI2 D;  5L2L A;  2VVN A;  4A5X A;  4UV8 B;  4X66 T;  1JNR A;  3CQG B;  2OLT A;  3NKZ A;  1QUU A;  3NRX A;  1ZOY A;  3QC9 A;  2LSG A;  4FJO A;  3TLT A;  5AQN B;  2VL8 A;  1WFD A;  1HR0 T;  1M62 A;  2YIN A;  5KMG P;  4UR9 A;  3A5X A;  2EHO D;  1YQ3 A;  2HH7 A;  2LKH A;  3FZF B;  3ZSS A;  4EEB A;  3ZST A;  1UUS A;  2E5V A;  3HI2 A;  3FBZ A;  4HFD A;  2Q9Q A;  4O4J E;  5EZY E;  2KT9 A;  2WZH A;  4U7Y A;  3SS1 A;  3EVY A;  4HE8 A;  3S4U A;  4MFR A;  1S35 A;  3KDS E;  5BMV E;  5CB4 E;  3UUL A;  1OED B;  2VVS A;  1N32 T;  1KNP A;  1ZP0 A;  5A1L A;  1YW0 A;  4DR4 T;  1OED C;  2ODU A;  1ZKE A;  5KXJ A;  4TWF A;  1YKH B;  3RLF F;  2X67 A;  5L3G B;  5JRC B;  1T98 A;  5IWA T;  5LG3 A;  2CXL A;  3D0T A;  1MMG A;  3FBL A;  3RYF E;  3UU5 A;  2WS3 A;  4JV5 T;  2OV9 A;  2IC6 A;  4JEU B;  1D0Z A;  1MNE A;  2LRL A;  3RKO A;  5LXT E;  4UVA B;  2BG9 A;  2IIU A;  5LGU B;  2LOS A;  4A56 A;  2V7M A;  4IL4 A;  3N9O A;  4AI6 A;  3IBP A;  4DV5 T;  5FMN A;  3IF8 B;  5C3J A;  5ADX L;  5HWX A;  3QK6 A;  1BR1 A;  2W2U A;  2BZB A;  4IDZ A;  4AQF C;  2BBH A;  3PUS A;  4G63 A;  5FXZ A;  4HTE A;  2LHR A;  1VOM A;  3I0Q A;  3P8C D;  4Z8X A;  3ZJ1 A;  4H9O C;  4H9S E;  4NUV A;  4ZS2 A;  4H9N C;  4YTP A;  2X0Y A;  2BKO A;  3PU8 A;  2XM2 A;  4X62 T;  2V5C A;  4LFC T;  1SE7 A;  3ABV A;  1DU2 A;  3RKG A;  5LG4 A;  1FMV A;  2WQY A;  4LMJ A;  5H6Q B;  3RIU C;  5LJM A;  3FHN A;  3N5L A;  3PUX F;  5L3D B;  2KIN B;  1HG5 A;  3AA7 B;  5FXV A;  3LDQ B;  3ZMV B;  3ZYK A;  2PJQ A;  4O4H E;  2YDQ A;  5FVL A;  4LF4 T;  2Q9Q D;  2M6B A;  4MLK A;  3ZMT B;  2R6G F;  3TLW A;  3CPZ A;  3VR9 A;  5J2T E;  2UU9 T;  3PU3 A;  1W09 A;  4B3T T;  3VU7 H;  4QKN A;  2EHO A;  5AQL B;  4I50 E;  4Z91 A;  5AQF B;  4EXT A;  3G06 A;  4CN1 A;  5C2T A;  2KZ7 B;  3MJX A;  2E5L T;  3TLV A;  3Q5D A;  3ZPO A;  3AAA B;  4BAY B;  4DV7 T;  3KV9 A;  1KF6 A;  2VWA A;  4TZ4 C;  1I6Z A;  3OPC A;  3OJA A;  4KHZ F;  1KEY A;  3KBT A;  3O1H A;  3OYZ A;  3LK3 B;  4QXB B;  3PE0 A;  3ZN1 B;  4CXX A;  5HAX A;  2WAU A;  1AJ3 A;  3DJB A;  2YN6 A;  1M7K A;  3UU3 A;  4XZC A;  5F3J A;  3RH3 A;  5DQV A;  4U2Y A;  3TLS A;  2I0M A;  4PK4 A;  4IE4 A;  2CHO A;  2HN2 A;  2VKD A;  4K0U A;  5DAB A;  2LRK A;  3V5S A;  4ZI3 D;  4A98 A;  3B13 A;  5JDH A;  3N2O A;  5JDL A;  2K24 A;  5HXE A;  5JH7 E;  3O9X A;  4B6X A;  2ZLY A;  3ZCI A;  4TV9 E;  3ZJ2 A;  2IHR 1;  1HNW T;  2W66 A;  3H3A A;  4IDN A;  4TN7 B;  1WYB A;  4JI3 T;  3PTR B;  2WDV A;  3K8P C;  5HXC A;  2W4X A;  2XQA A;  4U74 A;  3KVB A;  3OYX A;  5FP3 A;  5H6R B;  1D0Y A;  1X9B A;  3EI0 A;  3RC8 A;  4U33 A;  4WW0 A;  1XMQ T;  4ZXL A;  2V6Y A;  3OBV E;  4CZZ B;  4DV3 T;  1HFA A;  3FZK B;  2BKN A;  3ONJ A;  2VB6 A;  3N9M A;  3HKC E;  5LCY A;  1IBL T;  3AEG A;  1W0A A;  1Z0P A;  1HS7 A;  2X9H A;  3UQ7 A;  2AXD S;  3KVA A;  4AKR B;  2WSS V;  3PUR A;  5AQV B;  2H3R A;  2X68 A;  2I59 A;  2Y6X A;  3LBX A;  3CQC B;  4DV2 T;  4GKJ T;  4LFB T;  5AFU L;  4X1I E;  5JQG E;  2CEA A;  4JI0 T;  2LOP A;  3A8Y C;  2N1G A;  1US7 B;  3B57 A;  1Y01 A;  3ESL A;  4YTM A;  3QB5 A;  2MOZ A;  2XM1 A;  3Q5E A;  3MA9 A;  4H9P C;  3VHL A;  2NWB A;  4ILU A;  4O2A E;  5HEJ A;  2D5U A;  5LYJ E;  2XZE A;  4DMV A;  3AAE B;  3ZEF B;  2J62 A;  5CFB A;  4AKG A;  3I1A A;  3IHR A;  5LA6 E;  3P4S A;  3AE9 A;  3AA6 B;  3P4R A;  3SWH A;  3UU4 A;  5ABG A;  4AQG A;  4DID B;  3RF1 A;  4YSY A;  2K3W A;  2ACZ A;  3AXJ B;  2XUE A;  4HGA A;  5C8Y E;  4L0R A;  4QHO A;  2E8I A;  5AQJ B;  4H9Q C;  4ANJ A;  4E7Z A;  4K0K T;  3N9N A;  4HFE A;  3UQ4 A;  1FEW A;  4GK0 E;  3F57 A;  2XAG B;  1W9R A;  1UCU A;  2CA5 A;  4PJL A;  4IE6 A;  5FY1 A;  2IAK A;  2KLQ A;  5FYM A;  2VAS A;  4IRE A;  2QRX A;  3L39 A;  3L3P A;  4P1N A;  5FY7 A;  5CA1 E;  3N9L A;  2VUR A;  1MIY A;  4EGW A;  3JAD A;  2E9X A;  4F6R C;  1XDP A;  2XSB A;  4IGU A;  2ZM2 A;  5JDF A;  3AEE A;  2WB5 A;  3EDV A;  3ETU A;  3K3O A;  3AEC A;  3JAE A;  1SHZ C;  4H63 H;  2FJA A;  4BJM A;  2YOE A;  4YSX A;  3NZP A;  4PJN A;  2WY2 A;  4QX8 B;  4DV1 T;  5JDM A;  1E7P A;  1MMA A;  4ZI3 C;  3RI5 A;  2VQE T;  1KNZ A;  2JQH A;  4TUY E;  4OHF A;  3LSV A;  3WAJ A;  1E1H B;  5ABF B;  2CHN A;  3FZH B;  4IDP A;  4X64 T;  4P0A A;  4LF8 T;  3LBX B;  5AQU B;  4UIG A;  5J1G A;  5JDQ A;  5L3C B;  3GA8 A;  4DUZ T;  4PFP A;  1IJ5 A;  2JQK A;  2NR4 A;  3M65 A;  1LRZ A;  4WBN E;  5ETW A;  1LKX A;  2J47 A;  4WYV A;  1UX5 A;  2K48 A;  4UVC B;  5HEU A;  2LSI A;  4GK5 E;  4LMK A;  4YT0 A;  2Z6E A;  4ZS3 A;  4YXD A;  4O4I E;  3BQL A;  4CN4 A;  1BR0 A;  3PUY F;  4DBR A;  2XQ6 A;  4UF0 A;  3AEB A;  1OED E;  3L09 A;  3ONX A;  4H63 V;  4YLH A;  5LB7 B;  3RPU A;  2LSJ A;  1VRB A;  3RQW A;  2CCQ A;  3ZKR A;  4DMW A;  4EV6 A;  4DV0 T;  4U3C A;  4OFZ A;  2LLY A;  4CI2 B;  1NAF A;  1IBK T;  1WR6 A;  3PV0 F;  3ZMS B;  1CHU A;  1YKE B;  2XQ5 A;  3FZM B;  4AQY T;  5HEO A;  5CJ5 A;  2XHE B;  2X66 A;  4ZEY A;  4FI5 A;  2JPF A;  3FZL B;  3AE6 A;  5LOV E;  4ADZ A;  3LK2 B;  4UEM A;  2RP4 A;  3KV5 A;  3HKD E;  4O8S A;  4TNV A;  5L4E A;  2FJD A;  4QXC B;  2FBW A;  3AEF A;  2LKG A;  3EAM A;  2NW7 A;  2UXX B;  3CX7 B;  1KFY A;  3JAF A;  5HCJ A;  3RC3 A;  3UFG A;  3VRB A;  3ZCJ A;  4LF5 T;  2WU2 A;  3PUV F;  3NWI A;  2V7K A;  3IA3 A;  3GWH A;  3ZMZ B;  4CN6 A;  2A3D A;  1E2A A;  2MYS A;  4ILB A;  4WNK A;  4DO0 A;  5JR9 B;  3OVU A;  5JRE A;  3DTO A;  1BR2 A;  3H37 A;  4U7I A;  4Z90 A;  3TLU A;  4DBQ A;  3Q5W A;  3PUA A;  4YTN A;  2XJ7 A;  3M3Z B;  3IEE A;  1JNZ A;  5M4Y A;  3PJA A;  5JVD E;  1HCI A;  2CXF A;  2C5J A;  3C98 B;  2UXB T;  4OYJ A;  3MXZ A;  3E08 A;  3HA4 A;  2XTL A;  2IUB A;  2N2N A;  3RIA A;  1I94 T;  4AKL A;  1QLB A;  5JRC A;  2LM2 A;  2DI4 A;  2H7V C;  4J2C A;  2QA7 A;  4E7S A;  2DLR A;  4ZZB A;  5JDN A;  4HWI B;  1OED A;  4DV4 T;  2NTX A;  3N2G E;  3RIU A;  3O1J A;  5L3E B;  4JI4 T;  5LHG B;  1QSD A;  4YHH T;  4NXN T;  4CXW A;  5FKY A;  4QWN B;  5FXW A;  5L3B B;  3U3I A;  3O1I A;  5L47 A;  2JJ9 A;  2KXP B;  2PG8 A;  2I6H A;  2KWI B;  2JMH A;  3CWZ B;  4PAG A;  1D1C A;  2WM9 A;  2JIW A;  2ZMA A;  3X1D A;  4JI6 T;  4AKH A;  4LF7 T;  1H7C A;  4IT4 A;  1IJ6 A;  1G73 A;  5DJQ C;  4DR2 T;  3TKL B;  2HPJ A;  2BG9 B;  1XDO A;  2V6X A;  3ONL C;  5FXX A;  4IST A;  1SA0 E;  2ODV A;  3SRZ A;  2H88 A;  3SFE A;  5HYA A;  1HX1 B;  1IZN B;  2BS3 A;  2BS4 A;  2JMK A;  1HX8 A;  4JUY A;  5IHY A;  4YJ2 E;  3UU6 A;  4DR7 T;  3PUZ F;  1LVF A;  2WDR A;  3N2K E;  5AQS B;  4NIQ A;  3RHW A;  2LHN A;  1MND A;  4ASK A;  5LJN A;  4AIU A;  2LSY A;  4NPP A;  1Z8U A;  1IBM T;  4B3M T;  2SPC A;  1N36 T;  5HWY A;  3UU8 A;  2D0U A;  1BR4 A;  2DCF A;  4I0U A;  2V7L A;  4IE0 A;  3LJC A;  2A72 A;  4UXN B;  2Q9Q C;  2ACX A;  2VQF T;  4EZH A;  3QUJ A;  4GIW A;  5JR9 A;  2Q9Q B;  2UXN B;  1HNX T;  2H89 A;  4DR6 T;  3U78 A;  4OK0 A;  1D1B A;  3P4Q A;  3GN5 B;  4C91 A;  4CQI A;  2UUC T;  4ZHQ E;  2ES0 A;  2X51 A;  3P7I A;  1YXR A;  5LHI B;  4YJ3 E;  3OKQ A;  4N78 D;  1N34 T;  1MIV A;  1YD8 G;  4I4T E;  2WMN A;  4ILA A;  2JQQ A;  2WZI A;  4IDO A;  1XMO T;  3P50 A;  1VCT A;  4EAH A;  4KP3 C;  3EHZ A;  3I9Y A;  4AIS A;  4L9I A;  3PUG A;  4IDQ A;  1X79 A;  3L8R A;  5KX5 E;  1HF8 A;  2DL1 A;  2W63 A;  2D0T A;  4YSZ A;  4A97 A;  5IYZ E;  3NRY A;  4KMC A;  4DND A;  3CVR A;  5JDG A;  3JC6 D;  5HXS A;  2D9D A;  1NWM X;  2X0H A;  4U2Z A;  4UEL A;  4DVD A;  1MIW A;  3HL6 A;  1WLX A;  4UV9 B;  2WWU A;  4UF0 B;  2CMR A;  2KSR A;  2CLY B;  5FNV E;  2YU2 A;  4HWD A;  1MMN A;  2L3L A;  5AQI B;  3BQK A;  2IW5 B;  1GQE A;  1CUN A;  3NVO A;  4PK6 A;  5E0O A;  3AE8 A;  4JI2 T;  3N9Q A;  3ANW A;  3AEA A;  2XQ8 A;  3MKD A;  4MHC A;  4TV8 E;  5F8P A;  3EAB A;  5HXH A;  1D1A A;  5AQP B;  2LSK A;  4ZZC A;  1XZY A;  2CPT A;  4HN9 A;  1MMD A;  3QNU A;  2AE9 A;  4HEA A;  3C4X A;  4JYA T;  3RX6 A;  2ZM0 A;  3RGL A;  2KND A;  4HFV A;  3ZN0 B;  3ZT7 A;  5KDM C;  2WDQ A;  4QH4 A;  4CXY A;  2XQ4 A;  3HR0 A;  3EDU A;  4PW8 A;  5HCM A;  4LML A;  1XWM A;  2H7O A;  1OWA A;  3SFD A;  4HFI A;  4DR5 T;  4JI8 T;  4TWH A;  3SOL A;  1T7S A;  3I9W A;  3ZC1 A;  4JLE A;  3CML A;  2J4G A;  2CWO A;  2XY8 B;  3F2E A;  5BR8 T;  3AVR A;  5LGT B;  5AQH B;  5JR9 C;  2ZM8 A;  4UVB B;  3ZT6 A;  2LJL A;  2MBG A;  5DQW A;  4OX9 T;  4EIW A;  4B3S T;  5J2U E;  3Q9D A;  2VKO A;  3K3Q C;  2IML A;  3NBX X;  3ZT5 A;  2XQY A;  4KI0 F;  2W67 A;  3AE1 A;  2C5K T;  2HHH T;  3K3N A;  3Q2M A;  4QH1 A;  2YK0 A;  2WP9 A;  4QX7 B;  1L0V A;  3E22 E;  4PFO A;  5EK3 A;  2GK9 A;  4IE5 A;  2WWV A;  3AE4 A;  1XNQ T;  2X9W A; 
#chains in the Genus database with same CATH homology
 2V6X A;  4A5X A;  3K1S A;  1WCR A;  4U3C A;  2V6Y B;  5FVK A;  5FVL A;  2A9U A;  2LRL A;  2RPA A;  2WY2 A;  2XZE A;  3ZT7 A;  2DL1 A;  5CJ5 A;  1WFD A;  4ZEY A;  4U33 A;  2JQH A;  2K3W A;  2CPT A;  2V6Y A;  4NIQ A;  4WZX A;  4CN1 A;  4U2Z A;  3ZSS A;  3ZST A;  3ZT6 A;  2W2U A;  2JQK A;  4U7Y A;  4U31 A;  5CGM A;  3ZT5 A;  1WR0 A;  4CN6 A;  4P1N A;  4U2Y A;  3EAB A;  4CN4 A;  2WWV A;  1YXR A;  4U7I A;  2LRK A;  4IT4 A;  5LB7 B;  2MPK A;  2JQ9 A;  2CRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...