2LRKA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphocarrier protein HPr
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 39
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrkA00
3ZT6A 4U7IA 2A9UA 2CRBA 4U2ZA 2V6YA 5FVLA 4U31A 1WCRA 4U2YA 2K3WA 4ZEYA 1WFDA 2V6YB 2W2UA 2MPKA 4CN1A 5CJ5A 3ZSTA 1YXRA 2JQHA 2V6XA 3ZT7A 3K1SA 4A5XA 4U3CA 4U7YA 2JQKA 2WY2A 3EABA 4IT4A 2DL1A 2CPTA 4WZXA 2WWVA 4CN4A 3ZSSA 2JQ9A 5FVKA 2LRKA 4P1NA 4CN6A 5CGMA 2XZEA 5LB7B 2LRLA 2RPAA 1WR0A 4NIQA 3ZT5A 4U33A
chains in the Genus database with same CATH superfamily
3OBVE 4DMWA 1UCUA 3AVRA 3AE4A 3ZCJA 3PUYF 1MMNA 3LK42 3N9PA 3KV6A 3RYCE 3RHWA 3HL6A 1SA0E 4H9SE 4CXXA 3OPCA 1OEDA 1YD8G 3VR8A 3GN5B 1D1BA 5EZYE 3ZT7A 2X66A 2YKSA 4JI8T 3EHZA 2ZMAA 1D0ZA 2ODUA 2BG9E 4H63H 3CPZA 4TWDA 2V8SV 5LXTE 4AXPA 2C5JA 4X1IE 5DJQC 3RKOA 2W2UA 5C2TA 1E7PA 4UVAB 4DV7T 2VKHA 3U3IA 3LDQB 3KBTA 2E9XD 2N2NA 1D0YA 1T72A 1Y01A 4CXWA 2V7LA 3O4XE 2L8KA 2BVMA 2W66A 4B3RT 3KFWX 1UURA 1YKHB 5AQFB 2ES0A 4PW8A 4ZOLE 2VQFT 4MFRA 4JV5T 4YFSA 4AQYT 2IAKA 3RC3A 4IL9A 3IHRA 3ZJ2A 3FXDB 1BR1A 2Q9QA 5M4YA 4EIWA 1NEKA 4IDQA 1KNRA 4LFBT 5JDQA 2KXPB 3LG7A 1E1HB 3VHLA 5KXJA 2A9UA 3P4QA 4AKRB 2BG9B 2E8IA 3OYZA 4UIGA 3C4ZA 3L39A 2WU2A 3AVSA 4JI2T 1FMWA 3MZKB 4IDPA 3ZT5A 5JDHA 4P0AA 5HEJA 4U31A 2K3WA 4IE7A 4QH4A 2KT9A 2V6YB 4IDZA 3CQGB 4QWNB 5AQPB 5LHHB 4EXTA 3X1DA 4DV5T 2UUBT 4QH5A 5AQVB 2LSIA 5JR9B 3HKBE 5KX5E 5ABEA 3RH3A 4Z8XA 4CI3B 1QSDA 3C4WA 3RYHE 2KWHA 5CJ5A 4LMJA 3T1HT 5C8YE 1I94T 2HH7A 1ZHCA 1FMVA 2NTXA 4EV6A 4KI0F 4XZCA 5L3BB 2VKJA 4HWCA 3PTRB 3LBXA 3MXZA 2H7VC 3P4PA 1HF8A 2IUBA 1HFAA 2JRKA 2P9BA 3H3MA 3SWHA 1KK7A 5DQVA 2V7IA 3AAEB 2MAWA 4G63A 5LMUT 4X5TA 1HX8A 2YINA 3PUWF 3RYFE 5DQWA 1D1AA 2DHRA 4I50E 4J2CA 4JI6T 3VKHA 2A72A 2HN1A 5HWXA 1ZP0A 2L9QA 3UUMA 4DIDB 5DABA 5HYAA 4PK4A 5LMNT 2PTFA 1YXRA 2PBIA 3UUBA 2IDOB 2XM2A 4U3CA 3RRWA 2D9DA 2CXDA 3RX6A 2QVAA 3FZMB 2D0UA 3W15B 4GYSA 1OEDC 1HR0T 4YJ2E 1XNQT 1MIVA 3BK9A 4DV2T 3ZYLA 3MJXA 4CN1A 4GKJT 5J2TE 2LLYA 1XMQT 4IREA 1I6ZA 2LSYA 2JMKA 3ZCIA 4B3MT 5AQOB 4EAHA 5LOVE 4EZHA 2DWGA 5LJNA 4UXNB 4JEUB 3E0ZA 3H37A 5AQIB 2WB5A 1OXZA 3Q5EA 3P50A 2DL1A 3ZSSA 2YU1A 3PDYA 3ONJA 2FUPA 3LFMA 3EUHA 4YTNA 3FZLB 3UFGA 4COFA 5JDGA 2K48A 1NENA 3QUJA 3ZJ1A 1US7B 4I55E 4TV8E 5L2LA 1HG2A 5FY0A 4A5XA 5CA0E 1J1JA 4IGUA 1EZ3A 2JQ9A 5HEUA 3PUQA 2WZHA 3AE1A 2Q9QC 4E7ZA 4JBWF 3PJAJ 2YN6A 4GOUA 4KHPT 5JQGE 2M6BA 2XQAA 4IL4A 3UU5A 2QRXA 4L0RA 4HE8A 4P09A 1IJ6A 5AQNB 3HI2A 2LHNA 3TLWA 3AAAB 2E5VA 2LEHA 4JI1T 1VCTA 3RIFA 1ZKEA 3KVAA 1WR6A 3UU4A 3JAEA 2UXCT 3QB5A 3AEEA 5JRCA 4AKHA 4L9IA 2XQ8A 2V5DA 4B6XA 4PNIA 1HNZT 3EDUA 4X62T 3J7Yq 5L3CB 4PAGA 4X65T 3BQIA 1NWMX 5FP3A 1YKEB 1WLXA 5AQQB 5H6QB 2D2SA 3M3ZB 4G2AA 3FZHB 4AIUA 2DLRA 3RYIE 4PJLA 2BZBA 4H63V 4O4IE 4O4JE 2YEVC 5C3JA 4JUYA 4M1PA 1HTJF 2LE8A 4OYJA 2OA5A 2FJBA 2VKDA 4ZS3A 3ZSTA 3I0OA 5JDNA 1YW0A 2PG8A 1U4QA 2CPTA 2WS3A 4I43B 4IE6A 4NUUA 3ZMSB 4H9OC 3SRZA 1G8XA 5ABFB 2LM9A 3JAFA 4ILBA 5H6RB 4U2ZA 5ETWA 3PV0F 3UTKA 5J0ZA 2YDSA 5KDMC 2RP4A 2Q9QD 3RPUA 3JC6C 3ZLIA 4KP3C 2XZEA 2UXNB 5LNKA 5JH7E 3C64A 3ZN0B 5BMVE 4DR4T 3AXJA 3GMIA 3KINB 3CX6B 3AB3B 2ZM6T 3HKDE 4WW0A 5HXRA 4LF9T 3ANWB 1R8IA 3FB2A 3L09A 3UT5E 5JDFA 5LCYA 3SFDA 2RA1A 2WDRA 4KMCA 5FNVE 3NVOA 5AQLB 3LJCA 3AECA 1QUUA 4DV0T 3PUGA 3FHNA 5FXXA 4HWFA 2YDRA 2B76A 3UU3A 3HKCE 2GK9A 1SUMB 5JTGA 4DBRA 4HWHA 4TUYE 4CN4A 4GYRA 4QX8B 3KV4A 4YT0A 3RIAA 3AA6B 5E0OA 1OWAA 2CHNA 4ZS2A 5FXVA 4X64T 3F57A 2QGSA 4JYAT 4V1Av 3AE7A 3N9NA 2CE7A 2FJAA 1FEWA 3UUNA 3AE5A 3QC9A 3N2GE 2LSJA 4E7SA 5LG3A 2XSBA 1MMGA 4DNDA 4ERRA 3ZYMA 2H3RA 3ZC1A 5EK2A 2VK9A 2SPCA 3AAIA 2X9WA 2CA5A 2AXDS 3AA7B 2CBJA 5HXHA 5FXWA 2UU9T 4HFCA 1XMOT 2LJLA 5J1GA 2LKGA 2VQET 3LK3B 3AE8A 2CRBA 3JC6D 2W67A 5IUXA 1HNWT 4HFIA 5IYZE 4HTEA 2DCFA 5FL0A 4CZZB 5FYMA 4U7YA 3LBXB 2Y8DA 4TWFA 1LVKA 3MA9A 1YQ3A 3P4RA 2E9XB 4HKAA 5F8PA 1V9DA 1WCRA 2HPLA 2XTLA 4UVBB 3AEAA 4ZZBA 4YJ3E 3V5UA 2VL8A 4JI4T 4CN6A 4K0UA 3WAJA 3O1HA 1ZV4X 2XAHB 4CXYA 3GWHA 3K8PC 5LGUB 2LM2A 2N1GA 3P7IA 4H9PC 5AQMB 4OYKA 2WSSV 2LSKA 2W63A 3TLTA 2I0MA 3DJBA 2FBWA 4X1KE 4QX7B 4FJOA 3AE9A 3RLFF 1FIOA 4HFVA 2BDEA 4YTMA 2X9HA 3Q2MA 4AKLA 4JI7T 2MTQA 1SHZC 5LGNB 2ZM2A 1WFDA 2X51A 3FBZA 5L3FB 5LJMA 3N2KE 3UU8A 2E5LT 3FBLA 2K9AA 2C5IT 2XSAA 4DR1T 1WR0A 3VKGA 4P0BA 2ODVA 1T7SA 2XASB 2QYWA 3G06A 1IAPA 4U72A 3R6NA 5LG4A 4I0UA 4EOZB 3TKLB 4H9RC 4AQFA 4YLHA 3TLVA 4UVCB 2JQQA 2Y6XA 3K3OA 5FVLA 3N9QA 1X79A 1KFYA 1B7TA 2LOPA 1N33T 2W61A 2W62A 4JI3T 4BJNA 2UXBT 4ZI3C 4QXHB 1N36T 2DNXA 3AA1B 2XY8B 3QOFA 5JRCB 2BBHA 4O8SA 1KNPA 5L4HA 2HHHT 1MMDA 4PK6A 3NRYA 4HFHA 1CUNA 3T1YT 3ZKRA 2UXDT 1XWMA 4XBFB 3ZC0A 2NR4A 2XAGB 1VOMA 5L4EA 3UQ7A 3AEFA 2CLYC 2J47A 2VASA 1DU2A 2D5UA 1MIYA 3KDSE 5CB4E 3A7MA 4DBQA 1VRBA 3TLUA 2A2FX 5HCJA 1SE7A 4IHJE 2LSGA 4B3ST 5EK4A 3UU6A 4BAYB 4ILUA 3CQXC 4DUYT 1MNDA 4WBOA 2JMHA 5A1LA 4AKIA 5JREA 2JPFA 2BS3A 5FY7A 1OEDE 2WMNA 2KINB 1KNZA 1M62A 5J2UE 4MBQA 2V7JA 3EVYA 3KV9A 3PU8A 4UR9A 4HFBA 4X20E 1BR0A 5HWYA 3P4WA 2W0GA 4IDOA 2IMLA 5CFBA 1X9BA 5JDLA 4JI0T 2D0TA 3BQKA 3VR9A 2IC6A 3B13A 4DUZT 4TNVA 4WBNE 3JADA 4EZ4A 4ZI3D 3JCFA 5FMNA 4IIJE 4I4TE 3PUAA 3UULA 2JIWA 2UUCT 3Q5XA 2H7OA 3I9WA 4ASKA 3SS1A 4KX6A 2LT3A 1HX1B 4ZEYA 5AQUB 3I0QA 2NP9A 4LF5T 3R84B 3KVBA 2VVSA 3CKDA 3RF1A 4GK0E 4IE0A 1LVFA 5LP6E 2CXLA 2C5KT 3E08A 5EK3A 3VRBA 4O2BE 2UXXB 1J5ET 2CM0A 5GONE 1FJGT 2EHOD 2LKHA 1OEDB 3PUZF 4CQIA 5ADXL 4Z90A 1IJ5A 2JQKA 3CIRA 4LF8T 2X9YA 2IHR1 4A97A 5FVKA 4H9QC 4ZI2C 2WQYA 4DR6T 4U33A 4O4LE 4NXNT 4DO0A 4TZ4C 3FZFB 2J62A 5LBMA 2BKNA 3CQCB 1GQEA 2JJ9A 4UV8B 4AQFC 2XQ9A 4YTPA 1UK5A 2BKOA 4HEAA 4BJMA 1IBLT 4DVDA 2BKPA 4LFAT 4F8HA 4KUMB 3CWZB 2KSRA 3D0TA 4HWDA 1QLBA 2MPKA 2CLYB 4XAXB 2I59A 3VU7H 4ISSA 4TWHA 2WWVA 2X0HA 4DV4T 3RGLA 4N78D 3QNUA 3Q9DA 1HG5A 4YHJA 3OVUA 3PU3A 3NBXX 4K0KT 2OLTA 2MYSA 3N9MA 1MMAA 2NOXA 3AE3A 5LHGB 2I6HA 4ILAA 3TLSA 3F2EA 3M65A 3CVRA 5IHYA 5AQJB 2Q9QB 2VL0A 2V1DB 3E22E 2KZ7B 5JDMA 3I9YA 2XQ3A 1E2AA 2XQ6A 4U74A 2VKOA 2WAUA 2YK0A 2F4VT 1Z0PA 4PJMA 4OK0A 3FXEB 5L3DB 3EAMA 2BVLA 5F5WA 4KHZF 1T8BA 3S4UA 4PFPA 3N9LA 4X1YE 4QH1A 3VRAA 3CX8B 2FJEA 5ABFA 1HNXT 2CWYA 2CMRA 4DV6T 2ZM8A 4TX5A 5AQRB 4ZI2D 2EHOA 3UUXB 1D0XA 1L0VA 3QB5K 5LYJE 2H88A 4GIWA 1Y64B 4A98A 4UF0A 4AKGA 5LGTB 4P1NA 1JNZA 3B5MA 3MKDA 2V7KA 2XQ4A 3C4XA 1BR4A 1ZEEA 4BA9A 3UFEA 3ZEFB 3KV5A 1JNRA 2V6XA 1IZNB 4ADZA 4EGWA 3ANWA 2CBIA 3QK6A 4YSZA 2HN2A 2UUAT 3IA3A 2KMFA 4CI2B 4U7IA 4F6RC 2VURA 3K3QC 4EEDA 4YY3T 2ZLYA 2CXFA 4LFCT 1S94A 4C91A 1G73A 4Q25A 1UUSA 2WDQA 3K3NA 2XUEA 3F31A 4YXDA 4PJNA 4B3TT 2K24A 3GN5A 3OJAA 4EB6E 5HXCA 1VCSA 5L3GB 5HXSA 5F3JA 1NAFA 4ZI7E 2BBJA 1IBMT 4NUVA 4JEHB 1J5WA 3RIUA 4WYVA 5KMGP 3N9OA 5AQKB 2OV9A 4HWIB 3T8OA 3Q5WA 2XHEB 3AEBA 3LK2B 2JQHA 1WYBA 2MBGA 4TV9E 4A56A 4ZXLA 5TAOA 4LF4T 4GKKT 5FXZA 3ESLA 5FY1A 2L3LA 2E2AA 2V7MA 4AQGA 2BS4A 3PE0A 3P8CD 3RKGA 2PJQA 4OX9T 1M7KA 3N5LA 1IBKT 2XAQB 1HS7A 1YQ4A 3U78A 5AQHB 4ZHQE 2DWKA 4TNWA 3PURA 5AQGB 5L3EB 3OKQA 1O3XA 4YSXA 1MNEA 3KBUA 3OYXA 5FL1A 4QKNA 4OFZA 2E9XA 5HCMA 3ZMVB 4LMLA 3FZKB 3IBPA 4NIQA 1UX5A 2NTYA 3ZYKA 2BG9A 1ZOYA 3NKZA 1W0BA 4DMVA 1XDOA 1N32T 2W00A 2N9DA 5ABGA 4O2AE 4TN7B 5JVDE 3EI0A 4HFEA 4IE5A 4QXCB 2PFVA 4FI5A 3O9XA 3RI5A 2V6YA 2WP9A 3IEEA 2QA7A 3PUXF 4PK5A 2X0LB 4ANJA 4DR2T 2AE9A 2DI4A 2ZM0A 3N2OA 5JR9A 4UV9B 2R6GF 5L47A 4H9NC 3Q5DA 2V26A 3B57A 2Y48B 3ZMTB 3UQ4A 4DV1T 1W9RA 4PFOA 1T98A 2VWAA 3RRCA 5CA1E 2HPJA 2WY2A 4IT4A 3V5SA 2MOZA 3OTOT 2LRKA 3O1IA 5ABHA 2WBLA 2J1DG 2EHOC 3HA4A 1WRDA 3IF8B 2ACXA 2LHRA 3MK7C 3C98B 3DP7A 1UX4A 1XDPA 2CWOA 3AE2A 2LOSA 2VVNA 2VB6A 3SOLA 4WZXA 4HGAA 3EDVA 3A5XA 3L8RA 2NW9A 3CMLA 2M67A 1WYCA 2WMOA 3ZT6A 2KLQA 2V5CA 3A8YC 3L3PA 2CHOA 2WZIA 4AISA 3PJAA 1AJ3A 4UEMA 1XNRT 2H89A 3GA8A 3ZN1B 3NZPA 1Z8UA 4C90A 5LBQB 1H7CA 4IDNA 2KNDA 4JI5T 1CHUA 4ISTA 1D1CA 1S35A 2C0SA 5IWAT 2YOEA 1BR2A 3CX7B 4L5GA 5AQTB 3ABVA 1UGOA 4Z91A 4LF6T 2XJ7A 5HXEA 3ONXA 4GK5E 4ZZCA 2XQ7A 3AE6A 5LHIB 1MIWA 5HAXA 4WNKA 4NPPA 3CK6A 3C50A 5FKYA 1U5PA 2IC9A 3ZPOA 1LRZA 5HEHA 5AFUL 2FJDA 2XQ5A 3MACA 3AEDA 3AXJB 3EABA 3ZMUB 4DR5T 4KBMB 3RIUC 4ILCA 4HN9A 3ONLC 2CEAA 2WM9A 4EEBA 2X67A 3HKEE 2X0YA 1LKXA 4DR7T 2X9XA 4MLKA 1XZYA 2WU5A 3PUSA 3ZMZB 3RQWA 1W0AA 3NZQA 2K5BB 4CI1B 3O1JA 2A3DA 2WDVA 5CGMA 2LRLA 3WAKA 4MHCA 2IIUA 3NRXA 4QXBB 2WCAA 3DTOA 4IE4A 3C51A 3AA0B 4OHFA 2XPKA 1N34T 4LF7T 3J9X1 1HCIA 4JLEA 2XM1A 3P4SA 1KEYA 4LMKA 4DR3T 3H3AA 2KWIB 2YU2A 5LA6E 3SFEA 2IW5B 3BQLA 2J4GA 4X66T 3NWIA 3RQUA 2E9XC 2ACZA 2XQYA 4YHHT 2Z6EA 2BS2A 5HEOA 4NXMT 5BR8T 4AI6A 1W09A 2BG9C 2XAJB 2NW7A 4MALA 4U2YA 3HR0A 4DV3T 5HEGA 2X68A 4QHOA 2YDQA 4EYYR 2EHOB 3I1AA 2CCQA 4PJJA 2WWUA 4O4HE 4HFDA 5AQSB 2XAFB 2NWBA 3PUVF 3AEGA 4UF0B 2W4XA 2NW8A 3WI3A 4EYUA 4UELA 5JR9C 3K1SA 4YSYA 2G0UA 1KF6A 3ETUA 2M6IA 5LB7B 2RPAA 3ETVA 2B1EA 3LSVA 3RC8A
chains in the Genus database with same CATH topology
3ZT6A 4U7IA 2A9UA 2CRBA 4U2ZA 2V6YA 5FVLA 4U31A 1WCRA 4U2YA 2K3WA 4ZEYA 1WFDA 2V6YB 2W2UA 2MPKA 4CN1A 5CJ5A 3ZSTA 1YXRA 2JQHA 2V6XA 3ZT7A 3K1SA 4A5XA 4U3CA 4U7YA 2JQKA 2WY2A 3EABA 4IT4A 2DL1A 2CPTA 4WZXA 2WWVA 4CN4A 3ZSSA 2JQ9A 5FVKA 2LRKA 4P1NA 4CN6A 5CGMA 2XZEA 5LB7B 2LRLA 2RPAA 1WR0A 4NIQA 3ZT5A 4U33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT6 A;  4U7I A;  2A9U A;  2CRB A;  4U2Z A;  2V6Y A;  5FVL A;  4U31 A;  1WCR A;  4U2Y A;  2K3W A;  4ZEY A;  1WFD A;  2V6Y B;  2W2U A;  2MPK A;  4CN1 A;  5CJ5 A;  3ZST A;  1YXR A;  2JQH A;  2V6X A;  3ZT7 A;  3K1S A;  4A5X A;  4U3C A;  4U7Y A;  2JQK A;  2WY2 A;  3EAB A;  4IT4 A;  2DL1 A;  2CPT A;  4WZX A;  2WWV A;  4CN4 A;  3ZSS A;  2JQ9 A;  5FVK A;  2LRK A;  4P1N A;  4CN6 A;  5CGM A;  2XZE A;  5LB7 B;  2LRL A;  2RPA A;  1WR0 A;  4NIQ A;  3ZT5 A;  4U33 A; 
#chains in the Genus database with same CATH topology
 3OBV E;  4DMW A;  1UCU A;  3AVR A;  3AE4 A;  3ZCJ A;  3PUY F;  1MMN A;  3LK4 2;  3N9P A;  3KV6 A;  3RYC E;  3RHW A;  3HL6 A;  1SA0 E;  4H9S E;  4CXX A;  3OPC A;  1OED A;  1YD8 G;  3VR8 A;  3GN5 B;  1D1B A;  5EZY E;  3ZT7 A;  2X66 A;  2YKS A;  4JI8 T;  3EHZ A;  2ZMA A;  1D0Z A;  2ODU A;  2BG9 E;  4H63 H;  3CPZ A;  4TWD A;  2V8S V;  5LXT E;  4AXP A;  2C5J A;  4X1I E;  5DJQ C;  3RKO A;  2W2U A;  5C2T A;  1E7P A;  4UVA B;  4DV7 T;  2VKH A;  3U3I A;  3LDQ B;  3KBT A;  2E9X D;  2N2N A;  1D0Y A;  1T72 A;  1Y01 A;  4CXW A;  2V7L A;  3O4X E;  2L8K A;  2BVM A;  2W66 A;  4B3R T;  3KFW X;  1UUR A;  1YKH B;  5AQF B;  2ES0 A;  4PW8 A;  4ZOL E;  2VQF T;  4MFR A;  4JV5 T;  4YFS A;  4AQY T;  2IAK A;  3RC3 A;  4IL9 A;  3IHR A;  3ZJ2 A;  3FXD B;  1BR1 A;  2Q9Q A;  5M4Y A;  4EIW A;  1NEK A;  4IDQ A;  1KNR A;  4LFB T;  5JDQ A;  2KXP B;  3LG7 A;  1E1H B;  3VHL A;  5KXJ A;  2A9U A;  3P4Q A;  4AKR B;  2BG9 B;  2E8I A;  3OYZ A;  4UIG A;  3C4Z A;  3L39 A;  2WU2 A;  3AVS A;  4JI2 T;  1FMW A;  3MZK B;  4IDP A;  3ZT5 A;  5JDH A;  4P0A A;  5HEJ A;  4U31 A;  2K3W A;  4IE7 A;  4QH4 A;  2KT9 A;  2V6Y B;  4IDZ A;  3CQG B;  4QWN B;  5AQP B;  5LHH B;  4EXT A;  3X1D A;  4DV5 T;  2UUB T;  4QH5 A;  5AQV B;  2LSI A;  5JR9 B;  3HKB E;  5KX5 E;  5ABE A;  3RH3 A;  4Z8X A;  4CI3 B;  1QSD A;  3C4W A;  3RYH E;  2KWH A;  5CJ5 A;  4LMJ A;  3T1H T;  5C8Y E;  1I94 T;  2HH7 A;  1ZHC A;  1FMV A;  2NTX A;  4EV6 A;  4KI0 F;  4XZC A;  5L3B B;  2VKJ A;  4HWC A;  3PTR B;  3LBX A;  3MXZ A;  2H7V C;  3P4P A;  1HF8 A;  2IUB A;  1HFA A;  2JRK A;  2P9B A;  3H3M A;  3SWH A;  1KK7 A;  5DQV A;  2V7I A;  3AAE B;  2MAW A;  4G63 A;  5LMU T;  4X5T A;  1HX8 A;  2YIN A;  3PUW F;  3RYF E;  5DQW A;  1D1A A;  2DHR A;  4I50 E;  4J2C A;  4JI6 T;  3VKH A;  2A72 A;  2HN1 A;  5HWX A;  1ZP0 A;  2L9Q A;  3UUM A;  4DID B;  5DAB A;  5HYA A;  4PK4 A;  5LMN T;  2PTF A;  1YXR A;  2PBI A;  3UUB A;  2IDO B;  2XM2 A;  4U3C A;  3RRW A;  2D9D A;  2CXD A;  3RX6 A;  2QVA A;  3FZM B;  2D0U A;  3W15 B;  4GYS A;  1OED C;  1HR0 T;  4YJ2 E;  1XNQ T;  1MIV A;  3BK9 A;  4DV2 T;  3ZYL A;  3MJX A;  4CN1 A;  4GKJ T;  5J2T E;  2LLY A;  1XMQ T;  4IRE A;  1I6Z A;  2LSY A;  2JMK A;  3ZCI A;  4B3M T;  5AQO B;  4EAH A;  5LOV E;  4EZH A;  2DWG A;  5LJN A;  4UXN B;  4JEU B;  3E0Z A;  3H37 A;  5AQI B;  2WB5 A;  1OXZ A;  3Q5E A;  3P50 A;  2DL1 A;  3ZSS A;  2YU1 A;  3PDY A;  3ONJ A;  2FUP A;  3LFM A;  3EUH A;  4YTN A;  3FZL B;  3UFG A;  4COF A;  5JDG A;  2K48 A;  1NEN A;  3QUJ A;  3ZJ1 A;  1US7 B;  4I55 E;  4TV8 E;  5L2L A;  1HG2 A;  5FY0 A;  4A5X A;  5CA0 E;  1J1J A;  4IGU A;  1EZ3 A;  2JQ9 A;  5HEU A;  3PUQ A;  2WZH A;  3AE1 A;  2Q9Q C;  4E7Z A;  4JBW F;  3PJA J;  2YN6 A;  4GOU A;  4KHP T;  5JQG E;  2M6B A;  2XQA A;  4IL4 A;  3UU5 A;  2QRX A;  4L0R A;  4HE8 A;  4P09 A;  1IJ6 A;  5AQN B;  3HI2 A;  2LHN A;  3TLW A;  3AAA B;  2E5V A;  2LEH A;  4JI1 T;  1VCT A;  3RIF A;  1ZKE A;  3KVA A;  1WR6 A;  3UU4 A;  3JAE A;  2UXC T;  3QB5 A;  3AEE A;  5JRC A;  4AKH A;  4L9I A;  2XQ8 A;  2V5D A;  4B6X A;  4PNI A;  1HNZ T;  3EDU A;  4X62 T;  3J7Y q;  5L3C B;  4PAG A;  4X65 T;  3BQI A;  1NWM X;  5FP3 A;  1YKE B;  1WLX A;  5AQQ B;  5H6Q B;  2D2S A;  3M3Z B;  4G2A A;  3FZH B;  4AIU A;  2DLR A;  3RYI E;  4PJL A;  2BZB A;  4H63 V;  4O4I E;  4O4J E;  2YEV C;  5C3J A;  4JUY A;  4M1P A;  1HTJ F;  2LE8 A;  4OYJ A;  2OA5 A;  2FJB A;  2VKD A;  4ZS3 A;  3ZST A;  3I0O A;  5JDN A;  1YW0 A;  2PG8 A;  1U4Q A;  2CPT A;  2WS3 A;  4I43 B;  4IE6 A;  4NUU A;  3ZMS B;  4H9O C;  3SRZ A;  1G8X A;  5ABF B;  2LM9 A;  3JAF A;  4ILB A;  5H6R B;  4U2Z A;  5ETW A;  3PV0 F;  3UTK A;  5J0Z A;  2YDS A;  5KDM C;  2RP4 A;  2Q9Q D;  3RPU A;  3JC6 C;  3ZLI A;  4KP3 C;  2XZE A;  2UXN B;  5LNK A;  5JH7 E;  3C64 A;  3ZN0 B;  5BMV E;  4DR4 T;  3AXJ A;  3GMI A;  3KIN B;  3CX6 B;  3AB3 B;  2ZM6 T;  3HKD E;  4WW0 A;  5HXR A;  4LF9 T;  3ANW B;  1R8I A;  3FB2 A;  3L09 A;  3UT5 E;  5JDF A;  5LCY A;  3SFD A;  2RA1 A;  2WDR A;  4KMC A;  5FNV E;  3NVO A;  5AQL B;  3LJC A;  3AEC A;  1QUU A;  4DV0 T;  3PUG A;  3FHN A;  5FXX A;  4HWF A;  2YDR A;  2B76 A;  3UU3 A;  3HKC E;  2GK9 A;  1SUM B;  5JTG A;  4DBR A;  4HWH A;  4TUY E;  4CN4 A;  4GYR A;  4QX8 B;  3KV4 A;  4YT0 A;  3RIA A;  3AA6 B;  5E0O A;  1OWA A;  2CHN A;  4ZS2 A;  5FXV A;  4X64 T;  3F57 A;  2QGS A;  4JYA T;  4V1A v;  3AE7 A;  3N9N A;  2CE7 A;  2FJA A;  1FEW A;  3UUN A;  3AE5 A;  3QC9 A;  3N2G E;  2LSJ A;  4E7S A;  5LG3 A;  2XSB A;  1MMG A;  4DND A;  4ERR A;  3ZYM A;  2H3R A;  3ZC1 A;  5EK2 A;  2VK9 A;  2SPC A;  3AAI A;  2X9W A;  2CA5 A;  2AXD S;  3AA7 B;  2CBJ A;  5HXH A;  5FXW A;  2UU9 T;  4HFC A;  1XMO T;  2LJL A;  5J1G A;  2LKG A;  2VQE T;  3LK3 B;  3AE8 A;  2CRB A;  3JC6 D;  2W67 A;  5IUX A;  1HNW T;  4HFI A;  5IYZ E;  4HTE A;  2DCF A;  5FL0 A;  4CZZ B;  5FYM A;  4U7Y A;  3LBX B;  2Y8D A;  4TWF A;  1LVK A;  3MA9 A;  1YQ3 A;  3P4R A;  2E9X B;  4HKA A;  5F8P A;  1V9D A;  1WCR A;  2HPL A;  2XTL A;  4UVB B;  3AEA A;  4ZZB A;  4YJ3 E;  3V5U A;  2VL8 A;  4JI4 T;  4CN6 A;  4K0U A;  3WAJ A;  3O1H A;  1ZV4 X;  2XAH B;  4CXY A;  3GWH A;  3K8P C;  5LGU B;  2LM2 A;  2N1G A;  3P7I A;  4H9P C;  5AQM B;  4OYK A;  2WSS V;  2LSK A;  2W63 A;  3TLT A;  2I0M A;  3DJB A;  2FBW A;  4X1K E;  4QX7 B;  4FJO A;  3AE9 A;  3RLF F;  1FIO A;  4HFV A;  2BDE A;  4YTM A;  2X9H A;  3Q2M A;  4AKL A;  4JI7 T;  2MTQ A;  1SHZ C;  5LGN B;  2ZM2 A;  1WFD A;  2X51 A;  3FBZ A;  5L3F B;  5LJM A;  3N2K E;  3UU8 A;  2E5L T;  3FBL A;  2K9A A;  2C5I T;  2XSA A;  4DR1 T;  1WR0 A;  3VKG A;  4P0B A;  2ODV A;  1T7S A;  2XAS B;  2QYW A;  3G06 A;  1IAP A;  4U72 A;  3R6N A;  5LG4 A;  4I0U A;  4EOZ B;  3TKL B;  4H9R C;  4AQF A;  4YLH A;  3TLV A;  4UVC B;  2JQQ A;  2Y6X A;  3K3O A;  5FVL A;  3N9Q A;  1X79 A;  1KFY A;  1B7T A;  2LOP A;  1N33 T;  2W61 A;  2W62 A;  4JI3 T;  4BJN A;  2UXB T;  4ZI3 C;  4QXH B;  1N36 T;  2DNX A;  3AA1 B;  2XY8 B;  3QOF A;  5JRC B;  2BBH A;  4O8S A;  1KNP A;  5L4H A;  2HHH T;  1MMD A;  4PK6 A;  3NRY A;  4HFH A;  1CUN A;  3T1Y T;  3ZKR A;  2UXD T;  1XWM A;  4XBF B;  3ZC0 A;  2NR4 A;  2XAG B;  1VOM A;  5L4E A;  3UQ7 A;  3AEF A;  2CLY C;  2J47 A;  2VAS A;  1DU2 A;  2D5U A;  1MIY A;  3KDS E;  5CB4 E;  3A7M A;  4DBQ A;  1VRB A;  3TLU A;  2A2F X;  5HCJ A;  1SE7 A;  4IHJ E;  2LSG A;  4B3S T;  5EK4 A;  3UU6 A;  4BAY B;  4ILU A;  3CQX C;  4DUY T;  1MND A;  4WBO A;  2JMH A;  5A1L A;  4AKI A;  5JRE A;  2JPF A;  2BS3 A;  5FY7 A;  1OED E;  2WMN A;  2KIN B;  1KNZ A;  1M62 A;  5J2U E;  4MBQ A;  2V7J A;  3EVY A;  3KV9 A;  3PU8 A;  4UR9 A;  4HFB A;  4X20 E;  1BR0 A;  5HWY A;  3P4W A;  2W0G A;  4IDO A;  2IML A;  5CFB A;  1X9B A;  5JDL A;  4JI0 T;  2D0T A;  3BQK A;  3VR9 A;  2IC6 A;  3B13 A;  4DUZ T;  4TNV A;  4WBN E;  3JAD A;  4EZ4 A;  4ZI3 D;  3JCF A;  5FMN A;  4IIJ E;  4I4T E;  3PUA A;  3UUL A;  2JIW A;  2UUC T;  3Q5X A;  2H7O A;  3I9W A;  4ASK A;  3SS1 A;  4KX6 A;  2LT3 A;  1HX1 B;  4ZEY A;  5AQU B;  3I0Q A;  2NP9 A;  4LF5 T;  3R84 B;  3KVB A;  2VVS A;  3CKD A;  3RF1 A;  4GK0 E;  4IE0 A;  1LVF A;  5LP6 E;  2CXL A;  2C5K T;  3E08 A;  5EK3 A;  3VRB A;  4O2B E;  2UXX B;  1J5E T;  2CM0 A;  5GON E;  1FJG T;  2EHO D;  2LKH A;  1OED B;  3PUZ F;  4CQI A;  5ADX L;  4Z90 A;  1IJ5 A;  2JQK A;  3CIR A;  4LF8 T;  2X9Y A;  2IHR 1;  4A97 A;  5FVK A;  4H9Q C;  4ZI2 C;  2WQY A;  4DR6 T;  4U33 A;  4O4L E;  4NXN T;  4DO0 A;  4TZ4 C;  3FZF B;  2J62 A;  5LBM A;  2BKN A;  3CQC B;  1GQE A;  2JJ9 A;  4UV8 B;  4AQF C;  2XQ9 A;  4YTP A;  1UK5 A;  2BKO A;  4HEA A;  4BJM A;  1IBL T;  4DVD A;  2BKP A;  4LFA T;  4F8H A;  4KUM B;  3CWZ B;  2KSR A;  3D0T A;  4HWD A;  1QLB A;  2MPK A;  2CLY B;  4XAX B;  2I59 A;  3VU7 H;  4ISS A;  4TWH A;  2WWV A;  2X0H A;  4DV4 T;  3RGL A;  4N78 D;  3QNU A;  3Q9D A;  1HG5 A;  4YHJ A;  3OVU A;  3PU3 A;  3NBX X;  4K0K T;  2OLT A;  2MYS A;  3N9M A;  1MMA A;  2NOX A;  3AE3 A;  5LHG B;  2I6H A;  4ILA A;  3TLS A;  3F2E A;  3M65 A;  3CVR A;  5IHY A;  5AQJ B;  2Q9Q B;  2VL0 A;  2V1D B;  3E22 E;  2KZ7 B;  5JDM A;  3I9Y A;  2XQ3 A;  1E2A A;  2XQ6 A;  4U74 A;  2VKO A;  2WAU A;  2YK0 A;  2F4V T;  1Z0P A;  4PJM A;  4OK0 A;  3FXE B;  5L3D B;  3EAM A;  2BVL A;  5F5W A;  4KHZ F;  1T8B A;  3S4U A;  4PFP A;  3N9L A;  4X1Y E;  4QH1 A;  3VRA A;  3CX8 B;  2FJE A;  5ABF A;  1HNX T;  2CWY A;  2CMR A;  4DV6 T;  2ZM8 A;  4TX5 A;  5AQR B;  4ZI2 D;  2EHO A;  3UUX B;  1D0X A;  1L0V A;  3QB5 K;  5LYJ E;  2H88 A;  4GIW A;  1Y64 B;  4A98 A;  4UF0 A;  4AKG A;  5LGT B;  4P1N A;  1JNZ A;  3B5M A;  3MKD A;  2V7K A;  2XQ4 A;  3C4X A;  1BR4 A;  1ZEE A;  4BA9 A;  3UFE A;  3ZEF B;  3KV5 A;  1JNR A;  2V6X A;  1IZN B;  4ADZ A;  4EGW A;  3ANW A;  2CBI A;  3QK6 A;  4YSZ A;  2HN2 A;  2UUA T;  3IA3 A;  2KMF A;  4CI2 B;  4U7I A;  4F6R C;  2VUR A;  3K3Q C;  4EED A;  4YY3 T;  2ZLY A;  2CXF A;  4LFC T;  1S94 A;  4C91 A;  1G73 A;  4Q25 A;  1UUS A;  2WDQ A;  3K3N A;  2XUE A;  3F31 A;  4YXD A;  4PJN A;  4B3T T;  2K24 A;  3GN5 A;  3OJA A;  4EB6 E;  5HXC A;  1VCS A;  5L3G B;  5HXS A;  5F3J A;  1NAF A;  4ZI7 E;  2BBJ A;  1IBM T;  4NUV A;  4JEH B;  1J5W A;  3RIU A;  4WYV A;  5KMG P;  3N9O A;  5AQK B;  2OV9 A;  4HWI B;  3T8O A;  3Q5W A;  2XHE B;  3AEB A;  3LK2 B;  2JQH A;  1WYB A;  2MBG A;  4TV9 E;  4A56 A;  4ZXL A;  5TAO A;  4LF4 T;  4GKK T;  5FXZ A;  3ESL A;  5FY1 A;  2L3L A;  2E2A A;  2V7M A;  4AQG A;  2BS4 A;  3PE0 A;  3P8C D;  3RKG A;  2PJQ A;  4OX9 T;  1M7K A;  3N5L A;  1IBK T;  2XAQ B;  1HS7 A;  1YQ4 A;  3U78 A;  5AQH B;  4ZHQ E;  2DWK A;  4TNW A;  3PUR A;  5AQG B;  5L3E B;  3OKQ A;  1O3X A;  4YSX A;  1MNE A;  3KBU A;  3OYX A;  5FL1 A;  4QKN A;  4OFZ A;  2E9X A;  5HCM A;  3ZMV B;  4LML A;  3FZK B;  3IBP A;  4NIQ A;  1UX5 A;  2NTY A;  3ZYK A;  2BG9 A;  1ZOY A;  3NKZ A;  1W0B A;  4DMV A;  1XDO A;  1N32 T;  2W00 A;  2N9D A;  5ABG A;  4O2A E;  4TN7 B;  5JVD E;  3EI0 A;  4HFE A;  4IE5 A;  4QXC B;  2PFV A;  4FI5 A;  3O9X A;  3RI5 A;  2V6Y A;  2WP9 A;  3IEE A;  2QA7 A;  3PUX F;  4PK5 A;  2X0L B;  4ANJ A;  4DR2 T;  2AE9 A;  2DI4 A;  2ZM0 A;  3N2O A;  5JR9 A;  4UV9 B;  2R6G F;  5L47 A;  4H9N C;  3Q5D A;  2V26 A;  3B57 A;  2Y48 B;  3ZMT B;  3UQ4 A;  4DV1 T;  1W9R A;  4PFO A;  1T98 A;  2VWA A;  3RRC A;  5CA1 E;  2HPJ A;  2WY2 A;  4IT4 A;  3V5S A;  2MOZ A;  3OTO T;  2LRK A;  3O1I A;  5ABH A;  2WBL A;  2J1D G;  2EHO C;  3HA4 A;  1WRD A;  3IF8 B;  2ACX A;  2LHR A;  3MK7 C;  3C98 B;  3DP7 A;  1UX4 A;  1XDP A;  2CWO A;  3AE2 A;  2LOS A;  2VVN A;  2VB6 A;  3SOL A;  4WZX A;  4HGA A;  3EDV A;  3A5X A;  3L8R A;  2NW9 A;  3CML A;  2M67 A;  1WYC A;  2WMO A;  3ZT6 A;  2KLQ A;  2V5C A;  3A8Y C;  3L3P A;  2CHO A;  2WZI A;  4AIS A;  3PJA A;  1AJ3 A;  4UEM A;  1XNR T;  2H89 A;  3GA8 A;  3ZN1 B;  3NZP A;  1Z8U A;  4C90 A;  5LBQ B;  1H7C A;  4IDN A;  2KND A;  4JI5 T;  1CHU A;  4IST A;  1D1C A;  1S35 A;  2C0S A;  5IWA T;  2YOE A;  1BR2 A;  3CX7 B;  4L5G A;  5AQT B;  3ABV A;  1UGO A;  4Z91 A;  4LF6 T;  2XJ7 A;  5HXE A;  3ONX A;  4GK5 E;  4ZZC A;  2XQ7 A;  3AE6 A;  5LHI B;  1MIW A;  5HAX A;  4WNK A;  4NPP A;  3CK6 A;  3C50 A;  5FKY A;  1U5P A;  2IC9 A;  3ZPO A;  1LRZ A;  5HEH A;  5AFU L;  2FJD A;  2XQ5 A;  3MAC A;  3AED A;  3AXJ B;  3EAB A;  3ZMU B;  4DR5 T;  4KBM B;  3RIU C;  4ILC A;  4HN9 A;  3ONL C;  2CEA A;  2WM9 A;  4EEB A;  2X67 A;  3HKE E;  2X0Y A;  1LKX A;  4DR7 T;  2X9X A;  4MLK A;  1XZY A;  2WU5 A;  3PUS A;  3ZMZ B;  3RQW A;  1W0A A;  3NZQ A;  2K5B B;  4CI1 B;  3O1J A;  2A3D A;  2WDV A;  5CGM A;  2LRL A;  3WAK A;  4MHC A;  2IIU A;  3NRX A;  4QXB B;  2WCA A;  3DTO A;  4IE4 A;  3C51 A;  3AA0 B;  4OHF A;  2XPK A;  1N34 T;  4LF7 T;  3J9X 1;  1HCI A;  4JLE A;  2XM1 A;  3P4S A;  1KEY A;  4LMK A;  4DR3 T;  3H3A A;  2KWI B;  2YU2 A;  5LA6 E;  3SFE A;  2IW5 B;  3BQL A;  2J4G A;  4X66 T;  3NWI A;  3RQU A;  2E9X C;  2ACZ A;  2XQY A;  4YHH T;  2Z6E A;  2BS2 A;  5HEO A;  4NXM T;  5BR8 T;  4AI6 A;  1W09 A;  2BG9 C;  2XAJ B;  2NW7 A;  4MAL A;  4U2Y A;  3HR0 A;  4DV3 T;  5HEG A;  2X68 A;  4QHO A;  2YDQ A;  4EYY R;  2EHO B;  3I1A A;  2CCQ A;  4PJJ A;  2WWU A;  4O4H E;  4HFD A;  5AQS B;  2XAF B;  2NWB A;  3PUV F;  3AEG A;  4UF0 B;  2W4X A;  2NW8 A;  3WI3 A;  4EYU A;  4UEL A;  5JR9 C;  3K1S A;  4YSY A;  2G0U A;  1KF6 A;  3ETU A;  2M6I A;  5LB7 B;  2RPA A;  3ETV A;  2B1E A;  3LSV A;  3RC8 A; 
#chains in the Genus database with same CATH homology
 3ZT6 A;  4U7I A;  2A9U A;  2CRB A;  4U2Z A;  2V6Y A;  5FVL A;  4U31 A;  1WCR A;  4U2Y A;  2K3W A;  4ZEY A;  1WFD A;  2V6Y B;  2W2U A;  2MPK A;  4CN1 A;  5CJ5 A;  3ZST A;  1YXR A;  2JQH A;  2V6X A;  3ZT7 A;  3K1S A;  4A5X A;  4U3C A;  4U7Y A;  2JQK A;  2WY2 A;  3EAB A;  4IT4 A;  2DL1 A;  2CPT A;  4WZX A;  2WWV A;  4CN4 A;  3ZSS A;  2JQ9 A;  5FVK A;  2LRK A;  4P1N A;  4CN6 A;  5CGM A;  2XZE A;  5LB7 B;  2LRL A;  2RPA A;  1WR0 A;  4NIQ A;  3ZT5 A;  4U33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...