2LRKA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphocarrier protein HPr
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrkA00
1YXRA 2WY2A 4U3CA 4U7YA 4U2YA 2W2UA 4A5XA 2V6XA 4NIQA 4CN1A 2WWVA 2JQKA 4CN6A 2JQHA 2RPAA 4WZXA 5FVLA 4U2ZA 4U31A 3ZT5A 3ZT6A 4CN4A 2A9UA 4U33A 2DL1A 5LB7B 2V6YA 5CJ5A 2LRLA 2MPKA 5CGMA 3EABA 3ZSTA 4ZEYA 2JQ9A 1WFDA 2CPTA 3ZT7A 3ZSSA 4IT4A 4P1NA 4U7IA 2K3WA 2CRBA 2XZEA 2V6YB 3K1SA 1WR0A 2LRKA 5FVKA 1WCRA
chains in the Genus database with same CATH superfamily
2GK9A 1YKHB 1Y64B 2Y8DA 3FZKB 4PK5A 2XQYA 2UUBT 2K9AA 5CFBA 4ANJA 4LFBT 4H9SE 4JI8T 5LJNA 2A9UA 5KX5E 3NBXX 3RF1A 2V6YA 1MNEA 2B76A 2WBLA 5EK3A 5LBQB 1YQ4A 5BR8T 5LNKA 4IHJE 4O4IE 4QXCB 2BDEA 1D0ZA 2VQFT 2E9XA 4ISTA 3AE4A 2E2AA 4BJNA 2N9DA 3ZSTA 5LA6E 4IGUA 4Q25A 3E0ZA 5H6QB 2V6YB 4UV9B 3NKZA 4UIGA 5FXVA 2I0MA 5FY0A 3UULA 4YSYA 1FEWA 4LF9T 2LM9A 2E9XB 2VWAA 1HG5A 2CPTA 1W0BA 3HA4A 5HYAA 4PJMA 4F8HA 1MMNA 3RYHE 5HXSA 4QXHB 3JAFA 2WSSV 3EI0A 2BKOA 2R6GF 2BVMA 4OK0A 2LRKA 2JMHA 4ZI3D 4X1YE 2MBGA 3R84B 4CN1A 4WBNE 4U31A 4HGAA 2HPLA 3PUQA 4DR5T 3HKDE 2K5BB 3LJCA 4K0KT 2DHRA 1D1BA 5L3BB 2CLYC 2IC6A 3RLFF 3UQ4A 3ZMTB 4LF6T 5HXEA 3VKGA 3EVYA 3KV5A 2LLYA 3N9OA 2YKSA 2D9DA 4JUYA 3ANWA 5DABA 3S4UA 2V26A 1ZKEA 4EB6E 4HFIA 3P4PA 5AQMB 4H9PC 4KMCA 1W9RA 5AQJB 4TWFA 2XQAA 4EYUA 4DUYT 4EEBA 3ANWB 3FZFB 4QH5A 3O1JA 4FI5A 4KP3C 1UCUA 2KT9A 3UU8A 1D0YA 5F5WA 4AQGA 4ILCA 4J2CA 2CXDA 3V5UA 3KFWX 4PNIA 4UVBB 5HWXA 2XZEA 2CHNA 4IE7A 4JBWF 4PFPA 4TZ4C 2EHOC 1N36T 2NR4A 3EAMA 1G8XA 1WYCA 2DCFA 2MTQA 3UUMA 2NWBA 3U78A 2DWKA 4DNDA 5L47A 3QNUA 4H63H 3EDUA 2IMLA 2C0SA 2XQ9A 4X1IE 3TLWA 2V7IA 2XQ7A 1CHUA 4AI6A 1E2AA 4YSXA 2LT3A 1QSDA 2UUCT 3TLVA 2VKOA 3KV6A 4U7YA 3PUWF 4WYVA 2L3LA 3AEEA 3L8RA 4ZS3A 4P0AA 3AXJA 3KV9A 5AQIB 2ZM8A 2FJDA 5FP3A 3FZMB 5JRCA 2LRLA 2J1DG 4OYKA 2Q9QC 5AQOB 4DR6T 4X1KE 2AE9A 2BBHA 1OEDC 3P4SA 3HL6A 2YU1A 3WI3A 3PJAJ 3JADA 3AA7B 4HWCA 2K24A 3P4RA 2IHR1 3AXJB 4IDPA 1R8IA 5JRCB 2DWGA 5FVKA 3ZMVB 4JLEA 4IL4A 4QX8B 1HF8A 5AQQB 1XMQT 3WAKA 5HCMA 4U33A 1IJ5A 2CE7A 2WZIA 3UQ7A 3E22E 5LP6E 5ABGA 1KNRA 3L09A 4V1Av 4CZZB 2XAJB 3ZN0B 2W00A 4IE6A 4GYRA 4B6XA 3M3ZB 4JI0T 3RIFA 3UFGA 3UU3A 4H9NC 5JTGA 2W0GA 4WW0A 3OYXA 1IBMT 2CBIA 2N1GA 2W66A 4U7IA 4O8SA 4TUYE 1WRDA 4LF8T 5H6RB 1D0XA 4TN7B 3N5LA 4CI3B 3UU5A 5CA0E 4X66T 4OFZA 2RP4A 3CX6B 1LVKA 5CA1E 5C8YE 3F31A 4G63A 1UX5A 5JR9C 4HFCA 1NENA 4JV5T 1XNQT 3M65A 5AQRB 2PFVA 2EHOD 5L4HA 2JQHA 3BK9A 5L3FB 5JDHA 3AE8A 3CQCB 4TV9E 2VQET 2HHHT 3L39A 1LRZA 2X0HA 5JVDE 2HH7A 3N9PA 2LSJA 4K0UA 2W61A 4NXMT 5FVLA 1Z8UA 1OXZA 1HNZT 4JI3T 2LSGA 4TWHA 2M6IA 3GA8A 2KNDA 4A97A 4EEDA 2NW7A 4YTMA 3H37A 3O1HA 3T1HT 4HWHA 5FYMA 2W63A 5FKYA 3FZLB 2I59A 3ABVA 2V7MA 3J9X1 2X66A 4AKLA 4YTNA 4AQFC 3ZT7A 4AXPA 2Q9QD 5ABHA 4PW8A 2K3WA 3LK2B 4E7ZA 3RC3A 2CBJA 1VOMA 3QOFA 1OEDE 3RIUC 2CCQA 2JIWA 4HEAA 3AB3B 1LVFA 4EXTA 3AA0B 1D1AA 4UVCB 5AQVB 3UUXB 5AQKB 2BKPA 2LOPA 2BKNA 3JAEA 1HS7A 3PUYF 5L2LA 3ETVA 4ILBA 1UUSA 4AKGA 4YFSA 3T1YT 1I6ZA 3AEBA 1ZEEA 2ODVA 5J0ZA 5HEJA 5J2TE 5LYJE 2Y48B 4MLKA 2LSKA 2YDSA 4IDZA 3NRXA 5HEOA 2LE8A 3AECA 4YTPA 4Z8XA 3JCFA 5LGTB 3ONLC 4A98A 4PJLA 2KZ7B 4HE8A 3IA3A 4EZHA 1HNXT 3CQGB 4NXNT 2LM2A 3ZT6A 4OHFA 3Q5WA 4EOZB 2A3DA 3PUXF 5HAXA 2ES0A 3MK7C 2ZM2A 3ZEFB 2M67A 3CX8B 5LHIB 2YEVC 2WU5A 4F6RC 3CPZA 4EAHA 5JDMA 1JNZA 1YKEB 3CIRA 2W67A 1W09A 3CX7B 1OWAA 2XM2A 2FBWA 1N32T 3D0TA 5JDQA 1MMDA 2DI4A 1WYBA 4B3RT 2X0YA 1QUUA 2UXXB 3K1SA 3QUJA 3Q5XA 2XSBA 2VASA 1X79A 4CI1B 1J1JA 1U5PA 5E0OA 3MKDA 4ERRA 2LKHA 4EZ4A 3MA9A 4O2BE 2XTLA 4YHJA 4P0BA 4EYYR 2IAKA 4QX7B 3PTRB 3NVOA 2XSAA 1BR0A 3IBPA 2UU9T 1MIWA 2UUAT 4DR4T 1NEKA 4L0RA 4IT4A 2DLRA 4DV0T 2NW8A 3AEGA 5HEGA 3VHLA 4FJOA 4ZI2C 2H7OA 4QH4A 3R6NA 2V5DA 1HTJF 2JRKA 4IIJE 4DV5T 4AKRB 3VRBA 5LXTE 5FY1A 5JH7E 4H9RC 3CWZB 2SPCA 3OYZA 1N33T 4YY3T 4QH1A 3NRYA 4ZHQE 2VB6A 3VU7H 2WZHA 2BG9C 3QB5K 3T8OA 2KMFA 3B13A 4IE5A 4GKKT 5JDFA 3QK6A 4LMLA 2PBIA 5HEHA 5EK2A 3UT5E 4OYJA 3N9QA 1KNZA 2LSIA 2V8SV 2RPAA 4HN9A 4I0UA 5J2UE 3SFEA 2ZM0A 4YT0A 3O4XE 3EHZA 3V5SA 2CRBA 3BQKA 4G2AA 3ZJ2A 3B57A 4DUZT 1VCTA 1KK7A 4IDOA 4MFRA 2X67A 2CHOA 2LKGA 1NAFA 2NW9A 5AFUL 4IDQA 1MIVA 3OPCA 2E8IA 4IL9A 3ZLIA 4I55E 4DR2T 4QXBB 5AQUB 5LHHB 2V6XA 2JPFA 2V7LA 4JI4T 4LMJA 5ETWA 1IBLT 4UELA 2CMRA 2BS4A 2IW5B 3ZYKA 3VR8A 5ABEA 1BR4A 1FJGT 3L3PA 2UXCT 1BR1A 1B7TA 3RPUA 4A56A 2C5IT 2XM1A 2IIUA 5HEUA 3LFMA 5AQNB 3SS1A 3KBUA 2UXNB 3ESLA 3K3NA 2YK0A 5IYZE 4CQIA 5AQFB 5AQGB 3AVRA 3MACA 3TLTA 1SUMB 3KINB 5FMNA 1YQ3A 2FUPA 4DV7T 1UK5A 4O2AE 4DVDA 1XNRT 4ZOLE 1E1HB 2WY2A 2X9WA 4M1PA 3RGLA 3LBXA 4UVAB 2HPJA 2WDRA 5FXZA 4ZI2D 3Q9DA 2CEAA 4JYAT 4JI7T 4DV3T 2XQ8A 2Y6XA 4ZEYA 4UF0A 3N2GE 2BBJA 2WDQA 4P09A 1SHZC 2CLYB 1IJ6A 2JQQA 4DIDB 1AJ3A 1N34T 2DL1A 3FBLA 2JMKA 2QVAA 5LGNB 2BG9E 3LBXB 3LG7A 2D0UA 1HCIA 4LMKA 3TKLB 3A7MA 3PUGA 3GWHA 3PUVF 4MALA 4UF0B 2XAGB 4B3MT 1S94A 2XY8B 4UV8B 4ZZCA 4CXXA 1CUNA 3P50A 4X64T 4PK4A 3AEDA 4DV4T 1DU2A 4DMWA 3AAEB 3G06A 4AISA 3Q5EA 5JDNA 2EHOA 2MOZA 3C51A 4O4LE 2M6BA 2XASB 2CXLA 4U2YA 4LF4T 3DTOA 1HNWT 1UX4A 3ZT5A 4PAGA 4BA9A 3I0QA 4IE0A 1G73A 3ZSSA 1KF6A 2WP9A 5L4EA 4KBMB 2WU2A 3PU8A 4XAXB 3HKCE 4NIQA 4KHZF 2XJ7A 3RYFE 5CB4E 5LJMA 2EHOB 4JEUB 3AE9A 3K8PC 5HXHA 3EDVA 4CXWA 4QWNB 4BJMA 4NUUA 3B5MA 3RQWA 2WDVA 1YXRA 1T72A 2XUEA 1YW0A 4IDNA 2WB5A 1GQEA 2NTYA 3KVBA 1KEYA 5L3EB 2IUBA 4ILUA 2Q9QA 5CGMA 3CKDA 3ETUA 4Z91A 2P9BA 2QGSA 3IHRA 3N9MA 4EV6A 4YXDA 4HFDA 4DV6T 3SFDA 2IDOB 2X0LB 2KLQA 1OEDA 2YINA 1NWMX 1XZYA 2OA5A 4C91A 4MHCA 5LG3A 2E9XC 1KNPA 4LF5T 5HCJA 3UU4A 3VR9A 5ADXL 3FHNA 3TLUA 2LJLA 5LGUB 4UEMA 5DQVA 4O4HE 2Q9QB 2VK9A 2H3RA 2CA5A 5ABFA 4H63V 2ACXA 5KXJA 4DBRA 2I6HA 4DMVA 1OEDB 5IUXA 1SA0E 5CJ5A 5AQPB 4LFAT 3RQUA 2FJEA 2WCAA 1L0VA 4GKJT 5LHGB 2PG8A 2E5LT 3AE7A 3PDYA 1YD8G 3ZMSB 3UUNA 4DR7T 3QB5A 5ABFB 5FNVE 4DV1T 5KDMC 3AE3A 2XPKA 3ONXA 1IZNB 2HN1A 4KUMB 2LOSA 1FIOA 2WQYA 3RRWA 5J1GA 5KMGP 4HKAA 3OKQA 3HKEE 3C4WA 2KWIB 2NP9A 4U2ZA 3ZC1A 4C90A 3HI2A 4JI6T 5FXXA 2V5CA 5JR9A 3VKHA 3P8CD 3LK42 3PV0F 3ZPOA 5JDLA 4HFBA 1T8BA 5F8PA 2ZM6T 1MMGA 3ZCJA 4DR3T 1HFAA 5TAOA 4JI2T 4UXNB 4ILAA 2V1DB 3F2EA 3PU3A 3UU6A 2ZMAA 3NWIA 3LDQB 4U74A 3AVSA 3KBTA 4JEHB 5JR9B 3BQLA 3CMLA 4HWIB 2D0TA 5M4YA 2V7KA 4AQYT 3ZJ1A 3O9XA 1ZV4X 4LF7T 3AEFA 2QRXA 5FXWA 3AA1B 4LFCT 1ZP0A 2VL0A 2BS3A 3AE2A 2J47A 2LEHA 2MPKA 3RI5A 4AKHA 4AQFA 4WNKA 3P4WA 5JDGA 3KDSE 4E7SA 4O4JE 1ZHCA 5AQLB 1WCRA 1IAPA 2K48A 3RIUA 1JNRA 3FBZA 4TX5A 2E9XD 3N2KE 4DO0A 3SWHA 4XBFB 4ISSA 1J5WA 2DNXA 1I94T 1KFYA 3C98B 2QA7A 2A2FX 2N2NA 3NZQA 4TWDA 3K3OA 1Y01A 2X51A 2YN6A 3AEAA 4GOUA 1HX1B 4B3TT 4EGWA 2ODUA 2YDQA 4TNVA 4GK0E 4H9QC 3QC9A 4YLHA 2W2UA 4A5XA 2H89A 3RKOA 5A1LA 2BVLA 1HG2A 2UXDT 1MNDA 1UGOA 2WM9A 3UFEA 2BZBA 4EIWA 5JQGE 3ZC0A 1H7CA 2JQ9A 4QKNA 3I9YA 4Z90A 5FL1A 1WR0A 4GYSA 2VKJA 2X9XA 3AE6A 2LSYA 1XDPA 2A72A 4L9IA 4XZCA 4HWFA 5BMVE 2Z6EA 3PUSA 3I0OA 2VVSA 2XAHB 1UURA 1SE7A 4CI2B 2W4XA 3RX6A 4X20E 3FB2A 2V7JA 3AAIA 1LKXA 2XHEB 3SOLA 2WMOA 2B1EA 2NOXA 2J4GA 2IC9A 2KWHA 3ZMZB 2FJAA 2YU2A 3C4XA 3FZHB 4I43B 1V9DA 3PURA 3SRZA 4WZXA 3AE5A 3TLSA 2ACZA 3A5XA 4N78D 3PJAA 2UXBT 5JREA 3RIAA 1XDOA 3JC6C 5LOVE 1QLBA 1US7B 2BS2A 1WLXA 3I9WA 4YJ2E 3RH3A 2WAUA 3RHWA 2X9YA 2W62A 4HFVA 3ZN1B 3H3MA 4GK5E 4KHPT 1EZ3A 4ASKA 2C5KT 3OTOT 2XQ5A 3X1DA 4NPPA 2L9QA 1ZOYA 3LSVA 3ZYLA 4QHOA 5EK4A 2YDRA 2VURA 3UUBA 1XMOT 4PK6A 5C3JA 5HXCA 4DV2T 2KINB 3AE1A 3EABA 4HWDA 2XQ3A 5LMNT 4B3ST 3EUHA 4ZS2A 4ZZBA 2E5VA 3OJAA 4U3CA 4DBQA 3ONJA 3Q2MA 2BG9A 1U4QA 4CN4A 3AA6B 5FL0A 4IE4A 2WS3A 1VCSA 4KI0F 1WFDA 3MZKB 3NZPA 4P1NA 5DQWA 1E7PA 1W0AA 3O1IA 3OVUA 3PUZF 1HR0T 5LG4A 2F4VT 3PUAA 5AQTB 3C64A 2NTXA 4X5TA 5AQHB 4JI5T 4COFA 2BG9B 1MIYA 2H7VC 3Q5DA 1IBKT 4GIWA 1FMVA 3ZYMA 3ZCIA 2XQ6A 2KXPB 4MBQA 3HKBE 2D2SA 3KVAA 4X65T 3U3IA 2KSRA 5HWYA 1M62A 3RRCA 3J7Yq 4ADZA 3N9NA 5AQSB 4KX6A 5L3DB 3N2OA 5L3CB 3LK3B 1Z0PA 1D1CA 4ZI7E 3RYIE 2X68A 3C4ZA 4AKIA 2MYSA 3GMIA 1J5ET 2XAQB 3FXEB 1S35A 2X9HA 1MMAA 2OV9A 2WMNA 2WWVA 2JQKA 3RKGA 5DJQC 5LB7B 2VVNA 4PJJA 3ZMUB 5F3JA 1T98A 3JC6D 2CXFA 2C5JA 5C2TA 3GN5A 4HFHA 4IREA 1X9BA 4I50E 1BR2A 3A8YC 4UR9A 2LHNA 4BAYB 2XQ4A 3RC8A 2PTFA 3H3AA 3PE0A 4HFEA 2QYWA 3WAJA 3GN5B 4X62T 2AXDS 3DJBA 4YJ3E 3CQXC 2JJ9A 3P7IA 3HR0A 3CVRA 3K3QC 5LMUT 1M7KA 3MJXA 4CN6A 4WBOA 2FJBA 5HXRA 3W15B 4TV8E 3FXDB 4PFOA 4ZI3C 3N9LA 4L5GA 3AAAB 2VKHA 5IHYA 5GONE 1WR6A 5L3GB 3IF8B 4ZXLA 4JI1T 1O3XA 2CM0A 2LHRA 3F57A 1FMWA 4DR1T 2VL8A 2XAFB 5FY7A 3BQIA 3P4QA 2PJQA 1VRBA 2CWYA 4CXYA 2J62A 3ZKRA 1XWMA 3IEEA 4YSZA 3DP7A 4U72A 2CWOA 2VKDA 4NUVA 2WWUA 4H9OC 3E08A 3I1AA 2G0UA 2ZLYA 3MXZA 3OBVE 4OX9T 3UTKA 3RYCE 5IWAT 4PJNA 5LCYA 4AIUA 2OLTA 1HX8A 4I4TE 1T7SA 2MAWA 5LBMA 3KV4A 4HTEA 4YHHT 2L8KA 2YOEA 2D5UA 3CK6A 3VRAA 3C50A 2HN2A 2RA1A 2H88A 5EZYE 4TNWA
chains in the Genus database with same CATH topology
1YXRA 2WY2A 4U3CA 4U7YA 4U2YA 2W2UA 4A5XA 2V6XA 4NIQA 4CN1A 2WWVA 2JQKA 4CN6A 2JQHA 2RPAA 4WZXA 5FVLA 4U2ZA 4U31A 3ZT5A 3ZT6A 4CN4A 2A9UA 4U33A 2DL1A 5LB7B 2V6YA 5CJ5A 2LRLA 2MPKA 5CGMA 3EABA 3ZSTA 4ZEYA 2JQ9A 1WFDA 2CPTA 3ZT7A 3ZSSA 4IT4A 4P1NA 4U7IA 2K3WA 2CRBA 2XZEA 2V6YB 3K1SA 1WR0A 2LRKA 5FVKA 1WCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YXR A;  2WY2 A;  4U3C A;  4U7Y A;  4U2Y A;  2W2U A;  4A5X A;  2V6X A;  4NIQ A;  4CN1 A;  2WWV A;  2JQK A;  4CN6 A;  2JQH A;  2RPA A;  4WZX A;  5FVL A;  4U2Z A;  4U31 A;  3ZT5 A;  3ZT6 A;  4CN4 A;  2A9U A;  4U33 A;  2DL1 A;  5LB7 B;  2V6Y A;  5CJ5 A;  2LRL A;  2MPK A;  5CGM A;  3EAB A;  3ZST A;  4ZEY A;  2JQ9 A;  1WFD A;  2CPT A;  3ZT7 A;  3ZSS A;  4IT4 A;  4P1N A;  4U7I A;  2K3W A;  2CRB A;  2XZE A;  2V6Y B;  3K1S A;  1WR0 A;  2LRK A;  5FVK A;  1WCR A; 
#chains in the Genus database with same CATH topology
 2GK9 A;  1YKH B;  1Y64 B;  2Y8D A;  3FZK B;  4PK5 A;  2XQY A;  2UUB T;  2K9A A;  5CFB A;  4ANJ A;  4LFB T;  4H9S E;  4JI8 T;  5LJN A;  2A9U A;  5KX5 E;  3NBX X;  3RF1 A;  2V6Y A;  1MNE A;  2B76 A;  2WBL A;  5EK3 A;  5LBQ B;  1YQ4 A;  5BR8 T;  5LNK A;  4IHJ E;  4O4I E;  4QXC B;  2BDE A;  1D0Z A;  2VQF T;  2E9X A;  4IST A;  3AE4 A;  2E2A A;  4BJN A;  2N9D A;  3ZST A;  5LA6 E;  4IGU A;  4Q25 A;  3E0Z A;  5H6Q B;  2V6Y B;  4UV9 B;  3NKZ A;  4UIG A;  5FXV A;  2I0M A;  5FY0 A;  3UUL A;  4YSY A;  1FEW A;  4LF9 T;  2LM9 A;  2E9X B;  2VWA A;  1HG5 A;  2CPT A;  1W0B A;  3HA4 A;  5HYA A;  4PJM A;  4F8H A;  1MMN A;  3RYH E;  5HXS A;  4QXH B;  3JAF A;  2WSS V;  3EI0 A;  2BKO A;  2R6G F;  2BVM A;  4OK0 A;  2LRK A;  2JMH A;  4ZI3 D;  4X1Y E;  2MBG A;  3R84 B;  4CN1 A;  4WBN E;  4U31 A;  4HGA A;  2HPL A;  3PUQ A;  4DR5 T;  3HKD E;  2K5B B;  3LJC A;  4K0K T;  2DHR A;  1D1B A;  5L3B B;  2CLY C;  2IC6 A;  3RLF F;  3UQ4 A;  3ZMT B;  4LF6 T;  5HXE A;  3VKG A;  3EVY A;  3KV5 A;  2LLY A;  3N9O A;  2YKS A;  2D9D A;  4JUY A;  3ANW A;  5DAB A;  3S4U A;  2V26 A;  1ZKE A;  4EB6 E;  4HFI A;  3P4P A;  5AQM B;  4H9P C;  4KMC A;  1W9R A;  5AQJ B;  4TWF A;  2XQA A;  4EYU A;  4DUY T;  4EEB A;  3ANW B;  3FZF B;  4QH5 A;  3O1J A;  4FI5 A;  4KP3 C;  1UCU A;  2KT9 A;  3UU8 A;  1D0Y A;  5F5W A;  4AQG A;  4ILC A;  4J2C A;  2CXD A;  3V5U A;  3KFW X;  4PNI A;  4UVB B;  5HWX A;  2XZE A;  2CHN A;  4IE7 A;  4JBW F;  4PFP A;  4TZ4 C;  2EHO C;  1N36 T;  2NR4 A;  3EAM A;  1G8X A;  1WYC A;  2DCF A;  2MTQ A;  3UUM A;  2NWB A;  3U78 A;  2DWK A;  4DND A;  5L47 A;  3QNU A;  4H63 H;  3EDU A;  2IML A;  2C0S A;  2XQ9 A;  4X1I E;  3TLW A;  2V7I A;  2XQ7 A;  1CHU A;  4AI6 A;  1E2A A;  4YSX A;  2LT3 A;  1QSD A;  2UUC T;  3TLV A;  2VKO A;  3KV6 A;  4U7Y A;  3PUW F;  4WYV A;  2L3L A;  3AEE A;  3L8R A;  4ZS3 A;  4P0A A;  3AXJ A;  3KV9 A;  5AQI B;  2ZM8 A;  2FJD A;  5FP3 A;  3FZM B;  5JRC A;  2LRL A;  2J1D G;  4OYK A;  2Q9Q C;  5AQO B;  4DR6 T;  4X1K E;  2AE9 A;  2BBH A;  1OED C;  3P4S A;  3HL6 A;  2YU1 A;  3WI3 A;  3PJA J;  3JAD A;  3AA7 B;  4HWC A;  2K24 A;  3P4R A;  2IHR 1;  3AXJ B;  4IDP A;  1R8I A;  5JRC B;  2DWG A;  5FVK A;  3ZMV B;  4JLE A;  4IL4 A;  4QX8 B;  1HF8 A;  5AQQ B;  1XMQ T;  3WAK A;  5HCM A;  4U33 A;  1IJ5 A;  2CE7 A;  2WZI A;  3UQ7 A;  3E22 E;  5LP6 E;  5ABG A;  1KNR A;  3L09 A;  4V1A v;  4CZZ B;  2XAJ B;  3ZN0 B;  2W00 A;  4IE6 A;  4GYR A;  4B6X A;  3M3Z B;  4JI0 T;  3RIF A;  3UFG A;  3UU3 A;  4H9N C;  5JTG A;  2W0G A;  4WW0 A;  3OYX A;  1IBM T;  2CBI A;  2N1G A;  2W66 A;  4U7I A;  4O8S A;  4TUY E;  1WRD A;  4LF8 T;  5H6R B;  1D0X A;  4TN7 B;  3N5L A;  4CI3 B;  3UU5 A;  5CA0 E;  4X66 T;  4OFZ A;  2RP4 A;  3CX6 B;  1LVK A;  5CA1 E;  5C8Y E;  3F31 A;  4G63 A;  1UX5 A;  5JR9 C;  4HFC A;  1NEN A;  4JV5 T;  1XNQ T;  3M65 A;  5AQR B;  2PFV A;  2EHO D;  5L4H A;  2JQH A;  3BK9 A;  5L3F B;  5JDH A;  3AE8 A;  3CQC B;  4TV9 E;  2VQE T;  2HHH T;  3L39 A;  1LRZ A;  2X0H A;  5JVD E;  2HH7 A;  3N9P A;  2LSJ A;  4K0U A;  2W61 A;  4NXM T;  5FVL A;  1Z8U A;  1OXZ A;  1HNZ T;  4JI3 T;  2LSG A;  4TWH A;  2M6I A;  3GA8 A;  2KND A;  4A97 A;  4EED A;  2NW7 A;  4YTM A;  3H37 A;  3O1H A;  3T1H T;  4HWH A;  5FYM A;  2W63 A;  5FKY A;  3FZL B;  2I59 A;  3ABV A;  2V7M A;  3J9X 1;  2X66 A;  4AKL A;  4YTN A;  4AQF C;  3ZT7 A;  4AXP A;  2Q9Q D;  5ABH A;  4PW8 A;  2K3W A;  3LK2 B;  4E7Z A;  3RC3 A;  2CBJ A;  1VOM A;  3QOF A;  1OED E;  3RIU C;  2CCQ A;  2JIW A;  4HEA A;  3AB3 B;  1LVF A;  4EXT A;  3AA0 B;  1D1A A;  4UVC B;  5AQV B;  3UUX B;  5AQK B;  2BKP A;  2LOP A;  2BKN A;  3JAE A;  1HS7 A;  3PUY F;  5L2L A;  3ETV A;  4ILB A;  1UUS A;  4AKG A;  4YFS A;  3T1Y T;  1I6Z A;  3AEB A;  1ZEE A;  2ODV A;  5J0Z A;  5HEJ A;  5J2T E;  5LYJ E;  2Y48 B;  4MLK A;  2LSK A;  2YDS A;  4IDZ A;  3NRX A;  5HEO A;  2LE8 A;  3AEC A;  4YTP A;  4Z8X A;  3JCF A;  5LGT B;  3ONL C;  4A98 A;  4PJL A;  2KZ7 B;  4HE8 A;  3IA3 A;  4EZH A;  1HNX T;  3CQG B;  4NXN T;  2LM2 A;  3ZT6 A;  4OHF A;  3Q5W A;  4EOZ B;  2A3D A;  3PUX F;  5HAX A;  2ES0 A;  3MK7 C;  2ZM2 A;  3ZEF B;  2M67 A;  3CX8 B;  5LHI B;  2YEV C;  2WU5 A;  4F6R C;  3CPZ A;  4EAH A;  5JDM A;  1JNZ A;  1YKE B;  3CIR A;  2W67 A;  1W09 A;  3CX7 B;  1OWA A;  2XM2 A;  2FBW A;  1N32 T;  3D0T A;  5JDQ A;  1MMD A;  2DI4 A;  1WYB A;  4B3R T;  2X0Y A;  1QUU A;  2UXX B;  3K1S A;  3QUJ A;  3Q5X A;  2XSB A;  2VAS A;  1X79 A;  4CI1 B;  1J1J A;  1U5P A;  5E0O A;  3MKD A;  4ERR A;  2LKH A;  4EZ4 A;  3MA9 A;  4O2B E;  2XTL A;  4YHJ A;  4P0B A;  4EYY R;  2IAK A;  4QX7 B;  3PTR B;  3NVO A;  2XSA A;  1BR0 A;  3IBP A;  2UU9 T;  1MIW A;  2UUA T;  4DR4 T;  1NEK A;  4L0R A;  4IT4 A;  2DLR A;  4DV0 T;  2NW8 A;  3AEG A;  5HEG A;  3VHL A;  4FJO A;  4ZI2 C;  2H7O A;  4QH4 A;  3R6N A;  2V5D A;  1HTJ F;  2JRK A;  4IIJ E;  4DV5 T;  4AKR B;  3VRB A;  5LXT E;  5FY1 A;  5JH7 E;  4H9R C;  3CWZ B;  2SPC A;  3OYZ A;  1N33 T;  4YY3 T;  4QH1 A;  3NRY A;  4ZHQ E;  2VB6 A;  3VU7 H;  2WZH A;  2BG9 C;  3QB5 K;  3T8O A;  2KMF A;  3B13 A;  4IE5 A;  4GKK T;  5JDF A;  3QK6 A;  4LML A;  2PBI A;  5HEH A;  5EK2 A;  3UT5 E;  4OYJ A;  3N9Q A;  1KNZ A;  2LSI A;  2V8S V;  2RPA A;  4HN9 A;  4I0U A;  5J2U E;  3SFE A;  2ZM0 A;  4YT0 A;  3O4X E;  3EHZ A;  3V5S A;  2CRB A;  3BQK A;  4G2A A;  3ZJ2 A;  3B57 A;  4DUZ T;  1VCT A;  1KK7 A;  4IDO A;  4MFR A;  2X67 A;  2CHO A;  2LKG A;  1NAF A;  2NW9 A;  5AFU L;  4IDQ A;  1MIV A;  3OPC A;  2E8I A;  4IL9 A;  3ZLI A;  4I55 E;  4DR2 T;  4QXB B;  5AQU B;  5LHH B;  2V6X A;  2JPF A;  2V7L A;  4JI4 T;  4LMJ A;  5ETW A;  1IBL T;  4UEL A;  2CMR A;  2BS4 A;  2IW5 B;  3ZYK A;  3VR8 A;  5ABE A;  1BR4 A;  1FJG T;  3L3P A;  2UXC T;  1BR1 A;  1B7T A;  3RPU A;  4A56 A;  2C5I T;  2XM1 A;  2IIU A;  5HEU A;  3LFM A;  5AQN B;  3SS1 A;  3KBU A;  2UXN B;  3ESL A;  3K3N A;  2YK0 A;  5IYZ E;  4CQI A;  5AQF B;  5AQG B;  3AVR A;  3MAC A;  3TLT A;  1SUM B;  3KIN B;  5FMN A;  1YQ3 A;  2FUP A;  4DV7 T;  1UK5 A;  4O2A E;  4DVD A;  1XNR T;  4ZOL E;  1E1H B;  2WY2 A;  2X9W A;  4M1P A;  3RGL A;  3LBX A;  4UVA B;  2HPJ A;  2WDR A;  5FXZ A;  4ZI2 D;  3Q9D A;  2CEA A;  4JYA T;  4JI7 T;  4DV3 T;  2XQ8 A;  2Y6X A;  4ZEY A;  4UF0 A;  3N2G E;  2BBJ A;  2WDQ A;  4P09 A;  1SHZ C;  2CLY B;  1IJ6 A;  2JQQ A;  4DID B;  1AJ3 A;  1N34 T;  2DL1 A;  3FBL A;  2JMK A;  2QVA A;  5LGN B;  2BG9 E;  3LBX B;  3LG7 A;  2D0U A;  1HCI A;  4LMK A;  3TKL B;  3A7M A;  3PUG A;  3GWH A;  3PUV F;  4MAL A;  4UF0 B;  2XAG B;  4B3M T;  1S94 A;  2XY8 B;  4UV8 B;  4ZZC A;  4CXX A;  1CUN A;  3P50 A;  4X64 T;  4PK4 A;  3AED A;  4DV4 T;  1DU2 A;  4DMW A;  3AAE B;  3G06 A;  4AIS A;  3Q5E A;  5JDN A;  2EHO A;  2MOZ A;  3C51 A;  4O4L E;  2M6B A;  2XAS B;  2CXL A;  4U2Y A;  4LF4 T;  3DTO A;  1HNW T;  1UX4 A;  3ZT5 A;  4PAG A;  4BA9 A;  3I0Q A;  4IE0 A;  1G73 A;  3ZSS A;  1KF6 A;  2WP9 A;  5L4E A;  4KBM B;  2WU2 A;  3PU8 A;  4XAX B;  3HKC E;  4NIQ A;  4KHZ F;  2XJ7 A;  3RYF E;  5CB4 E;  5LJM A;  2EHO B;  4JEU B;  3AE9 A;  3K8P C;  5HXH A;  3EDV A;  4CXW A;  4QWN B;  4BJM A;  4NUU A;  3B5M A;  3RQW A;  2WDV A;  1YXR A;  1T72 A;  2XUE A;  1YW0 A;  4IDN A;  2WB5 A;  1GQE A;  2NTY A;  3KVB A;  1KEY A;  5L3E B;  2IUB A;  4ILU A;  2Q9Q A;  5CGM A;  3CKD A;  3ETU A;  4Z91 A;  2P9B A;  2QGS A;  3IHR A;  3N9M A;  4EV6 A;  4YXD A;  4HFD A;  4DV6 T;  3SFD A;  2IDO B;  2X0L B;  2KLQ A;  1OED A;  2YIN A;  1NWM X;  1XZY A;  2OA5 A;  4C91 A;  4MHC A;  5LG3 A;  2E9X C;  1KNP A;  4LF5 T;  5HCJ A;  3UU4 A;  3VR9 A;  5ADX L;  3FHN A;  3TLU A;  2LJL A;  5LGU B;  4UEM A;  5DQV A;  4O4H E;  2Q9Q B;  2VK9 A;  2H3R A;  2CA5 A;  5ABF A;  4H63 V;  2ACX A;  5KXJ A;  4DBR A;  2I6H A;  4DMV A;  1OED B;  5IUX A;  1SA0 E;  5CJ5 A;  5AQP B;  4LFA T;  3RQU A;  2FJE A;  2WCA A;  1L0V A;  4GKJ T;  5LHG B;  2PG8 A;  2E5L T;  3AE7 A;  3PDY A;  1YD8 G;  3ZMS B;  3UUN A;  4DR7 T;  3QB5 A;  5ABF B;  5FNV E;  4DV1 T;  5KDM C;  3AE3 A;  2XPK A;  3ONX A;  1IZN B;  2HN1 A;  4KUM B;  2LOS A;  1FIO A;  2WQY A;  3RRW A;  5J1G A;  5KMG P;  4HKA A;  3OKQ A;  3HKE E;  3C4W A;  2KWI B;  2NP9 A;  4U2Z A;  3ZC1 A;  4C90 A;  3HI2 A;  4JI6 T;  5FXX A;  2V5C A;  5JR9 A;  3VKH A;  3P8C D;  3LK4 2;  3PV0 F;  3ZPO A;  5JDL A;  4HFB A;  1T8B A;  5F8P A;  2ZM6 T;  1MMG A;  3ZCJ A;  4DR3 T;  1HFA A;  5TAO A;  4JI2 T;  4UXN B;  4ILA A;  2V1D B;  3F2E A;  3PU3 A;  3UU6 A;  2ZMA A;  3NWI A;  3LDQ B;  4U74 A;  3AVS A;  3KBT A;  4JEH B;  5JR9 B;  3BQL A;  3CML A;  4HWI B;  2D0T A;  5M4Y A;  2V7K A;  4AQY T;  3ZJ1 A;  3O9X A;  1ZV4 X;  4LF7 T;  3AEF A;  2QRX A;  5FXW A;  3AA1 B;  4LFC T;  1ZP0 A;  2VL0 A;  2BS3 A;  3AE2 A;  2J47 A;  2LEH A;  2MPK A;  3RI5 A;  4AKH A;  4AQF A;  4WNK A;  3P4W A;  5JDG A;  3KDS E;  4E7S A;  4O4J E;  1ZHC A;  5AQL B;  1WCR A;  1IAP A;  2K48 A;  3RIU A;  1JNR A;  3FBZ A;  4TX5 A;  2E9X D;  3N2K E;  4DO0 A;  3SWH A;  4XBF B;  4ISS A;  1J5W A;  2DNX A;  1I94 T;  1KFY A;  3C98 B;  2QA7 A;  2A2F X;  2N2N A;  3NZQ A;  4TWD A;  3K3O A;  1Y01 A;  2X51 A;  2YN6 A;  3AEA A;  4GOU A;  1HX1 B;  4B3T T;  4EGW A;  2ODU A;  2YDQ A;  4TNV A;  4GK0 E;  4H9Q C;  3QC9 A;  4YLH A;  2W2U A;  4A5X A;  2H89 A;  3RKO A;  5A1L A;  2BVL A;  1HG2 A;  2UXD T;  1MND A;  1UGO A;  2WM9 A;  3UFE A;  2BZB A;  4EIW A;  5JQG E;  3ZC0 A;  1H7C A;  2JQ9 A;  4QKN A;  3I9Y A;  4Z90 A;  5FL1 A;  1WR0 A;  4GYS A;  2VKJ A;  2X9X A;  3AE6 A;  2LSY A;  1XDP A;  2A72 A;  4L9I A;  4XZC A;  4HWF A;  5BMV E;  2Z6E A;  3PUS A;  3I0O A;  2VVS A;  2XAH B;  1UUR A;  1SE7 A;  4CI2 B;  2W4X A;  3RX6 A;  4X20 E;  3FB2 A;  2V7J A;  3AAI A;  1LKX A;  2XHE B;  3SOL A;  2WMO A;  2B1E A;  2NOX A;  2J4G A;  2IC9 A;  2KWH A;  3ZMZ B;  2FJA A;  2YU2 A;  3C4X A;  3FZH B;  4I43 B;  1V9D A;  3PUR A;  3SRZ A;  4WZX A;  3AE5 A;  3TLS A;  2ACZ A;  3A5X A;  4N78 D;  3PJA A;  2UXB T;  5JRE A;  3RIA A;  1XDO A;  3JC6 C;  5LOV E;  1QLB A;  1US7 B;  2BS2 A;  1WLX A;  3I9W A;  4YJ2 E;  3RH3 A;  2WAU A;  3RHW A;  2X9Y A;  2W62 A;  4HFV A;  3ZN1 B;  3H3M A;  4GK5 E;  4KHP T;  1EZ3 A;  4ASK A;  2C5K T;  3OTO T;  2XQ5 A;  3X1D A;  4NPP A;  2L9Q A;  1ZOY A;  3LSV A;  3ZYL A;  4QHO A;  5EK4 A;  2YDR A;  2VUR A;  3UUB A;  1XMO T;  4PK6 A;  5C3J A;  5HXC A;  4DV2 T;  2KIN B;  3AE1 A;  3EAB A;  4HWD A;  2XQ3 A;  5LMN T;  4B3S T;  3EUH A;  4ZS2 A;  4ZZB A;  2E5V A;  3OJA A;  4U3C A;  4DBQ A;  3ONJ A;  3Q2M A;  2BG9 A;  1U4Q A;  4CN4 A;  3AA6 B;  5FL0 A;  4IE4 A;  2WS3 A;  1VCS A;  4KI0 F;  1WFD A;  3MZK B;  3NZP A;  4P1N A;  5DQW A;  1E7P A;  1W0A A;  3O1I A;  3OVU A;  3PUZ F;  1HR0 T;  5LG4 A;  2F4V T;  3PUA A;  5AQT B;  3C64 A;  2NTX A;  4X5T A;  5AQH B;  4JI5 T;  4COF A;  2BG9 B;  1MIY A;  2H7V C;  3Q5D A;  1IBK T;  4GIW A;  1FMV A;  3ZYM A;  3ZCI A;  2XQ6 A;  2KXP B;  4MBQ A;  3HKB E;  2D2S A;  3KVA A;  4X65 T;  3U3I A;  2KSR A;  5HWY A;  1M62 A;  3RRC A;  3J7Y q;  4ADZ A;  3N9N A;  5AQS B;  4KX6 A;  5L3D B;  3N2O A;  5L3C B;  3LK3 B;  1Z0P A;  1D1C A;  4ZI7 E;  3RYI E;  2X68 A;  3C4Z A;  4AKI A;  2MYS A;  3GMI A;  1J5E T;  2XAQ B;  3FXE B;  1S35 A;  2X9H A;  1MMA A;  2OV9 A;  2WMN A;  2WWV A;  2JQK A;  3RKG A;  5DJQ C;  5LB7 B;  2VVN A;  4PJJ A;  3ZMU B;  5F3J A;  1T98 A;  3JC6 D;  2CXF A;  2C5J A;  5C2T A;  3GN5 A;  4HFH A;  4IRE A;  1X9B A;  4I50 E;  1BR2 A;  3A8Y C;  4UR9 A;  2LHN A;  4BAY B;  2XQ4 A;  3RC8 A;  2PTF A;  3H3A A;  3PE0 A;  4HFE A;  2QYW A;  3WAJ A;  3GN5 B;  4X62 T;  2AXD S;  3DJB A;  4YJ3 E;  3CQX C;  2JJ9 A;  3P7I A;  3HR0 A;  3CVR A;  3K3Q C;  5LMU T;  1M7K A;  3MJX A;  4CN6 A;  4WBO A;  2FJB A;  5HXR A;  3W15 B;  4TV8 E;  3FXD B;  4PFO A;  4ZI3 C;  3N9L A;  4L5G A;  3AAA B;  2VKH A;  5IHY A;  5GON E;  1WR6 A;  5L3G B;  3IF8 B;  4ZXL A;  4JI1 T;  1O3X A;  2CM0 A;  2LHR A;  3F57 A;  1FMW A;  4DR1 T;  2VL8 A;  2XAF B;  5FY7 A;  3BQI A;  3P4Q A;  2PJQ A;  1VRB A;  2CWY A;  4CXY A;  2J62 A;  3ZKR A;  1XWM A;  3IEE A;  4YSZ A;  3DP7 A;  4U72 A;  2CWO A;  2VKD A;  4NUV A;  2WWU A;  4H9O C;  3E08 A;  3I1A A;  2G0U A;  2ZLY A;  3MXZ A;  3OBV E;  4OX9 T;  3UTK A;  3RYC E;  5IWA T;  4PJN A;  5LCY A;  4AIU A;  2OLT A;  1HX8 A;  4I4T E;  1T7S A;  2MAW A;  5LBM A;  3KV4 A;  4HTE A;  4YHH T;  2L8K A;  2YOE A;  2D5U A;  3CK6 A;  3VRA A;  3C50 A;  2HN2 A;  2RA1 A;  2H88 A;  5EZY E;  4TNW A; 
#chains in the Genus database with same CATH homology
 1YXR A;  2WY2 A;  4U3C A;  4U7Y A;  4U2Y A;  2W2U A;  4A5X A;  2V6X A;  4NIQ A;  4CN1 A;  2WWV A;  2JQK A;  4CN6 A;  2JQH A;  2RPA A;  4WZX A;  5FVL A;  4U2Z A;  4U31 A;  3ZT5 A;  3ZT6 A;  4CN4 A;  2A9U A;  4U33 A;  2DL1 A;  5LB7 B;  2V6Y A;  5CJ5 A;  2LRL A;  2MPK A;  5CGM A;  3EAB A;  3ZST A;  4ZEY A;  2JQ9 A;  1WFD A;  2CPT A;  3ZT7 A;  3ZSS A;  4IT4 A;  4P1N A;  4U7I A;  2K3W A;  2CRB A;  2XZE A;  2V6Y B;  3K1S A;  1WR0 A;  2LRK A;  5FVK A;  1WCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...