2LRKA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphocarrier protein HPr
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 39
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrkA00
2CRBA 5FVLA 2V6XA 3ZSTA 4ZEYA 1WR0A 5CJ5A 4U2YA 3EABA 4A5XA 4CN4A 5CGMA 2V6YA 2A9UA 2DL1A 4U7YA 1WFDA 5LB7B 4WZXA 1YXRA 2V6YB 4U33A 1WCRA 4P1NA 4U2ZA 2JQ9A 2WWVA 4CN1A 4U31A 2XZEA 4IT4A 2LRLA 4NIQA 3ZT5A 2CPTA 2JQKA 4U7IA 4U3CA 2RPAA 5FVKA 2MPKA 2WY2A 3K1SA 2JQHA 2K3WA 2W2UA 3ZT6A 3ZSSA 3ZT7A 2LRKA 4CN6A
chains in the Genus database with same CATH superfamily
3ZSTA 3E22E 3UULA 2UXDT 2JMHA 1M7KA 3QC9A 2DLRA 2KWHA 4DV0T 3PJAJ 2XQ6A 3ZPOA 5BMVE 2LSYA 3CQCB 4ZEYA 4EAHA 2LHNA 4ILUA 3AE7A 3T1HT 3RC3A 3GA8A 1Z8UA 4JUYA 2V6YB 5ABFA 4ANJA 4HE8A 2PFVA 2WDQA 2NTXA 2N9DA 2YKSA 1QLBA 4HWHA 1IJ6A 4BJMA 3LK3B 2XQ5A 3F31A 2WDRA 3PUVF 3LBXB 1YKHB 3CMLA 4NXMT 3W15B 4EIWA 5JREA 2YEVC 3B13A 5L47A 3ANWB 4YY3T 3P4SA 3P4RA 3QB5A 2J4GA 2VWAA 3TLSA 5HEOA 4EEDA 5JR9A 4A97A 3N9LA 3IHRA 4BJNA 2ACZA 3AXJB 1U5PA 5ETWA 4XAXB 4JI4T 4DR7T 5L3EB 2BKNA 2IAKA 3PTRB 4UVAB 3GN5A 3LDQB 5HEGA 3VU7H 2W66A 2FUPA 2YU2A 4E7SA 1HCIA 3ZMVB 4EB6E 2Y8DA 3SOLA 5J0ZA 3RGLA 2V7KA 2KZ7B 1W09A 3HKBE 2I6HA 4EZHA 5HXCA 5LJMA 3P7IA 3JADA 4TNVA 3QB5K 4Z8XA 5AQIB 2LSJA 2PBIA 3C98B 3A7MA 3RLFF 5FVLA 5JDMA 2XPKA 3WAKA 3DJBA 4DO0A 4X65T 3J9X1 4OHFA 1T7SA 4I4TE 4PK4A 3R84B 2KWIB 2CXFA 4HFIA 1XDPA 3JCFA 4YJ3E 3VRBA 4YXDA 3AE4A 4IL4A 4LF5T 5JTGA 2XHEB 4CN4A 1ZV4X 1D0YA 3LFMA 4GOUA 1OEDC 2BVMA 3GMIA 1W0AA 4TUYE 2QYWA 3NRXA 3AEFA 3OTOT 2XY8B 4DNDA 3NBXX 4B3ST 4O8SA 4XZCA 5M4YA 2JQ9A 5L4EA 3HKDE 3DP7A 3PUXF 3SFEA 3EDUA 2LOSA 5LGNB 3E08A 5L3DB 3RF1A 2VKHA 2A9UA 5LGTB 3MKDA 5DQVA 2BS4A 5C2TA 2OV9A 2X9YA 4PJLA 1XNRT 4OK0A 2WWVA 2VVSA 4YHJA 3Q5WA 3N2OA 2B76A 4OX9T 4YSXA 4CXXA 2WM9A 4MHCA 3SS1A 1UCUA 3N5LA 3UU8A 4ZI2C 4PJMA 5JDFA 2XQYA 2NW9A 2E9XB 2CBIA 5HXSA 5JDGA 2JQKA 3AE5A 5LXTE 3PUZF 4ILBA 2FBWA 4ZI7E 3UQ4A 1OEDA 2LSGA 4O4IE 2XAHB 4WYVA 2KNDA 4HFCA 5FYMA 4JI0T 2UU9T 2UUCT 3U3IA 5FY0A 5ABEA 2F4VT 4IDPA 5HCJA 2NW7A 2D0TA 5FVKA 2X0LB 2CHNA 5FY1A 4CI1B 3MZKB 3AEGA 1LRZA 5BR8T 4DV1T 5AQMB 2AE9A 4IGUA 2VB6A 5LHIB 2FJAA 4WNKA 2N2NA 3FHNA 4MALA 2IMLA 5LOVE 3M3ZB 1KNZA 3RH3A 2Z6EA 4Z91A 5JDNA 2IC6A 4DV4T 3N2KE 5KXJA 2CM0A 2CRBA 2BVLA 2V8SV 5LBMA 4JI1T 4DR3T 3OPCA 1IAPA 4AKGA 3AAIA 2IIUA 3N9MA 3C4WA 5LYJE 3K3OA 2K24A 1VCTA 4LF6T 5AQSB 1HG2A 1WYCA 1XMOT 3PE0A 3ZT7A 4UELA 3JAEA 2Y48B 3OBVE 2WCAA 5HXHA 2YINA 3KFWX 1US7B 1OXZA 5AQFB 2LRLA 4NIQA 3CQXC 5AQJB 2VL8A 2BS2A 3H3MA 2JQQA 4TX5A 2GK9A 5L3FB 1HFAA 3MJXA 3NKZA 3RYHE 3AVSA 4IE6A 3ZYMA 4A5XA 4OYKA 1XDOA 3ZYKA 3ZMTB 4ERRA 3I9WA 5ABFB 1UX4A 5HAXA 3AAEB 4QX7B 4LFCT 3Q2MA 2Q9QD 3H3AA 2JIWA 4X64T 1YQ3A 5IHYA 4P0AA 2M6BA 1IZNB 1W0BA 3I1AA 2RA1A 2VQFT 3NZQA 4LF8T 3I9YA 2D0UA 1QSDA 5JVDE 3KVAA 2NTYA 3RYIE 4C91A 2WAUA 3LJCA 3NRYA 1OWAA 3AEEA 5FP3A 3UT5E 5KDMC 2JJ9A 2X51A 5JR9B 2Q9QC 2XTLA 3T1YT 4QXHB 3CKDA 4UVBB 5LNKA 3A5XA 4U72A 3OYZA 4H9OC 4YFSA 5E0OA 4P0BA 1FEWA 1HF8A 2LM9A 4TWHA 4K0KT 3AE9A 3BK9A 3L39A 2YK0A 3EAMA 2LOPA 4TWDA 3GN5B 1E7PA 2VURA 1FJGT 4AXPA 4EV6A 1GQEA 1S35A 4YT0A 2LHRA 2M67A 4Q25A 2LLYA 4QH5A 4P1NA 4JI5T 3AA0B 3SFDA 2WQYA 2JQHA 3OKQA 3OVUA 1QUUA 3A8YC 2CLYC 2D2SA 3CX7B 5AQHB 2X0YA 2XQ3A 4EXTA 4GK0E 2IUBA 3ESLA 4KX6A 2N1GA 1Y01A 3K1SA 2UXBT 3O1IA 2WDVA 4LF4T 3RRWA 3UU3A 3PU3A 5KMGP 2BBJA 2Q9QA 4HFEA 2C0SA 2PG8A 4NXNT 3RRCA 5L2LA 1BR2A 5EK2A 3K8PC 4HFVA 4QWNB 1L0VA 3BQIA 4U2ZA 3ONJA 1MIVA 4HKAA 3ZLIA 3AA1B 4U7YA 5EZYE 5AQQB 4E7ZA 5J2TE 1ZHCA 1KEYA 1VRBA 2A72A 2WZIA 3OJAA 3PU8A 3BQLA 1HX1B 4PFPA 1HX8A 5ADXL 2LRKA 3EABA 4HFHA 4F6RC 3JC6D 5F5WA 3BQKA 2QRXA 2VL0A 4IL9A 5C3JA 5ABHA 4UXNB 3P4PA 4I0UA 5KX5E 2H3RA 5FXVA 3NZPA 3RKGA 1HNWT 4AKRB 2YDRA 5LHHB 3RQWA 5J1GA 5JRCA 1MMGA 1WCRA 4DVDA 5HXEA 3FZKB 4AI6A 4IE4A 1LKXA 1IBMT 3P4QA 3JC6C 2XJ7A 4QHOA 2K48A 5LCYA 4H9SE 1OEDB 1BR1A 2PTFA 3SRZA 5FMNA 2WMOA 3TKLB 3UTKA 3TLWA 4TZ4C 2JMKA 2X68A 4DV3T 3O4XE 5L3BB 3IA3A 1HS7A 2LT3A 2V7MA 2V26A 2BG9C 1ZEEA 2MBGA 4YTNA 2LEHA 1YKEB 4CN1A 2H89A 5LMUT 2IHR1 3MK7C 3ZYLA 5LGUB 3AE2A 4B3MT 2HPJA 1D1BA 4ZS2A 4N78D 1X9BA 3UQ7A 4YLHA 3N9QA 3C4XA 4PW8A 3UUXB 5LHGB 1JNRA 5F8PA 2CBJA 3AA7B 1S94A 4TV8E 4MFRA 3PUSA 4OFZA 5AFUL 5AQRB 2UXNB 3UU6A 2CEAA 3TLVA 4LF7T 2E8IA 3VRAA 4U31A 1G8XA 4DMVA 2M6IA 1IJ5A 3B5MA 2VKDA 4PK5A 4O4JE 3RI5A 3K3NA 4AKHA 5IWAT 4OYJA 3ZSSA 4CN6A 2MYSA 3P8CD 4DUYT 4ASKA 2DL1A 3GWHA 2XSBA 4YHHT 2CMRA 4YJ2E 4ZI3D 2B1EA 1EZ3A 3ZKRA 2EHOD 4WW0A 4DR5T 2ZM6T 2ZM2A 2BG9A 5AQVB 2LKHA 4EEBA 4TN7B 3EVYA 4ISTA 3QK6A 3UUNA 4QXCB 3FZMB 2LM2A 5CFBA 2CXLA 3Q9DA 4WBNE 4DV6T 1N34T 3M65A 1FMVA 2J47A 2CXDA 4ZI3C 5JDQA 4I50E 3EUHA 4F8HA 2EHOC 2UXXB 5LB7B 2K5BB 3V5UA 2VASA 4AQGA 4AKLA 3G06A 3AEAA 4UV8B 5EK3A 1MNDA 3UFGA 2LSIA 2A3DA 2DCFA 1MMNA 3RHWA 3IEEA 3UUBA 1J5WA 4YSZA 1M62A 1LVKA 4JI2T 2C5KT 5EK4A 2RPAA 1T98A 3FBZA 4PJJA 4KUMB 5TAOA 4L5GA 5GONE 1T72A 3ZJ1A 1T8BA 2V7LA 4ZS3A 2WSSV 2BBHA 3KBTA 1I94T 2ZM0A 3D0TA 5LG4A 2BKPA 3C64A 4HFDA 3RYFE 1U4QA 3LG7A 4GIWA 2XQ8A 2UUAT 2L9QA 4ZHQE 2EHOA 2WS3A 3ONLC 2UXCT 4HWCA 4CI2B 3ZCJA 1MNEA 4BAYB 2WB5A 4FI5A 4IE5A 2E5LT 3CPZA 3CWZB 1KK7A 2Q9QB 4CXYA 4UIGA 4DUZT 3F57A 2D9DA 2KSRA 2DHRA 5LG3A 4GYSA 2J62A 2P9BA 2WZHA 2XSAA 1UUSA 2XASB 2XM1A 4HWFA 3AE3A 4AQYT 5HCMA 5AQOB 2RP4A 2XAGB 2UUBT 2W0GA 3U78A 2C5IT 4HGAA 3RPUA 1E1HB 1ZKEA 5FXXA 1UK5A 2CCQA 2K9AA 5FNVE 3HKCE 1FMWA 2NR4A 4U33A 3L3PA 1NENA 2CLYB 2W4XA 5IUXA 4L0RA 2ES0A 4J2CA 2Y6XA 5AQGB 1UURA 2H7VC 5LMNT 2CWYA 4DR4T 4NUUA 2VK9A 3FZHB 5IYZE 2ACXA 3RYCE 5JRCB 3LK2B 5HYAA 4IT4A 4O4HE 3HI2A 4KP3C 2WBLA 1KFYA 4LFBT 4ISSA 2JRKA 5FXWA 2BDEA 1CUNA 1NAFA 4O2BE 2X66A 2ZMAA 3KV6A 4PK6A 2XQ9A 1V9DA 3UU5A 3EHZA 1HNZT 2R6GF 5HEUA 2IC9A 2CHOA 3VHLA 3S4UA 2C5JA 2X9WA 1WR6A 2VQET 3FZLB 5HEHA 3RX6A 2CA5A 4GYRA 3RC8A 2W61A 2JPFA 1N36T 5L3CB 3IF8B 1MIWA 3AEDA 2YDSA 2VKOA 3CK6A 5AQNB 4U74A 5AQTB 5HWYA 5HEJA 4KHPT 1HNXT 4K0UA 1VOMA 3ZMUB 4WZXA 5CA1E 5DQWA 4JEUB 3FB2A 2A2FX 3ZN1B 1XWMA 4EOZB 2CPTA 3PJAA 4ILAA 2OA5A 4X66T 2MTQA 4KI0F 1LVFA 3PDYA 4L9IA 2XAJB 5LA6E 3T8OA 2KXPB 5FKYA 3CX8B 2FJEA 2BKOA 3NVOA 3O1HA 4PNIA 4H9RC 4NPPA 4QKNA 3AAAB 3FXEB 5DABA 5JR9C 3R6NA 3KV4A 4QH1A 4H9PC 5AQPB 3MA9A 2BG9B 3PUYF 4JV5T 1D1AA 5HWXA 2E2AA 1WR0A 3QOFA 4JLEA 4MBQA 1X79A 3RIAA 4LMLA 1D1CA 2BG9E 4DIDB 1IBLT 4PJNA 4IHJE 4EYUA 4YTPA 3ETVA 4QX8B 4ILCA 3Q5DA 2NWBA 1Z0PA 3C50A 3L09A 1IBKT 3H37A 3I0OA 2XQ7A 3P4WA 1BR0A 4GK5E 3AA6B 4UF0A 2W63A 4IDNA 4I55E 3AE6A 2PJQA 1ZP0A 2WWUA 4TWFA 3RQUA 2YU1A 1Y64B 3VR8A 4FJOA 3UFEA 1WRDA 2DWGA 5JDHA 4X5TA 3FXDB 4COFA 3ZT5A 2X0HA 1W9RA 4IE0A 2D5UA 1OEDE 4P09A 4HTEA 2X9HA 4LFAT 2YN6A 4EYYR 1WFDA 3ZC0A 1YXRA 4CI3B 2LE8A 3AECA 4DR6T 5LP6E 4X20E 2MPKA 3RIUC 3X1DA 3VR9A 3TLUA 2DWKA 4X1IE 1UGOA 3ZMSB 2DI4A 3QNUA 1UX5A 5CB4E 3PURA 4KHZF 2WP9A 5JQGE 4PAGA 3N9NA 4U7IA 2EHOB 3KV9A 3CQGB 3RKOA 3AE8A 2MAWA 4HEAA 5HXRA 2L3LA 3ONXA 1NWMX 1XMQT 4A98A 4KMCA 3P50A 2ZLYA 4C90A 3HL6A 4DBQA 1XNQT 5C8YE 2K3WA 2FJBA 3ZEFB 2G0UA 3PUGA 2KLQA 2XQ4A 1DU2A 2NW8A 4H9NC 5DJQC 3CIRA 5J2UE 4O4LE 1SA0E 4QH4A 3J7Yq 4B6XA 3OYXA 4JYAT 2YOEA 2BZBA 2BS3A 1R8IA 3ZT6A 4DV7T 2WU5A 4AISA 3RIUA 3C4ZA 2V6YA 5JDLA 2V5CA 3AE1A 4AQFC 2KINB 5FXZA 1KNRA 4IIJE 1MIYA 4ZI2D 1SHZC 1KNPA 2WY2A 4CZZB 3LSVA 4ZXLA 2AXDS 5CGMA 3LBXA 1D0ZA 4CQIA 5H6RB 1KF6A 1D0XA 4PFOA 4O2AE 2ODUA 4TV9E 4X1YE 4I43B 1YQ4A 5CJ5A 2NP9A 3ANWA 1HR0T 4LMKA 3E0ZA 3ZC1A 2XUEA 1WYBA 2X67A 3O9XA 1YW0A 2XZEA 4H9QC 4U3CA 4HWDA 3RIFA 1H7CA 2V6XA 4WBOA 2LKGA 3AXJA 1SUMB 3DTOA 1HG5A 4QXBB 2QGSA 2V1DB 1O3XA 3HR0A 4DV2T 3FBLA 3L8RA 4DR1T 3MXZA 2KMFA 4AQFA 4V1Av 2J1DG 2HN2A 5F3JA 2IDOB 3I0QA 1B7TA 2W2UA 3CVRA 5ABGA 1HTJF 4X1KE 3PUQA 4EZ4A 1ZOYA 2H88A 4DMWA 2E5VA 2E9XD 2HPLA 2LSKA 1AJ3A 2L8KA 2YDQA 4B3TT 4TNWA 2WMNA 4JI7T 4NUVA 1XZYA 3V5SA 2W62A 3WI3A 2KT9A 2I59A 3MACA 3VKGA 4CXWA 3IBPA 3ZN0B 1JNZA 3N2GE 4ZZCA 2VVNA 3UU4A 4DV5T 1MMAA 1YD8G 5AQUB 4JI6T 3SWHA 2W67A 5FL0A 4ADZA 2HHHT 3C51A 4IE7A 4YSYA 2LJLA 4EGWA 4BA9A 3KDSE 5JH7E 2ODVA 3JAFA 4AKIA 3FZFB 1G73A 2E9XC 5LJNA 5AQLB 4HN9A 2HN1A 3WAJA 5A1LA 1WLXA 2QA7A 3ZCIA 2CWOA 3KBUA 4UV9B 2V7JA 4UR9A 3TLTA 4IDZA 5FY7A 1FIOA 2FJDA 3LK42 3ABVA 4XBFB 4UEMA 1SE7A 2XQAA 1N32T 5CA0E 4MLKA 4IDOA 4DR2T 3UUMA 3QUJA 4KBMB 2I0MA 5H6QB 2CE7A 4LF9T 3AVRA 3AEBA 3K3QC 2XM2A 2VKJA 1E2AA 4B3RT 4ZZBA 2V7IA 3CX6B 3ZJ2A 4G2AA 4H63H 2X9XA 4M1PA 4UF0B 2SPCA 3PUAA 2QVAA 3VKHA 2DNXA 3N9OA 3ZMZB 1MMDA 2E9XA 4JBWF 4JI3T 3KV5A 3PV0F 2NOXA 2XAQB 3EI0A 4G63A 3F2EA 1I6ZA 4U2YA 3N9PA 2W00A 2WU2A 4AIUA 4YTMA 4GKJT 3KINB 1NEKA 2HH7A 3Q5XA 1J1JA 4LMJA 3PUWF 4JI8T 2ZM8A 4UVCB 3AB3B 4Z90A 5AQKB 5L3GB 3KVBA 3Q5EA 4HWIB 2IW5B 3O1JA 4A56A 4JEHB 2OLTA 1J5ET 4H63V 4IREA 5LBQB 1BR4A 4X62T 2MOZA 5L4HA 5FL1A 3ETUA 2H7OA 1VCSA 2XAFB 3HA4A 4ZOLE 2V5DA 3B57A 3HKEE 4IDQA 4HFBA 1CHUA 3NWIA 1N33T 3EDVA 4GKKT 4DBRA
chains in the Genus database with same CATH topology
2CRBA 5FVLA 2V6XA 3ZSTA 4ZEYA 1WR0A 5CJ5A 4U2YA 3EABA 4A5XA 4CN4A 5CGMA 2V6YA 2A9UA 2DL1A 4U7YA 1WFDA 5LB7B 4WZXA 1YXRA 2V6YB 4U33A 1WCRA 4P1NA 4U2ZA 2JQ9A 2WWVA 4CN1A 4U31A 2XZEA 4IT4A 2LRLA 4NIQA 3ZT5A 2CPTA 2JQKA 4U7IA 4U3CA 2RPAA 5FVKA 2MPKA 2WY2A 3K1SA 2JQHA 2K3WA 2W2UA 3ZT6A 3ZSSA 3ZT7A 2LRKA 4CN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRB A;  5FVL A;  2V6X A;  3ZST A;  4ZEY A;  1WR0 A;  5CJ5 A;  4U2Y A;  3EAB A;  4A5X A;  4CN4 A;  5CGM A;  2V6Y A;  2A9U A;  2DL1 A;  4U7Y A;  1WFD A;  5LB7 B;  4WZX A;  1YXR A;  2V6Y B;  4U33 A;  1WCR A;  4P1N A;  4U2Z A;  2JQ9 A;  2WWV A;  4CN1 A;  4U31 A;  2XZE A;  4IT4 A;  2LRL A;  4NIQ A;  3ZT5 A;  2CPT A;  2JQK A;  4U7I A;  4U3C A;  2RPA A;  5FVK A;  2MPK A;  2WY2 A;  3K1S A;  2JQH A;  2K3W A;  2W2U A;  3ZT6 A;  3ZSS A;  3ZT7 A;  2LRK A;  4CN6 A; 
#chains in the Genus database with same CATH topology
 3ZST A;  3E22 E;  3UUL A;  2UXD T;  2JMH A;  1M7K A;  3QC9 A;  2DLR A;  2KWH A;  4DV0 T;  3PJA J;  2XQ6 A;  3ZPO A;  5BMV E;  2LSY A;  3CQC B;  4ZEY A;  4EAH A;  2LHN A;  4ILU A;  3AE7 A;  3T1H T;  3RC3 A;  3GA8 A;  1Z8U A;  4JUY A;  2V6Y B;  5ABF A;  4ANJ A;  4HE8 A;  2PFV A;  2WDQ A;  2NTX A;  2N9D A;  2YKS A;  1QLB A;  4HWH A;  1IJ6 A;  4BJM A;  3LK3 B;  2XQ5 A;  3F31 A;  2WDR A;  3PUV F;  3LBX B;  1YKH B;  3CML A;  4NXM T;  3W15 B;  4EIW A;  5JRE A;  2YEV C;  3B13 A;  5L47 A;  3ANW B;  4YY3 T;  3P4S A;  3P4R A;  3QB5 A;  2J4G A;  2VWA A;  3TLS A;  5HEO A;  4EED A;  5JR9 A;  4A97 A;  3N9L A;  3IHR A;  4BJN A;  2ACZ A;  3AXJ B;  1U5P A;  5ETW A;  4XAX B;  4JI4 T;  4DR7 T;  5L3E B;  2BKN A;  2IAK A;  3PTR B;  4UVA B;  3GN5 A;  3LDQ B;  5HEG A;  3VU7 H;  2W66 A;  2FUP A;  2YU2 A;  4E7S A;  1HCI A;  3ZMV B;  4EB6 E;  2Y8D A;  3SOL A;  5J0Z A;  3RGL A;  2V7K A;  2KZ7 B;  1W09 A;  3HKB E;  2I6H A;  4EZH A;  5HXC A;  5LJM A;  3P7I A;  3JAD A;  4TNV A;  3QB5 K;  4Z8X A;  5AQI B;  2LSJ A;  2PBI A;  3C98 B;  3A7M A;  3RLF F;  5FVL A;  5JDM A;  2XPK A;  3WAK A;  3DJB A;  4DO0 A;  4X65 T;  3J9X 1;  4OHF A;  1T7S A;  4I4T E;  4PK4 A;  3R84 B;  2KWI B;  2CXF A;  4HFI A;  1XDP A;  3JCF A;  4YJ3 E;  3VRB A;  4YXD A;  3AE4 A;  4IL4 A;  4LF5 T;  5JTG A;  2XHE B;  4CN4 A;  1ZV4 X;  1D0Y A;  3LFM A;  4GOU A;  1OED C;  2BVM A;  3GMI A;  1W0A A;  4TUY E;  2QYW A;  3NRX A;  3AEF A;  3OTO T;  2XY8 B;  4DND A;  3NBX X;  4B3S T;  4O8S A;  4XZC A;  5M4Y A;  2JQ9 A;  5L4E A;  3HKD E;  3DP7 A;  3PUX F;  3SFE A;  3EDU A;  2LOS A;  5LGN B;  3E08 A;  5L3D B;  3RF1 A;  2VKH A;  2A9U A;  5LGT B;  3MKD A;  5DQV A;  2BS4 A;  5C2T A;  2OV9 A;  2X9Y A;  4PJL A;  1XNR T;  4OK0 A;  2WWV A;  2VVS A;  4YHJ A;  3Q5W A;  3N2O A;  2B76 A;  4OX9 T;  4YSX A;  4CXX A;  2WM9 A;  4MHC A;  3SS1 A;  1UCU A;  3N5L A;  3UU8 A;  4ZI2 C;  4PJM A;  5JDF A;  2XQY A;  2NW9 A;  2E9X B;  2CBI A;  5HXS A;  5JDG A;  2JQK A;  3AE5 A;  5LXT E;  3PUZ F;  4ILB A;  2FBW A;  4ZI7 E;  3UQ4 A;  1OED A;  2LSG A;  4O4I E;  2XAH B;  4WYV A;  2KND A;  4HFC A;  5FYM A;  4JI0 T;  2UU9 T;  2UUC T;  3U3I A;  5FY0 A;  5ABE A;  2F4V T;  4IDP A;  5HCJ A;  2NW7 A;  2D0T A;  5FVK A;  2X0L B;  2CHN A;  5FY1 A;  4CI1 B;  3MZK B;  3AEG A;  1LRZ A;  5BR8 T;  4DV1 T;  5AQM B;  2AE9 A;  4IGU A;  2VB6 A;  5LHI B;  2FJA A;  4WNK A;  2N2N A;  3FHN A;  4MAL A;  2IML A;  5LOV E;  3M3Z B;  1KNZ A;  3RH3 A;  2Z6E A;  4Z91 A;  5JDN A;  2IC6 A;  4DV4 T;  3N2K E;  5KXJ A;  2CM0 A;  2CRB A;  2BVL A;  2V8S V;  5LBM A;  4JI1 T;  4DR3 T;  3OPC A;  1IAP A;  4AKG A;  3AAI A;  2IIU A;  3N9M A;  3C4W A;  5LYJ E;  3K3O A;  2K24 A;  1VCT A;  4LF6 T;  5AQS B;  1HG2 A;  1WYC A;  1XMO T;  3PE0 A;  3ZT7 A;  4UEL A;  3JAE A;  2Y48 B;  3OBV E;  2WCA A;  5HXH A;  2YIN A;  3KFW X;  1US7 B;  1OXZ A;  5AQF B;  2LRL A;  4NIQ A;  3CQX C;  5AQJ B;  2VL8 A;  2BS2 A;  3H3M A;  2JQQ A;  4TX5 A;  2GK9 A;  5L3F B;  1HFA A;  3MJX A;  3NKZ A;  3RYH E;  3AVS A;  4IE6 A;  3ZYM A;  4A5X A;  4OYK A;  1XDO A;  3ZYK A;  3ZMT B;  4ERR A;  3I9W A;  5ABF B;  1UX4 A;  5HAX A;  3AAE B;  4QX7 B;  4LFC T;  3Q2M A;  2Q9Q D;  3H3A A;  2JIW A;  4X64 T;  1YQ3 A;  5IHY A;  4P0A A;  2M6B A;  1IZN B;  1W0B A;  3I1A A;  2RA1 A;  2VQF T;  3NZQ A;  4LF8 T;  3I9Y A;  2D0U A;  1QSD A;  5JVD E;  3KVA A;  2NTY A;  3RYI E;  4C91 A;  2WAU A;  3LJC A;  3NRY A;  1OWA A;  3AEE A;  5FP3 A;  3UT5 E;  5KDM C;  2JJ9 A;  2X51 A;  5JR9 B;  2Q9Q C;  2XTL A;  3T1Y T;  4QXH B;  3CKD A;  4UVB B;  5LNK A;  3A5X A;  4U72 A;  3OYZ A;  4H9O C;  4YFS A;  5E0O A;  4P0B A;  1FEW A;  1HF8 A;  2LM9 A;  4TWH A;  4K0K T;  3AE9 A;  3BK9 A;  3L39 A;  2YK0 A;  3EAM A;  2LOP A;  4TWD A;  3GN5 B;  1E7P A;  2VUR A;  1FJG T;  4AXP A;  4EV6 A;  1GQE A;  1S35 A;  4YT0 A;  2LHR A;  2M67 A;  4Q25 A;  2LLY A;  4QH5 A;  4P1N A;  4JI5 T;  3AA0 B;  3SFD A;  2WQY A;  2JQH A;  3OKQ A;  3OVU A;  1QUU A;  3A8Y C;  2CLY C;  2D2S A;  3CX7 B;  5AQH B;  2X0Y A;  2XQ3 A;  4EXT A;  4GK0 E;  2IUB A;  3ESL A;  4KX6 A;  2N1G A;  1Y01 A;  3K1S A;  2UXB T;  3O1I A;  2WDV A;  4LF4 T;  3RRW A;  3UU3 A;  3PU3 A;  5KMG P;  2BBJ A;  2Q9Q A;  4HFE A;  2C0S A;  2PG8 A;  4NXN T;  3RRC A;  5L2L A;  1BR2 A;  5EK2 A;  3K8P C;  4HFV A;  4QWN B;  1L0V A;  3BQI A;  4U2Z A;  3ONJ A;  1MIV A;  4HKA A;  3ZLI A;  3AA1 B;  4U7Y A;  5EZY E;  5AQQ B;  4E7Z A;  5J2T E;  1ZHC A;  1KEY A;  1VRB A;  2A72 A;  2WZI A;  3OJA A;  3PU8 A;  3BQL A;  1HX1 B;  4PFP A;  1HX8 A;  5ADX L;  2LRK A;  3EAB A;  4HFH A;  4F6R C;  3JC6 D;  5F5W A;  3BQK A;  2QRX A;  2VL0 A;  4IL9 A;  5C3J A;  5ABH A;  4UXN B;  3P4P A;  4I0U A;  5KX5 E;  2H3R A;  5FXV A;  3NZP A;  3RKG A;  1HNW T;  4AKR B;  2YDR A;  5LHH B;  3RQW A;  5J1G A;  5JRC A;  1MMG A;  1WCR A;  4DVD A;  5HXE A;  3FZK B;  4AI6 A;  4IE4 A;  1LKX A;  1IBM T;  3P4Q A;  3JC6 C;  2XJ7 A;  4QHO A;  2K48 A;  5LCY A;  4H9S E;  1OED B;  1BR1 A;  2PTF A;  3SRZ A;  5FMN A;  2WMO A;  3TKL B;  3UTK A;  3TLW A;  4TZ4 C;  2JMK A;  2X68 A;  4DV3 T;  3O4X E;  5L3B B;  3IA3 A;  1HS7 A;  2LT3 A;  2V7M A;  2V26 A;  2BG9 C;  1ZEE A;  2MBG A;  4YTN A;  2LEH A;  1YKE B;  4CN1 A;  2H89 A;  5LMU T;  2IHR 1;  3MK7 C;  3ZYL A;  5LGU B;  3AE2 A;  4B3M T;  2HPJ A;  1D1B A;  4ZS2 A;  4N78 D;  1X9B A;  3UQ7 A;  4YLH A;  3N9Q A;  3C4X A;  4PW8 A;  3UUX B;  5LHG B;  1JNR A;  5F8P A;  2CBJ A;  3AA7 B;  1S94 A;  4TV8 E;  4MFR A;  3PUS A;  4OFZ A;  5AFU L;  5AQR B;  2UXN B;  3UU6 A;  2CEA A;  3TLV A;  4LF7 T;  2E8I A;  3VRA A;  4U31 A;  1G8X A;  4DMV A;  2M6I A;  1IJ5 A;  3B5M A;  2VKD A;  4PK5 A;  4O4J E;  3RI5 A;  3K3N A;  4AKH A;  5IWA T;  4OYJ A;  3ZSS A;  4CN6 A;  2MYS A;  3P8C D;  4DUY T;  4ASK A;  2DL1 A;  3GWH A;  2XSB A;  4YHH T;  2CMR A;  4YJ2 E;  4ZI3 D;  2B1E A;  1EZ3 A;  3ZKR A;  2EHO D;  4WW0 A;  4DR5 T;  2ZM6 T;  2ZM2 A;  2BG9 A;  5AQV B;  2LKH A;  4EEB A;  4TN7 B;  3EVY A;  4IST A;  3QK6 A;  3UUN A;  4QXC B;  3FZM B;  2LM2 A;  5CFB A;  2CXL A;  3Q9D A;  4WBN E;  4DV6 T;  1N34 T;  3M65 A;  1FMV A;  2J47 A;  2CXD A;  4ZI3 C;  5JDQ A;  4I50 E;  3EUH A;  4F8H A;  2EHO C;  2UXX B;  5LB7 B;  2K5B B;  3V5U A;  2VAS A;  4AQG A;  4AKL A;  3G06 A;  3AEA A;  4UV8 B;  5EK3 A;  1MND A;  3UFG A;  2LSI A;  2A3D A;  2DCF A;  1MMN A;  3RHW A;  3IEE A;  3UUB A;  1J5W A;  4YSZ A;  1M62 A;  1LVK A;  4JI2 T;  2C5K T;  5EK4 A;  2RPA A;  1T98 A;  3FBZ A;  4PJJ A;  4KUM B;  5TAO A;  4L5G A;  5GON E;  1T72 A;  3ZJ1 A;  1T8B A;  2V7L A;  4ZS3 A;  2WSS V;  2BBH A;  3KBT A;  1I94 T;  2ZM0 A;  3D0T A;  5LG4 A;  2BKP A;  3C64 A;  4HFD A;  3RYF E;  1U4Q A;  3LG7 A;  4GIW A;  2XQ8 A;  2UUA T;  2L9Q A;  4ZHQ E;  2EHO A;  2WS3 A;  3ONL C;  2UXC T;  4HWC A;  4CI2 B;  3ZCJ A;  1MNE A;  4BAY B;  2WB5 A;  4FI5 A;  4IE5 A;  2E5L T;  3CPZ A;  3CWZ B;  1KK7 A;  2Q9Q B;  4CXY A;  4UIG A;  4DUZ T;  3F57 A;  2D9D A;  2KSR A;  2DHR A;  5LG3 A;  4GYS A;  2J62 A;  2P9B A;  2WZH A;  2XSA A;  1UUS A;  2XAS B;  2XM1 A;  4HWF A;  3AE3 A;  4AQY T;  5HCM A;  5AQO B;  2RP4 A;  2XAG B;  2UUB T;  2W0G A;  3U78 A;  2C5I T;  4HGA A;  3RPU A;  1E1H B;  1ZKE A;  5FXX A;  1UK5 A;  2CCQ A;  2K9A A;  5FNV E;  3HKC E;  1FMW A;  2NR4 A;  4U33 A;  3L3P A;  1NEN A;  2CLY B;  2W4X A;  5IUX A;  4L0R A;  2ES0 A;  4J2C A;  2Y6X A;  5AQG B;  1UUR A;  2H7V C;  5LMN T;  2CWY A;  4DR4 T;  4NUU A;  2VK9 A;  3FZH B;  5IYZ E;  2ACX A;  3RYC E;  5JRC B;  3LK2 B;  5HYA A;  4IT4 A;  4O4H E;  3HI2 A;  4KP3 C;  2WBL A;  1KFY A;  4LFB T;  4ISS A;  2JRK A;  5FXW A;  2BDE A;  1CUN A;  1NAF A;  4O2B E;  2X66 A;  2ZMA A;  3KV6 A;  4PK6 A;  2XQ9 A;  1V9D A;  3UU5 A;  3EHZ A;  1HNZ T;  2R6G F;  5HEU A;  2IC9 A;  2CHO A;  3VHL A;  3S4U A;  2C5J A;  2X9W A;  1WR6 A;  2VQE T;  3FZL B;  5HEH A;  3RX6 A;  2CA5 A;  4GYR A;  3RC8 A;  2W61 A;  2JPF A;  1N36 T;  5L3C B;  3IF8 B;  1MIW A;  3AED A;  2YDS A;  2VKO A;  3CK6 A;  5AQN B;  4U74 A;  5AQT B;  5HWY A;  5HEJ A;  4KHP T;  1HNX T;  4K0U A;  1VOM A;  3ZMU B;  4WZX A;  5CA1 E;  5DQW A;  4JEU B;  3FB2 A;  2A2F X;  3ZN1 B;  1XWM A;  4EOZ B;  2CPT A;  3PJA A;  4ILA A;  2OA5 A;  4X66 T;  2MTQ A;  4KI0 F;  1LVF A;  3PDY A;  4L9I A;  2XAJ B;  5LA6 E;  3T8O A;  2KXP B;  5FKY A;  3CX8 B;  2FJE A;  2BKO A;  3NVO A;  3O1H A;  4PNI A;  4H9R C;  4NPP A;  4QKN A;  3AAA B;  3FXE B;  5DAB A;  5JR9 C;  3R6N A;  3KV4 A;  4QH1 A;  4H9P C;  5AQP B;  3MA9 A;  2BG9 B;  3PUY F;  4JV5 T;  1D1A A;  5HWX A;  2E2A A;  1WR0 A;  3QOF A;  4JLE A;  4MBQ A;  1X79 A;  3RIA A;  4LML A;  1D1C A;  2BG9 E;  4DID B;  1IBL T;  4PJN A;  4IHJ E;  4EYU A;  4YTP A;  3ETV A;  4QX8 B;  4ILC A;  3Q5D A;  2NWB A;  1Z0P A;  3C50 A;  3L09 A;  1IBK T;  3H37 A;  3I0O A;  2XQ7 A;  3P4W A;  1BR0 A;  4GK5 E;  3AA6 B;  4UF0 A;  2W63 A;  4IDN A;  4I55 E;  3AE6 A;  2PJQ A;  1ZP0 A;  2WWU A;  4TWF A;  3RQU A;  2YU1 A;  1Y64 B;  3VR8 A;  4FJO A;  3UFE A;  1WRD A;  2DWG A;  5JDH A;  4X5T A;  3FXD B;  4COF A;  3ZT5 A;  2X0H A;  1W9R A;  4IE0 A;  2D5U A;  1OED E;  4P09 A;  4HTE A;  2X9H A;  4LFA T;  2YN6 A;  4EYY R;  1WFD A;  3ZC0 A;  1YXR A;  4CI3 B;  2LE8 A;  3AEC A;  4DR6 T;  5LP6 E;  4X20 E;  2MPK A;  3RIU C;  3X1D A;  3VR9 A;  3TLU A;  2DWK A;  4X1I E;  1UGO A;  3ZMS B;  2DI4 A;  3QNU A;  1UX5 A;  5CB4 E;  3PUR A;  4KHZ F;  2WP9 A;  5JQG E;  4PAG A;  3N9N A;  4U7I A;  2EHO B;  3KV9 A;  3CQG B;  3RKO A;  3AE8 A;  2MAW A;  4HEA A;  5HXR A;  2L3L A;  3ONX A;  1NWM X;  1XMQ T;  4A98 A;  4KMC A;  3P50 A;  2ZLY A;  4C90 A;  3HL6 A;  4DBQ A;  1XNQ T;  5C8Y E;  2K3W A;  2FJB A;  3ZEF B;  2G0U A;  3PUG A;  2KLQ A;  2XQ4 A;  1DU2 A;  2NW8 A;  4H9N C;  5DJQ C;  3CIR A;  5J2U E;  4O4L E;  1SA0 E;  4QH4 A;  3J7Y q;  4B6X A;  3OYX A;  4JYA T;  2YOE A;  2BZB A;  2BS3 A;  1R8I A;  3ZT6 A;  4DV7 T;  2WU5 A;  4AIS A;  3RIU A;  3C4Z A;  2V6Y A;  5JDL A;  2V5C A;  3AE1 A;  4AQF C;  2KIN B;  5FXZ A;  1KNR A;  4IIJ E;  1MIY A;  4ZI2 D;  1SHZ C;  1KNP A;  2WY2 A;  4CZZ B;  3LSV A;  4ZXL A;  2AXD S;  5CGM A;  3LBX A;  1D0Z A;  4CQI A;  5H6R B;  1KF6 A;  1D0X A;  4PFO A;  4O2A E;  2ODU A;  4TV9 E;  4X1Y E;  4I43 B;  1YQ4 A;  5CJ5 A;  2NP9 A;  3ANW A;  1HR0 T;  4LMK A;  3E0Z A;  3ZC1 A;  2XUE A;  1WYB A;  2X67 A;  3O9X A;  1YW0 A;  2XZE A;  4H9Q C;  4U3C A;  4HWD A;  3RIF A;  1H7C A;  2V6X A;  4WBO A;  2LKG A;  3AXJ A;  1SUM B;  3DTO A;  1HG5 A;  4QXB B;  2QGS A;  2V1D B;  1O3X A;  3HR0 A;  4DV2 T;  3FBL A;  3L8R A;  4DR1 T;  3MXZ A;  2KMF A;  4AQF A;  4V1A v;  2J1D G;  2HN2 A;  5F3J A;  2IDO B;  3I0Q A;  1B7T A;  2W2U A;  3CVR A;  5ABG A;  1HTJ F;  4X1K E;  3PUQ A;  4EZ4 A;  1ZOY A;  2H88 A;  4DMW A;  2E5V A;  2E9X D;  2HPL A;  2LSK A;  1AJ3 A;  2L8K A;  2YDQ A;  4B3T T;  4TNW A;  2WMN A;  4JI7 T;  4NUV A;  1XZY A;  3V5S A;  2W62 A;  3WI3 A;  2KT9 A;  2I59 A;  3MAC A;  3VKG A;  4CXW A;  3IBP A;  3ZN0 B;  1JNZ A;  3N2G E;  4ZZC A;  2VVN A;  3UU4 A;  4DV5 T;  1MMA A;  1YD8 G;  5AQU B;  4JI6 T;  3SWH A;  2W67 A;  5FL0 A;  4ADZ A;  2HHH T;  3C51 A;  4IE7 A;  4YSY A;  2LJL A;  4EGW A;  4BA9 A;  3KDS E;  5JH7 E;  2ODV A;  3JAF A;  4AKI A;  3FZF B;  1G73 A;  2E9X C;  5LJN A;  5AQL B;  4HN9 A;  2HN1 A;  3WAJ A;  5A1L A;  1WLX A;  2QA7 A;  3ZCI A;  2CWO A;  3KBU A;  4UV9 B;  2V7J A;  4UR9 A;  3TLT A;  4IDZ A;  5FY7 A;  1FIO A;  2FJD A;  3LK4 2;  3ABV A;  4XBF B;  4UEM A;  1SE7 A;  2XQA A;  1N32 T;  5CA0 E;  4MLK A;  4IDO A;  4DR2 T;  3UUM A;  3QUJ A;  4KBM B;  2I0M A;  5H6Q B;  2CE7 A;  4LF9 T;  3AVR A;  3AEB A;  3K3Q C;  2XM2 A;  2VKJ A;  1E2A A;  4B3R T;  4ZZB A;  2V7I A;  3CX6 B;  3ZJ2 A;  4G2A A;  4H63 H;  2X9X A;  4M1P A;  4UF0 B;  2SPC A;  3PUA A;  2QVA A;  3VKH A;  2DNX A;  3N9O A;  3ZMZ B;  1MMD A;  2E9X A;  4JBW F;  4JI3 T;  3KV5 A;  3PV0 F;  2NOX A;  2XAQ B;  3EI0 A;  4G63 A;  3F2E A;  1I6Z A;  4U2Y A;  3N9P A;  2W00 A;  2WU2 A;  4AIU A;  4YTM A;  4GKJ T;  3KIN B;  1NEK A;  2HH7 A;  3Q5X A;  1J1J A;  4LMJ A;  3PUW F;  4JI8 T;  2ZM8 A;  4UVC B;  3AB3 B;  4Z90 A;  5AQK B;  5L3G B;  3KVB A;  3Q5E A;  4HWI B;  2IW5 B;  3O1J A;  4A56 A;  4JEH B;  2OLT A;  1J5E T;  4H63 V;  4IRE A;  5LBQ B;  1BR4 A;  4X62 T;  2MOZ A;  5L4H A;  5FL1 A;  3ETU A;  2H7O A;  1VCS A;  2XAF B;  3HA4 A;  4ZOL E;  2V5D A;  3B57 A;  3HKE E;  4IDQ A;  4HFB A;  1CHU A;  3NWI A;  1N33 T;  3EDV A;  4GKK T;  4DBR A; 
#chains in the Genus database with same CATH homology
 2CRB A;  5FVL A;  2V6X A;  3ZST A;  4ZEY A;  1WR0 A;  5CJ5 A;  4U2Y A;  3EAB A;  4A5X A;  4CN4 A;  5CGM A;  2V6Y A;  2A9U A;  2DL1 A;  4U7Y A;  1WFD A;  5LB7 B;  4WZX A;  1YXR A;  2V6Y B;  4U33 A;  1WCR A;  4P1N A;  4U2Z A;  2JQ9 A;  2WWV A;  4CN1 A;  4U31 A;  2XZE A;  4IT4 A;  2LRL A;  4NIQ A;  3ZT5 A;  2CPT A;  2JQK A;  4U7I A;  4U3C A;  2RPA A;  5FVK A;  2MPK A;  2WY2 A;  3K1S A;  2JQH A;  2K3W A;  2W2U A;  3ZT6 A;  3ZSS A;  3ZT7 A;  2LRK A;  4CN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...