2LRKA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Phosphocarrier protein HPr
total genus 39
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrkA00
2MPKA 2LRKA 3K1SA 2V6YA 2LRLA 5FVLA 4U2YA 2WY2A 4IT4A 4NIQA 4U3CA 2DL1A 1WR0A 3ZSTA 4CN4A 5LB7B 4A5XA 2K3WA 4U2ZA 4WZXA 3ZT7A 5CGMA 2W2UA 4U33A 3ZSSA 2V6YB 2JQKA 3ZT5A 5FVKA 2CRBA 4U7YA 2WWVA 1YXRA 4CN6A 4CN1A 4ZEYA 2JQHA 2XZEA 2A9UA 4U31A 2RPAA 2CPTA 2V6XA 4P1NA 4U7IA 2JQ9A 1WFDA 3ZT6A 3EABA 5CJ5A 1WCRA
chains in the Genus database with same CATH superfamily
5HWXA 3PU3A 2LM9A 4QX8B 4AISA 4DR5T 2LKGA 3K1SA 2ZM6T 4IL4A 2HPJA 5CFBA 5FVLA 4U2YA 1XMOT 3KV6A 3RC3A 5JDNA 2LOSA 3C4ZA 4DMVA 4UF0A 1XMQT 2X0HA 4HE8A 3PU8A 1XNRT 2DL1A 3MK7C 4DBRA 1HNZT 3AA1B 3RYHE 1KNZA 4DO0A 4B3MT 3IEEA 1CUNA 2V7KA 2VWAA 2JRKA 3ZKRA 4V1Av 5IYZE 4JI0T 2VKDA 2VQFT 3K3OA 3ZT5A 5L3BB 4DV7T 3TLVA 3VHLA 3RRWA 2V26A 4PW8A 4UVCB 3WAJA 2VKHA 4U74A 1IBMT 2YK0A 2XZEA 2XQ9A 4CXXA 1U5PA 4H9OC 3AVSA 4IE7A 2LHNA 2V7MA 4ZS3A 4C91A 3QC9A 3I9WA 1WFDA 4TNVA 3RIFA 3UFGA 3FB2A 5FL1A 2WU5A 2BBJA 3NZPA 1N36T 2IAKA 5FP3A 1DU2A 1YQ3A 2YINA 3ZJ1A 5DABA 2N1GA 4N78D 3UUBA 2P9BA 4PK4A 4LF8T 4BJMA 4DUYT 2XSBA 1J5ET 1ZEEA 1HX1B 3LJCA 3KDSE 3H3MA 2NTYA 2UU9T 3ZT7A 4DV4T 1H7CA 5LG4A 3HI2A 4O8SA 4LF6T 1WLXA 2ODVA 3UQ4A 4AQFA 3EI0A 2CRBA 5JDLA 4GKKT 3H3AA 2J62A 4ZHQE 3AEFA 1UURA 1G8XA 3NBXX 2JQHA 2E9XB 2BG9E 1Z8UA 3E0ZA 4DV0T 3UTKA 5A1LA 1QSDA 4JI5T 5HEJA 4HFVA 4U7IA 2LSGA 5HXHA 5JTGA 1XNQT 3OPCA 4HWDA 3RPUA 2IUBA 4PJMA 3IHRA 3RIUC 4COFA 3O1IA 5JR9C 4UXNB 2CM0A 3UUNA 1VOMA 4F8HA 2WMOA 2NTXA 2X9WA 2WY2A 1XWMA 1J5WA 3AE4A 2IDOB 4U3CA 3QNUA 5AQQB 2W66A 5FXZA 3W15B 4MHCA 1MMAA 4U2ZA 1KF6A 5ABHA 4QXCB 5ABFB 3P4RA 2B76A 3QUJA 4H9SE 4G2AA 2JPFA 5AQIB 3HKEE 3QOFA 3JC6D 2WB5A 4JI6T 3B57A 2CA5A 4HTEA 4B3RT 4QHOA 4P1NA 2W0GA 4PK6A 5AQMB 3PJAA 3PV0F 4NUVA 3EDUA 4IE0A 1OEDB 3C64A 4ILBA 4WBNE 3PUXF 3T8OA 2BG9A 2DI4A 2WSSV 3N9NA 2OA5A 4IE4A 5HEUA 4XBFB 2XQAA 3CK6A 1XDPA 2WZIA 5JDQA 4EGWA 4UVBB 4I43B 3LBXB 4ZI3C 2XQ4A 3CPZA 5CGMA 3ZN1B 5LG3A 4NUUA 4MFRA 2V7JA 1YW0A 2W63A 2W62A 2Y48B 4MLKA 4UVAB 5EZYE 5LP6E 3N9PA 4HFCA 1XDOA 3BQKA 2VASA 4O4LE 5DJQC 3K3QC 4YSXA 4QXBB 5JDMA 4DR3T 4ERRA 1T72A 3LG7A 1HTJF 1X79A 4LMKA 4IHJE 3TLWA 1BR0A 5LHGB 5CA0E 1YKHB 4CQIA 3PJAJ 2JMHA 2XQ7A 3OYXA 1HFAA 4ISSA 1Z0PA 4EZ4A 2FJDA 3OYZA 2D0TA 3C98B 4H9QC 4YTMA 3RKGA 4EYYR 4X65T 4DUZT 4JI1T 4I50E 1OEDC 3PUSA 4DMWA 4YTPA 1OEDE 4EEBA 4P0AA 2X9YA 1D0XA 3L8RA 4IREA 4TZ4C 2M67A 4UEMA 2LE8A 4P0BA 4ILCA 5E0OA 1WRDA 3NZQA 5AQOB 5HXCA 3RF1A 3RYIE 5FXXA 4OK0A 5J0ZA 5HEOA 3ONJA 1WYCA 5FY0A 5TAOA 3ZN0B 4PK5A 1I6ZA 4EOZB 2CXLA 2I59A 4GKJT 4CI1B 3P4WA 2X9HA 5AQGB 4J2CA 1S35A 2H3RA 2H89A 5AQFB 3E08A 4L5GA 5ABGA 1VCSA 2I6HA 2X0LB 3AE2A 3CQCB 5FNVE 2SPCA 2WDRA 4QKNA 2A2FX 3M3ZB 4X1YE 5C2TA 2ACXA 3Q2MA 3JCFA 4GK5E 1D0YA 4MALA 3ABVA 2YKSA 2NP9A 3RH3A 2CWOA 2LOPA 2WM9A 3JAFA 2FJBA 4JLEA 5ETWA 2XSAA 3FZLB 1WCRA 2VVSA 3L09A 4ILAA 5HAXA 4ANJA 4JI7T 2Q9QC 2LSIA 1HG5A 3AA0B 4HWCA 2V6YA 3DJBA 3P4PA 2BVMA 5AQNB 3ZCIA 4E7ZA 2UUAT 3RI5A 4DR6T 3ZPOA 3TKLB 4X20E 2XHEB 5LYJE 2LT3A 2MBGA 2X68A 2V8SV 4TUYE 2HHHT 4A5XA 2ACZA 3ONXA 1KK7A 2E8IA 2FJEA 2XQ8A 3KV4A 3N5LA 5EK3A 3RQWA 4AIUA 1M7KA 4DV5T 3P4SA 4ZZCA 2X67A 3O9XA 2ES0A 1IJ6A 4ILUA 3T1HT 2E9XC 3KVBA 3P4QA 3EDVA 1JNRA 4U7YA 4YHJA 3RGLA 4ZI2D 3Q5WA 2NOXA 2V7LA 4A98A 3IF8B 3ONLC 4E7SA 4YY3T 2V6XA 3KFWX 5FL0A 5LHIB 4TWHA 4YT0A 3N2GE 5C3JA 1UK5A 3HKCE 2NWBA 3AAEB 1HNXT 4KX6A 1UCUA 2Y6XA 3PDYA 5F3JA 1T98A 2H7OA 5KMGP 2ODUA 1LRZA 2N2NA 2L9QA 3PURA 4YSZA 5AQVB 1KNRA 3AA6B 4IIJE 3MA9A 3JAEA 3RX6A 3TLUA 5L47A 4LF4T 2C5JA 2W61A 3EHZA 2WS3A 4FJOA 4WW0A 4LF7T 4H9NC 1US7B 1MNDA 2CXDA 4HGAA 3PUQA 3L39A 4L0RA 3ZSSA 2V6YB 4PAGA 4EAHA 2NR4A 4H9RC 2JMKA 2JQKA 4ASKA 2X51A 2A72A 4WNKA 3Q5XA 4HFBA 5AQJB 3P8CD 2QRXA 3RIAA 3ZEFB 2BKPA 2XM1A 2UXXB 3NVOA 3J9X1 4BAYB 3KVAA 2GK9A 4H63H 2A9UA 4QWNB 2RPAA 1LVKA 3G06A 1AJ3A 2NW7A 2D5UA 3D0TA 5J2TE 4GYRA 1UGOA 5BMVE 2DNXA 3ANWA 1MMDA 3N9LA 5LGUB 5LMNT 2VL8A 2IHR1 5HXEA 2MYSA 3KBTA 1QLBA 3I0OA 1SUMB 3ZC1A 1E7PA 1W0BA 3AA7B 1XZYA 2LRKA 3AEEA 2I0MA 5JDHA 3CX7B 4YJ2E 2D0UA 2XQ5A 3CQXC 4IT4A 2EHOC 4NPPA 4TWDA 2IW5B 3ZYMA 4A97A 4DNDA 5JDGA 1CHUA 3F57A 1WR0A 2XASB 1ZKEA 4CN4A 4DIDB 4ZOLE 2K24A 1JNZA 2G0UA 4TWFA 2J4GA 3MKDA 1R8IA 3LK2B 2OV9A 2J47A 2KZ7B 2QA7A 2WCAA 2YU2A 4B3ST 1ZOYA 3CKDA 4GYSA 1NAFA 2M6IA 3MJXA 1FMWA 2MTQA 1VCTA 4CN6A 5FKYA 3V5UA 3R84B 4CN1A 2X0YA 4YFSA 4OX9T 2DWGA 5AQUB 5LGTB 2XJ7A 2LLYA 4CI3B 1W0AA 5L4HA 4AQYT 1FMVA 4UF0B 1BR2A 3A7MA 1KNPA 1WR6A 2BS2A 2CCQA 1FJGT 4AI6A 2LSJA 2CMRA 2QVAA 2QGSA 4ZS2A 2MPKA 1OWAA 1WYBA 2WWVA 3LFMA 4IGUA 2LKHA 1UX4A 2ZM2A 2VKJA 3F2EA 3KBUA 4GK0E 3UU3A 3AXJA 2NW9A 3MZKB 3N9OA 4HFHA 1SE7A 2E5VA 1YD8G 2X66A 3QB5A 4PFPA 4TX5A 3HA4A 2XAJB 2ZLYA 1KFYA 3AEAA 4HN9A 2BS4A 2PBIA 3AVRA 4DR7T 5EK2A 1NENA 5AQSB 4I0UA 4KHPT 3VKHA 2ZM0A 4K0KT 2D9DA 2BKNA 2BKOA 2FBWA 1S94A 4AKRB 4JUYA 3C51A 4GIWA 1VRBA 1J1JA 2CPTA 3FXEB 3M65A 4O2BE 2C5KT 4OHFA 4PFOA 3NRXA 2XUEA 4HKAA 3SWHA 3KV5A 5FYMA 4ZXLA 2BG9B 5FY1A 1MIVA 5KX5E 4F6RC 4EXTA 1LKXA 4Q25A 2CXFA 4OFZA 2XAHB 2PTFA 2XQ3A 4I4TE 3FHNA 4HEAA 3OKQA 3P7IA 5LCYA 4EB6E 1SHZC 3N2KE 2QYWA 4U72A 2W67A 1MIYA 4YLHA 3WAKA 2K48A 3ZSTA 2D2SA 4C90A 4X64T 1UX5A 4DV6T 4QX7B 4CI2B 4JI4T 2HN1A 4XZCA 5FXWA 3S4UA 1HR0T 4LFBT 3AE6A 3GMIA 3H37A 3UU4A 3OJAA 5KDMC 2XM2A 1HCIA 5FVKA 5LMUT 3SOLA 4PJLA 3OVUA 3FBZA 4ZEYA 3ZMSB 3UU8A 5LJNA 1NWMX 4KBMB 4AXPA 4U31A 4UELA 5KXJA 5JRCB 4TNWA 2VQET 2UXNB 3N2OA 3AE5A 2IIUA 4L9IA 2WAUA 3BQIA 3P50A 3RHWA 2KWIB 4EZHA 3RLFF 1YQ4A 4ADZA 2UXDT 3BK9A 4HWHA 1D0ZA 2HPLA 4X1KE 3B5MA 4X62T 2JQQA 2YDSA 2W4XA 3CIRA 1U4QA 3LDQB 5CB4E 2WDQA 3EAMA 3Q5DA 2WMNA 4FI5A 3ZMVB 3KINB 5HEGA 3AE8A 2AXDS 1MNEA 5LJMA 3AE7A 2E9XA 4WYVA 4NXNT 2HN2A 2OLTA 2WQYA 3C4WA 2WZHA 1T8BA 4G63A 4WZXA 5BR8T 4DBQA 4ZZBA 5LHHB 4YXDA 3PUYF 3PUWF 2UUBT 2YOEA 2M6BA 2R6GF 3OTOT 2C0SA 2KT9A 2Y8DA 5ADXL 1HS7A 4GOUA 1G73A 3CVRA 3OBVE 2XTLA 4KHZF 4UV8B 4XAXB 3I9YA 5DQWA 1MIWA 1MMNA 4KP3C 4Z90A 2Q9QB 4DVDA 5CA1E 4QH4A 3EVYA 2E9XD 3UU5A 4CZZB 4DR2T 2V5DA 5FY7A 3HL6A 2RP4A 2WBLA 2XQ6A 2XY8B 2CLYC 4QXHB 2DLRA 4DV2T 3ANWB 1O3XA 1W9RA 2BBHA 2CHNA 3RRCA 5LXTE 1Y64B 3T1YT 1GQEA 4TV9E 2L8KA 3AE1A 4LFCT 4JYAT 4JI2T 2WU2A 4PJNA 1ZHCA 2YDRA 3FZHB 4UV9B 5HCJA 4EV6A 5AQKB 5HXSA 3F31A 1OXZA 1IJ5A 2LHRA 2CBIA 3AE9A 3UU6A 5L3CB 4OYJA 3ZLIA 2BS3A 4X66T 2CE7A 3B13A 4M1PA 2IC6A 2CHOA 2VL0A 3PUVF 4NXMT 5IUXA 3ZC0A 5DQVA 1N32T 5L3DB 3TLTA 4HWFA 3ZMTB 5LBQB 3UT5E 2RA1A 1L0VA 3EABA 3UULA 3UQ7A 3DP7A 3NRYA 4CXWA 1HNWT 1D1AA 2VB6A 5CJ5A 4KUMB 4A56A 3BQLA 1BR1A 3FBLA 4JEHB 3VRBA 5GONE 5JVDE 5LGNB 4AKGA 1N34T 3VR8A 2XAQB 4H63V 2EHOD 2XAGB 3GN5A 3ZCJA 3UUMA 1IBLT 3ZMZB 3UUXB 4B3TT 3O1JA 5JDFA 4LF9T 2Q9QA 2BDEA 3FXDB 1NEKA 3GWHA 5AQTB 2CEAA 3ZYKA 1MMGA 5AQLB 2DCFA 2LEHA 2UUCT 3N9MA 5ABEA 4JEUB 4KI0F 1YXRA 4LMLA 5F5WA 3C50A 1W09A 3GN5B 3C4XA 1UUSA 3PUZF 2LJLA 4IDPA 5AQHB 4LMJA 2EHOA 2FJAA 4ISTA 5HEHA 3WI3A 5ABFA 2C5IT 2KLQA 4IE6A 1FIOA 1QUUA 2E5LT 3ZJ2A 4CXYA 2Q9QD 4TN7B 4PNIA 4WBOA 4MBQA 2DHRA 1M62A 4HFDA 4O4IE 5H6QB 3K8PC 2L3LA 5L2LA 5LBMA 3X1DA 3LBXA 4KMCA 3VRAA 4ZI3D 2CWYA 3AAIA 3O4XE 2Z6EA 5HXRA 1LVFA 3AECA 3I0QA 3RQUA 4QH5A 4DR1T 3JADA 3VR9A 4P09A 3VU7H 4O2AE 2AE9A 4TV8E 1YKEB 1OEDA 1Y01A 5AQRB 3FZFB 1B7TA 1V9DA 3PE0A 5HWYA 2XAFB 2KNDA 4HWIB 5LOVE 1IZNB 2KMFA 2B1EA 2H7VC 3A5XA 3PUGA 4HFIA 5L4EA 3RYCE 3J7Yq 4QH1A 4JV5T 3HR0A 4O4HE 1ZV4X 5LNKA 1T7SA 2DWKA 3HKDE 2LSKA 2FUPA 2MOZA 2XQYA 2A3DA 4IL9A 5F8PA 3SRZA 4AQGA 3PUAA 4X5TA 2VK9A 4JI8T 3ETUA 2MAWA 5H6RB 1E2AA 2PG8A 2PJQA 2K9AA 3UFEA 4AKLA 4AKIA 3PTRB 4IDNA 1HG2A 2VKOA 3IA3A 4YJ3E 3RC8A 2J1DG 2H88A 4Z8XA 2V7IA 2ZM8A 3NWIA 5L3FB 1D1CA 1I94T 3IBPA 4LFAT 2LSYA 2KWHA 3E22E 5JH7E 2WWUA 1E1HB 3A8YC 4NIQA 3SFEA 5L3EB 5M4YA 3MACA 2F4VT 2IC9A 2KINB 2WDVA 4YSYA 5LB7B 1SA0E 4IDQA 2ZMAA 2BG9C 3Q9DA 4O4JE 4AQFC 2EHOB 2W2UA 4EYUA 3LK3B 4EIWA 5JR9B 3RYFE 4B6XA 2JJ9A 2W00A 3K3NA 3HKBE 3N9QA 5J1GA 3ZYLA 4YTNA 2V1DB 3LSVA 3Q5EA 3U3IA 3QB5K 1HF8A 3EUHA 4BJNA 1IBKT 2UXCT 4DR4T 4JI3T 3VKGA 2E2AA 3ETVA 1BR4A 3SS1A 5FMNA 5HYAA 2VVNA 2LM2A 3L3PA 3NKZA 2PFVA 4IE5A 5AFUL 2CLYB 4JBWF 4K0UA 4UIGA 1IAPA 5JQGE 5JREA 1HX8A 4H9PC 3AEBA 5J2UE 3RKOA 2X9XA 3AE3A 2LRLA 2YDQA 3DTOA 2KSRA 3FZKB 4I55E 4IDZA 3ESLA 5FXVA 3U78A 3CX6B 3MXZA 3QK6A 2IMLA 2UXBT 3AEDA 3GA8A 3AEGA 4ZI2C 1N33T 2CBJA 2XPKA 3AXJB 2K3WA 4HFEA 3FZMB 3JC6C 5LA6E 4UR9A 2NW8A 3SFDA 3R6NA 3TLSA 4AKHA 4U33A 2BVLA 2YU1A 5HCMA 3AAAB 1KEYA 3CMLA 4PJJA 5JR9A 2YEVC 3RIUA 1EZ3A 3KV9A 2V5CA 2BZBA 4BA9A 3ZMUB 4DV3T 4ZI7E 5JRCA 1D1BA 1FEWA 3CWZB 4OYKA 4EEDA 2N9DA 4LF5T 3AB3B 5IHYA 5AQPB 5C8YE 4YHHT 4IDOA 4Z91A 2K5BB 3CQGB 3V5SA 2KXPB 3I1AA 5L3GB 3O1HA 2JQ9A 1X9BA 3LK42 1ZP0A 2JIWA 2YN6A 5EK4A 3ZT6A 2WP9A 3CX8B 5IWAT 4DV1T 2HH7A 4X1IE 2VURA
chains in the Genus database with same CATH topology
2MPKA 2LRKA 3K1SA 2V6YA 2LRLA 5FVLA 4U2YA 2WY2A 4IT4A 4NIQA 4U3CA 2DL1A 1WR0A 3ZSTA 4CN4A 5LB7B 4A5XA 2K3WA 4U2ZA 4WZXA 3ZT7A 5CGMA 2W2UA 4U33A 3ZSSA 2V6YB 2JQKA 3ZT5A 5FVKA 2CRBA 4U7YA 2WWVA 1YXRA 4CN6A 4CN1A 4ZEYA 2JQHA 2XZEA 2A9UA 4U31A 2RPAA 2CPTA 2V6XA 4P1NA 4U7IA 2JQ9A 1WFDA 3ZT6A 3EABA 5CJ5A 1WCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPK A;  2LRK A;  3K1S A;  2V6Y A;  2LRL A;  5FVL A;  4U2Y A;  2WY2 A;  4IT4 A;  4NIQ A;  4U3C A;  2DL1 A;  1WR0 A;  3ZST A;  4CN4 A;  5LB7 B;  4A5X A;  2K3W A;  4U2Z A;  4WZX A;  3ZT7 A;  5CGM A;  2W2U A;  4U33 A;  3ZSS A;  2V6Y B;  2JQK A;  3ZT5 A;  5FVK A;  2CRB A;  4U7Y A;  2WWV A;  1YXR A;  4CN6 A;  4CN1 A;  4ZEY A;  2JQH A;  2XZE A;  2A9U A;  4U31 A;  2RPA A;  2CPT A;  2V6X A;  4P1N A;  4U7I A;  2JQ9 A;  1WFD A;  3ZT6 A;  3EAB A;  5CJ5 A;  1WCR A; 
#chains in the Genus database with same CATH topology
 5HWX A;  3PU3 A;  2LM9 A;  4QX8 B;  4AIS A;  4DR5 T;  2LKG A;  3K1S A;  2ZM6 T;  4IL4 A;  2HPJ A;  5CFB A;  5FVL A;  4U2Y A;  1XMO T;  3KV6 A;  3RC3 A;  5JDN A;  2LOS A;  3C4Z A;  4DMV A;  4UF0 A;  1XMQ T;  2X0H A;  4HE8 A;  3PU8 A;  1XNR T;  2DL1 A;  3MK7 C;  4DBR A;  1HNZ T;  3AA1 B;  3RYH E;  1KNZ A;  4DO0 A;  4B3M T;  3IEE A;  1CUN A;  2V7K A;  2VWA A;  2JRK A;  3ZKR A;  4V1A v;  5IYZ E;  4JI0 T;  2VKD A;  2VQF T;  3K3O A;  3ZT5 A;  5L3B B;  4DV7 T;  3TLV A;  3VHL A;  3RRW A;  2V26 A;  4PW8 A;  4UVC B;  3WAJ A;  2VKH A;  4U74 A;  1IBM T;  2YK0 A;  2XZE A;  2XQ9 A;  4CXX A;  1U5P A;  4H9O C;  3AVS A;  4IE7 A;  2LHN A;  2V7M A;  4ZS3 A;  4C91 A;  3QC9 A;  3I9W A;  1WFD A;  4TNV A;  3RIF A;  3UFG A;  3FB2 A;  5FL1 A;  2WU5 A;  2BBJ A;  3NZP A;  1N36 T;  2IAK A;  5FP3 A;  1DU2 A;  1YQ3 A;  2YIN A;  3ZJ1 A;  5DAB A;  2N1G A;  4N78 D;  3UUB A;  2P9B A;  4PK4 A;  4LF8 T;  4BJM A;  4DUY T;  2XSB A;  1J5E T;  1ZEE A;  1HX1 B;  3LJC A;  3KDS E;  3H3M A;  2NTY A;  2UU9 T;  3ZT7 A;  4DV4 T;  1H7C A;  5LG4 A;  3HI2 A;  4O8S A;  4LF6 T;  1WLX A;  2ODV A;  3UQ4 A;  4AQF A;  3EI0 A;  2CRB A;  5JDL A;  4GKK T;  3H3A A;  2J62 A;  4ZHQ E;  3AEF A;  1UUR A;  1G8X A;  3NBX X;  2JQH A;  2E9X B;  2BG9 E;  1Z8U A;  3E0Z A;  4DV0 T;  3UTK A;  5A1L A;  1QSD A;  4JI5 T;  5HEJ A;  4HFV A;  4U7I A;  2LSG A;  5HXH A;  5JTG A;  1XNQ T;  3OPC A;  4HWD A;  3RPU A;  2IUB A;  4PJM A;  3IHR A;  3RIU C;  4COF A;  3O1I A;  5JR9 C;  4UXN B;  2CM0 A;  3UUN A;  1VOM A;  4F8H A;  2WMO A;  2NTX A;  2X9W A;  2WY2 A;  1XWM A;  1J5W A;  3AE4 A;  2IDO B;  4U3C A;  3QNU A;  5AQQ B;  2W66 A;  5FXZ A;  3W15 B;  4MHC A;  1MMA A;  4U2Z A;  1KF6 A;  5ABH A;  4QXC B;  5ABF B;  3P4R A;  2B76 A;  3QUJ A;  4H9S E;  4G2A A;  2JPF A;  5AQI B;  3HKE E;  3QOF A;  3JC6 D;  2WB5 A;  4JI6 T;  3B57 A;  2CA5 A;  4HTE A;  4B3R T;  4QHO A;  4P1N A;  2W0G A;  4PK6 A;  5AQM B;  3PJA A;  3PV0 F;  4NUV A;  3EDU A;  4IE0 A;  1OED B;  3C64 A;  4ILB A;  4WBN E;  3PUX F;  3T8O A;  2BG9 A;  2DI4 A;  2WSS V;  3N9N A;  2OA5 A;  4IE4 A;  5HEU A;  4XBF B;  2XQA A;  3CK6 A;  1XDP A;  2WZI A;  5JDQ A;  4EGW A;  4UVB B;  4I43 B;  3LBX B;  4ZI3 C;  2XQ4 A;  3CPZ A;  5CGM A;  3ZN1 B;  5LG3 A;  4NUU A;  4MFR A;  2V7J A;  1YW0 A;  2W63 A;  2W62 A;  2Y48 B;  4MLK A;  4UVA B;  5EZY E;  5LP6 E;  3N9P A;  4HFC A;  1XDO A;  3BQK A;  2VAS A;  4O4L E;  5DJQ C;  3K3Q C;  4YSX A;  4QXB B;  5JDM A;  4DR3 T;  4ERR A;  1T72 A;  3LG7 A;  1HTJ F;  1X79 A;  4LMK A;  4IHJ E;  3TLW A;  1BR0 A;  5LHG B;  5CA0 E;  1YKH B;  4CQI A;  3PJA J;  2JMH A;  2XQ7 A;  3OYX A;  1HFA A;  4ISS A;  1Z0P A;  4EZ4 A;  2FJD A;  3OYZ A;  2D0T A;  3C98 B;  4H9Q C;  4YTM A;  3RKG A;  4EYY R;  4X65 T;  4DUZ T;  4JI1 T;  4I50 E;  1OED C;  3PUS A;  4DMW A;  4YTP A;  1OED E;  4EEB A;  4P0A A;  2X9Y A;  1D0X A;  3L8R A;  4IRE A;  4TZ4 C;  2M67 A;  4UEM A;  2LE8 A;  4P0B A;  4ILC A;  5E0O A;  1WRD A;  3NZQ A;  5AQO B;  5HXC A;  3RF1 A;  3RYI E;  5FXX A;  4OK0 A;  5J0Z A;  5HEO A;  3ONJ A;  1WYC A;  5FY0 A;  5TAO A;  3ZN0 B;  4PK5 A;  1I6Z A;  4EOZ B;  2CXL A;  2I59 A;  4GKJ T;  4CI1 B;  3P4W A;  2X9H A;  5AQG B;  4J2C A;  1S35 A;  2H3R A;  2H89 A;  5AQF B;  3E08 A;  4L5G A;  5ABG A;  1VCS A;  2I6H A;  2X0L B;  3AE2 A;  3CQC B;  5FNV E;  2SPC A;  2WDR A;  4QKN A;  2A2F X;  3M3Z B;  4X1Y E;  5C2T A;  2ACX A;  3Q2M A;  3JCF A;  4GK5 E;  1D0Y A;  4MAL A;  3ABV A;  2YKS A;  2NP9 A;  3RH3 A;  2CWO A;  2LOP A;  2WM9 A;  3JAF A;  2FJB A;  4JLE A;  5ETW A;  2XSA A;  3FZL B;  1WCR A;  2VVS A;  3L09 A;  4ILA A;  5HAX A;  4ANJ A;  4JI7 T;  2Q9Q C;  2LSI A;  1HG5 A;  3AA0 B;  4HWC A;  2V6Y A;  3DJB A;  3P4P A;  2BVM A;  5AQN B;  3ZCI A;  4E7Z A;  2UUA T;  3RI5 A;  4DR6 T;  3ZPO A;  3TKL B;  4X20 E;  2XHE B;  5LYJ E;  2LT3 A;  2MBG A;  2X68 A;  2V8S V;  4TUY E;  2HHH T;  4A5X A;  2ACZ A;  3ONX A;  1KK7 A;  2E8I A;  2FJE A;  2XQ8 A;  3KV4 A;  3N5L A;  5EK3 A;  3RQW A;  4AIU A;  1M7K A;  4DV5 T;  3P4S A;  4ZZC A;  2X67 A;  3O9X A;  2ES0 A;  1IJ6 A;  4ILU A;  3T1H T;  2E9X C;  3KVB A;  3P4Q A;  3EDV A;  1JNR A;  4U7Y A;  4YHJ A;  3RGL A;  4ZI2 D;  3Q5W A;  2NOX A;  2V7L A;  4A98 A;  3IF8 B;  3ONL C;  4E7S A;  4YY3 T;  2V6X A;  3KFW X;  5FL0 A;  5LHI B;  4TWH A;  4YT0 A;  3N2G E;  5C3J A;  1UK5 A;  3HKC E;  2NWB A;  3AAE B;  1HNX T;  4KX6 A;  1UCU A;  2Y6X A;  3PDY A;  5F3J A;  1T98 A;  2H7O A;  5KMG P;  2ODU A;  1LRZ A;  2N2N A;  2L9Q A;  3PUR A;  4YSZ A;  5AQV B;  1KNR A;  3AA6 B;  4IIJ E;  3MA9 A;  3JAE A;  3RX6 A;  3TLU A;  5L47 A;  4LF4 T;  2C5J A;  2W61 A;  3EHZ A;  2WS3 A;  4FJO A;  4WW0 A;  4LF7 T;  4H9N C;  1US7 B;  1MND A;  2CXD A;  4HGA A;  3PUQ A;  3L39 A;  4L0R A;  3ZSS A;  2V6Y B;  4PAG A;  4EAH A;  2NR4 A;  4H9R C;  2JMK A;  2JQK A;  4ASK A;  2X51 A;  2A72 A;  4WNK A;  3Q5X A;  4HFB A;  5AQJ B;  3P8C D;  2QRX A;  3RIA A;  3ZEF B;  2BKP A;  2XM1 A;  2UXX B;  3NVO A;  3J9X 1;  4BAY B;  3KVA A;  2GK9 A;  4H63 H;  2A9U A;  4QWN B;  2RPA A;  1LVK A;  3G06 A;  1AJ3 A;  2NW7 A;  2D5U A;  3D0T A;  5J2T E;  4GYR A;  1UGO A;  5BMV E;  2DNX A;  3ANW A;  1MMD A;  3N9L A;  5LGU B;  5LMN T;  2VL8 A;  2IHR 1;  5HXE A;  2MYS A;  3KBT A;  1QLB A;  3I0O A;  1SUM B;  3ZC1 A;  1E7P A;  1W0B A;  3AA7 B;  1XZY A;  2LRK A;  3AEE A;  2I0M A;  5JDH A;  3CX7 B;  4YJ2 E;  2D0U A;  2XQ5 A;  3CQX C;  4IT4 A;  2EHO C;  4NPP A;  4TWD A;  2IW5 B;  3ZYM A;  4A97 A;  4DND A;  5JDG A;  1CHU A;  3F57 A;  1WR0 A;  2XAS B;  1ZKE A;  4CN4 A;  4DID B;  4ZOL E;  2K24 A;  1JNZ A;  2G0U A;  4TWF A;  2J4G A;  3MKD A;  1R8I A;  3LK2 B;  2OV9 A;  2J47 A;  2KZ7 B;  2QA7 A;  2WCA A;  2YU2 A;  4B3S T;  1ZOY A;  3CKD A;  4GYS A;  1NAF A;  2M6I A;  3MJX A;  1FMW A;  2MTQ A;  1VCT A;  4CN6 A;  5FKY A;  3V5U A;  3R84 B;  4CN1 A;  2X0Y A;  4YFS A;  4OX9 T;  2DWG A;  5AQU B;  5LGT B;  2XJ7 A;  2LLY A;  4CI3 B;  1W0A A;  5L4H A;  4AQY T;  1FMV A;  4UF0 B;  1BR2 A;  3A7M A;  1KNP A;  1WR6 A;  2BS2 A;  2CCQ A;  1FJG T;  4AI6 A;  2LSJ A;  2CMR A;  2QVA A;  2QGS A;  4ZS2 A;  2MPK A;  1OWA A;  1WYB A;  2WWV A;  3LFM A;  4IGU A;  2LKH A;  1UX4 A;  2ZM2 A;  2VKJ A;  3F2E A;  3KBU A;  4GK0 E;  3UU3 A;  3AXJ A;  2NW9 A;  3MZK B;  3N9O A;  4HFH A;  1SE7 A;  2E5V A;  1YD8 G;  2X66 A;  3QB5 A;  4PFP A;  4TX5 A;  3HA4 A;  2XAJ B;  2ZLY A;  1KFY A;  3AEA A;  4HN9 A;  2BS4 A;  2PBI A;  3AVR A;  4DR7 T;  5EK2 A;  1NEN A;  5AQS B;  4I0U A;  4KHP T;  3VKH A;  2ZM0 A;  4K0K T;  2D9D A;  2BKN A;  2BKO A;  2FBW A;  1S94 A;  4AKR B;  4JUY A;  3C51 A;  4GIW A;  1VRB A;  1J1J A;  2CPT A;  3FXE B;  3M65 A;  4O2B E;  2C5K T;  4OHF A;  4PFO A;  3NRX A;  2XUE A;  4HKA A;  3SWH A;  3KV5 A;  5FYM A;  4ZXL A;  2BG9 B;  5FY1 A;  1MIV A;  5KX5 E;  4F6R C;  4EXT A;  1LKX A;  4Q25 A;  2CXF A;  4OFZ A;  2XAH B;  2PTF A;  2XQ3 A;  4I4T E;  3FHN A;  4HEA A;  3OKQ A;  3P7I A;  5LCY A;  4EB6 E;  1SHZ C;  3N2K E;  2QYW A;  4U72 A;  2W67 A;  1MIY A;  4YLH A;  3WAK A;  2K48 A;  3ZST A;  2D2S A;  4C90 A;  4X64 T;  1UX5 A;  4DV6 T;  4QX7 B;  4CI2 B;  4JI4 T;  2HN1 A;  4XZC A;  5FXW A;  3S4U A;  1HR0 T;  4LFB T;  3AE6 A;  3GMI A;  3H37 A;  3UU4 A;  3OJA A;  5KDM C;  2XM2 A;  1HCI A;  5FVK A;  5LMU T;  3SOL A;  4PJL A;  3OVU A;  3FBZ A;  4ZEY A;  3ZMS B;  3UU8 A;  5LJN A;  1NWM X;  4KBM B;  4AXP A;  4U31 A;  4UEL A;  5KXJ A;  5JRC B;  4TNW A;  2VQE T;  2UXN B;  3N2O A;  3AE5 A;  2IIU A;  4L9I A;  2WAU A;  3BQI A;  3P50 A;  3RHW A;  2KWI B;  4EZH A;  3RLF F;  1YQ4 A;  4ADZ A;  2UXD T;  3BK9 A;  4HWH A;  1D0Z A;  2HPL A;  4X1K E;  3B5M A;  4X62 T;  2JQQ A;  2YDS A;  2W4X A;  3CIR A;  1U4Q A;  3LDQ B;  5CB4 E;  2WDQ A;  3EAM A;  3Q5D A;  2WMN A;  4FI5 A;  3ZMV B;  3KIN B;  5HEG A;  3AE8 A;  2AXD S;  1MNE A;  5LJM A;  3AE7 A;  2E9X A;  4WYV A;  4NXN T;  2HN2 A;  2OLT A;  2WQY A;  3C4W A;  2WZH A;  1T8B A;  4G63 A;  4WZX A;  5BR8 T;  4DBQ A;  4ZZB A;  5LHH B;  4YXD A;  3PUY F;  3PUW F;  2UUB T;  2YOE A;  2M6B A;  2R6G F;  3OTO T;  2C0S A;  2KT9 A;  2Y8D A;  5ADX L;  1HS7 A;  4GOU A;  1G73 A;  3CVR A;  3OBV E;  2XTL A;  4KHZ F;  4UV8 B;  4XAX B;  3I9Y A;  5DQW A;  1MIW A;  1MMN A;  4KP3 C;  4Z90 A;  2Q9Q B;  4DVD A;  5CA1 E;  4QH4 A;  3EVY A;  2E9X D;  3UU5 A;  4CZZ B;  4DR2 T;  2V5D A;  5FY7 A;  3HL6 A;  2RP4 A;  2WBL A;  2XQ6 A;  2XY8 B;  2CLY C;  4QXH B;  2DLR A;  4DV2 T;  3ANW B;  1O3X A;  1W9R A;  2BBH A;  2CHN A;  3RRC A;  5LXT E;  1Y64 B;  3T1Y T;  1GQE A;  4TV9 E;  2L8K A;  3AE1 A;  4LFC T;  4JYA T;  4JI2 T;  2WU2 A;  4PJN A;  1ZHC A;  2YDR A;  3FZH B;  4UV9 B;  5HCJ A;  4EV6 A;  5AQK B;  5HXS A;  3F31 A;  1OXZ A;  1IJ5 A;  2LHR A;  2CBI A;  3AE9 A;  3UU6 A;  5L3C B;  4OYJ A;  3ZLI A;  2BS3 A;  4X66 T;  2CE7 A;  3B13 A;  4M1P A;  2IC6 A;  2CHO A;  2VL0 A;  3PUV F;  4NXM T;  5IUX A;  3ZC0 A;  5DQV A;  1N32 T;  5L3D B;  3TLT A;  4HWF A;  3ZMT B;  5LBQ B;  3UT5 E;  2RA1 A;  1L0V A;  3EAB A;  3UUL A;  3UQ7 A;  3DP7 A;  3NRY A;  4CXW A;  1HNW T;  1D1A A;  2VB6 A;  5CJ5 A;  4KUM B;  4A56 A;  3BQL A;  1BR1 A;  3FBL A;  4JEH B;  3VRB A;  5GON E;  5JVD E;  5LGN B;  4AKG A;  1N34 T;  3VR8 A;  2XAQ B;  4H63 V;  2EHO D;  2XAG B;  3GN5 A;  3ZCJ A;  3UUM A;  1IBL T;  3ZMZ B;  3UUX B;  4B3T T;  3O1J A;  5JDF A;  4LF9 T;  2Q9Q A;  2BDE A;  3FXD B;  1NEK A;  3GWH A;  5AQT B;  2CEA A;  3ZYK A;  1MMG A;  5AQL B;  2DCF A;  2LEH A;  2UUC T;  3N9M A;  5ABE A;  4JEU B;  4KI0 F;  1YXR A;  4LML A;  5F5W A;  3C50 A;  1W09 A;  3GN5 B;  3C4X A;  1UUS A;  3PUZ F;  2LJL A;  4IDP A;  5AQH B;  4LMJ A;  2EHO A;  2FJA A;  4IST A;  5HEH A;  3WI3 A;  5ABF A;  2C5I T;  2KLQ A;  4IE6 A;  1FIO A;  1QUU A;  2E5L T;  3ZJ2 A;  4CXY A;  2Q9Q D;  4TN7 B;  4PNI A;  4WBO A;  4MBQ A;  2DHR A;  1M62 A;  4HFD A;  4O4I E;  5H6Q B;  3K8P C;  2L3L A;  5L2L A;  5LBM A;  3X1D A;  3LBX A;  4KMC A;  3VRA A;  4ZI3 D;  2CWY A;  3AAI A;  3O4X E;  2Z6E A;  5HXR A;  1LVF A;  3AEC A;  3I0Q A;  3RQU A;  4QH5 A;  4DR1 T;  3JAD A;  3VR9 A;  4P09 A;  3VU7 H;  4O2A E;  2AE9 A;  4TV8 E;  1YKE B;  1OED A;  1Y01 A;  5AQR B;  3FZF B;  1B7T A;  1V9D A;  3PE0 A;  5HWY A;  2XAF B;  2KND A;  4HWI B;  5LOV E;  1IZN B;  2KMF A;  2B1E A;  2H7V C;  3A5X A;  3PUG A;  4HFI A;  5L4E A;  3RYC E;  3J7Y q;  4QH1 A;  4JV5 T;  3HR0 A;  4O4H E;  1ZV4 X;  5LNK A;  1T7S A;  2DWK A;  3HKD E;  2LSK A;  2FUP A;  2MOZ A;  2XQY A;  2A3D A;  4IL9 A;  5F8P A;  3SRZ A;  4AQG A;  3PUA A;  4X5T A;  2VK9 A;  4JI8 T;  3ETU A;  2MAW A;  5H6R B;  1E2A A;  2PG8 A;  2PJQ A;  2K9A A;  3UFE A;  4AKL A;  4AKI A;  3PTR B;  4IDN A;  1HG2 A;  2VKO A;  3IA3 A;  4YJ3 E;  3RC8 A;  2J1D G;  2H88 A;  4Z8X A;  2V7I A;  2ZM8 A;  3NWI A;  5L3F B;  1D1C A;  1I94 T;  3IBP A;  4LFA T;  2LSY A;  2KWH A;  3E22 E;  5JH7 E;  2WWU A;  1E1H B;  3A8Y C;  4NIQ A;  3SFE A;  5L3E B;  5M4Y A;  3MAC A;  2F4V T;  2IC9 A;  2KIN B;  2WDV A;  4YSY A;  5LB7 B;  1SA0 E;  4IDQ A;  2ZMA A;  2BG9 C;  3Q9D A;  4O4J E;  4AQF C;  2EHO B;  2W2U A;  4EYU A;  3LK3 B;  4EIW A;  5JR9 B;  3RYF E;  4B6X A;  2JJ9 A;  2W00 A;  3K3N A;  3HKB E;  3N9Q A;  5J1G A;  3ZYL A;  4YTN A;  2V1D B;  3LSV A;  3Q5E A;  3U3I A;  3QB5 K;  1HF8 A;  3EUH A;  4BJN A;  1IBK T;  2UXC T;  4DR4 T;  4JI3 T;  3VKG A;  2E2A A;  3ETV A;  1BR4 A;  3SS1 A;  5FMN A;  5HYA A;  2VVN A;  2LM2 A;  3L3P A;  3NKZ A;  2PFV A;  4IE5 A;  5AFU L;  2CLY B;  4JBW F;  4K0U A;  4UIG A;  1IAP A;  5JQG E;  5JRE A;  1HX8 A;  4H9P C;  3AEB A;  5J2U E;  3RKO A;  2X9X A;  3AE3 A;  2LRL A;  2YDQ A;  3DTO A;  2KSR A;  3FZK B;  4I55 E;  4IDZ A;  3ESL A;  5FXV A;  3U78 A;  3CX6 B;  3MXZ A;  3QK6 A;  2IML A;  2UXB T;  3AED A;  3GA8 A;  3AEG A;  4ZI2 C;  1N33 T;  2CBJ A;  2XPK A;  3AXJ B;  2K3W A;  4HFE A;  3FZM B;  3JC6 C;  5LA6 E;  4UR9 A;  2NW8 A;  3SFD A;  3R6N A;  3TLS A;  4AKH A;  4U33 A;  2BVL A;  2YU1 A;  5HCM A;  3AAA B;  1KEY A;  3CML A;  4PJJ A;  5JR9 A;  2YEV C;  3RIU A;  1EZ3 A;  3KV9 A;  2V5C A;  2BZB A;  4BA9 A;  3ZMU B;  4DV3 T;  4ZI7 E;  5JRC A;  1D1B A;  1FEW A;  3CWZ B;  4OYK A;  4EED A;  2N9D A;  4LF5 T;  3AB3 B;  5IHY A;  5AQP B;  5C8Y E;  4YHH T;  4IDO A;  4Z91 A;  2K5B B;  3CQG B;  3V5S A;  2KXP B;  3I1A A;  5L3G B;  3O1H A;  2JQ9 A;  1X9B A;  3LK4 2;  1ZP0 A;  2JIW A;  2YN6 A;  5EK4 A;  3ZT6 A;  2WP9 A;  3CX8 B;  5IWA T;  4DV1 T;  2HH7 A;  4X1I E;  2VUR A; 
#chains in the Genus database with same CATH homology
 2MPK A;  2LRK A;  3K1S A;  2V6Y A;  2LRL A;  5FVL A;  4U2Y A;  2WY2 A;  4IT4 A;  4NIQ A;  4U3C A;  2DL1 A;  1WR0 A;  3ZST A;  4CN4 A;  5LB7 B;  4A5X A;  2K3W A;  4U2Z A;  4WZX A;  3ZT7 A;  5CGM A;  2W2U A;  4U33 A;  3ZSS A;  2V6Y B;  2JQK A;  3ZT5 A;  5FVK A;  2CRB A;  4U7Y A;  2WWV A;  1YXR A;  4CN6 A;  4CN1 A;  4ZEY A;  2JQH A;  2XZE A;  2A9U A;  4U31 A;  2RPA A;  2CPT A;  2V6X A;  4P1N A;  4U7I A;  2JQ9 A;  1WFD A;  3ZT6 A;  3EAB A;  5CJ5 A;  1WCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...