2LRKA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
b'AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphocarrier protein HPr
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 39
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrkA00
4U2ZA 2JQ9A 1WCRA 4CN4A 2V6YA 4U7YA 5CGMA 3ZT5A 3ZSSA 4IT4A 2DL1A 4U3CA 1WFDA 3ZT6A 2A9UA 2LRLA 5FVLA 2WY2A 4WZXA 4A5XA 5FVKA 2CRBA 5LB7B 2JQKA 2V6YB 4NIQA 2XZEA 3ZSTA 1YXRA 4U33A 2CPTA 2W2UA 2V6XA 1WR0A 4U2YA 4U31A 2LRKA 3K1SA 2K3WA 3ZT7A 2RPAA 2WWVA 4CN1A 3EABA 2MPKA 4CN6A 4U7IA 4ZEYA 5CJ5A 4P1NA 2JQHA
chains in the Genus database with same CATH superfamily
5FKYA 3FZLB 4AKIA 3PV0F 5LOVE 5L3FB 1MIWA 3RGLA 3ZMTB 1NENA 3RRCA 4PNIA 1WRDA 4ZI2C 3CQXC 4CQIA 2L9QA 1J1JA 2WB5A 2LSYA 5JDFA 2V7IA 2XQ7A 3MJXA 1M62A 5EZYE 1W0AA 3PUWF 4MBQA 4HWHA 4A56A 3ETUA 4IDNA 2XAJB 1QUUA 3AE9A 1MIYA 4LF4T 2DWGA 5LHGB 3I0QA 2VQFT 1NEKA 3C4XA 4DV1T 3P50A 5HXSA 2UXCT 1HFAA 5ABFA 3UU4A 2MBGA 1WCRA 2EHOB 2BBJA 2LSIA 2X9XA 4O4JE 3LG7A 2V1DB 2V26A 1D1BA 3C4ZA 2ZMAA 4EEDA 4X1KE 5AQQB 3DTOA 4UV8B 2VVSA 3OYZA 4EOZB 1LVFA 3P4SA 2YK0A 2CXFA 4AQGA 4QH1A 4DIDB 1HNZT 4IL4A 2E9XD 2CXDA 2NW9A 3AE8A 3L09A 3F2EA 4TUYE 2Y8DA 3AB3B 1XMQT 2LKGA 3PUQA 4I50E 3UT5E 2WP9A 2NTXA 1X79A 2D0TA 4DV4T 4AISA 3PDYA 4N78D 4UF0A 2VL0A 1JNRA 2WSSV 3JADA 2BDEA 4EYYR 2D2SA 2CRBA 1OWAA 3N2GE 4XBFB 1MMGA 5JDHA 5DJQC 4EZHA 1V9DA 2XQ3A 4E7ZA 2JRKA 4GK5E 2A2FX 4G63A 3SFDA 4HFCA 1CUNA 1J5WA 3AEEA 4IIJE 1HX8A 1D0YA 3VHLA 4AQFC 3LK3B 3RLFF 4HFHA 4IREA 1OXZA 1WR6A 2DWKA 4L9IA 4OYKA 4MFRA 5CA1E 4U72A 1B7TA 4C91A 5FVKA 2HPJA 5LB7B 2NR4A 3QB5A 3G06A 1BR2A 4WYVA 3KV4A 4YSYA 4DV5T 3A8YC 1YQ4A 3GA8A 3C51A 2CCQA 4X20E 4B6XA 4DR1T 2V6YA 2KSRA 2LEHA 2VASA 4DMWA 5EK3A 2KT9A 4AQFA 5H6RB 4X65T 3HR0A 4WZXA 2V7LA 3N9NA 5FXXA 4DV2T 4B3TT 2I59A 2CMRA 3N9LA 3NRYA 2BVLA 2ODVA 2K5BB 2Y48B 3EVYA 3FHNA 4IDPA 4HWFA 3QOFA 3QB5K 1WFDA 4YTNA 4F6RC 4QHOA 2VQET 3UUXB 3AE4A 5GONE 4HWIB 2IIUA 3KFWX 2N1GA 2W62A 1BR0A 5H6QB 2LHRA 1IAPA 2Q9QB 2ES0A 3NZQA 3OTOT 2JPFA 4EAHA 3N9QA 4EZ4A 5AQGB 2M6BA 1HG2A 1UURA 2X51A 5HEUA 2WWUA 3E08A 4EIWA 3UFEA 5JDLA 3ZT6A 3BQKA 2XQ6A 2QRXA 4JEUB 4GOUA 2CE7A 2VVNA 3RQUA 2XJ7A 2WU2A 1U5PA 1US7B 5JDQA 3VU7H 4UR9A 2WAUA 1T72A 2ZLYA 4CI3B 3KV9A 1KEYA 4JBWF 3ZJ2A 4XAXB 2J1DG 3CQGB 1SUMB 4B3ST 4LMJA 2WU5A 2IDOB 4ANJA 2QGSA 1W0BA 2WZHA 2SPCA 2IHR1 1Y64B 5AQIB 5CB4E 4LF5T 4H63V 3EHZA 4H9NC 4YHHT 5BR8T 4HWDA 3ZCJA 5ABFB 1D1AA 2WY2A 1LKXA 5FMNA 2JQKA 2CM0A 4JI8T 4GKKT 1Z0PA 1UX4A 3RI5A 4KHPT 1SE7A 3VRAA 4UXNB 5L4EA 5AQPB 1G73A 2E5VA 4WNKA 4A5XA 2G0UA 4EGWA 1OEDB 4TNWA 3HKEE 1D0ZA 4COFA 3UU5A 2VKDA 3AEGA 4CXWA 2J4GA 1GQEA 4ZOLE 2H88A 5LBMA 4GYRA 2X0YA 2XQAA 3EDUA 2PFVA 2LRKA 2LJLA 2V5DA 2XQ9A 3Q5EA 4OX9T 4ZXLA 2PTFA 2VWAA 3MACA 4BAYB 4DUZT 4TWFA 1ZP0A 3LJCA 5HYAA 5LA6E 3N9PA 4ZEYA 2NWBA 2KWHA 4DV3T 1YKEB 2NW7A 5FXWA 3U3IA 5AQVB 3MZKB 3KBTA 1ZKEA 5AQTB 1Z8UA 5JH7E 2F4VT 2ACXA 2YU2A 2RA1A 2LT3A 5CFBA 3CK6A 1WLXA 4ZI3C 4IGUA 4X66T 5AQNB 5AQSB 5LBQB 5AQJB 2C0SA 4TV9E 4BJNA 5L4HA 2K48A 3SRZA 1UUSA 3JC6C 3HKDE 2V6YB 2B1EA 3AEBA 3J7Yq 4ZI2D 2N2NA 3GN5B 5FXVA 3TLVA 2KXPB 1UK5A 2YEVC 5HXRA 5LXTE 1YD8G 1E7PA 4IDZA 3ZPOA 2W67A 4U7YA 2ZM0A 3ANWA 4ISSA 5FP3A 5ADXL 1HS7A 4DUYT 3AAAB 3CKDA 3SOLA 4LFBT 3FZHB 2UXXB 4HN9A 2A72A 3RKGA 4NXNT 4PJJA 5CGMA 3ZSSA 4H9QC 3RH3A 5HXEA 5HXHA 3NVOA 3SFEA 2X0HA 3ZYMA 3ZN0B 3DJBA 1HNXT 3TLUA 4DO0A 4CN1A 3JCFA 5AQFB 2B76A 4ILBA 2FJBA 4ADZA 4JV5T 4JYAT 3LBXA 4H9OC 4YXDA 5AQLB 3QUJA 2NP9A 3FBLA 1N33T 3ZKRA 4EXTA 1WR0A 2CEAA 2UUCT 3CMLA 3E0ZA 4OK0A 4PJLA 2AE9A 4O2BE 4QXBB 4NUUA 2V8SV 4ZHQE 3X1DA 4WW0A 4LMLA 2YDSA 3KINB 3W15B 4JI3T 3N9OA 4WBOA 4JI4T 2KNDA 3MKDA 2IW5B 4X1YE 5J0ZA 4PK6A 5HCMA 4A97A 2UUBT 3IBPA 4WBNE 4YSZA 2H3RA 4HFVA 4AQYT 3KVBA 4X64T 4P09A 5LMNT 5IUXA 5L3BB 3AVRA 2BG9E 2W66A 5AQRB 2VKHA 4CXXA 4EV6A 3ONLC 2ZM8A 4TZ4C 2PG8A 4JI0T 5JRCA 2NOXA 3P8CD 5FL1A 1HR0T 4TNVA 5L3EB 3CIRA 4TV8E 2L3LA 1YW0A 3ZLIA 3K1SA 4LFAT 3Q5XA 2N9DA 1D0XA 3AECA 2K9AA 3AE3A 4OFZA 2XAQB 2CXLA 3E22E 3AE7A 4BA9A 3ESLA 3I9YA 2YN6A 3PUXF 4I55E 4B3MT 1YKHB 2JQHA 3KV5A 2OLTA 4G2AA 5JVDE 3AE1A 4JUYA 4DMVA 3ZCIA 1MMNA 3AE2A 5JDNA 3LK2B 1MMDA 4JI1T 3ZMVB 5TAOA 3O9XA 4O2AE 5JDMA 3M3ZB 2BS2A 4FI5A 3T8OA 4QWNB 1IZNB 3OYXA 1XNQT 1NAFA 3ETVA 4GK0E 3ZYKA 5LJMA 1ZHCA 2NW8A 4PFPA 1MMAA 2NTYA 3O1IA 2PBIA 5ABGA 2WDQA 2JIWA 3ZMZB 3SWHA 4U33A 5C8YE 4TN7B 5HWXA 1S94A 4ERRA 2X0LB 2K3WA 2WS3A 3ZYLA 4KHZF 4F8HA 2LSJA 3MA9A 2KMFA 2KLQA 3U78A 2QA7A 2C5JA 3Q5DA 3UQ4A 4AKRB 2CHOA 3HI2A 2RP4A 3N5LA 4QX7B 5IYZE 2W63A 4X62T 1MNDA 3HKCE 3A5XA 4DR5T 4OHFA 1S35A 3EDVA 2LM2A 2DHRA 4EEBA 3LDQB 2XAGB 5AQUB 3RYCE 1O3XA 5LYJE 2X68A 2VURA 3M65A 3UU6A 3OKQA 4ZZBA 5AQOB 3IF8B 2BS4A 4E7SA 2XSAA 1IBKT 4H9RC 1FEWA 1XDPA 2YU1A 2ACZA 2KWIB 3NBXX 1T98A 2BG9C 1LVKA 2I6HA 4PJMA 2IC6A 4YJ2E 5FXZA 2LE8A 3R6NA 3LK42 4JEHB 1HX1B 2CWYA 4K0UA 4YSXA 4U31A 4P0BA 2CHNA 3R84B 1X9BA 4I43B 2KINB 2JQQA 2CLYB 2EHOC 3BK9A 5L3DB 4YT0A 1HCIA 3A7MA 2P9BA 2BS3A 3RPUA 2A9UA 2FJAA 3CPZA 1IJ6A 3OPCA 4CI1B 2C5KT 3H3AA 2UXBT 2BG9A 2BKPA 4ILCA 2X9YA 3AVSA 2Y6XA 3EAMA 2XQ5A 3FZKB 5IHYA 4DR6T 3PUVF 3K3OA 2WQYA 1WYBA 3CWZB 5FYMA 2QYWA 4KMCA 1YXRA 5FNVE 1IBMT 2V6XA 4AKGA 2EHOA 4PW8A 3PU8A 4EB6E 4IHJE 4Z90A 3UUNA 1FJGT 2J62A 3Q2MA 2A3DA 3F31A 1Y01A 4NUVA 3WI3A 1KNRA 4DV6T 3AA0B 3P4QA 4ZS3A 3TLSA 3C98B 2WMNA 2DNXA 3ZT5A 5JR9C 2E5LT 3WAJA 2X9HA 1QSDA 1DU2A 5C2TA 2XUEA 5J1GA 3K3QC 5LGUB 1HF8A 3MXZA 3EI0A 4DBRA 5DABA 2IAKA 1KF6A 2ZM2A 4QXHB 2UXDT 1W9RA 5HAXA 4H63H 3TLTA 2K24A 3K3NA 5FY7A 4YLHA 2DLRA 1KNPA 3ZSTA 1XZYA 4ZI3D 4UF0B 5JR9A 3Q9DA 3VKHA 2V7MA 3LFMA 4K0KT 5J2UE 3AE5A 2CBIA 2JQ9A 3C64A 3N2KE 1AJ3A 4AI6A 2V7JA 3HL6A 5BMVE 3JC6D 4QH5A 3UQ7A 4CXYA 1XMOT 4O4LE 2HPLA 2H7VC 4C90A 1EZ3A 2VL8A 2WWVA 4U7IA 2UXNB 3PE0A 4PAGA 4KBMB 4LFCT 3V5SA 1KFYA 4U3CA 1ZV4X 4IDQA 4UEMA 3OVUA 2GK9A 2V5CA 5HEJA 2I0MA 2H89A 4IE6A 3IEEA 3WAKA 4UELA 2YDQA 5KMGP 3OBVE 1BR1A 3VRBA 2Q9QC 3NKZA 1VCSA 2L8KA 4L0RA 4NIQA 4GIWA 3P4WA 2BBHA 3OJAA 2BKOA 3NWIA 3RC8A 1VOMA 4DNDA 4P0AA 4DVDA 3RF1A 2VB6A 1CHUA 2M6IA 3MK7C 3FZMB 3PU3A 2VKOA 2ODUA 3AXJA 2Q9QA 4MLKA 1HTJF 4QH4A 5DQVA 2YOEA 3FBZA 4O4HE 2FUPA 4HGAA 4HFBA 4Z8XA 4AXPA 3ZC0A 2X9WA 3ONJA 4KI0F 4UVCB 2LOSA 3L8RA 3O1JA 4JI2T 3DP7A 2DI4A 5JQGE 4O8SA 2R6GF 3RIUA 3ZJ1A 1UX5A 1VRBA 2XM1A 5AQMB 4M1PA 3FXEB 4UVAB 4CN6A 3PUZF 2QVAA 2WCAA 5FY0A 4U2ZA 3HA4A 3I0OA 4IE4A 2E8IA 3L39A 4UV9B 4J2CA 5LG4A 3PUSA 4HTEA 2DCFA 4PFOA 1ZEEA 2Z6EA 4Q25A 3C50A 3BQIA 3AAEB 2YINA 2M67A 4JI6T 4CI2B 4DR4T 5CA0E 4LF7T 4O4IE 2BG9B 4DBQA 4X1IE 1OEDC 4YJ3E 2E2AA 1YQ3A 2XAHB 2YKSA 4I0UA 2CA5A 5CJ5A 4LMKA 5HCJA 2YDRA 4IT4A 4A98A 4TWDA 4MHCA 3UUMA 1XDOA 4HE8A 1VCTA 3JAFA 4IE7A 5L47A 3RIAA 3AEFA 1N32T 1OEDA 5ABEA 3GMIA 5C3JA 2FJDA 3C4WA 1N34T 4UIGA 4NXMT 4HWCA 2MOZA 2CWOA 3B57A 5LG3A 2W2UA 4ASKA 1UCUA 4UVBB 3ZT7A 4JLEA 2HN1A 5A1LA 2WMOA 1E2AA 3P4PA 3I9WA 3ZMUB 4HFEA 5KXJA 5FVLA 3KDSE 1XWMA 3T1HT 2OA5A 1SHZC 3TKLB 3AE6A 2WDVA 1HG5A 2XQ8A 3CQCB 3KV6A 2E9XC 1H7CA 2VK9A 2XAFB 5JR9B 3RIFA 3RHWA 3UFGA 5L2LA 2CBJA 4YFSA 3F57A 4JI7T 4AKLA 3AA1B 3IA3A 1KK7A 2RPAA 4ZS2A 3AAIA 3TLWA 4I4TE 3ONXA 4YTPA 3RX6A 4U74A 4BJMA 3O4XE 5L3CB 4PK4A 4DV7T 4L5GA 2BVMA 2AXDS 2E9XA 1J5ET 5KX5E 3O1HA 5LCYA 2JMHA 1I6ZA 5HEOA 3S4UA 3GN5A 5F5WA 4MALA 3KBUA 2J47A 4XZCA 3UU8A 2LOPA 2LSGA 3NZPA 4ZI7E 2V7KA 4OYJA 1NWMX 5L3GB 3ZN1B 4H9SE 4PK5A 1R8IA 2WBLA 5LGNB 2BZBA 2EHOD 3UU3A 4DV0T 3PUYF 3KVAA 3GWHA 2UU9T 5LMUT 2MTQA 3RQWA 3ANWB 2KZ7B 3N2OA 3EABA 4PJNA 3VR8A 3EUHA 5EK2A 5LHHB 5LP6E 1MIVA 1D1CA 2D5UA 3AXJB 4Z91A 3B13A 2XHEB 1T7SA 4AKHA 4HKAA 4U2YA 1ZOYA 5LJNA 2LLYA 3RYFE 3UUBA 3J9X1 2FJEA 4IE5A 1QLBA 4KUMB 4QX8B 2XPKA 2H7OA 4DR3T 4B3RT 3B5MA 2XQYA 3LBXB 5ABHA 3BQLA 4IDOA 5F3JA 2W4XA 1LRZA 1U4QA 3CX6B 2XASB 3RC3A 2XY8B 4YY3T 2LSKA 3AA6B 3V5UA 4P1NA 3ZEFB 1G8XA 4JI5T 3T1YT 4YTMA 2JMKA 3FZFB 2OV9A 3CVRA 3VR9A 5ETWA 2WDRA 3IHRA 5J2TE 3P4RA 3HKBE 2MPKA 1IBLT 4FJOA 2FBWA 5KDMC 5LNKA 3CX8B 1HNWT 3H3MA 3LSVA 2WM9A 3SS1A 2JJ9A 2D9DA 4ZZCA 4GKJT 2MAWA 4H9PC 1MNEA 4ISTA 3K8PC 2HH7A 2X66A 3D0TA 5F8PA 5M4YA 1I94T 3UTKA 3RYIE 5JRCB 5EK4A 5AQKB 2XTLA 3RKOA 2PJQA 3H37A 2D0UA 2LM9A 1T8BA 4IE0A 3PURA 3P7IA 2W61A 2ZM6T 5HWYA 4DR2T 1N36T 2IMLA 2LKHA 1W09A 3QNUA 3NRXA 2LHNA 2XQ4A 4NPPA 1OEDE 5JREA 5E0OA 4IL9A 3QC9A 2Q9QD 1WYCA 2XSBA 3FB2A 3Q5WA 4DR7T 3I1AA 3JAEA 4ILUA 4TX5A 4CN4A 3PUAA 5JDGA 4HFIA 4LF8T 2C5IT 3ZMSB 5HEHA 2XM2A 3ABVA 3PTRB 5FL0A 3PJAA 4EYUA 1E1HB 5LHIB 2UUAT 2VKJA 3PJAJ 4GYSA 4HFDA 2IUBA 2LRLA 4ILAA 3FXDB 1UGOA 3RYHE 1XNRT 1SA0E 2CPTA 2X67A 1BR4A 1FMVA 5HXCA 4LF9T 3QK6A 2WZIA 2MYSA 1IJ5A 3AEDA 3ZC1A 1L0VA 5HEGA 5AFUL 3AA7B 2IC9A 2E9XB 2DL1A 4HEAA 3VKGA 4YHJA 4KP3C 4X5TA 5DQWA 2XZEA 5AQHB 4QXCB 1JNZA 5LGTB 5FY1A 2CLYC 3RRWA 3UULA 2BKNA 2HHHT 3RIUC 4AIUA 3AEAA 1KNZA 1FMWA 4KX6A 3PUGA 4V1Av 5IWAT 4LF6T 4TWHA 2HN2A 5JTGA 4QKNA 4CZZB 2W00A 3L3PA 1FIOA 2W0GA 3CX7B 3N9MA 1M7KA
chains in the Genus database with same CATH topology
4U2ZA 2JQ9A 1WCRA 4CN4A 2V6YA 4U7YA 5CGMA 3ZT5A 3ZSSA 4IT4A 2DL1A 4U3CA 1WFDA 3ZT6A 2A9UA 2LRLA 5FVLA 2WY2A 4WZXA 4A5XA 5FVKA 2CRBA 5LB7B 2JQKA 2V6YB 4NIQA 2XZEA 3ZSTA 1YXRA 4U33A 2CPTA 2W2UA 2V6XA 1WR0A 4U2YA 4U31A 2LRKA 3K1SA 2K3WA 3ZT7A 2RPAA 2WWVA 4CN1A 3EABA 2MPKA 4CN6A 4U7IA 4ZEYA 5CJ5A 4P1NA 2JQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U2Z A;  2JQ9 A;  1WCR A;  4CN4 A;  2V6Y A;  4U7Y A;  5CGM A;  3ZT5 A;  3ZSS A;  4IT4 A;  2DL1 A;  4U3C A;  1WFD A;  3ZT6 A;  2A9U A;  2LRL A;  5FVL A;  2WY2 A;  4WZX A;  4A5X A;  5FVK A;  2CRB A;  5LB7 B;  2JQK A;  2V6Y B;  4NIQ A;  2XZE A;  3ZST A;  1YXR A;  4U33 A;  2CPT A;  2W2U A;  2V6X A;  1WR0 A;  4U2Y A;  4U31 A;  2LRK A;  3K1S A;  2K3W A;  3ZT7 A;  2RPA A;  2WWV A;  4CN1 A;  3EAB A;  2MPK A;  4CN6 A;  4U7I A;  4ZEY A;  5CJ5 A;  4P1N A;  2JQH A; 
#chains in the Genus database with same CATH topology
 5FKY A;  3FZL B;  4AKI A;  3PV0 F;  5LOV E;  5L3F B;  1MIW A;  3RGL A;  3ZMT B;  1NEN A;  3RRC A;  4PNI A;  1WRD A;  4ZI2 C;  3CQX C;  4CQI A;  2L9Q A;  1J1J A;  2WB5 A;  2LSY A;  5JDF A;  2V7I A;  2XQ7 A;  3MJX A;  1M62 A;  5EZY E;  1W0A A;  3PUW F;  4MBQ A;  4HWH A;  4A56 A;  3ETU A;  4IDN A;  2XAJ B;  1QUU A;  3AE9 A;  1MIY A;  4LF4 T;  2DWG A;  5LHG B;  3I0Q A;  2VQF T;  1NEK A;  3C4X A;  4DV1 T;  3P50 A;  5HXS A;  2UXC T;  1HFA A;  5ABF A;  3UU4 A;  2MBG A;  1WCR A;  2EHO B;  2BBJ A;  2LSI A;  2X9X A;  4O4J E;  3LG7 A;  2V1D B;  2V26 A;  1D1B A;  3C4Z A;  2ZMA A;  4EED A;  4X1K E;  5AQQ B;  3DTO A;  4UV8 B;  2VVS A;  3OYZ A;  4EOZ B;  1LVF A;  3P4S A;  2YK0 A;  2CXF A;  4AQG A;  4QH1 A;  4DID B;  1HNZ T;  4IL4 A;  2E9X D;  2CXD A;  2NW9 A;  3AE8 A;  3L09 A;  3F2E A;  4TUY E;  2Y8D A;  3AB3 B;  1XMQ T;  2LKG A;  3PUQ A;  4I50 E;  3UT5 E;  2WP9 A;  2NTX A;  1X79 A;  2D0T A;  4DV4 T;  4AIS A;  3PDY A;  4N78 D;  4UF0 A;  2VL0 A;  1JNR A;  2WSS V;  3JAD A;  2BDE A;  4EYY R;  2D2S A;  2CRB A;  1OWA A;  3N2G E;  4XBF B;  1MMG A;  5JDH A;  5DJQ C;  4EZH A;  1V9D A;  2XQ3 A;  4E7Z A;  2JRK A;  4GK5 E;  2A2F X;  4G63 A;  3SFD A;  4HFC A;  1CUN A;  1J5W A;  3AEE A;  4IIJ E;  1HX8 A;  1D0Y A;  3VHL A;  4AQF C;  3LK3 B;  3RLF F;  4HFH A;  4IRE A;  1OXZ A;  1WR6 A;  2DWK A;  4L9I A;  4OYK A;  4MFR A;  5CA1 E;  4U72 A;  1B7T A;  4C91 A;  5FVK A;  2HPJ A;  5LB7 B;  2NR4 A;  3QB5 A;  3G06 A;  1BR2 A;  4WYV A;  3KV4 A;  4YSY A;  4DV5 T;  3A8Y C;  1YQ4 A;  3GA8 A;  3C51 A;  2CCQ A;  4X20 E;  4B6X A;  4DR1 T;  2V6Y A;  2KSR A;  2LEH A;  2VAS A;  4DMW A;  5EK3 A;  2KT9 A;  4AQF A;  5H6R B;  4X65 T;  3HR0 A;  4WZX A;  2V7L A;  3N9N A;  5FXX A;  4DV2 T;  4B3T T;  2I59 A;  2CMR A;  3N9L A;  3NRY A;  2BVL A;  2ODV A;  2K5B B;  2Y48 B;  3EVY A;  3FHN A;  4IDP A;  4HWF A;  3QOF A;  3QB5 K;  1WFD A;  4YTN A;  4F6R C;  4QHO A;  2VQE T;  3UUX B;  3AE4 A;  5GON E;  4HWI B;  2IIU A;  3KFW X;  2N1G A;  2W62 A;  1BR0 A;  5H6Q B;  2LHR A;  1IAP A;  2Q9Q B;  2ES0 A;  3NZQ A;  3OTO T;  2JPF A;  4EAH A;  3N9Q A;  4EZ4 A;  5AQG B;  2M6B A;  1HG2 A;  1UUR A;  2X51 A;  5HEU A;  2WWU A;  3E08 A;  4EIW A;  3UFE A;  5JDL A;  3ZT6 A;  3BQK A;  2XQ6 A;  2QRX A;  4JEU B;  4GOU A;  2CE7 A;  2VVN A;  3RQU A;  2XJ7 A;  2WU2 A;  1U5P A;  1US7 B;  5JDQ A;  3VU7 H;  4UR9 A;  2WAU A;  1T72 A;  2ZLY A;  4CI3 B;  3KV9 A;  1KEY A;  4JBW F;  3ZJ2 A;  4XAX B;  2J1D G;  3CQG B;  1SUM B;  4B3S T;  4LMJ A;  2WU5 A;  2IDO B;  4ANJ A;  2QGS A;  1W0B A;  2WZH A;  2SPC A;  2IHR 1;  1Y64 B;  5AQI B;  5CB4 E;  4LF5 T;  4H63 V;  3EHZ A;  4H9N C;  4YHH T;  5BR8 T;  4HWD A;  3ZCJ A;  5ABF B;  1D1A A;  2WY2 A;  1LKX A;  5FMN A;  2JQK A;  2CM0 A;  4JI8 T;  4GKK T;  1Z0P A;  1UX4 A;  3RI5 A;  4KHP T;  1SE7 A;  3VRA A;  4UXN B;  5L4E A;  5AQP B;  1G73 A;  2E5V A;  4WNK A;  4A5X A;  2G0U A;  4EGW A;  1OED B;  4TNW A;  3HKE E;  1D0Z A;  4COF A;  3UU5 A;  2VKD A;  3AEG A;  4CXW A;  2J4G A;  1GQE A;  4ZOL E;  2H88 A;  5LBM A;  4GYR A;  2X0Y A;  2XQA A;  3EDU A;  2PFV A;  2LRK A;  2LJL A;  2V5D A;  2XQ9 A;  3Q5E A;  4OX9 T;  4ZXL A;  2PTF A;  2VWA A;  3MAC A;  4BAY B;  4DUZ T;  4TWF A;  1ZP0 A;  3LJC A;  5HYA A;  5LA6 E;  3N9P A;  4ZEY A;  2NWB A;  2KWH A;  4DV3 T;  1YKE B;  2NW7 A;  5FXW A;  3U3I A;  5AQV B;  3MZK B;  3KBT A;  1ZKE A;  5AQT B;  1Z8U A;  5JH7 E;  2F4V T;  2ACX A;  2YU2 A;  2RA1 A;  2LT3 A;  5CFB A;  3CK6 A;  1WLX A;  4ZI3 C;  4IGU A;  4X66 T;  5AQN B;  5AQS B;  5LBQ B;  5AQJ B;  2C0S A;  4TV9 E;  4BJN A;  5L4H A;  2K48 A;  3SRZ A;  1UUS A;  3JC6 C;  3HKD E;  2V6Y B;  2B1E A;  3AEB A;  3J7Y q;  4ZI2 D;  2N2N A;  3GN5 B;  5FXV A;  3TLV A;  2KXP B;  1UK5 A;  2YEV C;  5HXR A;  5LXT E;  1YD8 G;  1E7P A;  4IDZ A;  3ZPO A;  2W67 A;  4U7Y A;  2ZM0 A;  3ANW A;  4ISS A;  5FP3 A;  5ADX L;  1HS7 A;  4DUY T;  3AAA B;  3CKD A;  3SOL A;  4LFB T;  3FZH B;  2UXX B;  4HN9 A;  2A72 A;  3RKG A;  4NXN T;  4PJJ A;  5CGM A;  3ZSS A;  4H9Q C;  3RH3 A;  5HXE A;  5HXH A;  3NVO A;  3SFE A;  2X0H A;  3ZYM A;  3ZN0 B;  3DJB A;  1HNX T;  3TLU A;  4DO0 A;  4CN1 A;  3JCF A;  5AQF B;  2B76 A;  4ILB A;  2FJB A;  4ADZ A;  4JV5 T;  4JYA T;  3LBX A;  4H9O C;  4YXD A;  5AQL B;  3QUJ A;  2NP9 A;  3FBL A;  1N33 T;  3ZKR A;  4EXT A;  1WR0 A;  2CEA A;  2UUC T;  3CML A;  3E0Z A;  4OK0 A;  4PJL A;  2AE9 A;  4O2B E;  4QXB B;  4NUU A;  2V8S V;  4ZHQ E;  3X1D A;  4WW0 A;  4LML A;  2YDS A;  3KIN B;  3W15 B;  4JI3 T;  3N9O A;  4WBO A;  4JI4 T;  2KND A;  3MKD A;  2IW5 B;  4X1Y E;  5J0Z A;  4PK6 A;  5HCM A;  4A97 A;  2UUB T;  3IBP A;  4WBN E;  4YSZ A;  2H3R A;  4HFV A;  4AQY T;  3KVB A;  4X64 T;  4P09 A;  5LMN T;  5IUX A;  5L3B B;  3AVR A;  2BG9 E;  2W66 A;  5AQR B;  2VKH A;  4CXX A;  4EV6 A;  3ONL C;  2ZM8 A;  4TZ4 C;  2PG8 A;  4JI0 T;  5JRC A;  2NOX A;  3P8C D;  5FL1 A;  1HR0 T;  4TNV A;  5L3E B;  3CIR A;  4TV8 E;  2L3L A;  1YW0 A;  3ZLI A;  3K1S A;  4LFA T;  3Q5X A;  2N9D A;  1D0X A;  3AEC A;  2K9A A;  3AE3 A;  4OFZ A;  2XAQ B;  2CXL A;  3E22 E;  3AE7 A;  4BA9 A;  3ESL A;  3I9Y A;  2YN6 A;  3PUX F;  4I55 E;  4B3M T;  1YKH B;  2JQH A;  3KV5 A;  2OLT A;  4G2A A;  5JVD E;  3AE1 A;  4JUY A;  4DMV A;  3ZCI A;  1MMN A;  3AE2 A;  5JDN A;  3LK2 B;  1MMD A;  4JI1 T;  3ZMV B;  5TAO A;  3O9X A;  4O2A E;  5JDM A;  3M3Z B;  2BS2 A;  4FI5 A;  3T8O A;  4QWN B;  1IZN B;  3OYX A;  1XNQ T;  1NAF A;  3ETV A;  4GK0 E;  3ZYK A;  5LJM A;  1ZHC A;  2NW8 A;  4PFP A;  1MMA A;  2NTY A;  3O1I A;  2PBI A;  5ABG A;  2WDQ A;  2JIW A;  3ZMZ B;  3SWH A;  4U33 A;  5C8Y E;  4TN7 B;  5HWX A;  1S94 A;  4ERR A;  2X0L B;  2K3W A;  2WS3 A;  3ZYL A;  4KHZ F;  4F8H A;  2LSJ A;  3MA9 A;  2KMF A;  2KLQ A;  3U78 A;  2QA7 A;  2C5J A;  3Q5D A;  3UQ4 A;  4AKR B;  2CHO A;  3HI2 A;  2RP4 A;  3N5L A;  4QX7 B;  5IYZ E;  2W63 A;  4X62 T;  1MND A;  3HKC E;  3A5X A;  4DR5 T;  4OHF A;  1S35 A;  3EDV A;  2LM2 A;  2DHR A;  4EEB A;  3LDQ B;  2XAG B;  5AQU B;  3RYC E;  1O3X A;  5LYJ E;  2X68 A;  2VUR A;  3M65 A;  3UU6 A;  3OKQ A;  4ZZB A;  5AQO B;  3IF8 B;  2BS4 A;  4E7S A;  2XSA A;  1IBK T;  4H9R C;  1FEW A;  1XDP A;  2YU1 A;  2ACZ A;  2KWI B;  3NBX X;  1T98 A;  2BG9 C;  1LVK A;  2I6H A;  4PJM A;  2IC6 A;  4YJ2 E;  5FXZ A;  2LE8 A;  3R6N A;  3LK4 2;  4JEH B;  1HX1 B;  2CWY A;  4K0U A;  4YSX A;  4U31 A;  4P0B A;  2CHN A;  3R84 B;  1X9B A;  4I43 B;  2KIN B;  2JQQ A;  2CLY B;  2EHO C;  3BK9 A;  5L3D B;  4YT0 A;  1HCI A;  3A7M A;  2P9B A;  2BS3 A;  3RPU A;  2A9U A;  2FJA A;  3CPZ A;  1IJ6 A;  3OPC A;  4CI1 B;  2C5K T;  3H3A A;  2UXB T;  2BG9 A;  2BKP A;  4ILC A;  2X9Y A;  3AVS A;  2Y6X A;  3EAM A;  2XQ5 A;  3FZK B;  5IHY A;  4DR6 T;  3PUV F;  3K3O A;  2WQY A;  1WYB A;  3CWZ B;  5FYM A;  2QYW A;  4KMC A;  1YXR A;  5FNV E;  1IBM T;  2V6X A;  4AKG A;  2EHO A;  4PW8 A;  3PU8 A;  4EB6 E;  4IHJ E;  4Z90 A;  3UUN A;  1FJG T;  2J62 A;  3Q2M A;  2A3D A;  3F31 A;  1Y01 A;  4NUV A;  3WI3 A;  1KNR A;  4DV6 T;  3AA0 B;  3P4Q A;  4ZS3 A;  3TLS A;  3C98 B;  2WMN A;  2DNX A;  3ZT5 A;  5JR9 C;  2E5L T;  3WAJ A;  2X9H A;  1QSD A;  1DU2 A;  5C2T A;  2XUE A;  5J1G A;  3K3Q C;  5LGU B;  1HF8 A;  3MXZ A;  3EI0 A;  4DBR A;  5DAB A;  2IAK A;  1KF6 A;  2ZM2 A;  4QXH B;  2UXD T;  1W9R A;  5HAX A;  4H63 H;  3TLT A;  2K24 A;  3K3N A;  5FY7 A;  4YLH A;  2DLR A;  1KNP A;  3ZST A;  1XZY A;  4ZI3 D;  4UF0 B;  5JR9 A;  3Q9D A;  3VKH A;  2V7M A;  3LFM A;  4K0K T;  5J2U E;  3AE5 A;  2CBI A;  2JQ9 A;  3C64 A;  3N2K E;  1AJ3 A;  4AI6 A;  2V7J A;  3HL6 A;  5BMV E;  3JC6 D;  4QH5 A;  3UQ7 A;  4CXY A;  1XMO T;  4O4L E;  2HPL A;  2H7V C;  4C90 A;  1EZ3 A;  2VL8 A;  2WWV A;  4U7I A;  2UXN B;  3PE0 A;  4PAG A;  4KBM B;  4LFC T;  3V5S A;  1KFY A;  4U3C A;  1ZV4 X;  4IDQ A;  4UEM A;  3OVU A;  2GK9 A;  2V5C A;  5HEJ A;  2I0M A;  2H89 A;  4IE6 A;  3IEE A;  3WAK A;  4UEL A;  2YDQ A;  5KMG P;  3OBV E;  1BR1 A;  3VRB A;  2Q9Q C;  3NKZ A;  1VCS A;  2L8K A;  4L0R A;  4NIQ A;  4GIW A;  3P4W A;  2BBH A;  3OJA A;  2BKO A;  3NWI A;  3RC8 A;  1VOM A;  4DND A;  4P0A A;  4DVD A;  3RF1 A;  2VB6 A;  1CHU A;  2M6I A;  3MK7 C;  3FZM B;  3PU3 A;  2VKO A;  2ODU A;  3AXJ A;  2Q9Q A;  4MLK A;  1HTJ F;  4QH4 A;  5DQV A;  2YOE A;  3FBZ A;  4O4H E;  2FUP A;  4HGA A;  4HFB A;  4Z8X A;  4AXP A;  3ZC0 A;  2X9W A;  3ONJ A;  4KI0 F;  4UVC B;  2LOS A;  3L8R A;  3O1J A;  4JI2 T;  3DP7 A;  2DI4 A;  5JQG E;  4O8S A;  2R6G F;  3RIU A;  3ZJ1 A;  1UX5 A;  1VRB A;  2XM1 A;  5AQM B;  4M1P A;  3FXE B;  4UVA B;  4CN6 A;  3PUZ F;  2QVA A;  2WCA A;  5FY0 A;  4U2Z A;  3HA4 A;  3I0O A;  4IE4 A;  2E8I A;  3L39 A;  4UV9 B;  4J2C A;  5LG4 A;  3PUS A;  4HTE A;  2DCF A;  4PFO A;  1ZEE A;  2Z6E A;  4Q25 A;  3C50 A;  3BQI A;  3AAE B;  2YIN A;  2M67 A;  4JI6 T;  4CI2 B;  4DR4 T;  5CA0 E;  4LF7 T;  4O4I E;  2BG9 B;  4DBQ A;  4X1I E;  1OED C;  4YJ3 E;  2E2A A;  1YQ3 A;  2XAH B;  2YKS A;  4I0U A;  2CA5 A;  5CJ5 A;  4LMK A;  5HCJ A;  2YDR A;  4IT4 A;  4A98 A;  4TWD A;  4MHC A;  3UUM A;  1XDO A;  4HE8 A;  1VCT A;  3JAF A;  4IE7 A;  5L47 A;  3RIA A;  3AEF A;  1N32 T;  1OED A;  5ABE A;  3GMI A;  5C3J A;  2FJD A;  3C4W A;  1N34 T;  4UIG A;  4NXM T;  4HWC A;  2MOZ A;  2CWO A;  3B57 A;  5LG3 A;  2W2U A;  4ASK A;  1UCU A;  4UVB B;  3ZT7 A;  4JLE A;  2HN1 A;  5A1L A;  2WMO A;  1E2A A;  3P4P A;  3I9W A;  3ZMU B;  4HFE A;  5KXJ A;  5FVL A;  3KDS E;  1XWM A;  3T1H T;  2OA5 A;  1SHZ C;  3TKL B;  3AE6 A;  2WDV A;  1HG5 A;  2XQ8 A;  3CQC B;  3KV6 A;  2E9X C;  1H7C A;  2VK9 A;  2XAF B;  5JR9 B;  3RIF A;  3RHW A;  3UFG A;  5L2L A;  2CBJ A;  4YFS A;  3F57 A;  4JI7 T;  4AKL A;  3AA1 B;  3IA3 A;  1KK7 A;  2RPA A;  4ZS2 A;  3AAI A;  3TLW A;  4I4T E;  3ONX A;  4YTP A;  3RX6 A;  4U74 A;  4BJM A;  3O4X E;  5L3C B;  4PK4 A;  4DV7 T;  4L5G A;  2BVM A;  2AXD S;  2E9X A;  1J5E T;  5KX5 E;  3O1H A;  5LCY A;  2JMH A;  1I6Z A;  5HEO A;  3S4U A;  3GN5 A;  5F5W A;  4MAL A;  3KBU A;  2J47 A;  4XZC A;  3UU8 A;  2LOP A;  2LSG A;  3NZP A;  4ZI7 E;  2V7K A;  4OYJ A;  1NWM X;  5L3G B;  3ZN1 B;  4H9S E;  4PK5 A;  1R8I A;  2WBL A;  5LGN B;  2BZB A;  2EHO D;  3UU3 A;  4DV0 T;  3PUY F;  3KVA A;  3GWH A;  2UU9 T;  5LMU T;  2MTQ A;  3RQW A;  3ANW B;  2KZ7 B;  3N2O A;  3EAB A;  4PJN A;  3VR8 A;  3EUH A;  5EK2 A;  5LHH B;  5LP6 E;  1MIV A;  1D1C A;  2D5U A;  3AXJ B;  4Z91 A;  3B13 A;  2XHE B;  1T7S A;  4AKH A;  4HKA A;  4U2Y A;  1ZOY A;  5LJN A;  2LLY A;  3RYF E;  3UUB A;  3J9X 1;  2FJE A;  4IE5 A;  1QLB A;  4KUM B;  4QX8 B;  2XPK A;  2H7O A;  4DR3 T;  4B3R T;  3B5M A;  2XQY A;  3LBX B;  5ABH A;  3BQL A;  4IDO A;  5F3J A;  2W4X A;  1LRZ A;  1U4Q A;  3CX6 B;  2XAS B;  3RC3 A;  2XY8 B;  4YY3 T;  2LSK A;  3AA6 B;  3V5U A;  4P1N A;  3ZEF B;  1G8X A;  4JI5 T;  3T1Y T;  4YTM A;  2JMK A;  3FZF B;  2OV9 A;  3CVR A;  3VR9 A;  5ETW A;  2WDR A;  3IHR A;  5J2T E;  3P4R A;  3HKB E;  2MPK A;  1IBL T;  4FJO A;  2FBW A;  5KDM C;  5LNK A;  3CX8 B;  1HNW T;  3H3M A;  3LSV A;  2WM9 A;  3SS1 A;  2JJ9 A;  2D9D A;  4ZZC A;  4GKJ T;  2MAW A;  4H9P C;  1MNE A;  4IST A;  3K8P C;  2HH7 A;  2X66 A;  3D0T A;  5F8P A;  5M4Y A;  1I94 T;  3UTK A;  3RYI E;  5JRC B;  5EK4 A;  5AQK B;  2XTL A;  3RKO A;  2PJQ A;  3H37 A;  2D0U A;  2LM9 A;  1T8B A;  4IE0 A;  3PUR A;  3P7I A;  2W61 A;  2ZM6 T;  5HWY A;  4DR2 T;  1N36 T;  2IML A;  2LKH A;  1W09 A;  3QNU A;  3NRX A;  2LHN A;  2XQ4 A;  4NPP A;  1OED E;  5JRE A;  5E0O A;  4IL9 A;  3QC9 A;  2Q9Q D;  1WYC A;  2XSB A;  3FB2 A;  3Q5W A;  4DR7 T;  3I1A A;  3JAE A;  4ILU A;  4TX5 A;  4CN4 A;  3PUA A;  5JDG A;  4HFI A;  4LF8 T;  2C5I T;  3ZMS B;  5HEH A;  2XM2 A;  3ABV A;  3PTR B;  5FL0 A;  3PJA A;  4EYU A;  1E1H B;  5LHI B;  2UUA T;  2VKJ A;  3PJA J;  4GYS A;  4HFD A;  2IUB A;  2LRL A;  4ILA A;  3FXD B;  1UGO A;  3RYH E;  1XNR T;  1SA0 E;  2CPT A;  2X67 A;  1BR4 A;  1FMV A;  5HXC A;  4LF9 T;  3QK6 A;  2WZI A;  2MYS A;  1IJ5 A;  3AED A;  3ZC1 A;  1L0V A;  5HEG A;  5AFU L;  3AA7 B;  2IC9 A;  2E9X B;  2DL1 A;  4HEA A;  3VKG A;  4YHJ A;  4KP3 C;  4X5T A;  5DQW A;  2XZE A;  5AQH B;  4QXC B;  1JNZ A;  5LGT B;  5FY1 A;  2CLY C;  3RRW A;  3UUL A;  2BKN A;  2HHH T;  3RIU C;  4AIU A;  3AEA A;  1KNZ A;  1FMW A;  4KX6 A;  3PUG A;  4V1A v;  5IWA T;  4LF6 T;  4TWH A;  2HN2 A;  5JTG A;  4QKN A;  4CZZ B;  2W00 A;  3L3P A;  1FIO A;  2W0G A;  3CX7 B;  3N9M A;  1M7K A; 
#chains in the Genus database with same CATH homology
 4U2Z A;  2JQ9 A;  1WCR A;  4CN4 A;  2V6Y A;  4U7Y A;  5CGM A;  3ZT5 A;  3ZSS A;  4IT4 A;  2DL1 A;  4U3C A;  1WFD A;  3ZT6 A;  2A9U A;  2LRL A;  5FVL A;  2WY2 A;  4WZX A;  4A5X A;  5FVK A;  2CRB A;  5LB7 B;  2JQK A;  2V6Y B;  4NIQ A;  2XZE A;  3ZST A;  1YXR A;  4U33 A;  2CPT A;  2W2U A;  2V6X A;  1WR0 A;  4U2Y A;  4U31 A;  2LRK A;  3K1S A;  2K3W A;  3ZT7 A;  2RPA A;  2WWV A;  4CN1 A;  3EAB A;  2MPK A;  4CN6 A;  4U7I A;  4ZEY A;  5CJ5 A;  4P1N A;  2JQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...