3JC6D

Structure of the eukaryotic replicative cmg helicase and pumpjack motion
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
221
Chain Sequence
VSPQQDFSDLMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNESKLPLLCMETELERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEIKYHDTHSLIWLKLVNDSILKYMPEELQAINDTEGSVNMIDEPDWNKFVFIHVNGPPDGENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEVIRDLLRDDKVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication licensing factor MCM2
publication title Structure of the eukaryotic replicative CMG helicase suggests a pumpjack motion for translocation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 56
structure length 221
sequence length 240
ec nomenclature
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
D PF16922 SLD5_C DNA replication complex GINS protein SLD5 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3jc6D01
2Q9QC 2EHOB 3ANWA 2E9XD 3JC6D 2Q9QB 2EHOA 2E9XA
chains in the Genus database with same CATH superfamily
2ODUA 4ILUA 2CEAA 4XAXB 2ZM8A 3N9OA 3KVAA 4CZZB 5ABEA 4CXYA 4HWFA 4X1KE 3KFWX 1WR0A 4CI3B 4AQFC 3P4RA 3CX6B 1D0XA 3C51A 3KV9A 2DLRA 5HXRA 2F4VT 3CIRA 3RQWA 3P4WA 5AQKB 1J1JA 1NAFA 2XAHB 3C98B 5CA1E 3LJCA 4IIJE 4DV7T 2E2AA 3RIAA 2XQ6A 4ZI7E 3FBLA 2WP9A 2LRLA 2ODVA 3RIFA 3TKLB 4TWHA 2BZBA 3LBXA 2XAJB 2HPLA 3CWZB 4DBQA 2YDRA 2WMOA 3ZKRA 5LGNB 2Y8DA 4H9OC 5M4YA 1HNZT 2E9XB 5LXTE 5JDQA 4UIGA 5LP6E 5HWYA 3H37A 4X66T 5BR8T 2X0LB 4LFAT 3F57A 3O9XA 5FL0A 4HN9A 2XTLA 4L0RA 4IE5A 1D0ZA 2XAFB 1SUMB 3HKCE 1YKHB 2Y6XA 3UUMA 3PTRB 2VKOA 2UU9T 2JIWA 2H88A 5LJNA 4UVBB 4QKNA 1MNDA 2BG9B 4X5TA 2W0GA 3MA9A 4K0KT 2A3DA 3AE9A 2NR4A 3IEEA 4U7YA 3EHZA 1KNRA 3BQIA 4DV2T 3KBUA 2KNDA 2Q9QC 2K9AA 4AIUA 2HN2A 4DUYT 1JNRA 3RGLA 2FJAA 2BBJA 3P4SA 2MYSA 5CA0E 3HKBE 2A72A 4B3RT 2P9BA 4OK0A 2XY8B 4I50E 3T8OA 3NVOA 1N34T 4YLHA 4AKRB 3LK2B 2YKSA 3C4ZA 3ZSTA 5C2TA 4QHOA 4U2ZA 4HKAA 3TLTA 3QOFA 5HYAA 2X67A 4BJNA 4NIQA 3PUGA 3UU8A 2XPKA 4QH4A 2VKJA 2ACZA 2XM2A 3HKEE 4DVDA 2LHNA 2YN6A 1VCSA 2JQHA 2C0SA 3MXZA 3WI3A 1VCTA 5J0ZA 5FNVE 2VVNA 4K0UA 3IA3A 1T8BA 3AEFA 4WBNE 4Z8XA 4EZ4A 2M6BA 4PFOA 3RLFF 2PG8A 3KINB 1HNXT 5LGUB 3PJAJ 2V6YB 5J1GA 5L3EB 4DV0T 2BS3A 5LHHB 4YTPA 2NOXA 3LK42 3HL6A 3U78A 4LF5T 4I0UA 3OKQA 3AEAA 5L3BB 2C5JA 4U33A 1ZEEA 4YTNA 3AXJA 2ZM2A 3CMLA 1OEDB 2D5UA 2MTQA 5AQNB 4X20E 3N9MA 4UF0A 3IF8B 3EABA 4ZI3C 1YD8G 3O1HA 2OLTA 5H6QB 4YFSA 5L47A 5FY0A 1IBLT 1OWAA 2UXXB 4EB6E 4HFHA 2IC9A 5L3DB 1HG5A 3AVSA 3N9PA 3RQUA 5HWXA 3NRYA 4ZS2A 3ZMSB 4QH1A 2VKHA 3P50A 5ABHA 3AAAB 3RPUA 2LHRA 1YKEB 4HFEA 5HXHA 4QX8B 4TV9E 2BKNA 3AVRA 4JYAT 2JQKA 5KX5E 2JRKA 5HXSA 4CXWA 1T72A 3VRBA 1KEYA 4EV6A 2YK0A 1I6ZA 3I1AA 1D1AA 4U3CA 5LBQB 4ZEYA 4PK4A 2V6XA 3MKDA 1Z0PA 2XAGB 4TWDA 4LF4T 4YHJA 4O4JE 3UULA 4P0AA 2V7JA 4KBMB 3EAMA 3T1HT 2LSKA 3ZN1B 3ZSSA 4ERRA 4LF7T 3Q2MA 3RIUC 5LNKA 2V7IA 1EZ3A 3ANWB 4IDQA 3D0TA 3A5XA 5DABA 2PTFA 5LCYA 4OX9T 1W0BA 2CWOA 1UUSA 1UCUA 5EK4A 5L3CB 4JLEA 2WM9A 4CI1B 3S4UA 5A1LA 2X0YA 4NXMT 3K3QC 5HEJA 3ZJ1A 4QX7B 1Z8UA 2CA5A 2CLYB 4X62T 3PU3A 4P1NA 2VVSA 1NWMX 4DV4T 2CCQA 1D0YA 2VL8A 3EUHA 2PJQA 2VQFT 4GIWA 3P7IA 2QGSA 3F2EA 4A98A 2PFVA 5HCMA 2XHEB 4AKLA 2CBJA 2WZIA 3MJXA 4U31A 3VKGA 5E0OA 2Q9QA 3ZMTB 2CHNA 3L3PA 3TLWA 3GN5A 5LG4A 5AQLB 5FVLA 3P4PA 5JDHA 1O3XA 3KDSE 3C50A 3QNUA 4YTMA 3SRZA 1J5WA 3PDYA 3AEEA 1FJGT 4GYSA 5DJQC 4GK0E 4JI4T 2WMNA 3E0ZA 1XZYA 4HE8A 4ZXLA 3ZC0A 1XMOT 2DL1A 3GWHA 2CBIA 3VR8A 3RRCA 4HEAA 4YT0A 3UT5E 2CRBA 2YU2A 4IGUA 4JI1T 3CPZA 4DV6T 3RYIE 1FMVA 4V1Av 4CN1A 4LF6T 1BR1A 2XSBA 2JMKA 2VWAA 5FXWA 2QYWA 3LSVA 4H63H 5IUXA 3TLVA 4PJLA 4HWCA 3CKDA 2HHHT 3SOLA 3QK6A 3RRWA 3J7Yq 4AKHA 4CN4A 3B57A 4H9RC 4A97A 2JMHA 2FJDA 3PUYF 4KX6A 2W2UA 3KV4A 5LA6E 4ASKA 5LB7B 2VQET 3SFDA 4LMJA 5FKYA 2CXLA 3W15B 4O4IE 2CHOA 2IUBA 3KV5A 3AE2A 3LK3B 3UU4A 2J1DG 3ZYMA 1BR2A 3IBPA 3PUSA 2E9XD 3I0QA 4H9NC 4EEBA 3JAEA 4ZI2D 5HCJA 5FMNA 1W0AA 1I94T 4IDNA 2IDOB 4JV5T 3N2GE 1HX1B 4WBOA 5JH7E 1ZV4X 4PK5A 2V7MA 4ILAA 4LF8T 4GK5E 1HS7A 1W9RA 3ZCIA 4EXTA 2LKHA 5KMGP 2AE9A 3L39A 4DR5T 2E9XC 3UQ4A 3WAKA 2LOPA 4YSXA 3AE5A 5DQWA 4ZI2C 4IREA 2OA5A 2NP9A 4WZXA 5EZYE 4E7SA 1DU2A 4JI0T 5JR9A 1M62A 3UU5A 2XAQB 2EHOB 2KLQA 5L2LA 2WU5A 5CJ5A 2LM9A 3SFEA 2X9XA 2DI4A 4O4LE 2KWIB 2JJ9A 3EI0A 4KP3C 2NW8A 4UELA 2UUAT 2C5KT 3ZMVB 2ZLYA 2BG9C 3RIUA 2H3RA 4LMLA 2KMFA 1R8IA 2XQ8A 3K3OA 3ZLIA 1QSDA 4CN6A 2RPAA 3RKOA 4DNDA 4QH5A 5HEUA 3AA6B 1XDPA 4DV1T 5LG3A 2KT9A 4JI5T 4J2CA 3KVBA 1HFAA 2M67A 3UUNA 1H7CA 3VRAA 4TV8E 4QXCB 3P8CD 3I9YA 3JADA 2JPFA 5L3GB 3PUVF 5HAXA 2XZEA 2V1DB 2XSAA 4ZHQE 1HF8A 5AQTB 3ZC1A 4KHZF 1Y64B 1G73A 5CFBA 4X1YE 2CXDA 2BS2A 4BA9A 2SPCA 3QUJA 2DNXA 3L09A 4JUYA 5ABFB 2R6GF 3AA7B 2W63A 4ZZCA 4JI3T 3OYXA 2IHR1 4JI7T 2UXCT 4G2AA 4CQIA 3PE0A 4IE7A 1V9DA 3C4XA 4YXDA 3ZN0B 4B3TT 4DMVA 2OV9A 3JC6D 3K3NA 4A5XA 1M7KA 3TLUA 4MBQA 2GK9A 3KBTA 2YEVC 3AEGA 2ACXA 5AQVB 1MIWA 4HWHA 5AFUL 1KFYA 2H7OA 2WB5A 3AE3A 5JDLA 2LEHA 3PJAA 4U7IA 3UUBA 2W00A 2K3WA 3AB3B 4EOZB 4IL4A 4F6RC 1KNZA 4UEMA 1UK5A 2E5LT 3FZKB 3ETUA 4MHCA 5HXEA 3ZT7A 5JRCA 3CQXC 1ZHCA 4CXXA 3NKZA 4UV9B 4YJ3E 4GOUA 5F8PA 2XQ7A 4Z90A 4PAGA 2UXDT 5KXJA 4WYVA 1WLXA 2LE8A 2QA7A 3LBXB 5AQRB 4LFBT 2I6HA 3CX8B 3C64A 2WY2A 4NXNT 1UURA 2BKPA 4U72A 5FYMA 3N9LA 4DUZT 2D0TA 1SHZC 5JR9C 2Y48B 2LJLA 1XDOA 5AQFB 3U3IA 3I0OA 3QB5K 3N2KE 5HEHA 2G0UA 2FBWA 4YHHT 4GKJT 5FXXA 3QB5A 4O8SA 2IC6A 5BMVE 2X9HA 5LGTB 5LHGB 2E9XA 3AE1A 5C3JA 2KXPB 1KK7A 3FHNA 2J4GA 2XQ4A 4NPPA 4MFRA 2WS3A 4WNKA 1MMDA 2FJBA 1LRZA 4AI6A 2BG9E 2XQ5A 4DR6T 2RP4A 4DR3T 1MMNA 2CLYC 3CQGB 2X51A 2I0MA 3AECA 5LOVE 4TUYE 1FMWA 3LFMA 3G06A 3CVRA 2FUPA 2BG9A 2XQ3A 5KDMC 1YXRA 3FZHB 1T98A 2VURA 2XJ7A 2YINA 1QLBA 4AISA 2YDQA 4H9QC 4PK6A 5LBMA 2MBGA 4I55E 2WDVA 4HFCA 2WQYA 2H7VC 3FB2A 3OBVE 4X65T 5IYZE 5J2UE 4IHJE 2N9DA 4JI6T 5AQQB 4PW8A 5LHIB 4PNIA 4MLKA 1NEKA 3Q5WA 2KZ7B 2C5IT 4JI8T 4ILCA 3ZMZB 4DIDB 3Q5DA 3ZJ2A 3AAIA 3UU6A 2V7LA 4AXPA 5JTGA 2DWKA 3V5UA 3RI5A 4L5GA 4Z91A 2M6IA 4U2YA 3PUXF 1MMAA 1FEWA 2IIUA 5AQIB 1MIVA 2W62A 4ISSA 3EDUA 3AE7A 2JQQA 1OXZA 1XNRT 3Q5EA 3ZPOA 2W67A 3A8YC 1SE7A 3AE8A 5GONE 2B76A 1WCRA 2NWBA 2ES0A 2KWHA 3EVYA 2WCAA 3OPCA 2CPTA 2W61A 1BR0A 3AXJB 3AE6A 2CWYA 1N32T 4ILBA 2V6YA 3ONJA 3RH3A 4UF0B 5L4EA 4PJNA 1XNQT 4P0BA 5FVKA 5AQJB 3ZEFB 5HEGA 5J2TE 4AQGA 3X1DA 3RKGA 1N36T 2ZM6T 3NZQA 5FXZA 2BS4A 5H6RB 2DWGA 4QWNB 2LM2A 5LMUT 2A9UA 4IE4A 1D1BA 3AAEB 4IDZA 1MMGA 4MALA 2LSIA 5HXCA 2WSSV 4TWFA 5IWAT 1WR6A 1OEDA 1VOMA 2QVAA 3MK7C 5JDMA 4LF9T 4KMCA 3ZCJA 4IT4A 2I59A 1IBKT 1ZOYA 5AQPB 1HR0T 3ESLA 2W66A 4DR4T 4TX5A 2CXFA 1YW0A 3M65A 2LT3A 1Y01A 4UVAB 1U4QA 3FXEB 2BVMA 3UFEA 2MAWA 4TNVA 2MOZA 1GQEA 3ZT5A 4IL9A 2LKGA 4UXNB 1E2AA 2KINB 2MPKA 2XASB 3PUZF 2XUEA 2VKDA 1MNEA 2EHOD 2A2FX 4HFDA 4EEDA 3DTOA 2VASA 2QRXA 3T1YT 3DJBA 3IHRA 2V5DA 3P4QA 3K8PC 5F3JA 3VR9A 3M3ZB 5DQVA 2X0HA 4DMWA 5AQMB 1U5PA 1UX5A 1S94A 4XBFB 3L8RA 3PURA 1CHUA 2AXDS 3JCFA 3LDQB 1KF6A 3GA8A 2EHOC 4GYRA 1LKXA 1HG2A 2LSYA 3BQLA 2UUBT 3GMIA 3OVUA 4IE6A 4HFVA 2Q9QD 1CUNA 3N9QA 4PFPA 5AQHB 4KUMB 4XZCA 4NUUA 3HR0A 4EYUA 1SA0E 3HKDE 2N2NA 5IHYA 5LYJE 3ANWA 4HGAA 2WDQA 2K48A 4H9PC 3ETVA 3AA1B 1QUUA 4UVCB 1WFDA 4YSZA 2CMRA 5EK3A 4OHFA 2W4XA 3ZT6A 3BQKA 2X9YA 1YQ3A 1ZP0A 3FZLB 5C8YE 4ANJA 1XMQT 4DBRA 1HX8A 3K1SA 1W09A 2VK9A 2E8IA 4N78D 1LVFA 5LMNT 3SS1A 2ZMAA 2UXNB 1HCIA 1J5ET 1D1CA 1JNZA 2Q9QB 3R6NA 3GN5B 1XWMA 5EK2A 5AQGB 3UTKA 5JDGA 2L3LA 4QXBB 2D2SA 5JQGE 2YOEA 3UFGA 3V5SA 4U74A 2HH7A 3OTOT 4HWIB 2LRKA 5CB4E 4JEHB 2L9QA 4IE0A 5AQOB 2NW7A 2XQ9A 2CE7A 4L9IA 3PUWF 4ZS3A 1IZNB 2D9DA 2X68A 4LFCT 5CGMA 4DV3T 3MACA 2WWUA 3VKHA 1WRDA 2LOSA 4LMKA 1IAPA 4UR9A 2BKOA 3UQ7A 3FZMB 3FXDB 2XQAA 4ZI3D 4B3MT 4HWDA 3I9WA 1YQ4A 3MZKB 3RF1A 4PJJA 3R84B 2NTXA 1UGOA 3FBZA 3VHLA 4ADZA 1OEDC 4COFA 2VB6A 3LG7A 3N9NA 4OFZA 3UUXB 2KSRA 3ZMUB 3PV0F 3AA0B 4HFBA 4G63A 4OYJA 2YDSA 3AE4A 2UUCT 3OYZA 2NTYA 3OJAA 4JBWF 5ABGA 3AEBA 3N2OA 4ISTA 3JC6C 2V26A 3RX6A 2CM0A 4TZ4C 5F5WA 5JREA 3O1IA 4CI2B 4EIWA 4H9SE 1T7SA 4TNWA 5FP3A 4IDOA 3EDVA 1IJ5A 2K24A 4EAHA 2ZM0A 2B1EA 1WYCA 4B6XA 5JVDE 4P09A 4EGWA 4YSYA 3O4XE 3NWIA 4I4TE 4O4HE 2RA1A 5L4HA 3CX7B 3J9X1 2J47A 4BJMA 1E1HB 2V7KA 5TAOA 4X64T 1IJ6A 3JAFA 3A7MA 2VL0A 3PUQA 5FY1A 4GKKT 4DO0A 3C4WA 4YJ2E 3N5LA 4OYKA 1LVKA 3Q5XA 1US7B 4AQFA 4DV5T 2BDEA 4AKGA 2FJEA 2N1GA 5AQUB 3UU3A 2WWVA 3RYHE 1UX4A 1HNWT 5JR9B 1BR4A 5FY7A 1X9BA 4AQYT 3ZYLA 1HTJF 2WU2A 4PJMA 2X9WA 4YY3T 3DP7A 4UV8B 4C90A 2LSGA 3RHWA 5AQSB 4DR1T 2WDRA 2K5BB 2X66A 3H3AA 2PBIA 4HTEA 3BK9A 2L8KA 4BAYB 4AKIA 3Q9DA 3NBXX 1E7PA 3AEDA 3TLSA 3B5MA 2LSJA 2HN1A 3H3MA 2BBHA 4C91A 2EHOA 3RC3A 1L0VA 2WZHA 2Z6EA 4IDPA 4ZOLE 3CQCB 1S35A 2V5CA 4FI5A 1ZKEA 4F8HA 2IW5B 4E7ZA 1G8XA 2UXBT 3E08A 3VU7H 4DR7T 5JDNA 1AJ3A 2IMLA 1B7TA 3O1JA 3RYFE 2DCFA 5ETWA 4FJOA 3PU8A 2IAKA 3CK6A 1MIYA 4H63V 5FL1A 4JEUB 3ONXA 4JI2T 2H89A 3NZPA 4A56A 4I43B 2JQ9A 2BVLA 3QC9A 2XQYA 1X79A 1N33T 1FIOA 1NENA 5JDFA 2HPJA 1KNPA 2YU1A 2WAUA 4O2BE 2WBLA 4ZZBA 4Q25A 5FXVA 5ABFA 5LJMA 3HI2A 2DHRA 4KI0F 3ONLC 2D0UA 5L3FB 4TN7B 3ZYKA 4QXHB 3RC8A 2J62A 3SWHA 2LLYA 1WYBA 1OEDE 4O2AE 3WAJA 3ABVA 5HEOA 2XM1A 4WW0A 4NUVA 4KHPT 1VRBA 3FZFB 3NRXA 4B3ST 4HFIA 4M1PA 1IBMT 4EZHA 4EYYR 4DR2T 3HA4A 3PUAA 5JRCB 3F31A 3B13A 2NW9A 5ADXL 3E22E 3KV6A 3RYCE 2E5VA 4X1IE 2V8SV
chains in the Genus database with same CATH topology
2ODUA 4GIWA 1D1CA 5JRCA 3CQXC 3P7IA 2Q9QB 2QGSA 4ILUA 3R6NA 3F2EA 2PFVA 2CEAA 4XAXB 2ZM8A 3GN5B 3N9OA 5EK2A 2XHEB 3UTKA 1ZHCA 4AKLA 3KVAA 4CZZB 5JDGA 4CXXA 4CXYA 4X1KE 2L3LA 4UV9B 3KFWX 4YJ3E 4QXBB 3MJXA 3VKGA 4GOUA 5F8PA 5E0OA 2D2SA 2Q9QA 4CI3B 3ZMTB 4AQFC 3L3PA 5JQGE 3V5SA 3CX6B 4U74A 3GN5A 1D0XA 3C51A 4PAGA 5LG4A 2HH7A 3KV9A 2DLRA 5JDHA 1O3XA 3KDSE 5HXRA 5CB4E 4JEHB 3C50A 1WLXA 3SRZA 2L9QA 4IE0A 2NW7A 3PDYA 2LE8A 2QA7A 1NAFA 2CE7A 2XAHB 3C98B 3LBXB 3LJCA 4IIJE 4L9IA 5CA1E 4GYSA 5DJQC 4GK0E 3CX8B 2WMNA 3C64A 3E0ZA 4ZS3A 4HE8A 4U72A 1IZNB 5FYMA 4ZI7E 3ZC0A 3N9LA 3FBLA 2X68A 2ODVA 2D0TA 1SHZC 3TKLB 5JR9C 2BZBA 3GWHA 2Y48B 3LBXA 2XAJB 3MACA 2HPLA 2LJLA 2WWUA 3VKHA 1WRDA 3CWZB 3U3IA 4DBQA 2LOSA 3I0OA 2WMOA 1IAPA 3RRCA 5LGNB 2Y8DA 4H9OC 4HEAA 5M4YA 3N2KE 3UT5E 2YU2A 2G0UA 2E9XB 5LXTE 4IGUA 3CPZA 3FXDB 3RYIE 5JDQA 4UIGA 4ZI3D 1FMVA 4V1Av 5FXXA 4O8SA 5LP6E 5HWYA 2IC6A 3I9WA 3H37A 5BMVE 1BR1A 2X9HA 2X0LB 3MZKB 2JMKA 3F57A 4PJJA 3O9XA 3R84B 5LGTB 2VWAA 5LHGB 5FXWA 2NTXA 2E9XA 3FBZA 4H63H 4HN9A 2XTLA 3VHLA 4L0RA 2KXPB 1KK7A 3FHNA 4ADZA 4PJLA 2VB6A 3LG7A 3CKDA 3N9NA 4IE5A 4OFZA 3UUXB 1D0ZA 4MFRA 3SOLA 3QK6A 3RRWA 2XAFB 3ZMUB 3HKCE 1YKHB 4WNKA 2Y6XA 3UUMA 3PTRB 3AA0B 1MMDA 2VKOA 4G63A 4OYJA 3J7Yq 4AKHA 5LJNA 4UVBB 3B57A 4H9RC 4QKNA 3OYZA 2NTYA 1LRZA 2JMHA 3OJAA 1MNDA 4AI6A 2RP4A 3N2OA 1MMNA 2CLYC 3CQGB 2X51A 5LOVE 2W0GA 4TUYE 4ISTA 3MA9A 1FMWA 2V26A 3JC6C 3RX6A 2CM0A 3KV4A 3LFMA 4TZ4C 5LA6E 2A3DA 4ASKA 3CVRA 5JREA 3IEEA 3O1IA 4CI2B 4EIWA 4H9SE 3BQIA 3KBUA 2KNDA 5FP3A 2Q9QC 2CXLA 3W15B 2K9AA 5KDMC 1T98A 3EDVA 2YINA 1IJ5A 2K24A 4EAHA 4O4IE 2ZM0A 2B1EA 2MYSA 4H9QC 4PK6A 3KV5A 5LBMA 2MBGA 1WYCA 4I55E 4B6XA 5CA0E 3LK3B 3HKBE 2A72A 4P09A 5JVDE 2H7VC 2J1DG 3FB2A 3ZYMA 1BR2A 2P9BA 3OBVE 4OK0A 3IBPA 4I50E 3PUSA 3T8OA 5IYZE 5J2UE 3O4XE 4IHJE 2E9XD 2N9DA 4I4TE 3I0QA 4YLHA 4AKRB 4H9NC 3LK2B 4O4HE 2RA1A 4PW8A 3CX7B 3J9X1 5LHIB 4PNIA 3C4ZA 4ZI2D 4MLKA 4BJMA 3Q5WA 1E1HB 2V7KA 5TAOA 2KZ7B 2C5IT 5FMNA 1IJ6A 4QHOA 3ZMZB 4HKAA 5HYAA 2X67A 3ZJ2A 4BJNA 3PUGA 3AAIA 2V7LA 3PUQA 4AXPA 5FY1A 2DWKA 3V5UA 4DO0A 3C4WA 4YJ2E 2VKJA 4L5GA 3N2GE 4WBOA 3N5LA 5JH7E 4OYKA 1LVKA 3HKEE 1ZV4X 3Q5XA 2V7MA 4PK5A 1MMAA 1US7B 2LHNA 4DVDA 4AQFA 4GK5E 1HS7A 3ZCIA 4EXTA 2BDEA 2C0SA 1FEWA 3MXZA 5KMGP 4AKGA 3WI3A 2N1GA 1MIVA 5FNVE 3RYHE 2W62A 1UX4A 3EDUA 4ISSA 4K0UA 2JQQA 5JR9B 1OXZA 2E9XC 1BR4A 5FY7A 3WAKA 3ZYLA 2LOPA 1HTJF 3ZPOA 4PJMA 4WBNE 2X9WA 4Z8XA 3DP7A 4EZ4A 4UV8B 4C90A 2LSGA 4PFOA 5DQWA 5GONE 2NWBA 2PG8A 3KINB 5LGUB 4ZI2C 2OA5A 2ES0A 2K5BB 2KWHA 3EVYA 5J1GA 2NP9A 2X66A 3H3AA 5L3EB 2PBIA 5EZYE 4HTEA 4E7SA 5LHHB 2W61A 5JR9A 3BK9A 2NOXA 2L8KA 4BAYB 3LK42 1BR0A 4AKIA 2XAQB 2CWYA 2EHOB 3HL6A 3Q9DA 3U78A 2KLQA 3NBXX 5L2LA 3OKQA 2LM9A 5L3BB 2C5JA 3RH3A 4UF0B 2X9XA 2DI4A 4O4LE 2KWIB 2JJ9A 4PJNA 1ZEEA 4KP3C 4P0BA 2NW8A 4UELA 2LSJA 2C5KT 3ZEFB 2ZM2A 4C91A 5J2TE 2EHOA 3CMLA 3ZMVB 2ZLYA 4AQGA 2D5UA 2MTQA 3RC3A 2H3RA 3NZQA 2Z6EA 5FXZA 5H6RB 4ZOLE 2DWGA 4X20E 3N9MA 4QWNB 4UF0A 4IE4A 3IF8B 1D1BA 2KMFA 3AAEB 3CQCB 4IDZA 1MMGA 4ZI3C 1S35A 4MALA 2LSIA 3K3OA 5HXCA 2WSSV 4FI5A 1ZKEA 1WR6A 1YD8G 3ZLIA 1QSDA 1VOMA 3MK7C 2IW5B 3O1HA 3RKOA 5JDMA 4E7ZA 4DNDA 4KMCA 3ZCJA 2I59A 3AA6B 1G8XA 5H6QB 4YFSA 3E08A 3VU7H 5FY0A 5JDNA 1AJ3A 2KT9A 3ESLA 1B7TA 4J2CA 4TX5A 2CXFA 1YW0A 3M65A 3KVBA 2LT3A 1OWAA 2UXXB 3O1JA 4UVAB 3RYFE 1HFAA 1U4QA 4EB6E 2DCFA 5ETWA 2IC9A 2M67A 4FJOA 3UUNA 1H7CA 3PU8A 4TV8E 5L3DB 4QXCB 3P8CD 3FXEB 1HG5A 3AVSA 2IAKA 3N9PA 1MIYA 2BVMA 4H63V 3I9YA 2JPFA 3UFEA 2MOZA 5L3GB 5HAXA 4JEUB 5HWXA 3ONXA 2V1DB 3NRYA 4UXNB 4ZS2A 2KINB 3ZMSB 2VKHA 4ZHQE 2XASB 2XUEA 1HF8A 3AAAB 2VKDA 3RPUA 3NZPA 4A56A 1MNEA 2LHRA 1YKEB 4I43B 3ZC1A 2EHOD 2A2FX 1Y64B 1G73A 4X1YE 2CXDA 5HXHA 4BA9A 2SPCA 4QX8B 3DTOA 4TV9E 2VASA 3QUJA 2BVLA 2DNXA 3L09A 3QC9A 2XQYA 1X79A 3AVRA 4JUYA 3DJBA 3IHRA 5KX5E 2JRKA 5HXSA 1FIOA 2W63A 3AA7B 4CXWA 3K8PC 5JDFA 5F3JA 3OYXA 2HPJA 2YK0A 3I1AA 1D1AA 5DQVA 5LBQB 2YU1A 4G2AA 4CQIA 4DMWA 2WAUA 4O2BE 2WBLA 3PE0A 5FXVA 4PK4A 1U5PA 1UX5A 1S94A 4XBFB 4IE7A 1V9DA 3MKDA 1Z0PA 3C4XA 2XAGB 3PURA 5LJMA 4YHJA 3HI2A 4O4JE 3ZN0B 3UULA 4DMVA 4P0AA 2DHRA 2V7JA 4KBMB 2LSKA 3GA8A 3ZN1B 4ERRA 2D0UA 3JC6D 2EHOC 4GYRA 5L3FB 1LKXA 1HG2A 3Q2MA 2LSYA 5LNKA 4TN7B 3BQLA 3K3NA 2V7IA 1EZ3A 3ZYKA 3ANWB 3GMIA 3D0TA 4IE6A 4HFVA 2Q9QD 1CUNA 3N9QA 3A5XA 4PFPA 5DABA 5LCYA 4KUMB 4QXHB 4XZCA 4MBQA 2GK9A 4NUUA 3KBTA 3RC8A 2YEVC 2ACXA 1MIWA 3SWHA 1WYBA 3HR0A 4EYUA 1SA0E 3HKDE 5AFUL 2N2NA 4O2AE 5IHYA 2H7OA 3WAJA 5LYJE 5JDLA 3ANWA 4HGAA 2CWOA 2LEHA 2K48A 4H9PC 2W00A 3ETVA 1UCUA 3AA1B 4WW0A 4NUVA 1QUUA 1VRBA 3AB3B 5EK4A 4UVCB 5L3CB 3NRXA 4EOZB 4JLEA 2WM9A 4M1PA 3S4UA 5A1LA 4CI1B 4F6RC 2CMRA 4EZHA 3K3QC 5EK3A 4OHFA 4EYYR 3BQKA 3HA4A 2X9YA 4UEMA 1KNZA 3PUAA 5C8YE 3ZJ1A 5JRCB 4ANJA 4QX7B 2CA5A 2CLYB 4DBRA 1HX8A 3F31A 3B13A 2NW9A 3PU3A 5ADXL 1NWMX 2CCQA 3E22E 3KV6A 1D0YA 2VK9A 2E8IA 2VL8A 3RYCE 4N78D 3ETUA 4MHCA 3EUHA 4X1IE 2PJQA 1LVFA 5HXEA 3SS1A 2ZMAA 2UXNB 1HCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q C;  2EHO B;  3ANW A;  2E9X D;  3JC6 D;  2Q9Q B;  2EHO A;  2E9X A; 
#chains in the Genus database with same CATH topology
 2ODU A;  4ILU A;  2CEA A;  4XAX B;  2ZM8 A;  3N9O A;  3KVA A;  4CZZ B;  5ABE A;  4CXY A;  4HWF A;  4X1K E;  3KFW X;  1WR0 A;  4CI3 B;  4AQF C;  3P4R A;  3CX6 B;  1D0X A;  3C51 A;  3KV9 A;  2DLR A;  5HXR A;  2F4V T;  3CIR A;  3RQW A;  3P4W A;  5AQK B;  1J1J A;  1NAF A;  2XAH B;  3C98 B;  5CA1 E;  3LJC A;  4IIJ E;  4DV7 T;  2E2A A;  3RIA A;  2XQ6 A;  4ZI7 E;  3FBL A;  2WP9 A;  2LRL A;  2ODV A;  3RIF A;  3TKL B;  4TWH A;  2BZB A;  3LBX A;  2XAJ B;  2HPL A;  3CWZ B;  4DBQ A;  2YDR A;  2WMO A;  3ZKR A;  5LGN B;  2Y8D A;  4H9O C;  5M4Y A;  1HNZ T;  2E9X B;  5LXT E;  5JDQ A;  4UIG A;  5LP6 E;  5HWY A;  3H37 A;  4X66 T;  5BR8 T;  2X0L B;  4LFA T;  3F57 A;  3O9X A;  5FL0 A;  4HN9 A;  2XTL A;  4L0R A;  4IE5 A;  1D0Z A;  2XAF B;  1SUM B;  3HKC E;  1YKH B;  2Y6X A;  3UUM A;  3PTR B;  2VKO A;  2UU9 T;  2JIW A;  2H88 A;  5LJN A;  4UVB B;  4QKN A;  1MND A;  2BG9 B;  4X5T A;  2W0G A;  3MA9 A;  4K0K T;  2A3D A;  3AE9 A;  2NR4 A;  3IEE A;  4U7Y A;  3EHZ A;  1KNR A;  3BQI A;  4DV2 T;  3KBU A;  2KND A;  2Q9Q C;  2K9A A;  4AIU A;  2HN2 A;  4DUY T;  1JNR A;  3RGL A;  2FJA A;  2BBJ A;  3P4S A;  2MYS A;  5CA0 E;  3HKB E;  2A72 A;  4B3R T;  2P9B A;  4OK0 A;  2XY8 B;  4I50 E;  3T8O A;  3NVO A;  1N34 T;  4YLH A;  4AKR B;  3LK2 B;  2YKS A;  3C4Z A;  3ZST A;  5C2T A;  4QHO A;  4U2Z A;  4HKA A;  3TLT A;  3QOF A;  5HYA A;  2X67 A;  4BJN A;  4NIQ A;  3PUG A;  3UU8 A;  2XPK A;  4QH4 A;  2VKJ A;  2ACZ A;  2XM2 A;  3HKE E;  4DVD A;  2LHN A;  2YN6 A;  1VCS A;  2JQH A;  2C0S A;  3MXZ A;  3WI3 A;  1VCT A;  5J0Z A;  5FNV E;  2VVN A;  4K0U A;  3IA3 A;  1T8B A;  3AEF A;  4WBN E;  4Z8X A;  4EZ4 A;  2M6B A;  4PFO A;  3RLF F;  2PG8 A;  3KIN B;  1HNX T;  5LGU B;  3PJA J;  2V6Y B;  5J1G A;  5L3E B;  4DV0 T;  2BS3 A;  5LHH B;  4YTP A;  2NOX A;  3LK4 2;  3HL6 A;  3U78 A;  4LF5 T;  4I0U A;  3OKQ A;  3AEA A;  5L3B B;  2C5J A;  4U33 A;  1ZEE A;  4YTN A;  3AXJ A;  2ZM2 A;  3CML A;  1OED B;  2D5U A;  2MTQ A;  5AQN B;  4X20 E;  3N9M A;  4UF0 A;  3IF8 B;  3EAB A;  4ZI3 C;  1YD8 G;  3O1H A;  2OLT A;  5H6Q B;  4YFS A;  5L47 A;  5FY0 A;  1IBL T;  1OWA A;  2UXX B;  4EB6 E;  4HFH A;  2IC9 A;  5L3D B;  1HG5 A;  3AVS A;  3N9P A;  3RQU A;  5HWX A;  3NRY A;  4ZS2 A;  3ZMS B;  4QH1 A;  2VKH A;  3P50 A;  5ABH A;  3AAA B;  3RPU A;  2LHR A;  1YKE B;  4HFE A;  5HXH A;  4QX8 B;  4TV9 E;  2BKN A;  3AVR A;  4JYA T;  2JQK A;  5KX5 E;  2JRK A;  5HXS A;  4CXW A;  1T72 A;  3VRB A;  1KEY A;  4EV6 A;  2YK0 A;  1I6Z A;  3I1A A;  1D1A A;  4U3C A;  5LBQ B;  4ZEY A;  4PK4 A;  2V6X A;  3MKD A;  1Z0P A;  2XAG B;  4TWD A;  4LF4 T;  4YHJ A;  4O4J E;  3UUL A;  4P0A A;  2V7J A;  4KBM B;  3EAM A;  3T1H T;  2LSK A;  3ZN1 B;  3ZSS A;  4ERR A;  4LF7 T;  3Q2M A;  3RIU C;  5LNK A;  2V7I A;  1EZ3 A;  3ANW B;  4IDQ A;  3D0T A;  3A5X A;  5DAB A;  2PTF A;  5LCY A;  4OX9 T;  1W0B A;  2CWO A;  1UUS A;  1UCU A;  5EK4 A;  5L3C B;  4JLE A;  2WM9 A;  4CI1 B;  3S4U A;  5A1L A;  2X0Y A;  4NXM T;  3K3Q C;  5HEJ A;  3ZJ1 A;  4QX7 B;  1Z8U A;  2CA5 A;  2CLY B;  4X62 T;  3PU3 A;  4P1N A;  2VVS A;  1NWM X;  4DV4 T;  2CCQ A;  1D0Y A;  2VL8 A;  3EUH A;  2PJQ A;  2VQF T;  4GIW A;  3P7I A;  2QGS A;  3F2E A;  4A98 A;  2PFV A;  5HCM A;  2XHE B;  4AKL A;  2CBJ A;  2WZI A;  3MJX A;  4U31 A;  3VKG A;  5E0O A;  2Q9Q A;  3ZMT B;  2CHN A;  3L3P A;  3TLW A;  3GN5 A;  5LG4 A;  5AQL B;  5FVL A;  3P4P A;  5JDH A;  1O3X A;  3KDS E;  3C50 A;  3QNU A;  4YTM A;  3SRZ A;  1J5W A;  3PDY A;  3AEE A;  1FJG T;  4GYS A;  5DJQ C;  4GK0 E;  4JI4 T;  2WMN A;  3E0Z A;  1XZY A;  4HE8 A;  4ZXL A;  3ZC0 A;  1XMO T;  2DL1 A;  3GWH A;  2CBI A;  3VR8 A;  3RRC A;  4HEA A;  4YT0 A;  3UT5 E;  2CRB A;  2YU2 A;  4IGU A;  4JI1 T;  3CPZ A;  4DV6 T;  3RYI E;  1FMV A;  4V1A v;  4CN1 A;  4LF6 T;  1BR1 A;  2XSB A;  2JMK A;  2VWA A;  5FXW A;  2QYW A;  3LSV A;  4H63 H;  5IUX A;  3TLV A;  4PJL A;  4HWC A;  3CKD A;  2HHH T;  3SOL A;  3QK6 A;  3RRW A;  3J7Y q;  4AKH A;  4CN4 A;  3B57 A;  4H9R C;  4A97 A;  2JMH A;  2FJD A;  3PUY F;  4KX6 A;  2W2U A;  3KV4 A;  5LA6 E;  4ASK A;  5LB7 B;  2VQE T;  3SFD A;  4LMJ A;  5FKY A;  2CXL A;  3W15 B;  4O4I E;  2CHO A;  2IUB A;  3KV5 A;  3AE2 A;  3LK3 B;  3UU4 A;  2J1D G;  3ZYM A;  1BR2 A;  3IBP A;  3PUS A;  2E9X D;  3I0Q A;  4H9N C;  4EEB A;  3JAE A;  4ZI2 D;  5HCJ A;  5FMN A;  1W0A A;  1I94 T;  4IDN A;  2IDO B;  4JV5 T;  3N2G E;  1HX1 B;  4WBO A;  5JH7 E;  1ZV4 X;  4PK5 A;  2V7M A;  4ILA A;  4LF8 T;  4GK5 E;  1HS7 A;  1W9R A;  3ZCI A;  4EXT A;  2LKH A;  5KMG P;  2AE9 A;  3L39 A;  4DR5 T;  2E9X C;  3UQ4 A;  3WAK A;  2LOP A;  4YSX A;  3AE5 A;  5DQW A;  4ZI2 C;  4IRE A;  2OA5 A;  2NP9 A;  4WZX A;  5EZY E;  4E7S A;  1DU2 A;  4JI0 T;  5JR9 A;  1M62 A;  3UU5 A;  2XAQ B;  2EHO B;  2KLQ A;  5L2L A;  2WU5 A;  5CJ5 A;  2LM9 A;  3SFE A;  2X9X A;  2DI4 A;  4O4L E;  2KWI B;  2JJ9 A;  3EI0 A;  4KP3 C;  2NW8 A;  4UEL A;  2UUA T;  2C5K T;  3ZMV B;  2ZLY A;  2BG9 C;  3RIU A;  2H3R A;  4LML A;  2KMF A;  1R8I A;  2XQ8 A;  3K3O A;  3ZLI A;  1QSD A;  4CN6 A;  2RPA A;  3RKO A;  4DND A;  4QH5 A;  5HEU A;  3AA6 B;  1XDP A;  4DV1 T;  5LG3 A;  2KT9 A;  4JI5 T;  4J2C A;  3KVB A;  1HFA A;  2M67 A;  3UUN A;  1H7C A;  3VRA A;  4TV8 E;  4QXC B;  3P8C D;  3I9Y A;  3JAD A;  2JPF A;  5L3G B;  3PUV F;  5HAX A;  2XZE A;  2V1D B;  2XSA A;  4ZHQ E;  1HF8 A;  5AQT B;  3ZC1 A;  4KHZ F;  1Y64 B;  1G73 A;  5CFB A;  4X1Y E;  2CXD A;  2BS2 A;  4BA9 A;  2SPC A;  3QUJ A;  2DNX A;  3L09 A;  4JUY A;  5ABF B;  2R6G F;  3AA7 B;  2W63 A;  4ZZC A;  4JI3 T;  3OYX A;  2IHR 1;  4JI7 T;  2UXC T;  4G2A A;  4CQI A;  3PE0 A;  4IE7 A;  1V9D A;  3C4X A;  4YXD A;  3ZN0 B;  4B3T T;  4DMV A;  2OV9 A;  3JC6 D;  3K3N A;  4A5X A;  1M7K A;  3TLU A;  4MBQ A;  2GK9 A;  3KBT A;  2YEV C;  3AEG A;  2ACX A;  5AQV B;  1MIW A;  4HWH A;  5AFU L;  1KFY A;  2H7O A;  2WB5 A;  3AE3 A;  5JDL A;  2LEH A;  3PJA A;  4U7I A;  3UUB A;  2W00 A;  2K3W A;  3AB3 B;  4EOZ B;  4IL4 A;  4F6R C;  1KNZ A;  4UEM A;  1UK5 A;  2E5L T;  3FZK B;  3ETU A;  4MHC A;  5HXE A;  3ZT7 A;  5JRC A;  3CQX C;  1ZHC A;  4CXX A;  3NKZ A;  4UV9 B;  4YJ3 E;  4GOU A;  5F8P A;  2XQ7 A;  4Z90 A;  4PAG A;  2UXD T;  5KXJ A;  4WYV A;  1WLX A;  2LE8 A;  2QA7 A;  3LBX B;  5AQR B;  4LFB T;  2I6H A;  3CX8 B;  3C64 A;  2WY2 A;  4NXN T;  1UUR A;  2BKP A;  4U72 A;  5FYM A;  3N9L A;  4DUZ T;  2D0T A;  1SHZ C;  5JR9 C;  2Y48 B;  2LJL A;  1XDO A;  5AQF B;  3U3I A;  3I0O A;  3QB5 K;  3N2K E;  5HEH A;  2G0U A;  2FBW A;  4YHH T;  4GKJ T;  5FXX A;  3QB5 A;  4O8S A;  2IC6 A;  5BMV E;  2X9H A;  5LGT B;  5LHG B;  2E9X A;  3AE1 A;  5C3J A;  2KXP B;  1KK7 A;  3FHN A;  2J4G A;  2XQ4 A;  4NPP A;  4MFR A;  2WS3 A;  4WNK A;  1MMD A;  2FJB A;  1LRZ A;  4AI6 A;  2BG9 E;  2XQ5 A;  4DR6 T;  2RP4 A;  4DR3 T;  1MMN A;  2CLY C;  3CQG B;  2X51 A;  2I0M A;  3AEC A;  5LOV E;  4TUY E;  1FMW A;  3LFM A;  3G06 A;  3CVR A;  2FUP A;  2BG9 A;  2XQ3 A;  5KDM C;  1YXR A;  3FZH B;  1T98 A;  2VUR A;  2XJ7 A;  2YIN A;  1QLB A;  4AIS A;  2YDQ A;  4H9Q C;  4PK6 A;  5LBM A;  2MBG A;  4I55 E;  2WDV A;  4HFC A;  2WQY A;  2H7V C;  3FB2 A;  3OBV E;  4X65 T;  5IYZ E;  5J2U E;  4IHJ E;  2N9D A;  4JI6 T;  5AQQ B;  4PW8 A;  5LHI B;  4PNI A;  4MLK A;  1NEK A;  3Q5W A;  2KZ7 B;  2C5I T;  4JI8 T;  4ILC A;  3ZMZ B;  4DID B;  3Q5D A;  3ZJ2 A;  3AAI A;  3UU6 A;  2V7L A;  4AXP A;  5JTG A;  2DWK A;  3V5U A;  3RI5 A;  4L5G A;  4Z91 A;  2M6I A;  4U2Y A;  3PUX F;  1MMA A;  1FEW A;  2IIU A;  5AQI B;  1MIV A;  2W62 A;  4ISS A;  3EDU A;  3AE7 A;  2JQQ A;  1OXZ A;  1XNR T;  3Q5E A;  3ZPO A;  2W67 A;  3A8Y C;  1SE7 A;  3AE8 A;  5GON E;  2B76 A;  1WCR A;  2NWB A;  2ES0 A;  2KWH A;  3EVY A;  2WCA A;  3OPC A;  2CPT A;  2W61 A;  1BR0 A;  3AXJ B;  3AE6 A;  2CWY A;  1N32 T;  4ILB A;  2V6Y A;  3ONJ A;  3RH3 A;  4UF0 B;  5L4E A;  4PJN A;  1XNQ T;  4P0B A;  5FVK A;  5AQJ B;  3ZEF B;  5HEG A;  5J2T E;  4AQG A;  3X1D A;  3RKG A;  1N36 T;  2ZM6 T;  3NZQ A;  5FXZ A;  2BS4 A;  5H6R B;  2DWG A;  4QWN B;  2LM2 A;  5LMU T;  2A9U A;  4IE4 A;  1D1B A;  3AAE B;  4IDZ A;  1MMG A;  4MAL A;  2LSI A;  5HXC A;  2WSS V;  4TWF A;  5IWA T;  1WR6 A;  1OED A;  1VOM A;  2QVA A;  3MK7 C;  5JDM A;  4LF9 T;  4KMC A;  3ZCJ A;  4IT4 A;  2I59 A;  1IBK T;  1ZOY A;  5AQP B;  1HR0 T;  3ESL A;  2W66 A;  4DR4 T;  4TX5 A;  2CXF A;  1YW0 A;  3M65 A;  2LT3 A;  1Y01 A;  4UVA B;  1U4Q A;  3FXE B;  2BVM A;  3UFE A;  2MAW A;  4TNV A;  2MOZ A;  1GQE A;  3ZT5 A;  4IL9 A;  2LKG A;  4UXN B;  1E2A A;  2KIN B;  2MPK A;  2XAS B;  3PUZ F;  2XUE A;  2VKD A;  1MNE A;  2EHO D;  2A2F X;  4HFD A;  4EED A;  3DTO A;  2VAS A;  2QRX A;  3T1Y T;  3DJB A;  3IHR A;  2V5D A;  3P4Q A;  3K8P C;  5F3J A;  3VR9 A;  3M3Z B;  5DQV A;  2X0H A;  4DMW A;  5AQM B;  1U5P A;  1UX5 A;  1S94 A;  4XBF B;  3L8R A;  3PUR A;  1CHU A;  2AXD S;  3JCF A;  3LDQ B;  1KF6 A;  3GA8 A;  2EHO C;  4GYR A;  1LKX A;  1HG2 A;  2LSY A;  3BQL A;  2UUB T;  3GMI A;  3OVU A;  4IE6 A;  4HFV A;  2Q9Q D;  1CUN A;  3N9Q A;  4PFP A;  5AQH B;  4KUM B;  4XZC A;  4NUU A;  3HR0 A;  4EYU A;  1SA0 E;  3HKD E;  2N2N A;  5IHY A;  5LYJ E;  3ANW A;  4HGA A;  2WDQ A;  2K48 A;  4H9P C;  3ETV A;  3AA1 B;  1QUU A;  4UVC B;  1WFD A;  4YSZ A;  2CMR A;  5EK3 A;  4OHF A;  2W4X A;  3ZT6 A;  3BQK A;  2X9Y A;  1YQ3 A;  1ZP0 A;  3FZL B;  5C8Y E;  4ANJ A;  1XMQ T;  4DBR A;  1HX8 A;  3K1S A;  1W09 A;  2VK9 A;  2E8I A;  4N78 D;  1LVF A;  5LMN T;  3SS1 A;  2ZMA A;  2UXN B;  1HCI A;  1J5E T;  1D1C A;  1JNZ A;  2Q9Q B;  3R6N A;  3GN5 B;  1XWM A;  5EK2 A;  5AQG B;  3UTK A;  5JDG A;  2L3L A;  4QXB B;  2D2S A;  5JQG E;  2YOE A;  3UFG A;  3V5S A;  4U74 A;  2HH7 A;  3OTO T;  4HWI B;  2LRK A;  5CB4 E;  4JEH B;  2L9Q A;  4IE0 A;  5AQO B;  2NW7 A;  2XQ9 A;  2CE7 A;  4L9I A;  3PUW F;  4ZS3 A;  1IZN B;  2D9D A;  2X68 A;  4LFC T;  5CGM A;  4DV3 T;  3MAC A;  2WWU A;  3VKH A;  1WRD A;  2LOS A;  4LMK A;  1IAP A;  4UR9 A;  2BKO A;  3UQ7 A;  3FZM B;  3FXD B;  2XQA A;  4ZI3 D;  4B3M T;  4HWD A;  3I9W A;  1YQ4 A;  3MZK B;  3RF1 A;  4PJJ A;  3R84 B;  2NTX A;  1UGO A;  3FBZ A;  3VHL A;  4ADZ A;  1OED C;  4COF A;  2VB6 A;  3LG7 A;  3N9N A;  4OFZ A;  3UUX B;  2KSR A;  3ZMU B;  3PV0 F;  3AA0 B;  4HFB A;  4G63 A;  4OYJ A;  2YDS A;  3AE4 A;  2UUC T;  3OYZ A;  2NTY A;  3OJA A;  4JBW F;  5ABG A;  3AEB A;  3N2O A;  4IST A;  3JC6 C;  2V26 A;  3RX6 A;  2CM0 A;  4TZ4 C;  5F5W A;  5JRE A;  3O1I A;  4CI2 B;  4EIW A;  4H9S E;  1T7S A;  4TNW A;  5FP3 A;  4IDO A;  3EDV A;  1IJ5 A;  2K24 A;  4EAH A;  2ZM0 A;  2B1E A;  1WYC A;  4B6X A;  5JVD E;  4P09 A;  4EGW A;  4YSY A;  3O4X E;  3NWI A;  4I4T E;  4O4H E;  2RA1 A;  5L4H A;  3CX7 B;  3J9X 1;  2J47 A;  4BJM A;  1E1H B;  2V7K A;  5TAO A;  4X64 T;  1IJ6 A;  3JAF A;  3A7M A;  2VL0 A;  3PUQ A;  5FY1 A;  4GKK T;  4DO0 A;  3C4W A;  4YJ2 E;  3N5L A;  4OYK A;  1LVK A;  3Q5X A;  1US7 B;  4AQF A;  4DV5 T;  2BDE A;  4AKG A;  2FJE A;  2N1G A;  5AQU B;  3UU3 A;  2WWV A;  3RYH E;  1UX4 A;  1HNW T;  5JR9 B;  1BR4 A;  5FY7 A;  1X9B A;  4AQY T;  3ZYL A;  1HTJ F;  2WU2 A;  4PJM A;  2X9W A;  4YY3 T;  3DP7 A;  4UV8 B;  4C90 A;  2LSG A;  3RHW A;  5AQS B;  4DR1 T;  2WDR A;  2K5B B;  2X66 A;  3H3A A;  2PBI A;  4HTE A;  3BK9 A;  2L8K A;  4BAY B;  4AKI A;  3Q9D A;  3NBX X;  1E7P A;  3AED A;  3TLS A;  3B5M A;  2LSJ A;  2HN1 A;  3H3M A;  2BBH A;  4C91 A;  2EHO A;  3RC3 A;  1L0V A;  2WZH A;  2Z6E A;  4IDP A;  4ZOL E;  3CQC B;  1S35 A;  2V5C A;  4FI5 A;  1ZKE A;  4F8H A;  2IW5 B;  4E7Z A;  1G8X A;  2UXB T;  3E08 A;  3VU7 H;  4DR7 T;  5JDN A;  1AJ3 A;  2IML A;  1B7T A;  3O1J A;  3RYF E;  2DCF A;  5ETW A;  4FJO A;  3PU8 A;  2IAK A;  3CK6 A;  1MIY A;  4H63 V;  5FL1 A;  4JEU B;  3ONX A;  4JI2 T;  2H89 A;  3NZP A;  4A56 A;  4I43 B;  2JQ9 A;  2BVL A;  3QC9 A;  2XQY A;  1X79 A;  1N33 T;  1FIO A;  1NEN A;  5JDF A;  2HPJ A;  1KNP A;  2YU1 A;  2WAU A;  4O2B E;  2WBL A;  4ZZB A;  4Q25 A;  5FXV A;  5ABF A;  5LJM A;  3HI2 A;  2DHR A;  4KI0 F;  3ONL C;  2D0U A;  5L3F B;  4TN7 B;  3ZYK A;  4QXH B;  3RC8 A;  2J62 A;  3SWH A;  2LLY A;  1WYB A;  1OED E;  4O2A E;  3WAJ A;  3ABV A;  5HEO A;  2XM1 A;  4WW0 A;  4NUV A;  4KHP T;  1VRB A;  3FZF B;  3NRX A;  4B3S T;  4HFI A;  4M1P A;  1IBM T;  4EZH A;  4EYY R;  4DR2 T;  3HA4 A;  3PUA A;  5JRC B;  3F31 A;  3B13 A;  2NW9 A;  5ADX L;  3E22 E;  3KV6 A;  3RYC E;  2E5V A;  4X1I E;  2V8S V; 
#chains in the Genus database with same CATH homology
 2ODU A;  4GIW A;  1D1C A;  5JRC A;  3CQX C;  3P7I A;  2Q9Q B;  2QGS A;  4ILU A;  3R6N A;  3F2E A;  2PFV A;  2CEA A;  4XAX B;  2ZM8 A;  3GN5 B;  3N9O A;  5EK2 A;  2XHE B;  3UTK A;  1ZHC A;  4AKL A;  3KVA A;  4CZZ B;  5JDG A;  4CXX A;  4CXY A;  4X1K E;  2L3L A;  4UV9 B;  3KFW X;  4YJ3 E;  4QXB B;  3MJX A;  3VKG A;  4GOU A;  5F8P A;  5E0O A;  2D2S A;  2Q9Q A;  4CI3 B;  3ZMT B;  4AQF C;  3L3P A;  5JQG E;  3V5S A;  3CX6 B;  4U74 A;  3GN5 A;  1D0X A;  3C51 A;  4PAG A;  5LG4 A;  2HH7 A;  3KV9 A;  2DLR A;  5JDH A;  1O3X A;  3KDS E;  5HXR A;  5CB4 E;  4JEH B;  3C50 A;  1WLX A;  3SRZ A;  2L9Q A;  4IE0 A;  2NW7 A;  3PDY A;  2LE8 A;  2QA7 A;  1NAF A;  2CE7 A;  2XAH B;  3C98 B;  3LBX B;  3LJC A;  4IIJ E;  4L9I A;  5CA1 E;  4GYS A;  5DJQ C;  4GK0 E;  3CX8 B;  2WMN A;  3C64 A;  3E0Z A;  4ZS3 A;  4HE8 A;  4U72 A;  1IZN B;  5FYM A;  4ZI7 E;  3ZC0 A;  3N9L A;  3FBL A;  2X68 A;  2ODV A;  2D0T A;  1SHZ C;  3TKL B;  5JR9 C;  2BZB A;  3GWH A;  2Y48 B;  3LBX A;  2XAJ B;  3MAC A;  2HPL A;  2LJL A;  2WWU A;  3VKH A;  1WRD A;  3CWZ B;  3U3I A;  4DBQ A;  2LOS A;  3I0O A;  2WMO A;  1IAP A;  3RRC A;  5LGN B;  2Y8D A;  4H9O C;  4HEA A;  5M4Y A;  3N2K E;  3UT5 E;  2YU2 A;  2G0U A;  2E9X B;  5LXT E;  4IGU A;  3CPZ A;  3FXD B;  3RYI E;  5JDQ A;  4UIG A;  4ZI3 D;  1FMV A;  4V1A v;  5FXX A;  4O8S A;  5LP6 E;  5HWY A;  2IC6 A;  3I9W A;  3H37 A;  5BMV E;  1BR1 A;  2X9H A;  2X0L B;  3MZK B;  2JMK A;  3F57 A;  4PJJ A;  3O9X A;  3R84 B;  5LGT B;  2VWA A;  5LHG B;  5FXW A;  2NTX A;  2E9X A;  3FBZ A;  4H63 H;  4HN9 A;  2XTL A;  3VHL A;  4L0R A;  2KXP B;  1KK7 A;  3FHN A;  4ADZ A;  4PJL A;  2VB6 A;  3LG7 A;  3CKD A;  3N9N A;  4IE5 A;  4OFZ A;  3UUX B;  1D0Z A;  4MFR A;  3SOL A;  3QK6 A;  3RRW A;  2XAF B;  3ZMU B;  3HKC E;  1YKH B;  4WNK A;  2Y6X A;  3UUM A;  3PTR B;  3AA0 B;  1MMD A;  2VKO A;  4G63 A;  4OYJ A;  3J7Y q;  4AKH A;  5LJN A;  4UVB B;  3B57 A;  4H9R C;  4QKN A;  3OYZ A;  2NTY A;  1LRZ A;  2JMH A;  3OJA A;  1MND A;  4AI6 A;  2RP4 A;  3N2O A;  1MMN A;  2CLY C;  3CQG B;  2X51 A;  5LOV E;  2W0G A;  4TUY E;  4IST A;  3MA9 A;  1FMW A;  2V26 A;  3JC6 C;  3RX6 A;  2CM0 A;  3KV4 A;  3LFM A;  4TZ4 C;  5LA6 E;  2A3D A;  4ASK A;  3CVR A;  5JRE A;  3IEE A;  3O1I A;  4CI2 B;  4EIW A;  4H9S E;  3BQI A;  3KBU A;  2KND A;  5FP3 A;  2Q9Q C;  2CXL A;  3W15 B;  2K9A A;  5KDM C;  1T98 A;  3EDV A;  2YIN A;  1IJ5 A;  2K24 A;  4EAH A;  4O4I E;  2ZM0 A;  2B1E A;  2MYS A;  4H9Q C;  4PK6 A;  3KV5 A;  5LBM A;  2MBG A;  1WYC A;  4I55 E;  4B6X A;  5CA0 E;  3LK3 B;  3HKB E;  2A72 A;  4P09 A;  5JVD E;  2H7V C;  2J1D G;  3FB2 A;  3ZYM A;  1BR2 A;  2P9B A;  3OBV E;  4OK0 A;  3IBP A;  4I50 E;  3PUS A;  3T8O A;  5IYZ E;  5J2U E;  3O4X E;  4IHJ E;  2E9X D;  2N9D A;  4I4T E;  3I0Q A;  4YLH A;  4AKR B;  4H9N C;  3LK2 B;  4O4H E;  2RA1 A;  4PW8 A;  3CX7 B;  3J9X 1;  5LHI B;  4PNI A;  3C4Z A;  4ZI2 D;  4MLK A;  4BJM A;  3Q5W A;  1E1H B;  2V7K A;  5TAO A;  2KZ7 B;  2C5I T;  5FMN A;  1IJ6 A;  4QHO A;  3ZMZ B;  4HKA A;  5HYA A;  2X67 A;  3ZJ2 A;  4BJN A;  3PUG A;  3AAI A;  2V7L A;  3PUQ A;  4AXP A;  5FY1 A;  2DWK A;  3V5U A;  4DO0 A;  3C4W A;  4YJ2 E;  2VKJ A;  4L5G A;  3N2G E;  4WBO A;  3N5L A;  5JH7 E;  4OYK A;  1LVK A;  3HKE E;  1ZV4 X;  3Q5X A;  2V7M A;  4PK5 A;  1MMA A;  1US7 B;  2LHN A;  4DVD A;  4AQF A;  4GK5 E;  1HS7 A;  3ZCI A;  4EXT A;  2BDE A;  2C0S A;  1FEW A;  3MXZ A;  5KMG P;  4AKG A;  3WI3 A;  2N1G A;  1MIV A;  5FNV E;  3RYH E;  2W62 A;  1UX4 A;  3EDU A;  4ISS A;  4K0U A;  2JQQ A;  5JR9 B;  1OXZ A;  2E9X C;  1BR4 A;  5FY7 A;  3WAK A;  3ZYL A;  2LOP A;  1HTJ F;  3ZPO A;  4PJM A;  4WBN E;  2X9W A;  4Z8X A;  3DP7 A;  4EZ4 A;  4UV8 B;  4C90 A;  2LSG A;  4PFO A;  5DQW A;  5GON E;  2NWB A;  2PG8 A;  3KIN B;  5LGU B;  4ZI2 C;  2OA5 A;  2ES0 A;  2K5B B;  2KWH A;  3EVY A;  5J1G A;  2NP9 A;  2X66 A;  3H3A A;  5L3E B;  2PBI A;  5EZY E;  4HTE A;  4E7S A;  5LHH B;  2W61 A;  5JR9 A;  3BK9 A;  2NOX A;  2L8K A;  4BAY B;  3LK4 2;  1BR0 A;  4AKI A;  2XAQ B;  2CWY A;  2EHO B;  3HL6 A;  3Q9D A;  3U78 A;  2KLQ A;  3NBX X;  5L2L A;  3OKQ A;  2LM9 A;  5L3B B;  2C5J A;  3RH3 A;  4UF0 B;  2X9X A;  2DI4 A;  4O4L E;  2KWI B;  2JJ9 A;  4PJN A;  1ZEE A;  4KP3 C;  4P0B A;  2NW8 A;  4UEL A;  2LSJ A;  2C5K T;  3ZEF B;  2ZM2 A;  4C91 A;  5J2T E;  2EHO A;  3CML A;  3ZMV B;  2ZLY A;  4AQG A;  2D5U A;  2MTQ A;  3RC3 A;  2H3R A;  3NZQ A;  2Z6E A;  5FXZ A;  5H6R B;  4ZOL E;  2DWG A;  4X20 E;  3N9M A;  4QWN B;  4UF0 A;  4IE4 A;  3IF8 B;  1D1B A;  2KMF A;  3AAE B;  3CQC B;  4IDZ A;  1MMG A;  4ZI3 C;  1S35 A;  4MAL A;  2LSI A;  3K3O A;  5HXC A;  2WSS V;  4FI5 A;  1ZKE A;  1WR6 A;  1YD8 G;  3ZLI A;  1QSD A;  1VOM A;  3MK7 C;  2IW5 B;  3O1H A;  3RKO A;  5JDM A;  4E7Z A;  4DND A;  4KMC A;  3ZCJ A;  2I59 A;  3AA6 B;  1G8X A;  5H6Q B;  4YFS A;  3E08 A;  3VU7 H;  5FY0 A;  5JDN A;  1AJ3 A;  2KT9 A;  3ESL A;  1B7T A;  4J2C A;  4TX5 A;  2CXF A;  1YW0 A;  3M65 A;  3KVB A;  2LT3 A;  1OWA A;  2UXX B;  3O1J A;  4UVA B;  3RYF E;  1HFA A;  1U4Q A;  4EB6 E;  2DCF A;  5ETW A;  2IC9 A;  2M67 A;  4FJO A;  3UUN A;  1H7C A;  3PU8 A;  4TV8 E;  5L3D B;  4QXC B;  3P8C D;  3FXE B;  1HG5 A;  3AVS A;  2IAK A;  3N9P A;  1MIY A;  2BVM A;  4H63 V;  3I9Y A;  2JPF A;  3UFE A;  2MOZ A;  5L3G B;  5HAX A;  4JEU B;  5HWX A;  3ONX A;  2V1D B;  3NRY A;  4UXN B;  4ZS2 A;  2KIN B;  3ZMS B;  2VKH A;  4ZHQ E;  2XAS B;  2XUE A;  1HF8 A;  3AAA B;  2VKD A;  3RPU A;  3NZP A;  4A56 A;  1MNE A;  2LHR A;  1YKE B;  4I43 B;  3ZC1 A;  2EHO D;  2A2F X;  1Y64 B;  1G73 A;  4X1Y E;  2CXD A;  5HXH A;  4BA9 A;  2SPC A;  4QX8 B;  3DTO A;  4TV9 E;  2VAS A;  3QUJ A;  2BVL A;  2DNX A;  3L09 A;  3QC9 A;  2XQY A;  1X79 A;  3AVR A;  4JUY A;  3DJB A;  3IHR A;  5KX5 E;  2JRK A;  5HXS A;  1FIO A;  2W63 A;  3AA7 B;  4CXW A;  3K8P C;  5JDF A;  5F3J A;  3OYX A;  2HPJ A;  2YK0 A;  3I1A A;  1D1A A;  5DQV A;  5LBQ B;  2YU1 A;  4G2A A;  4CQI A;  4DMW A;  2WAU A;  4O2B E;  2WBL A;  3PE0 A;  5FXV A;  4PK4 A;  1U5P A;  1UX5 A;  1S94 A;  4XBF B;  4IE7 A;  1V9D A;  3MKD A;  1Z0P A;  3C4X A;  2XAG B;  3PUR A;  5LJM A;  4YHJ A;  3HI2 A;  4O4J E;  3ZN0 B;  3UUL A;  4DMV A;  4P0A A;  2DHR A;  2V7J A;  4KBM B;  2LSK A;  3GA8 A;  3ZN1 B;  4ERR A;  2D0U A;  3JC6 D;  2EHO C;  4GYR A;  5L3F B;  1LKX A;  1HG2 A;  3Q2M A;  2LSY A;  5LNK A;  4TN7 B;  3BQL A;  3K3N A;  2V7I A;  1EZ3 A;  3ZYK A;  3ANW B;  3GMI A;  3D0T A;  4IE6 A;  4HFV A;  2Q9Q D;  1CUN A;  3N9Q A;  3A5X A;  4PFP A;  5DAB A;  5LCY A;  4KUM B;  4QXH B;  4XZC A;  4MBQ A;  2GK9 A;  4NUU A;  3KBT A;  3RC8 A;  2YEV C;  2ACX A;  1MIW A;  3SWH A;  1WYB A;  3HR0 A;  4EYU A;  1SA0 E;  3HKD E;  5AFU L;  2N2N A;  4O2A E;  5IHY A;  2H7O A;  3WAJ A;  5LYJ E;  5JDL A;  3ANW A;  4HGA A;  2CWO A;  2LEH A;  2K48 A;  4H9P C;  2W00 A;  3ETV A;  1UCU A;  3AA1 B;  4WW0 A;  4NUV A;  1QUU A;  1VRB A;  3AB3 B;  5EK4 A;  4UVC B;  5L3C B;  3NRX A;  4EOZ B;  4JLE A;  2WM9 A;  4M1P A;  3S4U A;  5A1L A;  4CI1 B;  4F6R C;  2CMR A;  4EZH A;  3K3Q C;  5EK3 A;  4OHF A;  4EYY R;  3BQK A;  3HA4 A;  2X9Y A;  4UEM A;  1KNZ A;  3PUA A;  5C8Y E;  3ZJ1 A;  5JRC B;  4ANJ A;  4QX7 B;  2CA5 A;  2CLY B;  4DBR A;  1HX8 A;  3F31 A;  3B13 A;  2NW9 A;  3PU3 A;  5ADX L;  1NWM X;  2CCQ A;  3E22 E;  3KV6 A;  1D0Y A;  2VK9 A;  2E8I A;  2VL8 A;  3RYC E;  4N78 D;  3ETU A;  4MHC A;  3EUH A;  4X1I E;  2PJQ A;  1LVF A;  5HXE A;  3SS1 A;  2ZMA A;  2UXN B;  1HCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...