3JC6D

Structure of the eukaryotic replicative cmg helicase and pumpjack motion
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
221
Chain Sequence
VSPQQDFSDLMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNESKLPLLCMETELERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEIKYHDTHSLIWLKLVNDSILKYMPEELQAINDTEGSVNMIDEPDWNKFVFIHVNGPPDGENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEVIRDLLRDDKVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the eukaryotic replicative CMG helicase suggests a pumpjack motion for translocation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords DNA replication licensing factor MCM2
total genus 56
structure length 221
sequence length 240
ec nomenclature
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
D PF16922 SLD5_C DNA replication complex GINS protein SLD5 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3jc6D01
2EHOB 2EHOA 2E9XD 2E9XA 2Q9QB 3ANWA 3JC6D 2Q9QC
chains in the Genus database with same CATH superfamily
2VKDA 3ZC1A 4LF7T 4A98A 3RYIE 2BKNA 2JJ9A 2W67A 2XQ6A 3NWIA 3UU8A 1M7KA 4LMJA 5AQSB 3ZEFB 4NPPA 3JADA 3AA6B 1WLXA 4O4LE 4UV8B 1Y64B 3TLWA 4LMLA 5LP6E 3AVSA 2CPTA 1GQEA 3AECA 2FJBA 3P4WA 4C91A 4HFVA 4I50E 2XUEA 4KX6A 4YLHA 1YQ4A 1J5ET 2XY8B 3C4XA 4PJMA 4YT0A 5KMGP 2I6HA 1NENA 3CX6B 5L3CB 3D0TA 5FXXA 4P1NA 4EYYR 5L3EB 3DJBA 2LM9A 1MNEA 2K9AA 5AQMB 4TV9E 5AQKB 4OX9T 3U78A 1VCSA 1YQ3A 5JTGA 2WWVA 4DR3T 1IBMT 2SPCA 3N9NA 4EZ4A 3OYZA 2UUCT 4IDZA 4NXMT 3AEDA 2VKHA 3VRAA 2LRKA 3RPUA 2XASB 1EZ3A 2OLTA 3PJAA 2ACXA 1B7TA 2E2AA 4KMCA 4QX8B 3NBXX 4IE6A 2H89A 2I59A 2K24A 2DL1A 5HXHA 4IL4A 4MFRA 2W00A 1WFDA 2CA5A 2W61A 2FBWA 4YFSA 1NWMX 2J4GA 4QXCB 5DABA 2YK0A 2VL8A 2LSIA 5AQJB 3ZSSA 2CE7A 5CA1E 5HXSA 5L3FB 1ZKEA 2X68A 4IL9A 4AQYT 5LYJE 2EHOD 1ZP0A 1VCTA 2XQ7A 2YDQA 2XQ9A 3RHWA 5L4HA 5AQNB 2E8IA 4ZXLA 3H3AA 4AKLA 2VVNA 3GA8A 1G8XA 2NW8A 3P7IA 1FEWA 1XZYA 4UIGA 4BJNA 1KFYA 3CPZA 5HEOA 1I6ZA 2BKOA 2V8SV 2WU2A 4ZI7E 3ZMZB 1XWMA 4UVBB 4DR2T 3CQXC 2V7IA 3OPCA 3PV0F 5JDGA 3E08A 1WR0A 5AQHB 3EI0A 3PE0A 5ABGA 4JI4T 4HFBA 2WWUA 3ZSTA 4I55E 4ERRA 1LVKA 2Q9QB 3QK6A 3VR9A 4JI1T 2JIWA 2YDSA 2WDQA 3EAMA 3N9PA 4IT4A 2K3WA 3CIRA 2ZM8A 4JI8T 3K3OA 5AQIB 1SA0E 2F4VT 1QSDA 4OHFA 2XM2A 3AE6A 5M4YA 4JV5T 1IZNB 1S94A 2LE8A 3ZPOA 5EK4A 3EVYA 2CXFA 2ZLYA 5HXRA 4ZS3A 1WYCA 1IJ6A 4ILUA 3GWHA 5DQVA 2WMOA 3CX8B 3RKGA 3ONXA 3AE9A 2UXDT 4GKJT 2X9HA 3HR0A 2QRXA 4I0UA 2K5BB 2W62A 4B6XA 2WCAA 5F3JA 2DWKA 5LMNT 2V7LA 3ANWA 4TWDA 4DO0A 3A7MA 3CWZB 2VURA 1HG5A 1HX8A 1T72A 5J0ZA 3QB5A 2D0TA 4PFOA 4PK4A 5AQGB 4DMVA 4HWFA 4X62T 2Z6EA 3Q5XA 3ZJ2A 2X9XA 2Q9QC 3PURA 4GK0E 2PBIA 3MA9A 4ZI3C 3VRBA 5LHIB 4ADZA 3UFGA 5EK2A 3WAKA 3ZKRA 5ABFA 3N9LA 1E7PA 3UU6A 3B5MA 4UR9A 5LG3A 4HFCA 2N2NA 4OYKA 2NP9A 4QX7B 5FXVA 4DUZT 4U31A 5HEHA 3L39A 2VWAA 3PUZF 2VL0A 4YTPA 1Z0PA 2X0YA 2LOSA 3UU3A 1M62A 2BG9B 4H9QC 4U2YA 2BS3A 2JRKA 2DNXA 5LB7B 3WI3A 3SWHA 3LSVA 4WBNE 2LLYA 3AXJB 3NZPA 3OJAA 2LRLA 5AQFB 2WS3A 5CGMA 3LBXA 4HEAA 2CBJA 4P09A 4KHZF 2XQ5A 4AKRB 4E7ZA 4DVDA 1JNZA 3EDVA 4H9OC 4L9IA 4HN9A 4O4IE 4QH5A 4O4JE 4B3TT 3TLTA 5J2UE 4JI6T 2L8KA 3JAEA 3AAAB 2WP9A 4TWHA 1FMWA 4EGWA 3O4XE 3SS1A 2V5DA 3RYCE 2XAGB 4JEHB 2IW5B 4HFDA 4ILCA 2VB6A 5FY1A 2LKGA 4UVAB 2IUBA 2RPAA 3C51A 3IA3A 4EZHA 3AAEB 3KINB 4HFHA 4U33A 2ZM2A 1OEDA 3QC9A 4WBOA 2WY2A 4QKNA 2C5KT 4AKHA 5HWYA 5FNVE 4TV8E 3HKDE 1J5WA 2VQFT 2MTQA 4IHJE 3O1JA 3ZJ1A 1BR0A 2KNDA 3Q2MA 1DU2A 1BR4A 5LJMA 5HEJA 4HWIB 3AEBA 2FJEA 2KLQA 2C5JA 2J47A 2W2UA 3GN5B 5LGUB 3NVOA 3MZKB 2KMFA 3DP7A 3UU5A 3C50A 3K1SA 2KXPB 2BG9A 4JLEA 2V5CA 5AQPB 5F8PA 1T98A 5JREA 3AE4A 4J2CA 4NUUA 2HHHT 4K0UA 2CWOA 2IDOB 2LEHA 2W0GA 2XQ4A 2BS2A 3N2KE 4IGUA 4QXBB 3E0ZA 4WW0A 5HWXA 4EAHA 4A5XA 3LBXB 1JNRA 1OXZA 2JMHA 3KDSE 3ZLIA 2Y8DA 4I43B 4HWDA 4C90A 5A1LA 4ZEYA 4CXYA 4K0KT 5FL0A 4CN6A 2IMLA 5L3GB 2WZHA 3KV5A 4HE8A 1MNDA 2DHRA 4AQFA 4B3MT 4OYJA 3W15B 1XMQT 3T1HT 2NR4A 1WYBA 3JC6C 3KV9A 1W9RA 3EHZA 3GN5A 5FY0A 5L47A 4NXNT 2VKJA 1FMVA 1WR6A 1BR2A 2J62A 3ETVA 2XTLA 2CRBA 4O2AE 5FP3A 3DTOA 5F5WA 3UUBA 1LKXA 4CZZB 2L9QA 4EEBA 3SOLA 4LF6T 2WDRA 3BQIA 3C98B 5JR9C 4YHJA 1HFAA 2ODVA 5LHGB 3AE3A 1ZEEA 3C4ZA 3CVRA 3AE7A 4ILBA 4WZXA 3IHRA 4MLKA 5AQRB 3OBVE 2WAUA 3RX6A 1HF8A 3UUXB 3AEFA 3P4SA 2X0LB 3AA0B 4NIQA 3LFMA 3RKOA 3K3QC 2LHRA 4YSYA 1HTJF 2V7KA 1U4QA 1O3XA 2JQKA 4KI0F 3R84B 3RIUC 5JDMA 1E2AA 1KNRA 4JUYA 4O2BE 4ZS2A 4NUVA 5ETWA 4JI5T 4DV2T 2D5UA 4U2ZA 5JDQA 1D1AA 1IAPA 1LRZA 4WYVA 3MXZA 4H9NC 2CXDA 4KBMB 4YTNA 2XJ7A 2EHOC 3MK7C 4HTEA 2CEAA 4U74A 5CA0E 1X9BA 3GMIA 3LDQB 5HCJA 3TLVA 1R8IA 2LJLA 1UX4A 4IDNA 3ONJA 3PU8A 4E7SA 1N34T 3AVRA 2BBJA 5AQTB 2B76A 2DWGA 3ABVA 1MIYA 3PUSA 4FJOA 3UTKA 3IBPA 4HGAA 1D0ZA 3G06A 3I1AA 5LG4A 2C5IT 4AKIA 4DV4T 4DR4T 2BKPA 2YEVC 4EV6A 3OTOT 4V1Av 3PUGA 5JQGE 1G73A 2LM2A 1UUSA 3E22E 4MBQA 4CXWA 3QNUA 2NW7A 3UQ4A 4AQFC 5AFUL 1XMOT 1NAFA 3N9MA 4X64T 1QUUA 4CQIA 4YHHT 2ES0A 3PDYA 3AA1B 2NOXA 3T8OA 2YINA 2LSYA 4ILAA 4KHPT 3J7Yq 1AJ3A 3L09A 5H6RB 2KT9A 3SFDA 4DMWA 3KV4A 3N2GE 4B3RT 3AE5A 4JI7T 3CQGB 3TLUA 1N36T 3AB3B 2VQET 2JQQA 2JMKA 3CKDA 2BG9E 2BS4A 3BK9A 4IE5A 5DJQC 3S4UA 1KF6A 4P0BA 4GKKT 4PW8A 3UUMA 5ABFB 2KSRA 3H3MA 4N78D 3ZC0A 1T8BA 2HN2A 1VOMA 4TWFA 5J1GA 4PJLA 3ZCIA 4EB6E 3RRCA 3L3PA 1YKHB 3AA7B 4Z90A 3KV6A 3RC3A 4DV5T 2CHOA 3VU7H 3NZQA 5IUXA 5JDFA 3UUNA 2BVLA 4M1PA 2W66A 4JI2T 1HNZT 3ZMTB 2V7MA 3QOFA 4IREA 2XAJB 1FIOA 4LFBT 4A56A 2LKHA 2UXXB 5IHYA 3FXEB 3JC6D 4ZI2D 5JDHA 2RA1A 2BVMA 1HX1B 1FJGT 2H88A 4LF5T 2X9YA 3K8PC 2X66A 4UXNB 3I0QA 4CN1A 4YXDA 4JEUB 4ZOLE 5FY7A 2A3DA 2AE9A 1X79A 4JBWF 3V5UA 1WRDA 3AEAA 2OV9A 3F2EA 2N1GA 4UVCB 5ABEA 2BBHA 2H3RA 4CI2B 5L2LA 2H7OA 1D1CA 5H6QB 4DR5T 4AISA 3ZMUB 4BJMA 2LHNA 4AIUA 3FBZA 3PUXF 3EUHA 3H37A 4UELA 5BR8T 3Q5WA 2BZBA 3FB2A 4H9PC 1OEDB 2CXLA 4PFPA 2GK9A 4UEMA 5HYAA 2H7VC 3HKEE 4EIWA 5JRCB 3PUAA 4JYAT 3MKDA 2Y6XA 4DNDA 2YKSA 1HNWT 3MACA 4YTMA 1ZHCA 3P4QA 1SHZC 3AEEA 2IC6A 3FXDB 3PJAJ 5LMUT 3ETUA 3C4WA 4WNKA 4HFIA 2DLRA 4DIDB 2E5LT 3I9WA 4OK0A 1XDOA 3ZMSB 2XQ3A 4LMKA 5LBQB 1IJ5A 3CK6A 4B3ST 4IE0A 5JDLA 4DV0T 4YSXA 2E9XD 4FI5A 4JI0T 2KZ7B 2XQ8A 3N9OA 3FZLB 4OFZA 4ZI2C 3PUYF 3TKLB 4F6RC 3RQWA 2AXDS 2XSAA 1CUNA 4YJ2E 4X1KE 4Q25A 4ZZCA 3N5LA 5KX5E 4XAXB 1KNZA 4PNIA 3EABA 5AQVB 1YD8G 2CCQA 4PJNA 3LG7A 1I94T 2NWBA 2CLYC 2HPJA 3R6NA 4TX5A 2LSJA 3RI5A 3CQCB 1XNRT 4PK5A 2WM9A 3HKCE 5C2TA 2NTYA 2WDVA 2WU5A 3VHLA 2KWIB 2V6XA 3VR8A 5ABHA 3KBUA 4UF0B 1ZV4X 2IAKA 3RIAA 4QH4A 5L3DB 4ISSA 3AE8A 2CMRA 4DUYT 3AAIA 5HEUA 2P9BA 3FZKB 4X1IE 1L0VA 2DI4A 4HWCA 3Q5EA 4AQGA 4DR1T 4IDOA 2D0UA 4HKAA 1NEKA 4HWHA 2XAQB 2NW9A 4LF8T 2E9XB 3RYHE 2CWYA 2CBIA 2QA7A 4L0RA 2WSSV 1W0BA 2BDEA 2NTXA 2XAHB 3CMLA 3AE2A 4QH1A 5LGNB 4KUMB 4LF4T 4LF9T 3HL6A 2VKOA 2V26A 2YDRA 3M3ZB 4TNVA 5AQOB 2MBGA 2K48A 2G0UA 3O1IA 4UF0A 4KP3C 5FXZA 3ZN1B 5IWAT 1OEDC 3T1YT 3RC8A 2WMNA 5ADXL 3O1HA 4AKGA 4IIJE 1HR0T 4U3CA 1MIVA 1YKEB 2KWHA 2MOZA 2W63A 2C0SA 3OKQA 3ZCJA 1U5PA 1UX5A 4CN4A 5L4EA 5JRCA 1D1BA 4CI1B 2V6YA 4EEDA 2DCFA 4MALA 1OWAA 2X51A 4L5GA 1XNQT 1KNPA 2A2FX 2XZEA 3HKBE 1HCIA 4U7IA 5HEGA 3PUQA 3UT5E 1HNXT 4A97A 5KDMC 2XM1A 5JH7E 3ZYLA 2I0MA 4X20E 1S35A 3ZT6A 1SUMB 5EZYE 3P4RA 2V7JA 3NRXA 2XQAA 3RGLA 2E5VA 3LK3B 4QHOA 4BA9A 4CXXA 3B13A 5KXJA 2UXCT 1MMNA 2EHOB 3QB5K 2M6BA 3CX7B 1MMGA 4X66T 1D0YA 3HI2A 3OVUA 1D0XA 5AQLB 3L8RA 1J1JA 4X5TA 3V5SA 2WB5A 3FHNA 4ANJA 5BMVE 3AEGA 3PU3A 4X65T 4QWNB 4ISTA 4PK6A 2LSGA 2RP4A 2M67A 3ZMVB 4YSZA 4F8HA 2IC9A 2QVAA 3Q5DA 4G2AA 5LXTE 2VASA 4O8SA 1CHUA 3JCFA 3O9XA 3RRWA 2JQ9A 1BR1A 2KINB 4IE7A 3N2OA 5E0OA 3RIFA 3N9QA 2Q9QD 2E9XA 4MHCA 1W09A 4LFAT 3TLSA 1W0AA 2UXBT 3UFEA 1MMDA 3P8CD 1US7B 1ZOYA 3PTRB 4U7YA 2PFVA 3X1DA 4TZ4C 2BG9C 2WQYA 2Y48B 4GK5E 2B1EA 2XHEB 4HFEA 2R6GF 4IDQA 4IDPA 2Q9QA 2XAFB 4QXHB 5AQQB 1QLBA 4GYRA 5JVDE 4LFCT 4DR7T 1N32T 2FJAA 2YOEA 3KBTA 3RLFF 4EYUA 5HXEA 3WAJA 2HH7A 5FMNA 3K3NA 3ESLA 2XPKA 3M65A 1UURA 3KVBA 2D9DA 3LK42 4IE4A 2E9XC 4TNWA 5LCYA 5FL1A 2XSBA 3FZFB 4Z91A 4ZZBA 2QGSA 4AI6A 3I9YA 2HPLA 3FBLA 2J1DG 2X0HA 3KFWX 3ONLC 2VK9A 3I0OA 4H63V 4O4HE 2A9UA 4Z8XA 1UCUA 4UV9B 2LT3A 5J2TE 2XQYA 3BQLA 4DV3T 3ZYKA 1V9DA 2MAWA 2YN6A 3NRYA 4U72A 1OEDE 3ANWB 3HA4A 4CI3B 1YW0A 5IYZE 2X67A 4DR6T 5AQUB 1KK7A 5JR9A 1IBLT 1E1HB 2JQHA 2IHR1 4AXPA 3A5XA 5EK3A 3AE1A 3LK2B 3QUJA 1SE7A 3F57A 4X1YE 3UQ7A 1H7CA 2ACZA 2V6YB 3P50A 5FYMA 2ODUA 5TAOA 2HN1A 4H9SE 1HS7A 3KVAA 4YJ3E 3IEEA 2X9WA 3UULA 5DQWA 5FVKA 2FUPA 4GIWA 4ASKA 5FVLA 5LA6E 4ZI3D 5LOVE 3NKZA 2IIUA 2ZM0A 2A72A 2LOPA 2PJQA 3MJXA 2MPKA 3SFEA 2CHNA 2V1DB 5LJNA 2ZM6T 1YXRA 4JI3T 5LBMA 2EHOA 3RQUA 4YY3T 2LSKA 4XBFB 3UU4A 2OA5A 2YU2A 4EXTA 4GOUA 4H63H 4DBQA 4DBRA 3SRZA 5JR9B 3A8YC 4DV7T 1VRBA 2YU1A 4TUYE 3FZMB 1IBKT 5FXWA 4ZHQE 5L3BB 2UUBT 3VKHA 1UK5A 2ZMAA 1MMAA 2QYWA 2WBLA 3AXJA 5HXCA 1MIWA 2UU9T 5LGTB 5LNKA 2D2SA 3J9X1 1LVFA 1HG2A 2W4XA 3C64A 3ZT5A 1N33T 5HAXA 3ZYMA 2VVSA 4DV6T 4BAYB 4H9RC 5CFBA 2UXNB 3F31A 3LJCA 3IF8B 1Y01A 5HCMA 2JPFA 2FJDA 1Z8UA 4EOZB 5C8YE 3RF1A 3B57A 1WCRA 1XDPA 1UGOA 2PG8A 4GYSA 4P0AA 3VKGA 5CB4E 3P4PA 3EDUA 2N9DA 3PUVF 5CJ5A 2M6IA 2WZIA 4TN7B 3ZN0B 4PJJA 2CM0A 3ZT7A 3U3IA 1KEYA 2UUAT 4PAGA 5C3JA 5GONE 3FZHB 3JAFA 1T7SA 2MYSA 3BQKA 3Q9DA 4I4TE 5LHHB 3RIUA 5FKYA 2L3LA 2CLYB 3RH3A 2PTFA 3RYFE 5JDNA 4COFA 3PUWF 4G63A 3OYXA 4XZCA 4DV1T
chains in the Genus database with same CATH topology
2VKDA 3ZC1A 3RYIE 2JJ9A 3ZEFB 4O4LE 3AA6B 1WLXA 4UV8B 1Y64B 3AVSA 4C91A 4HFVA 4I50E 2XUEA 4YLHA 3C4XA 4PJMA 5KMGP 3CX6B 3D0TA 5FXXA 4EYYR 5L3EB 3DJBA 2LM9A 1MNEA 2K9AA 4TV9E 3U78A 2SPCA 3N9NA 4EZ4A 3OYZA 4IDZA 2VKHA 5LP6E 3RPUA 2XASB 1EZ3A 4KMCA 2ACXA 1B7TA 4QX8B 3NBXX 4IE6A 2I59A 2K24A 5HXHA 4MFRA 2W00A 2CA5A 2W61A 4YFSA 1NWMX 5DABA 4QXCB 5CA1E 2YK0A 2VL8A 2LSIA 5HXSA 2CE7A 5L3FB 1ZKEA 2X68A 5LYJE 2EHOD 2E8IA 4AKLA 3H3AA 3GA8A 1G8XA 2NW8A 3P7IA 1FEWA 4UIGA 4BJNA 3CPZA 4ZI7E 3ZMZB 4UVBB 3CQXC 2V7IA 5JDGA 3E08A 3PE0A 2WWUA 4ERRA 4I55E 1LVKA 2Q9QB 3QK6A 3N9PA 2ZM8A 3K3OA 1SA0E 1QSDA 4OHFA 5M4YA 1IZNB 1S94A 2LE8A 3ZPOA 5EK4A 3EVYA 2CXFA 2ZLYA 5HXRA 4ZS3A 1WYCA 1IJ6A 4ILUA 3GWHA 5DQVA 2WMOA 3CX8B 3ONXA 2X9HA 3HR0A 2K5BB 2W62A 4B6XA 5F3JA 2DWKA 2V7LA 3ANWA 4DO0A 3CWZB 1HG5A 1HX8A 4PFOA 2D0TA 4PK4A 4DMVA 2Z6EA 3Q5XA 3ZJ2A 2X9XA 2Q9QC 3PURA 4GK0E 2PBIA 3MA9A 4ZI3C 5LHIB 4ADZA 5EK2A 3WAKA 3N9LA 2N2NA 4OYKA 2NP9A 4QX7B 5FXVA 2VWAA 1Z0PA 2LOSA 4H9QC 3WI3A 2JRKA 2DNXA 3SWHA 4WBNE 3NZPA 3OJAA 3LBXA 4HEAA 4P09A 4AKRB 4E7ZA 4DVDA 3EDVA 4H9OC 4L9IA 4HN9A 4O4IE 4O4JE 5J2UE 2L8KA 3AAAB 1FMWA 3O4XE 3SS1A 3RYCE 2XAGB 4JEHB 2IW5B 2VB6A 5FY1A 4UVAB 3C51A 4EZHA 3AAEB 3KINB 2ZM2A 3QC9A 4WBOA 4QKNA 2C5KT 5HWYA 5FNVE 4TV8E 3HKDE 2MTQA 4IHJE 3O1JA 3ZJ1A 1BR0A 2KNDA 3Q2MA 1BR4A 5LJMA 2KLQA 2C5JA 3GN5B 5LGUB 3MZKB 2KMFA 3DP7A 3C50A 2KXPB 4JLEA 5F8PA 1T98A 5JREA 4J2CA 4NUUA 4K0UA 2CWOA 2LEHA 2W0GA 4QXBB 3N2KE 4AKHA 5HWXA 4IGUA 3E0ZA 4WW0A 4EAHA 3LBXB 1OXZA 3ZLIA 2JMHA 3KDSE 4DBQA 2Y8DA 4I43B 5A1LA 4C90A 4CXYA 5L3GB 3KV5A 4HE8A 1MNDA 2DHRA 4AQFA 4OYJA 3W15B 3JC6C 1WYBA 3KV9A 5FY0A 3GN5A 2VKJA 1WR6A 1FMVA 1BR2A 3ETVA 2XTLA 4O2AE 5FP3A 3DTOA 4CZZB 1LKXA 2L9QA 3SOLA 3C98B 3BQIA 5JR9C 4YHJA 1HFAA 2ODVA 5LHGB 1ZEEA 3C4ZA 3CVRA 3O9XA 3RX6A 3IHRA 4MLKA 3UUXB 3OBVE 2WAUA 1HF8A 2X0LB 3AA0B 3LFMA 3RKOA 3K3QC 2LHRA 1HTJF 2V7KA 1U4QA 1O3XA 3R84B 5JDMA 4JUYA 4O2BE 4ZS2A 4NUVA 5ETWA 2D5UA 5JDQA 1D1AA 1IAPA 1LRZA 5L3CB 3MXZA 4H9NC 2CXDA 4KBMB 2EHOC 3MK7C 4HTEA 2CEAA 4U74A 3GMIA 2LJLA 1UX4A 3PU8A 4E7SA 3AVRA 2DWGA 3PUSA 1MIYA 4FJOA 3UTKA 3IBPA 4HGAA 1D0ZA 5LG4A 3I1AA 4AKIA 2C5IT 2YEVC 4V1Av 3PUGA 5JQGE 1G73A 3E22E 4MBQA 4CXWA 5AFUL 4AQFC 2NW7A 1NAFA 3N9MA 1QUUA 4CQIA 2ES0A 3PDYA 3AA1B 2NOXA 3T8OA 2YINA 2LSYA 1AJ3A 3J7Yq 3L09A 5H6RB 2KT9A 4DMWA 3KV4A 3N2GE 3CQGB 3AB3B 2JQQA 2JMKA 3CKDA 4IE5A 5DJQC 3BK9A 3S4UA 4P0BA 4PW8A 3UUMA 4N78D 3ZC0A 1VOMA 4EB6E 5J1GA 4PJLA 3ZCIA 3RRCA 3L3PA 1YKHB 3AA7B 3KV6A 3RC3A 3VU7H 3NZQA 5JDFA 3UUNA 2BVLA 4M1PA 3ZMTB 2V7MA 2XAJB 1FIOA 4A56A 2UXXB 5IHYA 3FXEB 3JC6D 4ZI2D 5JDHA 2RA1A 2BVMA 2X9YA 3K8PC 2X66A 4UXNB 3I0QA 4JEUB 4ZOLE 5FY7A 2A3DA 1X79A 3V5UA 1WRDA 3F2EA 4UVCB 2N1GA 2H3RA 4CI2B 5L2LA 2H7OA 1D1CA 5H6QB 3ZMUB 4BJMA 2LHNA 3FBZA 3EUHA 3H37A 4UELA 3Q5WA 2BZBA 3FB2A 4H9PC 4PFPA 2CXLA 2GK9A 4UEMA 5HYAA 2H7VC 3HKEE 4EIWA 5JRCB 3PUAA 3MKDA 2Y6XA 4DNDA 3MACA 1ZHCA 1SHZC 2IC6A 3FXDB 3ETUA 3C4WA 4WNKA 2DLRA 3I9WA 4OK0A 3ZMSB 5LBQB 1IJ5A 4IE0A 5JDLA 2E9XD 4FI5A 2KZ7B 3N9OA 4OFZA 4ZI2C 3TKLB 4F6RC 1CUNA 4YJ2E 4X1KE 5KX5E 3N5LA 4XAXB 1KNZA 4PNIA 1YD8G 2CCQA 4PJNA 3LG7A 2NWBA 2CLYC 2HPJA 3R6NA 4TX5A 2LSJA 3CQCB 4PK5A 2WM9A 3HKCE 2NTYA 3VHLA 5CA0E 2KWIB 5L3DB 3KBUA 4UF0B 1ZV4X 2IAKA 4ISSA 2CMRA 3AAIA 2P9BA 4X1IE 4AQGA 2DI4A 2D0UA 4HKAA 2XAQB 2NW9A 2E9XB 3RYHE 2CWYA 2QA7A 4L0RA 2WSSV 2BDEA 2NTXA 2XAHB 3CMLA 5LGNB 4KUMB 3HL6A 2VKOA 2V26A 2MBGA 2K48A 2G0UA 3O1IA 4UF0A 4KP3C 5FXZA 3ZN1B 3RC8A 2WMNA 5ADXL 3O1HA 4AKGA 4IIJE 1MIVA 1YKEB 2KWHA 2MOZA 2W63A 2C0SA 3OKQA 3ZCJA 1U5PA 1UX5A 5JRCA 1D1BA 4CI1B 2DCFA 4MALA 1OWAA 2X51A 4L5GA 3HKBE 2A2FX 3UT5E 1HCIA 3PUQA 5KDMC 5JH7E 3ZYLA 4X20E 1S35A 5EZYE 2V7JA 3NRXA 4BA9A 3LK3B 4CXXA 4QHOA 3B13A 1MMNA 2EHOB 3CX7B 1MMGA 1D0YA 3HI2A 1D0XA 3V5SA 4ANJA 3FHNA 5BMVE 3PU3A 4QWNB 4ISTA 4PK6A 2LSGA 2RP4A 2M67A 3ZMVB 2IC9A 4G2AA 5LXTE 2VASA 4O8SA 3RRWA 4IE7A 1BR1A 2KINB 3N2OA 5E0OA 3N9QA 2Q9QD 2E9XA 4MHCA 3UFEA 1MMDA 3P8CD 1US7B 3PTRB 2PFVA 4TZ4C 2Y48B 4GK5E 2B1EA 2XHEB 4QXHB 2Q9QA 2XAFB 5JVDE 4GYRA 4EYUA 3KBTA 5HXEA 3WAJA 2HH7A 5FMNA 3K3NA 3ESLA 3M65A 3KVBA 3LK42 4IE4A 2E9XC 5LCYA 2QGSA 4AI6A 3I9YA 2HPLA 3FBLA 2J1DG 3KFWX 4H63V 4O4HE 2VK9A 3I0OA 4Z8XA 1UCUA 4UV9B 2LT3A 5J2TE 2XQYA 3BQLA 3ZYKA 1V9DA 4U72A 3NRYA 3ANWB 3HA4A 4CI3B 1YW0A 5IYZE 2X67A 1KK7A 5JR9A 1E1HB 4AXPA 3A5XA 5EK3A 3LK2B 3QUJA 3F57A 4X1YE 1H7CA 5FYMA 2ODUA 5TAOA 4H9SE 1HS7A 3KVAA 4YJ3E 3IEEA 2X9WA 3UULA 5DQWA 4GIWA 4ASKA 5LA6E 4ZI3D 5LOVE 2ZM0A 2A72A 2LOPA 2PJQA 3MJXA 2V1DB 5LJNA 4XBFB 5LBMA 2EHOA 2LSKA 2OA5A 2YU2A 4EXTA 4GOUA 4H63H 4DBRA 3SRZA 5JR9B 1VRBA 2YU1A 4TUYE 5FXWA 4ZHQE 5L3BB 3VKHA 2ZMAA 5HXCA 1MMAA 2WBLA 1MIWA 5LGTB 5LNKA 2D2SA 3J9X1 1LVFA 1HG2A 3C64A 5HAXA 3ZYMA 4BAYB 4H9RC 2UXNB 3F31A 3LJCA 3IF8B 2JPFA 4EOZB 5C8YE 3B57A 2PG8A 4GYSA 4P0AA 3VKGA 5CB4E 3EDUA 2N9DA 4TN7B 3ZN0B 4PJJA 2CM0A 3U3IA 4PAGA 5GONE 5LHHB 2MYSA 3BQKA 3Q9DA 4I4TE 2L3LA 2CLYB 3RH3A 3RYFE 5JDNA 4G63A 3OYXA 4XZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHO B;  2EHO A;  2E9X D;  2E9X A;  2Q9Q B;  3ANW A;  3JC6 D;  2Q9Q C; 
#chains in the Genus database with same CATH topology
 2VKD A;  3ZC1 A;  4LF7 T;  4A98 A;  3RYI E;  2BKN A;  2JJ9 A;  2W67 A;  2XQ6 A;  3NWI A;  3UU8 A;  1M7K A;  4LMJ A;  5AQS B;  3ZEF B;  4NPP A;  3JAD A;  3AA6 B;  1WLX A;  4O4L E;  4UV8 B;  1Y64 B;  3TLW A;  4LML A;  5LP6 E;  3AVS A;  2CPT A;  1GQE A;  3AEC A;  2FJB A;  3P4W A;  4C91 A;  4HFV A;  4I50 E;  2XUE A;  4KX6 A;  4YLH A;  1YQ4 A;  1J5E T;  2XY8 B;  3C4X A;  4PJM A;  4YT0 A;  5KMG P;  2I6H A;  1NEN A;  3CX6 B;  5L3C B;  3D0T A;  5FXX A;  4P1N A;  4EYY R;  5L3E B;  3DJB A;  2LM9 A;  1MNE A;  2K9A A;  5AQM B;  4TV9 E;  5AQK B;  4OX9 T;  3U78 A;  1VCS A;  1YQ3 A;  5JTG A;  2WWV A;  4DR3 T;  1IBM T;  2SPC A;  3N9N A;  4EZ4 A;  3OYZ A;  2UUC T;  4IDZ A;  4NXM T;  3AED A;  2VKH A;  3VRA A;  2LRK A;  3RPU A;  2XAS B;  1EZ3 A;  2OLT A;  3PJA A;  2ACX A;  1B7T A;  2E2A A;  4KMC A;  4QX8 B;  3NBX X;  4IE6 A;  2H89 A;  2I59 A;  2K24 A;  2DL1 A;  5HXH A;  4IL4 A;  4MFR A;  2W00 A;  1WFD A;  2CA5 A;  2W61 A;  2FBW A;  4YFS A;  1NWM X;  2J4G A;  4QXC B;  5DAB A;  2YK0 A;  2VL8 A;  2LSI A;  5AQJ B;  3ZSS A;  2CE7 A;  5CA1 E;  5HXS A;  5L3F B;  1ZKE A;  2X68 A;  4IL9 A;  4AQY T;  5LYJ E;  2EHO D;  1ZP0 A;  1VCT A;  2XQ7 A;  2YDQ A;  2XQ9 A;  3RHW A;  5L4H A;  5AQN B;  2E8I A;  4ZXL A;  3H3A A;  4AKL A;  2VVN A;  3GA8 A;  1G8X A;  2NW8 A;  3P7I A;  1FEW A;  1XZY A;  4UIG A;  4BJN A;  1KFY A;  3CPZ A;  5HEO A;  1I6Z A;  2BKO A;  2V8S V;  2WU2 A;  4ZI7 E;  3ZMZ B;  1XWM A;  4UVB B;  4DR2 T;  3CQX C;  2V7I A;  3OPC A;  3PV0 F;  5JDG A;  3E08 A;  1WR0 A;  5AQH B;  3EI0 A;  3PE0 A;  5ABG A;  4JI4 T;  4HFB A;  2WWU A;  3ZST A;  4I55 E;  4ERR A;  1LVK A;  2Q9Q B;  3QK6 A;  3VR9 A;  4JI1 T;  2JIW A;  2YDS A;  2WDQ A;  3EAM A;  3N9P A;  4IT4 A;  2K3W A;  3CIR A;  2ZM8 A;  4JI8 T;  3K3O A;  5AQI B;  1SA0 E;  2F4V T;  1QSD A;  4OHF A;  2XM2 A;  3AE6 A;  5M4Y A;  4JV5 T;  1IZN B;  1S94 A;  2LE8 A;  3ZPO A;  5EK4 A;  3EVY A;  2CXF A;  2ZLY A;  5HXR A;  4ZS3 A;  1WYC A;  1IJ6 A;  4ILU A;  3GWH A;  5DQV A;  2WMO A;  3CX8 B;  3RKG A;  3ONX A;  3AE9 A;  2UXD T;  4GKJ T;  2X9H A;  3HR0 A;  2QRX A;  4I0U A;  2K5B B;  2W62 A;  4B6X A;  2WCA A;  5F3J A;  2DWK A;  5LMN T;  2V7L A;  3ANW A;  4TWD A;  4DO0 A;  3A7M A;  3CWZ B;  2VUR A;  1HG5 A;  1HX8 A;  1T72 A;  5J0Z A;  3QB5 A;  2D0T A;  4PFO A;  4PK4 A;  5AQG B;  4DMV A;  4HWF A;  4X62 T;  2Z6E A;  3Q5X A;  3ZJ2 A;  2X9X A;  2Q9Q C;  3PUR A;  4GK0 E;  2PBI A;  3MA9 A;  4ZI3 C;  3VRB A;  5LHI B;  4ADZ A;  3UFG A;  5EK2 A;  3WAK A;  3ZKR A;  5ABF A;  3N9L A;  1E7P A;  3UU6 A;  3B5M A;  4UR9 A;  5LG3 A;  4HFC A;  2N2N A;  4OYK A;  2NP9 A;  4QX7 B;  5FXV A;  4DUZ T;  4U31 A;  5HEH A;  3L39 A;  2VWA A;  3PUZ F;  2VL0 A;  4YTP A;  1Z0P A;  2X0Y A;  2LOS A;  3UU3 A;  1M62 A;  2BG9 B;  4H9Q C;  4U2Y A;  2BS3 A;  2JRK A;  2DNX A;  5LB7 B;  3WI3 A;  3SWH A;  3LSV A;  4WBN E;  2LLY A;  3AXJ B;  3NZP A;  3OJA A;  2LRL A;  5AQF B;  2WS3 A;  5CGM A;  3LBX A;  4HEA A;  2CBJ A;  4P09 A;  4KHZ F;  2XQ5 A;  4AKR B;  4E7Z A;  4DVD A;  1JNZ A;  3EDV A;  4H9O C;  4L9I A;  4HN9 A;  4O4I E;  4QH5 A;  4O4J E;  4B3T T;  3TLT A;  5J2U E;  4JI6 T;  2L8K A;  3JAE A;  3AAA B;  2WP9 A;  4TWH A;  1FMW A;  4EGW A;  3O4X E;  3SS1 A;  2V5D A;  3RYC E;  2XAG B;  4JEH B;  2IW5 B;  4HFD A;  4ILC A;  2VB6 A;  5FY1 A;  2LKG A;  4UVA B;  2IUB A;  2RPA A;  3C51 A;  3IA3 A;  4EZH A;  3AAE B;  3KIN B;  4HFH A;  4U33 A;  2ZM2 A;  1OED A;  3QC9 A;  4WBO A;  2WY2 A;  4QKN A;  2C5K T;  4AKH A;  5HWY A;  5FNV E;  4TV8 E;  3HKD E;  1J5W A;  2VQF T;  2MTQ A;  4IHJ E;  3O1J A;  3ZJ1 A;  1BR0 A;  2KND A;  3Q2M A;  1DU2 A;  1BR4 A;  5LJM A;  5HEJ A;  4HWI B;  3AEB A;  2FJE A;  2KLQ A;  2C5J A;  2J47 A;  2W2U A;  3GN5 B;  5LGU B;  3NVO A;  3MZK B;  2KMF A;  3DP7 A;  3UU5 A;  3C50 A;  3K1S A;  2KXP B;  2BG9 A;  4JLE A;  2V5C A;  5AQP B;  5F8P A;  1T98 A;  5JRE A;  3AE4 A;  4J2C A;  4NUU A;  2HHH T;  4K0U A;  2CWO A;  2IDO B;  2LEH A;  2W0G A;  2XQ4 A;  2BS2 A;  3N2K E;  4IGU A;  4QXB B;  3E0Z A;  4WW0 A;  5HWX A;  4EAH A;  4A5X A;  3LBX B;  1JNR A;  1OXZ A;  2JMH A;  3KDS E;  3ZLI A;  2Y8D A;  4I43 B;  4HWD A;  4C90 A;  5A1L A;  4ZEY A;  4CXY A;  4K0K T;  5FL0 A;  4CN6 A;  2IML A;  5L3G B;  2WZH A;  3KV5 A;  4HE8 A;  1MND A;  2DHR A;  4AQF A;  4B3M T;  4OYJ A;  3W15 B;  1XMQ T;  3T1H T;  2NR4 A;  1WYB A;  3JC6 C;  3KV9 A;  1W9R A;  3EHZ A;  3GN5 A;  5FY0 A;  5L47 A;  4NXN T;  2VKJ A;  1FMV A;  1WR6 A;  1BR2 A;  2J62 A;  3ETV A;  2XTL A;  2CRB A;  4O2A E;  5FP3 A;  3DTO A;  5F5W A;  3UUB A;  1LKX A;  4CZZ B;  2L9Q A;  4EEB A;  3SOL A;  4LF6 T;  2WDR A;  3BQI A;  3C98 B;  5JR9 C;  4YHJ A;  1HFA A;  2ODV A;  5LHG B;  3AE3 A;  1ZEE A;  3C4Z A;  3CVR A;  3AE7 A;  4ILB A;  4WZX A;  3IHR A;  4MLK A;  5AQR B;  3OBV E;  2WAU A;  3RX6 A;  1HF8 A;  3UUX B;  3AEF A;  3P4S A;  2X0L B;  3AA0 B;  4NIQ A;  3LFM A;  3RKO A;  3K3Q C;  2LHR A;  4YSY A;  1HTJ F;  2V7K A;  1U4Q A;  1O3X A;  2JQK A;  4KI0 F;  3R84 B;  3RIU C;  5JDM A;  1E2A A;  1KNR A;  4JUY A;  4O2B E;  4ZS2 A;  4NUV A;  5ETW A;  4JI5 T;  4DV2 T;  2D5U A;  4U2Z A;  5JDQ A;  1D1A A;  1IAP A;  1LRZ A;  4WYV A;  3MXZ A;  4H9N C;  2CXD A;  4KBM B;  4YTN A;  2XJ7 A;  2EHO C;  3MK7 C;  4HTE A;  2CEA A;  4U74 A;  5CA0 E;  1X9B A;  3GMI A;  3LDQ B;  5HCJ A;  3TLV A;  1R8I A;  2LJL A;  1UX4 A;  4IDN A;  3ONJ A;  3PU8 A;  4E7S A;  1N34 T;  3AVR A;  2BBJ A;  5AQT B;  2B76 A;  2DWG A;  3ABV A;  1MIY A;  3PUS A;  4FJO A;  3UTK A;  3IBP A;  4HGA A;  1D0Z A;  3G06 A;  3I1A A;  5LG4 A;  2C5I T;  4AKI A;  4DV4 T;  4DR4 T;  2BKP A;  2YEV C;  4EV6 A;  3OTO T;  4V1A v;  3PUG A;  5JQG E;  1G73 A;  2LM2 A;  1UUS A;  3E22 E;  4MBQ A;  4CXW A;  3QNU A;  2NW7 A;  3UQ4 A;  4AQF C;  5AFU L;  1XMO T;  1NAF A;  3N9M A;  4X64 T;  1QUU A;  4CQI A;  4YHH T;  2ES0 A;  3PDY A;  3AA1 B;  2NOX A;  3T8O A;  2YIN A;  2LSY A;  4ILA A;  4KHP T;  3J7Y q;  1AJ3 A;  3L09 A;  5H6R B;  2KT9 A;  3SFD A;  4DMW A;  3KV4 A;  3N2G E;  4B3R T;  3AE5 A;  4JI7 T;  3CQG B;  3TLU A;  1N36 T;  3AB3 B;  2VQE T;  2JQQ A;  2JMK A;  3CKD A;  2BG9 E;  2BS4 A;  3BK9 A;  4IE5 A;  5DJQ C;  3S4U A;  1KF6 A;  4P0B A;  4GKK T;  4PW8 A;  3UUM A;  5ABF B;  2KSR A;  3H3M A;  4N78 D;  3ZC0 A;  1T8B A;  2HN2 A;  1VOM A;  4TWF A;  5J1G A;  4PJL A;  3ZCI A;  4EB6 E;  3RRC A;  3L3P A;  1YKH B;  3AA7 B;  4Z90 A;  3KV6 A;  3RC3 A;  4DV5 T;  2CHO A;  3VU7 H;  3NZQ A;  5IUX A;  5JDF A;  3UUN A;  2BVL A;  4M1P A;  2W66 A;  4JI2 T;  1HNZ T;  3ZMT B;  2V7M A;  3QOF A;  4IRE A;  2XAJ B;  1FIO A;  4LFB T;  4A56 A;  2LKH A;  2UXX B;  5IHY A;  3FXE B;  3JC6 D;  4ZI2 D;  5JDH A;  2RA1 A;  2BVM A;  1HX1 B;  1FJG T;  2H88 A;  4LF5 T;  2X9Y A;  3K8P C;  2X66 A;  4UXN B;  3I0Q A;  4CN1 A;  4YXD A;  4JEU B;  4ZOL E;  5FY7 A;  2A3D A;  2AE9 A;  1X79 A;  4JBW F;  3V5U A;  1WRD A;  3AEA A;  2OV9 A;  3F2E A;  2N1G A;  4UVC B;  5ABE A;  2BBH A;  2H3R A;  4CI2 B;  5L2L A;  2H7O A;  1D1C A;  5H6Q B;  4DR5 T;  4AIS A;  3ZMU B;  4BJM A;  2LHN A;  4AIU A;  3FBZ A;  3PUX F;  3EUH A;  3H37 A;  4UEL A;  5BR8 T;  3Q5W A;  2BZB A;  3FB2 A;  4H9P C;  1OED B;  2CXL A;  4PFP A;  2GK9 A;  4UEM A;  5HYA A;  2H7V C;  3HKE E;  4EIW A;  5JRC B;  3PUA A;  4JYA T;  3MKD A;  2Y6X A;  4DND A;  2YKS A;  1HNW T;  3MAC A;  4YTM A;  1ZHC A;  3P4Q A;  1SHZ C;  3AEE A;  2IC6 A;  3FXD B;  3PJA J;  5LMU T;  3ETU A;  3C4W A;  4WNK A;  4HFI A;  2DLR A;  4DID B;  2E5L T;  3I9W A;  4OK0 A;  1XDO A;  3ZMS B;  2XQ3 A;  4LMK A;  5LBQ B;  1IJ5 A;  3CK6 A;  4B3S T;  4IE0 A;  5JDL A;  4DV0 T;  4YSX A;  2E9X D;  4FI5 A;  4JI0 T;  2KZ7 B;  2XQ8 A;  3N9O A;  3FZL B;  4OFZ A;  4ZI2 C;  3PUY F;  3TKL B;  4F6R C;  3RQW A;  2AXD S;  2XSA A;  1CUN A;  4YJ2 E;  4X1K E;  4Q25 A;  4ZZC A;  3N5L A;  5KX5 E;  4XAX B;  1KNZ A;  4PNI A;  3EAB A;  5AQV B;  1YD8 G;  2CCQ A;  4PJN A;  3LG7 A;  1I94 T;  2NWB A;  2CLY C;  2HPJ A;  3R6N A;  4TX5 A;  2LSJ A;  3RI5 A;  3CQC B;  1XNR T;  4PK5 A;  2WM9 A;  3HKC E;  5C2T A;  2NTY A;  2WDV A;  2WU5 A;  3VHL A;  2KWI B;  2V6X A;  3VR8 A;  5ABH A;  3KBU A;  4UF0 B;  1ZV4 X;  2IAK A;  3RIA A;  4QH4 A;  5L3D B;  4ISS A;  3AE8 A;  2CMR A;  4DUY T;  3AAI A;  5HEU A;  2P9B A;  3FZK B;  4X1I E;  1L0V A;  2DI4 A;  4HWC A;  3Q5E A;  4AQG A;  4DR1 T;  4IDO A;  2D0U A;  4HKA A;  1NEK A;  4HWH A;  2XAQ B;  2NW9 A;  4LF8 T;  2E9X B;  3RYH E;  2CWY A;  2CBI A;  2QA7 A;  4L0R A;  2WSS V;  1W0B A;  2BDE A;  2NTX A;  2XAH B;  3CML A;  3AE2 A;  4QH1 A;  5LGN B;  4KUM B;  4LF4 T;  4LF9 T;  3HL6 A;  2VKO A;  2V26 A;  2YDR A;  3M3Z B;  4TNV A;  5AQO B;  2MBG A;  2K48 A;  2G0U A;  3O1I A;  4UF0 A;  4KP3 C;  5FXZ A;  3ZN1 B;  5IWA T;  1OED C;  3T1Y T;  3RC8 A;  2WMN A;  5ADX L;  3O1H A;  4AKG A;  4IIJ E;  1HR0 T;  4U3C A;  1MIV A;  1YKE B;  2KWH A;  2MOZ A;  2W63 A;  2C0S A;  3OKQ A;  3ZCJ A;  1U5P A;  1UX5 A;  4CN4 A;  5L4E A;  5JRC A;  1D1B A;  4CI1 B;  2V6Y A;  4EED A;  2DCF A;  4MAL A;  1OWA A;  2X51 A;  4L5G A;  1XNQ T;  1KNP A;  2A2F X;  2XZE A;  3HKB E;  1HCI A;  4U7I A;  5HEG A;  3PUQ A;  3UT5 E;  1HNX T;  4A97 A;  5KDM C;  2XM1 A;  5JH7 E;  3ZYL A;  2I0M A;  4X20 E;  1S35 A;  3ZT6 A;  1SUM B;  5EZY E;  3P4R A;  2V7J A;  3NRX A;  2XQA A;  3RGL A;  2E5V A;  3LK3 B;  4QHO A;  4BA9 A;  4CXX A;  3B13 A;  5KXJ A;  2UXC T;  1MMN A;  2EHO B;  3QB5 K;  2M6B A;  3CX7 B;  1MMG A;  4X66 T;  1D0Y A;  3HI2 A;  3OVU A;  1D0X A;  5AQL B;  3L8R A;  1J1J A;  4X5T A;  3V5S A;  2WB5 A;  3FHN A;  4ANJ A;  5BMV E;  3AEG A;  3PU3 A;  4X65 T;  4QWN B;  4IST A;  4PK6 A;  2LSG A;  2RP4 A;  2M67 A;  3ZMV B;  4YSZ A;  4F8H A;  2IC9 A;  2QVA A;  3Q5D A;  4G2A A;  5LXT E;  2VAS A;  4O8S A;  1CHU A;  3JCF A;  3O9X A;  3RRW A;  2JQ9 A;  1BR1 A;  2KIN B;  4IE7 A;  3N2O A;  5E0O A;  3RIF A;  3N9Q A;  2Q9Q D;  2E9X A;  4MHC A;  1W09 A;  4LFA T;  3TLS A;  1W0A A;  2UXB T;  3UFE A;  1MMD A;  3P8C D;  1US7 B;  1ZOY A;  3PTR B;  4U7Y A;  2PFV A;  3X1D A;  4TZ4 C;  2BG9 C;  2WQY A;  2Y48 B;  4GK5 E;  2B1E A;  2XHE B;  4HFE A;  2R6G F;  4IDQ A;  4IDP A;  2Q9Q A;  2XAF B;  4QXH B;  5AQQ B;  1QLB A;  4GYR A;  5JVD E;  4LFC T;  4DR7 T;  1N32 T;  2FJA A;  2YOE A;  3KBT A;  3RLF F;  4EYU A;  5HXE A;  3WAJ A;  2HH7 A;  5FMN A;  3K3N A;  3ESL A;  2XPK A;  3M65 A;  1UUR A;  3KVB A;  2D9D A;  3LK4 2;  4IE4 A;  2E9X C;  4TNW A;  5LCY A;  5FL1 A;  2XSB A;  3FZF B;  4Z91 A;  4ZZB A;  2QGS A;  4AI6 A;  3I9Y A;  2HPL A;  3FBL A;  2J1D G;  2X0H A;  3KFW X;  3ONL C;  2VK9 A;  3I0O A;  4H63 V;  4O4H E;  2A9U A;  4Z8X A;  1UCU A;  4UV9 B;  2LT3 A;  5J2T E;  2XQY A;  3BQL A;  4DV3 T;  3ZYK A;  1V9D A;  2MAW A;  2YN6 A;  3NRY A;  4U72 A;  1OED E;  3ANW B;  3HA4 A;  4CI3 B;  1YW0 A;  5IYZ E;  2X67 A;  4DR6 T;  5AQU B;  1KK7 A;  5JR9 A;  1IBL T;  1E1H B;  2JQH A;  2IHR 1;  4AXP A;  3A5X A;  5EK3 A;  3AE1 A;  3LK2 B;  3QUJ A;  1SE7 A;  3F57 A;  4X1Y E;  3UQ7 A;  1H7C A;  2ACZ A;  2V6Y B;  3P50 A;  5FYM A;  2ODU A;  5TAO A;  2HN1 A;  4H9S E;  1HS7 A;  3KVA A;  4YJ3 E;  3IEE A;  2X9W A;  3UUL A;  5DQW A;  5FVK A;  2FUP A;  4GIW A;  4ASK A;  5FVL A;  5LA6 E;  4ZI3 D;  5LOV E;  3NKZ A;  2IIU A;  2ZM0 A;  2A72 A;  2LOP A;  2PJQ A;  3MJX A;  2MPK A;  3SFE A;  2CHN A;  2V1D B;  5LJN A;  2ZM6 T;  1YXR A;  4JI3 T;  5LBM A;  2EHO A;  3RQU A;  4YY3 T;  2LSK A;  4XBF B;  3UU4 A;  2OA5 A;  2YU2 A;  4EXT A;  4GOU A;  4H63 H;  4DBQ A;  4DBR A;  3SRZ A;  5JR9 B;  3A8Y C;  4DV7 T;  1VRB A;  2YU1 A;  4TUY E;  3FZM B;  1IBK T;  5FXW A;  4ZHQ E;  5L3B B;  2UUB T;  3VKH A;  1UK5 A;  2ZMA A;  1MMA A;  2QYW A;  2WBL A;  3AXJ A;  5HXC A;  1MIW A;  2UU9 T;  5LGT B;  5LNK A;  2D2S A;  3J9X 1;  1LVF A;  1HG2 A;  2W4X A;  3C64 A;  3ZT5 A;  1N33 T;  5HAX A;  3ZYM A;  2VVS A;  4DV6 T;  4BAY B;  4H9R C;  5CFB A;  2UXN B;  3F31 A;  3LJC A;  3IF8 B;  1Y01 A;  5HCM A;  2JPF A;  2FJD A;  1Z8U A;  4EOZ B;  5C8Y E;  3RF1 A;  3B57 A;  1WCR A;  1XDP A;  1UGO A;  2PG8 A;  4GYS A;  4P0A A;  3VKG A;  5CB4 E;  3P4P A;  3EDU A;  2N9D A;  3PUV F;  5CJ5 A;  2M6I A;  2WZI A;  4TN7 B;  3ZN0 B;  4PJJ A;  2CM0 A;  3ZT7 A;  3U3I A;  1KEY A;  2UUA T;  4PAG A;  5C3J A;  5GON E;  3FZH B;  3JAF A;  1T7S A;  2MYS A;  3BQK A;  3Q9D A;  4I4T E;  5LHH B;  3RIU A;  5FKY A;  2L3L A;  2CLY B;  3RH3 A;  2PTF A;  3RYF E;  5JDN A;  4COF A;  3PUW F;  4G63 A;  3OYX A;  4XZC A;  4DV1 T; 
#chains in the Genus database with same CATH homology
 2VKD A;  3ZC1 A;  3RYI E;  2JJ9 A;  3ZEF B;  4O4L E;  3AA6 B;  1WLX A;  4UV8 B;  1Y64 B;  3AVS A;  4C91 A;  4HFV A;  4I50 E;  2XUE A;  4YLH A;  3C4X A;  4PJM A;  5KMG P;  3CX6 B;  3D0T A;  5FXX A;  4EYY R;  5L3E B;  3DJB A;  2LM9 A;  1MNE A;  2K9A A;  4TV9 E;  3U78 A;  2SPC A;  3N9N A;  4EZ4 A;  3OYZ A;  4IDZ A;  2VKH A;  5LP6 E;  3RPU A;  2XAS B;  1EZ3 A;  4KMC A;  2ACX A;  1B7T A;  4QX8 B;  3NBX X;  4IE6 A;  2I59 A;  2K24 A;  5HXH A;  4MFR A;  2W00 A;  2CA5 A;  2W61 A;  4YFS A;  1NWM X;  5DAB A;  4QXC B;  5CA1 E;  2YK0 A;  2VL8 A;  2LSI A;  5HXS A;  2CE7 A;  5L3F B;  1ZKE A;  2X68 A;  5LYJ E;  2EHO D;  2E8I A;  4AKL A;  3H3A A;  3GA8 A;  1G8X A;  2NW8 A;  3P7I A;  1FEW A;  4UIG A;  4BJN A;  3CPZ A;  4ZI7 E;  3ZMZ B;  4UVB B;  3CQX C;  2V7I A;  5JDG A;  3E08 A;  3PE0 A;  2WWU A;  4ERR A;  4I55 E;  1LVK A;  2Q9Q B;  3QK6 A;  3N9P A;  2ZM8 A;  3K3O A;  1SA0 E;  1QSD A;  4OHF A;  5M4Y A;  1IZN B;  1S94 A;  2LE8 A;  3ZPO A;  5EK4 A;  3EVY A;  2CXF A;  2ZLY A;  5HXR A;  4ZS3 A;  1WYC A;  1IJ6 A;  4ILU A;  3GWH A;  5DQV A;  2WMO A;  3CX8 B;  3ONX A;  2X9H A;  3HR0 A;  2K5B B;  2W62 A;  4B6X A;  5F3J A;  2DWK A;  2V7L A;  3ANW A;  4DO0 A;  3CWZ B;  1HG5 A;  1HX8 A;  4PFO A;  2D0T A;  4PK4 A;  4DMV A;  2Z6E A;  3Q5X A;  3ZJ2 A;  2X9X A;  2Q9Q C;  3PUR A;  4GK0 E;  2PBI A;  3MA9 A;  4ZI3 C;  5LHI B;  4ADZ A;  5EK2 A;  3WAK A;  3N9L A;  2N2N A;  4OYK A;  2NP9 A;  4QX7 B;  5FXV A;  2VWA A;  1Z0P A;  2LOS A;  4H9Q C;  3WI3 A;  2JRK A;  2DNX A;  3SWH A;  4WBN E;  3NZP A;  3OJA A;  3LBX A;  4HEA A;  4P09 A;  4AKR B;  4E7Z A;  4DVD A;  3EDV A;  4H9O C;  4L9I A;  4HN9 A;  4O4I E;  4O4J E;  5J2U E;  2L8K A;  3AAA B;  1FMW A;  3O4X E;  3SS1 A;  3RYC E;  2XAG B;  4JEH B;  2IW5 B;  2VB6 A;  5FY1 A;  4UVA B;  3C51 A;  4EZH A;  3AAE B;  3KIN B;  2ZM2 A;  3QC9 A;  4WBO A;  4QKN A;  2C5K T;  5HWY A;  5FNV E;  4TV8 E;  3HKD E;  2MTQ A;  4IHJ E;  3O1J A;  3ZJ1 A;  1BR0 A;  2KND A;  3Q2M A;  1BR4 A;  5LJM A;  2KLQ A;  2C5J A;  3GN5 B;  5LGU B;  3MZK B;  2KMF A;  3DP7 A;  3C50 A;  2KXP B;  4JLE A;  5F8P A;  1T98 A;  5JRE A;  4J2C A;  4NUU A;  4K0U A;  2CWO A;  2LEH A;  2W0G A;  4QXB B;  3N2K E;  4AKH A;  5HWX A;  4IGU A;  3E0Z A;  4WW0 A;  4EAH A;  3LBX B;  1OXZ A;  3ZLI A;  2JMH A;  3KDS E;  4DBQ A;  2Y8D A;  4I43 B;  5A1L A;  4C90 A;  4CXY A;  5L3G B;  3KV5 A;  4HE8 A;  1MND A;  2DHR A;  4AQF A;  4OYJ A;  3W15 B;  3JC6 C;  1WYB A;  3KV9 A;  5FY0 A;  3GN5 A;  2VKJ A;  1WR6 A;  1FMV A;  1BR2 A;  3ETV A;  2XTL A;  4O2A E;  5FP3 A;  3DTO A;  4CZZ B;  1LKX A;  2L9Q A;  3SOL A;  3C98 B;  3BQI A;  5JR9 C;  4YHJ A;  1HFA A;  2ODV A;  5LHG B;  1ZEE A;  3C4Z A;  3CVR A;  3O9X A;  3RX6 A;  3IHR A;  4MLK A;  3UUX B;  3OBV E;  2WAU A;  1HF8 A;  2X0L B;  3AA0 B;  3LFM A;  3RKO A;  3K3Q C;  2LHR A;  1HTJ F;  2V7K A;  1U4Q A;  1O3X A;  3R84 B;  5JDM A;  4JUY A;  4O2B E;  4ZS2 A;  4NUV A;  5ETW A;  2D5U A;  5JDQ A;  1D1A A;  1IAP A;  1LRZ A;  5L3C B;  3MXZ A;  4H9N C;  2CXD A;  4KBM B;  2EHO C;  3MK7 C;  4HTE A;  2CEA A;  4U74 A;  3GMI A;  2LJL A;  1UX4 A;  3PU8 A;  4E7S A;  3AVR A;  2DWG A;  3PUS A;  1MIY A;  4FJO A;  3UTK A;  3IBP A;  4HGA A;  1D0Z A;  5LG4 A;  3I1A A;  4AKI A;  2C5I T;  2YEV C;  4V1A v;  3PUG A;  5JQG E;  1G73 A;  3E22 E;  4MBQ A;  4CXW A;  5AFU L;  4AQF C;  2NW7 A;  1NAF A;  3N9M A;  1QUU A;  4CQI A;  2ES0 A;  3PDY A;  3AA1 B;  2NOX A;  3T8O A;  2YIN A;  2LSY A;  1AJ3 A;  3J7Y q;  3L09 A;  5H6R B;  2KT9 A;  4DMW A;  3KV4 A;  3N2G E;  3CQG B;  3AB3 B;  2JQQ A;  2JMK A;  3CKD A;  4IE5 A;  5DJQ C;  3BK9 A;  3S4U A;  4P0B A;  4PW8 A;  3UUM A;  4N78 D;  3ZC0 A;  1VOM A;  4EB6 E;  5J1G A;  4PJL A;  3ZCI A;  3RRC A;  3L3P A;  1YKH B;  3AA7 B;  3KV6 A;  3RC3 A;  3VU7 H;  3NZQ A;  5JDF A;  3UUN A;  2BVL A;  4M1P A;  3ZMT B;  2V7M A;  2XAJ B;  1FIO A;  4A56 A;  2UXX B;  5IHY A;  3FXE B;  3JC6 D;  4ZI2 D;  5JDH A;  2RA1 A;  2BVM A;  2X9Y A;  3K8P C;  2X66 A;  4UXN B;  3I0Q A;  4JEU B;  4ZOL E;  5FY7 A;  2A3D A;  1X79 A;  3V5U A;  1WRD A;  3F2E A;  4UVC B;  2N1G A;  2H3R A;  4CI2 B;  5L2L A;  2H7O A;  1D1C A;  5H6Q B;  3ZMU B;  4BJM A;  2LHN A;  3FBZ A;  3EUH A;  3H37 A;  4UEL A;  3Q5W A;  2BZB A;  3FB2 A;  4H9P C;  4PFP A;  2CXL A;  2GK9 A;  4UEM A;  5HYA A;  2H7V C;  3HKE E;  4EIW A;  5JRC B;  3PUA A;  3MKD A;  2Y6X A;  4DND A;  3MAC A;  1ZHC A;  1SHZ C;  2IC6 A;  3FXD B;  3ETU A;  3C4W A;  4WNK A;  2DLR A;  3I9W A;  4OK0 A;  3ZMS B;  5LBQ B;  1IJ5 A;  4IE0 A;  5JDL A;  2E9X D;  4FI5 A;  2KZ7 B;  3N9O A;  4OFZ A;  4ZI2 C;  3TKL B;  4F6R C;  1CUN A;  4YJ2 E;  4X1K E;  5KX5 E;  3N5L A;  4XAX B;  1KNZ A;  4PNI A;  1YD8 G;  2CCQ A;  4PJN A;  3LG7 A;  2NWB A;  2CLY C;  2HPJ A;  3R6N A;  4TX5 A;  2LSJ A;  3CQC B;  4PK5 A;  2WM9 A;  3HKC E;  2NTY A;  3VHL A;  5CA0 E;  2KWI B;  5L3D B;  3KBU A;  4UF0 B;  1ZV4 X;  2IAK A;  4ISS A;  2CMR A;  3AAI A;  2P9B A;  4X1I E;  4AQG A;  2DI4 A;  2D0U A;  4HKA A;  2XAQ B;  2NW9 A;  2E9X B;  3RYH E;  2CWY A;  2QA7 A;  4L0R A;  2WSS V;  2BDE A;  2NTX A;  2XAH B;  3CML A;  5LGN B;  4KUM B;  3HL6 A;  2VKO A;  2V26 A;  2MBG A;  2K48 A;  2G0U A;  3O1I A;  4UF0 A;  4KP3 C;  5FXZ A;  3ZN1 B;  3RC8 A;  2WMN A;  5ADX L;  3O1H A;  4AKG A;  4IIJ E;  1MIV A;  1YKE B;  2KWH A;  2MOZ A;  2W63 A;  2C0S A;  3OKQ A;  3ZCJ A;  1U5P A;  1UX5 A;  5JRC A;  1D1B A;  4CI1 B;  2DCF A;  4MAL A;  1OWA A;  2X51 A;  4L5G A;  3HKB E;  2A2F X;  3UT5 E;  1HCI A;  3PUQ A;  5KDM C;  5JH7 E;  3ZYL A;  4X20 E;  1S35 A;  5EZY E;  2V7J A;  3NRX A;  4BA9 A;  3LK3 B;  4CXX A;  4QHO A;  3B13 A;  1MMN A;  2EHO B;  3CX7 B;  1MMG A;  1D0Y A;  3HI2 A;  1D0X A;  3V5S A;  4ANJ A;  3FHN A;  5BMV E;  3PU3 A;  4QWN B;  4IST A;  4PK6 A;  2LSG A;  2RP4 A;  2M67 A;  3ZMV B;  2IC9 A;  4G2A A;  5LXT E;  2VAS A;  4O8S A;  3RRW A;  4IE7 A;  1BR1 A;  2KIN B;  3N2O A;  5E0O A;  3N9Q A;  2Q9Q D;  2E9X A;  4MHC A;  3UFE A;  1MMD A;  3P8C D;  1US7 B;  3PTR B;  2PFV A;  4TZ4 C;  2Y48 B;  4GK5 E;  2B1E A;  2XHE B;  4QXH B;  2Q9Q A;  2XAF B;  5JVD E;  4GYR A;  4EYU A;  3KBT A;  5HXE A;  3WAJ A;  2HH7 A;  5FMN A;  3K3N A;  3ESL A;  3M65 A;  3KVB A;  3LK4 2;  4IE4 A;  2E9X C;  5LCY A;  2QGS A;  4AI6 A;  3I9Y A;  2HPL A;  3FBL A;  2J1D G;  3KFW X;  4H63 V;  4O4H E;  2VK9 A;  3I0O A;  4Z8X A;  1UCU A;  4UV9 B;  2LT3 A;  5J2T E;  2XQY A;  3BQL A;  3ZYK A;  1V9D A;  4U72 A;  3NRY A;  3ANW B;  3HA4 A;  4CI3 B;  1YW0 A;  5IYZ E;  2X67 A;  1KK7 A;  5JR9 A;  1E1H B;  4AXP A;  3A5X A;  5EK3 A;  3LK2 B;  3QUJ A;  3F57 A;  4X1Y E;  1H7C A;  5FYM A;  2ODU A;  5TAO A;  4H9S E;  1HS7 A;  3KVA A;  4YJ3 E;  3IEE A;  2X9W A;  3UUL A;  5DQW A;  4GIW A;  4ASK A;  5LA6 E;  4ZI3 D;  5LOV E;  2ZM0 A;  2A72 A;  2LOP A;  2PJQ A;  3MJX A;  2V1D B;  5LJN A;  4XBF B;  5LBM A;  2EHO A;  2LSK A;  2OA5 A;  2YU2 A;  4EXT A;  4GOU A;  4H63 H;  4DBR A;  3SRZ A;  5JR9 B;  1VRB A;  2YU1 A;  4TUY E;  5FXW A;  4ZHQ E;  5L3B B;  3VKH A;  2ZMA A;  5HXC A;  1MMA A;  2WBL A;  1MIW A;  5LGT B;  5LNK A;  2D2S A;  3J9X 1;  1LVF A;  1HG2 A;  3C64 A;  5HAX A;  3ZYM A;  4BAY B;  4H9R C;  2UXN B;  3F31 A;  3LJC A;  3IF8 B;  2JPF A;  4EOZ B;  5C8Y E;  3B57 A;  2PG8 A;  4GYS A;  4P0A A;  3VKG A;  5CB4 E;  3EDU A;  2N9D A;  4TN7 B;  3ZN0 B;  4PJJ A;  2CM0 A;  3U3I A;  4PAG A;  5GON E;  5LHH B;  2MYS A;  3BQK A;  3Q9D A;  4I4T E;  2L3L A;  2CLY B;  3RH3 A;  3RYF E;  5JDN A;  4G63 A;  3OYX A;  4XZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...