3JC6D

Structure of the eukaryotic replicative cmg helicase and pumpjack motion
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
221
Chain Sequence
VSPQQDFSDLMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNESKLPLLCMETELERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEIKYHDTHSLIWLKLVNDSILKYMPEELQAINDTEGSVNMIDEPDWNKFVFIHVNGPPDGENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEVIRDLLRDDKVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the eukaryotic replicative CMG helicase suggests a pumpjack motion for translocation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords DNA replication licensing factor MCM2
total genus 56
structure length 221
sequence length 240
ec nomenclature
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
D PF16922 SLD5_C DNA replication complex GINS protein SLD5 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3jc6D01
2EHOB 3JC6D 2EHOA 2Q9QB 3ANWA 2E9XA 2E9XD 2Q9QC
chains in the Genus database with same CATH superfamily
4H63V 3PU8A 1YQ3A 3PE0A 3AE8A 3DJBA 3FB2A 2V7IA 4Q25A 4I0UA 4WBOA 5LHHB 3WAJA 3N9MA 3FZHB 4DV0T 2H89A 3OVUA 3GN5A 5AQPB 4ZZCA 2HH7A 4ERRA 5HXSA 1FIOA 1JNZA 1MMAA 2KLQA 3NRYA 4IDQA 4ANJA 2WB5A 4LFAT 2LJLA 4NXNT 2M6IA 2E9XD 3H3MA 1HG5A 5DJQC 4O8SA 5CB4E 2A2FX 3AEGA 4DUZT 4AIUA 2HPLA 2WU5A 3I9YA 2Y8DA 4DR3T 1T7SA 1YKEB 2WDVA 3CWZB 3I9WA 3UU6A 4CN6A 5FL1A 5L2LA 4DV3T 4HWFA 3C4WA 5JDHA 2K3WA 5AQTB 4P0BA 4ILBA 1MIVA 3BQIA 1LRZA 4MFRA 1B7TA 3F57A 3RIAA 3RYHE 2XAHB 5LYJE 1OEDB 1SHZC 5L4EA 2YDRA 3DP7A 2PTFA 3TLSA 2W66A 2K5BB 4XBFB 3MJXA 4H63H 3ZSSA 2XQAA 2LSYA 4G63A 4IDPA 3PUSA 4J2CA 3P50A 4IHJE 4AQFA 4COFA 4X20E 1HNXT 3FZMB 3SS1A 3E08A 1MMNA 2N1GA 2W63A 4AQFC 4LF4T 2V6XA 3PUZF 3QB5A 3AE5A 3ANWA 2IC6A 3GWHA 3VHLA 4CXWA 2WWVA 5HEJA 5KX5E 4X1KE 2ZM2A 5LHIB 4ZZBA 4PNIA 3CPZA 2NWBA 4IIJE 2XAJB 2K24A 3WI3A 3CMLA 2VQFT 3AXJA 1IJ5A 2LSGA 4B3MT 2YU2A 2VKOA 4H9RC 3L3PA 2BVLA 5IWAT 2M67A 2ES0A 3OJAA 4PJMA 4UEMA 4P1NA 4EYYR 1IBKT 1ZOYA 5FY0A 2V6YB 2WDQA 4IE6A 4U7IA 3RKGA 1HX8A 2W67A 2BDEA 1NWMX 2HN1A 3ZC0A 2CM0A 4X5TA 2W4XA 3K8PC 3RYFE 5ABHA 2ODUA 3MKDA 3N2OA 3ZC1A 2DHRA 3RRCA 3UFEA 1SA0E 2JQKA 5AQVB 3SWHA 4H9QC 3TKLB 1KFYA 4ILUA 4YXDA 2LKGA 5L3EB 5C3JA 4LF5T 3N9NA 1FMVA 2CMRA 4NPPA 4I4TE 4TWFA 3F31A 4X1IE 3RGLA 3SOLA 4MBQA 4DNDA 2XQ7A 2B76A 4UF0B 3RPUA 2YEVC 5M4YA 2C0SA 1FJGT 5FXXA 4JV5T 1MMDA 1UGOA 5HEGA 2EHOC 3AA6B 2KNDA 4DV6T 4ZS3A 3BK9A 3N2KE 4Z8XA 4HWIB 3ZPOA 3RIUA 1HFAA 3ZMZB 3NWIA 3ONJA 3K1SA 2BS3A 3UQ7A 3AXJB 2XSBA 3RX6A 2XY8B 5J2TE 2CEAA 2JQHA 4JBWF 5LBQB 4M1PA 2PJQA 3HA4A 4I55E 3I1AA 2QYWA 2IW5B 3LK2B 3P4WA 4EXTA 2WS3A 4U2ZA 4QWNB 3LJCA 5CJ5A 3EABA 4IGUA 2BZBA 2X51A 1OXZA 2WBLA 2N2NA 1HNWT 2D5UA 3EDUA 1OWAA 4DR1T 2CWOA 2UXXB 4TWDA 2LSKA 5LHGB 4K0KT 2A9UA 3VR9A 2YK0A 2ZLYA 3AAAB 3F2EA 4GK0E 2HPJA 3QNUA 4IDZA 2WCAA 2XQ3A 4AI6A 1LKXA 2WMOA 2H7OA 3HR0A 5C2TA 5JVDE 4CN4A 3PUGA 4O4JE 3M65A 5J0ZA 3C51A 3C50A 3C4XA 3Q2MA 3IEEA 3LDQB 4ISTA 3KVAA 3NKZA 4O4HE 4TUYE 2CRBA 3J7Yq 1FEWA 4YFSA 3ZN1B 1N36T 3EVYA 3V5UA 4JI8T 3P7IA 4HFDA 3GN5B 3P4PA 3VR8A 5JREA 4ZI3C 3K3NA 4A97A 1V9DA 4QH4A 1T98A 4EZ4A 5FNVE 3ZN0B 3CX8B 3EI0A 4UV9B 4YSYA 1QSDA 3C98B 1DU2A 4OYJA 4AKGA 1WR0A 2WZHA 5HXEA 2X9YA 3IA3A 1W0BA 2VKHA 4UVBB 1KNRA 3UULA 2DLRA 3HKDE 5AQFB 3AEDA 5JDQA 5LG4A 3PUYF 1M62A 4UVCB 3R84B 1XDPA 2KWIB 4EEDA 5ABFA 3RC8A 4DMWA 5ABGA 2DWGA 5HWYA 1SUMB 3AE3A 4KI0F 5LMUT 3OBVE 4YJ2E 2WMNA 4N78D 5FMNA 5EK3A 2LM9A 3NZQA 3JC6C 5AQMB 3T8OA 5CA0E 4X66T 2LT3A 2CCQA 2XTLA 3Q5WA 4LMKA 3RF1A 3FBZA 1HG2A 5LA6E 4CXXA 4MALA 3UU4A 5HXHA 5AQUB 4HWDA 4IDOA 4V1Av 3T1HT 2J62A 4IE7A 1BR1A 3HKEE 4PFPA 4NXMT 4TNVA 1OEDE 5HXRA 1R8IA 2EHOD 3P4QA 3P4RA 5LP6E 3KBTA 3RKOA 4KP3C 4IREA 1KNZA 3X1DA 4HEAA 3UU5A 4LFCT 1WYBA 5FVLA 4GOUA 2EHOB 2CXLA 2IAKA 3FXDB 4FJOA 5H6RB 1AJ3A 4ILCA 4JI3T 2XQ6A 5AQGB 2X9XA 4O4LE 2NOXA 5HEHA 1U5PA 5FXWA 4DBQA 4E7SA 2VKJA 3NBXX 4IDNA 2H88A 2L9QA 1O3XA 2A72A 1VCTA 3WAKA 4AQYT 2LM2A 2XQ9A 2HHHT 5JRCB 3I0QA 3N9QA 5AQRB 2KT9A 3AECA 2CA5A 1UK5A 1YQ4A 4CXYA 4UIGA 2D9DA 5HXCA 1ZKEA 3PUQA 4PK6A 2MBGA 4IE5A 1D0XA 2FJBA 4HFHA 3ZMVB 1FMWA 5IYZE 2FJAA 1NEKA 4DBRA 4PK5A 4KX6A 2K9AA 1KNPA 3W15B 1J1JA 2BG9E 4IL4A 5L3BB 1T8BA 1CUNA 1VCSA 2PFVA 3Q9DA 4JUYA 4KUMB 4TN7B 2OA5A 2BVMA 1HX1B 2AXDS 5AQNB 5J1GA 5HCMA 3RIUC 3B5MA 4IL9A 4KBMB 5HEUA 4ILAA 3N5LA 2WP9A 4AQGA 2XAFB 2CWYA 1US7B 1MMGA 4JLEA 2E9XA 2V5CA 5AQOB 2VB6A 3JAEA 2MPKA 3PDYA 4QH5A 4JI5T 2KINB 2C5JA 4QXCB 1G73A 4U3CA 4WZXA 3A5XA 3ZLIA 2BKNA 2XM1A 1E2AA 2EHOA 1WLXA 1UURA 2JIWA 4OHFA 5FKYA 3N9OA 2ACZA 1YW0A 2G0UA 2XAQB 4QKNA 4MLKA 4I43B 2DWKA 2K48A 2SPCA 5AQHB 5H6QB 3UUNA 4GKKT 2I0MA 4GYRA 2ODVA 3CVRA 3L39A 1ZHCA 4PJLA 4ZI2D 1J5ET 5JR9C 1UX4A 4DR2T 2V7LA 4TWHA 2IUBA 2RPAA 4NUVA 3AAIA 3M3ZB 2L8KA 3FBLA 4PJJA 4TZ4C 5AQLB 3VRAA 3N9LA 5AFUL 2VASA 1Z8UA 3S4UA 4DV2T 1MNEA 5FXZA 5JDMA 2X9WA 3C64A 4DUYT 2VK9A 2FBWA 2NP9A 4DV1T 3PJAA 1XDOA 2IMLA 2JMHA 4WNKA 3RI5A 5CFBA 3Q5XA 3R6NA 4QH1A 1HS7A 1VRBA 2LKHA 2VVSA 2XQYA 3P8CD 4HFVA 1D1BA 2LOPA 3PTRB 5FY7A 3QB5K 3ABVA 3UQ4A 2RA1A 4TV8E 2VKDA 2YN6A 4YTPA 3VKGA 3MACA 2P9BA 2WWUA 3AE2A 3KBUA 3L8RA 2E5VA 3ONLC 5JR9B 4JI4T 2BS4A 3AEFA 5JDFA 2RP4A 4P0AA 4K0UA 1NENA 3AE1A 3ONXA 5HWXA 4EZHA 2IDOB 4YY3T 4OFZA 2V7MA 2KZ7B 3BQKA 5FYMA 2J4GA 3O1IA 3OYXA 4XAXB 5JDNA 2E8IA 3K3QC 4JI1T 2LRLA 5JRCA 3RRWA 1IZNB 2XHEB 1OEDA 4DVDA 4P09A 1NAFA 2XQ8A 4PAGA 3RYIE 5ABFB 3KINB 4Z90A 3UT5E 2QA7A 3MXZA 2UU9T 1BR2A 2D0TA 3PUVF 4NIQA 5L3DB 2OLTA 2F4VT 1IBLT 3CK6A 4UXNB 4GK5E 2LSJA 4UELA 5JTGA 4HFIA 3QC9A 5LOVE 3UUXB 2UXCT 2GK9A 4KHPT 4YTMA 2X66A 2X68A 2JRKA 3PUWF 2I6HA 2WSSV 5L3FB 2MTQA 2DCFA 3HKCE 4DV5T 2DI4A 4JI0T 3U3IA 3UUBA 4JYAT 2YKSA 3EDVA 2E5LT 4JEUB 5C8YE 3IF8B 4O2AE 4YSZA 5J2UE 1HF8A 1YXRA 4HWCA 5AQQB 3G06A 3TLWA 2Y6XA 3VKHA 3BQLA 2IC9A 2W0GA 5HYAA 2CLYC 2UUAT 2B1EA 5LXTE 1UX5A 3JAFA 2YU1A 4PK4A 4FI5A 3RQWA 2KXPB 3E0ZA 5LB7B 2CLYB 1E1HB 3U78A 4ASKA 1LVKA 3KV5A 5EZYE 3ZJ2A 3ZMTB 1XMQT 4AKHA 2DL1A 2LHNA 3FXEB 4BAYB 4B3TT 4WYVA 1H7CA 5LJMA 2W2UA 4JEHB 3PUXF 4HFCA 4PW8A 3O4XE 3RC3A 3KVBA 2XASB 1Y01A 2ACXA 5LGNB 3RQUA 2WAUA 3B57A 3Q5EA 2UXDT 2WQYA 1W9RA 3CX7B 1X79A 3PUAA 4A98A 1IJ6A 1ZP0A 2J47A 2W00A 4H9OC 4UR9A 4B3RT 4HN9A 2V26A 2XJ7A 4IE0A 3RHWA 4LF7T 2M6BA 4ADZA 5BMVE 3AA0B 3I0OA 2JQQA 4HKAA 4TV9E 4MHCA 2H3RA 2X0YA 3ANWB 2VL8A 4TNWA 2LEHA 2LOSA 2FJEA 4YLHA 2LRKA 3EAMA 4HGAA 3ZT6A 3ZT5A 4AXPA 5LMNT 1WR6A 4DR7T 4IE4A 5KDMC 2L3LA 4L9IA 2X0HA 2ZM0A 3OTOT 4EEBA 2C5KT 4EIWA 3AVRA 1N33T 2MYSA 2CPTA 1MNDA 1I94T 5F3JA 1WCRA 4F8HA 4JI2T 3B13A 3QUJA 3FZFB 4EOZB 5EK2A 2XQ4A 4KHZF 4A5XA 3HL6A 2VL0A 3LG7A 4U7YA 4ZXLA 3AEEA 4OX9T 4CI3B 2CHOA 4I50E 5LGTB 2BKOA 2QVAA 2Y48B 4OYKA 5FXVA 2ZM6T 2ZMAA 2BG9A 2YINA 4B3ST 1MIYA 3CIRA 3ZYKA 4QXBB 2CBIA 4ZHQE 4B6XA 4TX5A 3TLVA 3QOFA 4DMVA 3AB3B 3NZPA 3ZMSB 2IIUA 1D1AA 1BR4A 5HEOA 5A1LA 1KEYA 5FY1A 2X67A 4KMCA 4BA9A 1N34T 2CBJA 2YOEA 1WYCA 2E9XC 5LJNA 2Q9QA 3J9X1 3JADA 1KF6A 3OYZA 1ZEEA 2XAGB 3ESLA 3KFWX 3LBXA 4GKJT 3NVOA 3N2GE 3FZLB 3UU3A 3ZKRA 4DV7T 4AKIA 3D0TA 4PFOA 5JR9A 4ISSA 4YT0A 1KK7A 2E2AA 4EAHA 1XMOT 2V6YA 1J5WA 2A3DA 2XZEA 4LF6T 2AE9A 3VRBA 3A7MA 1SE7A 4C91A 4EB6E 2CE7A 2CXFA 4Z91A 1XNRT 4LMJA 3JCFA 2YDQA 3N9PA 3O1HA 4HFEA 4U74A 1X9BA 3KDSE 4CQIA 4LF9T 3OPCA 3SFEA 2BBHA 4HWHA 1D0YA 4U33A 2QGSA 3HKBE 3GA8A 3RLFF 4EGWA 2W61A 4QX7B 2XUEA 1UUSA 3C4ZA 1E7PA 4U2YA 2UUCT 4DR6T 2JJ9A 4YHJA 4YTNA 5JH7E 3GMIA 4OK0A 4U31A 3TLUA 2VQET 3DTOA 4LMLA 1LVFA 2NR4A 3PURA 5FVKA 5LBMA 4DR5T 1JNRA 1D0ZA 3Q5DA 2D2SA 3MA9A 2VVNA 5F8PA 3L09A 4BJMA 5IUXA 1Y64B 4JI6T 3AE7A 4CI2B 4X1YE 5JQGE 2E9XB 3KV9A 4O4IE 3AEBA 3FHNA 1WFDA 4EV6A 5L3GB 3LBXB 4X62T 2HN2A 2LHRA 2JMKA 4UVAB 3PV0F 2XM2A 3ZCJA 2FUPA 2N9DA 5EK4A 3UUMA 3EUHA 4AKLA 3ETUA 3MK7C 3NRXA 2H7VC 1VOMA 1YKHB 3LK3B 2DNXA 5LCYA 1HNZT 3H3AA 4L0RA 3RIFA 4DR4T 5DQVA 2C5IT 4XZCA 5DABA 2V8SV 4H9SE 4CZZB 4DIDB 5L47A 5AQKB 1W0AA 2WDRA 3VU7H 1MIWA 4CN1A 2JPFA 4UV8B 3LFMA 2CHNA 1W09A 2WZIA 1GQEA 5AQSB 5KMGP 2WY2A 1N32T 2LLYA 2NW8A 1S35A 2CXDA 3JC6D 3UU8A 1QUUA 2WU2A 4H9NC 1BR0A 4EYUA 4NUUA 2V7KA 5IHYA 1L0VA 1U4QA 2W62A 4O2BE 2WM9A 2Q9QC 4HE8A 4YJ3E 1HTJF 4A56A 4G2AA 1OEDC 2XPKA 3CQCB 3SRZA 2NTXA 5BR8T 2IHR1 4IT4A 2QRXA 3ZEFB 3O9XA 4AISA 4BJNA 5AQIB 5CGMA 4X64T 5ETWA 4ZI7E 1S94A 3UTKA 2R6GF 2UXNB 1WRDA 2BKPA 2V7JA 3FZKB 3OKQA 4LFBT 2MOZA 2PG8A 2XSAA 5E0OA 5TAOA 4GIWA 1Z0PA 5CA1E 4CI1B 3LK42 4L5GA 2MAWA 3ZCIA 4DO0A 5JDLA 4X65T 1IBMT 4JI7T 1XNQT 3PU3A 2XQ5A 4QHOA 2NW9A 5ABEA 3AE6A 3KV6A 5FL0A 4ZI2C 1YD8G 4HFBA 4E7ZA 4ZI3D 5ADXL 1M7KA 2KWHA 2VURA 3KV4A 4U72A 4YHHT 3IBPA 3E22E 2BG9B 3AE9A 3AEAA 4QX8B 1ZV4X 5KXJA 3AVSA 5L3CB 2X0LB 3IHRA 4UF0A 3AE4A 2LE8A 2VWAA 3ZMUB 4ZEYA 2BG9C 3CX6B 3T1YT 5GONE 4H9PC 4F6RC 2UXBT 4QXHB 3ZJ1A 5LNKA 4GYSA 3V5SA 2Q9QD 1QLBA 3PJAJ 3ZYLA 1HCIA 5FP3A 2LSIA 3AA1B 3CQGB 2D0UA 1EZ3A 2I59A 3QK6A 2KSRA 2Q9QB 3TLTA 3AA7B 3CKDA 3UFGA 4ZOLE 1XWMA 2X9HA 3K3OA 2YDSA 4C90A 3ZSTA 1CHUA 4WBNE 2NTYA 5AQJB 1UCUA 3P4SA 2OV9A 4YSXA 2NW7A 2PBIA 5DQWA 4AKRB 5LGUB 2FJDA 4DV4T 2KMFA 2BS2A 5HCJA 3RYCE 2ZM8A 1HR0T 3AAEB 5JDGA 1G8XA 5HAXA 3SFDA 4ZS2A 1D1CA 3ETVA 5F5WA 2BBJA 3RH3A 1IAPA 2UUBT 3MZKB 2V5DA 3HI2A 1T72A 3O1JA 2Z6EA 4PJNA 1I6ZA 3H37A 3A8YC 5LG3A 4WW0A 3CQXC 4LF8T 3ZYMA 2V1DB 2J1DG 3ZT7A 3EHZA 5L4HA 2JQ9A 1XZYA 3LSVA 4HTEA
chains in the Genus database with same CATH topology
4H63V 3PU8A 3PE0A 3DJBA 3FB2A 4WBOA 2V7IA 5LHHB 3WAJA 3N9MA 3GN5A 2HH7A 4ERRA 5HXSA 1FIOA 1MMAA 2KLQA 3NRYA 4ANJA 2LJLA 2E9XD 1HG5A 5DJQC 4O8SA 5CB4E 2A2FX 2HPLA 3I9YA 2Y8DA 1YKEB 3CWZB 3I9WA 3C4WA 5JDHA 4P0BA 1MIVA 3BQIA 1LRZA 4MFRA 1B7TA 3F57A 3RYHE 2XAHB 5LYJE 1SHZC 3DP7A 2K5BB 4XBFB 3MJXA 4H63H 2LSYA 4G63A 3PUSA 4J2CA 4IHJE 4AQFA 4X20E 4AQFC 3SS1A 3E08A 1MMNA 2N1GA 2W63A 3VHLA 3ANWA 4CXWA 2IC6A 3GWHA 5LHIB 5KX5E 4X1KE 2ZM2A 4PNIA 3CPZA 2NWBA 4IIJE 2XAJB 2K24A 3WI3A 3CMLA 1IJ5A 2LSGA 2YU2A 2VKOA 4H9RC 3L3PA 2BVLA 2M67A 2ES0A 3OJAA 4PJMA 4UEMA 4EYYR 5FY0A 4IE6A 1HX8A 2BDEA 1NWMX 3ZC0A 2CM0A 3K8PC 3RYFE 2ODUA 3MKDA 3N2OA 3ZC1A 2DHRA 3RRCA 3UFEA 1SA0E 3SWHA 4H9QC 3TKLB 5L3EB 4ILUA 3N9NA 1FMVA 2CMRA 4X1IE 4I4TE 3SOLA 3F31A 4DNDA 3ZEFB 4MBQA 4UF0B 3RPUA 2YEVC 5M4YA 2C0SA 5FXXA 1MMDA 2EHOC 3AA6B 2KNDA 4ZS3A 3BK9A 3N2KE 4Z8XA 3ZPOA 1HFAA 3ZMZB 5J2TE 3RX6A 2CEAA 5LBQB 4M1PA 2PJQA 3HA4A 4I55E 3I1AA 4EXTA 2IW5B 3LK2B 4QWNB 3LJCA 4IGUA 2BZBA 2X51A 1OXZA 2WBLA 2N2NA 2D5UA 3EDUA 1OWAA 2CWOA 2UXXB 5LHGB 2LSKA 2YK0A 2ZLYA 3AAAB 3F2EA 4GK0E 2HPJA 4IDZA 4AI6A 1LKXA 2WMOA 2H7OA 3HR0A 5JVDE 3PUGA 4O4JE 3M65A 3C51A 3C50A 3C4XA 3Q2MA 3IEEA 4ISTA 3KVAA 4O4HE 4TUYE 3J7Yq 1FEWA 4YFSA 3ZN1B 3EVYA 3V5UA 3P7IA 3GN5B 5JREA 4ZI3C 3K3NA 1V9DA 1T98A 4EZ4A 5FNVE 3ZN0B 3CX8B 4UV9B 1QSDA 3C98B 4OYJA 4AKGA 5HXEA 2X9YA 4UVBB 5JDQA 2VKHA 3UULA 5JRCA 2DLRA 3HKDE 5LG4A 4UVCB 3R84B 2KWIB 3RC8A 4DMWA 2DWGA 5HWYA 3OBVE 4YJ2E 2WMNA 4N78D 5FMNA 5EK3A 2LM9A 3NZQA 3JC6C 3T8OA 5CA0E 2LT3A 2CCQA 2XTLA 3Q5WA 4CXXA 3FBZA 1HG2A 5LA6E 5HXHA 4MALA 4V1Av 4IE7A 1BR1A 3HKEE 4PFPA 5HXRA 5LP6E 2EHOD 1KNZA 3KBTA 3RKOA 4KP3C 4HEAA 1WYBA 4GOUA 2EHOB 2CXLA 2IAKA 3FXDB 4FJOA 5H6RB 1AJ3A 2X9XA 4O4LE 2NOXA 1U5PA 5FXWA 4DBQA 4E7SA 2VKJA 3NBXX 2L9QA 2A72A 1O3XA 3WAKA 5JRCB 3I0QA 3N9QA 2KT9A 2CA5A 4CXYA 4UIGA 5HXCA 1ZKEA 3PUQA 4PK6A 2MBGA 4IE5A 1D0XA 3ZMVB 1FMWA 5IYZE 4DBRA 4PK5A 5L3BB 2K9AA 3W15B 1CUNA 2PFVA 4KUMB 3Q9DA 4JUYA 4TN7B 5L2LA 2BVMA 2OA5A 5J1GA 4KBMB 4AQGA 2XAFB 2CWYA 1US7B 1MMGA 4JLEA 2E9XA 2VB6A 3PDYA 3ZLIA 2KINB 2C5JA 4QXCB 1G73A 3A5XA 2EHOA 1WLXA 4OHFA 3N9OA 2G0UA 1YW0A 2XAQB 4QKNA 5H6QB 4MLKA 4I43B 2DWKA 2K48A 2SPCA 3UUNA 4GYRA 2ODVA 3CVRA 4PJLA 1ZHCA 4ZI2D 5JR9C 1UX4A 2V7LA 4NUVA 3AAIA 4PJJA 2L8KA 3FBLA 4TZ4C 3N9LA 5AFUL 2VASA 3S4UA 1MNEA 5FXZA 5JDMA 2X9WA 3C64A 2VK9A 2NP9A 4WNKA 2JMHA 3Q5XA 3R6NA 1HS7A 1VRBA 3P8CD 2XQYA 4HFVA 1D1BA 2LOPA 3PTRB 5FY7A 2RA1A 4TV8E 2VKDA 3VKGA 3MACA 2P9BA 2WWUA 3KBUA 5JR9B 5JDFA 4P0AA 2RP4A 4K0UA 3ONXA 5HWXA 4EZHA 4OFZA 2V7MA 2KZ7B 3BQKA 5FYMA 4XAXB 3O1IA 3OYXA 5JDNA 2E8IA 3K3QC 3RRWA 1IZNB 2XHEB 4DVDA 4P09A 1NAFA 4PAGA 3RYIE 3KINB 3UT5E 2QA7A 3MXZA 1BR2A 2D0TA 5L3DB 4UXNB 4GK5E 2LSJA 4UELA 3QC9A 5LOVE 3UUXB 2GK9A 2X66A 2X68A 2JRKA 2WSSV 5L3FB 2MTQA 2DCFA 3HKCE 2DI4A 3U3IA 3EDVA 4JEUB 5C8YE 3IF8B 4O2AE 5J2UE 1HF8A 2Y6XA 3VKHA 3BQLA 2IC9A 2W0GA 5HYAA 2CLYC 2B1EA 5LXTE 1UX5A 2YU1A 4PK4A 4FI5A 2KXPB 3E0ZA 2CLYB 1E1HB 3U78A 4ASKA 1LVKA 3KV5A 5EZYE 3ZJ2A 3ZMTB 4AKHA 2LHNA 3FXEB 4BAYB 1H7CA 5LJMA 4PW8A 4JEHB 3RC3A 3O4XE 3KVBA 2XASB 2ACXA 5LGNB 2WAUA 3B57A 3CX7B 3PUAA 1X79A 1IJ6A 2W00A 4H9OC 4HN9A 2V26A 4IE0A 4ADZA 5BMVE 3AA0B 3I0OA 2JQQA 4HKAA 4TV9E 4MHCA 2H3RA 3ANWB 4YLHA 2VL8A 3ZCIA 2LEHA 2LOSA 4HGAA 4AXPA 1WR6A 4IE4A 5KDMC 2L3LA 4L9IA 2ZM0A 2C5KT 4EIWA 3AVRA 2MYSA 1MNDA 5F3JA 3B13A 3QUJA 4EOZB 5EK2A 3HL6A 3LG7A 4CI3B 4I50E 5LGTB 2Y48B 4OYKA 5FXVA 2ZMAA 2YINA 1MIYA 3ZYKA 4QXBB 4ZHQE 4B6XA 4TX5A 4DMVA 3AB3B 3NZPA 3ZMSB 1D1AA 1BR4A 5A1LA 5FY1A 2X67A 4KMCA 4BA9A 1WYCA 2E9XC 5LJNA 2Q9QA 3J9X1 3OYZA 1ZEEA 2XAGB 3ESLA 3KFWX 3LBXA 3N2GE 3D0TA 4PFOA 5JR9A 4ISSA 1KK7A 4AKIA 4EAHA 2A3DA 4C91A 4EB6E 2CE7A 2CXFA 3N9PA 3O1HA 4U74A 3KDSE 4CQIA 1D0YA 2QGSA 3HKBE 3GA8A 2W61A 4QX7B 2XUEA 3C4ZA 2JJ9A 4YHJA 5JH7E 3GMIA 4OK0A 3DTOA 1LVFA 3PURA 5LBMA 1D0ZA 5F8PA 2D2SA 3MA9A 4BJMA 3L09A 1Y64B 4CI2B 4X1YE 5JQGE 2E9XB 3KV9A 4O4IE 3FHNA 5L3GB 3LBXB 2LHRA 2JMKA 4UVAB 3ZCJA 2N9DA 5EK4A 3UUMA 3EUHA 4AKLA 3ETUA 3MK7C 3NRXA 2H7VC 1VOMA 1YKHB 3LK3B 2DNXA 5LCYA 3H3AA 4L0RA 5DQVA 2C5IT 4XZCA 5DABA 4CZZB 4H9SE 3VU7H 1MIWA 2JPFA 4UV8B 3LFMA 5KMGP 2NW8A 1S35A 2CXDA 3JC6D 1QUUA 4H9NC 1BR0A 4EYUA 4NUUA 2V7KA 5IHYA 1U4QA 2W62A 4O2BE 2WM9A 2Q9QC 4HE8A 4YJ3E 1HTJF 4A56A 4G2AA 3CQCB 3SRZA 2NTXA 3O9XA 4BJNA 5ETWA 4ZI7E 1S94A 3UTKA 2UXNB 1WRDA 2V7JA 3OKQA 2MOZA 2PG8A 5TAOA 5E0OA 5CA1E 4GIWA 1Z0PA 4CI1B 3LK42 4L5GA 4DO0A 5JDLA 3PU3A 4QHOA 2NW9A 3KV6A 4ZI2C 1YD8G 4E7ZA 4ZI3D 5ADXL 2KWHA 3KV4A 4U72A 3IBPA 3E22E 4QX8B 5L3CB 1ZV4X 3AVSA 2X0LB 3IHRA 4UF0A 2LE8A 2VWAA 3ZMUB 3CX6B 5GONE 4H9PC 4F6RC 4QXHB 3ZJ1A 5LNKA 4GYSA 3V5SA 2Q9QD 3ZYLA 1HCIA 5FP3A 2LSIA 3AA1B 3CQGB 2D0UA 1EZ3A 2I59A 3QK6A 2Q9QB 3AA7B 3CKDA 4ZOLE 4C90A 2X9HA 3K3OA 4WBNE 2NTYA 1UCUA 2NW7A 2PBIA 5DQWA 4AKRB 5LGUB 2KMFA 3RYCE 2ZM8A 3AAEB 5JDGA 1G8XA 5HAXA 4ZS2A 1D1CA 3ETVA 3RH3A 1IAPA 3MZKB 3HI2A 3O1JA 2Z6EA 4PJNA 3H37A 4WW0A 3CQXC 3ZYMA 2V1DB 2J1DG 3N5LA 4HTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHO B;  3JC6 D;  2EHO A;  2Q9Q B;  3ANW A;  2E9X A;  2E9X D;  2Q9Q C; 
#chains in the Genus database with same CATH topology
 4H63 V;  3PU8 A;  1YQ3 A;  3PE0 A;  3AE8 A;  3DJB A;  3FB2 A;  2V7I A;  4Q25 A;  4I0U A;  4WBO A;  5LHH B;  3WAJ A;  3N9M A;  3FZH B;  4DV0 T;  2H89 A;  3OVU A;  3GN5 A;  5AQP B;  4ZZC A;  2HH7 A;  4ERR A;  5HXS A;  1FIO A;  1JNZ A;  1MMA A;  2KLQ A;  3NRY A;  4IDQ A;  4ANJ A;  2WB5 A;  4LFA T;  2LJL A;  4NXN T;  2M6I A;  2E9X D;  3H3M A;  1HG5 A;  5DJQ C;  4O8S A;  5CB4 E;  2A2F X;  3AEG A;  4DUZ T;  4AIU A;  2HPL A;  2WU5 A;  3I9Y A;  2Y8D A;  4DR3 T;  1T7S A;  1YKE B;  2WDV A;  3CWZ B;  3I9W A;  3UU6 A;  4CN6 A;  5FL1 A;  5L2L A;  4DV3 T;  4HWF A;  3C4W A;  5JDH A;  2K3W A;  5AQT B;  4P0B A;  4ILB A;  1MIV A;  3BQI A;  1LRZ A;  4MFR A;  1B7T A;  3F57 A;  3RIA A;  3RYH E;  2XAH B;  5LYJ E;  1OED B;  1SHZ C;  5L4E A;  2YDR A;  3DP7 A;  2PTF A;  3TLS A;  2W66 A;  2K5B B;  4XBF B;  3MJX A;  4H63 H;  3ZSS A;  2XQA A;  2LSY A;  4G63 A;  4IDP A;  3PUS A;  4J2C A;  3P50 A;  4IHJ E;  4AQF A;  4COF A;  4X20 E;  1HNX T;  3FZM B;  3SS1 A;  3E08 A;  1MMN A;  2N1G A;  2W63 A;  4AQF C;  4LF4 T;  2V6X A;  3PUZ F;  3QB5 A;  3AE5 A;  3ANW A;  2IC6 A;  3GWH A;  3VHL A;  4CXW A;  2WWV A;  5HEJ A;  5KX5 E;  4X1K E;  2ZM2 A;  5LHI B;  4ZZB A;  4PNI A;  3CPZ A;  2NWB A;  4IIJ E;  2XAJ B;  2K24 A;  3WI3 A;  3CML A;  2VQF T;  3AXJ A;  1IJ5 A;  2LSG A;  4B3M T;  2YU2 A;  2VKO A;  4H9R C;  3L3P A;  2BVL A;  5IWA T;  2M67 A;  2ES0 A;  3OJA A;  4PJM A;  4UEM A;  4P1N A;  4EYY R;  1IBK T;  1ZOY A;  5FY0 A;  2V6Y B;  2WDQ A;  4IE6 A;  4U7I A;  3RKG A;  1HX8 A;  2W67 A;  2BDE A;  1NWM X;  2HN1 A;  3ZC0 A;  2CM0 A;  4X5T A;  2W4X A;  3K8P C;  3RYF E;  5ABH A;  2ODU A;  3MKD A;  3N2O A;  3ZC1 A;  2DHR A;  3RRC A;  3UFE A;  1SA0 E;  2JQK A;  5AQV B;  3SWH A;  4H9Q C;  3TKL B;  1KFY A;  4ILU A;  4YXD A;  2LKG A;  5L3E B;  5C3J A;  4LF5 T;  3N9N A;  1FMV A;  2CMR A;  4NPP A;  4I4T E;  4TWF A;  3F31 A;  4X1I E;  3RGL A;  3SOL A;  4MBQ A;  4DND A;  2XQ7 A;  2B76 A;  4UF0 B;  3RPU A;  2YEV C;  5M4Y A;  2C0S A;  1FJG T;  5FXX A;  4JV5 T;  1MMD A;  1UGO A;  5HEG A;  2EHO C;  3AA6 B;  2KND A;  4DV6 T;  4ZS3 A;  3BK9 A;  3N2K E;  4Z8X A;  4HWI B;  3ZPO A;  3RIU A;  1HFA A;  3ZMZ B;  3NWI A;  3ONJ A;  3K1S A;  2BS3 A;  3UQ7 A;  3AXJ B;  2XSB A;  3RX6 A;  2XY8 B;  5J2T E;  2CEA A;  2JQH A;  4JBW F;  5LBQ B;  4M1P A;  2PJQ A;  3HA4 A;  4I55 E;  3I1A A;  2QYW A;  2IW5 B;  3LK2 B;  3P4W A;  4EXT A;  2WS3 A;  4U2Z A;  4QWN B;  3LJC A;  5CJ5 A;  3EAB A;  4IGU A;  2BZB A;  2X51 A;  1OXZ A;  2WBL A;  2N2N A;  1HNW T;  2D5U A;  3EDU A;  1OWA A;  4DR1 T;  2CWO A;  2UXX B;  4TWD A;  2LSK A;  5LHG B;  4K0K T;  2A9U A;  3VR9 A;  2YK0 A;  2ZLY A;  3AAA B;  3F2E A;  4GK0 E;  2HPJ A;  3QNU A;  4IDZ A;  2WCA A;  2XQ3 A;  4AI6 A;  1LKX A;  2WMO A;  2H7O A;  3HR0 A;  5C2T A;  5JVD E;  4CN4 A;  3PUG A;  4O4J E;  3M65 A;  5J0Z A;  3C51 A;  3C50 A;  3C4X A;  3Q2M A;  3IEE A;  3LDQ B;  4IST A;  3KVA A;  3NKZ A;  4O4H E;  4TUY E;  2CRB A;  3J7Y q;  1FEW A;  4YFS A;  3ZN1 B;  1N36 T;  3EVY A;  3V5U A;  4JI8 T;  3P7I A;  4HFD A;  3GN5 B;  3P4P A;  3VR8 A;  5JRE A;  4ZI3 C;  3K3N A;  4A97 A;  1V9D A;  4QH4 A;  1T98 A;  4EZ4 A;  5FNV E;  3ZN0 B;  3CX8 B;  3EI0 A;  4UV9 B;  4YSY A;  1QSD A;  3C98 B;  1DU2 A;  4OYJ A;  4AKG A;  1WR0 A;  2WZH A;  5HXE A;  2X9Y A;  3IA3 A;  1W0B A;  2VKH A;  4UVB B;  1KNR A;  3UUL A;  2DLR A;  3HKD E;  5AQF B;  3AED A;  5JDQ A;  5LG4 A;  3PUY F;  1M62 A;  4UVC B;  3R84 B;  1XDP A;  2KWI B;  4EED A;  5ABF A;  3RC8 A;  4DMW A;  5ABG A;  2DWG A;  5HWY A;  1SUM B;  3AE3 A;  4KI0 F;  5LMU T;  3OBV E;  4YJ2 E;  2WMN A;  4N78 D;  5FMN A;  5EK3 A;  2LM9 A;  3NZQ A;  3JC6 C;  5AQM B;  3T8O A;  5CA0 E;  4X66 T;  2LT3 A;  2CCQ A;  2XTL A;  3Q5W A;  4LMK A;  3RF1 A;  3FBZ A;  1HG2 A;  5LA6 E;  4CXX A;  4MAL A;  3UU4 A;  5HXH A;  5AQU B;  4HWD A;  4IDO A;  4V1A v;  3T1H T;  2J62 A;  4IE7 A;  1BR1 A;  3HKE E;  4PFP A;  4NXM T;  4TNV A;  1OED E;  5HXR A;  1R8I A;  2EHO D;  3P4Q A;  3P4R A;  5LP6 E;  3KBT A;  3RKO A;  4KP3 C;  4IRE A;  1KNZ A;  3X1D A;  4HEA A;  3UU5 A;  4LFC T;  1WYB A;  5FVL A;  4GOU A;  2EHO B;  2CXL A;  2IAK A;  3FXD B;  4FJO A;  5H6R B;  1AJ3 A;  4ILC A;  4JI3 T;  2XQ6 A;  5AQG B;  2X9X A;  4O4L E;  2NOX A;  5HEH A;  1U5P A;  5FXW A;  4DBQ A;  4E7S A;  2VKJ A;  3NBX X;  4IDN A;  2H88 A;  2L9Q A;  1O3X A;  2A72 A;  1VCT A;  3WAK A;  4AQY T;  2LM2 A;  2XQ9 A;  2HHH T;  5JRC B;  3I0Q A;  3N9Q A;  5AQR B;  2KT9 A;  3AEC A;  2CA5 A;  1UK5 A;  1YQ4 A;  4CXY A;  4UIG A;  2D9D A;  5HXC A;  1ZKE A;  3PUQ A;  4PK6 A;  2MBG A;  4IE5 A;  1D0X A;  2FJB A;  4HFH A;  3ZMV B;  1FMW A;  5IYZ E;  2FJA A;  1NEK A;  4DBR A;  4PK5 A;  4KX6 A;  2K9A A;  1KNP A;  3W15 B;  1J1J A;  2BG9 E;  4IL4 A;  5L3B B;  1T8B A;  1CUN A;  1VCS A;  2PFV A;  3Q9D A;  4JUY A;  4KUM B;  4TN7 B;  2OA5 A;  2BVM A;  1HX1 B;  2AXD S;  5AQN B;  5J1G A;  5HCM A;  3RIU C;  3B5M A;  4IL9 A;  4KBM B;  5HEU A;  4ILA A;  3N5L A;  2WP9 A;  4AQG A;  2XAF B;  2CWY A;  1US7 B;  1MMG A;  4JLE A;  2E9X A;  2V5C A;  5AQO B;  2VB6 A;  3JAE A;  2MPK A;  3PDY A;  4QH5 A;  4JI5 T;  2KIN B;  2C5J A;  4QXC B;  1G73 A;  4U3C A;  4WZX A;  3A5X A;  3ZLI A;  2BKN A;  2XM1 A;  1E2A A;  2EHO A;  1WLX A;  1UUR A;  2JIW A;  4OHF A;  5FKY A;  3N9O A;  2ACZ A;  1YW0 A;  2G0U A;  2XAQ B;  4QKN A;  4MLK A;  4I43 B;  2DWK A;  2K48 A;  2SPC A;  5AQH B;  5H6Q B;  3UUN A;  4GKK T;  2I0M A;  4GYR A;  2ODV A;  3CVR A;  3L39 A;  1ZHC A;  4PJL A;  4ZI2 D;  1J5E T;  5JR9 C;  1UX4 A;  4DR2 T;  2V7L A;  4TWH A;  2IUB A;  2RPA A;  4NUV A;  3AAI A;  3M3Z B;  2L8K A;  3FBL A;  4PJJ A;  4TZ4 C;  5AQL B;  3VRA A;  3N9L A;  5AFU L;  2VAS A;  1Z8U A;  3S4U A;  4DV2 T;  1MNE A;  5FXZ A;  5JDM A;  2X9W A;  3C64 A;  4DUY T;  2VK9 A;  2FBW A;  2NP9 A;  4DV1 T;  3PJA A;  1XDO A;  2IML A;  2JMH A;  4WNK A;  3RI5 A;  5CFB A;  3Q5X A;  3R6N A;  4QH1 A;  1HS7 A;  1VRB A;  2LKH A;  2VVS A;  2XQY A;  3P8C D;  4HFV A;  1D1B A;  2LOP A;  3PTR B;  5FY7 A;  3QB5 K;  3ABV A;  3UQ4 A;  2RA1 A;  4TV8 E;  2VKD A;  2YN6 A;  4YTP A;  3VKG A;  3MAC A;  2P9B A;  2WWU A;  3AE2 A;  3KBU A;  3L8R A;  2E5V A;  3ONL C;  5JR9 B;  4JI4 T;  2BS4 A;  3AEF A;  5JDF A;  2RP4 A;  4P0A A;  4K0U A;  1NEN A;  3AE1 A;  3ONX A;  5HWX A;  4EZH A;  2IDO B;  4YY3 T;  4OFZ A;  2V7M A;  2KZ7 B;  3BQK A;  5FYM A;  2J4G A;  3O1I A;  3OYX A;  4XAX B;  5JDN A;  2E8I A;  3K3Q C;  4JI1 T;  2LRL A;  5JRC A;  3RRW A;  1IZN B;  2XHE B;  1OED A;  4DVD A;  4P09 A;  1NAF A;  2XQ8 A;  4PAG A;  3RYI E;  5ABF B;  3KIN B;  4Z90 A;  3UT5 E;  2QA7 A;  3MXZ A;  2UU9 T;  1BR2 A;  2D0T A;  3PUV F;  4NIQ A;  5L3D B;  2OLT A;  2F4V T;  1IBL T;  3CK6 A;  4UXN B;  4GK5 E;  2LSJ A;  4UEL A;  5JTG A;  4HFI A;  3QC9 A;  5LOV E;  3UUX B;  2UXC T;  2GK9 A;  4KHP T;  4YTM A;  2X66 A;  2X68 A;  2JRK A;  3PUW F;  2I6H A;  2WSS V;  5L3F B;  2MTQ A;  2DCF A;  3HKC E;  4DV5 T;  2DI4 A;  4JI0 T;  3U3I A;  3UUB A;  4JYA T;  2YKS A;  3EDV A;  2E5L T;  4JEU B;  5C8Y E;  3IF8 B;  4O2A E;  4YSZ A;  5J2U E;  1HF8 A;  1YXR A;  4HWC A;  5AQQ B;  3G06 A;  3TLW A;  2Y6X A;  3VKH A;  3BQL A;  2IC9 A;  2W0G A;  5HYA A;  2CLY C;  2UUA T;  2B1E A;  5LXT E;  1UX5 A;  3JAF A;  2YU1 A;  4PK4 A;  4FI5 A;  3RQW A;  2KXP B;  3E0Z A;  5LB7 B;  2CLY B;  1E1H B;  3U78 A;  4ASK A;  1LVK A;  3KV5 A;  5EZY E;  3ZJ2 A;  3ZMT B;  1XMQ T;  4AKH A;  2DL1 A;  2LHN A;  3FXE B;  4BAY B;  4B3T T;  4WYV A;  1H7C A;  5LJM A;  2W2U A;  4JEH B;  3PUX F;  4HFC A;  4PW8 A;  3O4X E;  3RC3 A;  3KVB A;  2XAS B;  1Y01 A;  2ACX A;  5LGN B;  3RQU A;  2WAU A;  3B57 A;  3Q5E A;  2UXD T;  2WQY A;  1W9R A;  3CX7 B;  1X79 A;  3PUA A;  4A98 A;  1IJ6 A;  1ZP0 A;  2J47 A;  2W00 A;  4H9O C;  4UR9 A;  4B3R T;  4HN9 A;  2V26 A;  2XJ7 A;  4IE0 A;  3RHW A;  4LF7 T;  2M6B A;  4ADZ A;  5BMV E;  3AA0 B;  3I0O A;  2JQQ A;  4HKA A;  4TV9 E;  4MHC A;  2H3R A;  2X0Y A;  3ANW B;  2VL8 A;  4TNW A;  2LEH A;  2LOS A;  2FJE A;  4YLH A;  2LRK A;  3EAM A;  4HGA A;  3ZT6 A;  3ZT5 A;  4AXP A;  5LMN T;  1WR6 A;  4DR7 T;  4IE4 A;  5KDM C;  2L3L A;  4L9I A;  2X0H A;  2ZM0 A;  3OTO T;  4EEB A;  2C5K T;  4EIW A;  3AVR A;  1N33 T;  2MYS A;  2CPT A;  1MND A;  1I94 T;  5F3J A;  1WCR A;  4F8H A;  4JI2 T;  3B13 A;  3QUJ A;  3FZF B;  4EOZ B;  5EK2 A;  2XQ4 A;  4KHZ F;  4A5X A;  3HL6 A;  2VL0 A;  3LG7 A;  4U7Y A;  4ZXL A;  3AEE A;  4OX9 T;  4CI3 B;  2CHO A;  4I50 E;  5LGT B;  2BKO A;  2QVA A;  2Y48 B;  4OYK A;  5FXV A;  2ZM6 T;  2ZMA A;  2BG9 A;  2YIN A;  4B3S T;  1MIY A;  3CIR A;  3ZYK A;  4QXB B;  2CBI A;  4ZHQ E;  4B6X A;  4TX5 A;  3TLV A;  3QOF A;  4DMV A;  3AB3 B;  3NZP A;  3ZMS B;  2IIU A;  1D1A A;  1BR4 A;  5HEO A;  5A1L A;  1KEY A;  5FY1 A;  2X67 A;  4KMC A;  4BA9 A;  1N34 T;  2CBJ A;  2YOE A;  1WYC A;  2E9X C;  5LJN A;  2Q9Q A;  3J9X 1;  3JAD A;  1KF6 A;  3OYZ A;  1ZEE A;  2XAG B;  3ESL A;  3KFW X;  3LBX A;  4GKJ T;  3NVO A;  3N2G E;  3FZL B;  3UU3 A;  3ZKR A;  4DV7 T;  4AKI A;  3D0T A;  4PFO A;  5JR9 A;  4ISS A;  4YT0 A;  1KK7 A;  2E2A A;  4EAH A;  1XMO T;  2V6Y A;  1J5W A;  2A3D A;  2XZE A;  4LF6 T;  2AE9 A;  3VRB A;  3A7M A;  1SE7 A;  4C91 A;  4EB6 E;  2CE7 A;  2CXF A;  4Z91 A;  1XNR T;  4LMJ A;  3JCF A;  2YDQ A;  3N9P A;  3O1H A;  4HFE A;  4U74 A;  1X9B A;  3KDS E;  4CQI A;  4LF9 T;  3OPC A;  3SFE A;  2BBH A;  4HWH A;  1D0Y A;  4U33 A;  2QGS A;  3HKB E;  3GA8 A;  3RLF F;  4EGW A;  2W61 A;  4QX7 B;  2XUE A;  1UUS A;  3C4Z A;  1E7P A;  4U2Y A;  2UUC T;  4DR6 T;  2JJ9 A;  4YHJ A;  4YTN A;  5JH7 E;  3GMI A;  4OK0 A;  4U31 A;  3TLU A;  2VQE T;  3DTO A;  4LML A;  1LVF A;  2NR4 A;  3PUR A;  5FVK A;  5LBM A;  4DR5 T;  1JNR A;  1D0Z A;  3Q5D A;  2D2S A;  3MA9 A;  2VVN A;  5F8P A;  3L09 A;  4BJM A;  5IUX A;  1Y64 B;  4JI6 T;  3AE7 A;  4CI2 B;  4X1Y E;  5JQG E;  2E9X B;  3KV9 A;  4O4I E;  3AEB A;  3FHN A;  1WFD A;  4EV6 A;  5L3G B;  3LBX B;  4X62 T;  2HN2 A;  2LHR A;  2JMK A;  4UVA B;  3PV0 F;  2XM2 A;  3ZCJ A;  2FUP A;  2N9D A;  5EK4 A;  3UUM A;  3EUH A;  4AKL A;  3ETU A;  3MK7 C;  3NRX A;  2H7V C;  1VOM A;  1YKH B;  3LK3 B;  2DNX A;  5LCY A;  1HNZ T;  3H3A A;  4L0R A;  3RIF A;  4DR4 T;  5DQV A;  2C5I T;  4XZC A;  5DAB A;  2V8S V;  4H9S E;  4CZZ B;  4DID B;  5L47 A;  5AQK B;  1W0A A;  2WDR A;  3VU7 H;  1MIW A;  4CN1 A;  2JPF A;  4UV8 B;  3LFM A;  2CHN A;  1W09 A;  2WZI A;  1GQE A;  5AQS B;  5KMG P;  2WY2 A;  1N32 T;  2LLY A;  2NW8 A;  1S35 A;  2CXD A;  3JC6 D;  3UU8 A;  1QUU A;  2WU2 A;  4H9N C;  1BR0 A;  4EYU A;  4NUU A;  2V7K A;  5IHY A;  1L0V A;  1U4Q A;  2W62 A;  4O2B E;  2WM9 A;  2Q9Q C;  4HE8 A;  4YJ3 E;  1HTJ F;  4A56 A;  4G2A A;  1OED C;  2XPK A;  3CQC B;  3SRZ A;  2NTX A;  5BR8 T;  2IHR 1;  4IT4 A;  2QRX A;  3ZEF B;  3O9X A;  4AIS A;  4BJN A;  5AQI B;  5CGM A;  4X64 T;  5ETW A;  4ZI7 E;  1S94 A;  3UTK A;  2R6G F;  2UXN B;  1WRD A;  2BKP A;  2V7J A;  3FZK B;  3OKQ A;  4LFB T;  2MOZ A;  2PG8 A;  2XSA A;  5E0O A;  5TAO A;  4GIW A;  1Z0P A;  5CA1 E;  4CI1 B;  3LK4 2;  4L5G A;  2MAW A;  3ZCI A;  4DO0 A;  5JDL A;  4X65 T;  1IBM T;  4JI7 T;  1XNQ T;  3PU3 A;  2XQ5 A;  4QHO A;  2NW9 A;  5ABE A;  3AE6 A;  3KV6 A;  5FL0 A;  4ZI2 C;  1YD8 G;  4HFB A;  4E7Z A;  4ZI3 D;  5ADX L;  1M7K A;  2KWH A;  2VUR A;  3KV4 A;  4U72 A;  4YHH T;  3IBP A;  3E22 E;  2BG9 B;  3AE9 A;  3AEA A;  4QX8 B;  1ZV4 X;  5KXJ A;  3AVS A;  5L3C B;  2X0L B;  3IHR A;  4UF0 A;  3AE4 A;  2LE8 A;  2VWA A;  3ZMU B;  4ZEY A;  2BG9 C;  3CX6 B;  3T1Y T;  5GON E;  4H9P C;  4F6R C;  2UXB T;  4QXH B;  3ZJ1 A;  5LNK A;  4GYS A;  3V5S A;  2Q9Q D;  1QLB A;  3PJA J;  3ZYL A;  1HCI A;  5FP3 A;  2LSI A;  3AA1 B;  3CQG B;  2D0U A;  1EZ3 A;  2I59 A;  3QK6 A;  2KSR A;  2Q9Q B;  3TLT A;  3AA7 B;  3CKD A;  3UFG A;  4ZOL E;  1XWM A;  2X9H A;  3K3O A;  2YDS A;  4C90 A;  3ZST A;  1CHU A;  4WBN E;  2NTY A;  5AQJ B;  1UCU A;  3P4S A;  2OV9 A;  4YSX A;  2NW7 A;  2PBI A;  5DQW A;  4AKR B;  5LGU B;  2FJD A;  4DV4 T;  2KMF A;  2BS2 A;  5HCJ A;  3RYC E;  2ZM8 A;  1HR0 T;  3AAE B;  5JDG A;  1G8X A;  5HAX A;  3SFD A;  4ZS2 A;  1D1C A;  3ETV A;  5F5W A;  2BBJ A;  3RH3 A;  1IAP A;  2UUB T;  3MZK B;  2V5D A;  3HI2 A;  1T72 A;  3O1J A;  2Z6E A;  4PJN A;  1I6Z A;  3H37 A;  3A8Y C;  5LG3 A;  4WW0 A;  3CQX C;  4LF8 T;  3ZYM A;  2V1D B;  2J1D G;  3ZT7 A;  3EHZ A;  5L4H A;  2JQ9 A;  1XZY A;  3LSV A;  4HTE A; 
#chains in the Genus database with same CATH homology
 4H63 V;  3PU8 A;  3PE0 A;  3DJB A;  3FB2 A;  4WBO A;  2V7I A;  5LHH B;  3WAJ A;  3N9M A;  3GN5 A;  2HH7 A;  4ERR A;  5HXS A;  1FIO A;  1MMA A;  2KLQ A;  3NRY A;  4ANJ A;  2LJL A;  2E9X D;  1HG5 A;  5DJQ C;  4O8S A;  5CB4 E;  2A2F X;  2HPL A;  3I9Y A;  2Y8D A;  1YKE B;  3CWZ B;  3I9W A;  3C4W A;  5JDH A;  4P0B A;  1MIV A;  3BQI A;  1LRZ A;  4MFR A;  1B7T A;  3F57 A;  3RYH E;  2XAH B;  5LYJ E;  1SHZ C;  3DP7 A;  2K5B B;  4XBF B;  3MJX A;  4H63 H;  2LSY A;  4G63 A;  3PUS A;  4J2C A;  4IHJ E;  4AQF A;  4X20 E;  4AQF C;  3SS1 A;  3E08 A;  1MMN A;  2N1G A;  2W63 A;  3VHL A;  3ANW A;  4CXW A;  2IC6 A;  3GWH A;  5LHI B;  5KX5 E;  4X1K E;  2ZM2 A;  4PNI A;  3CPZ A;  2NWB A;  4IIJ E;  2XAJ B;  2K24 A;  3WI3 A;  3CML A;  1IJ5 A;  2LSG A;  2YU2 A;  2VKO A;  4H9R C;  3L3P A;  2BVL A;  2M67 A;  2ES0 A;  3OJA A;  4PJM A;  4UEM A;  4EYY R;  5FY0 A;  4IE6 A;  1HX8 A;  2BDE A;  1NWM X;  3ZC0 A;  2CM0 A;  3K8P C;  3RYF E;  2ODU A;  3MKD A;  3N2O A;  3ZC1 A;  2DHR A;  3RRC A;  3UFE A;  1SA0 E;  3SWH A;  4H9Q C;  3TKL B;  5L3E B;  4ILU A;  3N9N A;  1FMV A;  2CMR A;  4X1I E;  4I4T E;  3SOL A;  3F31 A;  4DND A;  3ZEF B;  4MBQ A;  4UF0 B;  3RPU A;  2YEV C;  5M4Y A;  2C0S A;  5FXX A;  1MMD A;  2EHO C;  3AA6 B;  2KND A;  4ZS3 A;  3BK9 A;  3N2K E;  4Z8X A;  3ZPO A;  1HFA A;  3ZMZ B;  5J2T E;  3RX6 A;  2CEA A;  5LBQ B;  4M1P A;  2PJQ A;  3HA4 A;  4I55 E;  3I1A A;  4EXT A;  2IW5 B;  3LK2 B;  4QWN B;  3LJC A;  4IGU A;  2BZB A;  2X51 A;  1OXZ A;  2WBL A;  2N2N A;  2D5U A;  3EDU A;  1OWA A;  2CWO A;  2UXX B;  5LHG B;  2LSK A;  2YK0 A;  2ZLY A;  3AAA B;  3F2E A;  4GK0 E;  2HPJ A;  4IDZ A;  4AI6 A;  1LKX A;  2WMO A;  2H7O A;  3HR0 A;  5JVD E;  3PUG A;  4O4J E;  3M65 A;  3C51 A;  3C50 A;  3C4X A;  3Q2M A;  3IEE A;  4IST A;  3KVA A;  4O4H E;  4TUY E;  3J7Y q;  1FEW A;  4YFS A;  3ZN1 B;  3EVY A;  3V5U A;  3P7I A;  3GN5 B;  5JRE A;  4ZI3 C;  3K3N A;  1V9D A;  1T98 A;  4EZ4 A;  5FNV E;  3ZN0 B;  3CX8 B;  4UV9 B;  1QSD A;  3C98 B;  4OYJ A;  4AKG A;  5HXE A;  2X9Y A;  4UVB B;  5JDQ A;  2VKH A;  3UUL A;  5JRC A;  2DLR A;  3HKD E;  5LG4 A;  4UVC B;  3R84 B;  2KWI B;  3RC8 A;  4DMW A;  2DWG A;  5HWY A;  3OBV E;  4YJ2 E;  2WMN A;  4N78 D;  5FMN A;  5EK3 A;  2LM9 A;  3NZQ A;  3JC6 C;  3T8O A;  5CA0 E;  2LT3 A;  2CCQ A;  2XTL A;  3Q5W A;  4CXX A;  3FBZ A;  1HG2 A;  5LA6 E;  5HXH A;  4MAL A;  4V1A v;  4IE7 A;  1BR1 A;  3HKE E;  4PFP A;  5HXR A;  5LP6 E;  2EHO D;  1KNZ A;  3KBT A;  3RKO A;  4KP3 C;  4HEA A;  1WYB A;  4GOU A;  2EHO B;  2CXL A;  2IAK A;  3FXD B;  4FJO A;  5H6R B;  1AJ3 A;  2X9X A;  4O4L E;  2NOX A;  1U5P A;  5FXW A;  4DBQ A;  4E7S A;  2VKJ A;  3NBX X;  2L9Q A;  2A72 A;  1O3X A;  3WAK A;  5JRC B;  3I0Q A;  3N9Q A;  2KT9 A;  2CA5 A;  4CXY A;  4UIG A;  5HXC A;  1ZKE A;  3PUQ A;  4PK6 A;  2MBG A;  4IE5 A;  1D0X A;  3ZMV B;  1FMW A;  5IYZ E;  4DBR A;  4PK5 A;  5L3B B;  2K9A A;  3W15 B;  1CUN A;  2PFV A;  4KUM B;  3Q9D A;  4JUY A;  4TN7 B;  5L2L A;  2BVM A;  2OA5 A;  5J1G A;  4KBM B;  4AQG A;  2XAF B;  2CWY A;  1US7 B;  1MMG A;  4JLE A;  2E9X A;  2VB6 A;  3PDY A;  3ZLI A;  2KIN B;  2C5J A;  4QXC B;  1G73 A;  3A5X A;  2EHO A;  1WLX A;  4OHF A;  3N9O A;  2G0U A;  1YW0 A;  2XAQ B;  4QKN A;  5H6Q B;  4MLK A;  4I43 B;  2DWK A;  2K48 A;  2SPC A;  3UUN A;  4GYR A;  2ODV A;  3CVR A;  4PJL A;  1ZHC A;  4ZI2 D;  5JR9 C;  1UX4 A;  2V7L A;  4NUV A;  3AAI A;  4PJJ A;  2L8K A;  3FBL A;  4TZ4 C;  3N9L A;  5AFU L;  2VAS A;  3S4U A;  1MNE A;  5FXZ A;  5JDM A;  2X9W A;  3C64 A;  2VK9 A;  2NP9 A;  4WNK A;  2JMH A;  3Q5X A;  3R6N A;  1HS7 A;  1VRB A;  3P8C D;  2XQY A;  4HFV A;  1D1B A;  2LOP A;  3PTR B;  5FY7 A;  2RA1 A;  4TV8 E;  2VKD A;  3VKG A;  3MAC A;  2P9B A;  2WWU A;  3KBU A;  5JR9 B;  5JDF A;  4P0A A;  2RP4 A;  4K0U A;  3ONX A;  5HWX A;  4EZH A;  4OFZ A;  2V7M A;  2KZ7 B;  3BQK A;  5FYM A;  4XAX B;  3O1I A;  3OYX A;  5JDN A;  2E8I A;  3K3Q C;  3RRW A;  1IZN B;  2XHE B;  4DVD A;  4P09 A;  1NAF A;  4PAG A;  3RYI E;  3KIN B;  3UT5 E;  2QA7 A;  3MXZ A;  1BR2 A;  2D0T A;  5L3D B;  4UXN B;  4GK5 E;  2LSJ A;  4UEL A;  3QC9 A;  5LOV E;  3UUX B;  2GK9 A;  2X66 A;  2X68 A;  2JRK A;  2WSS V;  5L3F B;  2MTQ A;  2DCF A;  3HKC E;  2DI4 A;  3U3I A;  3EDV A;  4JEU B;  5C8Y E;  3IF8 B;  4O2A E;  5J2U E;  1HF8 A;  2Y6X A;  3VKH A;  3BQL A;  2IC9 A;  2W0G A;  5HYA A;  2CLY C;  2B1E A;  5LXT E;  1UX5 A;  2YU1 A;  4PK4 A;  4FI5 A;  2KXP B;  3E0Z A;  2CLY B;  1E1H B;  3U78 A;  4ASK A;  1LVK A;  3KV5 A;  5EZY E;  3ZJ2 A;  3ZMT B;  4AKH A;  2LHN A;  3FXE B;  4BAY B;  1H7C A;  5LJM A;  4PW8 A;  4JEH B;  3RC3 A;  3O4X E;  3KVB A;  2XAS B;  2ACX A;  5LGN B;  2WAU A;  3B57 A;  3CX7 B;  3PUA A;  1X79 A;  1IJ6 A;  2W00 A;  4H9O C;  4HN9 A;  2V26 A;  4IE0 A;  4ADZ A;  5BMV E;  3AA0 B;  3I0O A;  2JQQ A;  4HKA A;  4TV9 E;  4MHC A;  2H3R A;  3ANW B;  4YLH A;  2VL8 A;  3ZCI A;  2LEH A;  2LOS A;  4HGA A;  4AXP A;  1WR6 A;  4IE4 A;  5KDM C;  2L3L A;  4L9I A;  2ZM0 A;  2C5K T;  4EIW A;  3AVR A;  2MYS A;  1MND A;  5F3J A;  3B13 A;  3QUJ A;  4EOZ B;  5EK2 A;  3HL6 A;  3LG7 A;  4CI3 B;  4I50 E;  5LGT B;  2Y48 B;  4OYK A;  5FXV A;  2ZMA A;  2YIN A;  1MIY A;  3ZYK A;  4QXB B;  4ZHQ E;  4B6X A;  4TX5 A;  4DMV A;  3AB3 B;  3NZP A;  3ZMS B;  1D1A A;  1BR4 A;  5A1L A;  5FY1 A;  2X67 A;  4KMC A;  4BA9 A;  1WYC A;  2E9X C;  5LJN A;  2Q9Q A;  3J9X 1;  3OYZ A;  1ZEE A;  2XAG B;  3ESL A;  3KFW X;  3LBX A;  3N2G E;  3D0T A;  4PFO A;  5JR9 A;  4ISS A;  1KK7 A;  4AKI A;  4EAH A;  2A3D A;  4C91 A;  4EB6 E;  2CE7 A;  2CXF A;  3N9P A;  3O1H A;  4U74 A;  3KDS E;  4CQI A;  1D0Y A;  2QGS A;  3HKB E;  3GA8 A;  2W61 A;  4QX7 B;  2XUE A;  3C4Z A;  2JJ9 A;  4YHJ A;  5JH7 E;  3GMI A;  4OK0 A;  3DTO A;  1LVF A;  3PUR A;  5LBM A;  1D0Z A;  5F8P A;  2D2S A;  3MA9 A;  4BJM A;  3L09 A;  1Y64 B;  4CI2 B;  4X1Y E;  5JQG E;  2E9X B;  3KV9 A;  4O4I E;  3FHN A;  5L3G B;  3LBX B;  2LHR A;  2JMK A;  4UVA B;  3ZCJ A;  2N9D A;  5EK4 A;  3UUM A;  3EUH A;  4AKL A;  3ETU A;  3MK7 C;  3NRX A;  2H7V C;  1VOM A;  1YKH B;  3LK3 B;  2DNX A;  5LCY A;  3H3A A;  4L0R A;  5DQV A;  2C5I T;  4XZC A;  5DAB A;  4CZZ B;  4H9S E;  3VU7 H;  1MIW A;  2JPF A;  4UV8 B;  3LFM A;  5KMG P;  2NW8 A;  1S35 A;  2CXD A;  3JC6 D;  1QUU A;  4H9N C;  1BR0 A;  4EYU A;  4NUU A;  2V7K A;  5IHY A;  1U4Q A;  2W62 A;  4O2B E;  2WM9 A;  2Q9Q C;  4HE8 A;  4YJ3 E;  1HTJ F;  4A56 A;  4G2A A;  3CQC B;  3SRZ A;  2NTX A;  3O9X A;  4BJN A;  5ETW A;  4ZI7 E;  1S94 A;  3UTK A;  2UXN B;  1WRD A;  2V7J A;  3OKQ A;  2MOZ A;  2PG8 A;  5TAO A;  5E0O A;  5CA1 E;  4GIW A;  1Z0P A;  4CI1 B;  3LK4 2;  4L5G A;  4DO0 A;  5JDL A;  3PU3 A;  4QHO A;  2NW9 A;  3KV6 A;  4ZI2 C;  1YD8 G;  4E7Z A;  4ZI3 D;  5ADX L;  2KWH A;  3KV4 A;  4U72 A;  3IBP A;  3E22 E;  4QX8 B;  5L3C B;  1ZV4 X;  3AVS A;  2X0L B;  3IHR A;  4UF0 A;  2LE8 A;  2VWA A;  3ZMU B;  3CX6 B;  5GON E;  4H9P C;  4F6R C;  4QXH B;  3ZJ1 A;  5LNK A;  4GYS A;  3V5S A;  2Q9Q D;  3ZYL A;  1HCI A;  5FP3 A;  2LSI A;  3AA1 B;  3CQG B;  2D0U A;  1EZ3 A;  2I59 A;  3QK6 A;  2Q9Q B;  3AA7 B;  3CKD A;  4ZOL E;  4C90 A;  2X9H A;  3K3O A;  4WBN E;  2NTY A;  1UCU A;  2NW7 A;  2PBI A;  5DQW A;  4AKR B;  5LGU B;  2KMF A;  3RYC E;  2ZM8 A;  3AAE B;  5JDG A;  1G8X A;  5HAX A;  4ZS2 A;  1D1C A;  3ETV A;  3RH3 A;  1IAP A;  3MZK B;  3HI2 A;  3O1J A;  2Z6E A;  4PJN A;  3H37 A;  4WW0 A;  3CQX C;  3ZYM A;  2V1D B;  2J1D G;  3N5L A;  4HTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...