3JC6D

Structure of the eukaryotic replicative cmg helicase and pumpjack motion
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
221
Chain Sequence
VSPQQDFSDLMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNESKLPLLCMETELERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEIKYHDTHSLIWLKLVNDSILKYMPEELQAINDTEGSVNMIDEPDWNKFVFIHVNGPPDGENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEVIRDLLRDDKVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords DNA replication licensing factor MCM2
publication title Structure of the eukaryotic replicative CMG helicase suggests a pumpjack motion for translocation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 221
sequence length 240
ec nomenclature
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
D PF16922 SLD5_C DNA replication complex GINS protein SLD5 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3jc6D01
2Q9QC 2EHOA 2E9XA 3ANWA 2E9XD 3JC6D 2Q9QB 2EHOB
chains in the Genus database with same CATH superfamily
1AJ3A 5LG3A 2DI4A 5L4EA 2KT9A 2LKGA 4A97A 2RPAA 4JV5T 3V5SA 4WYVA 3AAIA 4UEMA 2JQKA 4ILBA 1HNXT 4KHPT 3C64A 3C4WA 2V5CA 3VKGA 2I59A 4UXNB 3F57A 1G8XA 3I0OA 4F6RC 4ZI2C 5IYZE 1MMDA 3UT5E 5JDHA 4AQYT 3VU7H 2NOXA 4AISA 4WNKA 5JDQA 3PU8A 4O4IE 4HWIB 4P0BA 1SE7A 1CUNA 4I0UA 2XAGB 2NW7A 2WWUA 3QC9A 4ZHQE 3LDQB 3X1DA 1Z0PA 2J62A 2V26A 1H7CA 1WCRA 3QNUA 2NW9A 1KNZA 1XNRT 5LBMA 4HWFA 3QOFA 4X1YE 4GKKT 4YSZA 2E9XD 3ESLA 2AE9A 2IMLA 2WQYA 2E8IA 4ILAA 4HWHA 3W15B 1EZ3A 2N2NA 2SPCA 3ZSSA 1MMGA 1D0XA 2DHRA 3AB3B 3ZCIA 4EYUA 4CN1A 4CI1B 3LK42 4B3RT 3N9PA 5L3GB 2CCQA 4OX9T 1D0YA 2V7MA 5FYMA 4I50E 1YXRA 5AQPB 2ES0A 3JC6D 2RP4A 3F2EA 4H9PC 2UXBT 2K24A 3P4SA 4TV8E 4HFEA 4X65T 3O4XE 4WBOA 3FZHB 3AE3A 5EZYE 5E0OA 3EABA 1QLBA 3I0QA 3ZKRA 1SHZC 3N2GE 1CHUA 2LLYA 2LJLA 1WR6A 2X9XA 3IBPA 4TNVA 1XMQT 2HHHT 3ZN0B 4ILCA 5FL1A 2E5LT 2V7KA 3GMIA 4EIWA 2LRLA 3BQKA 2XM2A 4PK5A 4HFDA 3K8PC 4L0RA 5LNKA 4EB6E 2XQ7A 4U33A 3MZKB 3D0TA 1N32T 2YN6A 3P8CD 3FXEB 4NXMT 4PFOA 2WZHA 3FBZA 1V9DA 4I43B 5FKYA 2XQ4A 2LSIA 4CI2B 1UUSA 4CI3B 2H88A 5FMNA 4X1IE 4PJMA 2EHOA 5JDLA 5JQGE 4AQGA 2UUBT 1MIYA 1IBLT 3O9XA 2WCAA 2YK0A 3N9LA 1VOMA 3O1HA 4Q25A 3LJCA 2JJ9A 3A5XA 5FXZA 5ABEA 4QH5A 4EYYR 1J5ET 5FY0A 3HKCE 2WSSV 3KVBA 3HA4A 4JBWF 2QRXA 3GN5A 1E2AA 2X68A 1J5WA 3AEFA 5AQNB 4X1KE 1M62A 3UU3A 2QYWA 5CA1E 2PFVA 2CLYB 4TN7B 3P4QA 3NZPA 3Q5EA 3UQ4A 4C90A 4JI3T 2V5DA 3LK2B 3A7MA 2ACXA 2EHOC 4HTEA 4QX8B 4PFPA 3RYHE 5JR9C 1L0VA 5FVLA 3PUGA 3WI3A 2Y8DA 3KV6A 2XAHB 4ERRA 5AQMB 4O4LE 5LG4A 3CQGB 2WM9A 4BJMA 2V6XA 4H63H 4CXYA 4PJLA 3HKEE 1U4QA 3RI5A 4JYAT 2V6YA 4DV0T 5DABA 3R6NA 1IZNB 4X64T 2LHRA 4YSXA 4DR1T 3EAMA 4KP3C 5LMNT 5L2LA 2LEHA 1BR2A 1HNWT 5C2TA 3KINB 4GYSA 4EZHA 2W61A 4OYKA 3P4PA 3ZT7A 2VQFT 2PG8A 4OHFA 2D0UA 3AE8A 5J2TE 4QXHB 4ZI2D 2QA7A 3FZFB 2Y48B 2E2AA 5L3BB 4YSYA 3O1JA 1S94A 2BBHA 2HN2A 1HG2A 2CWOA 2HN1A 2LSGA 4LF4T 4DR5T 4G2AA 2LKHA 2HPLA 2XM1A 2YDRA 3SFEA 1IJ5A 3ZT5A 3RKGA 4HN9A 4K0KT 4WZXA 2N9DA 2XSAA 1HCIA 2E9XB 4QH4A 3GWHA 3UUBA 2JRKA 3TLTA 3UFGA 3QB5A 3LK3B 2FJAA 2JQQA 3T1YT 2Q9QA 3AECA 5AQUB 3ANWB 2WB5A 5HEOA 3E0ZA 4IHJE 4DV3T 2CRBA 5ABFB 1D1BA 2RA1A 1ZP0A 3CMLA 2VKOA 4HFHA 2W67A 2W66A 3EVYA 2XTLA 4YHJA 3AA1B 3AEAA 5H6RB 3RC3A 2BKPA 3ZYKA 2H89A 4IL9A 5LGNB 3SFDA 1XDPA 2XPKA 1HR0T 2LHNA 1E1HB 3AE4A 1Y64B 3CX6B 4NIQA 3MXZA 2BS2A 1UK5A 3DJBA 3NRXA 1KFYA 3RIAA 3HR0A 4H9SE 3ZYMA 3KV5A 2DLRA 4EXTA 3PUXF 4PK4A 4LF9T 1IBMT 1YW0A 3ETUA 1B7TA 1UGOA 2ZM2A 4YJ2E 3UU6A 2Q9QC 3N9NA 2KNDA 1FIOA 3ZMZB 2BKNA 1OEDA 5HWYA 4JI7T 4YLHA 4B3ST 3RRCA 4HKAA 3L3PA 2W4XA 1OEDE 3IF8B 3K1SA 4F8HA 5LYJE 3NWIA 4ISSA 1WYCA 3EDUA 5F3JA 2YDQA 4LF6T 3E08A 2LM9A 1NEKA 3UU5A 4O2AE 2UUAT 4HEAA 2UXDT 3RC8A 3RQUA 3DP7A 2CXDA 3RRWA 3VRBA 3CQXC 1KNPA 5J0ZA 4MBQA 4MHCA 4ZZCA 1MNEA 5KX5E 1KEYA 2UUCT 2YEVC 4IGUA 3UTKA 4LFBT 3I9YA 3CKDA 3CWZB 2DCFA 3FXDB 5LCYA 3T1HT 1W09A 3CK6A 4LFAT 1VCSA 5C3JA 4H63V 1OEDC 2M6IA 1Z8UA 4JI2T 3Q5DA 5HCJA 4AQFA 3DTOA 5JDMA 3ZLIA 5L3FB 3NBXX 4YTMA 4JI0T 5FL0A 5JDFA 2WDQA 4UELA 2IUBA 3CIRA 3ONJA 3HI2A 4HWCA 2ZM8A 2VL8A 2D0TA 3TLWA 2EHOD 2A3DA 4DV1T 2CXFA 5FY1A 5HXHA 4IIJE 1N36T 3NZQA 2X9WA 4QX7B 2NWBA 3RQWA 3OBVE 2CBIA 3AA6B 5HCMA 5L47A 3U78A 3MK7C 4AKGA 1BR1A 1N33T 4TWFA 3WAKA 2NW8A 4NXNT 5HEHA 3ZCJA 4EAHA 3PUQA 2PTFA 2CMRA 2XQ9A 4LF5T 5LB7B 4IDQA 5AQIB 1HX8A 1UX4A 3FZLB 2D5UA 4IE7A 3ZC0A 2MTQA 4AQFC 3IA3A 3LBXA 4X5TA 1HX1B 4P0AA 5AQVB 5HEJA 2XAJB 1KNRA 1XWMA 3ZJ2A 4TNWA 3U3IA 2XJ7A 1QUUA 4XZCA 3HL6A 1VCTA 4IE4A 1MNDA 4DIDB 4N78D 1KF6A 2C5JA 4U2YA 2FJEA 2H7OA 1JNRA 3FB2A 4PW8A 3OYZA 5KDMC 3A8YC 3I9WA 4H9OC 1US7B 1J1JA 5FXWA 2LM2A 3ZMUB 2Y6XA 4U31A 2CM0A 3I1AA 4IDZA 2JQHA 5JR9A 3ZMSB 4LF7T 5AQRB 2XQ8A 1S35A 3AXJA 4PJNA 1M7KA 4COFA 3RIFA 5HXRA 2KXPB 4U3CA 4LF8T 5IUXA 3AE7A 4B3MT 3M65A 4ANJA 2FJDA 2XAQB 3K3QC 4DR2T 4U2ZA 3N2KE 1R8IA 5L3EB 2ACZA 1SUMB 1XZYA 3AEEA 3P4RA 5L3CB 4IDNA 4CN4A 1ZKEA 4UF0A 4QKNA 4LFCT 5JH7E 4CQIA 4HFVA 1ZEEA 2LT3A 3MKDA 2FBWA 3PUWF 3AE2A 4DBQA 3AEDA 3QK6A 4E7SA 2P9BA 2WP9A 4BAYB 3VR8A 4DR4T 4AKHA 4DUYT 4DUZT 3C51A 4IE5A 2W0GA 3IEEA 3RIUA 4ASKA 4NUVA 3QB5K 4ISTA 3L8RA 3ONXA 1X9BA 4IE0A 2BG9E 3TLSA 2Q9QD 2DNXA 4M1PA 1HFAA 4XBFB 4UR9A 5J2UE 3L39A 4I55E 5HEGA 5ETWA 5FY7A 5AQOB 5TAOA 4LMLA 5HAXA 5FXXA 2CXLA 3NKZA 2VURA 3RYFE 5LHGB 3PV0F 2C0SA 2C5IT 5AQGB 2ZM6T 5KMGP 2KSRA 3G06A 2WZIA 4YT0A 3EUHA 2XASB 4WW0A 2VK9A 2LRKA 4B6XA 1ZV4X 4YTNA 5LHHB 4UIGA 3VR9A 2OV9A 2CEAA 4TUYE 2I0MA 3RIUC 3E22E 4E7ZA 4KUMB 4ZI3C 2MYSA 2KMFA 3EDVA 1G73A 2YINA 2V1DB 2J47A 4TX5A 4OYJA 4PJJA 4DV4T 1WR0A 3AAEB 2N1GA 2XSBA 2W62A 3R84B 3UQ7A 1FJGT 3CVRA 2WU5A 1HTJF 2VB6A 4ZS3A 4CXWA 2XY8B 4FI5A 4IE6A 4H9QC 4MLKA 3Q5XA 2L9QA 3AE1A 3RX6A 5L3DB 2KINB 2JQ9A 4IDOA 5JREA 5JTGA 4DR7T 1NAFA 2EHOB 4UV9B 5JR9B 2H3RA 4YTPA 2IHR1 4YY3T 4CXXA 3O1IA 4G63A 3P7IA 3OTOT 1HNZT 3OJAA 4U7YA 5AQJB 4EEBA 3ZC1A 1XNQT 5M4YA 3RLFF 2XHEB 2C5KT 4O4JE 2J1DG 4ZEYA 2JIWA 3BQIA 4HGAA 2XQ6A 3HKDE 3NRYA 2IW5B 2XQYA 4CZZB 3GN5B 4OFZA 5LA6E 4DV6T 2X0HA 2ODUA 4AKIA 3CX8B 2L8KA 4X62T 4QH1A 2VVNA 5ABHA 5AQFB 3PURA 5JDGA 4QWNB 4HFIA 3N9MA 1I6ZA 2W00A 3P50A 1MIVA 5LJMA 4LMKA 2VKDA 4ZXLA 4TV9E 3TLVA 2YU1A 2WS3A 3KBTA 5A1LA 2CBJA 2X51A 3SWHA 2VASA 4HFBA 3PUVF 1YQ4A 3JAEA 2BZBA 3OYXA 3ZPOA 1Y01A 3P4WA 4JUYA 4V1Av 4KBMB 4MFRA 2V6YB 4KX6A 3C98B 4IDPA 2L3LA 1DU2A 2QVAA 2J4GA 4UVCB 3MJXA 3AE5A 2WAUA 5H6QB 1T98A 3AEBA 2M6BA 1T72A 3PUYF 2JPFA 1HF8A 2NR4A 2V8SV 4DNDA 1UURA 2V7JA 3SRZA 1KK7A 3B57A 5CA0E 3IHRA 3ZYLA 3H3AA 3UUNA 1W0AA 4JEUB 3H37A 5DJQC 4Z90A 4DR3T 2OLTA 3MA9A 5HYAA 3UU4A 3VHLA 4EEDA 1JNZA 2UXXB 3ZMTB 5CFBA 1SA0E 4U7IA 2X66A 4WBNE 4IREA 1X79A 5L4HA 3ZSTA 2X9HA 5ABGA 2ZLYA 4KMCA 2JMHA 5DQWA 2IC6A 4PAGA 5C8YE 5BMVE 3PDYA 4BA9A 2CHNA 4AI6A 1T7SA 1O3XA 2V7LA 1NWMX 2Q9QB 3FHNA 1WFDA 4H9RC 5JVDE 1BR4A 2VWAA 2JMKA 4ZZBA 3UULA 4TWDA 3CX7B 4I4TE 2UU9T 3UUXB 3ONLC 5EK2A 2QGSA 3LFMA 3LSVA 5F5WA 3AEGA 4QXBB 4P09A 2KLQA 5HXEA 2D2SA 1T8BA 4GIWA 1E7PA 2IAKA 4O4HE 3M3ZB 3NVOA 1LVKA 5GONE 2IDOB 2VL0A 3RYCE 2VVSA 2YOEA 5AQKB 3FZMB 5JDNA 3N9OA 2F4VT 5BR8T 3ZT6A 4AKRB 5JRCA 5LP6E 4EV6A 1ZOYA 4GKJT 3Q2MA 4ZI3D 2D9DA 1YQ3A 4Z8XA 3PTRB 2B76A 1D1AA 2CLYC 5LBQB 2A2FX 5IHYA 2LSKA 3MACA 3GA8A 1OEDB 1OWAA 3ZJ1A 2R6GF 2HPJA 3SS1A 5J1GA 5KXJA 5CB4E 3KV4A 2KWIB 4NUUA 4JI4T 3K3OA 2BVLA 5LXTE 4HFCA 4NPPA 4Z91A 3LG7A 2XUEA 2LOSA 1IAPA 3C50A 3Q9DA 1MMNA 3RF1A 3N5LA 2BS4A 3PE0A 1LVFA 4XAXB 3H3MA 3UUMA 3V5UA 2YKSA 3C4XA 5AQSB 2BKOA 4JI6T 2VKJA 3L09A 5FP3A 4DMWA 5HWXA 3K3NA 5DQVA 4GOUA 2E9XA 4PK6A 1XMOT 3JADA 1U5PA 4U72A 3CQCB 2K48A 1HS7A 3VKHA 3EHZA 2CHOA 4PNIA 2K5BB 1ZHCA 4AKLA 3J9X1 3JCFA 2CA5A 2ZM0A 4ILUA 3ANWA 2I6HA 3RHWA 2XAFB 4DR6T 4ADZA 3VRAA 4ZS2A 1FEWA 5ABFA 4FJOA 1MMAA 4X66T 2E5VA 4A5XA 3AA7B 2XQ5A 4UVBB 2W63A 2A72A 3T8OA 1OXZA 3CPZA 2WU2A 5F8PA 3S4UA 2M67A 2CPTA 2KWHA 3J7Yq 2BG9A 5ADXL 2UXCT 1FMWA 2FJBA 2ZMAA 3RH3A 3KFWX 1GQEA 5HEUA 2LOPA 2AXDS 3OVUA 1WLXA 2A9UA 3PUSA 2ODVA 2E9XC 2Z6EA 4JI8T 1FMVA 3FZKB 5HXSA 2BDEA 3JAFA 1XDOA 5FNVE 5LGTB 4GK5E 2HH7A 4DO0A 3SOLA 4QHOA 2WY2A 4KI0F 3PU3A 3AVSA 3LBXB 4DVDA 1LRZA 2DWKA 5AQQB 4DV7T 3PUAA 4AIUA 4YFSA 5IWAT 3Q5WA 1IJ6A 1MIWA 3ZMVB 3JC6C 3OKQA 4CN6A 2W2UA 3QUJA 2MOZA 2BBJA 2G0UA 2GK9A 5JRCB 4UV8B 2X9YA 3PJAJ 4J2CA 2FUPA 3AA0B 1N34T 1NENA 4L5GA 3RPUA 2XZEA 2BG9C 1UX5A 1W0BA 4YJ3E 2BVMA 2NTYA 1VRBA 2MBGA 3N2OA 3PJAA 3F31A 4IT4A 4JI5T 3FBLA 1W9RA 2LSYA 2CWYA 3TLUA 1QSDA 2LE8A 4L9IA 2WMNA 2CE7A 2WWVA 2DL1A 4TZ4C 4YXDA 2X67A 2X0LB 3AVRA 4MALA 4AXPA 3UFEA 1UCUA 2WBLA 3AE9A 3BQLA 3ABVA 1D0ZA 2V7IA 3AXJB 5LHIB 3PUZF 2MAWA 5CGMA 5HXCA 2NP9A 4O2BE 5AQTB 5FVKA 4LMJA 2VQET 1HG5A 2WDVA 4EOZB 5LGUB 2WDRA 3C4ZA 2XQ3A 4A56A 2YDSA 4BJNA 3ZEFB 2VKHA 2WMOA 1I94T 3KBUA 4DMVA 2IIUA 4IL4A 4OK0A 4DV5T 4UF0B 4EGWA 2DWGA 3BK9A 2OA5A 3OPCA 4JEHB 5LJNA 3N9QA 2K9AA 3RKOA 2K3WA 4U74A 5AQHB 5CJ5A 4JI1T 4HWDA 3RYIE 5EK3A 2BG9B 1WYBA 4KHZF 3ETVA 4ZOLE 4H9NC 4EZ4A 3B5MA 4ZI7E 2MPKA 5LMUT 5FXVA 2NTXA 4UVAB 3WAJA 5LOVE 4QXCB 2BS3A 4JLEA 3B13A 4DV2T 2KZ7B 1BR0A 2PBIA 4GYRA 1IBKT 4O8SA 2H7VC 2PJQA 4P1NA 1WRDA 3RGLA 5AFUL 4GK0E 1D1CA 1YKEB 4YHHT 3KVAA 1YKHB 2XQAA 4HE8A 4TWHA 2B1EA 4C91A 3KV9A 4K0UA 4DBRA 2UXNB 3AAAB 2IC9A 2YU2A 1LKXA 5AQLB 3AE6A 3KDSE 3HKBE 4A98A 1YD8G 3UU8A 3TKLB 5EK4A 3ZN1B 4X20E 2LSJA 3EI0A 4B3TT 2X0YA
chains in the Genus database with same CATH topology
4ASKA 1AJ3A 4Z8XA 4NUVA 3PTRB 4ISTA 2JRKA 2DI4A 3ONXA 1D1AA 2KT9A 4IE0A 2CLYC 5LBQB 2A2FX 5IHYA 2Q9QD 3LK3B 2DNXA 2JQQA 2LSKA 3MACA 3V5SA 3AAIA 4M1PA 4UEMA 2Q9QA 3GA8A 3ANWB 1OWAA 3ZJ1A 2HPJA 1HFAA 3C64A 3C4WA 3E0ZA 5J1GA 3SS1A 4IHJE 4XBFB 5J2UE 5CB4E 3VKGA 3KV4A 4I55E 5ETWA 5FY7A 1D1BA 2KWIB 2RA1A 5TAOA 4NUUA 2I59A 3CMLA 5HAXA 2VKOA 5FXXA 2CXLA 4UXNB 3F57A 3K3OA 2BVLA 5LXTE 1G8XA 3I0OA 4F6RC 4ZI2C 5IYZE 3EVYA 5LHGB 2XTLA 4YHJA 3RYFE 1MMDA 3UT5E 5JDHA 3VU7H 2NOXA 2C0SA 3AA1B 2C5IT 3LG7A 5H6RB 3RC3A 2XUEA 2LOSA 1IAPA 3C50A 5KMGP 3Q9DA 4WNKA 1MMNA 3N5LA 3ZYKA 5JDQA 3PU8A 3PE0A 4O4IE 1LVFA 5LGNB 4P0BA 4XAXB 3EUHA 1CUNA 2XAGB 2XASB 3UUMA 3V5UA 2NW7A 2LHNA 3C4XA 2WWUA 4WW0A 3QC9A 4ZHQE 2VK9A 1E1HB 1Z0PA 2V26A 1H7CA 2VKJA 3L09A 1Y64B 3CX6B 1ZV4X 4B6XA 2NW9A 5FP3A 5LHHB 4UIGA 1KNZA 5LBMA 3MXZA 4X1YE 4DMWA 5HWXA 3K3NA 2E9XD 3ESLA 2CEAA 5DQVA 4TUYE 3DJBA 3NRXA 4GOUA 2E9XA 4PK6A 3HR0A 4H9SE 3ZYMA 3E22E 1U5PA 3KV5A 2E8IA 4U72A 2DLRA 4KUMB 4E7ZA 3CQCB 2K48A 4ZI3C 4EXTA 3W15B 2MYSA 4PK4A 1HS7A 1EZ3A 3VKHA 2N2NA 1YW0A 4PNIA 2SPCA 1MMGA 1D0XA 2KMFA 2K5BB 3ETUA 2DHRA 3EDVA 3AB3B 3ZCIA 1ZHCA 4AKLA 1G73A 1B7TA 2YINA 4EYUA 4CI1B 2V1DB 3J9X1 2ZM2A 4YJ2E 3LK42 2Q9QC 3N9NA 2KNDA 3N9PA 4OYJA 4PJJA 1FIOA 2CA5A 4TX5A 3ZMZB 2ZM0A 5L3GB 2CCQA 3ANWA 4ILUA 3AAEB 5HWYA 2XAFB 1D0YA 2N1GA 4YLHA 3RRCA 2V7MA 5FYMA 4ADZA 2W62A 4ZS2A 4HKAA 1FEWA 4I50E 3R84B 3L3PA 3CVRA 3IF8B 4FJOA 1HTJF 1MMAA 2ES0A 2VB6A 4ZS3A 5LYJE 3JC6D 2RP4A 4CXWA 4FI5A 4IE6A 3F2EA 4H9QC 4MLKA 3Q5XA 2L9QA 3RX6A 4H9PC 5L3DB 2K24A 2KINB 4ISSA 3AA7B 1WYCA 3EDUA 4UVBB 5JREA 1NAFA 2W63A 2EHOB 5F3JA 2A72A 3T8OA 1OXZA 3CPZA 5F8PA 4UV9B 3S4UA 3E08A 4TV8E 2LM9A 2M67A 5JR9B 2H3RA 3O4XE 2KWHA 4WBOA 3J7Yq 4O2AE 5ADXL 4CXXA 4HEAA 1FMWA 3O1IA 3RC8A 3DP7A 2CXDA 5EZYE 5E0OA 4G63A 3RRWA 2ZMAA 3CQXC 3RH3A 3KFWX 3P7IA 3I0QA 3OJAA 1SHZC 2LOPA 3ZC1A 3N2GE 4MBQA 5M4YA 4MHCA 1WLXA 2LJLA 2XHEB 3PUSA 1WR6A 1MNEA 2C5KT 2E9XC 2ODVA 2X9XA 2Z6EA 3IBPA 5KX5E 1FMVA 4O4JE 2YEVC 4IGUA 3ZN0B 3UTKA 2J1DG 5HXSA 2BDEA 3BQIA 4HGAA 3I9YA 3CKDA 3HKDE 3NRYA 3CWZB 2DCFA 3FXDB 5LCYA 2IW5B 5FNVE 5LGTB 2XQYA 2HH7A 2V7KA 4GK5E 4DO0A 4CZZB 3SOLA 3GMIA 4QHOA 4EIWA 3GN5B 4OFZA 3BQKA 4H63V 3PU3A 4PK5A 5LA6E 3AVSA 3K8PC 4L0RA 4AQFA 3DTOA 3LBXB 5JDMA 2ODUA 3ZLIA 4DVDA 5L3FB 3NBXX 5LNKA 4EB6E 4AKIA 1LRZA 3MZKB 2DWKA 3CX8B 3D0TA 3PUAA 2L8KA 4YFSA 5JDFA 3Q5WA 1IJ6A 3PURA 5JDGA 3P8CD 3FXEB 4QWNB 4PFOA 4UELA 3FBZA 1MIWA 3N9MA 3ZMVB 3JC6C 3OKQA 3QUJA 1V9DA 4I43B 2MOZA 2LSIA 4CI2B 3HI2A 2G0UA 2GK9A 5JRCB 2W00A 2ZM8A 2X9YA 4UV8B 4CI3B 2VL8A 5FMNA 2D0TA 1MIVA 2EHOD 4X1IE 5LJMA 2A3DA 4J2CA 4PJMA 2VKDA 2CXFA 2EHOA 5JDLA 5FY1A 4TV9E 4IIJE 5HXHA 5JQGE 4AQGA 3AA0B 4L5GA 3NZQA 2YU1A 3RPUA 2X9WA 1MIYA 4QX7B 3KBTA 2NWBA 1UX5A 4YJ3E 2BVMA 3OBVE 5A1LA 3O9XA 2X51A 2NTYA 1VRBA 3AA6B 3SWHA 2YK0A 2MBGA 3N9LA 2VASA 1VOMA 2BZBA 3OYXA 3N2OA 3U78A 3ZPOA 3F31A 3O1HA 3MK7C 4AKGA 3FBLA 1BR1A 2LSYA 4JUYA 3LJCA 2JJ9A 2CWYA 3A5XA 4V1Av 3WAKA 2NW8A 5FXZA 3ZCJA 4EAHA 1QSDA 2LE8A 4L9IA 2WMNA 2CE7A 3PUQA 4EYYR 2CMRA 4KBMB 4MFRA 3HKCE 5FY0A 2WSSV 1HX8A 3C98B 4TZ4C 1UX4A 3KVBA 2D5UA 2L3LA 3HA4A 3GN5A 4IE7A 2X68A 4UVCB 3ZC0A 2X67A 3MJXA 2MTQA 4AQFC 2X0LB 2WAUA 5H6QB 1T98A 3LBXA 3AVRA 2JPFA 4X1KE 1HF8A 4MALA 4AXPA 3UFEA 1UCUA 2WBLA 5CA1E 2PFVA 3BQLA 4P0AA 4DNDA 2CLYB 1D0ZA 2V7JA 2V7IA 4TN7B 3NZPA 2XAJB 5LHIB 5HXCA 4C90A 2NP9A 4O2BE 3SRZA 1KK7A 3B57A 3ZJ2A 5CA0E 3LK2B 1HG5A 2ACXA 3IHRA 2EHOC 3U3IA 4HTEA 3ZYLA 3H3AA 1QUUA 4QX8B 3UUNA 4XZCA 4EOZB 4PFPA 3HL6A 3RYHE 5LGUB 4JEUB 3H37A 5JR9C 3PUGA 4IE4A 3C4ZA 1MNDA 5DJQC 3WI3A 4A56A 2Y8DA 4N78D 4BJNA 3KV6A 3ZEFB 2XAHB 2C5JA 2VKHA 4ERRA 3MA9A 4O4LE 2WMOA 5LG4A 3KBUA 3CQGB 4DMVA 2H7OA 5HYAA 3FB2A 2WM9A 4PW8A 4BJMA 4OK0A 3VHLA 4H63H 4UF0B 3OYZA 2UXXB 4CXYA 4PJLA 3ZMTB 2DWGA 5KDMC 3BK9A 3I9WA 4JEHB 1SA0E 3HKEE 5LJNA 4H9OC 1US7B 3N9QA 2X66A 4WBNE 1U4QA 2K9AA 1X79A 2X9HA 5FXWA 2ZLYA 3RKOA 5DABA 3R6NA 4KMCA 2JMHA 3ZMUB 5DQWA 1IZNB 4U74A 2IC6A 2Y6XA 4PAGA 5C8YE 2LHRA 5BMVE 3PDYA 3RYIE 2CM0A 3I1AA 4IDZA 5EK3A 1WYBA 4BA9A 3ETVA 4ZOLE 5JR9A 4H9NC 4KP3C 4EZ4A 4AI6A 5L2LA 3ZMSB 2LEHA 1BR2A 4ZI7E 5FXVA 3KINB 2NTXA 1S35A 1O3XA 2V7LA 4UVAB 1NWMX 4PJNA 2Q9QB 4GYSA 4EZHA 3FHNA 3WAJA 2W61A 5LOVE 4OYKA 4H9RC 5JVDE 1BR4A 2VWAA 5HXRA 2KXPB 4QXCB 2JMKA 2PG8A 3UULA 3M65A 4ANJA 4OHFA 2D0UA 4JLEA 2XAQB 3B13A 5J2TE 4QXHB 3CX7B 2KZ7B 4I4TE 1BR0A 3K3QC 4ZI2D 2PBIA 2QA7A 4GYRA 3UUXB 2Y48B 4O8SA 2H7VC 3N2KE 2PJQA 1WRDA 5L3BB 5L3EB 3O1JA 5EK2A 1S94A 2QGSA 3LFMA 5AFUL 1HG2A 2CWOA 4GK0E 1D1CA 1YKEB 4QXBB 3KVAA 2LSGA 5L3CB 1YKHB 1ZKEA 2KLQA 4P09A 4HE8A 4UF0A 4QKNA 2B1EA 5HXEA 2D2SA 4C91A 3KV9A 4G2AA 4K0UA 5JH7E 4DBRA 4GIWA 4CQIA 2UXNB 2IAKA 1ZEEA 3AAAB 2LT3A 2IC9A 4HFVA 4O4HE 2HPLA 1LVKA 5GONE 3MKDA 2YU2A 1LKXA 3RYCE 1IJ5A 3KDSE 4HN9A 3HKBE 5JDNA 3N9OA 4DBQA 1YD8G 3QK6A 4E7SA 2N9DA 2P9BA 3TKLB 4BAYB 4AKRB 1HCIA 5EK4A 5JRCA 4AKHA 2E9XB 3ZN1B 5LP6E 3C51A 4X20E 3Q2MA 2LSJA 4IE5A 2W0GA 4ZI3D 3IEEA 3GWHA 2OA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q C;  2EHO A;  2E9X A;  3ANW A;  2E9X D;  3JC6 D;  2Q9Q B;  2EHO B; 
#chains in the Genus database with same CATH topology
 1AJ3 A;  5LG3 A;  2DI4 A;  5L4E A;  2KT9 A;  2LKG A;  4A97 A;  2RPA A;  4JV5 T;  3V5S A;  4WYV A;  3AAI A;  4UEM A;  2JQK A;  4ILB A;  1HNX T;  4KHP T;  3C64 A;  3C4W A;  2V5C A;  3VKG A;  2I59 A;  4UXN B;  3F57 A;  1G8X A;  3I0O A;  4F6R C;  4ZI2 C;  5IYZ E;  1MMD A;  3UT5 E;  5JDH A;  4AQY T;  3VU7 H;  2NOX A;  4AIS A;  4WNK A;  5JDQ A;  3PU8 A;  4O4I E;  4HWI B;  4P0B A;  1SE7 A;  1CUN A;  4I0U A;  2XAG B;  2NW7 A;  2WWU A;  3QC9 A;  4ZHQ E;  3LDQ B;  3X1D A;  1Z0P A;  2J62 A;  2V26 A;  1H7C A;  1WCR A;  3QNU A;  2NW9 A;  1KNZ A;  1XNR T;  5LBM A;  4HWF A;  3QOF A;  4X1Y E;  4GKK T;  4YSZ A;  2E9X D;  3ESL A;  2AE9 A;  2IML A;  2WQY A;  2E8I A;  4ILA A;  4HWH A;  3W15 B;  1EZ3 A;  2N2N A;  2SPC A;  3ZSS A;  1MMG A;  1D0X A;  2DHR A;  3AB3 B;  3ZCI A;  4EYU A;  4CN1 A;  4CI1 B;  3LK4 2;  4B3R T;  3N9P A;  5L3G B;  2CCQ A;  4OX9 T;  1D0Y A;  2V7M A;  5FYM A;  4I50 E;  1YXR A;  5AQP B;  2ES0 A;  3JC6 D;  2RP4 A;  3F2E A;  4H9P C;  2UXB T;  2K24 A;  3P4S A;  4TV8 E;  4HFE A;  4X65 T;  3O4X E;  4WBO A;  3FZH B;  3AE3 A;  5EZY E;  5E0O A;  3EAB A;  1QLB A;  3I0Q A;  3ZKR A;  1SHZ C;  3N2G E;  1CHU A;  2LLY A;  2LJL A;  1WR6 A;  2X9X A;  3IBP A;  4TNV A;  1XMQ T;  2HHH T;  3ZN0 B;  4ILC A;  5FL1 A;  2E5L T;  2V7K A;  3GMI A;  4EIW A;  2LRL A;  3BQK A;  2XM2 A;  4PK5 A;  4HFD A;  3K8P C;  4L0R A;  5LNK A;  4EB6 E;  2XQ7 A;  4U33 A;  3MZK B;  3D0T A;  1N32 T;  2YN6 A;  3P8C D;  3FXE B;  4NXM T;  4PFO A;  2WZH A;  3FBZ A;  1V9D A;  4I43 B;  5FKY A;  2XQ4 A;  2LSI A;  4CI2 B;  1UUS A;  4CI3 B;  2H88 A;  5FMN A;  4X1I E;  4PJM A;  2EHO A;  5JDL A;  5JQG E;  4AQG A;  2UUB T;  1MIY A;  1IBL T;  3O9X A;  2WCA A;  2YK0 A;  3N9L A;  1VOM A;  3O1H A;  4Q25 A;  3LJC A;  2JJ9 A;  3A5X A;  5FXZ A;  5ABE A;  4QH5 A;  4EYY R;  1J5E T;  5FY0 A;  3HKC E;  2WSS V;  3KVB A;  3HA4 A;  4JBW F;  2QRX A;  3GN5 A;  1E2A A;  2X68 A;  1J5W A;  3AEF A;  5AQN B;  4X1K E;  1M62 A;  3UU3 A;  2QYW A;  5CA1 E;  2PFV A;  2CLY B;  4TN7 B;  3P4Q A;  3NZP A;  3Q5E A;  3UQ4 A;  4C90 A;  4JI3 T;  2V5D A;  3LK2 B;  3A7M A;  2ACX A;  2EHO C;  4HTE A;  4QX8 B;  4PFP A;  3RYH E;  5JR9 C;  1L0V A;  5FVL A;  3PUG A;  3WI3 A;  2Y8D A;  3KV6 A;  2XAH B;  4ERR A;  5AQM B;  4O4L E;  5LG4 A;  3CQG B;  2WM9 A;  4BJM A;  2V6X A;  4H63 H;  4CXY A;  4PJL A;  3HKE E;  1U4Q A;  3RI5 A;  4JYA T;  2V6Y A;  4DV0 T;  5DAB A;  3R6N A;  1IZN B;  4X64 T;  2LHR A;  4YSX A;  4DR1 T;  3EAM A;  4KP3 C;  5LMN T;  5L2L A;  2LEH A;  1BR2 A;  1HNW T;  5C2T A;  3KIN B;  4GYS A;  4EZH A;  2W61 A;  4OYK A;  3P4P A;  3ZT7 A;  2VQF T;  2PG8 A;  4OHF A;  2D0U A;  3AE8 A;  5J2T E;  4QXH B;  4ZI2 D;  2QA7 A;  3FZF B;  2Y48 B;  2E2A A;  5L3B B;  4YSY A;  3O1J A;  1S94 A;  2BBH A;  2HN2 A;  1HG2 A;  2CWO A;  2HN1 A;  2LSG A;  4LF4 T;  4DR5 T;  4G2A A;  2LKH A;  2HPL A;  2XM1 A;  2YDR A;  3SFE A;  1IJ5 A;  3ZT5 A;  3RKG A;  4HN9 A;  4K0K T;  4WZX A;  2N9D A;  2XSA A;  1HCI A;  2E9X B;  4QH4 A;  3GWH A;  3UUB A;  2JRK A;  3TLT A;  3UFG A;  3QB5 A;  3LK3 B;  2FJA A;  2JQQ A;  3T1Y T;  2Q9Q A;  3AEC A;  5AQU B;  3ANW B;  2WB5 A;  5HEO A;  3E0Z A;  4IHJ E;  4DV3 T;  2CRB A;  5ABF B;  1D1B A;  2RA1 A;  1ZP0 A;  3CML A;  2VKO A;  4HFH A;  2W67 A;  2W66 A;  3EVY A;  2XTL A;  4YHJ A;  3AA1 B;  3AEA A;  5H6R B;  3RC3 A;  2BKP A;  3ZYK A;  2H89 A;  4IL9 A;  5LGN B;  3SFD A;  1XDP A;  2XPK A;  1HR0 T;  2LHN A;  1E1H B;  3AE4 A;  1Y64 B;  3CX6 B;  4NIQ A;  3MXZ A;  2BS2 A;  1UK5 A;  3DJB A;  3NRX A;  1KFY A;  3RIA A;  3HR0 A;  4H9S E;  3ZYM A;  3KV5 A;  2DLR A;  4EXT A;  3PUX F;  4PK4 A;  4LF9 T;  1IBM T;  1YW0 A;  3ETU A;  1B7T A;  1UGO A;  2ZM2 A;  4YJ2 E;  3UU6 A;  2Q9Q C;  3N9N A;  2KND A;  1FIO A;  3ZMZ B;  2BKN A;  1OED A;  5HWY A;  4JI7 T;  4YLH A;  4B3S T;  3RRC A;  4HKA A;  3L3P A;  2W4X A;  1OED E;  3IF8 B;  3K1S A;  4F8H A;  5LYJ E;  3NWI A;  4ISS A;  1WYC A;  3EDU A;  5F3J A;  2YDQ A;  4LF6 T;  3E08 A;  2LM9 A;  1NEK A;  3UU5 A;  4O2A E;  2UUA T;  4HEA A;  2UXD T;  3RC8 A;  3RQU A;  3DP7 A;  2CXD A;  3RRW A;  3VRB A;  3CQX C;  1KNP A;  5J0Z A;  4MBQ A;  4MHC A;  4ZZC A;  1MNE A;  5KX5 E;  1KEY A;  2UUC T;  2YEV C;  4IGU A;  3UTK A;  4LFB T;  3I9Y A;  3CKD A;  3CWZ B;  2DCF A;  3FXD B;  5LCY A;  3T1H T;  1W09 A;  3CK6 A;  4LFA T;  1VCS A;  5C3J A;  4H63 V;  1OED C;  2M6I A;  1Z8U A;  4JI2 T;  3Q5D A;  5HCJ A;  4AQF A;  3DTO A;  5JDM A;  3ZLI A;  5L3F B;  3NBX X;  4YTM A;  4JI0 T;  5FL0 A;  5JDF A;  2WDQ A;  4UEL A;  2IUB A;  3CIR A;  3ONJ A;  3HI2 A;  4HWC A;  2ZM8 A;  2VL8 A;  2D0T A;  3TLW A;  2EHO D;  2A3D A;  4DV1 T;  2CXF A;  5FY1 A;  5HXH A;  4IIJ E;  1N36 T;  3NZQ A;  2X9W A;  4QX7 B;  2NWB A;  3RQW A;  3OBV E;  2CBI A;  3AA6 B;  5HCM A;  5L47 A;  3U78 A;  3MK7 C;  4AKG A;  1BR1 A;  1N33 T;  4TWF A;  3WAK A;  2NW8 A;  4NXN T;  5HEH A;  3ZCJ A;  4EAH A;  3PUQ A;  2PTF A;  2CMR A;  2XQ9 A;  4LF5 T;  5LB7 B;  4IDQ A;  5AQI B;  1HX8 A;  1UX4 A;  3FZL B;  2D5U A;  4IE7 A;  3ZC0 A;  2MTQ A;  4AQF C;  3IA3 A;  3LBX A;  4X5T A;  1HX1 B;  4P0A A;  5AQV B;  5HEJ A;  2XAJ B;  1KNR A;  1XWM A;  3ZJ2 A;  4TNW A;  3U3I A;  2XJ7 A;  1QUU A;  4XZC A;  3HL6 A;  1VCT A;  4IE4 A;  1MND A;  4DID B;  4N78 D;  1KF6 A;  2C5J A;  4U2Y A;  2FJE A;  2H7O A;  1JNR A;  3FB2 A;  4PW8 A;  3OYZ A;  5KDM C;  3A8Y C;  3I9W A;  4H9O C;  1US7 B;  1J1J A;  5FXW A;  2LM2 A;  3ZMU B;  2Y6X A;  4U31 A;  2CM0 A;  3I1A A;  4IDZ A;  2JQH A;  5JR9 A;  3ZMS B;  4LF7 T;  5AQR B;  2XQ8 A;  1S35 A;  3AXJ A;  4PJN A;  1M7K A;  4COF A;  3RIF A;  5HXR A;  2KXP B;  4U3C A;  4LF8 T;  5IUX A;  3AE7 A;  4B3M T;  3M65 A;  4ANJ A;  2FJD A;  2XAQ B;  3K3Q C;  4DR2 T;  4U2Z A;  3N2K E;  1R8I A;  5L3E B;  2ACZ A;  1SUM B;  1XZY A;  3AEE A;  3P4R A;  5L3C B;  4IDN A;  4CN4 A;  1ZKE A;  4UF0 A;  4QKN A;  4LFC T;  5JH7 E;  4CQI A;  4HFV A;  1ZEE A;  2LT3 A;  3MKD A;  2FBW A;  3PUW F;  3AE2 A;  4DBQ A;  3AED A;  3QK6 A;  4E7S A;  2P9B A;  2WP9 A;  4BAY B;  3VR8 A;  4DR4 T;  4AKH A;  4DUY T;  4DUZ T;  3C51 A;  4IE5 A;  2W0G A;  3IEE A;  3RIU A;  4ASK A;  4NUV A;  3QB5 K;  4IST A;  3L8R A;  3ONX A;  1X9B A;  4IE0 A;  2BG9 E;  3TLS A;  2Q9Q D;  2DNX A;  4M1P A;  1HFA A;  4XBF B;  4UR9 A;  5J2U E;  3L39 A;  4I55 E;  5HEG A;  5ETW A;  5FY7 A;  5AQO B;  5TAO A;  4LML A;  5HAX A;  5FXX A;  2CXL A;  3NKZ A;  2VUR A;  3RYF E;  5LHG B;  3PV0 F;  2C0S A;  2C5I T;  5AQG B;  2ZM6 T;  5KMG P;  2KSR A;  3G06 A;  2WZI A;  4YT0 A;  3EUH A;  2XAS B;  4WW0 A;  2VK9 A;  2LRK A;  4B6X A;  1ZV4 X;  4YTN A;  5LHH B;  4UIG A;  3VR9 A;  2OV9 A;  2CEA A;  4TUY E;  2I0M A;  3RIU C;  3E22 E;  4E7Z A;  4KUM B;  4ZI3 C;  2MYS A;  2KMF A;  3EDV A;  1G73 A;  2YIN A;  2V1D B;  2J47 A;  4TX5 A;  4OYJ A;  4PJJ A;  4DV4 T;  1WR0 A;  3AAE B;  2N1G A;  2XSB A;  2W62 A;  3R84 B;  3UQ7 A;  1FJG T;  3CVR A;  2WU5 A;  1HTJ F;  2VB6 A;  4ZS3 A;  4CXW A;  2XY8 B;  4FI5 A;  4IE6 A;  4H9Q C;  4MLK A;  3Q5X A;  2L9Q A;  3AE1 A;  3RX6 A;  5L3D B;  2KIN B;  2JQ9 A;  4IDO A;  5JRE A;  5JTG A;  4DR7 T;  1NAF A;  2EHO B;  4UV9 B;  5JR9 B;  2H3R A;  4YTP A;  2IHR 1;  4YY3 T;  4CXX A;  3O1I A;  4G63 A;  3P7I A;  3OTO T;  1HNZ T;  3OJA A;  4U7Y A;  5AQJ B;  4EEB A;  3ZC1 A;  1XNQ T;  5M4Y A;  3RLF F;  2XHE B;  2C5K T;  4O4J E;  2J1D G;  4ZEY A;  2JIW A;  3BQI A;  4HGA A;  2XQ6 A;  3HKD E;  3NRY A;  2IW5 B;  2XQY A;  4CZZ B;  3GN5 B;  4OFZ A;  5LA6 E;  4DV6 T;  2X0H A;  2ODU A;  4AKI A;  3CX8 B;  2L8K A;  4X62 T;  4QH1 A;  2VVN A;  5ABH A;  5AQF B;  3PUR A;  5JDG A;  4QWN B;  4HFI A;  3N9M A;  1I6Z A;  2W00 A;  3P50 A;  1MIV A;  5LJM A;  4LMK A;  2VKD A;  4ZXL A;  4TV9 E;  3TLV A;  2YU1 A;  2WS3 A;  3KBT A;  5A1L A;  2CBJ A;  2X51 A;  3SWH A;  2VAS A;  4HFB A;  3PUV F;  1YQ4 A;  3JAE A;  2BZB A;  3OYX A;  3ZPO A;  1Y01 A;  3P4W A;  4JUY A;  4V1A v;  4KBM B;  4MFR A;  2V6Y B;  4KX6 A;  3C98 B;  4IDP A;  2L3L A;  1DU2 A;  2QVA A;  2J4G A;  4UVC B;  3MJX A;  3AE5 A;  2WAU A;  5H6Q B;  1T98 A;  3AEB A;  2M6B A;  1T72 A;  3PUY F;  2JPF A;  1HF8 A;  2NR4 A;  2V8S V;  4DND A;  1UUR A;  2V7J A;  3SRZ A;  1KK7 A;  3B57 A;  5CA0 E;  3IHR A;  3ZYL A;  3H3A A;  3UUN A;  1W0A A;  4JEU B;  3H37 A;  5DJQ C;  4Z90 A;  4DR3 T;  2OLT A;  3MA9 A;  5HYA A;  3UU4 A;  3VHL A;  4EED A;  1JNZ A;  2UXX B;  3ZMT B;  5CFB A;  1SA0 E;  4U7I A;  2X66 A;  4WBN E;  4IRE A;  1X79 A;  5L4H A;  3ZST A;  2X9H A;  5ABG A;  2ZLY A;  4KMC A;  2JMH A;  5DQW A;  2IC6 A;  4PAG A;  5C8Y E;  5BMV E;  3PDY A;  4BA9 A;  2CHN A;  4AI6 A;  1T7S A;  1O3X A;  2V7L A;  1NWM X;  2Q9Q B;  3FHN A;  1WFD A;  4H9R C;  5JVD E;  1BR4 A;  2VWA A;  2JMK A;  4ZZB A;  3UUL A;  4TWD A;  3CX7 B;  4I4T E;  2UU9 T;  3UUX B;  3ONL C;  5EK2 A;  2QGS A;  3LFM A;  3LSV A;  5F5W A;  3AEG A;  4QXB B;  4P09 A;  2KLQ A;  5HXE A;  2D2S A;  1T8B A;  4GIW A;  1E7P A;  2IAK A;  4O4H E;  3M3Z B;  3NVO A;  1LVK A;  5GON E;  2IDO B;  2VL0 A;  3RYC E;  2VVS A;  2YOE A;  5AQK B;  3FZM B;  5JDN A;  3N9O A;  2F4V T;  5BR8 T;  3ZT6 A;  4AKR B;  5JRC A;  5LP6 E;  4EV6 A;  1ZOY A;  4GKJ T;  3Q2M A;  4ZI3 D;  2D9D A;  1YQ3 A;  4Z8X A;  3PTR B;  2B76 A;  1D1A A;  2CLY C;  5LBQ B;  2A2F X;  5IHY A;  2LSK A;  3MAC A;  3GA8 A;  1OED B;  1OWA A;  3ZJ1 A;  2R6G F;  2HPJ A;  3SS1 A;  5J1G A;  5KXJ A;  5CB4 E;  3KV4 A;  2KWI B;  4NUU A;  4JI4 T;  3K3O A;  2BVL A;  5LXT E;  4HFC A;  4NPP A;  4Z91 A;  3LG7 A;  2XUE A;  2LOS A;  1IAP A;  3C50 A;  3Q9D A;  1MMN A;  3RF1 A;  3N5L A;  2BS4 A;  3PE0 A;  1LVF A;  4XAX B;  3H3M A;  3UUM A;  3V5U A;  2YKS A;  3C4X A;  5AQS B;  2BKO A;  4JI6 T;  2VKJ A;  3L09 A;  5FP3 A;  4DMW A;  5HWX A;  3K3N A;  5DQV A;  4GOU A;  2E9X A;  4PK6 A;  1XMO T;  3JAD A;  1U5P A;  4U72 A;  3CQC B;  2K48 A;  1HS7 A;  3VKH A;  3EHZ A;  2CHO A;  4PNI A;  2K5B B;  1ZHC A;  4AKL A;  3J9X 1;  3JCF A;  2CA5 A;  2ZM0 A;  4ILU A;  3ANW A;  2I6H A;  3RHW A;  2XAF B;  4DR6 T;  4ADZ A;  3VRA A;  4ZS2 A;  1FEW A;  5ABF A;  4FJO A;  1MMA A;  4X66 T;  2E5V A;  4A5X A;  3AA7 B;  2XQ5 A;  4UVB B;  2W63 A;  2A72 A;  3T8O A;  1OXZ A;  3CPZ A;  2WU2 A;  5F8P A;  3S4U A;  2M67 A;  2CPT A;  2KWH A;  3J7Y q;  2BG9 A;  5ADX L;  2UXC T;  1FMW A;  2FJB A;  2ZMA A;  3RH3 A;  3KFW X;  1GQE A;  5HEU A;  2LOP A;  2AXD S;  3OVU A;  1WLX A;  2A9U A;  3PUS A;  2ODV A;  2E9X C;  2Z6E A;  4JI8 T;  1FMV A;  3FZK B;  5HXS A;  2BDE A;  3JAF A;  1XDO A;  5FNV E;  5LGT B;  4GK5 E;  2HH7 A;  4DO0 A;  3SOL A;  4QHO A;  2WY2 A;  4KI0 F;  3PU3 A;  3AVS A;  3LBX B;  4DVD A;  1LRZ A;  2DWK A;  5AQQ B;  4DV7 T;  3PUA A;  4AIU A;  4YFS A;  5IWA T;  3Q5W A;  1IJ6 A;  1MIW A;  3ZMV B;  3JC6 C;  3OKQ A;  4CN6 A;  2W2U A;  3QUJ A;  2MOZ A;  2BBJ A;  2G0U A;  2GK9 A;  5JRC B;  4UV8 B;  2X9Y A;  3PJA J;  4J2C A;  2FUP A;  3AA0 B;  1N34 T;  1NEN A;  4L5G A;  3RPU A;  2XZE A;  2BG9 C;  1UX5 A;  1W0B A;  4YJ3 E;  2BVM A;  2NTY A;  1VRB A;  2MBG A;  3N2O A;  3PJA A;  3F31 A;  4IT4 A;  4JI5 T;  3FBL A;  1W9R A;  2LSY A;  2CWY A;  3TLU A;  1QSD A;  2LE8 A;  4L9I A;  2WMN A;  2CE7 A;  2WWV A;  2DL1 A;  4TZ4 C;  4YXD A;  2X67 A;  2X0L B;  3AVR A;  4MAL A;  4AXP A;  3UFE A;  1UCU A;  2WBL A;  3AE9 A;  3BQL A;  3ABV A;  1D0Z A;  2V7I A;  3AXJ B;  5LHI B;  3PUZ F;  2MAW A;  5CGM A;  5HXC A;  2NP9 A;  4O2B E;  5AQT B;  5FVK A;  4LMJ A;  2VQE T;  1HG5 A;  2WDV A;  4EOZ B;  5LGU B;  2WDR A;  3C4Z A;  2XQ3 A;  4A56 A;  2YDS A;  4BJN A;  3ZEF B;  2VKH A;  2WMO A;  1I94 T;  3KBU A;  4DMV A;  2IIU A;  4IL4 A;  4OK0 A;  4DV5 T;  4UF0 B;  4EGW A;  2DWG A;  3BK9 A;  2OA5 A;  3OPC A;  4JEH B;  5LJN A;  3N9Q A;  2K9A A;  3RKO A;  2K3W A;  4U74 A;  5AQH B;  5CJ5 A;  4JI1 T;  4HWD A;  3RYI E;  5EK3 A;  2BG9 B;  1WYB A;  4KHZ F;  3ETV A;  4ZOL E;  4H9N C;  4EZ4 A;  3B5M A;  4ZI7 E;  2MPK A;  5LMU T;  5FXV A;  2NTX A;  4UVA B;  3WAJ A;  5LOV E;  4QXC B;  2BS3 A;  4JLE A;  3B13 A;  4DV2 T;  2KZ7 B;  1BR0 A;  2PBI A;  4GYR A;  1IBK T;  4O8S A;  2H7V C;  2PJQ A;  4P1N A;  1WRD A;  3RGL A;  5AFU L;  4GK0 E;  1D1C A;  1YKE B;  4YHH T;  3KVA A;  1YKH B;  2XQA A;  4HE8 A;  4TWH A;  2B1E A;  4C91 A;  3KV9 A;  4K0U A;  4DBR A;  2UXN B;  3AAA B;  2IC9 A;  2YU2 A;  1LKX A;  5AQL B;  3AE6 A;  3KDS E;  3HKB E;  4A98 A;  1YD8 G;  3UU8 A;  3TKL B;  5EK4 A;  3ZN1 B;  4X20 E;  2LSJ A;  3EI0 A;  4B3T T;  2X0Y A; 
#chains in the Genus database with same CATH homology
 4ASK A;  1AJ3 A;  4Z8X A;  4NUV A;  3PTR B;  4IST A;  2JRK A;  2DI4 A;  3ONX A;  1D1A A;  2KT9 A;  4IE0 A;  2CLY C;  5LBQ B;  2A2F X;  5IHY A;  2Q9Q D;  3LK3 B;  2DNX A;  2JQQ A;  2LSK A;  3MAC A;  3V5S A;  3AAI A;  4M1P A;  4UEM A;  2Q9Q A;  3GA8 A;  3ANW B;  1OWA A;  3ZJ1 A;  2HPJ A;  1HFA A;  3C64 A;  3C4W A;  3E0Z A;  5J1G A;  3SS1 A;  4IHJ E;  4XBF B;  5J2U E;  5CB4 E;  3VKG A;  3KV4 A;  4I55 E;  5ETW A;  5FY7 A;  1D1B A;  2KWI B;  2RA1 A;  5TAO A;  4NUU A;  2I59 A;  3CML A;  5HAX A;  2VKO A;  5FXX A;  2CXL A;  4UXN B;  3F57 A;  3K3O A;  2BVL A;  5LXT E;  1G8X A;  3I0O A;  4F6R C;  4ZI2 C;  5IYZ E;  3EVY A;  5LHG B;  2XTL A;  4YHJ A;  3RYF E;  1MMD A;  3UT5 E;  5JDH A;  3VU7 H;  2NOX A;  2C0S A;  3AA1 B;  2C5I T;  3LG7 A;  5H6R B;  3RC3 A;  2XUE A;  2LOS A;  1IAP A;  3C50 A;  5KMG P;  3Q9D A;  4WNK A;  1MMN A;  3N5L A;  3ZYK A;  5JDQ A;  3PU8 A;  3PE0 A;  4O4I E;  1LVF A;  5LGN B;  4P0B A;  4XAX B;  3EUH A;  1CUN A;  2XAG B;  2XAS B;  3UUM A;  3V5U A;  2NW7 A;  2LHN A;  3C4X A;  2WWU A;  4WW0 A;  3QC9 A;  4ZHQ E;  2VK9 A;  1E1H B;  1Z0P A;  2V26 A;  1H7C A;  2VKJ A;  3L09 A;  1Y64 B;  3CX6 B;  1ZV4 X;  4B6X A;  2NW9 A;  5FP3 A;  5LHH B;  4UIG A;  1KNZ A;  5LBM A;  3MXZ A;  4X1Y E;  4DMW A;  5HWX A;  3K3N A;  2E9X D;  3ESL A;  2CEA A;  5DQV A;  4TUY E;  3DJB A;  3NRX A;  4GOU A;  2E9X A;  4PK6 A;  3HR0 A;  4H9S E;  3ZYM A;  3E22 E;  1U5P A;  3KV5 A;  2E8I A;  4U72 A;  2DLR A;  4KUM B;  4E7Z A;  3CQC B;  2K48 A;  4ZI3 C;  4EXT A;  3W15 B;  2MYS A;  4PK4 A;  1HS7 A;  1EZ3 A;  3VKH A;  2N2N A;  1YW0 A;  4PNI A;  2SPC A;  1MMG A;  1D0X A;  2KMF A;  2K5B B;  3ETU A;  2DHR A;  3EDV A;  3AB3 B;  3ZCI A;  1ZHC A;  4AKL A;  1G73 A;  1B7T A;  2YIN A;  4EYU A;  4CI1 B;  2V1D B;  3J9X 1;  2ZM2 A;  4YJ2 E;  3LK4 2;  2Q9Q C;  3N9N A;  2KND A;  3N9P A;  4OYJ A;  4PJJ A;  1FIO A;  2CA5 A;  4TX5 A;  3ZMZ B;  2ZM0 A;  5L3G B;  2CCQ A;  3ANW A;  4ILU A;  3AAE B;  5HWY A;  2XAF B;  1D0Y A;  2N1G A;  4YLH A;  3RRC A;  2V7M A;  5FYM A;  4ADZ A;  2W62 A;  4ZS2 A;  4HKA A;  1FEW A;  4I50 E;  3R84 B;  3L3P A;  3CVR A;  3IF8 B;  4FJO A;  1HTJ F;  1MMA A;  2ES0 A;  2VB6 A;  4ZS3 A;  5LYJ E;  3JC6 D;  2RP4 A;  4CXW A;  4FI5 A;  4IE6 A;  3F2E A;  4H9Q C;  4MLK A;  3Q5X A;  2L9Q A;  3RX6 A;  4H9P C;  5L3D B;  2K24 A;  2KIN B;  4ISS A;  3AA7 B;  1WYC A;  3EDU A;  4UVB B;  5JRE A;  1NAF A;  2W63 A;  2EHO B;  5F3J A;  2A72 A;  3T8O A;  1OXZ A;  3CPZ A;  5F8P A;  4UV9 B;  3S4U A;  3E08 A;  4TV8 E;  2LM9 A;  2M67 A;  5JR9 B;  2H3R A;  3O4X E;  2KWH A;  4WBO A;  3J7Y q;  4O2A E;  5ADX L;  4CXX A;  4HEA A;  1FMW A;  3O1I A;  3RC8 A;  3DP7 A;  2CXD A;  5EZY E;  5E0O A;  4G63 A;  3RRW A;  2ZMA A;  3CQX C;  3RH3 A;  3KFW X;  3P7I A;  3I0Q A;  3OJA A;  1SHZ C;  2LOP A;  3ZC1 A;  3N2G E;  4MBQ A;  5M4Y A;  4MHC A;  1WLX A;  2LJL A;  2XHE B;  3PUS A;  1WR6 A;  1MNE A;  2C5K T;  2E9X C;  2ODV A;  2X9X A;  2Z6E A;  3IBP A;  5KX5 E;  1FMV A;  4O4J E;  2YEV C;  4IGU A;  3ZN0 B;  3UTK A;  2J1D G;  5HXS A;  2BDE A;  3BQI A;  4HGA A;  3I9Y A;  3CKD A;  3HKD E;  3NRY A;  3CWZ B;  2DCF A;  3FXD B;  5LCY A;  2IW5 B;  5FNV E;  5LGT B;  2XQY A;  2HH7 A;  2V7K A;  4GK5 E;  4DO0 A;  4CZZ B;  3SOL A;  3GMI A;  4QHO A;  4EIW A;  3GN5 B;  4OFZ A;  3BQK A;  4H63 V;  3PU3 A;  4PK5 A;  5LA6 E;  3AVS A;  3K8P C;  4L0R A;  4AQF A;  3DTO A;  3LBX B;  5JDM A;  2ODU A;  3ZLI A;  4DVD A;  5L3F B;  3NBX X;  5LNK A;  4EB6 E;  4AKI A;  1LRZ A;  3MZK B;  2DWK A;  3CX8 B;  3D0T A;  3PUA A;  2L8K A;  4YFS A;  5JDF A;  3Q5W A;  1IJ6 A;  3PUR A;  5JDG A;  3P8C D;  3FXE B;  4QWN B;  4PFO A;  4UEL A;  3FBZ A;  1MIW A;  3N9M A;  3ZMV B;  3JC6 C;  3OKQ A;  3QUJ A;  1V9D A;  4I43 B;  2MOZ A;  2LSI A;  4CI2 B;  3HI2 A;  2G0U A;  2GK9 A;  5JRC B;  2W00 A;  2ZM8 A;  2X9Y A;  4UV8 B;  4CI3 B;  2VL8 A;  5FMN A;  2D0T A;  1MIV A;  2EHO D;  4X1I E;  5LJM A;  2A3D A;  4J2C A;  4PJM A;  2VKD A;  2CXF A;  2EHO A;  5JDL A;  5FY1 A;  4TV9 E;  4IIJ E;  5HXH A;  5JQG E;  4AQG A;  3AA0 B;  4L5G A;  3NZQ A;  2YU1 A;  3RPU A;  2X9W A;  1MIY A;  4QX7 B;  3KBT A;  2NWB A;  1UX5 A;  4YJ3 E;  2BVM A;  3OBV E;  5A1L A;  3O9X A;  2X51 A;  2NTY A;  1VRB A;  3AA6 B;  3SWH A;  2YK0 A;  2MBG A;  3N9L A;  2VAS A;  1VOM A;  2BZB A;  3OYX A;  3N2O A;  3U78 A;  3ZPO A;  3F31 A;  3O1H A;  3MK7 C;  4AKG A;  3FBL A;  1BR1 A;  2LSY A;  4JUY A;  3LJC A;  2JJ9 A;  2CWY A;  3A5X A;  4V1A v;  3WAK A;  2NW8 A;  5FXZ A;  3ZCJ A;  4EAH A;  1QSD A;  2LE8 A;  4L9I A;  2WMN A;  2CE7 A;  3PUQ A;  4EYY R;  2CMR A;  4KBM B;  4MFR A;  3HKC E;  5FY0 A;  2WSS V;  1HX8 A;  3C98 B;  4TZ4 C;  1UX4 A;  3KVB A;  2D5U A;  2L3L A;  3HA4 A;  3GN5 A;  4IE7 A;  2X68 A;  4UVC B;  3ZC0 A;  2X67 A;  3MJX A;  2MTQ A;  4AQF C;  2X0L B;  2WAU A;  5H6Q B;  1T98 A;  3LBX A;  3AVR A;  2JPF A;  4X1K E;  1HF8 A;  4MAL A;  4AXP A;  3UFE A;  1UCU A;  2WBL A;  5CA1 E;  2PFV A;  3BQL A;  4P0A A;  4DND A;  2CLY B;  1D0Z A;  2V7J A;  2V7I A;  4TN7 B;  3NZP A;  2XAJ B;  5LHI B;  5HXC A;  4C90 A;  2NP9 A;  4O2B E;  3SRZ A;  1KK7 A;  3B57 A;  3ZJ2 A;  5CA0 E;  3LK2 B;  1HG5 A;  2ACX A;  3IHR A;  2EHO C;  3U3I A;  4HTE A;  3ZYL A;  3H3A A;  1QUU A;  4QX8 B;  3UUN A;  4XZC A;  4EOZ B;  4PFP A;  3HL6 A;  3RYH E;  5LGU B;  4JEU B;  3H37 A;  5JR9 C;  3PUG A;  4IE4 A;  3C4Z A;  1MND A;  5DJQ C;  3WI3 A;  4A56 A;  2Y8D A;  4N78 D;  4BJN A;  3KV6 A;  3ZEF B;  2XAH B;  2C5J A;  2VKH A;  4ERR A;  3MA9 A;  4O4L E;  2WMO A;  5LG4 A;  3KBU A;  3CQG B;  4DMV A;  2H7O A;  5HYA A;  3FB2 A;  2WM9 A;  4PW8 A;  4BJM A;  4OK0 A;  3VHL A;  4H63 H;  4UF0 B;  3OYZ A;  2UXX B;  4CXY A;  4PJL A;  3ZMT B;  2DWG A;  5KDM C;  3BK9 A;  3I9W A;  4JEH B;  1SA0 E;  3HKE E;  5LJN A;  4H9O C;  1US7 B;  3N9Q A;  2X66 A;  4WBN E;  1U4Q A;  2K9A A;  1X79 A;  2X9H A;  5FXW A;  2ZLY A;  3RKO A;  5DAB A;  3R6N A;  4KMC A;  2JMH A;  3ZMU B;  5DQW A;  1IZN B;  4U74 A;  2IC6 A;  2Y6X A;  4PAG A;  5C8Y E;  2LHR A;  5BMV E;  3PDY A;  3RYI E;  2CM0 A;  3I1A A;  4IDZ A;  5EK3 A;  1WYB A;  4BA9 A;  3ETV A;  4ZOL E;  5JR9 A;  4H9N C;  4KP3 C;  4EZ4 A;  4AI6 A;  5L2L A;  3ZMS B;  2LEH A;  1BR2 A;  4ZI7 E;  5FXV A;  3KIN B;  2NTX A;  1S35 A;  1O3X A;  2V7L A;  4UVA B;  1NWM X;  4PJN A;  2Q9Q B;  4GYS A;  4EZH A;  3FHN A;  3WAJ A;  2W61 A;  5LOV E;  4OYK A;  4H9R C;  5JVD E;  1BR4 A;  2VWA A;  5HXR A;  2KXP B;  4QXC B;  2JMK A;  2PG8 A;  3UUL A;  3M65 A;  4ANJ A;  4OHF A;  2D0U A;  4JLE A;  2XAQ B;  3B13 A;  5J2T E;  4QXH B;  3CX7 B;  2KZ7 B;  4I4T E;  1BR0 A;  3K3Q C;  4ZI2 D;  2PBI A;  2QA7 A;  4GYR A;  3UUX B;  2Y48 B;  4O8S A;  2H7V C;  3N2K E;  2PJQ A;  1WRD A;  5L3B B;  5L3E B;  3O1J A;  5EK2 A;  1S94 A;  2QGS A;  3LFM A;  5AFU L;  1HG2 A;  2CWO A;  4GK0 E;  1D1C A;  1YKE B;  4QXB B;  3KVA A;  2LSG A;  5L3C B;  1YKH B;  1ZKE A;  2KLQ A;  4P09 A;  4HE8 A;  4UF0 A;  4QKN A;  2B1E A;  5HXE A;  2D2S A;  4C91 A;  3KV9 A;  4G2A A;  4K0U A;  5JH7 E;  4DBR A;  4GIW A;  4CQI A;  2UXN B;  2IAK A;  1ZEE A;  3AAA B;  2LT3 A;  2IC9 A;  4HFV A;  4O4H E;  2HPL A;  1LVK A;  5GON E;  3MKD A;  2YU2 A;  1LKX A;  3RYC E;  1IJ5 A;  3KDS E;  4HN9 A;  3HKB E;  5JDN A;  3N9O A;  4DBQ A;  1YD8 G;  3QK6 A;  4E7S A;  2N9D A;  2P9B A;  3TKL B;  4BAY B;  4AKR B;  1HCI A;  5EK4 A;  5JRC A;  4AKH A;  2E9X B;  3ZN1 B;  5LP6 E;  3C51 A;  4X20 E;  3Q2M A;  2LSJ A;  4IE5 A;  2W0G A;  4ZI3 D;  3IEE A;  3GWH A;  2OA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...