4XAXB

Crystal structure of thermus thermophilus card in complex with the thermus aquaticus rna polymerase beta1 domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit beta domain 1
publication title CarD uses a minor groove wedge mechanism to stabilize the RNA polymerase open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription regulator
total genus 47
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4xaxB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xaxB01
2LT3A 4ILUA 4MFRA 2LT4A 4XAXB 4L5GA 2LT1A 2LQKA 4KBMB 4KMCA 2EYQA
chains in the Genus database with same CATH superfamily
2Q9QC 2DLRA 1NPPA 2W62A 5CQXA 4ZHQE 3NZPA 1CKAA 1JU5C 3FIFA 3MP6A 3NTKA 5GMKh 4XK8E 2OAUA 3C0CA 1WLXA 2LEHA 4YY3T 3O1HA 4JBWF 1UE9A 4ZGDB 4HA8A 1YI2Q 4M7DD 1U5PA 4QQ6A 4JI3T 4N4IA 5FXXA 4PFZA 2W0ZA 3KV5A 3NKZA 2GQVA 4IT4A 2RHIA 4IDPA 3CX6B 4U7IA 4WCIA 3SHWA 2XUEA 4PJNA 5C3JA 5J2TE 1JB0E 2F4VT 1X27A 2IC9A 2ZM6T 2V8SV 3NRYA 4HWFA 1MUZA 1YW0A 2RP4A 3AXJA 5LA6E 2MTQA 3JB9G 4E7HA 1D1BA 3VKHA 2WMOA 3ZPOA 3QDRB 3CCLQ 1VQMT 1BCMA 2XPKA 2YLBA 3PUQA 5ETWA 3L3PA 1XOVA 2QG9B 5L3CB 1WJQA 1UTIA 3V7RA 3QB5K 2HN1A 2DKGA 4M77C 5A0GA 1BR0A 1YIJQ 1M4ZA 2Y48B 5L3GB 1G3WA 1U3OA 1X6BA 3UT1A 4DV4T 1YITA 2KBTA 5FXZA 1CSKA 3B5MA 3EFOB 2PVOB 1M30A 5KX5E 2LQKA 2W10A 3PGGA 4X1KE 4F7UA 4X65T 2VQFT 2MK5A 5L23A 1B34B 2BIVA 1UGQB 3CC2Q 3MEUA 2VL0A 2DCFA 2A3DA 4KBMB 2KRSA 3ONXA 4OMPA 4QQGA 1X79A 2CH4W 2XICA 2DI4A 4JI2T 2XSBA 4IIMA 4J7IA 4J5YA 2ODVA 4O6JA 1VQ9T 4H9RC 2D1XA 1WHKA 4IDOA 1M8VA 2K5LA 2LM2A 2EYZA 2QDLA 1VYUA 4LF9T 3FZFB 3OYYA 4YTMA 2X0YA 2RNAA 2FPDA 2OTJQ 1KC8R 1XDPA 1PWTA 4FYXB 1YI2T 3P7IA 3GN5B 3T1YT 2ECZA 3KFWX 5CQYA 1E2AA 3ZLIA 2KLQA 3QK6A 3ESLA 5AQPB 1PD1A 1RLPC 2E2AA 1V76A 4AG1C 2GNCA 2E8IA 5LHHB 3SFMA 4C92D 5GANh 1N27A 1N8RR 4JEUB 3FC3A 2J6OA 1WLPB 1MMGA 3F57A 5I11A 4JV5T 2QA4Q 2BS4A 2D8HA 4ZN3A 1FX7A 3NGPA 2M6IA 1Y0MA 2K9GA 1GXIE 5CVIA 4BDZA 3SFEA 1IAPA 1HK9A 4IUTA 1UHCA 1MHNA 2YEVC 2BKDN 4PNOA 3OYAA 3JCMd 2CA5A 5DLQE 5FU7B 2VUBA 1V1CA 1YWPA 2DWKA 4DV3T 3ULRB 1VQPQ 1BR2A 4YJ3E 5CA1E 3NRXA 4F8HA 1H8KA 4A4KA 3I5RA 2XASB 4RTTA 3CCVQ 2CZ7B 2ACZA 2XAHB 3RH3A 5HK3A 2XQ3A 3ZSSA 2VASA 4Z8AA 3EGXB 1Q82U 4FU6A 1NYGA 1AZEA 3A5ZB 4M77G 3ZYKA 2X67A 1RAIB 2DMOA 1IBMT 2EYYA 4PJMA 3UULA 2PG8A 1Q81C 3VR8A 2FZKB 4A4HA 3G4SA 1YJNQ 2AKLA 4HCKA 4DO0A 2XAQB 2FUPA 1YHQA 2XD0A 3M59A 4U7YA 5LHIB 2CT3A 3MACA 3H0FA 3KUFA 4PJOF 2QA4T 2DAQA 5CKFA 4X9DA 3JCMX 5GAOp 2CS7A 3EABA 1VRBA 5CCAA 4NL3A 2C0OA 1OU8A 1OX8A 4JI5T 3ZEHA 2WB5A 3JCMc 2CYZB 1UG1A 4B6XA 1X9BA 2E41A 3N2GE 4O4HE 1VQPT 4BB7A 1ACMB 1XWMA 3I0QA 1K9AA 2DD4A 1N36T 2V7IA 2XQYA 5I2SA 1BBZA 3RR6A 2CWOA 3TLVA 2DL4A 1T0JA 1SF9A 3CQCB 2KZ7B 4HCCA 1KFYA 4EGWA 2A37A 1IXDA 2AK5A 4QHOA 1US7B 4E7LA 4IKFA 2IAKA 3PVLA 4JI0T 5CO7A 5GANf 1YJNT 2VXFA 2FZGB 5HCMA 1EIFA 3I1AA 4EV6A 3PUWF 1S72T 4HWHA 5HXCA 3D7SB 2KWHA 2F2WA 2XZEA 4LD6A 4GK0E 3DB4A 1BI3A 2LCLA 2LSJA 2OLTA 2C0TA 5GJWB 2FJEA 4EEBA 2X0HA 2PQWA 2VKOA 3BQIA 2W63A 2LRQA 3AA1B 3EGUA 3NTIA 3I56T 2KVQG 1I5LA 2A2FX 1Y57A 4MFRA 4XU2A 2FG0A 1HX8A 2HMAA 2EQUA 5JQGE 1NM7A 3AVRA 5H6QB 5E0OA 3L2QA 2VKDA 4CC3A 2QGFB 1IB8A 3CX8B 4X9CA 4B9XA 1SHGA 2FL7A 2KRMA 4LFAT 1BI1A 3PTAA 5C0MA 1I5OB 2E9XD 3E9GA 1TTHB 2X9XA 3FBLA 4F7UF 4XTZA 1OEDE 5HEUA 4OYJA 4HFHA 1Q81R 3CC7Q 4M7DA 2M67A 5LL6S 4N78D 4OMNA 3DLMA 4RUGA 4I50E 1OEDB 3LBXA 4BY6C 1XQHA 1WPYA 2QTXA 4MHCA 4I4TE 1QCOA 4F16A 3QPHA 4G63A 3UATA 1YHQT 2W66A 2XQ4A 3FJ5A 2J1DG 1WNLA 3OYGA 2LOSA 3PMTA 2ED1A 2ENMA 3CCST 3RC3A 2HBWA 2JVVA 3VS3A 4LXCA 3JC6D 2L3RA 1NJIU 4CC7A 5LJNA 3OSVA 5BMVE 3M9QA 4XTUA 1M2VA 1OI1A 3EVYA 2VURA 2CPTA 2CZ1B 1YN8A 2LTOA 1YBYA 3OMGA 1UJ0A 4M78E 1J3TA 2XAFB 2GFAA 4HVVA 1Q82C 1Y96A 5A1LA 4M78B 1BB9A 4EMKC 3AECA 4DR3T 2EVRA 4CC4B 5FVKA 5FMNA 3RIUA 2J7IA 3JAME 2YDRA 4ILUA 3G6ET 3H0HA 1K9MU 1WXUA 4J7FA 2JW4A 5J2UE 3AT1B 2JQ9A 2MWOA 2V5DA 3ZYLA 5CKEA 3FRNA 2BE9B 1JJ2S 2HKNA 3L2RA 4ELZC 2COYA 4DUYT 3MEVA 2KR3A 1KF6A 3SWHA 4JLEA 4OVAA 3OYLA 2P4RA 3RRWA 2X9WA 1NEKA 1ARKA 3QC9A 1TUDA 3I5SA 4C92A 2XK0A 4PJOC 1MV0B 4M7AE 1SPKA 1PCXA 2WY2A 4M7AB 1CHUA 1UGPB 3CCJT 2CM0A 2DPPB 1JXOA 5JVDE 1RAFB 1VQLA 2OTLA 3P4PA 3OS1A 3RNJA 4M1PA 4X34A 1NG2A 4WF2A 3OYXA 3IHRA 4F04B 4IE7A 2RI2A 4C8QD 5LJ5e 3C64A 4TWDA 3RKOA 2D8JA 1AEYA 3LJCA 4LFBT 5AQJB 5DY9A 3C50A 1VQ6T 4CI2B 3EFSA 4N0AC 2ZGWA 3BK9A 1IHVA 3EGDA 1HD3A 3ZT7A 1VCSA 1T8BA 1L0VA 1PSFA 1U5SA 1HSQA 2WDQA 3AEAA 2GTOA 1G3SA 2XTLA 2V6YA 3CBPA 5CIUA 1YKEB 2NUPA 4CXWA 2LT4A 3AE2A 4AXPA 1PC0A 4D8KA 5GAN8 1JJ2A 4UXNB 2QQRA 2ZM0A 1RAAB 2LM9A 1IRXA 1VQOA 4A54A 4Q5WA 1Q7YC 1M8MA 4IUPA 5AQOB 1NENA 1I07A 2X4XA 1LJOA 2KYBA 3HKEE 1D1CA 2AZSA 3CCUA 3HRSA 4AT1B 1AWWA 1TUGB 3CPWS 2EQIA 1T7SA 4OGCA 5LHGB 2GGRA 4LDUA 3OB9A 1RI0A 2HSPA 3M4GA 4XAXB 3JCMh 2JMAA 4AFZC 2EIFA 2VKJA 1Q82R 5D6WA 1BK2A 2QA7A 3A8OB 3O5ZA 3ZT5A 3RRCA 2COZA 4OX9T 2QK0A 2EGCA 1LCKA 1FMKA 3QOFA 1D3BB 2CZ0B 2EJFA 3RYFE 3ZT6A 2KYMA 5LG4A 1N34T 3AAAB 1Q95G 3I35A 1BIBA 3U78A 1QSDA 4ASKA 3A8HB 2XM2A 4R56A 1WR0A 2L3LA 2JTMA 4AQGA 4PJOG 4B3RT 2WWVA 4ZZBA 5LNKA 4JRPA 2HL3A 5FWCA 2BE7D 1PG5B 5GMKl 2DETA 1SA0E 3N9NA 2DM1A 2WSCE 4B3ST 3G06A 3RQWA 2DBMA 5LYJE 3A8MB 2MAMA 1VQ5T 3TLWA 2YUNA 5HKCA 2LCCA 3K3OA 4J9HA 1NJIC 1VQNA 2E6ZA 1G2BA 4EEDA 5DLOA 2LLYA 3G71A 1I81A 4LF5T 1RI9A 2L3PA 2NYSA 4UVBB 4M7DF 4D8DA 3M57A 5GONE 2BZ8A 3META 3FB2A 4I55E 2EQJA 1WJRA 4U3CA 4BA9A 1N9RA 1VQLT 1U4QA 2NTXA 3RYCE 4MZPA 3CPWA 2HN2A 3FBZA 4ADZA 5AYFA 1T0HA 4EXTA 1X2KA 5AQNB 4AG2C 3L42A 1D1AA 1MNDA 1QQJA 1VQKQ 3X20B 2L89A 3NPFA 1QMCA 1K9MC 2EKOA 2K2MA 5LGTB 3ONJA 3AAEB 1HNZT 2HQXA 4C0FA 3ZBDA 1LVKA 1ZKEA 5M4YA 1JO8A 3OYMA 1QW1A 5C6SA 2H3EB 5L47A 2D9DA 4HWCA 3REBB 5AQHB 1NPRA 3OY9A 2E9XA 2DTHA 3HL6A 3QZ9B 5ABGA 1QVFS 3HFOA 4KMCA 4MZTA 3PURA 3PUYF 2LQWA 4RTZA 2DF6A 3ANWA 3VS0A 2F5TX 2O9SA 2E6NA 1NZ9A 4ILCA 4WBOA 2C5IT 1O9SA 4HFEA 4JI8T 3RIAA 4ZI3D 1KNZA 1B7TA 4MBQA 5GAMg 2NTYA 4AMCA 3UU4A 3PUZF 3OBWA 4QW2A 5GAOr 4L9IA 2HDAA 3M55A 4IURA 5AQTB 3CMAA 4YTLA 4RCCA 4F7UG 4X1YE 5AQRB 3M0TA 2BBHA 3WAKA 4HWDA 2ROTA 5CJ5A 1FYNA 3RHWA 1VQKT 4C92F 4TX5A 3AE4A 3FXDB 3UTKA 3M58A 4K0UA 3BE3A 3CMET 3K3NA 1AWJA 4AKGA 3PMIA 2RQVA 1VCTA 2W61A 1JQQA 2WSFE 2IUBA 2CLYC 2K5BB 4HFCA 3CC4Q 1C0MA 2E3HA 2O2OA 2FJDA 1Q86U 2ZPHB 5GAOq 4X5TA 5IXFA 2XDPA 1VQ4T 4JI7T 2GBQA 4ZEYA 3RIRA 5C2TA 4A4FA 4CN4A 1N9SA 1LNXA 1WI7A 1NJIR 2M02A 2XQ7A 2QVAA 3VHLA 5AQIB 2NOXA 2EBPA 3P8BB 3ZYMA 3OYIA 2VVNA 3CCQA 5LB7B 2W4XA 4JS5A 2CBIA 3T1HT 3I9YA 1FMVA 2H88A 2O4XB 3Q2MA 3RMSA 2H7OA 3PNWC 4EMKA 5KYWB 2XG8D 3CK6A 1F1BB 4RTYA 1ABQA 3V8LA 1K9MR 4ZNXA 4E47A 2EJGA 1YJWQ 2VYTA 4GY5A 5HY6A 2CE7A 2MCNA 3X28B 3FZMB 2HSEB 3E1SA 4E2FB 2NR4A 2J6FA 1AHJB 2EHOD 4C8QA 4GBQA 2LSKA 4FT4A 2LVMA 3EG9B 2GQIA 4DMVA 1UB4A 5IHIA 2WBLA 1MMNA 4BE0A 4IDZA 1IJ5A 2H3JA 4ISSA 4L5GA 1ZP0A 5HEHA 4GKJT 2D0QB 4GLMA 2AXDS 1H92A 1HF8A 2Q9QB 1VQ8T 4BACA 4MALA 1VA7A 2A08A 1ZQ1A 3VRYA 3TREA 3DKMA 2X4YA 3L2VA 4HWIB 3SRZA 4RMOA 3LFMA 3A8YC 3Q5EA 1LKXA 1MNEA 3CCRT 4YTPA 5EC7A 3VYHB 2KT8A 3ZN0B 3CCEQ 8ATCB 5KYYB 3CX7B 4PK5A 3C51A 4QX7B 1UEBA 4M7DC 5HXEA 3AA6B 4UV9B 3BDUA 2Y8DA 1WHHA 2XDDA 1YJ9Q 3ZL7C 4X20E 2WZIA 5LMNT 2HQEA 4M77B 5FL1A 2N1GA 2YRDA 1Z9QA 3GWHA 5LGUB 4D6WA 3SOLA 3NWIA 2CGHA 2FB7A 4HN9A 3S4UA 5IWAT 1NAFA 3VJPA 4BDYA 2RA1A 2EYWA 3HPWA 5ABEA 1JEGA 4IIOA 3CCLA 3FEOA 5HCJA 3QHSA 2KWIB 4YLHA 1VQ9Q 4J2CA 4HT8A 1H3HA 2QASA 5JDFA 1YIJA 3S3NA 3QWYA 5GAOm 5JR9C 1JNZA 1GBRA 4IL9A 5ABFB 5JRCA 1X75C 2K57A 4ZTFA 3P8DA 4KHZF 5GAN2 2XJ7A 3CC2A 4ELYC 2DNXA 1DU2A 2M0YA 4IE4A 2YU1A 4C0ZA 2O01E 1KSWA 2DXTA 2WMNA 3RIUC 4X1IE 4PKCC 2JT4A 3ABVA 5CKHA 3CCET 5HEJA 2UU9T 4HVUA 2L9QA 4JRQA 4J9DA 2E5VA 2ZPFB 2LJLA 5LP6E 3M65A 1OQKA 3OW2A 2NUPB 1YJ9T 4CXYA 2E1HA 2OTJA 1OXZA 2N2NA 4QWNB 1KHCA 3I55A 2LQ8A 3ZCJA 2QTVA 2KRNA 5F8PA 2VXEA 2XAGB 2X4JA 2YXYA 4C92C 1YCYA 3CWZB 4UVAB 4BJMA 4OMLA 1Q86C 5KYNA 5FLXE 3KV9A 2FRWA 4HKEA 1ABOA 5AQVB 1GCPA 2V7LA 1ZSZA 4C0DC 5JDMA 1UCUA 4HFDA 3VRAA 2KEAA 2A72A 3EH1A 3WXMB 4QVDA 1QVGS 1PSEA 1K76A 2V8JA 3AVSA 4JEHB 4M7DG 1XMQT 4LDWA 3OA6A 2QXFA 2JN0A 1RL2A 3R6OA 2DLPA 2OX7A 2CH4A 3X24B 2YSQA 3CPFA 5IHNA 2L2PA 3E08A 1OX9A 5FU6C 3G7ZA 2NUZA 3JB9J 3M0SA 1ZUUA 2DYIA 4U2YA 2L8KA 1SKUB 3CCVA 2LNVA 4PJJA 5KYUA 3UUBA 3EHZA 2RQUA 3LYIA 1HTJF 3PT9A 5GAN7 2X66A 3AE7A 3EDVA 3C94A 2J62A 2EYXA 3M4YA 3HP9A 3MCAB 4B3MT 1YXRA 5FY7A 3PJAA 3KV6A 2YLCA 1KQSS 2PBIA 3N9PA 2VL8A 2M9UA 2NUTA 5IH2A 3P4SA 1YNZA 3ETUA 4AQFC 5HK0A 3H3AA 2NWMA 2WSEE 2DL3A 3NFCA 8AT1B 3DTOA 3L2UA 3AEFA 3SDZA 2ZM8A 3N9LA 2DEQA 4ZTJA 3BQKA 4NL2A 2V26A 2DWGA 3MJXA 2LE8A 3LDQB 4DMWA 4RCBA 4XZCA 4HE8A 4FSXA 4MZMA 3SD4A 1KD1U 4KHPT 1QVGA 1YWOA 2EKHA 2B1EA 2XQAA 5J1GA 1RAHB 2WDVA 2JMKA 4ORZA 4C8QF 1SE7A 3ZMUB 1EZ3A 5GMKj 4DR4T 1WHLA 1M1GA 3QYHB 2LHNA 2WZHA 4O8SA 4LF6T 4C92G 4QVCA 3OS5A 2BUDA 3PUGA 3TVTA 4MMKA 3MPUB 4PLLA 3UU5A 4AKRB 1S72Q 2LSGA 3CPZA 3ZC1A 2W0GA 5CB4E 5CR2A 2DE0X 3VKIA 3PDYA 2YU2A 2BBJA 3GA8A 1KQ1A 1XDOA 3G1JA 3JB9I 4J9CA 2BS2A 2IIMA 2DHRA 2DD5A 2RD1A 2ZAEA 3CQXC 3S6WA 1Q86R 3FZKB 1YITT 3TSWA 5FROA 2CXDA 2A36A 3I56Q 1UX5A 3AE9A 1W2BS 2HL5C 1WFWA 1GL5A 4EPCA 1KQSA 2AHJB 3P8CD 2BDEA 3E22E 1X01A 4EB6E 2IMLA 2EHOA 5IUXA 2V1DB 2LKHA 4XU1A 1YQ3A 4YTNA 2NLUA 3RLFF 4JZ3A 3UWNA 3PU3A 3TEEA 2G0UA 3J7Yq 2DFUA 4QH4A 3VS6A 1HX1B 2LC4A 1R8IA 3UFGA 3TKLB 1MIVA 3RYIE 3LH5A 3AAIA 2CHOA 4GOUA 4F17A 2X9YA 2YK0A 4NPPA 3IA3A 3KV4A 4LNPA 2X9HA 1AZGB 1I1JA 2RI3A 2XHCA 2R5AA 2XIDA 2HZYA 1M5Q1 4BY6B 5J3BA 3RIFA 4FI5A 1IGUA 4KP3C 2SPCA 4DV2T 2HBPA 3G4SQ 1QKWA 1VYVA 2F5KA 2E9XC 3UUNA 3NHNA 4PLIA 3N2OA 1YHQQ 4WZXA 2MOXA 4DVDA 1ZHIA 1QVPA 1Y01A 3M3ZB 3PUVF 2FJAA 4C5GA 5KYXB 4H9NC 3CCSQ 2N9DA 2K2VA 2XQ8A 5LJMA 2DO3A 2JQHA 3AEDA 4L59A 5GAMf 4UF0B 3CC7A 3Q5DA 1Q7YU 3OSSC 2DL8A 3NTHA 2BG9A 5GANj 1G3TA 3J81E 4BE2A 3B13A 2YDLA 4CI0C 1X2QA 4JJBA 5HXSA 4EMGA 2XY8B 1PD0A 4NOYA 1W2BA 2EFIA 3EI0A 2A3LA 2EGEA 3CXCS 2L3QA 2DJZA 1M27C 3AEEA 4J6WA 2DRKA 4ZGJB 4J9BA 3P8HA 3JC6C 3M0RA 5I22A 2BS3A 4EMKB 3CEYA 4KGZB 4M4ZA 1W9RA 4M7AF 2K3XA 2WACA 1HNXT 3G6EQ 4X1VA 3L2ZA 2WDRA 2ZMAA 4CN6A 4LMKA 1MGQA 2DNUA 3EAMA 2LSYA 4Z02A 5EG2A 1JNRA 4ZXLA 4KGXB 2M1HA 2WSSV 3SWNA 3QJ6A 4AFQC 2HPLA 4LD9K 1EFNA 4TZ4C 4B3TT 4JI1T 2JRKA 3GIBA 3CVRA 4BE1A 2D0TA 3M0UA 3BY7A 4O5VA 5L8RE 5LJ5g 3G4ST 2MF2A 3JCMe 2YDSA 5DABA 2Z0WA 3LWIA 4EAHA 4PJOE 2HKQB 2BKOA 1T3SA 4PJOB 2X0LB 3V7SA 3VS2A 2K7AA 1TS9A 3RF1A 4QT7A 3CCJQ 4A97A 4I0UA 2FVUA 4Z90A 1WYCA 2XM1A 4YFSA 1UJYA 2K3WA 2VKHA 3SB2A 2JQKA 4ZOLE 4DEYA 2KT1A 3TU4K 2RF0A 1KD1C 5JR9A 2V7KA 2B86A 3GLXA 3EG2A 2C0IA 3J80E 2PNIA 3RERA 1VQ6Q 3CXCA 2MBGA 4DOVA 2ES0A 4CQIA 1FEWA 2JXBA 4OMMA 2SRCA 1AD5A 2X51A 1WR6A 2FYKA 2ZLYA 3KINB 4Y92A 4C8QC 5JTGA 3UF4A 2D0NA 5AQFB 1GFCA 4AI6A 1QKXA 2EGAA 3C4SA 3HHTB 3OMCA 2LT3A 1Y64B 1VQ7A 4R55A 5AQSB 3ZCIA 1I94T 3KBUA 4HCZA 2ODUA 3IQLA 2E5QA 2CSQA 4AKLA 1HYOA 2DZCA 5ABHA 4JUVA 3A7MA 4PK4A 2GTJA 2X3XD 4C5EA 5LJ3e 3KDSE 4TNWA 1TH7A 3MEWA 2XKOC 3OYNA 2K3YA 1S35A 3X1DA 4FSSA 2DJQA 2QI2A 5JDQA 1JJ2P 4QX8B 1SRLA 2PVDB 3AXJB 2LKGA 2NW8A 3JCMb 2WS3A 2RK2A 1LVFA 3HKCE 5LOVE 1WZOA 4XTYA 3N2KE 4KUIA 4DV6T 1UUSA 5EK2A 2PUKB 4C90A 3UFEA 4ZI2D 4O4LE 3UQ7A 1BYMA 4V2SA 1HS7A 3LK42 4F7UE 4EMHA 2CKKA 2CXFA 4QKUA 3C98B 4F7UB 1PM3A 3DJBA 3FB9A 5BR8T 3EG1A 3OYEA 4CRIA 2WP9A 2CP6A 4KH0B 1LRZA 2VVKA 4OMFB 3X25B 4OF1A 3HKBE 1D0XA 3ETVA 3RKXA 1VQ5Q 1AWOA 1SUMB 4E6RA 1YQ4A 3VUZA 1UDLA 2HEQA 4OYKA 4LF4T 3VS1A 1QUUA 2IPOB 3MXZA 5D7UA 3JCMP 1GCQA 3PFSA 4AQFA 1MMAA 2CUDA 1S94A 3VKGA 4DV0T 2PUOB 2OI3A 4Q25A 1NYFA 1JXMA 1UHFA 3O9XA 2E4HA 1VQLQ 1V9DA 2OTLQ 4P0BA 2L5QA 4YXDA 1I6ZA 2DL7A 4JZ4A 1KD1R 2I59A 2AZVA 1O75A 3TLUA 4NUVA 1C6VX 2UXBT 3AE6A 4C8QG 4HFVA 2K79A 4M75F 3PE0A 1A0NB 1FJGT 3EFOA 5KYUB 1B34A 3UA7A 3FZHB 2RN8A 2AIRB 3CBMA 4FYYB 3H6ZA 1HFAA 3O4XE 1B07A 4M78D 1JBMA 2YINA 3GMIA 4UR9A 1ZX6A 4PK6A 2UUCT 1UGRB 2E3IA 3CPWP 2YDQA 1YCSB 2RHXA 3JCMW 1NEBA 2E12A 2RQRA 4C5HA 1T3LA 1HG5A 4H9SE 2E65A 3PV0F 1ZSZC 5KE3A 3CMLA 3GN5A 2OJ2A 3TLSA 2CRBA 3JB9F 2QQAA 3P4QA 2MPKA 4HFBA 1Z8UA 2YOEA 4TWHA 4XTVA 5KMGP 4MLKA 4C91A 2RHZA 1SRMA 1X6OA 4JDSA 3CCUQ 5HCKA 1GFDA 1NBEB 1UGSB 1QCNA 4N4HA 2RB6A 5IYZE 5FYMA 2VGMA 3FJPA 2KK4A 2UXXB 3RQUA 2FO0A 2QGSA 4X62T 4KT0E 4M7AD 1VOMA 3WI3A 1YP5A 2OTLT 1WHJA 1H641 3LWHA 4BD3A 3QIIA 4QKNA 1M1KC 1VYTA 5GAMd 4ZI3C 3JV3A 3UU3A 4DV7T 3PVQA 3RKYA 2X4WA 1I8FA 3L09A 2ZM2A 2AT1B 3CMEQ 3RYHE 4DR7T 4K0KT 4IL4A 4AKHA 1AVZC 2FEIA 1EX4A 3IEEA 5KH6A 1KC8U 3NZQA 3HR0A 2K4YA 2CLYB 4JPBW 3JCMQ 3OQ5A 1Z0PA 3ZEFB 4FIBA 3JCFA 5KXJA 4P1NA 4IDNA 4BJNA 2HD0A 2LCSA 1VQ4Q 3CCMA 5I21A 2QQ9A 4AFSC 4H9OC 2KGTA 2JQQA 5GAN3 3EGXA 1WGSA 2QYWA 2WU2A 1Q7YR 5LBQB 2JZ2A 3W15B 3NVOA 2GK9A 4MMLA 2UXNB 1VQOT 4IE6A 5FKYA 2B8AA 5L3DB 1NLPC 3A8LB 1GQEA 3QKJA 3I9QA 2VQET 2ZZDA 3CC4A 3S3OA 1TUCA 2B76A 2V8IA 3CCUT 3Q9DA 2XI9A 2PTFA 5FWBA 4UIGA 1PRMC 4QH5A 3FDRA 3CBOA 4J6XA 1QVFP 1XNRT 3U23A 2CDTA 3ASKA 3PUAA 2DZ9A 2C5KT 5GMKe 1R8OB 4BI4A 4UVCB 2Y90A 3LX7A 1E1HB 5IXBA 4Z8XA 4KUDK 2MOZA 4F14A 2YRVA 2CMRA 4LDVA 4E7SA 2VWFA 4Y91A 3EHRA 2O88A 1WXTA 3M0PA 2YN6A 1VQ8Q 3O1IA 2PTKA 4OB3B 2QEXA 4M77F 4ZI7E 4H9QC 4XBFB 2ABLA 1M3AA 2EHOC 2GF7A 3H8ZA 1YJWA 1WIEA 4KGVB 3VYGA 3RMQA 1W0AA 2V5CA 1M3BA 3MKDA 3CCRQ 1IZNB 2MWPA 2W67A 1XNQT 3AEBA 1QP3A 2RHYA 5EK3A 1D0YA 2W2UA 3I9WA 4CXXA 1VQNT 3MP8A 4M7DE 3G71T 4BI3A 2LQNA 2M0OA 4LE9A 4M7DB 4JJNK 3HRTA 1HG2A 3LBXB 4J8OA 3CMAQ 4A4EA 2HQHA 4YSXA 2DL5A 2P0KA 1W0BA 4M75C 1UK5A 3TCJA 2K48A 2QGGA 1MMDA 1IBKT 2MPXC 3QYGB 2IC6A 3ZMTB 4J6YA 1K4US 5I2MA 1K8AU 1VQMA 1UFFA 1PKTA 4HVWA 2DYBA 3AE5A 5LGNB 2HCKA 3A8GB 2BG9C 3JRZA 1WFDA 2VB6A 4V1Av 2JUFA 5DJQC 2BZYA 1SHFA 4A5XA 1M2VB 2A0FB 1WDXA 4KRTA 5GANe 2RI5A 5JR9B 3VRZA 5AQQB 5AQKB 3CD6A 4FW1A 2EQMA 4JLGA 2YUPA 4OB1B 1Y96B 1WYBA 1O3XA 4IE0A 3VS4A 4ERRA 5KE2A 1QLBA 4M75D 3GBQA 1BCOA 1K73U 3E2UA 1WX6A 1VQ9A 1TU0B 2DXBA 3OW2S 2HH7A 4LFCT 5LJ5f 2K24A 1QP2A 3C4XA 2R58A 3M53A 3ER0A 2BKNA 2F69A 3SWNC 4WNKA 3TLTA 1YI2A 1X69A 4AFUC 3CMAT 3LGFA 2KSSA 1CKBA 5HAXA 2RHUA 4FCYA 5LXTE 4C92E 3OS2A 1KC8C 5HXHA 2E64A 5DQVA 3RKGA 2MIOA 2H89A 1AOJA 3K3QC 1IGQA 1QLYA 4C92B 2DXUA 2FPFA 4KX6A 3A1PA 2SEMA 1J1JA 3OYDA 3I0OA 4ZGEB 5IHKA 2YWWA 1WRDA 5HXRA 3INZA 3JB9D 3NMZC 5GMKi 1GBQA 2Y4YA 3PUXF 3BW1A 2KMTA 4M78A 4C0DB 2EWNA 3MO8A 1ZBXA 2M16A 4PJLA 1ZOYA 3UPUA 4OP0A 1VUBA 2RK1A 3EAEA 3LSVA 4Z88A 1Z9ZA 3N5BB 3AHUA 4QXCB 1ZBJA 5FVLA 1JRIA 2ZCFB 1E7PA 2CSIA 2I6HA 2IHR1 3Q5XA 4ILAA 5FU6B 3EGDB 2XDBA 3UT5E 2RH2A 3UA6A 1QWEA 3CCQT 3A98A 5FRNA 2KT9A 3CIRA 1WA7A 3DB3A 3MHXA 2V6YB 4YSZA 3AE1A 2H7VC 5L3FB 1UUEA 2YUOA 4LN2A 4O2AE 2UUAT 2KROA 4M7AA 1G3YA 2BVLA 2W00A 4EOZB 4DBRA 2KNBB 4LF7T 2CP3A 5FRMA 1KQ2A 2KXPB 4A4GA 4TVRA 4CI3B 4U2ZA 2CT4A 2LHRA 1ZLMA 5J26A 4ZS3A 3VS7A 2A9UA 2V6XA 2KE9A 4E7JA 3UQ4A 2QA4A 3V7CA 1SHZC 1FXXA 7AT1B 4ANJA 3KFVA 2Q9QD 3OJAA 2EQKA 2GFUA 2MYSA 3VS5A 3RI5A 3N9MA 2D5UA 4UV8B 3CD6T 4U33A 2JS2A 1KIKA 2K9AA 2VVSA 2EAYA 2IW5B 3SEMA 5C8YE 3QXEB 2LX7A 2F1LA 2KNDA 3SFDA 3MA9A 4OB2B 1WHMA 1VQPA 2IG0A 2RJDA 1V29B 3OYZA 5GAN6 1FWZA 2FRYA 2P9BA 3KBGA 3H37A 2OAWA 1QVGP 4KI0F 2JIWA 1M9SA 2LT1A 2RJFA 4ESRA 2LZ6B 5CKDA 4J9EA 3I55Q 4DBFA 1BIAA 1NE8A 5D6XA 4B6MA 3KBTA 4H63H 1YITQ 5GAMh 4M77D 4OHFA 2K5IA 2XQ6A 2BKPA 5J0ZA 3THKA 1K8AC 3REAB 1S1NA 3RPUA 4A56A 4MDXA 2R6GF 2ATCB 2M51A 2KDSA 1GCQC 4ISTA 4FJOA 4KUMB 3HI2A 4OB0B 1YJNA 4GKKT 3V8KA 4MDWA 4NUUA 4WYVA 3TSZA 1S72A 3CCLT 2NW7A 3CQGB 1D3BA 2OA5A 1WQWA 3EH2A 3BFMA 1YIJT 2JM9A 1Y71A 1UX4A 5CGMA 1OZ3A 4JYAT 2LRLA 2X35A 4IUVA 4WW0A 3L1AA 3I56A 4QVZA 1K73C 5HYAA 1KQSP 1KNPA 3MZKB 5CKBA 1QCFA 4E7IA 2RM4A 4FW2A 3CC2T 1RAGB 3OTOT 3T8OA 2LJ3A 4O4JE 5AQUB 2LDMA 5CFBA 4HGAA 3R6NA 5LMUT 5GAN5 4FYVB 2D6FA 5AQGB 4FM4B 3VUBA 2E9XB 5EZYE 2J4GA 2P0QA 1U1SA 5GJVB 1ZV4X 2OTJT 3ANWB 1LOJA 3I55T 5M9OA 4DR6T 5FW9A 1W70A 5IAYA 4DQ2A 2RQWA 1T98A 2FBWA 2I0NA 1RLQC 2F2VA 1T72A 5D6YA 1KFZA 4JUYA 2IDOB 2X3WD 1UECA 2BTTA 1ZA1B 3LK2B 2H3RA 1RABB 2IIUA 4RTWA 3OPCA 3GNFB 2PU9B 3C4WA 2P84A 3JCMg 5GAOn 2A7YA 1IJ6A 3K1SA 4HTEA 4P0AA 4QQDA 5FY1A 1W1FA 1K0XA 3CCSA 3PTRB 2ACXA 2D2SA 1HXDA 5AQLB 3QUJA 5GMKm 1D0ZA 1OWAA 2EJ9A 1KK7A 2O31A 3ME9A 4YHJA 5FU7C 2JM8A 1OV3A 1W2BP 3E9FA 5JDGA 4ZS2A 5LJ3d 4AIUA 2K5FA 4M78F 4YHHT 4M75A 2NWBA 3O8VA 1PHTA 4CN1A 2DTIA 3CCVT 4LDXA 4PFPA 1BU1A 1KHIA 1W4SA 3G6EA 2EPDA 1K8AR 4DR5T 1RUWA 3PU8A 2DBKA 2L3SA 3S3MA 1HNWT 2UXCT 2XHEB 3CKDA 5A0DA 5LJ5d 3HA4A 3HKSA 4GLKA 2YUQA 5HWYA 2ZPGB 3N9OA 4DR1T 1E6GA 5KCHA 3Q5WA 2WQYA 1HCIA 1TXQA 2R5MA 1N6AA 3L39A 1W6XA 1CUNA 1BR4A 2J06A 3VU3C 4XU0A 4FT2A 5GAMj 3GPLA 2CWYA 2RO0A 4BUGA 2FPEA 4HKAA 3Q1JA 4FL6A 4U72A 5J39A 2X68A 1N32T 5LJ3g 1K73R 3CCJA 2OV9A 3JB9H 3AE8A 4C8QE 3CQTA 2XQ5A 5JH7E 3VU7H 3FLGA 4C8QB 4JRKA 1KG1A 3OBVE 2L8DA 4RKUE 3UUMA 3V5SA 2KQWA 1PNJA 4TV8E 4HFIA 1U8RA 3HTRA 5FP3A 2YT6A 9ATCB 3CXCP 2LSIA 1VQ6A 4TWFA 4ME7A 2JOYA 4NIQA 2PJQA 2P4TA 4JJDA 3RGLA 2E70A 3ZC0A 3H9NA 1MIWA 2FHDA 4AQYT 2CP0A 4LUDA 3UDCA 3OYFA 3M54A 4ZN1A 2MAWA 3H3MA 4COFA 3TQ7P 1IHWA 2FJBA 4J9GA 5GAOl 2GCXA 3JAFA 2O4XA 2CUBA 3ZMZB 3MEAA 2ZPEB 4KULA 4EZ4A 5KYWA 1WYXA 4EYYR 2PZ1A 2RMOA 2ZPBB 2CP2A 4O2BE 1OYXA 1WHGA 1KEYA 2V7MA 2Y6XA 2DX1A 4H63V 4UELA 1U1TA 3JCMJ 3HKDE 3P4RA 2J05A 4RTUA 3SS1A 1M1KU 3C12A 4IIJE 4UEMA 3EG9A 4K11A 4VUBA 3VR9A 4PAGA 3ZN1B 4YT0A 4GK5E 2VWAA 5FNVE 4DV5T 2Q9QA 2QQSA 2UUBT 2L0AA 4LF8T 4GIWA 2DA9A 3RC8A 1WQ7A 1H7CA 4DUZT 4E7ZA 1HR0T 4IUQA 2D9TA 1AJ3A 4ZI2C 1M90U 4OGEA 1AWXA 2VC8A 3K8PC 1TWBA 3QBYA 4XTWA 1IO6A 5F3JA 4RTXA 4IREA 2DIGA 3QUIA 4G2AA 2IVWA 5KYYA 1NLOC 3F2EA 3PUSA 5L4HA 3GOXA 5JRCB 1BR1A 1P92A 2CREA 3OYJA 4IE5A 4XU3A 2XMFA 3PIPA 5CA0E 1UGVA 5LCYA 3RKWA 1FMWA 1DJ7B 5AT1B 1OEDC 5IT9E 3CC7T 1R0BG 2F2XA 4M77A 3QSUA 4KH1B 2JJ9A 4BAYB 3T9NA 4N4GA 3X26B 1VQ5A 3BQLA 5F5WA 2WM9A 4C0GA 5GAN4 4U31A 4OK0A 2XAJB 3N5LA 1G83A 4OMOA 2M6BA 1W09A 4JLIA 1SSHA 3VV0A 4A63B 2I0MA 2A28A 3JADA 3QB5A 2RJCA 2CXLA 3HSBA 4TV9E 2PVGB 3EUHA 3PIOA 4PFOA 3RBBB 3NBXX 4YSYA 1U06A 4DNDA 1XJWB 3EG3A 1XZYA 4DV1T 1Y07A 4DOWA 2ESWA 1MIYA 1NEGA 5ABFA 3V5UA 1RAEB 1ZSZB 1VQ7Q 4M78C 2BVMA 2G6FX 2CCQA 2E10A 4F6RC 4PL6A 2JMCA 2V1QA 4LDYA 2XQ9A 4WBNE 3GP8A 3UU8A 3FHNA 3M56A 3OYKA 1FIOA 1UGOA 3HL8A 4PJOD 4J9IA 1ZA2B 2C06A 4LMJA 2DERA 3C4ZA 2DILA 2VKNA 5H6RB 5AQMB 4QXHB 5HWXA 4X64T 3L2WA 1IZ6A 1M7KA 2YKSA 3OYCA 3O1JA 2BZBA 2K6DA 2NW9A 2DL1A 1OULA 2V8KA 4E7KA 4M7AC 2R57A 2VV5A 1IBLT 4DR2T 2QDYB 2KXCA 2DK3A 3OVUA 3J7AF 1E7OA 2NUTB 1R0CB 1AT1B 1OU9A 3FZLB 4EIWA 4DBQA 2AKKA 2QRXA 4GYRA 1VQKA 3F31A 2DVEA 3RDVA 1GRIA 2HPJA 3QO3A 3CMEA 1VQOQ 5DQWA 1VQ7T 2LRKA 1WCRA 2JNGA 4XTXA 2JS0A 2O9VA 1X6GA 1G5VA 4H9PC 4P5NA 5JDNA 2QYZA 3QZ5B 5HEGA 1WJSA 4X66T 1VIEA 4J83A 1ZSGA 3GF5A 1VQ4A 2JPFA 3UUXB 4IDQA 2KAFA 1OOTA 4RG2A 4P09A 1OPKA 3AA0B 1TSFA 4RG8A 5CK9A 3ZFJA 4JJCA 3E19A 5LBMA 1SEMA 1WXBA 4AISA 4UC4A 1H3ZA 2VK9A 1KNRA 2KY9A 4ZZCA 1YKHB 4M78G 2YHTA 1G8XA 5A2QE 5GANd 1TOVA 2JMHA 1M3CA 1BI0A 1J5WA 4WTOB 1Y7XA 2CEAA 2RPNA 1TG0A 2AE9A 1M90C 2YRCA 3HRUA 4I43B 3IF8B 4CZZB 1BI2A 2DRMA 4L0RA 5HEOA 2HAXA 5KDMC 2EHOB 3OYBA 5LJ3h 4JS4A 5JDLA 2LOPA 3M0QA 4DIDB 2QAZA 3IBPA 3V8JA 1N8RU 1K0SA 5L3EB 2VGNA 1RACB 2WCAA 3FXEB 3LG7A 1C1AA 5AFUL 3QDFA 4TNVA 5JDHA 2BZXA 1VQNQ 3G71Q 3ZMSB 2ZPIB 1SG5A 2NP9A 4U74A 1B3QA 6AT1B 4II1A 1VQ8A 2CP7A 1ZEEA 2EYQA 1N5ZA 1YD8G 4EYUA 2P0PA 5LJ5h 4M7AG 1SSFA 3P4WA 3ZKRA 2KINB 5EK4A 3ZJ1A 4M75E 4QXBB 5GANg 5KCOA 3QJYA 5L3BB 3CCRA 4M75B 5FXVA 4R0KA 4NXMT 4FYWB 3ZMVB 4OMQA 5TAOA 3RUXA 4ATOA 3J9X1 2LNHB 1M62A 4EZHA 5FL0A 2BG9E 1D09B 4PNIA 1M2OA 1KJWA 2DVJA 2BG9B 2FZCB 5L4EA 3RX6A 3JCMf 3M5AA 3CCMQ 5IHYA 3D0TA 4YJ2E 3BDLA 3QWXX 2E5LT 2DIQA 1VIFA 2HNIA 3GNGA 3JSCA 3L8RA 3EFRA 1G73A 5JREA 4Y28E 1I0CA 2LJ0A 5L2LA 2E5KA 3LK3B 4A98A 2ROLA 2KXDA 2RJEA 4HCBA 4IHJE 2V1RA 2XSAA 2WWUA 3MK7C 1RADB 4A53A 4LMLA 2G3RA 2MMPA 3QNUA 1EZZB 4CI1B 3AB3B 1M1FA 2H8HA 4J9FA 4HT9A 1I4K1 3E0ZA 1N33T 4OFZA 3WVEB 1M1KR 4HEAA 3DLLA 4JI4T 2D0UA 5ADXL 2DXCA 2RA2A 3HFNA 1XTDA 3ZSTA 3SWNB 5KYXA 2V7JA 1QVFA 3JAEA 4Z89A 2WU5A 1XNIA 4QH1A 4XQ3A 3EDUA 4UF0A 2JTEA 3U3IA 3URGA 2JTFA 5LG3A 2RPAA 1OPLA 2MI6A 3KVAA 1LPLA 3CCEA 1E6HA 3P50A 1QWFA 1ZUYA 1K1ZA 1M90R 1ZUKA 4RTVA 3B57A 3OYHA 3UU6A 3LH0A 2LP5A 3A5XA 3ONLC 3ZJ2A 1YJ9A 3WVDB 2QEXQ 2J47A 1PKSA 2KSRA 3LLRA 2COWA 4B9WA 3KVBA 2Y4XA 4HXJA 5CAIA 2PFVA 4LUEA 3CCMT 5IN1A 4TN7B 4NXNT 2LX9A 4AKIA 5LJ3f 1X43A 4EIKA 5ECAA 2UXDT 3VRBA 5A0LA 2EW3A 3EHQA 3EG0A 3N9QA 5FY0A 3RESA 4EDUA 1OEDA 2DEUA 5DM7R 3DP7A 5GAMe 2LJ1A 3KXTA 4ILBA 1NWMX 2I2LA 2CHNA 1YFNA 4IUUA 4DBHA 1ZHCA 2CZ6B 3CC4T 3H41A 3WAJA 5LJ3j 3CCQQ 5FXWA 3AE3A 4PW8A 2KI7A 4DA4A 3PJAJ 2J6KA 4IGUA 1MV3A 1R77A 4PJOA 2DTOA 3AA7B 1IREB 2C0SA 3JCMV 3OKQA 3LW5E 4NS5A 5LJ5j 2CP5A 1OZ2A 2C5JA 2K3BA 3C95A 4GYSA 1VQMQ 1PRLC 2XU8A 4DEXA 4BI8B 1OEBA 2QQBA 4M77E 3OW2P 1XMOT 1Q81U 2CBJA 4O4IE 3AEGA 3MP1A 4C5IA 2QEXT 3R84B 4JI6T 1N8RC 4N0AA 2LMJA 4Z91A 4TUYE 2Z6EA 1J5ET 3OBYA 2KMFA 3CD6Q 1YJWT 4JRIA 3H0IA 2WAUA 1BKBA 4L6V5 2HHHT 3OS0A 1HJDA 4M75G 2ED0A 3QG1A 3LGLA 1UURA 2RQTA 3F70A 4CC2A
chains in the Genus database with same CATH topology
2Q9QC 2DLRA 1NPPA 2W62A 5CQXA 4ZHQE 3NZPA 3FIFA 3MP6A 3NTKA 5GMKh 4XK8E 2OAUA 1WLXA 2LEHA 3O1HA 4ZGDB 4HA8A 4M7DD 1U5PA 4QQ6A 4N4IA 5FXXA 3KV5A 2GQVA 2RHIA 3CX6B 2XUEA 4PJNA 5J2TE 1JB0E 2IC9A 3NRYA 1YW0A 2RP4A 5LA6E 2MTQA 3JB9G 4E7HA 1D1BA 3VKHA 2WMOA 3ZPOA 3QDRB 1VQMT 2YLBA 3PUQA 5ETWA 3L3PA 1XOVA 3V7RA 5L3CB 1WJQA 5A0GA 2DKGA 4M77C 1BR0A 1M4ZA 2Y48B 5L3GB 1G3WA 3UT1A 1YITA 5FXZA 2PVOB 2LQKA 5KX5E 3PGGA 4X1KE 4F7UA 1B34B 2BIVA 1UGQB 3MEUA 2DCFA 2A3DA 4KBMB 3ONXA 4QQGA 1X79A 2XICA 2DI4A 4J7IA 4J5YA 2ODVA 4O6JA 1VQ9T 4H9RC 1M8VA 2K5LA 3OYYA 1YI2T 3P7IA 3GN5B 3KFWX 5CQYA 3ZLIA 2KLQA 3QK6A 3ESLA 2E8IA 5LHHB 3SFMA 4C92D 5GANh 1N27A 4JEUB 3FC3A 1MMGA 3F57A 4ZN3A 1FX7A 1GXIE 5CVIA 4BDZA 1IAPA 1HK9A 4IUTA 1MHNA 2YEVC 2BKDN 4PNOA 3OYAA 3JCMd 2CA5A 5DLQE 5FU7B 2VUBA 2DWKA 1BR2A 4YJ3E 3NRXA 5CA1E 4A4KA 2XASB 2CZ7B 2XAHB 3RH3A 5HK3A 2VASA 1Q82U 4FU6A 3A5ZB 4M77G 3ZYKA 2X67A 4PJMA 3UULA 2PG8A 1Q81C 3G4SA 4A4HA 4DO0A 2XAQB 1YHQA 2XD0A 3M59A 5LHIB 3MACA 3KUFA 4PJOF 2QA4T 2DAQA 5CKFA 4X9DA 3JCMX 5GAOp 2CS7A 1VRBA 5CCAA 4NL3A 3ZEHA 3JCMc 2CYZB 4B6XA 2E41A 3N2GE 4O4HE 1VQPT 4BB7A 3I0QA 2DD4A 2V7IA 2XQYA 5I2SA 2CWOA 3CQCB 2KZ7B 4HCCA 4QHOA 1US7B 4E7LA 4IKFA 2IAKA 5CO7A 5GANf 1YJNT 2VXFA 1EIFA 3I1AA 1S72T 5HXCA 2KWHA 4LD6A 4GK0E 3DB4A 1BI3A 2LCLA 2LSJA 2PQWA 2VKOA 3BQIA 2W63A 2LRQA 3AA1B 3NTIA 3I56T 2KVQG 1I5LA 2A2FX 4MFRA 4XU2A 1HX8A 2EQUA 5JQGE 3AVRA 5H6QB 5E0OA 3L2QA 2VKDA 3CX8B 4X9CA 4B9XA 2FL7A 1BI1A 3PTAA 5C0MA 2E9XD 3E9GA 4F7UF 2X9XA 3FBLA 4XTZA 4OYJA 4M7DA 2M67A 5LL6S 4N78D 3DLMA 4I50E 3LBXA 4BY6C 1XQHA 1WPYA 2QTXA 4MHCA 4I4TE 3QPHA 4G63A 1YHQT 2J1DG 1WNLA 3OYGA 2LOSA 3PMTA 3CCST 3RC3A 2JVVA 3JC6D 2L3RA 1NJIU 5LJNA 3OSVA 5BMVE 3M9QA 4XTUA 1OI1A 3EVYA 2CZ1B 2LTOA 3OMGA 1YBYA 4M78E 2XAFB 2GFAA 1Q82C 1Y96A 5A1LA 4M78B 4EMKC 5FMNA 3JAME 4ILUA 3G6ET 1K9MU 4J7FA 5J2UE 2MWOA 3ZYLA 5CKEA 3FRNA 1JJ2S 3L2RA 4ELZC 3MEVA 3SWHA 4JLEA 4OVAA 3OYLA 3RRWA 2X9WA 3QC9A 4C92A 2XK0A 4PJOC 4M7AE 4M7AB 1UGPB 3CCJT 2CM0A 2DPPB 5JVDE 1VQLA 2OTLA 3OS1A 4M1PA 4X34A 4WF2A 3OYXA 3IHRA 4IE7A 2RI2A 4C8QD 5LJ5e 3C64A 3RKOA 3LJCA 5DY9A 3C50A 1VQ6T 4CI2B 3EFSA 4N0AC 2ZGWA 3BK9A 1PSFA 1G3SA 2XTLA 3CBPA 5CIUA 1YKEB 4CXWA 2LT4A 4AXPA 5GAN8 1JJ2A 4UXNB 2QQRA 2ZM0A 2LM9A 1VQOA 4A54A 4Q5WA 1Q7YC 4IUPA 2X4XA 1LJOA 3HKEE 1D1CA 3CCUA 3HRSA 3CPWS 4OGCA 5LHGB 4LDUA 3OB9A 1RI0A 3M4GA 4XAXB 3JCMh 2EIFA 2VKJA 5D6WA 2QA7A 3A8OB 3RRCA 1D3BB 2CZ0B 2EJFA 3RYFE 5LG4A 3AAAB 1BIBA 3U78A 1QSDA 4ASKA 3A8HB 4R56A 2L3LA 2JTMA 4AQGA 4PJOG 5LNKA 4JRPA 5GMKl 1SA0E 3N9NA 2WSCE 5LYJE 3A8MB 2MAMA 1VQ5T 5HKCA 2LCCA 3K3OA 1NJIC 1VQNA 2E6ZA 5DLOA 3G71A 1I81A 4UVBB 4M7DF 3M57A 5GONE 3META 3FB2A 4I55E 2EQJA 1WJRA 4BA9A 1N9RA 1VQLT 1U4QA 2NTXA 3RYCE 4MZPA 3CPWA 3FBZA 4ADZA 5AYFA 4EXTA 3L42A 1D1AA 1MNDA 3X20B 2L89A 1K9MC 2EKOA 5LGTB 3AAEB 2HQXA 4C0FA 3ZBDA 1LVKA 1ZKEA 5M4YA 3OYMA 1QW1A 5C6SA 1NPRA 3OY9A 2E9XA 2DTHA 3HL6A 3QZ9B 1QVFS 3HFOA 4KMCA 4MZTA 3PURA 3ANWA 2F5TX 2E6NA 1NZ9A 4WBOA 2C5IT 1O9SA 4ZI3D 1KNZA 1B7TA 4MBQA 5GAMg 2NTYA 3OBWA 4QW2A 5GAOr 4L9IA 3M55A 4IURA 3CMAA 4YTLA 4RCCA 4F7UG 4X1YE 3WAKA 1VQKT 4C92F 4TX5A 3UTKA 3FXDB 3M58A 4K0UA 3CMET 3K3NA 4AKGA 3PMIA 2W61A 2WSFE 2CLYC 2K5BB 1Q86U 2ZPHB 5GAOq 2XDPA 1VQ4T 3RIRA 4A4FA 1N9SA 1LNXA 3VHLA 2NOXA 3P8BB 3ZYMA 3OYIA 3CCQA 4JS5A 3I9YA 1FMVA 2O4XB 3Q2MA 3RMSA 2H7OA 3PNWC 4EMKA 2XG8D 3V8LA 4E47A 2EJGA 2VYTA 4GY5A 5HY6A 2CE7A 3X28B 3E1SA 1AHJB 2EHOD 4C8QA 2LSKA 4FT4A 2LVMA 4DMVA 1UB4A 2WBLA 1MMNA 4BE0A 4IDZA 1IJ5A 2H3JA 4ISSA 4L5GA 2D0QB 1HF8A 2Q9QB 1VQ8T 4BACA 4MALA 1ZQ1A 3TREA 3DKMA 2X4YA 3L2VA 3SRZA 4RMOA 3LFMA 1LKXA 1MNEA 3CCRT 3VYHB 3ZN0B 3CX7B 4PK5A 3C51A 4QX7B 1UEBA 4M7DC 5HXEA 3AA6B 4UV9B 3BDUA 2Y8DA 2XDDA 4X20E 2HQEA 4M77B 2N1GA 3GWHA 5LGUB 4D6WA 3SOLA 2CGHA 2FB7A 4HN9A 3S4UA 1NAFA 3VJPA 4BDYA 2RA1A 3HPWA 3CCLA 3FEOA 3QHSA 2KWIB 4YLHA 4J2CA 4HT8A 5JDFA 1YIJA 3S3NA 5GAOm 5JR9C 5JRCA 1X75C 2K57A 4ZTFA 3P8DA 5GAN2 3CC2A 4ELYC 2DNXA 4IE4A 2YU1A 4C0ZA 2O01E 2DXTA 2WMNA 4X1IE 4PKCC 5CKHA 3CCET 4JRQA 2L9QA 2ZPFB 2LJLA 5LP6E 3M65A 3OW2A 1YJ9T 4CXYA 2E1HA 2OTJA 1OXZA 2N2NA 4QWNB 1KHCA 3I55A 2LQ8A 3ZCJA 5F8PA 2VXEA 2XAGB 2X4JA 4C92C 1YCYA 3CWZB 4UVAB 4BJMA 1Q86C 5FLXE 3KV9A 4HKEA 2V7LA 4C0DC 5JDMA 1UCUA 4QVDA 1QVGS 2A72A 3WXMB 1PSEA 2V8JA 3AVSA 4JEHB 4M7DG 4LDWA 3OA6A 2QXFA 2JN0A 1RL2A 3R6OA 3X24B 3CPFA 3E08A 5FU6C 3G7ZA 3JB9J 2L8KA 3CCVA 2LNVA 4PJJA 3LYIA 1HTJF 3PT9A 5GAN7 2X66A 3EDVA 3C94A 3M4YA 3HP9A 3MCAB 5FY7A 2YLCA 3KV6A 1KQSS 2PBIA 3N9PA 2VL8A 2M9UA 3ETUA 4AQFC 5HK0A 3H3AA 2WSEE 3NFCA 3DTOA 3L2UA 3SDZA 2ZM8A 3N9LA 2DEQA 4ZTJA 3BQKA 4NL2A 2V26A 2DWGA 3MJXA 2LE8A 4DMWA 4RCBA 4XZCA 4HE8A 4FSXA 4MZMA 3SD4A 1KD1U 1QVGA 2B1EA 5J1GA 2JMKA 4C8QF 3ZMUB 1EZ3A 5GMKj 1M1GA 3QYHB 2LHNA 4O8SA 4QVCA 4C92G 3OS5A 2BUDA 3PUGA 4MMKA 4PLLA 4AKRB 2LSGA 3CPZA 3ZC1A 2W0GA 5CB4E 5CR2A 3VKIA 3PDYA 2YU2A 3GA8A 1KQ1A 3JB9I 2DHRA 2DD5A 2RD1A 3CQXC 3S6WA 1YITT 5FROA 2CXDA 1UX5A 1W2BS 4EPCA 1KQSA 2AHJB 3P8CD 2BDEA 3E22E 1X01A 4EB6E 2EHOA 2V1DB 4XU1A 2NLUA 3UWNA 3PU3A 3TEEA 2G0UA 3J7Yq 2LC4A 3TKLB 1MIVA 3RYIE 3AAIA 4GOUA 2X9YA 2YK0A 3KV4A 2X9HA 2RI3A 2XHCA 2R5AA 2XIDA 1M5Q1 4BY6B 5J3BA 4FI5A 4KP3C 2SPCA 2HBPA 2F5KA 4PLIA 2E9XC 3UUNA 3N2OA 4DVDA 1ZHIA 1QVPA 4C5GA 4H9NC 2N9DA 2K2VA 5LJMA 2DO3A 4L59A 5GAMf 4UF0B 3CC7A 1Q7YU 3OSSC 3NTHA 5GANj 1G3TA 3J81E 4BE2A 3B13A 4CI0C 5HXSA 4EMGA 4NOYA 1W2BA 2EFIA 3CXCS 2A3LA 2DJZA 4J6WA 4ZGJB 3P8HA 3JC6C 4EMKB 3CEYA 4M7AF 2K3XA 2WACA 3L2ZA 2ZMAA 1MGQA 2LSYA 4Z02A 5EG2A 2M1HA 2WSSV 3SWNA 3QJ6A 2HPLA 4LD9K 4TZ4C 2JRKA 3GIBA 3CVRA 4BE1A 2D0TA 3BY7A 4O5VA 5L8RE 5LJ5g 3G4ST 2MF2A 3JCMe 5DABA 3LWIA 4EAHA 4PJOE 4PJOB 2X0LB 3V7SA 2FVUA 1WYCA 4YFSA 2VKHA 3SB2A 4ZOLE 3TU4K 1KD1C 5JR9A 2V7KA 3GLXA 3J80E 3RERA 3CXCA 2MBGA 4DOVA 2ES0A 4CQIA 1FEWA 2X51A 1WR6A 2FYKA 2ZLYA 3KINB 4C8QC 4AI6A 3C4SA 3HHTB 3OMCA 2LT3A 1Y64B 1VQ7A 4R55A 3ZCIA 3KBUA 4HCZA 2ODUA 2E5QA 4AKLA 2DZCA 4JUVA 5LJ3e 4PK4A 4C5EA 3KDSE 1TH7A 3MEWA 2XKOC 3OYNA 2K3YA 1S35A 2QI2A 5JDQA 4QX8B 2PVDB 2NW8A 3JCMb 2RK2A 1LVFA 3HKCE 5LOVE 4XTYA 3N2KE 4KUIA 5EK2A 2PUKB 4C90A 3UFEA 4ZI2D 4O4LE 1BYMA 4V2SA 1HS7A 3LK42 4F7UE 4EMHA 2CKKA 2CXFA 3C98B 4F7UB 3DJBA 3FB9A 3OYEA 4CRIA 1LRZA 4OMFB 3X25B 4OF1A 3HKBE 1D0XA 3ETVA 3RKXA 3VUZA 4OYKA 1QUUA 3MXZA 3JCMP 3PFSA 4AQFA 1MMAA 1S94A 3VKGA 2PUOB 3O9XA 1V9DA 4P0BA 2L5QA 2I59A 1O75A 4NUVA 4C8QG 4HFVA 4M75F 3PE0A 1B34A 3CBMA 3H6ZA 1HFAA 3O4XE 4M78D 1JBMA 2YINA 3GMIA 4PK6A 1UGRB 2RHXA 3JCMW 2E12A 4C5HA 2E65A 1HG5A 4H9SE 5KE3A 3CMLA 3GN5A 3JB9F 2QQAA 4XTVA 5KMGP 4MLKA 4C91A 2RHZA 1X6OA 4JDSA 1UGSB 4N4HA 2RB6A 5IYZE 5FYMA 2VGMA 3FJPA 2KK4A 2UXXB 4KT0E 4M7AD 2QGSA 1VOMA 3WI3A 2OTLT 1H641 3LWHA 4BD3A 3QIIA 4QKNA 1M1KC 5GAMd 4ZI3C 3RKYA 2X4WA 1I8FA 3L09A 2ZM2A 3RYHE 4AKHA 3IEEA 5KH6A 1KC8U 3NZQA 3HR0A 2K4YA 2CLYB 3JCMQ 3OQ5A 1Z0PA 3ZEFB 4FIBA 4BJNA 2HD0A 3CCMA 5I21A 2QQ9A 4H9OC 2JQQA 5GAN3 1WGSA 5LBQB 2JZ2A 3W15B 2GK9A 4MMLA 2UXNB 1VQOT 4IE6A 2B8AA 5L3DB 3A8LB 3QKJA 2ZZDA 3CC4A 3S3OA 2V8IA 3CCUT 3Q9DA 2XI9A 4UIGA 3FDRA 3CBOA 4J6XA 3ASKA 3PUAA 2DZ9A 2C5KT 5GMKe 1R8OB 4BI4A 4UVCB 2Y90A 3LX7A 1E1HB 4KUDK 4Z8XA 2MOZA 2YRVA 2CMRA 4LDVA 4E7SA 4Y91A 3O1IA 4OB3B 2QEXA 4M77F 4ZI7E 4H9QC 4XBFB 2EHOC 2GF7A 3H8ZA 1YJWA 3VYGA 3RMQA 3MKDA 1IZNB 2MWPA 1QP3A 2RHYA 5EK3A 1D0YA 3I9WA 4CXXA 1VQNT 3MP8A 4M7DE 3G71T 4BI3A 2M0OA 4M7DB 4JJNK 3HRTA 1HG2A 3LBXB 4J8OA 4A4EA 2P0KA 4M75C 3TCJA 2K48A 1MMDA 3QYGB 2IC6A 3ZMTB 4J6YA 5I2MA 1K8AU 1VQMA 5LGNB 3A8GB 3JRZA 2VB6A 4V1Av 2JUFA 5DJQC 5GANe 2RI5A 5JR9B 3CD6A 2EQMA 4JLGA 4OB1B 1Y96B 1WYBA 1O3XA 4IE0A 4ERRA 5KE2A 4M75D 1K73U 1VQ9A 2DXBA 3OW2S 2HH7A 5LJ5f 2K24A 1QP2A 3C4XA 2R58A 3M53A 3ER0A 2F69A 3SWNC 4WNKA 1YI2A 3CMAT 3LGFA 2KSSA 5HAXA 2RHUA 5LXTE 4C92E 3OS2A 1KC8C 5HXHA 2E64A 5DQVA 3K3QC 4C92B 2DXUA 3OYDA 3I0OA 4ZGEB 1WRDA 5HXRA 3INZA 3JB9D 5GMKi 2Y4YA 3BW1A 2KMTA 4M78A 4C0DB 2EWNA 3MO8A 1ZBXA 2M16A 4PJLA 3UPUA 4OP0A 1VUBA 2RK1A 3EAEA 3N5BB 3AHUA 4QXCB 1JRIA 2ZCFB 3Q5XA 5FU6B 2XDBA 3UT5E 2RH2A 3CCQT 5FRNA 2KT9A 3DB3A 3MHXA 2H7VC 5L3FB 4O2AE 4M7AA 1G3YA 2BVLA 2W00A 4EOZB 4DBRA 5FRMA 1KQ2A 2KXPB 4A4GA 4TVRA 4CI3B 2LHRA 5J26A 4ZS3A 4E7JA 2QA4A 3V7CA 1SHZC 1FXXA 4ANJA 2Q9QD 3OJAA 2EQKA 2GFUA 2MYSA 3N9MA 2D5UA 4UV8B 3CD6T 2K9AA 2EAYA 2IW5B 5C8YE 3QXEB 2KNDA 3MA9A 4OB2B 1VQPA 2IG0A 2RJDA 1V29B 3OYZA 5GAN6 1FWZA 2P9BA 3KBGA 3H37A 1M9SA 2LT1A 2RJFA 5CKDA 1BIAA 1NE8A 5D6XA 3KBTA 4H63H 5GAMh 4M77D 4OHFA 2K5IA 1K8AC 3RPUA 4A56A 4MDXA 2KDSA 4ISTA 4FJOA 4KUMB 3HI2A 4OB0B 1YJNA 3V8KA 4MDWA 4NUUA 1S72A 3CCLT 2NW7A 3CQGB 1D3BA 2OA5A 1WQWA 3BFMA 1YIJT 1Y71A 1UX4A 1OZ3A 2X35A 4IUVA 4WW0A 3L1AA 3I56A 4QVZA 1K73C 5HYAA 3MZKB 5CKBA 4E7IA 2RM4A 3CC2T 3T8OA 4O4JE 2LDMA 4HGAA 3R6NA 5GAN5 2D6FA 4FM4B 3VUBA 2E9XB 5EZYE 2P0QA 1U1SA 1ZV4X 2OTJT 3ANWB 1LOJA 3I55T 5M9OA 5IAYA 4DQ2A 1T98A 5D6YA 4JUYA 3LK2B 2H3RA 3GNFB 2PU9B 3C4WA 3JCMg 5GAOn 2A7YA 1IJ6A 4HTEA 4P0AA 4QQDA 5FY1A 3CCSA 3PTRB 2ACXA 2D2SA 1HXDA 5GMKm 3QUJA 1D0ZA 1OWAA 2EJ9A 1KK7A 3ME9A 4YHJA 5FU7C 3E9FA 5JDGA 4ZS2A 5LJ3d 2K5FA 4M78F 4M75A 2NWBA 3O8VA 2DTIA 3CCVT 4LDXA 4PFPA 1W4SA 1KHIA 3G6EA 3PU8A 3S3MA 2XHEB 3CKDA 5A0DA 5LJ5d 3HA4A 3HKSA 4GLKA 5HWYA 2ZPGB 3N9OA 5KCHA 3Q5WA 1HCIA 2R5MA 1N6AA 1CUNA 1BR4A 3VU3C 4XU0A 4FT2A 5GAMj 3GPLA 2CWYA 2RO0A 4BUGA 4HKAA 3Q1JA 4FL6A 4U72A 5J39A 2X68A 5LJ3g 3CCJA 3JB9H 4C8QE 5JH7E 3VU7H 3FLGA 4C8QB 4JRKA 1KG1A 3OBVE 2L8DA 4RKUE 3UUMA 3V5SA 2KQWA 4TV8E 1U8RA 5FP3A 2LSIA 1VQ6A 4ME7A 2JOYA 2PJQA 2P4TA 2E70A 3ZC0A 1MIWA 2FHDA 3OYFA 3UDCA 3M54A 4ZN1A 5GAOl 2GCXA 2O4XA 3ZMZB 3MEAA 2ZPEB 4KULA 4EZ4A 4EYYR 2ZPBB 4O2BE 1OYXA 2V7MA 2Y6XA 4H63V 4UELA 1U1TA 3JCMJ 3HKDE 3SS1A 1M1KU 3C12A 4IIJE 4UEMA 4VUBA 3ZN1B 4PAGA 4GK5E 2VWAA 5FNVE 2Q9QA 2QQSA 4GIWA 3RC8A 1WQ7A 1H7CA 4E7ZA 4IUQA 2D9TA 1AJ3A 4ZI2C 1M90U 4OGEA 2VC8A 3K8PC 4XTWA 3QBYA 5F3JA 2DIGA 3QUIA 4G2AA 2IVWA 3F2EA 3PUSA 3GOXA 5JRCB 1BR1A 1P92A 3OYJA 4IE5A 4XU3A 3PIPA 5CA0E 5LCYA 3RKWA 1FMWA 1DJ7B 5IT9E 3CC7T 3QSUA 4M77A 2JJ9A 4BAYB 3T9NA 4N4GA 3X26B 1VQ5A 3BQLA 4C0GA 2WM9A 5GAN4 4OK0A 2XAJB 3N5LA 4JLIA 3VV0A 2RJCA 2CXLA 3HSBA 4TV9E 2PVGB 3EUHA 3PIOA 4PFOA 3NBXX 4DNDA 4DOWA 1Y07A 1MIYA 3V5UA 4M78C 2BVMA 2CCQA 2E10A 4F6RC 4PL6A 4LDYA 4WBNE 3GP8A 3M56A 3FHNA 3OYKA 1FIOA 3HL8A 4PJOD 2C06A 3C4ZA 5H6RB 4QXHB 5HWXA 3L2WA 1IZ6A 3OYCA 3O1JA 2BZBA 2NW9A 2V8KA 4E7KA 4M7AC 2R57A 2VV5A 2QDYB 2DK3A 3J7AF 4EIWA 4DBQA 4GYRA 1VQKA 3F31A 2DVEA 2HPJA 3QO3A 3CMEA 1VQ7T 5DQWA 2JNGA 4XTXA 1G5VA 4H9PC 4P5NA 5JDNA 3QZ5B 1WJSA 1VIEA 4J83A 1VQ4A 3GF5A 2JPFA 3UUXB 2KAFA 4RG2A 4P09A 3AA0B 4RG8A 5CK9A 3ZFJA 3E19A 5LBMA 4UC4A 1H3ZA 2VK9A 2KY9A 1YKHB 4M78G 2YHTA 1G8XA 5A2QE 5GANd 2JMHA 1BI0A 1Y7XA 2CEAA 1M90C 3HRUA 4I43B 3IF8B 4CZZB 1BI2A 4L0RA 2HAXA 5KDMC 2EHOB 3OYBA 5LJ3h 4JS4A 5JDLA 2LOPA 3IBPA 3V8JA 1N8RU 5L3EB 2VGNA 3FXEB 3LG7A 5AFUL 5JDHA 3ZMSB 2ZPIB 2NP9A 4U74A 1VQ8A 4II1A 1ZEEA 2EYQA 1YD8G 4EYUA 2P0PA 5LJ5h 4M7AG 1SSFA 2KINB 5EK4A 3ZJ1A 4M75E 4QXBB 5GANg 5KCOA 3QJYA 5L3BB 3CCRA 4M75B 5FXVA 3ZMVB 5TAOA 3RUXA 4ATOA 3J9X1 4EZHA 4PNIA 3RX6A 3JCMf 3M5AA 5IHYA 3D0TA 4YJ2E 3BDLA 2DIQA 1VIFA 2HNIA 3GNGA 3JSCA 3EFRA 1G73A 5JREA 4Y28E 5L2LA 3LK3B 2RJEA 4HCBA 4IHJE 2WWUA 3MK7C 4A53A 2MMPA 2G3RA 4CI1B 3AB3B 1M1FA 4HT9A 1I4K1 3E0ZA 4OFZA 3WVEB 4HEAA 3DLLA 2RA2A 2D0UA 5ADXL 2DXCA 3HFNA 1XTDA 3SWNB 2V7JA 1QVFA 1XNIA 4XQ3A 3EDUA 4UF0A 3U3IA 3URGA 2JTFA 2MI6A 3KVAA 3CCEA 3B57A 3OYHA 3LH0A 3A5XA 3ZJ2A 1YJ9A 3WVDB 3LLRA 4B9WA 3KVBA 2Y4XA 5CAIA 2PFVA 3CCMT 5IN1A 4TN7B 2LX9A 4AKIA 5LJ3f 5A0LA 3N9QA 5FY0A 3RESA 4EDUA 5DM7R 3DP7A 5GAMe 3KXTA 1NWMX 2I2LA 4IUUA 3CC4T 1ZHCA 2CZ6B 5LJ3j 3WAJA 5FXWA 4PW8A 4DA4A 4IGUA 4PJOA 2DTOA 3AA7B 1IREB 2C0SA 3JCMV 3OKQA 3LW5E 4NS5A 5LJ5j 1OZ2A 2C5JA 3C95A 4GYSA 2XU8A 4BI8B 2QQBA 4M77E 1Q81U 3MP1A 4O4IE 4C5IA 2QEXT 3R84B 1N8RC 4N0AA 4TUYE 2Z6EA 3OBYA 2KMFA 1YJWT 4JRIA 2WAUA 1BKBA 4L6V5 3OS0A 4M75G 3QG1A 3LGLA 3F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT3 A;  4ILU A;  4MFR A;  2LT4 A;  4XAX B;  4L5G A;  2LT1 A;  2LQK A;  4KBM B;  4KMC A;  2EYQ A; 
#chains in the Genus database with same CATH topology
 2Q9Q C;  2DLR A;  1NPP A;  2W62 A;  5CQX A;  4ZHQ E;  3NZP A;  1CKA A;  1JU5 C;  3FIF A;  3MP6 A;  3NTK A;  5GMK h;  4XK8 E;  2OAU A;  3C0C A;  1WLX A;  2LEH A;  4YY3 T;  3O1H A;  4JBW F;  1UE9 A;  4ZGD B;  4HA8 A;  1YI2 Q;  4M7D D;  1U5P A;  4QQ6 A;  4JI3 T;  4N4I A;  5FXX A;  4PFZ A;  2W0Z A;  3KV5 A;  3NKZ A;  2GQV A;  4IT4 A;  2RHI A;  4IDP A;  3CX6 B;  4U7I A;  4WCI A;  3SHW A;  2XUE A;  4PJN A;  5C3J A;  5J2T E;  1JB0 E;  2F4V T;  1X27 A;  2IC9 A;  2ZM6 T;  2V8S V;  3NRY A;  4HWF A;  1MUZ A;  1YW0 A;  2RP4 A;  3AXJ A;  5LA6 E;  2MTQ A;  3JB9 G;  4E7H A;  1D1B A;  3VKH A;  2WMO A;  3ZPO A;  3QDR B;  3CCL Q;  1VQM T;  1BCM A;  2XPK A;  2YLB A;  3PUQ A;  5ETW A;  3L3P A;  1XOV A;  2QG9 B;  5L3C B;  1WJQ A;  1UTI A;  3V7R A;  3QB5 K;  2HN1 A;  2DKG A;  4M77 C;  5A0G A;  1BR0 A;  1YIJ Q;  1M4Z A;  2Y48 B;  5L3G B;  1G3W A;  1U3O A;  1X6B A;  3UT1 A;  4DV4 T;  1YIT A;  2KBT A;  5FXZ A;  1CSK A;  3B5M A;  3EFO B;  2PVO B;  1M30 A;  5KX5 E;  2LQK A;  2W10 A;  3PGG A;  4X1K E;  4F7U A;  4X65 T;  2VQF T;  2MK5 A;  5L23 A;  1B34 B;  2BIV A;  1UGQ B;  3CC2 Q;  3MEU A;  2VL0 A;  2DCF A;  2A3D A;  4KBM B;  2KRS A;  3ONX A;  4OMP A;  4QQG A;  1X79 A;  2CH4 W;  2XIC A;  2DI4 A;  4JI2 T;  2XSB A;  4IIM A;  4J7I A;  4J5Y A;  2ODV A;  4O6J A;  1VQ9 T;  4H9R C;  2D1X A;  1WHK A;  4IDO A;  1M8V A;  2K5L A;  2LM2 A;  2EYZ A;  2QDL A;  1VYU A;  4LF9 T;  3FZF B;  3OYY A;  4YTM A;  2X0Y A;  2RNA A;  2FPD A;  2OTJ Q;  1KC8 R;  1XDP A;  1PWT A;  4FYX B;  1YI2 T;  3P7I A;  3GN5 B;  3T1Y T;  2ECZ A;  3KFW X;  5CQY A;  1E2A A;  3ZLI A;  2KLQ A;  3QK6 A;  3ESL A;  5AQP B;  1PD1 A;  1RLP C;  2E2A A;  1V76 A;  4AG1 C;  2GNC A;  2E8I A;  5LHH B;  3SFM A;  4C92 D;  5GAN h;  1N27 A;  1N8R R;  4JEU B;  3FC3 A;  2J6O A;  1WLP B;  1MMG A;  3F57 A;  5I11 A;  4JV5 T;  2QA4 Q;  2BS4 A;  2D8H A;  4ZN3 A;  1FX7 A;  3NGP A;  2M6I A;  1Y0M A;  2K9G A;  1GXI E;  5CVI A;  4BDZ A;  3SFE A;  1IAP A;  1HK9 A;  4IUT A;  1UHC A;  1MHN A;  2YEV C;  2BKD N;  4PNO A;  3OYA A;  3JCM d;  2CA5 A;  5DLQ E;  5FU7 B;  2VUB A;  1V1C A;  1YWP A;  2DWK A;  4DV3 T;  3ULR B;  1VQP Q;  1BR2 A;  4YJ3 E;  5CA1 E;  3NRX A;  4F8H A;  1H8K A;  4A4K A;  3I5R A;  2XAS B;  4RTT A;  3CCV Q;  2CZ7 B;  2ACZ A;  2XAH B;  3RH3 A;  5HK3 A;  2XQ3 A;  3ZSS A;  2VAS A;  4Z8A A;  3EGX B;  1Q82 U;  4FU6 A;  1NYG A;  1AZE A;  3A5Z B;  4M77 G;  3ZYK A;  2X67 A;  1RAI B;  2DMO A;  1IBM T;  2EYY A;  4PJM A;  3UUL A;  2PG8 A;  1Q81 C;  3VR8 A;  2FZK B;  4A4H A;  3G4S A;  1YJN Q;  2AKL A;  4HCK A;  4DO0 A;  2XAQ B;  2FUP A;  1YHQ A;  2XD0 A;  3M59 A;  4U7Y A;  5LHI B;  2CT3 A;  3MAC A;  3H0F A;  3KUF A;  4PJO F;  2QA4 T;  2DAQ A;  5CKF A;  4X9D A;  3JCM X;  5GAO p;  2CS7 A;  3EAB A;  1VRB A;  5CCA A;  4NL3 A;  2C0O A;  1OU8 A;  1OX8 A;  4JI5 T;  3ZEH A;  2WB5 A;  3JCM c;  2CYZ B;  1UG1 A;  4B6X A;  1X9B A;  2E41 A;  3N2G E;  4O4H E;  1VQP T;  4BB7 A;  1ACM B;  1XWM A;  3I0Q A;  1K9A A;  2DD4 A;  1N36 T;  2V7I A;  2XQY A;  5I2S A;  1BBZ A;  3RR6 A;  2CWO A;  3TLV A;  2DL4 A;  1T0J A;  1SF9 A;  3CQC B;  2KZ7 B;  4HCC A;  1KFY A;  4EGW A;  2A37 A;  1IXD A;  2AK5 A;  4QHO A;  1US7 B;  4E7L A;  4IKF A;  2IAK A;  3PVL A;  4JI0 T;  5CO7 A;  5GAN f;  1YJN T;  2VXF A;  2FZG B;  5HCM A;  1EIF A;  3I1A A;  4EV6 A;  3PUW F;  1S72 T;  4HWH A;  5HXC A;  3D7S B;  2KWH A;  2F2W A;  2XZE A;  4LD6 A;  4GK0 E;  3DB4 A;  1BI3 A;  2LCL A;  2LSJ A;  2OLT A;  2C0T A;  5GJW B;  2FJE A;  4EEB A;  2X0H A;  2PQW A;  2VKO A;  3BQI A;  2W63 A;  2LRQ A;  3AA1 B;  3EGU A;  3NTI A;  3I56 T;  2KVQ G;  1I5L A;  2A2F X;  1Y57 A;  4MFR A;  4XU2 A;  2FG0 A;  1HX8 A;  2HMA A;  2EQU A;  5JQG E;  1NM7 A;  3AVR A;  5H6Q B;  5E0O A;  3L2Q A;  2VKD A;  4CC3 A;  2QGF B;  1IB8 A;  3CX8 B;  4X9C A;  4B9X A;  1SHG A;  2FL7 A;  2KRM A;  4LFA T;  1BI1 A;  3PTA A;  5C0M A;  1I5O B;  2E9X D;  3E9G A;  1TTH B;  2X9X A;  3FBL A;  4F7U F;  4XTZ A;  1OED E;  5HEU A;  4OYJ A;  4HFH A;  1Q81 R;  3CC7 Q;  4M7D A;  2M67 A;  5LL6 S;  4N78 D;  4OMN A;  3DLM A;  4RUG A;  4I50 E;  1OED B;  3LBX A;  4BY6 C;  1XQH A;  1WPY A;  2QTX A;  4MHC A;  4I4T E;  1QCO A;  4F16 A;  3QPH A;  4G63 A;  3UAT A;  1YHQ T;  2W66 A;  2XQ4 A;  3FJ5 A;  2J1D G;  1WNL A;  3OYG A;  2LOS A;  3PMT A;  2ED1 A;  2ENM A;  3CCS T;  3RC3 A;  2HBW A;  2JVV A;  3VS3 A;  4LXC A;  3JC6 D;  2L3R A;  1NJI U;  4CC7 A;  5LJN A;  3OSV A;  5BMV E;  3M9Q A;  4XTU A;  1M2V A;  1OI1 A;  3EVY A;  2VUR A;  2CPT A;  2CZ1 B;  1YN8 A;  2LTO A;  1YBY A;  3OMG A;  1UJ0 A;  4M78 E;  1J3T A;  2XAF B;  2GFA A;  4HVV A;  1Q82 C;  1Y96 A;  5A1L A;  4M78 B;  1BB9 A;  4EMK C;  3AEC A;  4DR3 T;  2EVR A;  4CC4 B;  5FVK A;  5FMN A;  3RIU A;  2J7I A;  3JAM E;  2YDR A;  4ILU A;  3G6E T;  3H0H A;  1K9M U;  1WXU A;  4J7F A;  2JW4 A;  5J2U E;  3AT1 B;  2JQ9 A;  2MWO A;  2V5D A;  3ZYL A;  5CKE A;  3FRN A;  2BE9 B;  1JJ2 S;  2HKN A;  3L2R A;  4ELZ C;  2COY A;  4DUY T;  3MEV A;  2KR3 A;  1KF6 A;  3SWH A;  4JLE A;  4OVA A;  3OYL A;  2P4R A;  3RRW A;  2X9W A;  1NEK A;  1ARK A;  3QC9 A;  1TUD A;  3I5S A;  4C92 A;  2XK0 A;  4PJO C;  1MV0 B;  4M7A E;  1SPK A;  1PCX A;  2WY2 A;  4M7A B;  1CHU A;  1UGP B;  3CCJ T;  2CM0 A;  2DPP B;  1JXO A;  5JVD E;  1RAF B;  1VQL A;  2OTL A;  3P4P A;  3OS1 A;  3RNJ A;  4M1P A;  4X34 A;  1NG2 A;  4WF2 A;  3OYX A;  3IHR A;  4F04 B;  4IE7 A;  2RI2 A;  4C8Q D;  5LJ5 e;  3C64 A;  4TWD A;  3RKO A;  2D8J A;  1AEY A;  3LJC A;  4LFB T;  5AQJ B;  5DY9 A;  3C50 A;  1VQ6 T;  4CI2 B;  3EFS A;  4N0A C;  2ZGW A;  3BK9 A;  1IHV A;  3EGD A;  1HD3 A;  3ZT7 A;  1VCS A;  1T8B A;  1L0V A;  1PSF A;  1U5S A;  1HSQ A;  2WDQ A;  3AEA A;  2GTO A;  1G3S A;  2XTL A;  2V6Y A;  3CBP A;  5CIU A;  1YKE B;  2NUP A;  4CXW A;  2LT4 A;  3AE2 A;  4AXP A;  1PC0 A;  4D8K A;  5GAN 8;  1JJ2 A;  4UXN B;  2QQR A;  2ZM0 A;  1RAA B;  2LM9 A;  1IRX A;  1VQO A;  4A54 A;  4Q5W A;  1Q7Y C;  1M8M A;  4IUP A;  5AQO B;  1NEN A;  1I07 A;  2X4X A;  1LJO A;  2KYB A;  3HKE E;  1D1C A;  2AZS A;  3CCU A;  3HRS A;  4AT1 B;  1AWW A;  1TUG B;  3CPW S;  2EQI A;  1T7S A;  4OGC A;  5LHG B;  2GGR A;  4LDU A;  3OB9 A;  1RI0 A;  2HSP A;  3M4G A;  4XAX B;  3JCM h;  2JMA A;  4AFZ C;  2EIF A;  2VKJ A;  1Q82 R;  5D6W A;  1BK2 A;  2QA7 A;  3A8O B;  3O5Z A;  3ZT5 A;  3RRC A;  2COZ A;  4OX9 T;  2QK0 A;  2EGC A;  1LCK A;  1FMK A;  3QOF A;  1D3B B;  2CZ0 B;  2EJF A;  3RYF E;  3ZT6 A;  2KYM A;  5LG4 A;  1N34 T;  3AAA B;  1Q95 G;  3I35 A;  1BIB A;  3U78 A;  1QSD A;  4ASK A;  3A8H B;  2XM2 A;  4R56 A;  1WR0 A;  2L3L A;  2JTM A;  4AQG A;  4PJO G;  4B3R T;  2WWV A;  4ZZB A;  5LNK A;  4JRP A;  2HL3 A;  5FWC A;  2BE7 D;  1PG5 B;  5GMK l;  2DET A;  1SA0 E;  3N9N A;  2DM1 A;  2WSC E;  4B3S T;  3G06 A;  3RQW A;  2DBM A;  5LYJ E;  3A8M B;  2MAM A;  1VQ5 T;  3TLW A;  2YUN A;  5HKC A;  2LCC A;  3K3O A;  4J9H A;  1NJI C;  1VQN A;  2E6Z A;  1G2B A;  4EED A;  5DLO A;  2LLY A;  3G71 A;  1I81 A;  4LF5 T;  1RI9 A;  2L3P A;  2NYS A;  4UVB B;  4M7D F;  4D8D A;  3M57 A;  5GON E;  2BZ8 A;  3MET A;  3FB2 A;  4I55 E;  2EQJ A;  1WJR A;  4U3C A;  4BA9 A;  1N9R A;  1VQL T;  1U4Q A;  2NTX A;  3RYC E;  4MZP A;  3CPW A;  2HN2 A;  3FBZ A;  4ADZ A;  5AYF A;  1T0H A;  4EXT A;  1X2K A;  5AQN B;  4AG2 C;  3L42 A;  1D1A A;  1MND A;  1QQJ A;  1VQK Q;  3X20 B;  2L89 A;  3NPF A;  1QMC A;  1K9M C;  2EKO A;  2K2M A;  5LGT B;  3ONJ A;  3AAE B;  1HNZ T;  2HQX A;  4C0F A;  3ZBD A;  1LVK A;  1ZKE A;  5M4Y A;  1JO8 A;  3OYM A;  1QW1 A;  5C6S A;  2H3E B;  5L47 A;  2D9D A;  4HWC A;  3REB B;  5AQH B;  1NPR A;  3OY9 A;  2E9X A;  2DTH A;  3HL6 A;  3QZ9 B;  5ABG A;  1QVF S;  3HFO A;  4KMC A;  4MZT A;  3PUR A;  3PUY F;  2LQW A;  4RTZ A;  2DF6 A;  3ANW A;  3VS0 A;  2F5T X;  2O9S A;  2E6N A;  1NZ9 A;  4ILC A;  4WBO A;  2C5I T;  1O9S A;  4HFE A;  4JI8 T;  3RIA A;  4ZI3 D;  1KNZ A;  1B7T A;  4MBQ A;  5GAM g;  2NTY A;  4AMC A;  3UU4 A;  3PUZ F;  3OBW A;  4QW2 A;  5GAO r;  4L9I A;  2HDA A;  3M55 A;  4IUR A;  5AQT B;  3CMA A;  4YTL A;  4RCC A;  4F7U G;  4X1Y E;  5AQR B;  3M0T A;  2BBH A;  3WAK A;  4HWD A;  2ROT A;  5CJ5 A;  1FYN A;  3RHW A;  1VQK T;  4C92 F;  4TX5 A;  3AE4 A;  3FXD B;  3UTK A;  3M58 A;  4K0U A;  3BE3 A;  3CME T;  3K3N A;  1AWJ A;  4AKG A;  3PMI A;  2RQV A;  1VCT A;  2W61 A;  1JQQ A;  2WSF E;  2IUB A;  2CLY C;  2K5B B;  4HFC A;  3CC4 Q;  1C0M A;  2E3H A;  2O2O A;  2FJD A;  1Q86 U;  2ZPH B;  5GAO q;  4X5T A;  5IXF A;  2XDP A;  1VQ4 T;  4JI7 T;  2GBQ A;  4ZEY A;  3RIR A;  5C2T A;  4A4F A;  4CN4 A;  1N9S A;  1LNX A;  1WI7 A;  1NJI R;  2M02 A;  2XQ7 A;  2QVA A;  3VHL A;  5AQI B;  2NOX A;  2EBP A;  3P8B B;  3ZYM A;  3OYI A;  2VVN A;  3CCQ A;  5LB7 B;  2W4X A;  4JS5 A;  2CBI A;  3T1H T;  3I9Y A;  1FMV A;  2H88 A;  2O4X B;  3Q2M A;  3RMS A;  2H7O A;  3PNW C;  4EMK A;  5KYW B;  2XG8 D;  3CK6 A;  1F1B B;  4RTY A;  1ABQ A;  3V8L A;  1K9M R;  4ZNX A;  4E47 A;  2EJG A;  1YJW Q;  2VYT A;  4GY5 A;  5HY6 A;  2CE7 A;  2MCN A;  3X28 B;  3FZM B;  2HSE B;  3E1S A;  4E2F B;  2NR4 A;  2J6F A;  1AHJ B;  2EHO D;  4C8Q A;  4GBQ A;  2LSK A;  4FT4 A;  2LVM A;  3EG9 B;  2GQI A;  4DMV A;  1UB4 A;  5IHI A;  2WBL A;  1MMN A;  4BE0 A;  4IDZ A;  1IJ5 A;  2H3J A;  4ISS A;  4L5G A;  1ZP0 A;  5HEH A;  4GKJ T;  2D0Q B;  4GLM A;  2AXD S;  1H92 A;  1HF8 A;  2Q9Q B;  1VQ8 T;  4BAC A;  4MAL A;  1VA7 A;  2A08 A;  1ZQ1 A;  3VRY A;  3TRE A;  3DKM A;  2X4Y A;  3L2V A;  4HWI B;  3SRZ A;  4RMO A;  3LFM A;  3A8Y C;  3Q5E A;  1LKX A;  1MNE A;  3CCR T;  4YTP A;  5EC7 A;  3VYH B;  2KT8 A;  3ZN0 B;  3CCE Q;  8ATC B;  5KYY B;  3CX7 B;  4PK5 A;  3C51 A;  4QX7 B;  1UEB A;  4M7D C;  5HXE A;  3AA6 B;  4UV9 B;  3BDU A;  2Y8D A;  1WHH A;  2XDD A;  1YJ9 Q;  3ZL7 C;  4X20 E;  2WZI A;  5LMN T;  2HQE A;  4M77 B;  5FL1 A;  2N1G A;  2YRD A;  1Z9Q A;  3GWH A;  5LGU B;  4D6W A;  3SOL A;  3NWI A;  2CGH A;  2FB7 A;  4HN9 A;  3S4U A;  5IWA T;  1NAF A;  3VJP A;  4BDY A;  2RA1 A;  2EYW A;  3HPW A;  5ABE A;  1JEG A;  4IIO A;  3CCL A;  3FEO A;  5HCJ A;  3QHS A;  2KWI B;  4YLH A;  1VQ9 Q;  4J2C A;  4HT8 A;  1H3H A;  2QAS A;  5JDF A;  1YIJ A;  3S3N A;  3QWY A;  5GAO m;  5JR9 C;  1JNZ A;  1GBR A;  4IL9 A;  5ABF B;  5JRC A;  1X75 C;  2K57 A;  4ZTF A;  3P8D A;  4KHZ F;  5GAN 2;  2XJ7 A;  3CC2 A;  4ELY C;  2DNX A;  1DU2 A;  2M0Y A;  4IE4 A;  2YU1 A;  4C0Z A;  2O01 E;  1KSW A;  2DXT A;  2WMN A;  3RIU C;  4X1I E;  4PKC C;  2JT4 A;  3ABV A;  5CKH A;  3CCE T;  5HEJ A;  2UU9 T;  4HVU A;  2L9Q A;  4JRQ A;  4J9D A;  2E5V A;  2ZPF B;  2LJL A;  5LP6 E;  3M65 A;  1OQK A;  3OW2 A;  2NUP B;  1YJ9 T;  4CXY A;  2E1H A;  2OTJ A;  1OXZ A;  2N2N A;  4QWN B;  1KHC A;  3I55 A;  2LQ8 A;  3ZCJ A;  2QTV A;  2KRN A;  5F8P A;  2VXE A;  2XAG B;  2X4J A;  2YXY A;  4C92 C;  1YCY A;  3CWZ B;  4UVA B;  4BJM A;  4OML A;  1Q86 C;  5KYN A;  5FLX E;  3KV9 A;  2FRW A;  4HKE A;  1ABO A;  5AQV B;  1GCP A;  2V7L A;  1ZSZ A;  4C0D C;  5JDM A;  1UCU A;  4HFD A;  3VRA A;  2KEA A;  2A72 A;  3EH1 A;  3WXM B;  4QVD A;  1QVG S;  1PSE A;  1K76 A;  2V8J A;  3AVS A;  4JEH B;  4M7D G;  1XMQ T;  4LDW A;  3OA6 A;  2QXF A;  2JN0 A;  1RL2 A;  3R6O A;  2DLP A;  2OX7 A;  2CH4 A;  3X24 B;  2YSQ A;  3CPF A;  5IHN A;  2L2P A;  3E08 A;  1OX9 A;  5FU6 C;  3G7Z A;  2NUZ A;  3JB9 J;  3M0S A;  1ZUU A;  2DYI A;  4U2Y A;  2L8K A;  1SKU B;  3CCV A;  2LNV A;  4PJJ A;  5KYU A;  3UUB A;  3EHZ A;  2RQU A;  3LYI A;  1HTJ F;  3PT9 A;  5GAN 7;  2X66 A;  3AE7 A;  3EDV A;  3C94 A;  2J62 A;  2EYX A;  3M4Y A;  3HP9 A;  3MCA B;  4B3M T;  1YXR A;  5FY7 A;  3PJA A;  3KV6 A;  2YLC A;  1KQS S;  2PBI A;  3N9P A;  2VL8 A;  2M9U A;  2NUT A;  5IH2 A;  3P4S A;  1YNZ A;  3ETU A;  4AQF C;  5HK0 A;  3H3A A;  2NWM A;  2WSE E;  2DL3 A;  3NFC A;  8AT1 B;  3DTO A;  3L2U A;  3AEF A;  3SDZ A;  2ZM8 A;  3N9L A;  2DEQ A;  4ZTJ A;  3BQK A;  4NL2 A;  2V26 A;  2DWG A;  3MJX A;  2LE8 A;  3LDQ B;  4DMW A;  4RCB A;  4XZC A;  4HE8 A;  4FSX A;  4MZM A;  3SD4 A;  1KD1 U;  4KHP T;  1QVG A;  1YWO A;  2EKH A;  2B1E A;  2XQA A;  5J1G A;  1RAH B;  2WDV A;  2JMK A;  4ORZ A;  4C8Q F;  1SE7 A;  3ZMU B;  1EZ3 A;  5GMK j;  4DR4 T;  1WHL A;  1M1G A;  3QYH B;  2LHN A;  2WZH A;  4O8S A;  4LF6 T;  4C92 G;  4QVC A;  3OS5 A;  2BUD A;  3PUG A;  3TVT A;  4MMK A;  3MPU B;  4PLL A;  3UU5 A;  4AKR B;  1S72 Q;  2LSG A;  3CPZ A;  3ZC1 A;  2W0G A;  5CB4 E;  5CR2 A;  2DE0 X;  3VKI A;  3PDY A;  2YU2 A;  2BBJ A;  3GA8 A;  1KQ1 A;  1XDO A;  3G1J A;  3JB9 I;  4J9C A;  2BS2 A;  2IIM A;  2DHR A;  2DD5 A;  2RD1 A;  2ZAE A;  3CQX C;  3S6W A;  1Q86 R;  3FZK B;  1YIT T;  3TSW A;  5FRO A;  2CXD A;  2A36 A;  3I56 Q;  1UX5 A;  3AE9 A;  1W2B S;  2HL5 C;  1WFW A;  1GL5 A;  4EPC A;  1KQS A;  2AHJ B;  3P8C D;  2BDE A;  3E22 E;  1X01 A;  4EB6 E;  2IML A;  2EHO A;  5IUX A;  2V1D B;  2LKH A;  4XU1 A;  1YQ3 A;  4YTN A;  2NLU A;  3RLF F;  4JZ3 A;  3UWN A;  3PU3 A;  3TEE A;  2G0U A;  3J7Y q;  2DFU A;  4QH4 A;  3VS6 A;  1HX1 B;  2LC4 A;  1R8I A;  3UFG A;  3TKL B;  1MIV A;  3RYI E;  3LH5 A;  3AAI A;  2CHO A;  4GOU A;  4F17 A;  2X9Y A;  2YK0 A;  4NPP A;  3IA3 A;  3KV4 A;  4LNP A;  2X9H A;  1AZG B;  1I1J A;  2RI3 A;  2XHC A;  2R5A A;  2XID A;  2HZY A;  1M5Q 1;  4BY6 B;  5J3B A;  3RIF A;  4FI5 A;  1IGU A;  4KP3 C;  2SPC A;  4DV2 T;  2HBP A;  3G4S Q;  1QKW A;  1VYV A;  2F5K A;  2E9X C;  3UUN A;  3NHN A;  4PLI A;  3N2O A;  1YHQ Q;  4WZX A;  2MOX A;  4DVD A;  1ZHI A;  1QVP A;  1Y01 A;  3M3Z B;  3PUV F;  2FJA A;  4C5G A;  5KYX B;  4H9N C;  3CCS Q;  2N9D A;  2K2V A;  2XQ8 A;  5LJM A;  2DO3 A;  2JQH A;  3AED A;  4L59 A;  5GAM f;  4UF0 B;  3CC7 A;  3Q5D A;  1Q7Y U;  3OSS C;  2DL8 A;  3NTH A;  2BG9 A;  5GAN j;  1G3T A;  3J81 E;  4BE2 A;  3B13 A;  2YDL A;  4CI0 C;  1X2Q A;  4JJB A;  5HXS A;  4EMG A;  2XY8 B;  1PD0 A;  4NOY A;  1W2B A;  2EFI A;  3EI0 A;  2A3L A;  2EGE A;  3CXC S;  2L3Q A;  2DJZ A;  1M27 C;  3AEE A;  4J6W A;  2DRK A;  4ZGJ B;  4J9B A;  3P8H A;  3JC6 C;  3M0R A;  5I22 A;  2BS3 A;  4EMK B;  3CEY A;  4KGZ B;  4M4Z A;  1W9R A;  4M7A F;  2K3X A;  2WAC A;  1HNX T;  3G6E Q;  4X1V A;  3L2Z A;  2WDR A;  2ZMA A;  4CN6 A;  4LMK A;  1MGQ A;  2DNU A;  3EAM A;  2LSY A;  4Z02 A;  5EG2 A;  1JNR A;  4ZXL A;  4KGX B;  2M1H A;  2WSS V;  3SWN A;  3QJ6 A;  4AFQ C;  2HPL A;  4LD9 K;  1EFN A;  4TZ4 C;  4B3T T;  4JI1 T;  2JRK A;  3GIB A;  3CVR A;  4BE1 A;  2D0T A;  3M0U A;  3BY7 A;  4O5V A;  5L8R E;  5LJ5 g;  3G4S T;  2MF2 A;  3JCM e;  2YDS A;  5DAB A;  2Z0W A;  3LWI A;  4EAH A;  4PJO E;  2HKQ B;  2BKO A;  1T3S A;  4PJO B;  2X0L B;  3V7S A;  3VS2 A;  2K7A A;  1TS9 A;  3RF1 A;  4QT7 A;  3CCJ Q;  4A97 A;  4I0U A;  2FVU A;  4Z90 A;  1WYC A;  2XM1 A;  4YFS A;  1UJY A;  2K3W A;  2VKH A;  3SB2 A;  2JQK A;  4ZOL E;  4DEY A;  2KT1 A;  3TU4 K;  2RF0 A;  1KD1 C;  5JR9 A;  2V7K A;  2B86 A;  3GLX A;  3EG2 A;  2C0I A;  3J80 E;  2PNI A;  3RER A;  1VQ6 Q;  3CXC A;  2MBG A;  4DOV A;  2ES0 A;  4CQI A;  1FEW A;  2JXB A;  4OMM A;  2SRC A;  1AD5 A;  2X51 A;  1WR6 A;  2FYK A;  2ZLY A;  3KIN B;  4Y92 A;  4C8Q C;  5JTG A;  3UF4 A;  2D0N A;  5AQF B;  1GFC A;  4AI6 A;  1QKX A;  2EGA A;  3C4S A;  3HHT B;  3OMC A;  2LT3 A;  1Y64 B;  1VQ7 A;  4R55 A;  5AQS B;  3ZCI A;  1I94 T;  3KBU A;  4HCZ A;  2ODU A;  3IQL A;  2E5Q A;  2CSQ A;  4AKL A;  1HYO A;  2DZC A;  5ABH A;  4JUV A;  3A7M A;  4PK4 A;  2GTJ A;  2X3X D;  4C5E A;  5LJ3 e;  3KDS E;  4TNW A;  1TH7 A;  3MEW A;  2XKO C;  3OYN A;  2K3Y A;  1S35 A;  3X1D A;  4FSS A;  2DJQ A;  2QI2 A;  5JDQ A;  1JJ2 P;  4QX8 B;  1SRL A;  2PVD B;  3AXJ B;  2LKG A;  2NW8 A;  3JCM b;  2WS3 A;  2RK2 A;  1LVF A;  3HKC E;  5LOV E;  1WZO A;  4XTY A;  3N2K E;  4KUI A;  4DV6 T;  1UUS A;  5EK2 A;  2PUK B;  4C90 A;  3UFE A;  4ZI2 D;  4O4L E;  3UQ7 A;  1BYM A;  4V2S A;  1HS7 A;  3LK4 2;  4F7U E;  4EMH A;  2CKK A;  2CXF A;  4QKU A;  3C98 B;  4F7U B;  1PM3 A;  3DJB A;  3FB9 A;  5BR8 T;  3EG1 A;  3OYE A;  4CRI A;  2WP9 A;  2CP6 A;  4KH0 B;  1LRZ A;  2VVK A;  4OMF B;  3X25 B;  4OF1 A;  3HKB E;  1D0X A;  3ETV A;  3RKX A;  1VQ5 Q;  1AWO A;  1SUM B;  4E6R A;  1YQ4 A;  3VUZ A;  1UDL A;  2HEQ A;  4OYK A;  4LF4 T;  3VS1 A;  1QUU A;  2IPO B;  3MXZ A;  5D7U A;  3JCM P;  1GCQ A;  3PFS A;  4AQF A;  1MMA A;  2CUD A;  1S94 A;  3VKG A;  4DV0 T;  2PUO B;  2OI3 A;  4Q25 A;  1NYF A;  1JXM A;  1UHF A;  3O9X A;  2E4H A;  1VQL Q;  1V9D A;  2OTL Q;  4P0B A;  2L5Q A;  4YXD A;  1I6Z A;  2DL7 A;  4JZ4 A;  1KD1 R;  2I59 A;  2AZV A;  1O75 A;  3TLU A;  4NUV A;  1C6V X;  2UXB T;  3AE6 A;  4C8Q G;  4HFV A;  2K79 A;  4M75 F;  3PE0 A;  1A0N B;  1FJG T;  3EFO A;  5KYU B;  1B34 A;  3UA7 A;  3FZH B;  2RN8 A;  2AIR B;  3CBM A;  4FYY B;  3H6Z A;  1HFA A;  3O4X E;  1B07 A;  4M78 D;  1JBM A;  2YIN A;  3GMI A;  4UR9 A;  1ZX6 A;  4PK6 A;  2UUC T;  1UGR B;  2E3I A;  3CPW P;  2YDQ A;  1YCS B;  2RHX A;  3JCM W;  1NEB A;  2E12 A;  2RQR A;  4C5H A;  1T3L A;  1HG5 A;  4H9S E;  2E65 A;  3PV0 F;  1ZSZ C;  5KE3 A;  3CML A;  3GN5 A;  2OJ2 A;  3TLS A;  2CRB A;  3JB9 F;  2QQA A;  3P4Q A;  2MPK A;  4HFB A;  1Z8U A;  2YOE A;  4TWH A;  4XTV A;  5KMG P;  4MLK A;  4C91 A;  2RHZ A;  1SRM A;  1X6O A;  4JDS A;  3CCU Q;  5HCK A;  1GFD A;  1NBE B;  1UGS B;  1QCN A;  4N4H A;  2RB6 A;  5IYZ E;  5FYM A;  2VGM A;  3FJP A;  2KK4 A;  2UXX B;  3RQU A;  2FO0 A;  2QGS A;  4X62 T;  4KT0 E;  4M7A D;  1VOM A;  3WI3 A;  1YP5 A;  2OTL T;  1WHJ A;  1H64 1;  3LWH A;  4BD3 A;  3QII A;  4QKN A;  1M1K C;  1VYT A;  5GAM d;  4ZI3 C;  3JV3 A;  3UU3 A;  4DV7 T;  3PVQ A;  3RKY A;  2X4W A;  1I8F A;  3L09 A;  2ZM2 A;  2AT1 B;  3CME Q;  3RYH E;  4DR7 T;  4K0K T;  4IL4 A;  4AKH A;  1AVZ C;  2FEI A;  1EX4 A;  3IEE A;  5KH6 A;  1KC8 U;  3NZQ A;  3HR0 A;  2K4Y A;  2CLY B;  4JPB W;  3JCM Q;  3OQ5 A;  1Z0P A;  3ZEF B;  4FIB A;  3JCF A;  5KXJ A;  4P1N A;  4IDN A;  4BJN A;  2HD0 A;  2LCS A;  1VQ4 Q;  3CCM A;  5I21 A;  2QQ9 A;  4AFS C;  4H9O C;  2KGT A;  2JQQ A;  5GAN 3;  3EGX A;  1WGS A;  2QYW A;  2WU2 A;  1Q7Y R;  5LBQ B;  2JZ2 A;  3W15 B;  3NVO A;  2GK9 A;  4MML A;  2UXN B;  1VQO T;  4IE6 A;  5FKY A;  2B8A A;  5L3D B;  1NLP C;  3A8L B;  1GQE A;  3QKJ A;  3I9Q A;  2VQE T;  2ZZD A;  3CC4 A;  3S3O A;  1TUC A;  2B76 A;  2V8I A;  3CCU T;  3Q9D A;  2XI9 A;  2PTF A;  5FWB A;  4UIG A;  1PRM C;  4QH5 A;  3FDR A;  3CBO A;  4J6X A;  1QVF P;  1XNR T;  3U23 A;  2CDT A;  3ASK A;  3PUA A;  2DZ9 A;  2C5K T;  5GMK e;  1R8O B;  4BI4 A;  4UVC B;  2Y90 A;  3LX7 A;  1E1H B;  5IXB A;  4Z8X A;  4KUD K;  2MOZ A;  4F14 A;  2YRV A;  2CMR A;  4LDV A;  4E7S A;  2VWF A;  4Y91 A;  3EHR A;  2O88 A;  1WXT A;  3M0P A;  2YN6 A;  1VQ8 Q;  3O1I A;  2PTK A;  4OB3 B;  2QEX A;  4M77 F;  4ZI7 E;  4H9Q C;  4XBF B;  2ABL A;  1M3A A;  2EHO C;  2GF7 A;  3H8Z A;  1YJW A;  1WIE A;  4KGV B;  3VYG A;  3RMQ A;  1W0A A;  2V5C A;  1M3B A;  3MKD A;  3CCR Q;  1IZN B;  2MWP A;  2W67 A;  1XNQ T;  3AEB A;  1QP3 A;  2RHY A;  5EK3 A;  1D0Y A;  2W2U A;  3I9W A;  4CXX A;  1VQN T;  3MP8 A;  4M7D E;  3G71 T;  4BI3 A;  2LQN A;  2M0O A;  4LE9 A;  4M7D B;  4JJN K;  3HRT A;  1HG2 A;  3LBX B;  4J8O A;  3CMA Q;  4A4E A;  2HQH A;  4YSX A;  2DL5 A;  2P0K A;  1W0B A;  4M75 C;  1UK5 A;  3TCJ A;  2K48 A;  2QGG A;  1MMD A;  1IBK T;  2MPX C;  3QYG B;  2IC6 A;  3ZMT B;  4J6Y A;  1K4U S;  5I2M A;  1K8A U;  1VQM A;  1UFF A;  1PKT A;  4HVW A;  2DYB A;  3AE5 A;  5LGN B;  2HCK A;  3A8G B;  2BG9 C;  3JRZ A;  1WFD A;  2VB6 A;  4V1A v;  2JUF A;  5DJQ C;  2BZY A;  1SHF A;  4A5X A;  1M2V B;  2A0F B;  1WDX A;  4KRT A;  5GAN e;  2RI5 A;  5JR9 B;  3VRZ A;  5AQQ B;  5AQK B;  3CD6 A;  4FW1 A;  2EQM A;  4JLG A;  2YUP A;  4OB1 B;  1Y96 B;  1WYB A;  1O3X A;  4IE0 A;  3VS4 A;  4ERR A;  5KE2 A;  1QLB A;  4M75 D;  3GBQ A;  1BCO A;  1K73 U;  3E2U A;  1WX6 A;  1VQ9 A;  1TU0 B;  2DXB A;  3OW2 S;  2HH7 A;  4LFC T;  5LJ5 f;  2K24 A;  1QP2 A;  3C4X A;  2R58 A;  3M53 A;  3ER0 A;  2BKN A;  2F69 A;  3SWN C;  4WNK A;  3TLT A;  1YI2 A;  1X69 A;  4AFU C;  3CMA T;  3LGF A;  2KSS A;  1CKB A;  5HAX A;  2RHU A;  4FCY A;  5LXT E;  4C92 E;  3OS2 A;  1KC8 C;  5HXH A;  2E64 A;  5DQV A;  3RKG A;  2MIO A;  2H89 A;  1AOJ A;  3K3Q C;  1IGQ A;  1QLY A;  4C92 B;  2DXU A;  2FPF A;  4KX6 A;  3A1P A;  2SEM A;  1J1J A;  3OYD A;  3I0O A;  4ZGE B;  5IHK A;  2YWW A;  1WRD A;  5HXR A;  3INZ A;  3JB9 D;  3NMZ C;  5GMK i;  1GBQ A;  2Y4Y A;  3PUX F;  3BW1 A;  2KMT A;  4M78 A;  4C0D B;  2EWN A;  3MO8 A;  1ZBX A;  2M16 A;  4PJL A;  1ZOY A;  3UPU A;  4OP0 A;  1VUB A;  2RK1 A;  3EAE A;  3LSV A;  4Z88 A;  1Z9Z A;  3N5B B;  3AHU A;  4QXC B;  1ZBJ A;  5FVL A;  1JRI A;  2ZCF B;  1E7P A;  2CSI A;  2I6H A;  2IHR 1;  3Q5X A;  4ILA A;  5FU6 B;  3EGD B;  2XDB A;  3UT5 E;  2RH2 A;  3UA6 A;  1QWE A;  3CCQ T;  3A98 A;  5FRN A;  2KT9 A;  3CIR A;  1WA7 A;  3DB3 A;  3MHX A;  2V6Y B;  4YSZ A;  3AE1 A;  2H7V C;  5L3F B;  1UUE A;  2YUO A;  4LN2 A;  4O2A E;  2UUA T;  2KRO A;  4M7A A;  1G3Y A;  2BVL A;  2W00 A;  4EOZ B;  4DBR A;  2KNB B;  4LF7 T;  2CP3 A;  5FRM A;  1KQ2 A;  2KXP B;  4A4G A;  4TVR A;  4CI3 B;  4U2Z A;  2CT4 A;  2LHR A;  1ZLM A;  5J26 A;  4ZS3 A;  3VS7 A;  2A9U A;  2V6X A;  2KE9 A;  4E7J A;  3UQ4 A;  2QA4 A;  3V7C A;  1SHZ C;  1FXX A;  7AT1 B;  4ANJ A;  3KFV A;  2Q9Q D;  3OJA A;  2EQK A;  2GFU A;  2MYS A;  3VS5 A;  3RI5 A;  3N9M A;  2D5U A;  4UV8 B;  3CD6 T;  4U33 A;  2JS2 A;  1KIK A;  2K9A A;  2VVS A;  2EAY A;  2IW5 B;  3SEM A;  5C8Y E;  3QXE B;  2LX7 A;  2F1L A;  2KND A;  3SFD A;  3MA9 A;  4OB2 B;  1WHM A;  1VQP A;  2IG0 A;  2RJD A;  1V29 B;  3OYZ A;  5GAN 6;  1FWZ A;  2FRY A;  2P9B A;  3KBG A;  3H37 A;  2OAW A;  1QVG P;  4KI0 F;  2JIW A;  1M9S A;  2LT1 A;  2RJF A;  4ESR A;  2LZ6 B;  5CKD A;  4J9E A;  3I55 Q;  4DBF A;  1BIA A;  1NE8 A;  5D6X A;  4B6M A;  3KBT A;  4H63 H;  1YIT Q;  5GAM h;  4M77 D;  4OHF A;  2K5I A;  2XQ6 A;  2BKP A;  5J0Z A;  3THK A;  1K8A C;  3REA B;  1S1N A;  3RPU A;  4A56 A;  4MDX A;  2R6G F;  2ATC B;  2M51 A;  2KDS A;  1GCQ C;  4IST A;  4FJO A;  4KUM B;  3HI2 A;  4OB0 B;  1YJN A;  4GKK T;  3V8K A;  4MDW A;  4NUU A;  4WYV A;  3TSZ A;  1S72 A;  3CCL T;  2NW7 A;  3CQG B;  1D3B A;  2OA5 A;  1WQW A;  3EH2 A;  3BFM A;  1YIJ T;  2JM9 A;  1Y71 A;  1UX4 A;  5CGM A;  1OZ3 A;  4JYA T;  2LRL A;  2X35 A;  4IUV A;  4WW0 A;  3L1A A;  3I56 A;  4QVZ A;  1K73 C;  5HYA A;  1KQS P;  1KNP A;  3MZK B;  5CKB A;  1QCF A;  4E7I A;  2RM4 A;  4FW2 A;  3CC2 T;  1RAG B;  3OTO T;  3T8O A;  2LJ3 A;  4O4J E;  5AQU B;  2LDM A;  5CFB A;  4HGA A;  3R6N A;  5LMU T;  5GAN 5;  4FYV B;  2D6F A;  5AQG B;  4FM4 B;  3VUB A;  2E9X B;  5EZY E;  2J4G A;  2P0Q A;  1U1S A;  5GJV B;  1ZV4 X;  2OTJ T;  3ANW B;  1LOJ A;  3I55 T;  5M9O A;  4DR6 T;  5FW9 A;  1W70 A;  5IAY A;  4DQ2 A;  2RQW A;  1T98 A;  2FBW A;  2I0N A;  1RLQ C;  2F2V A;  1T72 A;  5D6Y A;  1KFZ A;  4JUY A;  2IDO B;  2X3W D;  1UEC A;  2BTT A;  1ZA1 B;  3LK2 B;  2H3R A;  1RAB B;  2IIU A;  4RTW A;  3OPC A;  3GNF B;  2PU9 B;  3C4W A;  2P84 A;  3JCM g;  5GAO n;  2A7Y A;  1IJ6 A;  3K1S A;  4HTE A;  4P0A A;  4QQD A;  5FY1 A;  1W1F A;  1K0X A;  3CCS A;  3PTR B;  2ACX A;  2D2S A;  1HXD A;  5AQL B;  3QUJ A;  5GMK m;  1D0Z A;  1OWA A;  2EJ9 A;  1KK7 A;  2O31 A;  3ME9 A;  4YHJ A;  5FU7 C;  2JM8 A;  1OV3 A;  1W2B P;  3E9F A;  5JDG A;  4ZS2 A;  5LJ3 d;  4AIU A;  2K5F A;  4M78 F;  4YHH T;  4M75 A;  2NWB A;  3O8V A;  1PHT A;  4CN1 A;  2DTI A;  3CCV T;  4LDX A;  4PFP A;  1BU1 A;  1KHI A;  1W4S A;  3G6E A;  2EPD A;  1K8A R;  4DR5 T;  1RUW A;  3PU8 A;  2DBK A;  2L3S A;  3S3M A;  1HNW T;  2UXC T;  2XHE B;  3CKD A;  5A0D A;  5LJ5 d;  3HA4 A;  3HKS A;  4GLK A;  2YUQ A;  5HWY A;  2ZPG B;  3N9O A;  4DR1 T;  1E6G A;  5KCH A;  3Q5W A;  2WQY A;  1HCI A;  1TXQ A;  2R5M A;  1N6A A;  3L39 A;  1W6X A;  1CUN A;  1BR4 A;  2J06 A;  3VU3 C;  4XU0 A;  4FT2 A;  5GAM j;  3GPL A;  2CWY A;  2RO0 A;  4BUG A;  2FPE A;  4HKA A;  3Q1J A;  4FL6 A;  4U72 A;  5J39 A;  2X68 A;  1N32 T;  5LJ3 g;  1K73 R;  3CCJ A;  2OV9 A;  3JB9 H;  3AE8 A;  4C8Q E;  3CQT A;  2XQ5 A;  5JH7 E;  3VU7 H;  3FLG A;  4C8Q B;  4JRK A;  1KG1 A;  3OBV E;  2L8D A;  4RKU E;  3UUM A;  3V5S A;  2KQW A;  1PNJ A;  4TV8 E;  4HFI A;  1U8R A;  3HTR A;  5FP3 A;  2YT6 A;  9ATC B;  3CXC P;  2LSI A;  1VQ6 A;  4TWF A;  4ME7 A;  2JOY A;  4NIQ A;  2PJQ A;  2P4T A;  4JJD A;  3RGL A;  2E70 A;  3ZC0 A;  3H9N A;  1MIW A;  2FHD A;  4AQY T;  2CP0 A;  4LUD A;  3UDC A;  3OYF A;  3M54 A;  4ZN1 A;  2MAW A;  3H3M A;  4COF A;  3TQ7 P;  1IHW A;  2FJB A;  4J9G A;  5GAO l;  2GCX A;  3JAF A;  2O4X A;  2CUB A;  3ZMZ B;  3MEA A;  2ZPE B;  4KUL A;  4EZ4 A;  5KYW A;  1WYX A;  4EYY R;  2PZ1 A;  2RMO A;  2ZPB B;  2CP2 A;  4O2B E;  1OYX A;  1WHG A;  1KEY A;  2V7M A;  2Y6X A;  2DX1 A;  4H63 V;  4UEL A;  1U1T A;  3JCM J;  3HKD E;  3P4R A;  2J05 A;  4RTU A;  3SS1 A;  1M1K U;  3C12 A;  4IIJ E;  4UEM A;  3EG9 A;  4K11 A;  4VUB A;  3VR9 A;  4PAG A;  3ZN1 B;  4YT0 A;  4GK5 E;  2VWA A;  5FNV E;  4DV5 T;  2Q9Q A;  2QQS A;  2UUB T;  2L0A A;  4LF8 T;  4GIW A;  2DA9 A;  3RC8 A;  1WQ7 A;  1H7C A;  4DUZ T;  4E7Z A;  1HR0 T;  4IUQ A;  2D9T A;  1AJ3 A;  4ZI2 C;  1M90 U;  4OGE A;  1AWX A;  2VC8 A;  3K8P C;  1TWB A;  3QBY A;  4XTW A;  1IO6 A;  5F3J A;  4RTX A;  4IRE A;  2DIG A;  3QUI A;  4G2A A;  2IVW A;  5KYY A;  1NLO C;  3F2E A;  3PUS A;  5L4H A;  3GOX A;  5JRC B;  1BR1 A;  1P92 A;  2CRE A;  3OYJ A;  4IE5 A;  4XU3 A;  2XMF A;  3PIP A;  5CA0 E;  1UGV A;  5LCY A;  3RKW A;  1FMW A;  1DJ7 B;  5AT1 B;  1OED C;  5IT9 E;  3CC7 T;  1R0B G;  2F2X A;  4M77 A;  3QSU A;  4KH1 B;  2JJ9 A;  4BAY B;  3T9N A;  4N4G A;  3X26 B;  1VQ5 A;  3BQL A;  5F5W A;  2WM9 A;  4C0G A;  5GAN 4;  4U31 A;  4OK0 A;  2XAJ B;  3N5L A;  1G83 A;  4OMO A;  2M6B A;  1W09 A;  4JLI A;  1SSH A;  3VV0 A;  4A63 B;  2I0M A;  2A28 A;  3JAD A;  3QB5 A;  2RJC A;  2CXL A;  3HSB A;  4TV9 E;  2PVG B;  3EUH A;  3PIO A;  4PFO A;  3RBB B;  3NBX X;  4YSY A;  1U06 A;  4DND A;  1XJW B;  3EG3 A;  1XZY A;  4DV1 T;  1Y07 A;  4DOW A;  2ESW A;  1MIY A;  1NEG A;  5ABF A;  3V5U A;  1RAE B;  1ZSZ B;  1VQ7 Q;  4M78 C;  2BVM A;  2G6F X;  2CCQ A;  2E10 A;  4F6R C;  4PL6 A;  2JMC A;  2V1Q A;  4LDY A;  2XQ9 A;  4WBN E;  3GP8 A;  3UU8 A;  3FHN A;  3M56 A;  3OYK A;  1FIO A;  1UGO A;  3HL8 A;  4PJO D;  4J9I A;  1ZA2 B;  2C06 A;  4LMJ A;  2DER A;  3C4Z A;  2DIL A;  2VKN A;  5H6R B;  5AQM B;  4QXH B;  5HWX A;  4X64 T;  3L2W A;  1IZ6 A;  1M7K A;  2YKS A;  3OYC A;  3O1J A;  2BZB A;  2K6D A;  2NW9 A;  2DL1 A;  1OUL A;  2V8K A;  4E7K A;  4M7A C;  2R57 A;  2VV5 A;  1IBL T;  4DR2 T;  2QDY B;  2KXC A;  2DK3 A;  3OVU A;  3J7A F;  1E7O A;  2NUT B;  1R0C B;  1AT1 B;  1OU9 A;  3FZL B;  4EIW A;  4DBQ A;  2AKK A;  2QRX A;  4GYR A;  1VQK A;  3F31 A;  2DVE A;  3RDV A;  1GRI A;  2HPJ A;  3QO3 A;  3CME A;  1VQO Q;  5DQW A;  1VQ7 T;  2LRK A;  1WCR A;  2JNG A;  4XTX A;  2JS0 A;  2O9V A;  1X6G A;  1G5V A;  4H9P C;  4P5N A;  5JDN A;  2QYZ A;  3QZ5 B;  5HEG A;  1WJS A;  4X66 T;  1VIE A;  4J83 A;  1ZSG A;  3GF5 A;  1VQ4 A;  2JPF A;  3UUX B;  4IDQ A;  2KAF A;  1OOT A;  4RG2 A;  4P09 A;  1OPK A;  3AA0 B;  1TSF A;  4RG8 A;  5CK9 A;  3ZFJ A;  4JJC A;  3E19 A;  5LBM A;  1SEM A;  1WXB A;  4AIS A;  4UC4 A;  1H3Z A;  2VK9 A;  1KNR A;  2KY9 A;  4ZZC A;  1YKH B;  4M78 G;  2YHT A;  1G8X A;  5A2Q E;  5GAN d;  1TOV A;  2JMH A;  1M3C A;  1BI0 A;  1J5W A;  4WTO B;  1Y7X A;  2CEA A;  2RPN A;  1TG0 A;  2AE9 A;  1M90 C;  2YRC A;  3HRU A;  4I43 B;  3IF8 B;  4CZZ B;  1BI2 A;  2DRM A;  4L0R A;  5HEO A;  2HAX A;  5KDM C;  2EHO B;  3OYB A;  5LJ3 h;  4JS4 A;  5JDL A;  2LOP A;  3M0Q A;  4DID B;  2QAZ A;  3IBP A;  3V8J A;  1N8R U;  1K0S A;  5L3E B;  2VGN A;  1RAC B;  2WCA A;  3FXE B;  3LG7 A;  1C1A A;  5AFU L;  3QDF A;  4TNV A;  5JDH A;  2BZX A;  1VQN Q;  3G71 Q;  3ZMS B;  2ZPI B;  1SG5 A;  2NP9 A;  4U74 A;  1B3Q A;  6AT1 B;  4II1 A;  1VQ8 A;  2CP7 A;  1ZEE A;  2EYQ A;  1N5Z A;  1YD8 G;  4EYU A;  2P0P A;  5LJ5 h;  4M7A G;  1SSF A;  3P4W A;  3ZKR A;  2KIN B;  5EK4 A;  3ZJ1 A;  4M75 E;  4QXB B;  5GAN g;  5KCO A;  3QJY A;  5L3B B;  3CCR A;  4M75 B;  5FXV A;  4R0K A;  4NXM T;  4FYW B;  3ZMV B;  4OMQ A;  5TAO A;  3RUX A;  4ATO A;  3J9X 1;  2LNH B;  1M62 A;  4EZH A;  5FL0 A;  2BG9 E;  1D09 B;  4PNI A;  1M2O A;  1KJW A;  2DVJ A;  2BG9 B;  2FZC B;  5L4E A;  3RX6 A;  3JCM f;  3M5A A;  3CCM Q;  5IHY A;  3D0T A;  4YJ2 E;  3BDL A;  3QWX X;  2E5L T;  2DIQ A;  1VIF A;  2HNI A;  3GNG A;  3JSC A;  3L8R A;  3EFR A;  1G73 A;  5JRE A;  4Y28 E;  1I0C A;  2LJ0 A;  5L2L A;  2E5K A;  3LK3 B;  4A98 A;  2ROL A;  2KXD A;  2RJE A;  4HCB A;  4IHJ E;  2V1R A;  2XSA A;  2WWU A;  3MK7 C;  1RAD B;  4A53 A;  4LML A;  2G3R A;  2MMP A;  3QNU A;  1EZZ B;  4CI1 B;  3AB3 B;  1M1F A;  2H8H A;  4J9F A;  4HT9 A;  1I4K 1;  3E0Z A;  1N33 T;  4OFZ A;  3WVE B;  1M1K R;  4HEA A;  3DLL A;  4JI4 T;  2D0U A;  5ADX L;  2DXC A;  2RA2 A;  3HFN A;  1XTD A;  3ZST A;  3SWN B;  5KYX A;  2V7J A;  1QVF A;  3JAE A;  4Z89 A;  2WU5 A;  1XNI A;  4QH1 A;  4XQ3 A;  3EDU A;  4UF0 A;  2JTE A;  3U3I A;  3URG A;  2JTF A;  5LG3 A;  2RPA A;  1OPL A;  2MI6 A;  3KVA A;  1LPL A;  3CCE A;  1E6H A;  3P50 A;  1QWF A;  1ZUY A;  1K1Z A;  1M90 R;  1ZUK A;  4RTV A;  3B57 A;  3OYH A;  3UU6 A;  3LH0 A;  2LP5 A;  3A5X A;  3ONL C;  3ZJ2 A;  1YJ9 A;  3WVD B;  2QEX Q;  2J47 A;  1PKS A;  2KSR A;  3LLR A;  2COW A;  4B9W A;  3KVB A;  2Y4X A;  4HXJ A;  5CAI A;  2PFV A;  4LUE A;  3CCM T;  5IN1 A;  4TN7 B;  4NXN T;  2LX9 A;  4AKI A;  5LJ3 f;  1X43 A;  4EIK A;  5ECA A;  2UXD T;  3VRB A;  5A0L A;  2EW3 A;  3EHQ A;  3EG0 A;  3N9Q A;  5FY0 A;  3RES A;  4EDU A;  1OED A;  2DEU A;  5DM7 R;  3DP7 A;  5GAM e;  2LJ1 A;  3KXT A;  4ILB A;  1NWM X;  2I2L A;  2CHN A;  1YFN A;  4IUU A;  4DBH A;  1ZHC A;  2CZ6 B;  3CC4 T;  3H41 A;  3WAJ A;  5LJ3 j;  3CCQ Q;  5FXW A;  3AE3 A;  4PW8 A;  2KI7 A;  4DA4 A;  3PJA J;  2J6K A;  4IGU A;  1MV3 A;  1R77 A;  4PJO A;  2DTO A;  3AA7 B;  1IRE B;  2C0S A;  3JCM V;  3OKQ A;  3LW5 E;  4NS5 A;  5LJ5 j;  2CP5 A;  1OZ2 A;  2C5J A;  2K3B A;  3C95 A;  4GYS A;  1VQM Q;  1PRL C;  2XU8 A;  4DEX A;  4BI8 B;  1OEB A;  2QQB A;  4M77 E;  3OW2 P;  1XMO T;  1Q81 U;  2CBJ A;  4O4I E;  3AEG A;  3MP1 A;  4C5I A;  2QEX T;  3R84 B;  4JI6 T;  1N8R C;  4N0A A;  2LMJ A;  4Z91 A;  4TUY E;  2Z6E A;  1J5E T;  3OBY A;  2KMF A;  3CD6 Q;  1YJW T;  4JRI A;  3H0I A;  2WAU A;  1BKB A;  4L6V 5;  2HHH T;  3OS0 A;  1HJD A;  4M75 G;  2ED0 A;  3QG1 A;  3LGL A;  1UUR A;  2RQT A;  3F70 A;  4CC2 A; 
#chains in the Genus database with same CATH homology
 2Q9Q C;  2DLR A;  1NPP A;  2W62 A;  5CQX A;  4ZHQ E;  3NZP A;  3FIF A;  3MP6 A;  3NTK A;  5GMK h;  4XK8 E;  2OAU A;  1WLX A;  2LEH A;  3O1H A;  4ZGD B;  4HA8 A;  4M7D D;  1U5P A;  4QQ6 A;  4N4I A;  5FXX A;  3KV5 A;  2GQV A;  2RHI A;  3CX6 B;  2XUE A;  4PJN A;  5J2T E;  1JB0 E;  2IC9 A;  3NRY A;  1YW0 A;  2RP4 A;  5LA6 E;  2MTQ A;  3JB9 G;  4E7H A;  1D1B A;  3VKH A;  2WMO A;  3ZPO A;  3QDR B;  1VQM T;  2YLB A;  3PUQ A;  5ETW A;  3L3P A;  1XOV A;  3V7R A;  5L3C B;  1WJQ A;  5A0G A;  2DKG A;  4M77 C;  1BR0 A;  1M4Z A;  2Y48 B;  5L3G B;  1G3W A;  3UT1 A;  1YIT A;  5FXZ A;  2PVO B;  2LQK A;  5KX5 E;  3PGG A;  4X1K E;  4F7U A;  1B34 B;  2BIV A;  1UGQ B;  3MEU A;  2DCF A;  2A3D A;  4KBM B;  3ONX A;  4QQG A;  1X79 A;  2XIC A;  2DI4 A;  4J7I A;  4J5Y A;  2ODV A;  4O6J A;  1VQ9 T;  4H9R C;  1M8V A;  2K5L A;  3OYY A;  1YI2 T;  3P7I A;  3GN5 B;  3KFW X;  5CQY A;  3ZLI A;  2KLQ A;  3QK6 A;  3ESL A;  2E8I A;  5LHH B;  3SFM A;  4C92 D;  5GAN h;  1N27 A;  4JEU B;  3FC3 A;  1MMG A;  3F57 A;  4ZN3 A;  1FX7 A;  1GXI E;  5CVI A;  4BDZ A;  1IAP A;  1HK9 A;  4IUT A;  1MHN A;  2YEV C;  2BKD N;  4PNO A;  3OYA A;  3JCM d;  2CA5 A;  5DLQ E;  5FU7 B;  2VUB A;  2DWK A;  1BR2 A;  4YJ3 E;  3NRX A;  5CA1 E;  4A4K A;  2XAS B;  2CZ7 B;  2XAH B;  3RH3 A;  5HK3 A;  2VAS A;  1Q82 U;  4FU6 A;  3A5Z B;  4M77 G;  3ZYK A;  2X67 A;  4PJM A;  3UUL A;  2PG8 A;  1Q81 C;  3G4S A;  4A4H A;  4DO0 A;  2XAQ B;  1YHQ A;  2XD0 A;  3M59 A;  5LHI B;  3MAC A;  3KUF A;  4PJO F;  2QA4 T;  2DAQ A;  5CKF A;  4X9D A;  3JCM X;  5GAO p;  2CS7 A;  1VRB A;  5CCA A;  4NL3 A;  3ZEH A;  3JCM c;  2CYZ B;  4B6X A;  2E41 A;  3N2G E;  4O4H E;  1VQP T;  4BB7 A;  3I0Q A;  2DD4 A;  2V7I A;  2XQY A;  5I2S A;  2CWO A;  3CQC B;  2KZ7 B;  4HCC A;  4QHO A;  1US7 B;  4E7L A;  4IKF A;  2IAK A;  5CO7 A;  5GAN f;  1YJN T;  2VXF A;  1EIF A;  3I1A A;  1S72 T;  5HXC A;  2KWH A;  4LD6 A;  4GK0 E;  3DB4 A;  1BI3 A;  2LCL A;  2LSJ A;  2PQW A;  2VKO A;  3BQI A;  2W63 A;  2LRQ A;  3AA1 B;  3NTI A;  3I56 T;  2KVQ G;  1I5L A;  2A2F X;  4MFR A;  4XU2 A;  1HX8 A;  2EQU A;  5JQG E;  3AVR A;  5H6Q B;  5E0O A;  3L2Q A;  2VKD A;  3CX8 B;  4X9C A;  4B9X A;  2FL7 A;  1BI1 A;  3PTA A;  5C0M A;  2E9X D;  3E9G A;  4F7U F;  2X9X A;  3FBL A;  4XTZ A;  4OYJ A;  4M7D A;  2M67 A;  5LL6 S;  4N78 D;  3DLM A;  4I50 E;  3LBX A;  4BY6 C;  1XQH A;  1WPY A;  2QTX A;  4MHC A;  4I4T E;  3QPH A;  4G63 A;  1YHQ T;  2J1D G;  1WNL A;  3OYG A;  2LOS A;  3PMT A;  3CCS T;  3RC3 A;  2JVV A;  3JC6 D;  2L3R A;  1NJI U;  5LJN A;  3OSV A;  5BMV E;  3M9Q A;  4XTU A;  1OI1 A;  3EVY A;  2CZ1 B;  2LTO A;  3OMG A;  1YBY A;  4M78 E;  2XAF B;  2GFA A;  1Q82 C;  1Y96 A;  5A1L A;  4M78 B;  4EMK C;  5FMN A;  3JAM E;  4ILU A;  3G6E T;  1K9M U;  4J7F A;  5J2U E;  2MWO A;  3ZYL A;  5CKE A;  3FRN A;  1JJ2 S;  3L2R A;  4ELZ C;  3MEV A;  3SWH A;  4JLE A;  4OVA A;  3OYL A;  3RRW A;  2X9W A;  3QC9 A;  4C92 A;  2XK0 A;  4PJO C;  4M7A E;  4M7A B;  1UGP B;  3CCJ T;  2CM0 A;  2DPP B;  5JVD E;  1VQL A;  2OTL A;  3OS1 A;  4M1P A;  4X34 A;  4WF2 A;  3OYX A;  3IHR A;  4IE7 A;  2RI2 A;  4C8Q D;  5LJ5 e;  3C64 A;  3RKO A;  3LJC A;  5DY9 A;  3C50 A;  1VQ6 T;  4CI2 B;  3EFS A;  4N0A C;  2ZGW A;  3BK9 A;  1PSF A;  1G3S A;  2XTL A;  3CBP A;  5CIU A;  1YKE B;  4CXW A;  2LT4 A;  4AXP A;  5GAN 8;  1JJ2 A;  4UXN B;  2QQR A;  2ZM0 A;  2LM9 A;  1VQO A;  4A54 A;  4Q5W A;  1Q7Y C;  4IUP A;  2X4X A;  1LJO A;  3HKE E;  1D1C A;  3CCU A;  3HRS A;  3CPW S;  4OGC A;  5LHG B;  4LDU A;  3OB9 A;  1RI0 A;  3M4G A;  4XAX B;  3JCM h;  2EIF A;  2VKJ A;  5D6W A;  2QA7 A;  3A8O B;  3RRC A;  1D3B B;  2CZ0 B;  2EJF A;  3RYF E;  5LG4 A;  3AAA B;  1BIB A;  3U78 A;  1QSD A;  4ASK A;  3A8H B;  4R56 A;  2L3L A;  2JTM A;  4AQG A;  4PJO G;  5LNK A;  4JRP A;  5GMK l;  1SA0 E;  3N9N A;  2WSC E;  5LYJ E;  3A8M B;  2MAM A;  1VQ5 T;  5HKC A;  2LCC A;  3K3O A;  1NJI C;  1VQN A;  2E6Z A;  5DLO A;  3G71 A;  1I81 A;  4UVB B;  4M7D F;  3M57 A;  5GON E;  3MET A;  3FB2 A;  4I55 E;  2EQJ A;  1WJR A;  4BA9 A;  1N9R A;  1VQL T;  1U4Q A;  2NTX A;  3RYC E;  4MZP A;  3CPW A;  3FBZ A;  4ADZ A;  5AYF A;  4EXT A;  3L42 A;  1D1A A;  1MND A;  3X20 B;  2L89 A;  1K9M C;  2EKO A;  5LGT B;  3AAE B;  2HQX A;  4C0F A;  3ZBD A;  1LVK A;  1ZKE A;  5M4Y A;  3OYM A;  1QW1 A;  5C6S A;  1NPR A;  3OY9 A;  2E9X A;  2DTH A;  3HL6 A;  3QZ9 B;  1QVF S;  3HFO A;  4KMC A;  4MZT A;  3PUR A;  3ANW A;  2F5T X;  2E6N A;  1NZ9 A;  4WBO A;  2C5I T;  1O9S A;  4ZI3 D;  1KNZ A;  1B7T A;  4MBQ A;  5GAM g;  2NTY A;  3OBW A;  4QW2 A;  5GAO r;  4L9I A;  3M55 A;  4IUR A;  3CMA A;  4YTL A;  4RCC A;  4F7U G;  4X1Y E;  3WAK A;  1VQK T;  4C92 F;  4TX5 A;  3UTK A;  3FXD B;  3M58 A;  4K0U A;  3CME T;  3K3N A;  4AKG A;  3PMI A;  2W61 A;  2WSF E;  2CLY C;  2K5B B;  1Q86 U;  2ZPH B;  5GAO q;  2XDP A;  1VQ4 T;  3RIR A;  4A4F A;  1N9S A;  1LNX A;  3VHL A;  2NOX A;  3P8B B;  3ZYM A;  3OYI A;  3CCQ A;  4JS5 A;  3I9Y A;  1FMV A;  2O4X B;  3Q2M A;  3RMS A;  2H7O A;  3PNW C;  4EMK A;  2XG8 D;  3V8L A;  4E47 A;  2EJG A;  2VYT A;  4GY5 A;  5HY6 A;  2CE7 A;  3X28 B;  3E1S A;  1AHJ B;  2EHO D;  4C8Q A;  2LSK A;  4FT4 A;  2LVM A;  4DMV A;  1UB4 A;  2WBL A;  1MMN A;  4BE0 A;  4IDZ A;  1IJ5 A;  2H3J A;  4ISS A;  4L5G A;  2D0Q B;  1HF8 A;  2Q9Q B;  1VQ8 T;  4BAC A;  4MAL A;  1ZQ1 A;  3TRE A;  3DKM A;  2X4Y A;  3L2V A;  3SRZ A;  4RMO A;  3LFM A;  1LKX A;  1MNE A;  3CCR T;  3VYH B;  3ZN0 B;  3CX7 B;  4PK5 A;  3C51 A;  4QX7 B;  1UEB A;  4M7D C;  5HXE A;  3AA6 B;  4UV9 B;  3BDU A;  2Y8D A;  2XDD A;  4X20 E;  2HQE A;  4M77 B;  2N1G A;  3GWH A;  5LGU B;  4D6W A;  3SOL A;  2CGH A;  2FB7 A;  4HN9 A;  3S4U A;  1NAF A;  3VJP A;  4BDY A;  2RA1 A;  3HPW A;  3CCL A;  3FEO A;  3QHS A;  2KWI B;  4YLH A;  4J2C A;  4HT8 A;  5JDF A;  1YIJ A;  3S3N A;  5GAO m;  5JR9 C;  5JRC A;  1X75 C;  2K57 A;  4ZTF A;  3P8D A;  5GAN 2;  3CC2 A;  4ELY C;  2DNX A;  4IE4 A;  2YU1 A;  4C0Z A;  2O01 E;  2DXT A;  2WMN A;  4X1I E;  4PKC C;  5CKH A;  3CCE T;  4JRQ A;  2L9Q A;  2ZPF B;  2LJL A;  5LP6 E;  3M65 A;  3OW2 A;  1YJ9 T;  4CXY A;  2E1H A;  2OTJ A;  1OXZ A;  2N2N A;  4QWN B;  1KHC A;  3I55 A;  2LQ8 A;  3ZCJ A;  5F8P A;  2VXE A;  2XAG B;  2X4J A;  4C92 C;  1YCY A;  3CWZ B;  4UVA B;  4BJM A;  1Q86 C;  5FLX E;  3KV9 A;  4HKE A;  2V7L A;  4C0D C;  5JDM A;  1UCU A;  4QVD A;  1QVG S;  2A72 A;  3WXM B;  1PSE A;  2V8J A;  3AVS A;  4JEH B;  4M7D G;  4LDW A;  3OA6 A;  2QXF A;  2JN0 A;  1RL2 A;  3R6O A;  3X24 B;  3CPF A;  3E08 A;  5FU6 C;  3G7Z A;  3JB9 J;  2L8K A;  3CCV A;  2LNV A;  4PJJ A;  3LYI A;  1HTJ F;  3PT9 A;  5GAN 7;  2X66 A;  3EDV A;  3C94 A;  3M4Y A;  3HP9 A;  3MCA B;  5FY7 A;  2YLC A;  3KV6 A;  1KQS S;  2PBI A;  3N9P A;  2VL8 A;  2M9U A;  3ETU A;  4AQF C;  5HK0 A;  3H3A A;  2WSE E;  3NFC A;  3DTO A;  3L2U A;  3SDZ A;  2ZM8 A;  3N9L A;  2DEQ A;  4ZTJ A;  3BQK A;  4NL2 A;  2V26 A;  2DWG A;  3MJX A;  2LE8 A;  4DMW A;  4RCB A;  4XZC A;  4HE8 A;  4FSX A;  4MZM A;  3SD4 A;  1KD1 U;  1QVG A;  2B1E A;  5J1G A;  2JMK A;  4C8Q F;  3ZMU B;  1EZ3 A;  5GMK j;  1M1G A;  3QYH B;  2LHN A;  4O8S A;  4QVC A;  4C92 G;  3OS5 A;  2BUD A;  3PUG A;  4MMK A;  4PLL A;  4AKR B;  2LSG A;  3CPZ A;  3ZC1 A;  2W0G A;  5CB4 E;  5CR2 A;  3VKI A;  3PDY A;  2YU2 A;  3GA8 A;  1KQ1 A;  3JB9 I;  2DHR A;  2DD5 A;  2RD1 A;  3CQX C;  3S6W A;  1YIT T;  5FRO A;  2CXD A;  1UX5 A;  1W2B S;  4EPC A;  1KQS A;  2AHJ B;  3P8C D;  2BDE A;  3E22 E;  1X01 A;  4EB6 E;  2EHO A;  2V1D B;  4XU1 A;  2NLU A;  3UWN A;  3PU3 A;  3TEE A;  2G0U A;  3J7Y q;  2LC4 A;  3TKL B;  1MIV A;  3RYI E;  3AAI A;  4GOU A;  2X9Y A;  2YK0 A;  3KV4 A;  2X9H A;  2RI3 A;  2XHC A;  2R5A A;  2XID A;  1M5Q 1;  4BY6 B;  5J3B A;  4FI5 A;  4KP3 C;  2SPC A;  2HBP A;  2F5K A;  4PLI A;  2E9X C;  3UUN A;  3N2O A;  4DVD A;  1ZHI A;  1QVP A;  4C5G A;  4H9N C;  2N9D A;  2K2V A;  5LJM A;  2DO3 A;  4L59 A;  5GAM f;  4UF0 B;  3CC7 A;  1Q7Y U;  3OSS C;  3NTH A;  5GAN j;  1G3T A;  3J81 E;  4BE2 A;  3B13 A;  4CI0 C;  5HXS A;  4EMG A;  4NOY A;  1W2B A;  2EFI A;  3CXC S;  2A3L A;  2DJZ A;  4J6W A;  4ZGJ B;  3P8H A;  3JC6 C;  4EMK B;  3CEY A;  4M7A F;  2K3X A;  2WAC A;  3L2Z A;  2ZMA A;  1MGQ A;  2LSY A;  4Z02 A;  5EG2 A;  2M1H A;  2WSS V;  3SWN A;  3QJ6 A;  2HPL A;  4LD9 K;  4TZ4 C;  2JRK A;  3GIB A;  3CVR A;  4BE1 A;  2D0T A;  3BY7 A;  4O5V A;  5L8R E;  5LJ5 g;  3G4S T;  2MF2 A;  3JCM e;  5DAB A;  3LWI A;  4EAH A;  4PJO E;  4PJO B;  2X0L B;  3V7S A;  2FVU A;  1WYC A;  4YFS A;  2VKH A;  3SB2 A;  4ZOL E;  3TU4 K;  1KD1 C;  5JR9 A;  2V7K A;  3GLX A;  3J80 E;  3RER A;  3CXC A;  2MBG A;  4DOV A;  2ES0 A;  4CQI A;  1FEW A;  2X51 A;  1WR6 A;  2FYK A;  2ZLY A;  3KIN B;  4C8Q C;  4AI6 A;  3C4S A;  3HHT B;  3OMC A;  2LT3 A;  1Y64 B;  1VQ7 A;  4R55 A;  3ZCI A;  3KBU A;  4HCZ A;  2ODU A;  2E5Q A;  4AKL A;  2DZC A;  4JUV A;  5LJ3 e;  4PK4 A;  4C5E A;  3KDS E;  1TH7 A;  3MEW A;  2XKO C;  3OYN A;  2K3Y A;  1S35 A;  2QI2 A;  5JDQ A;  4QX8 B;  2PVD B;  2NW8 A;  3JCM b;  2RK2 A;  1LVF A;  3HKC E;  5LOV E;  4XTY A;  3N2K E;  4KUI A;  5EK2 A;  2PUK B;  4C90 A;  3UFE A;  4ZI2 D;  4O4L E;  1BYM A;  4V2S A;  1HS7 A;  3LK4 2;  4F7U E;  4EMH A;  2CKK A;  2CXF A;  3C98 B;  4F7U B;  3DJB A;  3FB9 A;  3OYE A;  4CRI A;  1LRZ A;  4OMF B;  3X25 B;  4OF1 A;  3HKB E;  1D0X A;  3ETV A;  3RKX A;  3VUZ A;  4OYK A;  1QUU A;  3MXZ A;  3JCM P;  3PFS A;  4AQF A;  1MMA A;  1S94 A;  3VKG A;  2PUO B;  3O9X A;  1V9D A;  4P0B A;  2L5Q A;  2I59 A;  1O75 A;  4NUV A;  4C8Q G;  4HFV A;  4M75 F;  3PE0 A;  1B34 A;  3CBM A;  3H6Z A;  1HFA A;  3O4X E;  4M78 D;  1JBM A;  2YIN A;  3GMI A;  4PK6 A;  1UGR B;  2RHX A;  3JCM W;  2E12 A;  4C5H A;  2E65 A;  1HG5 A;  4H9S E;  5KE3 A;  3CML A;  3GN5 A;  3JB9 F;  2QQA A;  4XTV A;  5KMG P;  4MLK A;  4C91 A;  2RHZ A;  1X6O A;  4JDS A;  1UGS B;  4N4H A;  2RB6 A;  5IYZ E;  5FYM A;  2VGM A;  3FJP A;  2KK4 A;  2UXX B;  4KT0 E;  4M7A D;  2QGS A;  1VOM A;  3WI3 A;  2OTL T;  1H64 1;  3LWH A;  4BD3 A;  3QII A;  4QKN A;  1M1K C;  5GAM d;  4ZI3 C;  3RKY A;  2X4W A;  1I8F A;  3L09 A;  2ZM2 A;  3RYH E;  4AKH A;  3IEE A;  5KH6 A;  1KC8 U;  3NZQ A;  3HR0 A;  2K4Y A;  2CLY B;  3JCM Q;  3OQ5 A;  1Z0P A;  3ZEF B;  4FIB A;  4BJN A;  2HD0 A;  3CCM A;  5I21 A;  2QQ9 A;  4H9O C;  2JQQ A;  5GAN 3;  1WGS A;  5LBQ B;  2JZ2 A;  3W15 B;  2GK9 A;  4MML A;  2UXN B;  1VQO T;  4IE6 A;  2B8A A;  5L3D B;  3A8L B;  3QKJ A;  2ZZD A;  3CC4 A;  3S3O A;  2V8I A;  3CCU T;  3Q9D A;  2XI9 A;  4UIG A;  3FDR A;  3CBO A;  4J6X A;  3ASK A;  3PUA A;  2DZ9 A;  2C5K T;  5GMK e;  1R8O B;  4BI4 A;  4UVC B;  2Y90 A;  3LX7 A;  1E1H B;  4KUD K;  4Z8X A;  2MOZ A;  2YRV A;  2CMR A;  4LDV A;  4E7S A;  4Y91 A;  3O1I A;  4OB3 B;  2QEX A;  4M77 F;  4ZI7 E;  4H9Q C;  4XBF B;  2EHO C;  2GF7 A;  3H8Z A;  1YJW A;  3VYG A;  3RMQ A;  3MKD A;  1IZN B;  2MWP A;  1QP3 A;  2RHY A;  5EK3 A;  1D0Y A;  3I9W A;  4CXX A;  1VQN T;  3MP8 A;  4M7D E;  3G71 T;  4BI3 A;  2M0O A;  4M7D B;  4JJN K;  3HRT A;  1HG2 A;  3LBX B;  4J8O A;  4A4E A;  2P0K A;  4M75 C;  3TCJ A;  2K48 A;  1MMD A;  3QYG B;  2IC6 A;  3ZMT B;  4J6Y A;  5I2M A;  1K8A U;  1VQM A;  5LGN B;  3A8G B;  3JRZ A;  2VB6 A;  4V1A v;  2JUF A;  5DJQ C;  5GAN e;  2RI5 A;  5JR9 B;  3CD6 A;  2EQM A;  4JLG A;  4OB1 B;  1Y96 B;  1WYB A;  1O3X A;  4IE0 A;  4ERR A;  5KE2 A;  4M75 D;  1K73 U;  1VQ9 A;  2DXB A;  3OW2 S;  2HH7 A;  5LJ5 f;  2K24 A;  1QP2 A;  3C4X A;  2R58 A;  3M53 A;  3ER0 A;  2F69 A;  3SWN C;  4WNK A;  1YI2 A;  3CMA T;  3LGF A;  2KSS A;  5HAX A;  2RHU A;  5LXT E;  4C92 E;  3OS2 A;  1KC8 C;  5HXH A;  2E64 A;  5DQV A;  3K3Q C;  4C92 B;  2DXU A;  3OYD A;  3I0O A;  4ZGE B;  1WRD A;  5HXR A;  3INZ A;  3JB9 D;  5GMK i;  2Y4Y A;  3BW1 A;  2KMT A;  4M78 A;  4C0D B;  2EWN A;  3MO8 A;  1ZBX A;  2M16 A;  4PJL A;  3UPU A;  4OP0 A;  1VUB A;  2RK1 A;  3EAE A;  3N5B B;  3AHU A;  4QXC B;  1JRI A;  2ZCF B;  3Q5X A;  5FU6 B;  2XDB A;  3UT5 E;  2RH2 A;  3CCQ T;  5FRN A;  2KT9 A;  3DB3 A;  3MHX A;  2H7V C;  5L3F B;  4O2A E;  4M7A A;  1G3Y A;  2BVL A;  2W00 A;  4EOZ B;  4DBR A;  5FRM A;  1KQ2 A;  2KXP B;  4A4G A;  4TVR A;  4CI3 B;  2LHR A;  5J26 A;  4ZS3 A;  4E7J A;  2QA4 A;  3V7C A;  1SHZ C;  1FXX A;  4ANJ A;  2Q9Q D;  3OJA A;  2EQK A;  2GFU A;  2MYS A;  3N9M A;  2D5U A;  4UV8 B;  3CD6 T;  2K9A A;  2EAY A;  2IW5 B;  5C8Y E;  3QXE B;  2KND A;  3MA9 A;  4OB2 B;  1VQP A;  2IG0 A;  2RJD A;  1V29 B;  3OYZ A;  5GAN 6;  1FWZ A;  2P9B A;  3KBG A;  3H37 A;  1M9S A;  2LT1 A;  2RJF A;  5CKD A;  1BIA A;  1NE8 A;  5D6X A;  3KBT A;  4H63 H;  5GAM h;  4M77 D;  4OHF A;  2K5I A;  1K8A C;  3RPU A;  4A56 A;  4MDX A;  2KDS A;  4IST A;  4FJO A;  4KUM B;  3HI2 A;  4OB0 B;  1YJN A;  3V8K A;  4MDW A;  4NUU A;  1S72 A;  3CCL T;  2NW7 A;  3CQG B;  1D3B A;  2OA5 A;  1WQW A;  3BFM A;  1YIJ T;  1Y71 A;  1UX4 A;  1OZ3 A;  2X35 A;  4IUV A;  4WW0 A;  3L1A A;  3I56 A;  4QVZ A;  1K73 C;  5HYA A;  3MZK B;  5CKB A;  4E7I A;  2RM4 A;  3CC2 T;  3T8O A;  4O4J E;  2LDM A;  4HGA A;  3R6N A;  5GAN 5;  2D6F A;  4FM4 B;  3VUB A;  2E9X B;  5EZY E;  2P0Q A;  1U1S A;  1ZV4 X;  2OTJ T;  3ANW B;  1LOJ A;  3I55 T;  5M9O A;  5IAY A;  4DQ2 A;  1T98 A;  5D6Y A;  4JUY A;  3LK2 B;  2H3R A;  3GNF B;  2PU9 B;  3C4W A;  3JCM g;  5GAO n;  2A7Y A;  1IJ6 A;  4HTE A;  4P0A A;  4QQD A;  5FY1 A;  3CCS A;  3PTR B;  2ACX A;  2D2S A;  1HXD A;  5GMK m;  3QUJ A;  1D0Z A;  1OWA A;  2EJ9 A;  1KK7 A;  3ME9 A;  4YHJ A;  5FU7 C;  3E9F A;  5JDG A;  4ZS2 A;  5LJ3 d;  2K5F A;  4M78 F;  4M75 A;  2NWB A;  3O8V A;  2DTI A;  3CCV T;  4LDX A;  4PFP A;  1W4S A;  1KHI A;  3G6E A;  3PU8 A;  3S3M A;  2XHE B;  3CKD A;  5A0D A;  5LJ5 d;  3HA4 A;  3HKS A;  4GLK A;  5HWY A;  2ZPG B;  3N9O A;  5KCH A;  3Q5W A;  1HCI A;  2R5M A;  1N6A A;  1CUN A;  1BR4 A;  3VU3 C;  4XU0 A;  4FT2 A;  5GAM j;  3GPL A;  2CWY A;  2RO0 A;  4BUG A;  4HKA A;  3Q1J A;  4FL6 A;  4U72 A;  5J39 A;  2X68 A;  5LJ3 g;  3CCJ A;  3JB9 H;  4C8Q E;  5JH7 E;  3VU7 H;  3FLG A;  4C8Q B;  4JRK A;  1KG1 A;  3OBV E;  2L8D A;  4RKU E;  3UUM A;  3V5S A;  2KQW A;  4TV8 E;  1U8R A;  5FP3 A;  2LSI A;  1VQ6 A;  4ME7 A;  2JOY A;  2PJQ A;  2P4T A;  2E70 A;  3ZC0 A;  1MIW A;  2FHD A;  3OYF A;  3UDC A;  3M54 A;  4ZN1 A;  5GAO l;  2GCX A;  2O4X A;  3ZMZ B;  3MEA A;  2ZPE B;  4KUL A;  4EZ4 A;  4EYY R;  2ZPB B;  4O2B E;  1OYX A;  2V7M A;  2Y6X A;  4H63 V;  4UEL A;  1U1T A;  3JCM J;  3HKD E;  3SS1 A;  1M1K U;  3C12 A;  4IIJ E;  4UEM A;  4VUB A;  3ZN1 B;  4PAG A;  4GK5 E;  2VWA A;  5FNV E;  2Q9Q A;  2QQS A;  4GIW A;  3RC8 A;  1WQ7 A;  1H7C A;  4E7Z A;  4IUQ A;  2D9T A;  1AJ3 A;  4ZI2 C;  1M90 U;  4OGE A;  2VC8 A;  3K8P C;  4XTW A;  3QBY A;  5F3J A;  2DIG A;  3QUI A;  4G2A A;  2IVW A;  3F2E A;  3PUS A;  3GOX A;  5JRC B;  1BR1 A;  1P92 A;  3OYJ A;  4IE5 A;  4XU3 A;  3PIP A;  5CA0 E;  5LCY A;  3RKW A;  1FMW A;  1DJ7 B;  5IT9 E;  3CC7 T;  3QSU A;  4M77 A;  2JJ9 A;  4BAY B;  3T9N A;  4N4G A;  3X26 B;  1VQ5 A;  3BQL A;  4C0G A;  2WM9 A;  5GAN 4;  4OK0 A;  2XAJ B;  3N5L A;  4JLI A;  3VV0 A;  2RJC A;  2CXL A;  3HSB A;  4TV9 E;  2PVG B;  3EUH A;  3PIO A;  4PFO A;  3NBX X;  4DND A;  4DOW A;  1Y07 A;  1MIY A;  3V5U A;  4M78 C;  2BVM A;  2CCQ A;  2E10 A;  4F6R C;  4PL6 A;  4LDY A;  4WBN E;  3GP8 A;  3M56 A;  3FHN A;  3OYK A;  1FIO A;  3HL8 A;  4PJO D;  2C06 A;  3C4Z A;  5H6R B;  4QXH B;  5HWX A;  3L2W A;  1IZ6 A;  3OYC A;  3O1J A;  2BZB A;  2NW9 A;  2V8K A;  4E7K A;  4M7A C;  2R57 A;  2VV5 A;  2QDY B;  2DK3 A;  3J7A F;  4EIW A;  4DBQ A;  4GYR A;  1VQK A;  3F31 A;  2DVE A;  2HPJ A;  3QO3 A;  3CME A;  1VQ7 T;  5DQW A;  2JNG A;  4XTX A;  1G5V A;  4H9P C;  4P5N A;  5JDN A;  3QZ5 B;  1WJS A;  1VIE A;  4J83 A;  1VQ4 A;  3GF5 A;  2JPF A;  3UUX B;  2KAF A;  4RG2 A;  4P09 A;  3AA0 B;  4RG8 A;  5CK9 A;  3ZFJ A;  3E19 A;  5LBM A;  4UC4 A;  1H3Z A;  2VK9 A;  2KY9 A;  1YKH B;  4M78 G;  2YHT A;  1G8X A;  5A2Q E;  5GAN d;  2JMH A;  1BI0 A;  1Y7X A;  2CEA A;  1M90 C;  3HRU A;  4I43 B;  3IF8 B;  4CZZ B;  1BI2 A;  4L0R A;  2HAX A;  5KDM C;  2EHO B;  3OYB A;  5LJ3 h;  4JS4 A;  5JDL A;  2LOP A;  3IBP A;  3V8J A;  1N8R U;  5L3E B;  2VGN A;  3FXE B;  3LG7 A;  5AFU L;  5JDH A;  3ZMS B;  2ZPI B;  2NP9 A;  4U74 A;  1VQ8 A;  4II1 A;  1ZEE A;  2EYQ A;  1YD8 G;  4EYU A;  2P0P A;  5LJ5 h;  4M7A G;  1SSF A;  2KIN B;  5EK4 A;  3ZJ1 A;  4M75 E;  4QXB B;  5GAN g;  5KCO A;  3QJY A;  5L3B B;  3CCR A;  4M75 B;  5FXV A;  3ZMV B;  5TAO A;  3RUX A;  4ATO A;  3J9X 1;  4EZH A;  4PNI A;  3RX6 A;  3JCM f;  3M5A A;  5IHY A;  3D0T A;  4YJ2 E;  3BDL A;  2DIQ A;  1VIF A;  2HNI A;  3GNG A;  3JSC A;  3EFR A;  1G73 A;  5JRE A;  4Y28 E;  5L2L A;  3LK3 B;  2RJE A;  4HCB A;  4IHJ E;  2WWU A;  3MK7 C;  4A53 A;  2MMP A;  2G3R A;  4CI1 B;  3AB3 B;  1M1F A;  4HT9 A;  1I4K 1;  3E0Z A;  4OFZ A;  3WVE B;  4HEA A;  3DLL A;  2RA2 A;  2D0U A;  5ADX L;  2DXC A;  3HFN A;  1XTD A;  3SWN B;  2V7J A;  1QVF A;  1XNI A;  4XQ3 A;  3EDU A;  4UF0 A;  3U3I A;  3URG A;  2JTF A;  2MI6 A;  3KVA A;  3CCE A;  3B57 A;  3OYH A;  3LH0 A;  3A5X A;  3ZJ2 A;  1YJ9 A;  3WVD B;  3LLR A;  4B9W A;  3KVB A;  2Y4X A;  5CAI A;  2PFV A;  3CCM T;  5IN1 A;  4TN7 B;  2LX9 A;  4AKI A;  5LJ3 f;  5A0L A;  3N9Q A;  5FY0 A;  3RES A;  4EDU A;  5DM7 R;  3DP7 A;  5GAM e;  3KXT A;  1NWM X;  2I2L A;  4IUU A;  3CC4 T;  1ZHC A;  2CZ6 B;  5LJ3 j;  3WAJ A;  5FXW A;  4PW8 A;  4DA4 A;  4IGU A;  4PJO A;  2DTO A;  3AA7 B;  1IRE B;  2C0S A;  3JCM V;  3OKQ A;  3LW5 E;  4NS5 A;  5LJ5 j;  1OZ2 A;  2C5J A;  3C95 A;  4GYS A;  2XU8 A;  4BI8 B;  2QQB A;  4M77 E;  1Q81 U;  3MP1 A;  4O4I E;  4C5I A;  2QEX T;  3R84 B;  1N8R C;  4N0A A;  4TUY E;  2Z6E A;  3OBY A;  2KMF A;  1YJW T;  4JRI A;  2WAU A;  1BKB A;  4L6V 5;  3OS0 A;  4M75 G;  3QG1 A;  3LGL A;  3F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...