4XAXB

Crystal structure of thermus thermophilus card in complex with the thermus aquaticus rna polymerase beta1 domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CarD uses a minor groove wedge mechanism to stabilize the RNA polymerase open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription regulator
molecule keywords DNA-directed RNA polymerase subunit beta domain 1
total genus 47
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4xaxB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xaxB01
4KBMB 2EYQA 2LQKA 2LT3A 4KMCA 4XAXB 4L5GA 4ILUA 2LT4A 2LT1A 4MFRA
chains in the Genus database with same CATH superfamily
3CD6T 3Q5WA 4D8DA 3QZ5B 3QYHB 4IDQA 2K9GA 3CMAA 4IUUA 3EFSA 1TTHB 1YJWQ 4BE2A 4QVCA 2K5FA 3QK6A 4X64T 5GANd 1KFZA 3KFVA 2D0QB 4JI2T 5IYZE 1V1CA 5ABFB 2UXBT 3CMAQ 2KVQG 3CCLA 3O4XE 2DFUA 2EHOD 3KBGA 3WVDB 3FB2A 3TLTA 3WAKA 2KR3A 5HK0A 1LOJA 3LGLA 5JDMA 5EZYE 2BG9E 3QB5K 1WDXA 1VQMQ 2YXYA 1NAFA 2BG9B 3CD6Q 3JC6D 2RF0A 3BQLA 1RI0A 2DVJA 5EK4A 1EZZB 1UTIA 2KZ7B 2PVDB 1BR1A 2NTXA 1SA0E 2VXEA 3M65A 2COYA 2MAWA 3N5BB 4RTTA 4M7AE 5KDMC 2D0NA 3KVBA 2EPDA 1NJIC 4X66T 1WX6A 1E7PA 1RAGB 4QH5A 1WHHA 4I50E 3H0HA 4X20E 3VRYA 1HFAA 3AEDA 2J6OA 2VGMA 5EG2A 2ZPIB 5HCKA 4LF8T 2VWAA 1HR0T 4ZTJA 2XAHB 1H3HA 4TUYE 3NHNA 2XU8A 3EFOB 1OOTA 3QB5A 4EB6E 3VRZA 3MKDA 4OFZA 2MPKA 3HKEE 5L4HA 2F2WA 4JZ4A 1D3BB 3PFSA 3G06A 2YEVC 3MCAB 2WDVA 2FBWA 3EDUA 1TU0B 3PJAJ 2XIDA 2I0NA 4YTNA 3OYBA 3E08A 5IT9E 1K0SA 5GJVB 4ZXLA 2B8AA 2Q9QC 3NTIA 4UXNB 2BE9B 3JCMW 1TUGB 5FRMA 5FWCA 1WQ7A 3PUGA 3PUXF 2KXDA 4AKLA 1YIJT 3FDRA 3RKWA 2W0GA 5IN1A 5HWYA 4L9IA 4V1Av 1K9MU 4HWCA 3SB2A 1BBZA 1V9DA 1N27A 3MACA 2A0FB 2CE7A 1D09B 4MHCA 5KE3A 4M75A 1NG2A 2Y6XA 3VYHB 1IHWA 2K2MA 3CX7B 2EQUA 3AXJB 1V29B 3G4SQ 2DXUA 2H7OA 1N33T 2ABLA 2F69A 2B86A 3BW1A 5J39A 4LD9K 2A28A 1NYFA 4B3TT 4Z91A 2K9AA 4QHOA 4E7JA 2SPCA 1KD1C 2DF6A 3LSVA 1OU8A 3ZC1A 2I6HA 2PJQA 1UCUA 3E22E 3P7IA 2EYWA 3EGXA 3UU4A 1ZBJA 3BDUA 4PJOA 3ZT5A 4HFHA 1Y64B 3I1AA 4JI4T 2O31A 4Z89A 5KH6A 3U78A 3CC4Q 3OBVE 3TKLB 2LCLA 2QQ9A 3M0UA 2WSSV 3RKOA 3A8HB 5HK3A 1VQ5T 2KYMA 1CKAA 2E9XC 4R56A 3KBTA 5CCAA 4CXYA 1AT1B 3RPUA 3A8MB 3EG9A 4ISSA 3PUZF 5GONE 2KRNA 4F17A 1KIKA 2LT3A 5L3EB 4N4HA 1BR2A 4X34A 2NUPA 2QK0A 1K8AR 2XQAA 5KMGP 3GN5B 4CRIA 1QMCA 1KQSA 4E7IA 1KEYA 2V26A 2ODVA 1G83A 2HD0A 1H7CA 3G6EQ 2M67A 2F2VA 4KBMB 2LP5A 5D6YA 3RUXA 1AWWA 2CP3A 4J5YA 4I43B 1IXDA 1FEWA 2HZYA 1Q82C 2HDAA 3JB9F 1I1JA 4TNVA 2D1XA 5L23A 3JCMQ 3JSCA 3KVAA 5L3CB 2HQHA 5FVKA 4ME7A 3VS4A 4AXPA 2E6NA 2ZPFB 2LEHA 5CIUA 4XK8E 3VU7H 3AB3B 4H9PC 4DIDB 2L3LA 3L39A 1U06A 3I56Q 2L3SA 4ZN1A 4QQGA 4Z90A 1VYVA 2HBWA 5ECAA 5AQVB 3NTKA 2QAZA 3O1IA 2FG0A 4IIOA 2KWHA 3G1JA 4M4ZA 1YCSB 4J6XA 3CKDA 2KT8A 2DHRA 1M2VA 3QKJA 3OYGA 4U3CA 3FZKB 2EWNA 2C0TA 2WS3A 4QVDA 3J81E 1ZQ1A 4FYXB 1HX1B 2LTOA 2LSJA 3FHNA 1YI2Q 1IBKT 1BI2A 3RIUC 1CSKA 1VQ7T 5H6RB 4M77B 2NWMA 4OMNA 4C91A 5LJ3f 5LOVE 3SOLA 2W0ZA 1LJOA 1N9SA 4UF0B 3ZYKA 5L3BB 2V8SV 5GANf 3HKSA 3MP1A 2CHNA 2DNXA 3JCMb 3VS1A 1TSFA 2X4JA 2JMCA 4M7DE 4ZS3A 3JAEA 3C4XA 3EGDA 3ETUA 4TN7B 2DXTA 3UTKA 4YSZA 5IXBA 3M58A 4RG2A 2FZCB 2DI4A 2N1GA 2VL0A 4TV8E 2A08A 1X2KA 4IUQA 2N9DA 2XDDA 2C5KT 2E10A 3DB4A 1WIEA 4BI8B 3HKCE 4DV6T 2EJFA 2KMTA 2VWFA 2ZM0A 5LG4A 4BAYB 3Q5DA 4JLGA 4PK4A 3I55Q 2JOYA 3C0CA 1I81A 2JZ2A 2JQHA 2X66A 3SWHA 4J6YA 4O5VA 5I21A 2DMOA 4TV9E 1ZA2B 2H8HA 4WF2A 2JN0A 1JNRA 2A2FX 3C4WA 2QQRA 3X25B 2DWGA 2A37A 1VIEA 4HWIB 4P1NA 5JDFA 2EQIA 5AQPB 2L9QA 4HGAA 5GMKl 3EG1A 5D6XA 3LWIA 1YBYA 2YLBA 4F6RC 3PUYF 4GK0E 4C0ZA 1W0BA 2XQ7A 3SFEA 4ADZA 3M53A 4RUGA 4HE8A 2M1HA 4QT7A 4A5XA 2HQEA 1AOJA 2P84A 2CM0A 3S3MA 2LKGA 2XK0A 4ZGJB 4GK5E 3H0FA 3F70A 4LE9A 5KYXA 2LJ0A 2M16A 4JRPA 3OQ5A 3L09A 2EQMA 3NTHA 4M7AB 3UU8A 3RNJA 1I8FA 4FIBA 2RD1A 4A4GA 2XQ9A 5LGNB 1BYMA 4ILUA 2OTLQ 1IO6A 2V6YA 2E70A 3ZT6A 4E7LA 1VQKT 3BQKA 4JI8T 3HRUA 3NGPA 3P8DA 3J7Yq 3G4SA 2LX7A 4PJOD 2PVOB 3C98B 4JBWF 1QQJA 3CBOA 3Q5XA 4DMWA 1XOVA 5GAMd 3GBQA 1T72A 4KUMB 2DL3A 2DCFA 4M7AG 1UGVA 5IWAT 1VQ9Q 4FCYA 1N8RU 1R8IA 3MXZA 5J2TE 4B9XA 1OPLA 4RTYA 5GMKi 4CXXA 1VQ6A 2XQ5A 1H8KA 1T8BA 4RCBA 2K3WA 3AE7A 1HYOA 3HR0A 3VKIA 2QA4Q 4M78F 4O4HE 5LYJE 1Q81C 3L3PA 4HWDA 3EGXB 1WA7A 2LQNA 5AQQB 3DKMA 3QYGB 1W0AA 3EHZA 1FMVA 1HF8A 4DV4T 1NEKA 3H37A 3X1DA 5DQVA 2LM2A 2D0TA 3P8CD 4TWHA 5HKCA 1M90C 5FXXA 2ACXA 3HTRA 2YT6A 5FKYA 4RTXA 3QWXX 4LMKA 2Q9QA 4PNIA 3FXDB 3FZMB 4U7YA 1DJ7B 2AZSA 2VQET 4GLKA 1O75A 1WHLA 3MO8A 3REBB 2Q9QB 1ARKA 2W00A 1WI7A 4MLKA 2PZ1A 3I0OA 1OEDE 4FYYB 4UELA 2DEQA 8AT1B 4OMPA 4IDZA 5CJ5A 2DKGA 1SHZC 4CN1A 1C0MA 2M6IA 2UXCT 3L42A 5GAN5 4I55E 3OYEA 2E5LT 3G71T 2NW7A 5JDQA 3F57A 1AJ3A 3EABA 3OPCA 2M51A 4F7UE 1W4SA 3GNFB 3JAME 3CCQQ 4E7HA 4L6V5 1N8RR 1YJNQ 2G0UA 4X65T 4M77G 2XUEA 4MZPA 3M3ZB 2YLCA 3DLMA 4E6RA 2P4TA 3ZSTA 2RPNA 4QH1A 4BDYA 4DV5T 4LDYA 4LDXA 2BDEA 2RPAA 2YRVA 2EW3A 3EFOA 2DPPB 4J8OA 1UHCA 3ZMTB 2E1HA 1YJNT 1M8MA 5FP3A 4Q5WA 5IHNA 2V6XA 2FYKA 2QA7A 5A1LA 1WHKA 2JM8A 2L3RA 3SWNC 2RHYA 4K0KT 4ZOLE 3M55A 4E47A 1AZEA 4M7AC 2HBPA 1FX7A 5HEHA 3L8RA 1KC8U 1Z8UA 3QDRB 2H7VC 2CHOA 2W61A 2KSSA 2LHNA 3B13A 4P0AA 1LKXA 3ZMUB 1WHJA 2IUBA 2PUOB 4ZI2D 4C8QG 3MJXA 4BI3A 1T3LA 3CEYA 1EIFA 1OX9A 3A8LB 4CC7A 2WSEE 1UUEA 2HSPA 4KT0E 3AEAA 3VYGA 1BU1A 2G3RA 4MFRA 2MIOA 2NUTB 3H6ZA 4B6MA 1VQOT 5CAIA 1KF6A 4H9RC 1SSHA 1TXQA 2OI3A 3RLFF 4UVBB 5CFBA 3IEEA 2X9WA 2WSCE 4BD3A 2GTJA 2W10A 1S94A 4OMQA 3HKBE 2X0LB 5LJ5e 4BB7A 2JQ9A 2VXFA 1M1KC 5LJ5g 5AQJB 4M77E 4OB1B 1O9SA 4JRQA 3PV0F 2KT1A 2VKHA 3I9WA 3HRTA 1UX4A 2WQYA 5HXCA 4Z8XA 4II1A 2CKKA 1S72A 3OY9A 2DVEA 2A3LA 5LJ3d 2K48A 2EBPA 3LJCA 2QDYB 3VS0A 3OW2A 3RYCE 1T98A 1YITQ 3X26B 1I5LA 4J6WA 2CXLA 3CQTA 5GMKe 3JB9I 1NEBA 2FPDA 1K8AU 5CKEA 1QCFA 2AT1B 4CC2A 5AQOB 1MHNA 2NW9A 3QPHA 4N0AA 2QQBA 4ILAA 1PRLC 4AT1B 1KC8C 4MZTA 2FJBA 3PE0A 2W62A 1ZLMA 3JCMg 2X35A 1UGQB 3UT1A 3VR9A 2LHRA 3ME9A 3QJYA 3RMQA 3ZEHA 3OS5A 3JCMP 2BKNA 4JEUB 2LSKA 2KWIB 2ZAEA 5KYUA 1VQNT 4ZEYA 2BVLA 4O2BE 2BIVA 4M7DF 3QZ9B 1QP2A 4NUVA 3JRZA 5L2LA 3CCLT 4XTXA 2WMNA 3FZHB 2F5KA 3OYJA 2VL8A 5GANh 3MP8A 1Z9ZA 1WJRA 1XDPA 2X9HA 2I59A 2QRXA 1CHUA 2E64A 2K3XA 3QG1A 4FT4A 4QH4A 2DETA 3U3IA 4UV8B 4JRKA 4TX5A 4CI1B 2YRDA 3E0ZA 1NZ9A 4JI3T 2V7KA 3H0IA 5KYYA 2XHEB 3EG2A 4DA4A 1VQOA 4QKUA 2ED0A 1XWMA 2VVNA 2DZ9A 3AHUA 4DMVA 2PU9B 4NS5A 1UG1A 3CXCS 1VQMT 2HN2A 3CPZA 3N9LA 1YHQQ 3M4YA 1W6XA 1SSFA 1KC8R 3SRZA 3GA8A 1U5PA 3GMIA 3RRWA 2LM9A 4ESRA 2FEIA 3T8OA 1TH7A 4HXJA 5LJ5d 5FL0A 5HEUA 2BKPA 1BI1A 4NOYA 1IBMT 1KD1R 1MGQA 5LBMA 4OHFA 1ABOA 1SG5A 5AT1B 4C0GA 1RAHB 3NMZC 2DX1A 4JI0T 4RTUA 2RM4A 5GMKm 5IHYA 2DERA 5L8RE 3OYLA 4PJOG 3VUZA 1CKBA 1U3OA 4NIQA 1IRXA 4R0KA 4M7DC 1UEBA 2JM9A 4AI6A 2H3JA 1VQOQ 3S3OA 2QGFB 2HAXA 1NYGA 2HL3A 3FIFA 4M7AD 2NTYA 4XBFB 2ZM8A 1HS7A 3NKZA 1UDLA 1LRZA 4DEXA 4IUVA 3OW2P 3CCQT 2XG8D 5AQUB 4DBRA 3A8OB 2CP7A 5FW9A 3HRSA 3VR8A 1W09A 3ZCJA 3FB9A 2RK1A 4UVAB 4ISTA 4QWNB 3AEBA 4PJOB 5LJ3g 2JVVA 1MNDA 3AE5A 2DLPA 2RHIA 3QC9A 1X6GA 1OEDC 2QVAA 2HPLA 4M7DG 2C5IT 4NUUA 3AECA 4YTMA 1YXRA 2EJGA 1WYBA 3RGLA 3IBPA 5F3JA 3D0TA 4J7FA 4AIUA 4PFOA 2KEAA 3RC3A 4XU3A 3CBMA 5CKHA 5ABEA 2CMRA 5KE2A 3JB9D 5ADXL 2A72A 5J2UE 2LT4A 2RB6A 2A3DA 2LQWA 2RP4A 1SUMB 2R5MA 1K9MC 2RHUA 2GTOA 3MK7C 5C3JA 3RIFA 2JS0A 2DJQA 2L5QA 2YWWA 2YDSA 1FYNA 2D9TA 2MOZA 1WXTA 1VQ9T 3ZN1B 5ABHA 2PUKB 1YCYA 3PUAA 3PIOA 2DE0X 2O01E 2DILA 4K0UA 3UU5A 2RO0A 4JJNK 5AQNB 4OYJA 2KLQA 2I0MA 4C92A 1JNZA 3MEAA 4ILCA 3IHRA 1AWXA 1ZV4X 2CS7A 2A9UA 5M4YA 2WDRA 2OTLT 2PQWA 3PTAA 2XQYA 1VQLQ 3EDVA 1GCQA 1UGOA 3TLWA 1E7OA 3PVQA 3DB3A 4EMKA 1X79A 3N2KE 4OGEA 1QVFA 2I2LA 4OK0A 3UPUA 1H641 2XAJB 3K3OA 1X75C 5AQFB 2NP9A 3OS0A 3OYFA 4LFAT 4PJOF 4O8SA 3G6ET 3QUIA 2EYQA 1U8RA 1W2BP 2GBQA 1OU9A 1YIJQ 2E41A 1AWOA 4M78G 3OTOT 2XPKA 4NPPA 4B3MT 2ROTA 4HCZA 2E9XA 4HFBA 3RX6A 1N6AA 4PJNA 3VS2A 5KYYB 4KGXB 5C6SA 3PIPA 1VQ7A 4F7UG 3I5SA 3HKDE 1I6ZA 2IAKA 4G2AA 3V7SA 3NRXA 5KXJA 2BS4A 3K3NA 1UGRB 4QQ6A 4M75E 4QW2A 4GYSA 5L3DB 1M2OA 2M9UA 4ANJA 4ELYC 5DLQE 2EYXA 4PFZA 5CA0E 1J1JA 2KINB 3P8BB 1WYXA 4M78C 2L3PA 4GYRA 2RA1A 3CCUA 1MV0B 2EFIA 3MEVA 2J1DG 3G6EA 2CSIA 1W2BS 3PGGA 3UUXB 2VKJA 4DVDA 1E2AA 4D6WA 4WYVA 1I5OB 2CPTA 1T7SA 3VS5A 1QWEA 1YJ9Q 3CQGB 1OQKA 1RADB 2FPFA 3G7ZA 5IAYA 4NXNT 4J7IA 2IG0A 1IJ6A 2C0IA 3UA6A 4UIGA 2QA4A 4HA8A 2EHOA 5JTGA 3PVLA 1Q82R 2K57A 2OAWA 5GANe 2LJLA 1MMDA 3CQXC 2OLTA 3WAJA 3VS3A 2YRCA 3N2GE 5KCHA 4LF5T 2DA9A 4C90A 2EAYA 4O6JA 3H3MA 1NLPC 2X9XA 2L89A 4JEHB 1EZ3A 1JEGA 5M9OA 3FLGA 1KG1A 3E1SA 1U1TA 4EMKB 3M5AA 2XM2A 2O88A 2HPJA 3P4QA 3CXCP 5BMVE 4AKIA 3CPWA 4KRTA 1ZUUA 2V1QA 4HVWA 2ZZDA 2WZIA 5IHIA 2COZA 4EMKC 1ZHIA 2CGHA 3PUVF 1SEMA 4N0AC 1M9SA 1B34A 3THKA 1JJ2P 3QIIA 4WBNE 4EDUA 1ZUKA 3RDVA 3I55T 3CMAT 3OJAA 2MWOA 2P9BA 1M3BA 2P0KA 1UUSA 4C5HA 1VQ8Q 1GBRA 3JB9J 5CVIA 2E5QA 2M6BA 3S6WA 1PSEA 3RKGA 5CK9A 2E12A 1K0XA 4C92D 4Z8AA 1E1HB 2YDQA 3ONJA 5C8YE 4PKCC 1J5WA 3JAFA 2WWUA 1RI9A 1QLBA 2D8HA 3FZFB 4LF4T 3AA6B 2VB6A 3AEEA 1HK9A 1ZSZB 1VQ4Q 3OW2S 5EK2A 2Z0WA 5CO7A 2K79A 1M62A 2WCAA 1X9BA 3LFMA 3CQCB 5JVDE 1PSFA 3LW5E 5LJ3j 1YI2T 1GFCA 5JDHA 2CZ6B 3H9NA 3JCMc 3V7CA 3FRNA 4EZ4A 2D8JA 2EYZA 1U5SA 4PLIA 2QA4T 4TZ4C 4BACA 3ER0A 2CCQA 5AQGB 2DLRA 2E6ZA 1TWBA 2CP6A 2CH4A 2NR4A 1OEBA 4B3RT 1YW0A 3CCMQ 3W15B 2LJ1A 1I94T 3NZQA 4J9BA 3VKHA 3GP8A 2NUTA 2DIQA 4XU1A 3QSUA 1XNRT 2EKOA 2CP0A 3R84B 1GCQC 2H89A 3CX6B 4XAXB 1LNXA 2DO3A 4XTYA 1Q86C 2FJAA 2EJ9A 2L2PA 2OJ2A 5CKDA 2ENMA 3CC2Q 5FL1A 3OKQA 1YQ3A 4OF1A 4U33A 2RK2A 2D0UA 2JPFA 5LMNT 4UR9A 3ZYMA 2DNUA 2JTEA 2ZPHB 4FSSA 1UB4A 4FYWB 1YQ4A 2YU2A 1FMKA 4KUIA 3OS2A 3G4ST 2VKOA 4M75C 4J9GA 2KT9A 3KDSE 2QEXQ 4M75B 1S35A 1VQ6Q 5GAN8 3I35A 2RJEA 1UX5A 3L1AA 4UC4A 3E9FA 1KQSS 1G3TA 3KV4A 2OX7A 3CXCA 3VV0A 1GL5A 3MPUB 1BR0A 3C95A 1G3WA 2R57A 3K3QC 3ANWB 4B6XA 1BI3A 4AKHA 1G3SA 3M0QA 2HSEB 4BUGA 2MI6A 4EGWA 1XMQT 2DAQA 2CREA 3LK2B 1TS9A 3M57A 2ZMAA 5LBQB 5BR8T 2F5TX 1AD5A 2OTLA 3N9NA 1US7B 2CLYB 2IW5B 2YHTA 2O4XA 2ZCFB 4M78B 1KNZA 1K76A 2QQSA 3AAEB 1RL2A 2NLUA 3CMET 1NE8A 5J1GA 1N36T 5GAOl 2X0HA 4C8QE 3EH2A 4Y91A 1M4ZA 1Q86R 4GBQA 1N8RC 3TCJA 4AG2C 1QVGA 4WBOA 3UT5E 2YKSA 2JW4A 3RH3A 2X0YA 3NZPA 1LVKA 1SKUB 4HN9A 3TLVA 3UF4A 3H3AA 4OYKA 1JXMA 2WMOA 5FYMA 2VUBA 5LMUT 2VGNA 1VQPQ 3EG0A 3V5SA 1R0BG 2H88A 2QTXA 2CH4W 1UURA 4JI6T 2UUAT 2AE9A 2BG9A 3ZC0A 5JR9A 3VHLA 4NL2A 2OV9A 1RAAB 1VQKA 1BCMA 2CZ7B 4EMGA 3MP6A 4BJNA 1ZSGA 2QYWA 4KMCA 2RI5A 4KH1B 5LHIB 3UUNA 4MALA 2YSQA 1VQPT 2BZXA 2GFAA 4XQ3A 3HA4A 4HCCA 5FU7B 3TLUA 3LDQB 2FL7A 4F7UA 2UUCT 1QVPA 3AE6A 4ILBA 2E65A 3BY7A 3ZBDA 4C92C 4ZHQE 3OBWA 4EXTA 4V2SA 3P50A 3MEWA 2NYSA 5HEGA 1VQ5A 2KI7A 1VQ8T 1T0JA 1D1BA 4HTEA 4PNOA 4CZZB 4A63B 2ED1A 4RMOA 3JC6C 1S72Q 5IUXA 4FYVB 2IC9A 4XTWA 4A4EA 2XDPA 1BIAA 3AT1B 3WVEB 2KMFA 4HKEA 2NW8A 2WDQA 4A54A 1M8VA 3UQ7A 2V6YB 4N78D 3OS1A 1M1KR 2LSYA 3ONXA 4DR5T 4CN6A 4R55A 4C8QD 2QEXA 3RBBB 3N2OA 2XTLA 2JTMA 3V8KA 1ZSZA 2DD4A 2XZEA 3J7AF 3VUBA 4IHJE 4YLHA 4FI5A 5GAMh 1UK5A 2IHR1 2NWBA 2CZ0B 2WZHA 4ERRA 3TSWA 4KULA 1IHVA 2DL4A 2XJ7A 5IXFA 3OYAA 1NM7A 1U4QA 1JJ2S 5GAN7 1QWFA 3P4WA 3OYIA 3HHTB 3UU3A 3CC4A 5LG3A 4CXWA 3PT9A 1NEGA 1K9MR 4DOWA 4UEMA 3OSSC 2LSIA 1LPLA 4YHJA 3CCVA 4O2AE 3EI0A 3K1SA 4ATOA 3VU3C 3FEOA 2FJEA 3QJ6A 4LNPA 3P4RA 3NPFA 4A4FA 3G71A 1W70A 3L2ZA 1PG5B 3PUSA 4JRIA 2AZVA 2QGGA 1RACB 5A0LA 2O9VA 4LF7T 3ZKRA 1VQ4A 5HEJA 1UFFA 4DR6T 1WRDA 1VUBA 5JR9C 1UJ0A 5GAN6 3HFOA 3IQLA 3GLXA 4A4HA 2LZ6B 2DEUA 1Q95G 2CA5A 2MYSA 2N2NA 2XSAA 4X1YE 1IGUA 1JU5C 4YJ2E 1YWPA 2E3HA 2L8DA 2VC8A 4F04B 2DL5A 4JUVA 4X9CA 1BI0A 3ANWA 2E9XB 3ZN0B 1TG0A 3N9MA 4JLIA 1YJNA 3ZCIA 4RTVA 4DBFA 4AKRB 3SHWA 5FWBA 3CPWS 3NBXX 3AA1B 1WLPB 4FSXA 3TQ7P 2W63A 2O9SA 5KYWA 3EUHA 1WCRA 4H9NC 5EK3A 4ZI2C 3M4GA 4Q25A 4UF0A 5LJNA 1QKWA 2J6FA 3UATA 1A0NB 3CPFA 2K5IA 1R0CB 1NJIR 2NUZA 5GAN3 3CC7T 4WTOB 3QBYA 4F8HA 1C6VX 2DL1A 1G8XA 2LNHB 3A7MA 2D2SA 2RI2A 5LXTE 3LG7A 4LMLA 2FZGB 4XZCA 1QVFS 4H9OC 4AQFC 4HWHA 5FLXE 4AFZC 3C51A 1HNXT 2WU2A 2WACA 4GY5A 1VIFA 4I0UA 3CCET 4FW1A 4DR3T 4C92B 1XNIA 2EVRA 3RKYA 1WR0A 5HXRA 2YDLA 3RERA 4G63A 4AMCA 2YUNA 1HG5A 1ZP0A 1MUZA 2EQKA 4AG1C 4CC4B 1RAIB 2Y90A 1ABQA 2KRSA 3NWIA 2B1EA 1WNLA 5FXVA 2DK3A 3OYCA 4AFUC 3EHRA 3X24B 2JJ9A 4PW8A 2MK5A 2F4VT 3M0SA 1PD1A 1YN8A 5F8PA 4MMLA 2XQ4A 4WNKA 1QCOA 2DL8A 2KGTA 2BG9C 3FBLA 2AHJB 3JCMX 4IUPA 1RUWA 4EYUA 2XSBA 1K9AA 2GCXA 5LJ3h 2V7MA 5GAMe 1YITT 3R6NA 3JB9H 1J5ET 3A98A 4CN4A 4KHPT 3LH5A 5GMKh 1KNRA 1XMOT 1FWZA 2PFVA 4M7AF 3GN5A 2LT1A 1VQ7Q 2XD0A 4Z88A 3A8GB 4DBHA 3CCRQ 5DJQC 1EX4A 5L4EA 3ZMVB 2QGSA 1QW1A 4IT4A 2ZGWA 2PTKA 1GFDA 1LVFA 4H9SE 2M0YA 3ZSSA 4GOUA 4X1IE 3CCUT 4OMOA 1K8AC 3ZMZB 4C5EA 1JRIA 3RYIE 2KSRA 2VASA 3JCMd 1X69A 2OTJT 4ZS2A 2FZKB 1W1FA 2CXDA 1KHCA 2J6KA 3WI3A 1GRIA 3TEEA 1QKXA 2VVSA 4WCIA 2BKDN 1VQMA 4LXCA 1AZGB 4IDNA 4OB3B 5JREA 3CCSQ 1Q7YR 2HN1A 2Y4XA 3LLRA 4TWDA 2J06A 3DP7A 1Y7XA 4LDVA 4C0FA 2ZM2A 1KD1U 1XTDA 3CC2A 2XICA 2GF7A 2V1RA 5DY9A 2F2XA 3REAB 4EMHA 2BKOA 3RIAA 3AXJA 5FXWA 2DRMA 1ZEEA 3PURA 5HCJA 3AA0B 3FC3A 2W2UA 4DV3T 4X1KE 3SWNB 3L2QA 1PCXA 4M78E 1YFNA 3CCJA 3O9XA 4J9HA 4C8QF 2JT4A 1VA7A 3ZEFB 1XQHA 2CBJA 5JDNA 4M78D 1MMAA 5AQIB 3UWNA 3EGDB 2V1DB 1M30A 2PVGB 2GGRA 1WJSA 4X1VA 3HL8A 1B34B 4YHHT 4RG8A 4BY6B 4M77F 2L8KA 2CP2A 2E5VA 3BE3A 1G5VA 2VV5A 1JJ2A 3L2WA 4DO0A 2E2AA 5E0OA 2RJCA 3CCMA 1VQNQ 1PKSA 2GQVA 2JTFA 2K5BB 3OVUA 5LP6E 4D8KA 2XQ6A 3HL6A 1WJQA 3JCMh 3CCEA 1B7TA 3CPWP 2X4XA 5GAOq 4IDPA 1HX8A 2W4XA 2JQQA 2J62A 1FJGT 3TU4K 1Y71A 3FZLB 3N9OA 2UXNB 3F31A 4X62T 3CCVT 4HWFA 2XAFB 3HI2A 5FU7C 4UV9B 4KX6A 5CR2A 4P0BA 3KXTA 2ATCB 3NFCA 2B76A 2RNAA 2MTQA 1I07A 1HG2A 5GAMg 1V76A 4KGVB 4CQIA 2KYBA 4J9IA 4YXDA 4L59A 4M77A 4Z02A 1VQLA 5LJ5h 3CMEA 3UFEA 2XI9A 2X67A 2BE7D 2YN6A 4HFDA 4FL6A 2AXDS 2QI2A 4JJDA 3LBXA 5L3FB 2QTVA 3S3NA 1XJWB 3I5RA 3OYYA 5AFUL 2ZPGB 3PMIA 2K5LA 2L3QA 3QUJA 1M90U 4AQYT 4AFSC 4E7SA 2PTFA 1LCKA 3C50A 4DOVA 1VRBA 4C8QB 3OYMA 2LX9A 1OEDA 4BI4A 5LJ5j 1I0CA 1N34T 2DBMA 3V8JA 3JCMf 2C5JA 3O5ZA 4KGZB 1HD3A 2LNVA 5CQXA 3UDCA 1ZHCA 1SHGA 2LOPA 1C1AA 2F1LA 3SWNA 4E7KA 3CCST 4E7ZA 3KV6A 1WZOA 2LRKA 2YK0A 2X4WA 4H63V 3FJPA 2XQ3A 1PC0A 2MAMA 1BIBA 4EEDA 2M0OA 3M0PA 4DUZT 3IF8B 4B9WA 3LH0A 4J9EA 1TUCA 4YSYA 5JDLA 2K7AA 4ZZBA 4FW2A 3ABVA 1Y96B 2OTJA 4J2CA 2CWYA 2DWKA 2KAFA 2X4YA 5LJ5f 1Y01A 1FMWA 3N9QA 3MZKB 2DTIA 3OSVA 2P0QA 2HH7A 5JRCB 2BS3A 3PJAA 2CYZB 3UULA 2DIGA 3RIRA 1PHTA 4KP3C 4O4JE 5A2QE 4N4GA 5AQTB 3RR6A 5FNVE 4ASKA 4OMLA 2GFUA 8ATCB 5TAOA 4BE0A 3LK42 1X6BA 3OYXA 4YSXA 2RQRA 2OAUA 4MDWA 2IDOB 4NL3A 3ZMSB 5AQSB 3E19A 1D1CA 3OYKA 3RYHE 4AQFA 1NWMX 1SHFA 2C0SA 2UUBT 4IURA 3AE9A 1K4US 2C0OA 3F2EA 1GBQA 5I22A 2CWOA 9ATCB 3PUWF 1NENA 3PDYA 4A56A 1WQWA 3FJ5A 1D0XA 4JUYA 3G71Q 1ZUYA 4A53A 5LNKA 2QQAA 2LJ3A 1WR6A 4OB2B 1KHIA 1UECA 3AA7B 3M0RA 2V5DA 3ZJ1A 3RQWA 3I55A 1J3TA 2FPEA 5I2MA 4LUDA 3BK9A 1EFNA 3PU3A 2XDBA 4PJOC 4YTPA 3TVTA 1VQ6T 1MV3A 4QVZA 2VKNA 4DEYA 4DUYT 5A0DA 5HXHA 3EFRA 4M78A 3JCMV 2RN8A 3P4SA 2CT3A 2LLYA 2J05A 2JQKA 3KINB 1WGSA 2KXCA 2ZM6T 1RABB 3U23A 2WBLA 2GNCA 1IZNB 4J9DA 1D3BA 1X27A 1G3YA 5ABFA 3AEFA 2QASA 3ZJ2A 2Y4YA 3SFDA 2RMOA 2WSFE 3I9QA 4EIKA 2FRYA 4NXMT 2YU1A 4U72A 5GANj 3GIBA 1ZKEA 4HEAA 2DM1A 3JCFA 4DV1T 3M56A 4RTWA 4E2FB 2WB5A 4ORZA 3EHQA 2DTHA 3AE8A 3JCMe 3CMLA 4M77C 1W2BA 5HAXA 3CWZB 3CCJT 3UA7A 1VYTA 2DXBA 3DJBA 4O4LE 2QYZA 3J9X1 1RAFB 1OI1A 4I4TE 2W66A 2AK5A 2XY8B 3C4SA 1QSDA 3A8YC 4JPBW 4BE1A 1VQ4T 1B07A 2PG8A 1IREB 1TUDA 3LGFA 5HXSA 3ULRB 2G6FX 1BKBA 3LWHA 5IH2A 3J80E 1VQKQ 1N5ZA 4OGCA 2LQ8A 1RLPC 3CVRA 2JRKA 2CXFA 2LRLA 2EIFA 3H8ZA 3D7SB 3X20B 4JI5T 2JUFA 4EZHA 1CUNA 2CRBA 1JBMA 4AFQC 2CZ1B 5C0MA 2FHDA 5GAOp 1SF9A 5KYUB 4GKKT 3RF1A 4QQDA 1Y96A 3PUQA 3Q9DA 3OB9A 1Z9QA 1KQSP 3RMSA 2JMAA 3KV5A 4C0DB 2L0AA 4IDOA 1YJ9T 1YKHB 2BVMA 1KQ1A 2XMFA 5CB4E 4O4IE 4FU6A 5CQYA 4C92G 1M90R 3L2RA 1MMGA 5KCOA 4DR1T 2V7IA 1XDOA 2V8KA 5DQWA 2CLYC 5GAMj 4IREA 4BY6C 3UUBA 5JR9B 3L2UA 1OWAA 1YNZA 3B57A 5KYXB 2YOEA 4IE6A 2LC4A 3T1HT 3CCRT 1Y57A 4U74A 4A4KA 2VURA 5LHGB 3MEUA 4F7UF 2X3XD 1BCOA 3C94A 3V8LA 2HQXA 5GAMf 1ACMB 3CX8B 3ZYLA 1N32T 2ODUA 3RQUA 5AQHB 2IPOB 3LX7A 2ROLA 3META 3TREA 2J7IA 3CK6A 2RQUA 3O1HA 5EC7A 4HFEA 4JYAT 5FY1A 3AVRA 2K3YA 4F7UB 3LBXB 4LDWA 2MMPA 2KQWA 1VQ9A 5HWXA 2DRKA 4N4IA 2LMJA 3C4ZA 4PK6A 2WP9A 1HTJF 3ZFJA 1JO8A 1HNZT 1PKTA 1G73A 5FVLA 3S4UA 1WXBA 1Q81U 3RC8A 1RAEB 7AT1B 2D9DA 4YT0A 2MOXA 4KHZF 5DLOA 2Y8DA 4AQGA 1AHJB 2RJFA 5GANg 2RA2A 1E6GA 3CC7A 2IMLA 1OZ2A 4U7IA 2OA5A 2FRWA 5I2SA 1UGPB 3M54A 5FXZA 2KK4A 3ETVA 3CBPA 1YJWA 4WZXA 4MDXA 2WY2A 4PJLA 2J47A 5C2TA 1X2QA 2PNIA 2CDTA 5HEOA 1L0VA 3UFGA 1WXUA 2LCCA 2VVKA 2XAGB 1NPRA 2K6DA 3RKXA 1OXZA 4COFA 4OVAA 4JLEA 1QCNA 2DL7A 4RKUE 3SD4A 5L3GB 1X6OA 1WHMA 3HFNA 2ECZA 5JQGE 3C64A 1NJIU 1VQ8A 1PD0A 2LSGA 1YKEB 3LYIA 4PFPA 4C5GA 4M1PA 4P09A 1JB0E 2DYBA 5J26A 5HXEA 1HSQA 1JXOA 2H3EB 5LA6E 2KNDA 2WAUA 3QWYA 3MHXA 3HSBA 5CKFA 2PBIA 1MIYA 1MIVA 1D0YA 2HKQB 3N5LA 3ZPOA 4OMFB 2LE8A 3CMEQ 3ZL7C 4ZI3D 3I0QA 3EG3A 3CCJQ 3RHWA 1UE9A 3OYHA 2XAQB 2K3BA 3JCMJ 4LUEA 1KSWA 2KY9A 2QXFA 1M1GA 2E5KA 3C12A 4QX8B 2J4GA 3UQ4A 3L2VA 4IIMA 4HCBA 2Y48B 4L5GA 5LB7B 5AQRB 5D7UA 1NPPA 2AKLA 5J3BA 1VCSA 2DXCA 3R6OA 1ZBXA 1T3SA 5CA1E 4HFVA 4XU2A 3EG9B 3RESA 4X9DA 4BJMA 1GXIE 3IA3A 4HT9A 4DR7T 4C0DC 4IUTA 2D5UA 2IIUA 3VKGA 4JJBA 1ZA1B 4TWFA 1Z0PA 4L0RA 2AIRB 4OX9T 1IB8A 2MWPA 5GAN2 4WW0A 2UXDT 3CCMT 3CCQA 4LF6T 1SE7A 1IZ6A 4IE0A 4DNDA 4PK5A 2IC6A 2V8JA 1M3CA 2HMAA 4M7DD 1QLYA 2JMHA 3K8PC 1YWOA 4IL9A 4ZZCA 3PTRB 2ZLYA 3INZA 2R58A 3EAMA 1R8OB 5GMKj 2R6GF 3CCUQ 2RQVA 4FT2A 1M5Q1 4GLMA 4MZMA 1QVGS 1AEYA 4Y28E 4ZN3A 4M7AA 4HVVA 5GJWB 4EPCA 3CIRA 2BBHA 2FUPA 1Q7YC 2HKNA 2RJDA 2DD5A 3OBYA 4JI7T 2K2VA 1QP3A 1B3QA 2W67A 3ZLIA 2SEMA 2V7LA 2DZCA 1TOVA 3EGUA 3SDZA 4F16A 1YJ9A 3UUMA 1SRLA 1YHQT 2AKKA 5FRNA 3SS1A 5ABGA 1OULA 3ONLC 5IHKA 2LVMA 4P5NA 3CCSA 3PU8A 3V5UA 1PRMC 5AQMB 3GPLA 2D6FA 4LDUA 3QO3A 4JDSA 3OYNA 1MIWA 4EIWA 2EQJA 4LN2A 2X68A 2EGEA 3Q5EA 1KK7A 4OB0B 3LK3B 1OZ3A 4YJ3E 1OX8A 3E2UA 2BS2A 5FY0A 1IGQA 3VS7A 2WU5A 1YP5A 1M2VB 1X01A 4JS4A 4RCCA 4ZGEB 2YUQA 4VUBA 3OYZA 4DV2T 4QKNA 5LCYA 3BQIA 3M59A 3I56A 1FIOA 2QEXT 1UHFA 4ELZC 1UGSB 3P4PA 1VQ5Q 5J0ZA 3MA9A 2EHOB 1X43A 1ZSZC 2ZPBB 3E9GA 1JQQA 3BFMA 4KUDK 5LHHB 3FXEB 2X3WD 2SRCA 1WFWA 4TNWA 1WPYA 4KI0F 1WHGA 5KYNA 1Q7YU 1AWJA 2E4HA 2EGAA 1W9RA 4CC3A 5GAN4 2E8IA 2K4YA 3QXEB 1PM3A 4IIJE 3I9YA 3Q2MA 4IGUA 4GKJT 2FO0A 2IIMA 3CCVQ 2KE9A 4H9QC 3QOFA 5A0GA 4JS5A 3KV9A 2UXXB 3WXMB 2NOXA 4PJOE 4HT8A 5AQKB 1U1SA 2M02A 3AE2A 1VQPA 3NVOA 5KX5E 2NUPB 2MBGA 1KNPA 3ESLA 3GNGA 4LFCT 4ZI3C 3BDLA 1AVZC 3O1JA 3QHSA 4PAGA 1O3XA 2JNGA 4J9FA 4QXHB 4ZNXA 2XHCA 3KUFA 2JMKA 4PJJA 3OMCA 4M75F 4EOZB 2KBTA 4FM4B 1GCPA 3OA6A 4LFBT 1IAPA 1Y07A 4IE4A 4H63H 4IE5A 5LGUB 4XTZA 2DTOA 3OMGA 3SFMA 5FROA 4AKGA 3N9PA 1BK2A 1S1NA 4DQ2A 2LRQA 3GF5A 1YI2A 4IL4A 3P8HA 1WYCA 2KDSA 4HFCA 5LGTB 3TSZA 2LOSA 5CKBA 1HCIA 2MF2A 3DLLA 1OPKA 2ES0A 1MMNA 3AAAB 2MPXC 2X9YA 5HY6A 1NLOC 1PNJA 2QG9B 3RRCA 1M1KU 2EKHA 5DM7R 3I56T 3JB9G 1H92A 1FXXA 2IVWA 2XM1A 1SPKA 3DTOA 4U2ZA 4C92F 2CUDA 4ZI7E 4M7DA 4CI0C 1WLXA 1K73R 2YUPA 4PJMA 3AE3A 1WFDA 5H6QB 2K24A 4JZ3A 2YUOA 1QUUA 5CGMA 1KJWA 3ASKA 2BZYA 4XTVA 3JV3A 5LJMA 4QXCB 4AISA 4EEBA 4EV6A 2HCKA 3VRBA 3A1PA 2FB7A 2OTJQ 3PMTA 4EYYR 3KFWX 1XNQT 1P92A 2A36A 4DR2T 1R77A 2HNIA 2CP5A 1GQEA 5DABA 5D6WA 4C92E 1UJYA 1YHQA 1QVFP 2EHOC 2V5CA 1NBEB 5ETWA 2WM9A 5GAOr 5L47A 2P0PA 4OMMA 5HCMA 5GAOn 2HL5C 2QDLA 4QXBB 2EGCA 1QVGP 4GIWA 3CCEQ 2ACZA 4DV0T 2YINA 2VK9A 2DJZA 1M3AA 3KBUA 3QDFA 3NRYA 2BBJA 1YITA 2RHXA 1Y0MA 1MNEA 1VYUA 1KFYA 1N9RA 4X5TA 1D0ZA 2BTTA 1I4K1 2HEQA 4M75G 4A97A 5HYAA 3B5MA 2O4XB 1H3ZA 2HHHT 1T0HA 3AAIA 4YTLA 2RQWA 2C06A 1KQ2A 2R5AA 4YY3T 2LQKA 1K73C 2X51A 4M77D 3VS6A 2H3RA 1IJ5A 5F5WA 2BUDA 3QNUA 3CD6A 2XQ8A 1Q82U 4J9CA 3A5XA 2VQFT 5LL6S 4C8QC 5FY7A 1HXDA 4DBQA 4HKAA 1VQLT 2CUBA 2O2OA 3T9NA 5KYWB 3HPWA 2Q9QD 1VOMA 3RIUA 2BZBA 4RTZA 3RYFE 3AE4A 3ZT7A 1OYXA 5AQLB 4BA9A 5I11A 3A5ZB 1BB9A 4FJOA 2RQTA 2RH2A 1HNWT 1XZYA 1PWTA 1F1BB 4M75D 3FBZA 2UU9T 4MBQA 4IE7A 1ZOYA 3GWHA 2CSQA 2CBIA 1VCTA 3Q1JA 5FU6B 2LCSA 2COWA 4CI3B 2JXBA 2V7JA 3URGA 1D1AA 2LKHA 4YFSA 6AT1B 4M7DB 1YD8G 1ZX6A 2FVUA 3O8VA 4DV7T 5GAOm 1SRMA 3SEMA 2GK9A 2KXPB 1VQNA 5JRCA 3OYDA 4U31A 4XTUA 4TVRA 2RHZA 2ZPEB 4EAHA 1IBLT 2P4RA 2CEAA 4IKFA 3VRAA 4LF9T 5FU6C 4ZTFA 4C5IA 1G2BA 3CCRA 4JI1T 2A7YA 3H41A 3HP9A 4K11A 4PLLA 2VYTA 2XASB 4UVCB 2KROA 2V8IA 1Q81R 2EYYA 1HJDA 3CC7Q 4HFIA 4J83A 1OV3A 3EH1A 3VJPA 2YDRA 4A98A 1RLQC 2KRMA 4Y92A 2E9XD 3PNWC 3GOXA 4KH0B 1K73U 4CI2B 3RI5A 2MCNA 2DBKA 4HVUA 5FMNA 2DYIA 4ZGDB 3TLSA 5AYFA 5LJ3e 2ESWA 3AE1A 1M1FA 1S72T 4F14A 2E3IA 3M9QA 3CC2T 3CCLQ 3X28B 1Q86U 1M27C 4HCKA 2JIWA 2WWVA 2BZ8A 4B3ST 4XU0A 2FJDA 2RI3A 2Z6EA 3AVSA 3M0TA 4LD6A 3EAEA 3CC4T 1BR4A 4OP0A 4U2YA 3UU6A 4MMKA 1YJWT 2XKOC 4JV5T 1K1ZA 5JDGA 2LDMA 4DR4T 3T1YT 1OEDB 3AEGA 5JH7E 1DU2A 3JADA 4QX7B 2KNBB 4JJCA 4BDZA 2VKDA 2GQIA 2JS2A 1E6HA 4C8QA 1YIJA 4LMJA 1M7KA 3EVYA 4PL6A 2CT4A 3V7RA
chains in the Genus database with same CATH topology
3CD6T 3Q5WA 3QZ5B 3QYHB 3CMAA 4IUUA 3EFSA 4BE2A 4QVCA 2K5FA 3QK6A 5GANd 2D0QB 5IYZE 2KVQG 3CCLA 3O4XE 2EHOD 3KBGA 3WVDB 3FB2A 3WAKA 5HK0A 1LOJA 3LGLA 5JDMA 5EZYE 1NAFA 3JC6D 3BQLA 1RI0A 5EK4A 2KZ7B 2PVDB 1BR1A 2NTXA 1SA0E 2VXEA 3M65A 3N5BB 4M7AE 5KDMC 1NJIC 3KVBA 4I50E 4X20E 1HFAA 2VGMA 5EG2A 2ZPIB 4ZTJA 2VWAA 2XAHB 4TUYE 2XU8A 4EB6E 3MKDA 4OFZA 3HKEE 1D3BB 3PFSA 2YEVC 3MCAB 3EDUA 2XIDA 3OYBA 3E08A 5IT9E 2B8AA 2Q9QC 3NTIA 4UXNB 3JCMW 5FRMA 1WQ7A 3PUGA 4AKLA 1YIJT 3FDRA 3RKWA 2W0GA 5IN1A 5HWYA 4L9IA 4V1Av 1K9MU 3SB2A 1V9DA 1N27A 3MACA 2CE7A 4MHCA 5KE3A 4M75A 2Y6XA 3VYHB 3CX7B 2EQUA 1V29B 2DXUA 2H7OA 4LD9K 3BW1A 2F69A 5J39A 2K9AA 4QHOA 4E7JA 2SPCA 3ZC1A 2PJQA 1UCUA 3E22E 3P7IA 3BDUA 4PJOA 1Y64B 3I1AA 5KH6A 3U78A 3OBVE 3TKLB 2LCLA 2QQ9A 2WSSV 3RKOA 3A8HB 5HK3A 1VQ5T 2E9XC 4R56A 3KBTA 5CCAA 4CXYA 3RPUA 3A8MB 4ISSA 5GONE 2LT3A 5L3EB 4N4HA 1BR2A 4X34A 5KMGP 3GN5B 4CRIA 1KQSA 4E7IA 2V26A 2ODVA 2HD0A 1H7CA 2M67A 4KBMB 5D6YA 3RUXA 4J5YA 4I43B 1FEWA 1Q82C 3JB9F 3JCMQ 3JSCA 3KVAA 5L3CB 4ME7A 4AXPA 2E6NA 2ZPFB 2LEHA 5CIUA 4XK8E 3VU7H 3AB3B 4H9PC 2L3LA 4ZN1A 4QQGA 3NTKA 3O1IA 2KWHA 4J6XA 3CKDA 2DHRA 3QKJA 3OYGA 2EWNA 4QVDA 3J81E 1ZQ1A 2LTOA 2LSJA 3FHNA 1BI2A 1VQ7T 5H6RB 4M77B 4C91A 5LJ3f 5LOVE 3SOLA 1LJOA 1N9SA 4UF0B 3ZYKA 5L3BB 5GANf 3HKSA 3MP1A 2DNXA 3JCMb 2X4JA 4M7DE 4ZS3A 3C4XA 3ETUA 4TN7B 2DXTA 3UTKA 3M58A 4RG2A 2DI4A 2N1GA 4TV8E 2XDDA 4IUQA 2N9DA 2C5KT 2E10A 3DB4A 4BI8B 3HKCE 2EJFA 2KMTA 2ZM0A 5LG4A 4BAYB 4JLGA 4PK4A 2JOYA 1I81A 2JZ2A 2X66A 3SWHA 4J6YA 4O5VA 5I21A 4TV9E 4WF2A 2JN0A 2A2FX 3C4WA 2QQRA 3X25B 2DWGA 1VIEA 5JDFA 2L9QA 4HGAA 5GMKl 5D6XA 3LWIA 1YBYA 2YLBA 4F6RC 4GK0E 4C0ZA 4ADZA 3M53A 4HE8A 2M1HA 2HQEA 2CM0A 3S3MA 2XK0A 4ZGJB 4GK5E 3F70A 2M16A 4JRPA 3OQ5A 3L09A 2EQMA 3NTHA 4M7AB 1I8FA 4FIBA 2RD1A 4A4GA 5LGNB 1BYMA 4ILUA 2E70A 4E7LA 1VQKT 3BQKA 3HRUA 3G4SA 4PJOD 3P8DA 3J7Yq 2PVOB 3C98B 3CBOA 3Q5XA 4DMWA 1XOVA 5GAMd 4KUMB 2DCFA 4M7AG 1N8RU 5J2TE 3MXZA 4B9XA 1VQ6A 5GMKi 4CXXA 4RCBA 3VKIA 3HR0A 4M78F 4O4HE 5LYJE 1Q81C 3L3PA 3DKMA 3QYGB 1FMVA 1HF8A 3H37A 5DQVA 2D0TA 3P8CD 5HKCA 1M90C 5FXXA 2ACXA 2Q9QA 4PNIA 3FXDB 4GLKA 1DJ7B 1O75A 3MO8A 2Q9QB 2W00A 4MLKA 3I0OA 4UELA 2DEQA 4IDZA 2DKGA 1SHZC 3OYEA 3L42A 3G71T 5GAN5 4I55E 2NW7A 5JDQA 3F57A 1AJ3A 4E7HA 4F7UE 1W4SA 3GNFB 3JAME 4L6V5 2G0UA 4M77G 2XUEA 4MZPA 2YLCA 3DLMA 2P4TA 4BDYA 4LDYA 4LDXA 2BDEA 2YRVA 2DPPB 4J8OA 3ZMTB 2E1HA 1YJNT 4Q5WA 5FP3A 2FYKA 2QA7A 5A1LA 2L3RA 3SWNC 2RHYA 4ZOLE 3M55A 4E47A 4M7AC 2HBPA 1FX7A 1KC8U 3QDRB 2H7VC 2W61A 2KSSA 2LHNA 3B13A 3ZMUB 1LKXA 4P0AA 2PUOB 4ZI2D 4C8QG 3MJXA 4BI3A 3CEYA 1EIFA 3A8LB 2WSEE 4KT0E 3VYGA 2G3RA 4MFRA 3H6ZA 1VQOT 5CAIA 4H9RC 4UVBB 2WSCE 3IEEA 2X9WA 4BD3A 1S94A 3HKBE 2X0LB 5LJ5e 4BB7A 2VXFA 1M1KC 5LJ5g 4M77E 4OB1B 1O9SA 4JRQA 2VKHA 3I9WA 3HRTA 1UX4A 5HXCA 4Z8XA 4II1A 2CKKA 1S72A 3OY9A 2DVEA 2A3LA 5LJ3d 2K48A 2QDYB 3LJCA 3OW2A 3RYCE 1T98A 3X26B 1I5LA 4J6WA 2CXLA 5GMKe 3JB9I 1K8AU 5CKEA 1MHNA 2NW9A 4N0AA 3QPHA 2QQBA 1KC8C 4MZTA 3PE0A 2W62A 3JCMg 2X35A 1UGQB 3UT1A 3ME9A 2LHRA 3QJYA 3RMQA 3ZEHA 3OS5A 3JCMP 4JEUB 2LSKA 2KWIB 1VQNT 2BVLA 4O2BE 2BIVA 4M7DF 3QZ9B 1QP2A 4NUVA 3JRZA 5L2LA 3CCLT 4XTXA 2WMNA 2F5KA 3OYJA 2VL8A 5GANh 3MP8A 1WJRA 2X9HA 2I59A 2E64A 2K3XA 3QG1A 4FT4A 3U3IA 4UV8B 4JRKA 4TX5A 4CI1B 3E0ZA 1NZ9A 2V7KA 2XHEB 4DA4A 1VQOA 2DZ9A 3AHUA 4DMVA 2PU9B 4NS5A 3CXCS 1VQMT 3CPZA 3N9LA 3M4YA 1SSFA 3SRZA 3GA8A 1U5PA 3GMIA 3RRWA 2LM9A 3T8OA 1TH7A 5LJ5d 1BI1A 4NOYA 1MGQA 5LBMA 4OHFA 4C0GA 2RM4A 5GMKm 5IHYA 5L8RE 3OYLA 4PJOG 3VUZA 4M7DC 1UEBA 4AI6A 2H3JA 3S3OA 2HAXA 3FIFA 4M7AD 2NTYA 4XBFB 2ZM8A 1HS7A 1LRZA 4IUVA 3CCQT 2XG8D 4DBRA 3A8OB 3HRSA 3ZCJA 3FB9A 2RK1A 4QWNB 4ISTA 4UVAB 4PJOB 5LJ3g 2JVVA 1MNDA 2RHIA 3QC9A 2HPLA 4M7DG 2C5IT 4NUUA 2EJGA 1WYBA 3IBPA 5F3JA 3D0TA 4J7FA 4PFOA 3RC3A 4XU3A 3CBMA 5CKHA 2CMRA 5KE2A 3JB9D 5ADXL 2A72A 5J2UE 2LT4A 2RB6A 2A3DA 2RP4A 2R5MA 1K9MC 2RHUA 3MK7C 2L5QA 2D9TA 1VQ9T 2MOZA 3ZN1B 2PUKB 1YCYA 3PUAA 3PIOA 2O01E 4K0UA 2RO0A 4JJNK 4OYJA 2KLQA 4C92A 3MEAA 3IHRA 1ZV4X 2CS7A 5M4YA 2OTLT 2PQWA 3PTAA 2XQYA 3EDVA 3DB3A 4EMKA 1X79A 3N2KE 4OGEA 1QVFA 2I2LA 4OK0A 3UPUA 1H641 2XAJB 3K3OA 1X75C 2NP9A 3OS0A 3OYFA 4PJOF 4O8SA 3G6ET 3QUIA 2EYQA 1U8RA 2E41A 4M78G 4HCZA 2E9XA 3RX6A 1N6AA 4PJNA 5C6SA 3PIPA 1VQ7A 4F7UG 3HKDE 2IAKA 4G2AA 3V7SA 3NRXA 3K3NA 1UGRB 4QQ6A 4M75E 4QW2A 4GYSA 5L3DB 2M9UA 4ANJA 4ELYC 5DLQE 5CA0E 2KINB 3P8BB 4M78C 4GYRA 2RA1A 3CCUA 3MEVA 2EFIA 3G6EA 2J1DG 1W2BS 3PGGA 3UUXB 2VKJA 4DVDA 4D6WA 3CQGB 3G7ZA 5IAYA 4J7IA 2IG0A 1IJ6A 2QA4A 4UIGA 4HA8A 2EHOA 2K57A 5GANe 2LJLA 1MMDA 3CQXC 3WAJA 5KCHA 3N2GE 4C90A 2EAYA 4O6JA 2X9XA 2L89A 4JEHB 1EZ3A 5M9OA 3FLGA 1KG1A 3E1SA 1U1TA 4EMKB 3M5AA 2HPJA 5BMVE 4AKIA 3CPWA 2ZZDA 4EMKC 1ZHIA 2CGHA 4N0AC 1M9SA 1B34A 3QIIA 4WBNE 4EDUA 3I55T 3CMAT 3OJAA 2MWOA 2P9BA 2P0KA 4C5HA 3JB9J 5CVIA 2E5QA 3S6WA 1PSEA 5CK9A 2E12A 4C92D 1E1HB 5C8YE 4PKCC 2WWUA 3AA6B 2VB6A 1HK9A 3OW2S 5EK2A 5CO7A 3LFMA 3CQCB 5JVDE 1PSFA 3LW5E 5LJ3j 1YI2T 5JDHA 2CZ6B 3JCMc 3V7CA 3FRNA 4EZ4A 4PLIA 2QA4T 4TZ4C 4BACA 3ER0A 2CCQA 2DLRA 2E6ZA 1YW0A 3W15B 3NZQA 3VKHA 3GP8A 3QSUA 2DIQA 4XU1A 2EKOA 3R84B 4XTYA 3CX6B 4XAXB 1LNXA 2DO3A 1Q86C 2EJ9A 5CKDA 3OKQA 4OF1A 2RK2A 2D0UA 2JPFA 3ZYMA 2ZPHB 1UB4A 2YU2A 4KUIA 3OS2A 3G4ST 2VKOA 4M75C 2KT9A 3KDSE 4M75B 1S35A 5GAN8 2RJEA 1UX5A 3L1AA 4UC4A 3E9FA 1KQSS 1G3TA 3KV4A 3CXCA 3VV0A 1BR0A 3C95A 1G3WA 2R57A 3K3QC 3ANWB 4B6XA 1BI3A 4AKHA 1G3SA 4BUGA 2MI6A 2DAQA 3LK2B 3M57A 2ZMAA 5LBQB 2F5TX 2OTLA 3N9NA 1US7B 2CLYB 2IW5B 2YHTA 2O4XA 2ZCFB 4M78B 1KNZA 2QQSA 3AAEB 1RL2A 2NLUA 3CMET 1NE8A 5J1GA 5GAOl 4C8QE 4Y91A 1M4ZA 1N8RC 3TCJA 1QVGA 4WBOA 3UT5E 3RH3A 3NZPA 1LVKA 4HN9A 3H3AA 4OYKA 2WMOA 5FYMA 2VUBA 2VGNA 3V5SA 2QTXA 3ZC0A 5JR9A 3VHLA 4NL2A 1VQKA 2CZ7B 4EMGA 3MP6A 4BJNA 4KMCA 2RI5A 5LHIB 3UUNA 4MALA 1VQPT 2GFAA 4XQ3A 3HA4A 4HCCA 5FU7B 2FL7A 4F7UA 1QVPA 2E65A 3BY7A 3ZBDA 4C92C 4ZHQE 3OBWA 4EXTA 4V2SA 3MEWA 1VQ5A 1VQ8T 1D1BA 4HTEA 4PNOA 4CZZB 4RMOA 3JC6C 2IC9A 4XTWA 4A4EA 2XDPA 1BIAA 3WVEB 2KMFA 4HKEA 2NW8A 4A54A 1M8VA 4N78D 3OS1A 2LSYA 3ONXA 4R55A 2QEXA 4C8QD 3N2OA 2XTLA 2JTMA 3V8KA 2DD4A 3J7AF 3VUBA 4IHJE 4YLHA 4FI5A 5GAMh 2CZ0B 2NWBA 4ERRA 4KULA 3OYAA 1U4QA 1JJ2S 5GAN7 3OYIA 3HHTB 3CC4A 4CXWA 3PT9A 4DOWA 4UEMA 3OSSC 2LSIA 4YHJA 3CCVA 4O2AE 4ATOA 3VU3C 3FEOA 3QJ6A 4A4FA 3G71A 3L2ZA 3PUSA 4JRIA 5A0LA 1VQ4A 1WRDA 1VUBA 5JR9C 5GAN6 3HFOA 3GLXA 4A4HA 2CA5A 2MYSA 2N2NA 2L8DA 4X1YE 4YJ2E 2VC8A 4JUVA 4X9CA 1BI0A 3ANWA 2E9XB 3ZN0B 3N9MA 4JLIA 1YJNA 3ZCIA 4AKRB 3CPWS 3NBXX 3AA1B 4FSXA 2W63A 3EUHA 4H9NC 5EK3A 4ZI2C 3M4GA 4UF0A 5LJNA 3CPFA 2K5IA 5GAN3 3CC7T 3QBYA 1G8XA 2D2SA 2RI2A 5LXTE 3LG7A 4XZCA 1QVFS 4H9OC 4AQFC 5FLXE 3C51A 2WACA 4GY5A 1VIFA 3CCET 4C92B 1XNIA 3RKYA 5HXRA 3RERA 4G63A 1HG5A 2EQKA 2Y90A 2B1EA 1WNLA 5FXVA 2DK3A 3OYCA 3X24B 2JJ9A 4PW8A 5F8PA 4MMLA 4WNKA 3FBLA 2AHJB 3JCMX 4IUPA 4EYUA 2GCXA 5LJ3h 2V7MA 5GAMe 1YITT 3R6NA 3JB9H 5GMKh 1FWZA 2PFVA 4M7AF 3GN5A 2LT1A 2XD0A 3A8GB 5DJQC 3ZMVB 2QGSA 1QW1A 2ZGWA 1LVFA 4H9SE 4GOUA 4X1IE 3CCUT 1K8AC 3ZMZB 4C5EA 1JRIA 3RYIE 2VASA 3JCMd 2OTJT 4ZS2A 2CXDA 1KHCA 3WI3A 3TEEA 2BKDN 1VQMA 4OB3B 5JREA 2Y4XA 3LLRA 4LDVA 3DP7A 1Y7XA 4C0FA 2ZM2A 1KD1U 1XTDA 3CC2A 2XICA 2GF7A 4EMHA 5DY9A 5FXWA 1ZEEA 3PURA 3FC3A 3AA0B 3L2QA 4X1KE 3SWNB 4M78E 3CCJA 3O9XA 4C8QF 3ZEFB 1XQHA 5JDNA 4M78D 1MMAA 3UWNA 2V1DB 2PVGB 1WJSA 3HL8A 1B34B 4RG8A 4BY6B 4M77F 2L8KA 1G5VA 2VV5A 1JJ2A 3L2WA 4DO0A 5E0OA 2RJCA 3CCMA 2GQVA 2JTFA 2K5BB 5LP6E 3HL6A 1WJQA 3JCMh 3CCEA 1B7TA 2X4XA 5GAOq 1HX8A 2JQQA 3TU4K 1Y71A 3N9OA 2UXNB 3F31A 3CCVT 2XAFB 3HI2A 5FU7C 4UV9B 5CR2A 3KXTA 4P0BA 3NFCA 2MTQA 1HG2A 5GAMg 4CQIA 4L59A 4M77A 4Z02A 1VQLA 5LJ5h 3CMEA 3UFEA 2XI9A 2X67A 4FL6A 2QI2A 3LBXA 5L3FB 3S3NA 3OYYA 5AFUL 2ZPGB 3PMIA 2K5LA 1M90U 3QUJA 4DOVA 4E7SA 3C50A 1VRBA 4C8QB 3OYMA 2LX9A 4BI4A 5LJ5j 3V8JA 3JCMf 2C5JA 5CQXA 2LNVA 3UDCA 1ZHCA 2LOPA 3SWNA 4E7KA 3CCST 4E7ZA 3KV6A 2YK0A 2X4WA 4H63V 3FJPA 2MAMA 1BIBA 2M0OA 3IF8B 4B9WA 3LH0A 5JDLA 1Y96B 2OTJA 4J2CA 2CWYA 2DWKA 2KAFA 2X4YA 5LJ5f 1FMWA 3N9QA 3MZKB 2DTIA 3OSVA 2P0QA 2HH7A 5JRCB 2CYZB 3UULA 2DIGA 3RIRA 4KP3C 4O4JE 5A2QE 4N4GA 5FNVE 4ASKA 2GFUA 5TAOA 4BE0A 3LK42 3OYXA 4MDWA 2OAUA 4NL3A 3ZMSB 3E19A 1D1CA 3OYKA 3RYHE 4AQFA 1NWMX 2C0SA 4IURA 3F2EA 2CWOA 3PDYA 4A56A 1WQWA 1D0XA 4JUYA 4A53A 5LNKA 2QQAA 1WR6A 4OB2B 1KHIA 3AA7B 3ZJ1A 3I55A 5I2MA 3BK9A 2XDBA 3PU3A 4PJOC 1VQ6T 4QVZA 5A0DA 5HXHA 3EFRA 4M78A 3JCMV 3KINB 1WGSA 2WBLA 1IZNB 1D3BA 1G3YA 3ZJ2A 2Y4YA 2WSFE 2YU1A 4U72A 5GANj 3GIBA 1ZKEA 4HEAA 3M56A 2DTHA 3JCMe 3CMLA 4M77C 1W2BA 5HAXA 3CWZB 3CCJT 2DXBA 3DJBA 4O4LE 3J9X1 1OI1A 4I4TE 3C4SA 1QSDA 4BE1A 1VQ4T 2PG8A 1IREB 3LGFA 5HXSA 1BKBA 3LWHA 3J80E 4OGCA 2LQ8A 3CVRA 2JRKA 2CXFA 2EIFA 3H8ZA 3X20B 2JUFA 4EZHA 1CUNA 1JBMA 5C0MA 2CZ1B 2FHDA 5GAOp 4QQDA 1Y96A 3PUQA 3Q9DA 3OB9A 3RMSA 3KV5A 4C0DB 1YJ9T 1YKHB 2BVMA 1KQ1A 5CB4E 4O4IE 4FU6A 5CQYA 4C92G 3L2RA 1MMGA 5KCOA 2V7IA 2V8KA 5DQWA 2CLYC 5GAMj 4BY6C 5JR9B 3L2UA 1OWAA 3B57A 2LC4A 4IE6A 3CCRT 4U74A 4A4KA 5LHGB 3MEUA 4F7UF 3C94A 3V8LA 2HQXA 5GAMf 3CX8B 3ZYLA 2ODUA 3LX7A 3META 3TREA 3O1HA 5FY1A 3AVRA 2K3YA 4F7UB 3LBXB 4LDWA 2MMPA 2KQWA 1VQ9A 5HWXA 4N4IA 3C4ZA 4PK6A 1HTJF 3ZFJA 1G73A 3S4UA 1Q81U 3RC8A 5DLOA 2Y8DA 4AQGA 1AHJB 2RJFA 5GANg 2RA2A 3CC7A 1OZ2A 2OA5A 5I2SA 1UGPB 3M54A 5FXZA 2KK4A 3ETVA 3CBPA 1YJWA 4MDXA 4PJLA 2LCCA 2XAGB 1NPRA 3RKXA 1OXZA 4OVAA 4JLEA 4RKUE 3SD4A 5L3GB 1X6OA 3HFNA 5JQGE 3C64A 1NJIU 1VQ8A 2LSGA 1YKEB 3LYIA 4PFPA 4C5GA 4M1PA 4P09A 1JB0E 5J26A 5HXEA 5LA6E 2KNDA 2WAUA 3MHXA 3HSBA 5CKFA 2PBIA 1MIYA 1MIVA 1D0YA 4OMFB 3N5LA 3ZPOA 2LE8A 4ZI3D 3I0QA 3OYHA 2XAQB 3JCMJ 2KY9A 2QXFA 1M1GA 3C12A 4QX8B 3L2VA 4HCBA 2Y48B 4L5GA 1NPPA 5J3BA 2DXCA 3R6OA 1ZBXA 4HFVA 5CA1E 4XU2A 3RESA 4X9DA 4BJMA 1GXIE 4HT9A 4C0DC 4IUTA 2D5UA 3VKGA 1Z0PA 4L0RA 2MWPA 5GAN2 4WW0A 3CCMT 3CCQA 1IZ6A 4IE0A 4DNDA 4PK5A 2IC6A 2V8JA 4M7DD 2JMHA 3K8PC 3PTRB 2ZLYA 3INZA 2R58A 1R8OB 5GMKj 4FT2A 1M5Q1 4MZMA 1QVGS 4Y28E 4ZN3A 4M7AA 4EPCA 1Q7YC 2RJDA 2DD5A 3OBYA 2K2VA 1QP3A 3ZLIA 2V7LA 2DZCA 3SDZA 1YJ9A 3UUMA 1YHQT 5FRNA 3SS1A 2LVMA 4P5NA 3CCSA 3PU8A 3V5UA 2D6FA 3GPLA 4LDUA 3QO3A 4JDSA 3OYNA 1MIWA 4EIWA 2EQJA 2X68A 1KK7A 4OB0B 3LK3B 1OZ3A 4YJ3E 5FY0A 1X01A 4JS4A 4RCCA 4ZGEB 4VUBA 3OYZA 4QKNA 5LCYA 3BQIA 3M59A 3I56A 1FIOA 2QEXT 4ELZC 1UGSB 3MA9A 2EHOB 2ZPBB 3E9GA 4KUDK 3BFMA 5LHHB 3FXEB 1WPYA 1Q7YU 5GAN4 2E8IA 2K4YA 3QXEB 4IIJE 3I9YA 3Q2MA 4IGUA 4H9QC 5A0GA 4JS5A 3KV9A 2UXXB 3WXMB 2NOXA 4PJOE 4HT8A 1U1SA 1VQPA 5KX5E 2MBGA 3ESLA 3GNGA 4ZI3C 3BDLA 3O1JA 3QHSA 4PAGA 1O3XA 2JNGA 4QXHB 2XHCA 3KUFA 2JMKA 4PJJA 3OMCA 4M75F 4EOZB 4FM4B 3OA6A 1IAPA 1Y07A 4IE4A 4H63H 4IE5A 5LGUB 4XTZA 2DTOA 3OMGA 3SFMA 5FROA 4AKGA 3N9PA 4DQ2A 2LRQA 3GF5A 1YI2A 3P8HA 1WYCA 2KDSA 5LGTB 2LOSA 5CKBA 1HCIA 2MF2A 3DLLA 2ES0A 1MMNA 3AAAB 2X9YA 5HY6A 3RRCA 1M1KU 5DM7R 3I56T 3JB9G 1FXXA 2IVWA 3DTOA 4C92F 4ZI7E 4M7DA 4CI0C 1WLXA 4PJMA 5H6QB 2K24A 1QUUA 3ASKA 4XTVA 5LJMA 4QXCB 2FB7A 3PMTA 4EYYR 3KFWX 1P92A 2HNIA 5D6WA 5DABA 4C92E 1YHQA 2EHOC 5ETWA 2WM9A 5GAOr 2P0PA 5GAOn 4QXBB 4GIWA 2YINA 2VK9A 2DJZA 3KBUA 3NRYA 1YITA 2RHXA 1MNEA 1N9RA 1D0ZA 1I4K1 4M75G 5HYAA 2O4XB 1H3ZA 4YTLA 3AAIA 2C06A 1KQ2A 2R5AA 2LQKA 1K73C 2X51A 4M77D 2H3RA 1IJ5A 2BUDA 3CD6A 1Q82U 3A5XA 5LL6S 4C8QC 5FY7A 1HXDA 4DBQA 4HKAA 1VQLT 3T9NA 3HPWA 2Q9QD 1VOMA 2BZBA 3RYFE 1OYXA 4BA9A 3A5ZB 4FJOA 2RH2A 4M75D 3FBZA 4MBQA 4IE7A 3GWHA 3Q1JA 5FU6B 4CI3B 2V7JA 3URGA 1D1AA 4YFSA 4M7DB 1YD8G 2FVUA 3O8VA 5GAOm 2GK9A 2KXPB 1VQNA 5JRCA 3OYDA 4XTUA 4TVRA 2RHZA 2ZPEB 4EAHA 2CEAA 4IKFA 5FU6C 4ZTFA 4C5IA 3CCRA 2A7YA 4PLLA 3HP9A 2VYTA 2XASB 4UVCB 2V8IA 4J83A 3VJPA 2E9XD 3PNWC 3GOXA 1K73U 4CI2B 5FMNA 4ZGDB 5AYFA 5LJ3e 1M1FA 1S72T 3CC2T 3M9QA 3X28B 1Q86U 4XU0A 2RI3A 2Z6EA 3AVSA 4LD6A 3EAEA 3CC4T 1BR4A 4OP0A 4MMKA 1YJWT 2XKOC 5JDGA 2LDMA 5JH7E 4BDZA 4QX7B 2VKDA 4C8QA 1YIJA 3EVYA 1KD1C 4PL6A 3V7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBM B;  2EYQ A;  2LQK A;  2LT3 A;  4KMC A;  4XAX B;  4L5G A;  4ILU A;  2LT4 A;  2LT1 A;  4MFR A; 
#chains in the Genus database with same CATH topology
 3CD6 T;  3Q5W A;  4D8D A;  3QZ5 B;  3QYH B;  4IDQ A;  2K9G A;  3CMA A;  4IUU A;  3EFS A;  1TTH B;  1YJW Q;  4BE2 A;  4QVC A;  2K5F A;  3QK6 A;  4X64 T;  5GAN d;  1KFZ A;  3KFV A;  2D0Q B;  4JI2 T;  5IYZ E;  1V1C A;  5ABF B;  2UXB T;  3CMA Q;  2KVQ G;  3CCL A;  3O4X E;  2DFU A;  2EHO D;  3KBG A;  3WVD B;  3FB2 A;  3TLT A;  3WAK A;  2KR3 A;  5HK0 A;  1LOJ A;  3LGL A;  5JDM A;  5EZY E;  2BG9 E;  3QB5 K;  1WDX A;  1VQM Q;  2YXY A;  1NAF A;  2BG9 B;  3CD6 Q;  3JC6 D;  2RF0 A;  3BQL A;  1RI0 A;  2DVJ A;  5EK4 A;  1EZZ B;  1UTI A;  2KZ7 B;  2PVD B;  1BR1 A;  2NTX A;  1SA0 E;  2VXE A;  3M65 A;  2COY A;  2MAW A;  3N5B B;  4RTT A;  4M7A E;  5KDM C;  2D0N A;  3KVB A;  2EPD A;  1NJI C;  4X66 T;  1WX6 A;  1E7P A;  1RAG B;  4QH5 A;  1WHH A;  4I50 E;  3H0H A;  4X20 E;  3VRY A;  1HFA A;  3AED A;  2J6O A;  2VGM A;  5EG2 A;  2ZPI B;  5HCK A;  4LF8 T;  2VWA A;  1HR0 T;  4ZTJ A;  2XAH B;  1H3H A;  4TUY E;  3NHN A;  2XU8 A;  3EFO B;  1OOT A;  3QB5 A;  4EB6 E;  3VRZ A;  3MKD A;  4OFZ A;  2MPK A;  3HKE E;  5L4H A;  2F2W A;  4JZ4 A;  1D3B B;  3PFS A;  3G06 A;  2YEV C;  3MCA B;  2WDV A;  2FBW A;  3EDU A;  1TU0 B;  3PJA J;  2XID A;  2I0N A;  4YTN A;  3OYB A;  3E08 A;  5IT9 E;  1K0S A;  5GJV B;  4ZXL A;  2B8A A;  2Q9Q C;  3NTI A;  4UXN B;  2BE9 B;  3JCM W;  1TUG B;  5FRM A;  5FWC A;  1WQ7 A;  3PUG A;  3PUX F;  2KXD A;  4AKL A;  1YIJ T;  3FDR A;  3RKW A;  2W0G A;  5IN1 A;  5HWY A;  4L9I A;  4V1A v;  1K9M U;  4HWC A;  3SB2 A;  1BBZ A;  1V9D A;  1N27 A;  3MAC A;  2A0F B;  2CE7 A;  1D09 B;  4MHC A;  5KE3 A;  4M75 A;  1NG2 A;  2Y6X A;  3VYH B;  1IHW A;  2K2M A;  3CX7 B;  2EQU A;  3AXJ B;  1V29 B;  3G4S Q;  2DXU A;  2H7O A;  1N33 T;  2ABL A;  2F69 A;  2B86 A;  3BW1 A;  5J39 A;  4LD9 K;  2A28 A;  1NYF A;  4B3T T;  4Z91 A;  2K9A A;  4QHO A;  4E7J A;  2SPC A;  1KD1 C;  2DF6 A;  3LSV A;  1OU8 A;  3ZC1 A;  2I6H A;  2PJQ A;  1UCU A;  3E22 E;  3P7I A;  2EYW A;  3EGX A;  3UU4 A;  1ZBJ A;  3BDU A;  4PJO A;  3ZT5 A;  4HFH A;  1Y64 B;  3I1A A;  4JI4 T;  2O31 A;  4Z89 A;  5KH6 A;  3U78 A;  3CC4 Q;  3OBV E;  3TKL B;  2LCL A;  2QQ9 A;  3M0U A;  2WSS V;  3RKO A;  3A8H B;  5HK3 A;  1VQ5 T;  2KYM A;  1CKA A;  2E9X C;  4R56 A;  3KBT A;  5CCA A;  4CXY A;  1AT1 B;  3RPU A;  3A8M B;  3EG9 A;  4ISS A;  3PUZ F;  5GON E;  2KRN A;  4F17 A;  1KIK A;  2LT3 A;  5L3E B;  4N4H A;  1BR2 A;  4X34 A;  2NUP A;  2QK0 A;  1K8A R;  2XQA A;  5KMG P;  3GN5 B;  4CRI A;  1QMC A;  1KQS A;  4E7I A;  1KEY A;  2V26 A;  2ODV A;  1G83 A;  2HD0 A;  1H7C A;  3G6E Q;  2M67 A;  2F2V A;  4KBM B;  2LP5 A;  5D6Y A;  3RUX A;  1AWW A;  2CP3 A;  4J5Y A;  4I43 B;  1IXD A;  1FEW A;  2HZY A;  1Q82 C;  2HDA A;  3JB9 F;  1I1J A;  4TNV A;  2D1X A;  5L23 A;  3JCM Q;  3JSC A;  3KVA A;  5L3C B;  2HQH A;  5FVK A;  4ME7 A;  3VS4 A;  4AXP A;  2E6N A;  2ZPF B;  2LEH A;  5CIU A;  4XK8 E;  3VU7 H;  3AB3 B;  4H9P C;  4DID B;  2L3L A;  3L39 A;  1U06 A;  3I56 Q;  2L3S A;  4ZN1 A;  4QQG A;  4Z90 A;  1VYV A;  2HBW A;  5ECA A;  5AQV B;  3NTK A;  2QAZ A;  3O1I A;  2FG0 A;  4IIO A;  2KWH A;  3G1J A;  4M4Z A;  1YCS B;  4J6X A;  3CKD A;  2KT8 A;  2DHR A;  1M2V A;  3QKJ A;  3OYG A;  4U3C A;  3FZK B;  2EWN A;  2C0T A;  2WS3 A;  4QVD A;  3J81 E;  1ZQ1 A;  4FYX B;  1HX1 B;  2LTO A;  2LSJ A;  3FHN A;  1YI2 Q;  1IBK T;  1BI2 A;  3RIU C;  1CSK A;  1VQ7 T;  5H6R B;  4M77 B;  2NWM A;  4OMN A;  4C91 A;  5LJ3 f;  5LOV E;  3SOL A;  2W0Z A;  1LJO A;  1N9S A;  4UF0 B;  3ZYK A;  5L3B B;  2V8S V;  5GAN f;  3HKS A;  3MP1 A;  2CHN A;  2DNX A;  3JCM b;  3VS1 A;  1TSF A;  2X4J A;  2JMC A;  4M7D E;  4ZS3 A;  3JAE A;  3C4X A;  3EGD A;  3ETU A;  4TN7 B;  2DXT A;  3UTK A;  4YSZ A;  5IXB A;  3M58 A;  4RG2 A;  2FZC B;  2DI4 A;  2N1G A;  2VL0 A;  4TV8 E;  2A08 A;  1X2K A;  4IUQ A;  2N9D A;  2XDD A;  2C5K T;  2E10 A;  3DB4 A;  1WIE A;  4BI8 B;  3HKC E;  4DV6 T;  2EJF A;  2KMT A;  2VWF A;  2ZM0 A;  5LG4 A;  4BAY B;  3Q5D A;  4JLG A;  4PK4 A;  3I55 Q;  2JOY A;  3C0C A;  1I81 A;  2JZ2 A;  2JQH A;  2X66 A;  3SWH A;  4J6Y A;  4O5V A;  5I21 A;  2DMO A;  4TV9 E;  1ZA2 B;  2H8H A;  4WF2 A;  2JN0 A;  1JNR A;  2A2F X;  3C4W A;  2QQR A;  3X25 B;  2DWG A;  2A37 A;  1VIE A;  4HWI B;  4P1N A;  5JDF A;  2EQI A;  5AQP B;  2L9Q A;  4HGA A;  5GMK l;  3EG1 A;  5D6X A;  3LWI A;  1YBY A;  2YLB A;  4F6R C;  3PUY F;  4GK0 E;  4C0Z A;  1W0B A;  2XQ7 A;  3SFE A;  4ADZ A;  3M53 A;  4RUG A;  4HE8 A;  2M1H A;  4QT7 A;  4A5X A;  2HQE A;  1AOJ A;  2P84 A;  2CM0 A;  3S3M A;  2LKG A;  2XK0 A;  4ZGJ B;  4GK5 E;  3H0F A;  3F70 A;  4LE9 A;  5KYX A;  2LJ0 A;  2M16 A;  4JRP A;  3OQ5 A;  3L09 A;  2EQM A;  3NTH A;  4M7A B;  3UU8 A;  3RNJ A;  1I8F A;  4FIB A;  2RD1 A;  4A4G A;  2XQ9 A;  5LGN B;  1BYM A;  4ILU A;  2OTL Q;  1IO6 A;  2V6Y A;  2E70 A;  3ZT6 A;  4E7L A;  1VQK T;  3BQK A;  4JI8 T;  3HRU A;  3NGP A;  3P8D A;  3J7Y q;  3G4S A;  2LX7 A;  4PJO D;  2PVO B;  3C98 B;  4JBW F;  1QQJ A;  3CBO A;  3Q5X A;  4DMW A;  1XOV A;  5GAM d;  3GBQ A;  1T72 A;  4KUM B;  2DL3 A;  2DCF A;  4M7A G;  1UGV A;  5IWA T;  1VQ9 Q;  4FCY A;  1N8R U;  1R8I A;  3MXZ A;  5J2T E;  4B9X A;  1OPL A;  4RTY A;  5GMK i;  4CXX A;  1VQ6 A;  2XQ5 A;  1H8K A;  1T8B A;  4RCB A;  2K3W A;  3AE7 A;  1HYO A;  3HR0 A;  3VKI A;  2QA4 Q;  4M78 F;  4O4H E;  5LYJ E;  1Q81 C;  3L3P A;  4HWD A;  3EGX B;  1WA7 A;  2LQN A;  5AQQ B;  3DKM A;  3QYG B;  1W0A A;  3EHZ A;  1FMV A;  1HF8 A;  4DV4 T;  1NEK A;  3H37 A;  3X1D A;  5DQV A;  2LM2 A;  2D0T A;  3P8C D;  4TWH A;  5HKC A;  1M90 C;  5FXX A;  2ACX A;  3HTR A;  2YT6 A;  5FKY A;  4RTX A;  3QWX X;  4LMK A;  2Q9Q A;  4PNI A;  3FXD B;  3FZM B;  4U7Y A;  1DJ7 B;  2AZS A;  2VQE T;  4GLK A;  1O75 A;  1WHL A;  3MO8 A;  3REB B;  2Q9Q B;  1ARK A;  2W00 A;  1WI7 A;  4MLK A;  2PZ1 A;  3I0O A;  1OED E;  4FYY B;  4UEL A;  2DEQ A;  8AT1 B;  4OMP A;  4IDZ A;  5CJ5 A;  2DKG A;  1SHZ C;  4CN1 A;  1C0M A;  2M6I A;  2UXC T;  3L42 A;  5GAN 5;  4I55 E;  3OYE A;  2E5L T;  3G71 T;  2NW7 A;  5JDQ A;  3F57 A;  1AJ3 A;  3EAB A;  3OPC A;  2M51 A;  4F7U E;  1W4S A;  3GNF B;  3JAM E;  3CCQ Q;  4E7H A;  4L6V 5;  1N8R R;  1YJN Q;  2G0U A;  4X65 T;  4M77 G;  2XUE A;  4MZP A;  3M3Z B;  2YLC A;  3DLM A;  4E6R A;  2P4T A;  3ZST A;  2RPN A;  4QH1 A;  4BDY A;  4DV5 T;  4LDY A;  4LDX A;  2BDE A;  2RPA A;  2YRV A;  2EW3 A;  3EFO A;  2DPP B;  4J8O A;  1UHC A;  3ZMT B;  2E1H A;  1YJN T;  1M8M A;  5FP3 A;  4Q5W A;  5IHN A;  2V6X A;  2FYK A;  2QA7 A;  5A1L A;  1WHK A;  2JM8 A;  2L3R A;  3SWN C;  2RHY A;  4K0K T;  4ZOL E;  3M55 A;  4E47 A;  1AZE A;  4M7A C;  2HBP A;  1FX7 A;  5HEH A;  3L8R A;  1KC8 U;  1Z8U A;  3QDR B;  2H7V C;  2CHO A;  2W61 A;  2KSS A;  2LHN A;  3B13 A;  4P0A A;  1LKX A;  3ZMU B;  1WHJ A;  2IUB A;  2PUO B;  4ZI2 D;  4C8Q G;  3MJX A;  4BI3 A;  1T3L A;  3CEY A;  1EIF A;  1OX9 A;  3A8L B;  4CC7 A;  2WSE E;  1UUE A;  2HSP A;  4KT0 E;  3AEA A;  3VYG A;  1BU1 A;  2G3R A;  4MFR A;  2MIO A;  2NUT B;  3H6Z A;  4B6M A;  1VQO T;  5CAI A;  1KF6 A;  4H9R C;  1SSH A;  1TXQ A;  2OI3 A;  3RLF F;  4UVB B;  5CFB A;  3IEE A;  2X9W A;  2WSC E;  4BD3 A;  2GTJ A;  2W10 A;  1S94 A;  4OMQ A;  3HKB E;  2X0L B;  5LJ5 e;  4BB7 A;  2JQ9 A;  2VXF A;  1M1K C;  5LJ5 g;  5AQJ B;  4M77 E;  4OB1 B;  1O9S A;  4JRQ A;  3PV0 F;  2KT1 A;  2VKH A;  3I9W A;  3HRT A;  1UX4 A;  2WQY A;  5HXC A;  4Z8X A;  4II1 A;  2CKK A;  1S72 A;  3OY9 A;  2DVE A;  2A3L A;  5LJ3 d;  2K48 A;  2EBP A;  3LJC A;  2QDY B;  3VS0 A;  3OW2 A;  3RYC E;  1T98 A;  1YIT Q;  3X26 B;  1I5L A;  4J6W A;  2CXL A;  3CQT A;  5GMK e;  3JB9 I;  1NEB A;  2FPD A;  1K8A U;  5CKE A;  1QCF A;  2AT1 B;  4CC2 A;  5AQO B;  1MHN A;  2NW9 A;  3QPH A;  4N0A A;  2QQB A;  4ILA A;  1PRL C;  4AT1 B;  1KC8 C;  4MZT A;  2FJB A;  3PE0 A;  2W62 A;  1ZLM A;  3JCM g;  2X35 A;  1UGQ B;  3UT1 A;  3VR9 A;  2LHR A;  3ME9 A;  3QJY A;  3RMQ A;  3ZEH A;  3OS5 A;  3JCM P;  2BKN A;  4JEU B;  2LSK A;  2KWI B;  2ZAE A;  5KYU A;  1VQN T;  4ZEY A;  2BVL A;  4O2B E;  2BIV A;  4M7D F;  3QZ9 B;  1QP2 A;  4NUV A;  3JRZ A;  5L2L A;  3CCL T;  4XTX A;  2WMN A;  3FZH B;  2F5K A;  3OYJ A;  2VL8 A;  5GAN h;  3MP8 A;  1Z9Z A;  1WJR A;  1XDP A;  2X9H A;  2I59 A;  2QRX A;  1CHU A;  2E64 A;  2K3X A;  3QG1 A;  4FT4 A;  4QH4 A;  2DET A;  3U3I A;  4UV8 B;  4JRK A;  4TX5 A;  4CI1 B;  2YRD A;  3E0Z A;  1NZ9 A;  4JI3 T;  2V7K A;  3H0I A;  5KYY A;  2XHE B;  3EG2 A;  4DA4 A;  1VQO A;  4QKU A;  2ED0 A;  1XWM A;  2VVN A;  2DZ9 A;  3AHU A;  4DMV A;  2PU9 B;  4NS5 A;  1UG1 A;  3CXC S;  1VQM T;  2HN2 A;  3CPZ A;  3N9L A;  1YHQ Q;  3M4Y A;  1W6X A;  1SSF A;  1KC8 R;  3SRZ A;  3GA8 A;  1U5P A;  3GMI A;  3RRW A;  2LM9 A;  4ESR A;  2FEI A;  3T8O A;  1TH7 A;  4HXJ A;  5LJ5 d;  5FL0 A;  5HEU A;  2BKP A;  1BI1 A;  4NOY A;  1IBM T;  1KD1 R;  1MGQ A;  5LBM A;  4OHF A;  1ABO A;  1SG5 A;  5AT1 B;  4C0G A;  1RAH B;  3NMZ C;  2DX1 A;  4JI0 T;  4RTU A;  2RM4 A;  5GMK m;  5IHY A;  2DER A;  5L8R E;  3OYL A;  4PJO G;  3VUZ A;  1CKB A;  1U3O A;  4NIQ A;  1IRX A;  4R0K A;  4M7D C;  1UEB A;  2JM9 A;  4AI6 A;  2H3J A;  1VQO Q;  3S3O A;  2QGF B;  2HAX A;  1NYG A;  2HL3 A;  3FIF A;  4M7A D;  2NTY A;  4XBF B;  2ZM8 A;  1HS7 A;  3NKZ A;  1UDL A;  1LRZ A;  4DEX A;  4IUV A;  3OW2 P;  3CCQ T;  2XG8 D;  5AQU B;  4DBR A;  3A8O B;  2CP7 A;  5FW9 A;  3HRS A;  3VR8 A;  1W09 A;  3ZCJ A;  3FB9 A;  2RK1 A;  4UVA B;  4IST A;  4QWN B;  3AEB A;  4PJO B;  5LJ3 g;  2JVV A;  1MND A;  3AE5 A;  2DLP A;  2RHI A;  3QC9 A;  1X6G A;  1OED C;  2QVA A;  2HPL A;  4M7D G;  2C5I T;  4NUU A;  3AEC A;  4YTM A;  1YXR A;  2EJG A;  1WYB A;  3RGL A;  3IBP A;  5F3J A;  3D0T A;  4J7F A;  4AIU A;  4PFO A;  2KEA A;  3RC3 A;  4XU3 A;  3CBM A;  5CKH A;  5ABE A;  2CMR A;  5KE2 A;  3JB9 D;  5ADX L;  2A72 A;  5J2U E;  2LT4 A;  2RB6 A;  2A3D A;  2LQW A;  2RP4 A;  1SUM B;  2R5M A;  1K9M C;  2RHU A;  2GTO A;  3MK7 C;  5C3J A;  3RIF A;  2JS0 A;  2DJQ A;  2L5Q A;  2YWW A;  2YDS A;  1FYN A;  2D9T A;  2MOZ A;  1WXT A;  1VQ9 T;  3ZN1 B;  5ABH A;  2PUK B;  1YCY A;  3PUA A;  3PIO A;  2DE0 X;  2O01 E;  2DIL A;  4K0U A;  3UU5 A;  2RO0 A;  4JJN K;  5AQN B;  4OYJ A;  2KLQ A;  2I0M A;  4C92 A;  1JNZ A;  3MEA A;  4ILC A;  3IHR A;  1AWX A;  1ZV4 X;  2CS7 A;  2A9U A;  5M4Y A;  2WDR A;  2OTL T;  2PQW A;  3PTA A;  2XQY A;  1VQL Q;  3EDV A;  1GCQ A;  1UGO A;  3TLW A;  1E7O A;  3PVQ A;  3DB3 A;  4EMK A;  1X79 A;  3N2K E;  4OGE A;  1QVF A;  2I2L A;  4OK0 A;  3UPU A;  1H64 1;  2XAJ B;  3K3O A;  1X75 C;  5AQF B;  2NP9 A;  3OS0 A;  3OYF A;  4LFA T;  4PJO F;  4O8S A;  3G6E T;  3QUI A;  2EYQ A;  1U8R A;  1W2B P;  2GBQ A;  1OU9 A;  1YIJ Q;  2E41 A;  1AWO A;  4M78 G;  3OTO T;  2XPK A;  4NPP A;  4B3M T;  2ROT A;  4HCZ A;  2E9X A;  4HFB A;  3RX6 A;  1N6A A;  4PJN A;  3VS2 A;  5KYY B;  4KGX B;  5C6S A;  3PIP A;  1VQ7 A;  4F7U G;  3I5S A;  3HKD E;  1I6Z A;  2IAK A;  4G2A A;  3V7S A;  3NRX A;  5KXJ A;  2BS4 A;  3K3N A;  1UGR B;  4QQ6 A;  4M75 E;  4QW2 A;  4GYS A;  5L3D B;  1M2O A;  2M9U A;  4ANJ A;  4ELY C;  5DLQ E;  2EYX A;  4PFZ A;  5CA0 E;  1J1J A;  2KIN B;  3P8B B;  1WYX A;  4M78 C;  2L3P A;  4GYR A;  2RA1 A;  3CCU A;  1MV0 B;  2EFI A;  3MEV A;  2J1D G;  3G6E A;  2CSI A;  1W2B S;  3PGG A;  3UUX B;  2VKJ A;  4DVD A;  1E2A A;  4D6W A;  4WYV A;  1I5O B;  2CPT A;  1T7S A;  3VS5 A;  1QWE A;  1YJ9 Q;  3CQG B;  1OQK A;  1RAD B;  2FPF A;  3G7Z A;  5IAY A;  4NXN T;  4J7I A;  2IG0 A;  1IJ6 A;  2C0I A;  3UA6 A;  4UIG A;  2QA4 A;  4HA8 A;  2EHO A;  5JTG A;  3PVL A;  1Q82 R;  2K57 A;  2OAW A;  5GAN e;  2LJL A;  1MMD A;  3CQX C;  2OLT A;  3WAJ A;  3VS3 A;  2YRC A;  3N2G E;  5KCH A;  4LF5 T;  2DA9 A;  4C90 A;  2EAY A;  4O6J A;  3H3M A;  1NLP C;  2X9X A;  2L89 A;  4JEH B;  1EZ3 A;  1JEG A;  5M9O A;  3FLG A;  1KG1 A;  3E1S A;  1U1T A;  4EMK B;  3M5A A;  2XM2 A;  2O88 A;  2HPJ A;  3P4Q A;  3CXC P;  5BMV E;  4AKI A;  3CPW A;  4KRT A;  1ZUU A;  2V1Q A;  4HVW A;  2ZZD A;  2WZI A;  5IHI A;  2COZ A;  4EMK C;  1ZHI A;  2CGH A;  3PUV F;  1SEM A;  4N0A C;  1M9S A;  1B34 A;  3THK A;  1JJ2 P;  3QII A;  4WBN E;  4EDU A;  1ZUK A;  3RDV A;  3I55 T;  3CMA T;  3OJA A;  2MWO A;  2P9B A;  1M3B A;  2P0K A;  1UUS A;  4C5H A;  1VQ8 Q;  1GBR A;  3JB9 J;  5CVI A;  2E5Q A;  2M6B A;  3S6W A;  1PSE A;  3RKG A;  5CK9 A;  2E12 A;  1K0X A;  4C92 D;  4Z8A A;  1E1H B;  2YDQ A;  3ONJ A;  5C8Y E;  4PKC C;  1J5W A;  3JAF A;  2WWU A;  1RI9 A;  1QLB A;  2D8H A;  3FZF B;  4LF4 T;  3AA6 B;  2VB6 A;  3AEE A;  1HK9 A;  1ZSZ B;  1VQ4 Q;  3OW2 S;  5EK2 A;  2Z0W A;  5CO7 A;  2K79 A;  1M62 A;  2WCA A;  1X9B A;  3LFM A;  3CQC B;  5JVD E;  1PSF A;  3LW5 E;  5LJ3 j;  1YI2 T;  1GFC A;  5JDH A;  2CZ6 B;  3H9N A;  3JCM c;  3V7C A;  3FRN A;  4EZ4 A;  2D8J A;  2EYZ A;  1U5S A;  4PLI A;  2QA4 T;  4TZ4 C;  4BAC A;  3ER0 A;  2CCQ A;  5AQG B;  2DLR A;  2E6Z A;  1TWB A;  2CP6 A;  2CH4 A;  2NR4 A;  1OEB A;  4B3R T;  1YW0 A;  3CCM Q;  3W15 B;  2LJ1 A;  1I94 T;  3NZQ A;  4J9B A;  3VKH A;  3GP8 A;  2NUT A;  2DIQ A;  4XU1 A;  3QSU A;  1XNR T;  2EKO A;  2CP0 A;  3R84 B;  1GCQ C;  2H89 A;  3CX6 B;  4XAX B;  1LNX A;  2DO3 A;  4XTY A;  1Q86 C;  2FJA A;  2EJ9 A;  2L2P A;  2OJ2 A;  5CKD A;  2ENM A;  3CC2 Q;  5FL1 A;  3OKQ A;  1YQ3 A;  4OF1 A;  4U33 A;  2RK2 A;  2D0U A;  2JPF A;  5LMN T;  4UR9 A;  3ZYM A;  2DNU A;  2JTE A;  2ZPH B;  4FSS A;  1UB4 A;  4FYW B;  1YQ4 A;  2YU2 A;  1FMK A;  4KUI A;  3OS2 A;  3G4S T;  2VKO A;  4M75 C;  4J9G A;  2KT9 A;  3KDS E;  2QEX Q;  4M75 B;  1S35 A;  1VQ6 Q;  5GAN 8;  3I35 A;  2RJE A;  1UX5 A;  3L1A A;  4UC4 A;  3E9F A;  1KQS S;  1G3T A;  3KV4 A;  2OX7 A;  3CXC A;  3VV0 A;  1GL5 A;  3MPU B;  1BR0 A;  3C95 A;  1G3W A;  2R57 A;  3K3Q C;  3ANW B;  4B6X A;  1BI3 A;  4AKH A;  1G3S A;  3M0Q A;  2HSE B;  4BUG A;  2MI6 A;  4EGW A;  1XMQ T;  2DAQ A;  2CRE A;  3LK2 B;  1TS9 A;  3M57 A;  2ZMA A;  5LBQ B;  5BR8 T;  2F5T X;  1AD5 A;  2OTL A;  3N9N A;  1US7 B;  2CLY B;  2IW5 B;  2YHT A;  2O4X A;  2ZCF B;  4M78 B;  1KNZ A;  1K76 A;  2QQS A;  3AAE B;  1RL2 A;  2NLU A;  3CME T;  1NE8 A;  5J1G A;  1N36 T;  5GAO l;  2X0H A;  4C8Q E;  3EH2 A;  4Y91 A;  1M4Z A;  1Q86 R;  4GBQ A;  1N8R C;  3TCJ A;  4AG2 C;  1QVG A;  4WBO A;  3UT5 E;  2YKS A;  2JW4 A;  3RH3 A;  2X0Y A;  3NZP A;  1LVK A;  1SKU B;  4HN9 A;  3TLV A;  3UF4 A;  3H3A A;  4OYK A;  1JXM A;  2WMO A;  5FYM A;  2VUB A;  5LMU T;  2VGN A;  1VQP Q;  3EG0 A;  3V5S A;  1R0B G;  2H88 A;  2QTX A;  2CH4 W;  1UUR A;  4JI6 T;  2UUA T;  2AE9 A;  2BG9 A;  3ZC0 A;  5JR9 A;  3VHL A;  4NL2 A;  2OV9 A;  1RAA B;  1VQK A;  1BCM A;  2CZ7 B;  4EMG A;  3MP6 A;  4BJN A;  1ZSG A;  2QYW A;  4KMC A;  2RI5 A;  4KH1 B;  5LHI B;  3UUN A;  4MAL A;  2YSQ A;  1VQP T;  2BZX A;  2GFA A;  4XQ3 A;  3HA4 A;  4HCC A;  5FU7 B;  3TLU A;  3LDQ B;  2FL7 A;  4F7U A;  2UUC T;  1QVP A;  3AE6 A;  4ILB A;  2E65 A;  3BY7 A;  3ZBD A;  4C92 C;  4ZHQ E;  3OBW A;  4EXT A;  4V2S A;  3P50 A;  3MEW A;  2NYS A;  5HEG A;  1VQ5 A;  2KI7 A;  1VQ8 T;  1T0J A;  1D1B A;  4HTE A;  4PNO A;  4CZZ B;  4A63 B;  2ED1 A;  4RMO A;  3JC6 C;  1S72 Q;  5IUX A;  4FYV B;  2IC9 A;  4XTW A;  4A4E A;  2XDP A;  1BIA A;  3AT1 B;  3WVE B;  2KMF A;  4HKE A;  2NW8 A;  2WDQ A;  4A54 A;  1M8V A;  3UQ7 A;  2V6Y B;  4N78 D;  3OS1 A;  1M1K R;  2LSY A;  3ONX A;  4DR5 T;  4CN6 A;  4R55 A;  4C8Q D;  2QEX A;  3RBB B;  3N2O A;  2XTL A;  2JTM A;  3V8K A;  1ZSZ A;  2DD4 A;  2XZE A;  3J7A F;  3VUB A;  4IHJ E;  4YLH A;  4FI5 A;  5GAM h;  1UK5 A;  2IHR 1;  2NWB A;  2CZ0 B;  2WZH A;  4ERR A;  3TSW A;  4KUL A;  1IHV A;  2DL4 A;  2XJ7 A;  5IXF A;  3OYA A;  1NM7 A;  1U4Q A;  1JJ2 S;  5GAN 7;  1QWF A;  3P4W A;  3OYI A;  3HHT B;  3UU3 A;  3CC4 A;  5LG3 A;  4CXW A;  3PT9 A;  1NEG A;  1K9M R;  4DOW A;  4UEM A;  3OSS C;  2LSI A;  1LPL A;  4YHJ A;  3CCV A;  4O2A E;  3EI0 A;  3K1S A;  4ATO A;  3VU3 C;  3FEO A;  2FJE A;  3QJ6 A;  4LNP A;  3P4R A;  3NPF A;  4A4F A;  3G71 A;  1W70 A;  3L2Z A;  1PG5 B;  3PUS A;  4JRI A;  2AZV A;  2QGG A;  1RAC B;  5A0L A;  2O9V A;  4LF7 T;  3ZKR A;  1VQ4 A;  5HEJ A;  1UFF A;  4DR6 T;  1WRD A;  1VUB A;  5JR9 C;  1UJ0 A;  5GAN 6;  3HFO A;  3IQL A;  3GLX A;  4A4H A;  2LZ6 B;  2DEU A;  1Q95 G;  2CA5 A;  2MYS A;  2N2N A;  2XSA A;  4X1Y E;  1IGU A;  1JU5 C;  4YJ2 E;  1YWP A;  2E3H A;  2L8D A;  2VC8 A;  4F04 B;  2DL5 A;  4JUV A;  4X9C A;  1BI0 A;  3ANW A;  2E9X B;  3ZN0 B;  1TG0 A;  3N9M A;  4JLI A;  1YJN A;  3ZCI A;  4RTV A;  4DBF A;  4AKR B;  3SHW A;  5FWB A;  3CPW S;  3NBX X;  3AA1 B;  1WLP B;  4FSX A;  3TQ7 P;  2W63 A;  2O9S A;  5KYW A;  3EUH A;  1WCR A;  4H9N C;  5EK3 A;  4ZI2 C;  3M4G A;  4Q25 A;  4UF0 A;  5LJN A;  1QKW A;  2J6F A;  3UAT A;  1A0N B;  3CPF A;  2K5I A;  1R0C B;  1NJI R;  2NUZ A;  5GAN 3;  3CC7 T;  4WTO B;  3QBY A;  4F8H A;  1C6V X;  2DL1 A;  1G8X A;  2LNH B;  3A7M A;  2D2S A;  2RI2 A;  5LXT E;  3LG7 A;  4LML A;  2FZG B;  4XZC A;  1QVF S;  4H9O C;  4AQF C;  4HWH A;  5FLX E;  4AFZ C;  3C51 A;  1HNX T;  2WU2 A;  2WAC A;  4GY5 A;  1VIF A;  4I0U A;  3CCE T;  4FW1 A;  4DR3 T;  4C92 B;  1XNI A;  2EVR A;  3RKY A;  1WR0 A;  5HXR A;  2YDL A;  3RER A;  4G63 A;  4AMC A;  2YUN A;  1HG5 A;  1ZP0 A;  1MUZ A;  2EQK A;  4AG1 C;  4CC4 B;  1RAI B;  2Y90 A;  1ABQ A;  2KRS A;  3NWI A;  2B1E A;  1WNL A;  5FXV A;  2DK3 A;  3OYC A;  4AFU C;  3EHR A;  3X24 B;  2JJ9 A;  4PW8 A;  2MK5 A;  2F4V T;  3M0S A;  1PD1 A;  1YN8 A;  5F8P A;  4MML A;  2XQ4 A;  4WNK A;  1QCO A;  2DL8 A;  2KGT A;  2BG9 C;  3FBL A;  2AHJ B;  3JCM X;  4IUP A;  1RUW A;  4EYU A;  2XSB A;  1K9A A;  2GCX A;  5LJ3 h;  2V7M A;  5GAM e;  1YIT T;  3R6N A;  3JB9 H;  1J5E T;  3A98 A;  4CN4 A;  4KHP T;  3LH5 A;  5GMK h;  1KNR A;  1XMO T;  1FWZ A;  2PFV A;  4M7A F;  3GN5 A;  2LT1 A;  1VQ7 Q;  2XD0 A;  4Z88 A;  3A8G B;  4DBH A;  3CCR Q;  5DJQ C;  1EX4 A;  5L4E A;  3ZMV B;  2QGS A;  1QW1 A;  4IT4 A;  2ZGW A;  2PTK A;  1GFD A;  1LVF A;  4H9S E;  2M0Y A;  3ZSS A;  4GOU A;  4X1I E;  3CCU T;  4OMO A;  1K8A C;  3ZMZ B;  4C5E A;  1JRI A;  3RYI E;  2KSR A;  2VAS A;  3JCM d;  1X69 A;  2OTJ T;  4ZS2 A;  2FZK B;  1W1F A;  2CXD A;  1KHC A;  2J6K A;  3WI3 A;  1GRI A;  3TEE A;  1QKX A;  2VVS A;  4WCI A;  2BKD N;  1VQM A;  4LXC A;  1AZG B;  4IDN A;  4OB3 B;  5JRE A;  3CCS Q;  1Q7Y R;  2HN1 A;  2Y4X A;  3LLR A;  4TWD A;  2J06 A;  3DP7 A;  1Y7X A;  4LDV A;  4C0F A;  2ZM2 A;  1KD1 U;  1XTD A;  3CC2 A;  2XIC A;  2GF7 A;  2V1R A;  5DY9 A;  2F2X A;  3REA B;  4EMH A;  2BKO A;  3RIA A;  3AXJ A;  5FXW A;  2DRM A;  1ZEE A;  3PUR A;  5HCJ A;  3AA0 B;  3FC3 A;  2W2U A;  4DV3 T;  4X1K E;  3SWN B;  3L2Q A;  1PCX A;  4M78 E;  1YFN A;  3CCJ A;  3O9X A;  4J9H A;  4C8Q F;  2JT4 A;  1VA7 A;  3ZEF B;  1XQH A;  2CBJ A;  5JDN A;  4M78 D;  1MMA A;  5AQI B;  3UWN A;  3EGD B;  2V1D B;  1M30 A;  2PVG B;  2GGR A;  1WJS A;  4X1V A;  3HL8 A;  1B34 B;  4YHH T;  4RG8 A;  4BY6 B;  4M77 F;  2L8K A;  2CP2 A;  2E5V A;  3BE3 A;  1G5V A;  2VV5 A;  1JJ2 A;  3L2W A;  4DO0 A;  2E2A A;  5E0O A;  2RJC A;  3CCM A;  1VQN Q;  1PKS A;  2GQV A;  2JTF A;  2K5B B;  3OVU A;  5LP6 E;  4D8K A;  2XQ6 A;  3HL6 A;  1WJQ A;  3JCM h;  3CCE A;  1B7T A;  3CPW P;  2X4X A;  5GAO q;  4IDP A;  1HX8 A;  2W4X A;  2JQQ A;  2J62 A;  1FJG T;  3TU4 K;  1Y71 A;  3FZL B;  3N9O A;  2UXN B;  3F31 A;  4X62 T;  3CCV T;  4HWF A;  2XAF B;  3HI2 A;  5FU7 C;  4UV9 B;  4KX6 A;  5CR2 A;  4P0B A;  3KXT A;  2ATC B;  3NFC A;  2B76 A;  2RNA A;  2MTQ A;  1I07 A;  1HG2 A;  5GAM g;  1V76 A;  4KGV B;  4CQI A;  2KYB A;  4J9I A;  4YXD A;  4L59 A;  4M77 A;  4Z02 A;  1VQL A;  5LJ5 h;  3CME A;  3UFE A;  2XI9 A;  2X67 A;  2BE7 D;  2YN6 A;  4HFD A;  4FL6 A;  2AXD S;  2QI2 A;  4JJD A;  3LBX A;  5L3F B;  2QTV A;  3S3N A;  1XJW B;  3I5R A;  3OYY A;  5AFU L;  2ZPG B;  3PMI A;  2K5L A;  2L3Q A;  3QUJ A;  1M90 U;  4AQY T;  4AFS C;  4E7S A;  2PTF A;  1LCK A;  3C50 A;  4DOV A;  1VRB A;  4C8Q B;  3OYM A;  2LX9 A;  1OED A;  4BI4 A;  5LJ5 j;  1I0C A;  1N34 T;  2DBM A;  3V8J A;  3JCM f;  2C5J A;  3O5Z A;  4KGZ B;  1HD3 A;  2LNV A;  5CQX A;  3UDC A;  1ZHC A;  1SHG A;  2LOP A;  1C1A A;  2F1L A;  3SWN A;  4E7K A;  3CCS T;  4E7Z A;  3KV6 A;  1WZO A;  2LRK A;  2YK0 A;  2X4W A;  4H63 V;  3FJP A;  2XQ3 A;  1PC0 A;  2MAM A;  1BIB A;  4EED A;  2M0O A;  3M0P A;  4DUZ T;  3IF8 B;  4B9W A;  3LH0 A;  4J9E A;  1TUC A;  4YSY A;  5JDL A;  2K7A A;  4ZZB A;  4FW2 A;  3ABV A;  1Y96 B;  2OTJ A;  4J2C A;  2CWY A;  2DWK A;  2KAF A;  2X4Y A;  5LJ5 f;  1Y01 A;  1FMW A;  3N9Q A;  3MZK B;  2DTI A;  3OSV A;  2P0Q A;  2HH7 A;  5JRC B;  2BS3 A;  3PJA A;  2CYZ B;  3UUL A;  2DIG A;  3RIR A;  1PHT A;  4KP3 C;  4O4J E;  5A2Q E;  4N4G A;  5AQT B;  3RR6 A;  5FNV E;  4ASK A;  4OML A;  2GFU A;  8ATC B;  5TAO A;  4BE0 A;  3LK4 2;  1X6B A;  3OYX A;  4YSX A;  2RQR A;  2OAU A;  4MDW A;  2IDO B;  4NL3 A;  3ZMS B;  5AQS B;  3E19 A;  1D1C A;  3OYK A;  3RYH E;  4AQF A;  1NWM X;  1SHF A;  2C0S A;  2UUB T;  4IUR A;  3AE9 A;  1K4U S;  2C0O A;  3F2E A;  1GBQ A;  5I22 A;  2CWO A;  9ATC B;  3PUW F;  1NEN A;  3PDY A;  4A56 A;  1WQW A;  3FJ5 A;  1D0X A;  4JUY A;  3G71 Q;  1ZUY A;  4A53 A;  5LNK A;  2QQA A;  2LJ3 A;  1WR6 A;  4OB2 B;  1KHI A;  1UEC A;  3AA7 B;  3M0R A;  2V5D A;  3ZJ1 A;  3RQW A;  3I55 A;  1J3T A;  2FPE A;  5I2M A;  4LUD A;  3BK9 A;  1EFN A;  3PU3 A;  2XDB A;  4PJO C;  4YTP A;  3TVT A;  1VQ6 T;  1MV3 A;  4QVZ A;  2VKN A;  4DEY A;  4DUY T;  5A0D A;  5HXH A;  3EFR A;  4M78 A;  3JCM V;  2RN8 A;  3P4S A;  2CT3 A;  2LLY A;  2J05 A;  2JQK A;  3KIN B;  1WGS A;  2KXC A;  2ZM6 T;  1RAB B;  3U23 A;  2WBL A;  2GNC A;  1IZN B;  4J9D A;  1D3B A;  1X27 A;  1G3Y A;  5ABF A;  3AEF A;  2QAS A;  3ZJ2 A;  2Y4Y A;  3SFD A;  2RMO A;  2WSF E;  3I9Q A;  4EIK A;  2FRY A;  4NXM T;  2YU1 A;  4U72 A;  5GAN j;  3GIB A;  1ZKE A;  4HEA A;  2DM1 A;  3JCF A;  4DV1 T;  3M56 A;  4RTW A;  4E2F B;  2WB5 A;  4ORZ A;  3EHQ A;  2DTH A;  3AE8 A;  3JCM e;  3CML A;  4M77 C;  1W2B A;  5HAX A;  3CWZ B;  3CCJ T;  3UA7 A;  1VYT A;  2DXB A;  3DJB A;  4O4L E;  2QYZ A;  3J9X 1;  1RAF B;  1OI1 A;  4I4T E;  2W66 A;  2AK5 A;  2XY8 B;  3C4S A;  1QSD A;  3A8Y C;  4JPB W;  4BE1 A;  1VQ4 T;  1B07 A;  2PG8 A;  1IRE B;  1TUD A;  3LGF A;  5HXS A;  3ULR B;  2G6F X;  1BKB A;  3LWH A;  5IH2 A;  3J80 E;  1VQK Q;  1N5Z A;  4OGC A;  2LQ8 A;  1RLP C;  3CVR A;  2JRK A;  2CXF A;  2LRL A;  2EIF A;  3H8Z A;  3D7S B;  3X20 B;  4JI5 T;  2JUF A;  4EZH A;  1CUN A;  2CRB A;  1JBM A;  4AFQ C;  2CZ1 B;  5C0M A;  2FHD A;  5GAO p;  1SF9 A;  5KYU B;  4GKK T;  3RF1 A;  4QQD A;  1Y96 A;  3PUQ A;  3Q9D A;  3OB9 A;  1Z9Q A;  1KQS P;  3RMS A;  2JMA A;  3KV5 A;  4C0D B;  2L0A A;  4IDO A;  1YJ9 T;  1YKH B;  2BVM A;  1KQ1 A;  2XMF A;  5CB4 E;  4O4I E;  4FU6 A;  5CQY A;  4C92 G;  1M90 R;  3L2R A;  1MMG A;  5KCO A;  4DR1 T;  2V7I A;  1XDO A;  2V8K A;  5DQW A;  2CLY C;  5GAM j;  4IRE A;  4BY6 C;  3UUB A;  5JR9 B;  3L2U A;  1OWA A;  1YNZ A;  3B57 A;  5KYX B;  2YOE A;  4IE6 A;  2LC4 A;  3T1H T;  3CCR T;  1Y57 A;  4U74 A;  4A4K A;  2VUR A;  5LHG B;  3MEU A;  4F7U F;  2X3X D;  1BCO A;  3C94 A;  3V8L A;  2HQX A;  5GAM f;  1ACM B;  3CX8 B;  3ZYL A;  1N32 T;  2ODU A;  3RQU A;  5AQH B;  2IPO B;  3LX7 A;  2ROL A;  3MET A;  3TRE A;  2J7I A;  3CK6 A;  2RQU A;  3O1H A;  5EC7 A;  4HFE A;  4JYA T;  5FY1 A;  3AVR A;  2K3Y A;  4F7U B;  3LBX B;  4LDW A;  2MMP A;  2KQW A;  1VQ9 A;  5HWX A;  2DRK A;  4N4I A;  2LMJ A;  3C4Z A;  4PK6 A;  2WP9 A;  1HTJ F;  3ZFJ A;  1JO8 A;  1HNZ T;  1PKT A;  1G73 A;  5FVL A;  3S4U A;  1WXB A;  1Q81 U;  3RC8 A;  1RAE B;  7AT1 B;  2D9D A;  4YT0 A;  2MOX A;  4KHZ F;  5DLO A;  2Y8D A;  4AQG A;  1AHJ B;  2RJF A;  5GAN g;  2RA2 A;  1E6G A;  3CC7 A;  2IML A;  1OZ2 A;  4U7I A;  2OA5 A;  2FRW A;  5I2S A;  1UGP B;  3M54 A;  5FXZ A;  2KK4 A;  3ETV A;  3CBP A;  1YJW A;  4WZX A;  4MDX A;  2WY2 A;  4PJL A;  2J47 A;  5C2T A;  1X2Q A;  2PNI A;  2CDT A;  5HEO A;  1L0V A;  3UFG A;  1WXU A;  2LCC A;  2VVK A;  2XAG B;  1NPR A;  2K6D A;  3RKX A;  1OXZ A;  4COF A;  4OVA A;  4JLE A;  1QCN A;  2DL7 A;  4RKU E;  3SD4 A;  5L3G B;  1X6O A;  1WHM A;  3HFN A;  2ECZ A;  5JQG E;  3C64 A;  1NJI U;  1VQ8 A;  1PD0 A;  2LSG A;  1YKE B;  3LYI A;  4PFP A;  4C5G A;  4M1P A;  4P09 A;  1JB0 E;  2DYB A;  5J26 A;  5HXE A;  1HSQ A;  1JXO A;  2H3E B;  5LA6 E;  2KND A;  2WAU A;  3QWY A;  3MHX A;  3HSB A;  5CKF A;  2PBI A;  1MIY A;  1MIV A;  1D0Y A;  2HKQ B;  3N5L A;  3ZPO A;  4OMF B;  2LE8 A;  3CME Q;  3ZL7 C;  4ZI3 D;  3I0Q A;  3EG3 A;  3CCJ Q;  3RHW A;  1UE9 A;  3OYH A;  2XAQ B;  2K3B A;  3JCM J;  4LUE A;  1KSW A;  2KY9 A;  2QXF A;  1M1G A;  2E5K A;  3C12 A;  4QX8 B;  2J4G A;  3UQ4 A;  3L2V A;  4IIM A;  4HCB A;  2Y48 B;  4L5G A;  5LB7 B;  5AQR B;  5D7U A;  1NPP A;  2AKL A;  5J3B A;  1VCS A;  2DXC A;  3R6O A;  1ZBX A;  1T3S A;  5CA1 E;  4HFV A;  4XU2 A;  3EG9 B;  3RES A;  4X9D A;  4BJM A;  1GXI E;  3IA3 A;  4HT9 A;  4DR7 T;  4C0D C;  4IUT A;  2D5U A;  2IIU A;  3VKG A;  4JJB A;  1ZA1 B;  4TWF A;  1Z0P A;  4L0R A;  2AIR B;  4OX9 T;  1IB8 A;  2MWP A;  5GAN 2;  4WW0 A;  2UXD T;  3CCM T;  3CCQ A;  4LF6 T;  1SE7 A;  1IZ6 A;  4IE0 A;  4DND A;  4PK5 A;  2IC6 A;  2V8J A;  1M3C A;  2HMA A;  4M7D D;  1QLY A;  2JMH A;  3K8P C;  1YWO A;  4IL9 A;  4ZZC A;  3PTR B;  2ZLY A;  3INZ A;  2R58 A;  3EAM A;  1R8O B;  5GMK j;  2R6G F;  3CCU Q;  2RQV A;  4FT2 A;  1M5Q 1;  4GLM A;  4MZM A;  1QVG S;  1AEY A;  4Y28 E;  4ZN3 A;  4M7A A;  4HVV A;  5GJW B;  4EPC A;  3CIR A;  2BBH A;  2FUP A;  1Q7Y C;  2HKN A;  2RJD A;  2DD5 A;  3OBY A;  4JI7 T;  2K2V A;  1QP3 A;  1B3Q A;  2W67 A;  3ZLI A;  2SEM A;  2V7L A;  2DZC A;  1TOV A;  3EGU A;  3SDZ A;  4F16 A;  1YJ9 A;  3UUM A;  1SRL A;  1YHQ T;  2AKK A;  5FRN A;  3SS1 A;  5ABG A;  1OUL A;  3ONL C;  5IHK A;  2LVM A;  4P5N A;  3CCS A;  3PU8 A;  3V5U A;  1PRM C;  5AQM B;  3GPL A;  2D6F A;  4LDU A;  3QO3 A;  4JDS A;  3OYN A;  1MIW A;  4EIW A;  2EQJ A;  4LN2 A;  2X68 A;  2EGE A;  3Q5E A;  1KK7 A;  4OB0 B;  3LK3 B;  1OZ3 A;  4YJ3 E;  1OX8 A;  3E2U A;  2BS2 A;  5FY0 A;  1IGQ A;  3VS7 A;  2WU5 A;  1YP5 A;  1M2V B;  1X01 A;  4JS4 A;  4RCC A;  4ZGE B;  2YUQ A;  4VUB A;  3OYZ A;  4DV2 T;  4QKN A;  5LCY A;  3BQI A;  3M59 A;  3I56 A;  1FIO A;  2QEX T;  1UHF A;  4ELZ C;  1UGS B;  3P4P A;  1VQ5 Q;  5J0Z A;  3MA9 A;  2EHO B;  1X43 A;  1ZSZ C;  2ZPB B;  3E9G A;  1JQQ A;  3BFM A;  4KUD K;  5LHH B;  3FXE B;  2X3W D;  2SRC A;  1WFW A;  4TNW A;  1WPY A;  4KI0 F;  1WHG A;  5KYN A;  1Q7Y U;  1AWJ A;  2E4H A;  2EGA A;  1W9R A;  4CC3 A;  5GAN 4;  2E8I A;  2K4Y A;  3QXE B;  1PM3 A;  4IIJ E;  3I9Y A;  3Q2M A;  4IGU A;  4GKJ T;  2FO0 A;  2IIM A;  3CCV Q;  2KE9 A;  4H9Q C;  3QOF A;  5A0G A;  4JS5 A;  3KV9 A;  2UXX B;  3WXM B;  2NOX A;  4PJO E;  4HT8 A;  5AQK B;  1U1S A;  2M02 A;  3AE2 A;  1VQP A;  3NVO A;  5KX5 E;  2NUP B;  2MBG A;  1KNP A;  3ESL A;  3GNG A;  4LFC T;  4ZI3 C;  3BDL A;  1AVZ C;  3O1J A;  3QHS A;  4PAG A;  1O3X A;  2JNG A;  4J9F A;  4QXH B;  4ZNX A;  2XHC A;  3KUF A;  2JMK A;  4PJJ A;  3OMC A;  4M75 F;  4EOZ B;  2KBT A;  4FM4 B;  1GCP A;  3OA6 A;  4LFB T;  1IAP A;  1Y07 A;  4IE4 A;  4H63 H;  4IE5 A;  5LGU B;  4XTZ A;  2DTO A;  3OMG A;  3SFM A;  5FRO A;  4AKG A;  3N9P A;  1BK2 A;  1S1N A;  4DQ2 A;  2LRQ A;  3GF5 A;  1YI2 A;  4IL4 A;  3P8H A;  1WYC A;  2KDS A;  4HFC A;  5LGT B;  3TSZ A;  2LOS A;  5CKB A;  1HCI A;  2MF2 A;  3DLL A;  1OPK A;  2ES0 A;  1MMN A;  3AAA B;  2MPX C;  2X9Y A;  5HY6 A;  1NLO C;  1PNJ A;  2QG9 B;  3RRC A;  1M1K U;  2EKH A;  5DM7 R;  3I56 T;  3JB9 G;  1H92 A;  1FXX A;  2IVW A;  2XM1 A;  1SPK A;  3DTO A;  4U2Z A;  4C92 F;  2CUD A;  4ZI7 E;  4M7D A;  4CI0 C;  1WLX A;  1K73 R;  2YUP A;  4PJM A;  3AE3 A;  1WFD A;  5H6Q B;  2K24 A;  4JZ3 A;  2YUO A;  1QUU A;  5CGM A;  1KJW A;  3ASK A;  2BZY A;  4XTV A;  3JV3 A;  5LJM A;  4QXC B;  4AIS A;  4EEB A;  4EV6 A;  2HCK A;  3VRB A;  3A1P A;  2FB7 A;  2OTJ Q;  3PMT A;  4EYY R;  3KFW X;  1XNQ T;  1P92 A;  2A36 A;  4DR2 T;  1R77 A;  2HNI A;  2CP5 A;  1GQE A;  5DAB A;  5D6W A;  4C92 E;  1UJY A;  1YHQ A;  1QVF P;  2EHO C;  2V5C A;  1NBE B;  5ETW A;  2WM9 A;  5GAO r;  5L47 A;  2P0P A;  4OMM A;  5HCM A;  5GAO n;  2HL5 C;  2QDL A;  4QXB B;  2EGC A;  1QVG P;  4GIW A;  3CCE Q;  2ACZ A;  4DV0 T;  2YIN A;  2VK9 A;  2DJZ A;  1M3A A;  3KBU A;  3QDF A;  3NRY A;  2BBJ A;  1YIT A;  2RHX A;  1Y0M A;  1MNE A;  1VYU A;  1KFY A;  1N9R A;  4X5T A;  1D0Z A;  2BTT A;  1I4K 1;  2HEQ A;  4M75 G;  4A97 A;  5HYA A;  3B5M A;  2O4X B;  1H3Z A;  2HHH T;  1T0H A;  3AAI A;  4YTL A;  2RQW A;  2C06 A;  1KQ2 A;  2R5A A;  4YY3 T;  2LQK A;  1K73 C;  2X51 A;  4M77 D;  3VS6 A;  2H3R A;  1IJ5 A;  5F5W A;  2BUD A;  3QNU A;  3CD6 A;  2XQ8 A;  1Q82 U;  4J9C A;  3A5X A;  2VQF T;  5LL6 S;  4C8Q C;  5FY7 A;  1HXD A;  4DBQ A;  4HKA A;  1VQL T;  2CUB A;  2O2O A;  3T9N A;  5KYW B;  3HPW A;  2Q9Q D;  1VOM A;  3RIU A;  2BZB A;  4RTZ A;  3RYF E;  3AE4 A;  3ZT7 A;  1OYX A;  5AQL B;  4BA9 A;  5I11 A;  3A5Z B;  1BB9 A;  4FJO A;  2RQT A;  2RH2 A;  1HNW T;  1XZY A;  1PWT A;  1F1B B;  4M75 D;  3FBZ A;  2UU9 T;  4MBQ A;  4IE7 A;  1ZOY A;  3GWH A;  2CSQ A;  2CBI A;  1VCT A;  3Q1J A;  5FU6 B;  2LCS A;  2COW A;  4CI3 B;  2JXB A;  2V7J A;  3URG A;  1D1A A;  2LKH A;  4YFS A;  6AT1 B;  4M7D B;  1YD8 G;  1ZX6 A;  2FVU A;  3O8V A;  4DV7 T;  5GAO m;  1SRM A;  3SEM A;  2GK9 A;  2KXP B;  1VQN A;  5JRC A;  3OYD A;  4U31 A;  4XTU A;  4TVR A;  2RHZ A;  2ZPE B;  4EAH A;  1IBL T;  2P4R A;  2CEA A;  4IKF A;  3VRA A;  4LF9 T;  5FU6 C;  4ZTF A;  4C5I A;  1G2B A;  3CCR A;  4JI1 T;  2A7Y A;  3H41 A;  3HP9 A;  4K11 A;  4PLL A;  2VYT A;  2XAS B;  4UVC B;  2KRO A;  2V8I A;  1Q81 R;  2EYY A;  1HJD A;  3CC7 Q;  4HFI A;  4J83 A;  1OV3 A;  3EH1 A;  3VJP A;  2YDR A;  4A98 A;  1RLQ C;  2KRM A;  4Y92 A;  2E9X D;  3PNW C;  3GOX A;  4KH0 B;  1K73 U;  4CI2 B;  3RI5 A;  2MCN A;  2DBK A;  4HVU A;  5FMN A;  2DYI A;  4ZGD B;  3TLS A;  5AYF A;  5LJ3 e;  2ESW A;  3AE1 A;  1M1F A;  1S72 T;  4F14 A;  2E3I A;  3M9Q A;  3CC2 T;  3CCL Q;  3X28 B;  1Q86 U;  1M27 C;  4HCK A;  2JIW A;  2WWV A;  2BZ8 A;  4B3S T;  4XU0 A;  2FJD A;  2RI3 A;  2Z6E A;  3AVS A;  3M0T A;  4LD6 A;  3EAE A;  3CC4 T;  1BR4 A;  4OP0 A;  4U2Y A;  3UU6 A;  4MMK A;  1YJW T;  2XKO C;  4JV5 T;  1K1Z A;  5JDG A;  2LDM A;  4DR4 T;  3T1Y T;  1OED B;  3AEG A;  5JH7 E;  1DU2 A;  3JAD A;  4QX7 B;  2KNB B;  4JJC A;  4BDZ A;  2VKD A;  2GQI A;  2JS2 A;  1E6H A;  4C8Q A;  1YIJ A;  4LMJ A;  1M7K A;  3EVY A;  4PL6 A;  2CT4 A;  3V7R A; 
#chains in the Genus database with same CATH homology
 3CD6 T;  3Q5W A;  3QZ5 B;  3QYH B;  3CMA A;  4IUU A;  3EFS A;  4BE2 A;  4QVC A;  2K5F A;  3QK6 A;  5GAN d;  2D0Q B;  5IYZ E;  2KVQ G;  3CCL A;  3O4X E;  2EHO D;  3KBG A;  3WVD B;  3FB2 A;  3WAK A;  5HK0 A;  1LOJ A;  3LGL A;  5JDM A;  5EZY E;  1NAF A;  3JC6 D;  3BQL A;  1RI0 A;  5EK4 A;  2KZ7 B;  2PVD B;  1BR1 A;  2NTX A;  1SA0 E;  2VXE A;  3M65 A;  3N5B B;  4M7A E;  5KDM C;  1NJI C;  3KVB A;  4I50 E;  4X20 E;  1HFA A;  2VGM A;  5EG2 A;  2ZPI B;  4ZTJ A;  2VWA A;  2XAH B;  4TUY E;  2XU8 A;  4EB6 E;  3MKD A;  4OFZ A;  3HKE E;  1D3B B;  3PFS A;  2YEV C;  3MCA B;  3EDU A;  2XID A;  3OYB A;  3E08 A;  5IT9 E;  2B8A A;  2Q9Q C;  3NTI A;  4UXN B;  3JCM W;  5FRM A;  1WQ7 A;  3PUG A;  4AKL A;  1YIJ T;  3FDR A;  3RKW A;  2W0G A;  5IN1 A;  5HWY A;  4L9I A;  4V1A v;  1K9M U;  3SB2 A;  1V9D A;  1N27 A;  3MAC A;  2CE7 A;  4MHC A;  5KE3 A;  4M75 A;  2Y6X A;  3VYH B;  3CX7 B;  2EQU A;  1V29 B;  2DXU A;  2H7O A;  4LD9 K;  3BW1 A;  2F69 A;  5J39 A;  2K9A A;  4QHO A;  4E7J A;  2SPC A;  3ZC1 A;  2PJQ A;  1UCU A;  3E22 E;  3P7I A;  3BDU A;  4PJO A;  1Y64 B;  3I1A A;  5KH6 A;  3U78 A;  3OBV E;  3TKL B;  2LCL A;  2QQ9 A;  2WSS V;  3RKO A;  3A8H B;  5HK3 A;  1VQ5 T;  2E9X C;  4R56 A;  3KBT A;  5CCA A;  4CXY A;  3RPU A;  3A8M B;  4ISS A;  5GON E;  2LT3 A;  5L3E B;  4N4H A;  1BR2 A;  4X34 A;  5KMG P;  3GN5 B;  4CRI A;  1KQS A;  4E7I A;  2V26 A;  2ODV A;  2HD0 A;  1H7C A;  2M67 A;  4KBM B;  5D6Y A;  3RUX A;  4J5Y A;  4I43 B;  1FEW A;  1Q82 C;  3JB9 F;  3JCM Q;  3JSC A;  3KVA A;  5L3C B;  4ME7 A;  4AXP A;  2E6N A;  2ZPF B;  2LEH A;  5CIU A;  4XK8 E;  3VU7 H;  3AB3 B;  4H9P C;  2L3L A;  4ZN1 A;  4QQG A;  3NTK A;  3O1I A;  2KWH A;  4J6X A;  3CKD A;  2DHR A;  3QKJ A;  3OYG A;  2EWN A;  4QVD A;  3J81 E;  1ZQ1 A;  2LTO A;  2LSJ A;  3FHN A;  1BI2 A;  1VQ7 T;  5H6R B;  4M77 B;  4C91 A;  5LJ3 f;  5LOV E;  3SOL A;  1LJO A;  1N9S A;  4UF0 B;  3ZYK A;  5L3B B;  5GAN f;  3HKS A;  3MP1 A;  2DNX A;  3JCM b;  2X4J A;  4M7D E;  4ZS3 A;  3C4X A;  3ETU A;  4TN7 B;  2DXT A;  3UTK A;  3M58 A;  4RG2 A;  2DI4 A;  2N1G A;  4TV8 E;  2XDD A;  4IUQ A;  2N9D A;  2C5K T;  2E10 A;  3DB4 A;  4BI8 B;  3HKC E;  2EJF A;  2KMT A;  2ZM0 A;  5LG4 A;  4BAY B;  4JLG A;  4PK4 A;  2JOY A;  1I81 A;  2JZ2 A;  2X66 A;  3SWH A;  4J6Y A;  4O5V A;  5I21 A;  4TV9 E;  4WF2 A;  2JN0 A;  2A2F X;  3C4W A;  2QQR A;  3X25 B;  2DWG A;  1VIE A;  5JDF A;  2L9Q A;  4HGA A;  5GMK l;  5D6X A;  3LWI A;  1YBY A;  2YLB A;  4F6R C;  4GK0 E;  4C0Z A;  4ADZ A;  3M53 A;  4HE8 A;  2M1H A;  2HQE A;  2CM0 A;  3S3M A;  2XK0 A;  4ZGJ B;  4GK5 E;  3F70 A;  2M16 A;  4JRP A;  3OQ5 A;  3L09 A;  2EQM A;  3NTH A;  4M7A B;  1I8F A;  4FIB A;  2RD1 A;  4A4G A;  5LGN B;  1BYM A;  4ILU A;  2E70 A;  4E7L A;  1VQK T;  3BQK A;  3HRU A;  3G4S A;  4PJO D;  3P8D A;  3J7Y q;  2PVO B;  3C98 B;  3CBO A;  3Q5X A;  4DMW A;  1XOV A;  5GAM d;  4KUM B;  2DCF A;  4M7A G;  1N8R U;  5J2T E;  3MXZ A;  4B9X A;  1VQ6 A;  5GMK i;  4CXX A;  4RCB A;  3VKI A;  3HR0 A;  4M78 F;  4O4H E;  5LYJ E;  1Q81 C;  3L3P A;  3DKM A;  3QYG B;  1FMV A;  1HF8 A;  3H37 A;  5DQV A;  2D0T A;  3P8C D;  5HKC A;  1M90 C;  5FXX A;  2ACX A;  2Q9Q A;  4PNI A;  3FXD B;  4GLK A;  1DJ7 B;  1O75 A;  3MO8 A;  2Q9Q B;  2W00 A;  4MLK A;  3I0O A;  4UEL A;  2DEQ A;  4IDZ A;  2DKG A;  1SHZ C;  3OYE A;  3L42 A;  3G71 T;  5GAN 5;  4I55 E;  2NW7 A;  5JDQ A;  3F57 A;  1AJ3 A;  4E7H A;  4F7U E;  1W4S A;  3GNF B;  3JAM E;  4L6V 5;  2G0U A;  4M77 G;  2XUE A;  4MZP A;  2YLC A;  3DLM A;  2P4T A;  4BDY A;  4LDY A;  4LDX A;  2BDE A;  2YRV A;  2DPP B;  4J8O A;  3ZMT B;  2E1H A;  1YJN T;  4Q5W A;  5FP3 A;  2FYK A;  2QA7 A;  5A1L A;  2L3R A;  3SWN C;  2RHY A;  4ZOL E;  3M55 A;  4E47 A;  4M7A C;  2HBP A;  1FX7 A;  1KC8 U;  3QDR B;  2H7V C;  2W61 A;  2KSS A;  2LHN A;  3B13 A;  3ZMU B;  1LKX A;  4P0A A;  2PUO B;  4ZI2 D;  4C8Q G;  3MJX A;  4BI3 A;  3CEY A;  1EIF A;  3A8L B;  2WSE E;  4KT0 E;  3VYG A;  2G3R A;  4MFR A;  3H6Z A;  1VQO T;  5CAI A;  4H9R C;  4UVB B;  2WSC E;  3IEE A;  2X9W A;  4BD3 A;  1S94 A;  3HKB E;  2X0L B;  5LJ5 e;  4BB7 A;  2VXF A;  1M1K C;  5LJ5 g;  4M77 E;  4OB1 B;  1O9S A;  4JRQ A;  2VKH A;  3I9W A;  3HRT A;  1UX4 A;  5HXC A;  4Z8X A;  4II1 A;  2CKK A;  1S72 A;  3OY9 A;  2DVE A;  2A3L A;  5LJ3 d;  2K48 A;  2QDY B;  3LJC A;  3OW2 A;  3RYC E;  1T98 A;  3X26 B;  1I5L A;  4J6W A;  2CXL A;  5GMK e;  3JB9 I;  1K8A U;  5CKE A;  1MHN A;  2NW9 A;  4N0A A;  3QPH A;  2QQB A;  1KC8 C;  4MZT A;  3PE0 A;  2W62 A;  3JCM g;  2X35 A;  1UGQ B;  3UT1 A;  3ME9 A;  2LHR A;  3QJY A;  3RMQ A;  3ZEH A;  3OS5 A;  3JCM P;  4JEU B;  2LSK A;  2KWI B;  1VQN T;  2BVL A;  4O2B E;  2BIV A;  4M7D F;  3QZ9 B;  1QP2 A;  4NUV A;  3JRZ A;  5L2L A;  3CCL T;  4XTX A;  2WMN A;  2F5K A;  3OYJ A;  2VL8 A;  5GAN h;  3MP8 A;  1WJR A;  2X9H A;  2I59 A;  2E64 A;  2K3X A;  3QG1 A;  4FT4 A;  3U3I A;  4UV8 B;  4JRK A;  4TX5 A;  4CI1 B;  3E0Z A;  1NZ9 A;  2V7K A;  2XHE B;  4DA4 A;  1VQO A;  2DZ9 A;  3AHU A;  4DMV A;  2PU9 B;  4NS5 A;  3CXC S;  1VQM T;  3CPZ A;  3N9L A;  3M4Y A;  1SSF A;  3SRZ A;  3GA8 A;  1U5P A;  3GMI A;  3RRW A;  2LM9 A;  3T8O A;  1TH7 A;  5LJ5 d;  1BI1 A;  4NOY A;  1MGQ A;  5LBM A;  4OHF A;  4C0G A;  2RM4 A;  5GMK m;  5IHY A;  5L8R E;  3OYL A;  4PJO G;  3VUZ A;  4M7D C;  1UEB A;  4AI6 A;  2H3J A;  3S3O A;  2HAX A;  3FIF A;  4M7A D;  2NTY A;  4XBF B;  2ZM8 A;  1HS7 A;  1LRZ A;  4IUV A;  3CCQ T;  2XG8 D;  4DBR A;  3A8O B;  3HRS A;  3ZCJ A;  3FB9 A;  2RK1 A;  4QWN B;  4IST A;  4UVA B;  4PJO B;  5LJ3 g;  2JVV A;  1MND A;  2RHI A;  3QC9 A;  2HPL A;  4M7D G;  2C5I T;  4NUU A;  2EJG A;  1WYB A;  3IBP A;  5F3J A;  3D0T A;  4J7F A;  4PFO A;  3RC3 A;  4XU3 A;  3CBM A;  5CKH A;  2CMR A;  5KE2 A;  3JB9 D;  5ADX L;  2A72 A;  5J2U E;  2LT4 A;  2RB6 A;  2A3D A;  2RP4 A;  2R5M A;  1K9M C;  2RHU A;  3MK7 C;  2L5Q A;  2D9T A;  1VQ9 T;  2MOZ A;  3ZN1 B;  2PUK B;  1YCY A;  3PUA A;  3PIO A;  2O01 E;  4K0U A;  2RO0 A;  4JJN K;  4OYJ A;  2KLQ A;  4C92 A;  3MEA A;  3IHR A;  1ZV4 X;  2CS7 A;  5M4Y A;  2OTL T;  2PQW A;  3PTA A;  2XQY A;  3EDV A;  3DB3 A;  4EMK A;  1X79 A;  3N2K E;  4OGE A;  1QVF A;  2I2L A;  4OK0 A;  3UPU A;  1H64 1;  2XAJ B;  3K3O A;  1X75 C;  2NP9 A;  3OS0 A;  3OYF A;  4PJO F;  4O8S A;  3G6E T;  3QUI A;  2EYQ A;  1U8R A;  2E41 A;  4M78 G;  4HCZ A;  2E9X A;  3RX6 A;  1N6A A;  4PJN A;  5C6S A;  3PIP A;  1VQ7 A;  4F7U G;  3HKD E;  2IAK A;  4G2A A;  3V7S A;  3NRX A;  3K3N A;  1UGR B;  4QQ6 A;  4M75 E;  4QW2 A;  4GYS A;  5L3D B;  2M9U A;  4ANJ A;  4ELY C;  5DLQ E;  5CA0 E;  2KIN B;  3P8B B;  4M78 C;  4GYR A;  2RA1 A;  3CCU A;  3MEV A;  2EFI A;  3G6E A;  2J1D G;  1W2B S;  3PGG A;  3UUX B;  2VKJ A;  4DVD A;  4D6W A;  3CQG B;  3G7Z A;  5IAY A;  4J7I A;  2IG0 A;  1IJ6 A;  2QA4 A;  4UIG A;  4HA8 A;  2EHO A;  2K57 A;  5GAN e;  2LJL A;  1MMD A;  3CQX C;  3WAJ A;  5KCH A;  3N2G E;  4C90 A;  2EAY A;  4O6J A;  2X9X A;  2L89 A;  4JEH B;  1EZ3 A;  5M9O A;  3FLG A;  1KG1 A;  3E1S A;  1U1T A;  4EMK B;  3M5A A;  2HPJ A;  5BMV E;  4AKI A;  3CPW A;  2ZZD A;  4EMK C;  1ZHI A;  2CGH A;  4N0A C;  1M9S A;  1B34 A;  3QII A;  4WBN E;  4EDU A;  3I55 T;  3CMA T;  3OJA A;  2MWO A;  2P9B A;  2P0K A;  4C5H A;  3JB9 J;  5CVI A;  2E5Q A;  3S6W A;  1PSE A;  5CK9 A;  2E12 A;  4C92 D;  1E1H B;  5C8Y E;  4PKC C;  2WWU A;  3AA6 B;  2VB6 A;  1HK9 A;  3OW2 S;  5EK2 A;  5CO7 A;  3LFM A;  3CQC B;  5JVD E;  1PSF A;  3LW5 E;  5LJ3 j;  1YI2 T;  5JDH A;  2CZ6 B;  3JCM c;  3V7C A;  3FRN A;  4EZ4 A;  4PLI A;  2QA4 T;  4TZ4 C;  4BAC A;  3ER0 A;  2CCQ A;  2DLR A;  2E6Z A;  1YW0 A;  3W15 B;  3NZQ A;  3VKH A;  3GP8 A;  3QSU A;  2DIQ A;  4XU1 A;  2EKO A;  3R84 B;  4XTY A;  3CX6 B;  4XAX B;  1LNX A;  2DO3 A;  1Q86 C;  2EJ9 A;  5CKD A;  3OKQ A;  4OF1 A;  2RK2 A;  2D0U A;  2JPF A;  3ZYM A;  2ZPH B;  1UB4 A;  2YU2 A;  4KUI A;  3OS2 A;  3G4S T;  2VKO A;  4M75 C;  2KT9 A;  3KDS E;  4M75 B;  1S35 A;  5GAN 8;  2RJE A;  1UX5 A;  3L1A A;  4UC4 A;  3E9F A;  1KQS S;  1G3T A;  3KV4 A;  3CXC A;  3VV0 A;  1BR0 A;  3C95 A;  1G3W A;  2R57 A;  3K3Q C;  3ANW B;  4B6X A;  1BI3 A;  4AKH A;  1G3S A;  4BUG A;  2MI6 A;  2DAQ A;  3LK2 B;  3M57 A;  2ZMA A;  5LBQ B;  2F5T X;  2OTL A;  3N9N A;  1US7 B;  2CLY B;  2IW5 B;  2YHT A;  2O4X A;  2ZCF B;  4M78 B;  1KNZ A;  2QQS A;  3AAE B;  1RL2 A;  2NLU A;  3CME T;  1NE8 A;  5J1G A;  5GAO l;  4C8Q E;  4Y91 A;  1M4Z A;  1N8R C;  3TCJ A;  1QVG A;  4WBO A;  3UT5 E;  3RH3 A;  3NZP A;  1LVK A;  4HN9 A;  3H3A A;  4OYK A;  2WMO A;  5FYM A;  2VUB A;  2VGN A;  3V5S A;  2QTX A;  3ZC0 A;  5JR9 A;  3VHL A;  4NL2 A;  1VQK A;  2CZ7 B;  4EMG A;  3MP6 A;  4BJN A;  4KMC A;  2RI5 A;  5LHI B;  3UUN A;  4MAL A;  1VQP T;  2GFA A;  4XQ3 A;  3HA4 A;  4HCC A;  5FU7 B;  2FL7 A;  4F7U A;  1QVP A;  2E65 A;  3BY7 A;  3ZBD A;  4C92 C;  4ZHQ E;  3OBW A;  4EXT A;  4V2S A;  3MEW A;  1VQ5 A;  1VQ8 T;  1D1B A;  4HTE A;  4PNO A;  4CZZ B;  4RMO A;  3JC6 C;  2IC9 A;  4XTW A;  4A4E A;  2XDP A;  1BIA A;  3WVE B;  2KMF A;  4HKE A;  2NW8 A;  4A54 A;  1M8V A;  4N78 D;  3OS1 A;  2LSY A;  3ONX A;  4R55 A;  2QEX A;  4C8Q D;  3N2O A;  2XTL A;  2JTM A;  3V8K A;  2DD4 A;  3J7A F;  3VUB A;  4IHJ E;  4YLH A;  4FI5 A;  5GAM h;  2CZ0 B;  2NWB A;  4ERR A;  4KUL A;  3OYA A;  1U4Q A;  1JJ2 S;  5GAN 7;  3OYI A;  3HHT B;  3CC4 A;  4CXW A;  3PT9 A;  4DOW A;  4UEM A;  3OSS C;  2LSI A;  4YHJ A;  3CCV A;  4O2A E;  4ATO A;  3VU3 C;  3FEO A;  3QJ6 A;  4A4F A;  3G71 A;  3L2Z A;  3PUS A;  4JRI A;  5A0L A;  1VQ4 A;  1WRD A;  1VUB A;  5JR9 C;  5GAN 6;  3HFO A;  3GLX A;  4A4H A;  2CA5 A;  2MYS A;  2N2N A;  2L8D A;  4X1Y E;  4YJ2 E;  2VC8 A;  4JUV A;  4X9C A;  1BI0 A;  3ANW A;  2E9X B;  3ZN0 B;  3N9M A;  4JLI A;  1YJN A;  3ZCI A;  4AKR B;  3CPW S;  3NBX X;  3AA1 B;  4FSX A;  2W63 A;  3EUH A;  4H9N C;  5EK3 A;  4ZI2 C;  3M4G A;  4UF0 A;  5LJN A;  3CPF A;  2K5I A;  5GAN 3;  3CC7 T;  3QBY A;  1G8X A;  2D2S A;  2RI2 A;  5LXT E;  3LG7 A;  4XZC A;  1QVF S;  4H9O C;  4AQF C;  5FLX E;  3C51 A;  2WAC A;  4GY5 A;  1VIF A;  3CCE T;  4C92 B;  1XNI A;  3RKY A;  5HXR A;  3RER A;  4G63 A;  1HG5 A;  2EQK A;  2Y90 A;  2B1E A;  1WNL A;  5FXV A;  2DK3 A;  3OYC A;  3X24 B;  2JJ9 A;  4PW8 A;  5F8P A;  4MML A;  4WNK A;  3FBL A;  2AHJ B;  3JCM X;  4IUP A;  4EYU A;  2GCX A;  5LJ3 h;  2V7M A;  5GAM e;  1YIT T;  3R6N A;  3JB9 H;  5GMK h;  1FWZ A;  2PFV A;  4M7A F;  3GN5 A;  2LT1 A;  2XD0 A;  3A8G B;  5DJQ C;  3ZMV B;  2QGS A;  1QW1 A;  2ZGW A;  1LVF A;  4H9S E;  4GOU A;  4X1I E;  3CCU T;  1K8A C;  3ZMZ B;  4C5E A;  1JRI A;  3RYI E;  2VAS A;  3JCM d;  2OTJ T;  4ZS2 A;  2CXD A;  1KHC A;  3WI3 A;  3TEE A;  2BKD N;  1VQM A;  4OB3 B;  5JRE A;  2Y4X A;  3LLR A;  4LDV A;  3DP7 A;  1Y7X A;  4C0F A;  2ZM2 A;  1KD1 U;  1XTD A;  3CC2 A;  2XIC A;  2GF7 A;  4EMH A;  5DY9 A;  5FXW A;  1ZEE A;  3PUR A;  3FC3 A;  3AA0 B;  3L2Q A;  4X1K E;  3SWN B;  4M78 E;  3CCJ A;  3O9X A;  4C8Q F;  3ZEF B;  1XQH A;  5JDN A;  4M78 D;  1MMA A;  3UWN A;  2V1D B;  2PVG B;  1WJS A;  3HL8 A;  1B34 B;  4RG8 A;  4BY6 B;  4M77 F;  2L8K A;  1G5V A;  2VV5 A;  1JJ2 A;  3L2W A;  4DO0 A;  5E0O A;  2RJC A;  3CCM A;  2GQV A;  2JTF A;  2K5B B;  5LP6 E;  3HL6 A;  1WJQ A;  3JCM h;  3CCE A;  1B7T A;  2X4X A;  5GAO q;  1HX8 A;  2JQQ A;  3TU4 K;  1Y71 A;  3N9O A;  2UXN B;  3F31 A;  3CCV T;  2XAF B;  3HI2 A;  5FU7 C;  4UV9 B;  5CR2 A;  3KXT A;  4P0B A;  3NFC A;  2MTQ A;  1HG2 A;  5GAM g;  4CQI A;  4L59 A;  4M77 A;  4Z02 A;  1VQL A;  5LJ5 h;  3CME A;  3UFE A;  2XI9 A;  2X67 A;  4FL6 A;  2QI2 A;  3LBX A;  5L3F B;  3S3N A;  3OYY A;  5AFU L;  2ZPG B;  3PMI A;  2K5L A;  1M90 U;  3QUJ A;  4DOV A;  4E7S A;  3C50 A;  1VRB A;  4C8Q B;  3OYM A;  2LX9 A;  4BI4 A;  5LJ5 j;  3V8J A;  3JCM f;  2C5J A;  5CQX A;  2LNV A;  3UDC A;  1ZHC A;  2LOP A;  3SWN A;  4E7K A;  3CCS T;  4E7Z A;  3KV6 A;  2YK0 A;  2X4W A;  4H63 V;  3FJP A;  2MAM A;  1BIB A;  2M0O A;  3IF8 B;  4B9W A;  3LH0 A;  5JDL A;  1Y96 B;  2OTJ A;  4J2C A;  2CWY A;  2DWK A;  2KAF A;  2X4Y A;  5LJ5 f;  1FMW A;  3N9Q A;  3MZK B;  2DTI A;  3OSV A;  2P0Q A;  2HH7 A;  5JRC B;  2CYZ B;  3UUL A;  2DIG A;  3RIR A;  4KP3 C;  4O4J E;  5A2Q E;  4N4G A;  5FNV E;  4ASK A;  2GFU A;  5TAO A;  4BE0 A;  3LK4 2;  3OYX A;  4MDW A;  2OAU A;  4NL3 A;  3ZMS B;  3E19 A;  1D1C A;  3OYK A;  3RYH E;  4AQF A;  1NWM X;  2C0S A;  4IUR A;  3F2E A;  2CWO A;  3PDY A;  4A56 A;  1WQW A;  1D0X A;  4JUY A;  4A53 A;  5LNK A;  2QQA A;  1WR6 A;  4OB2 B;  1KHI A;  3AA7 B;  3ZJ1 A;  3I55 A;  5I2M A;  3BK9 A;  2XDB A;  3PU3 A;  4PJO C;  1VQ6 T;  4QVZ A;  5A0D A;  5HXH A;  3EFR A;  4M78 A;  3JCM V;  3KIN B;  1WGS A;  2WBL A;  1IZN B;  1D3B A;  1G3Y A;  3ZJ2 A;  2Y4Y A;  2WSF E;  2YU1 A;  4U72 A;  5GAN j;  3GIB A;  1ZKE A;  4HEA A;  3M56 A;  2DTH A;  3JCM e;  3CML A;  4M77 C;  1W2B A;  5HAX A;  3CWZ B;  3CCJ T;  2DXB A;  3DJB A;  4O4L E;  3J9X 1;  1OI1 A;  4I4T E;  3C4S A;  1QSD A;  4BE1 A;  1VQ4 T;  2PG8 A;  1IRE B;  3LGF A;  5HXS A;  1BKB A;  3LWH A;  3J80 E;  4OGC A;  2LQ8 A;  3CVR A;  2JRK A;  2CXF A;  2EIF A;  3H8Z A;  3X20 B;  2JUF A;  4EZH A;  1CUN A;  1JBM A;  5C0M A;  2CZ1 B;  2FHD A;  5GAO p;  4QQD A;  1Y96 A;  3PUQ A;  3Q9D A;  3OB9 A;  3RMS A;  3KV5 A;  4C0D B;  1YJ9 T;  1YKH B;  2BVM A;  1KQ1 A;  5CB4 E;  4O4I E;  4FU6 A;  5CQY A;  4C92 G;  3L2R A;  1MMG A;  5KCO A;  2V7I A;  2V8K A;  5DQW A;  2CLY C;  5GAM j;  4BY6 C;  5JR9 B;  3L2U A;  1OWA A;  3B57 A;  2LC4 A;  4IE6 A;  3CCR T;  4U74 A;  4A4K A;  5LHG B;  3MEU A;  4F7U F;  3C94 A;  3V8L A;  2HQX A;  5GAM f;  3CX8 B;  3ZYL A;  2ODU A;  3LX7 A;  3MET A;  3TRE A;  3O1H A;  5FY1 A;  3AVR A;  2K3Y A;  4F7U B;  3LBX B;  4LDW A;  2MMP A;  2KQW A;  1VQ9 A;  5HWX A;  4N4I A;  3C4Z A;  4PK6 A;  1HTJ F;  3ZFJ A;  1G73 A;  3S4U A;  1Q81 U;  3RC8 A;  5DLO A;  2Y8D A;  4AQG A;  1AHJ B;  2RJF A;  5GAN g;  2RA2 A;  3CC7 A;  1OZ2 A;  2OA5 A;  5I2S A;  1UGP B;  3M54 A;  5FXZ A;  2KK4 A;  3ETV A;  3CBP A;  1YJW A;  4MDX A;  4PJL A;  2LCC A;  2XAG B;  1NPR A;  3RKX A;  1OXZ A;  4OVA A;  4JLE A;  4RKU E;  3SD4 A;  5L3G B;  1X6O A;  3HFN A;  5JQG E;  3C64 A;  1NJI U;  1VQ8 A;  2LSG A;  1YKE B;  3LYI A;  4PFP A;  4C5G A;  4M1P A;  4P09 A;  1JB0 E;  5J26 A;  5HXE A;  5LA6 E;  2KND A;  2WAU A;  3MHX A;  3HSB A;  5CKF A;  2PBI A;  1MIY A;  1MIV A;  1D0Y A;  4OMF B;  3N5L A;  3ZPO A;  2LE8 A;  4ZI3 D;  3I0Q A;  3OYH A;  2XAQ B;  3JCM J;  2KY9 A;  2QXF A;  1M1G A;  3C12 A;  4QX8 B;  3L2V A;  4HCB A;  2Y48 B;  4L5G A;  1NPP A;  5J3B A;  2DXC A;  3R6O A;  1ZBX A;  4HFV A;  5CA1 E;  4XU2 A;  3RES A;  4X9D A;  4BJM A;  1GXI E;  4HT9 A;  4C0D C;  4IUT A;  2D5U A;  3VKG A;  1Z0P A;  4L0R A;  2MWP A;  5GAN 2;  4WW0 A;  3CCM T;  3CCQ A;  1IZ6 A;  4IE0 A;  4DND A;  4PK5 A;  2IC6 A;  2V8J A;  4M7D D;  2JMH A;  3K8P C;  3PTR B;  2ZLY A;  3INZ A;  2R58 A;  1R8O B;  5GMK j;  4FT2 A;  1M5Q 1;  4MZM A;  1QVG S;  4Y28 E;  4ZN3 A;  4M7A A;  4EPC A;  1Q7Y C;  2RJD A;  2DD5 A;  3OBY A;  2K2V A;  1QP3 A;  3ZLI A;  2V7L A;  2DZC A;  3SDZ A;  1YJ9 A;  3UUM A;  1YHQ T;  5FRN A;  3SS1 A;  2LVM A;  4P5N A;  3CCS A;  3PU8 A;  3V5U A;  2D6F A;  3GPL A;  4LDU A;  3QO3 A;  4JDS A;  3OYN A;  1MIW A;  4EIW A;  2EQJ A;  2X68 A;  1KK7 A;  4OB0 B;  3LK3 B;  1OZ3 A;  4YJ3 E;  5FY0 A;  1X01 A;  4JS4 A;  4RCC A;  4ZGE B;  4VUB A;  3OYZ A;  4QKN A;  5LCY A;  3BQI A;  3M59 A;  3I56 A;  1FIO A;  2QEX T;  4ELZ C;  1UGS B;  3MA9 A;  2EHO B;  2ZPB B;  3E9G A;  4KUD K;  3BFM A;  5LHH B;  3FXE B;  1WPY A;  1Q7Y U;  5GAN 4;  2E8I A;  2K4Y A;  3QXE B;  4IIJ E;  3I9Y A;  3Q2M A;  4IGU A;  4H9Q C;  5A0G A;  4JS5 A;  3KV9 A;  2UXX B;  3WXM B;  2NOX A;  4PJO E;  4HT8 A;  1U1S A;  1VQP A;  5KX5 E;  2MBG A;  3ESL A;  3GNG A;  4ZI3 C;  3BDL A;  3O1J A;  3QHS A;  4PAG A;  1O3X A;  2JNG A;  4QXH B;  2XHC A;  3KUF A;  2JMK A;  4PJJ A;  3OMC A;  4M75 F;  4EOZ B;  4FM4 B;  3OA6 A;  1IAP A;  1Y07 A;  4IE4 A;  4H63 H;  4IE5 A;  5LGU B;  4XTZ A;  2DTO A;  3OMG A;  3SFM A;  5FRO A;  4AKG A;  3N9P A;  4DQ2 A;  2LRQ A;  3GF5 A;  1YI2 A;  3P8H A;  1WYC A;  2KDS A;  5LGT B;  2LOS A;  5CKB A;  1HCI A;  2MF2 A;  3DLL A;  2ES0 A;  1MMN A;  3AAA B;  2X9Y A;  5HY6 A;  3RRC A;  1M1K U;  5DM7 R;  3I56 T;  3JB9 G;  1FXX A;  2IVW A;  3DTO A;  4C92 F;  4ZI7 E;  4M7D A;  4CI0 C;  1WLX A;  4PJM A;  5H6Q B;  2K24 A;  1QUU A;  3ASK A;  4XTV A;  5LJM A;  4QXC B;  2FB7 A;  3PMT A;  4EYY R;  3KFW X;  1P92 A;  2HNI A;  5D6W A;  5DAB A;  4C92 E;  1YHQ A;  2EHO C;  5ETW A;  2WM9 A;  5GAO r;  2P0P A;  5GAO n;  4QXB B;  4GIW A;  2YIN A;  2VK9 A;  2DJZ A;  3KBU A;  3NRY A;  1YIT A;  2RHX A;  1MNE A;  1N9R A;  1D0Z A;  1I4K 1;  4M75 G;  5HYA A;  2O4X B;  1H3Z A;  4YTL A;  3AAI A;  2C06 A;  1KQ2 A;  2R5A A;  2LQK A;  1K73 C;  2X51 A;  4M77 D;  2H3R A;  1IJ5 A;  2BUD A;  3CD6 A;  1Q82 U;  3A5X A;  5LL6 S;  4C8Q C;  5FY7 A;  1HXD A;  4DBQ A;  4HKA A;  1VQL T;  3T9N A;  3HPW A;  2Q9Q D;  1VOM A;  2BZB A;  3RYF E;  1OYX A;  4BA9 A;  3A5Z B;  4FJO A;  2RH2 A;  4M75 D;  3FBZ A;  4MBQ A;  4IE7 A;  3GWH A;  3Q1J A;  5FU6 B;  4CI3 B;  2V7J A;  3URG A;  1D1A A;  4YFS A;  4M7D B;  1YD8 G;  2FVU A;  3O8V A;  5GAO m;  2GK9 A;  2KXP B;  1VQN A;  5JRC A;  3OYD A;  4XTU A;  4TVR A;  2RHZ A;  2ZPE B;  4EAH A;  2CEA A;  4IKF A;  5FU6 C;  4ZTF A;  4C5I A;  3CCR A;  2A7Y A;  4PLL A;  3HP9 A;  2VYT A;  2XAS B;  4UVC B;  2V8I A;  4J83 A;  3VJP A;  2E9X D;  3PNW C;  3GOX A;  1K73 U;  4CI2 B;  5FMN A;  4ZGD B;  5AYF A;  5LJ3 e;  1M1F A;  1S72 T;  3CC2 T;  3M9Q A;  3X28 B;  1Q86 U;  4XU0 A;  2RI3 A;  2Z6E A;  3AVS A;  4LD6 A;  3EAE A;  3CC4 T;  1BR4 A;  4OP0 A;  4MMK A;  1YJW T;  2XKO C;  5JDG A;  2LDM A;  5JH7 E;  4BDZ A;  4QX7 B;  2VKD A;  4C8Q A;  1YIJ A;  3EVY A;  1KD1 C;  4PL6 A;  3V7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...