4XAXB

Crystal structure of thermus thermophilus card in complex with the thermus aquaticus rna polymerase beta1 domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit beta domain 1
publication title CarD uses a minor groove wedge mechanism to stabilize the RNA polymerase open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription regulator
total genus 47
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4xaxB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xaxB01
4XAXB 4MFRA 4KBMB 4L5GA 2LT1A 4ILUA 2LT3A 4KMCA 2LT4A 2EYQA 2LQKA
chains in the Genus database with same CATH superfamily
2O31A 3CQGB 1RAGB 3A8HB 1Q86R 4FL6A 4XZCA 2FZGB 4Y91A 4FSXA 2V5CA 1M90R 2VVNA 1YN8A 2XDPA 2YUOA 3B13A 1XWMA 2PUOB 1K73U 1R0CB 5CJ5A 2LX9A 1MIWA 2LSKA 5C3JA 2RQRA 1YJNQ 2ENMA 1EIFA 2NUTA 2J47A 4J7IA 2J6FA 3PV0F 5J0ZA 5J1GA 3DLMA 3BQLA 3M55A 1XOVA 1OI1A 4NUVA 2RH2A 2Y90A 1D0XA 4U31A 5KDMC 1PSFA 1SRMA 3PUSA 4JI7T 3C4SA 4RCCA 9ATCB 3P4PA 2XSBA 2K48A 1VQPA 1TXQA 2K79A 2F5KA 2K5LA 2NUTB 2L2PA 4DR4T 3OW2A 5AQFB 4A5XA 5FU7C 2BDEA 2MCNA 2JMCA 3DJBA 2IVWA 3ZCIA 1Y71A 2LHRA 3PJAA 3S6WA 4XTXA 2A36A 2W63A 1VQ6Q 2YEVC 3J9X1 1G3TA 2CYZB 3PU3A 4FW1A 4I4TE 3RIUC 5J3BA 4XU2A 2C5IT 3KBTA 4KI0F 2LCCA 1BB9A 3V7CA 2LMJA 5LGTB 3OYDA 2F2XA 1YQ4A 5JRCB 4ZTFA 3WVEB 1M62A 2W0ZA 1MMAA 3FXDB 4UF0A 1FJGT 1PSEA 3PTRB 4X1KE 4EYUA 2VWAA 2EKOA 1UURA 3CPWA 5LOVE 4DOVA 4EGWA 1BR4A 3QO3A 1QLBA 1K73C 2R58A 3U23A 2RA2A 3RESA 2BBHA 1QVGA 2DPPB 4TWHA 3P7IA 5LJ5h 4UF0B 1PRLC 3NHNA 4P5NA 3SS1A 2DZ9A 5KYWA 4XU1A 2LP5A 2P0PA 4H9PC 3V5SA 1BKBA 2A3LA 4M75D 3QPHA 4IE5A 3ONLC 4HFIA 4B3MT 1OEBA 1LVFA 3ONXA 5LBMA 4QKUA 4RG2A 1W2BA 2B76A 2E6ZA 1JJ2S 5KYWB 3QG1A 4ZI2D 1YD8G 2RHUA 3BDUA 2NOXA 5HKCA 4DNDA 1LJOA 3SD4A 3CCVQ 4IIMA 3AEBA 2XQYA 2MI6A 2QGSA 2P0QA 4JDSA 2DXBA 1VQOA 3HKEE 2CBJA 2ROLA 3C95A 2WB5A 4HN9A 4TZ4C 2RO0A 2LQNA 4J6WA 3N5BB 2LNHB 3M65A 4UEMA 2CXLA 3AE9A 3CIRA 3NBXX 2UXCT 5GAOq 2KINB 3JCMd 4OGEA 2KSRA 1WHMA 4IDOA 5FMNA 2RQVA 3FLGA 1KEYA 4XU0A 2XHEB 2E3IA 3JB9F 2NTYA 5HK3A 3RIFA 3NMZC 2ACZA 1V76A 4JEUB 2UXDT 2BZYA 4Y28E 4CI2B 5FWCA 4WBOA 1NYGA 4DEYA 1YKHB 1QVFP 5EK4A 4HFVA 2XQ9A 2EFIA 3CXCA 2DL5A 3C4WA 4RTUA 2HKNA 2L9QA 1UK5A 3HFNA 3WVDB 2OTLQ 1GBQA 3SDZA 2NUPA 4C8QG 2BKPA 1X27A 1UGQB 4LF5T 3PUGA 3KBUA 3OKQA 1FMVA 4QW2A 1VYVA 3UU3A 3ETVA 2LRKA 3CD6A 3N9MA 2O4XB 3LBXA 4LNPA 5DABA 3JCMe 3PNWC 2CLYC 1K9MR 3L2VA 2NUPB 2KDSA 1VIFA 2LJLA 2DL3A 1US7B 1W70A 2WDVA 4H9SE 5KYYA 1VRBA 3OYIA 4B6XA 1IB8A 3ONJA 2EHOD 2YU1A 3RIUA 5GANg 4M7AE 3U78A 5L23A 3LX7A 4CC7A 5A0LA 2VQFT 1NYFA 5GAOm 5FU7B 2JQ9A 3G71T 4CI0C 4GYRA 3MKDA 3J80E 3UWNA 5FXWA 1PRMC 2M16A 2JQKA 4PJJA 1XNRT 2E9XD 5LHIB 5KYYB 3CMEA 2XAJB 1N32T 3CC4T 5CKDA 4YLHA 3NRXA 5AQLB 3T1YT 3EUHA 2OAWA 4GLMA 4RG8A 5EK3A 4DV3T 4HWCA 4J9CA 4ME7A 2DVEA 3FBLA 2Q9QC 2X3XD 4CC2A 2IHR1 2F69A 5GMKh 1T98A 4J6YA 4E2FB 3H3MA 1K73R 4X9DA 5HXHA 3TQ7P 2CRBA 4D6WA 1WGSA 2CMRA 4JI8T 3OPCA 2XUEA 5FY0A 2CT3A 2RJEA 2G3RA 1H3ZA 4AKGA 4LFBT 2M67A 2UXBT 5LHGB 2KRMA 3J7AF 1QCOA 3CPZA 4BY6C 4ILBA 2LEHA 4TV8E 2HPLA 4G2AA 3VRAA 4GBQA 2HHHT 2RHZA 3N9LA 4DR1T 2DLPA 1LPLA 1D1BA 3Q5XA 3C98B 1T0JA 4LFAT 2GQIA 1HK9A 1OXZA 4AISA 2DA9A 5FY7A 1D3BA 5LP6E 2GK9A 1KQSP 3FIFA 5KX5E 1BCOA 2Z0WA 3BFMA 4BB7A 1YJ9T 3INZA 4M77E 1Q95G 2BS4A 3ZFJA 1IAPA 4F7UF 2WZIA 5CQYA 1OOTA 1M1GA 2LNVA 1D3BB 4UVBB 5HWYA 3CWZB 4OK0A 3JCMX 3CCRT 2WQYA 4E7KA 5AYFA 4YTNA 2EGAA 1NWMX 1BI3A 1PNJA 3FEOA 3ZCJA 3FB9A 1YI2A 2COZA 3ZLIA 4X65T 2QEXT 1YJWQ 3RLFF 4CXYA 1UECA 5IHNA 5HK0A 2A3DA 2DRKA 2KK4A 2ZPBB 3X24B 2NYSA 5AQQB 2NP9A 2KAFA 1W0AA 3ZMTB 4JI3T 2DKGA 2ZZDA 2JMKA 3NGPA 5FNVE 3H3AA 4GK5E 2EKHA 2KYMA 4FYXB 1EZ3A 4F7UA 4JBWF 2CS7A 2DAQA 3ABVA 3I56T 3S3OA 2M6BA 2YKSA 3AAAB 4C8QC 1ZBXA 2YU2A 5AQOB 3ESLA 3SFDA 2BS2A 2QRXA 1W0BA 3S3NA 1Z9QA 1WR6A 2M0YA 2XM1A 4NXMT 1SRLA 3SWNA 5JDMA 2AK5A 5GAMf 4F7UB 4PFOA 1YITQ 2KRSA 1OV3A 4XK8E 4LFCT 4MZMA 3P4SA 2K9AA 1Q81U 3EHRA 3AB3B 2L3LA 3NPFA 1WXBA 3JCMh 3ZJ1A 1SF9A 5FROA 1AWOA 3FZKB 4QH4A 4LMKA 2IDOB 1OWAA 1X6BA 3C4ZA 4FI5A 1DU2A 2FYKA 4I50E 3PMIA 2Q9QA 5IUXA 3BY7A 3SWNB 4AFQC 1ZV4X 1WHHA 3EFOA 4LD6A 4JI5T 1OX9A 3JRZA 4EMKC 4KUDK 3FZMB 2A2FX 2EJFA 3OB9A 3M4GA 1DJ7B 2J05A 1VYUA 3I55Q 2FPFA 4WW0A 3EVYA 3G6EA 5LA6E 1B34A 1CHUA 3OSVA 1QVFS 4N4GA 2K5FA 1CKBA 4IL9A 1VQKQ 4LF6T 4DR6T 2G0UA 1SPKA 4C0FA 3RYIE 3M9QA 2E2AA 5D7UA 1J1JA 5LJ3d 4FCYA 2IC9A 3CCSA 2HEQA 5JQGE 3EGUA 1SHGA 2L5QA 2JS0A 3META 1WQWA 5DQVA 3LDQB 4B6MA 2QQSA 2WACA 1MNEA 4OB3B 4PNOA 1Y64B 1LCKA 2ZM6T 1BIAA 4EXTA 2JT4A 1QSDA 2LSYA 2CCQA 2JMAA 1UX4A 5I2MA 4J9BA 5AQKB 3RR6A 2LQKA 3RHWA 2ODUA 4LN2A 3L2UA 2JTMA 4E7HA 2ZM8A 2CUBA 2VL0A 5GAMj 5AQRB 2K3YA 1BI2A 1Q81C 3M0SA 2KLQA 1UJYA 4JI0T 2V8KA 4Z91A 2DTHA 3KFWX 2RHYA 1BCMA 1GFCA 5I2SA 5LJ3e 1OPKA 1BR0A 4HWHA 4DMWA 5GMKi 4JS4A 1KD1U 3O1JA 2KROA 1HG2A 1VQ7A 4JPBW 1YIJA 1AZGB 2X4JA 1AD5A 1UJ0A 2X9XA 2XDBA 1RADB 1FX7A 3OYAA 4ZZCA 1RL2A 3RC3A 2RK2A 1RI0A 2L8KA 1D1CA 2HQHA 2BG9E 3AXJA 4WYVA 4M78E 2MYSA 1PKSA 1KNRA 1IZNB 3QHSA 4C8QA 2HSPA 1GBRA 2XD0A 5J2TE 4CQIA 2FB7A 3QB5A 1YWOA 4NOYA 4OMOA 1VQPT 1WZOA 4JLEA 3EFRA 2LCSA 3AXJB 1RLPC 2E6NA 2GTJA 4FYYB 3TEEA 4EEBA 1YJNA 3IBPA 4XTWA 3ZT6A 2AE9A 3VYGA 3ZMSB 5JR9C 1M1FA 2HL5C 5LL6S 4PJLA 4TX5A 2PFVA 1KQSS 1XMOT 4C5IA 2L8DA 1T8BA 1UCUA 2DL7A 4JLGA 4G63A 2F1LA 2K2MA 1M9SA 3PVQA 1A0NB 4U2ZA 2X0HA 4QX7B 3CC7Q 5LGUB 1S35A 2ZCFB 3M53A 4U2YA 2M1HA 3NKZA 3F31A 3NZPA 1JQQA 1KD1C 1VQMQ 4EYYR 2ZPIB 3IHRA 2BVMA 1YQ3A 5FXVA 2DJZA 2P0KA 2Y48B 3MXZA 1IHWA 4HXJA 5A1LA 1WJSA 4JI6T 1AWJA 2VUBA 3EGXB 3OBWA 1NJIU 1WFDA 4OX9T 4E7LA 2F4VT 2XMFA 1FMKA 1UGPB 2J6OA 3RIRA 2XAFB 2WY2A 2WZHA 1SE7A 4DEXA 1QW1A 5CGMA 4M7DG 2P9BA 1G3SA 5AQVB 4M78G 2ODVA 2KNDA 4PJOG 3U3IA 5HXEA 1WXTA 4MALA 4X64T 2K5IA 3ZMUB 1WJQA 1AJ3A 4O4HE 1GRIA 4AKHA 3AEGA 3EG9B 3ER0A 3A8MB 3MCAB 1KHCA 3AEAA 3SOLA 4IT4A 2GFAA 1VQNA 5LNKA 2CP5A 1Z0PA 3ZSTA 5GAN2 4N4IA 3GOXA 4NUUA 2CREA 2VK9A 2D8JA 4ZGJB 3RKYA 2LSJA 3RMQA 4OMMA 1X2KA 3RQWA 3ZMVB 4WZXA 4EMGA 3C12A 5GANf 1YWPA 3TREA 3NWIA 3ZN0B 3MP1A 3QB5K 2DWGA 2LKGA 3Q5EA 2MWPA 2PTFA 3RMSA 1PG5B 2DCFA 3UATA 2BS3A 2D2SA 1HTJF 4UV9B 3LK42 4UVAB 3ZYLA 1VQOT 3SFEA 2QAZA 2JQHA 2CP3A 1G5VA 2CZ1B 1VYTA 4J9IA 3LWIA 2KQWA 3LK3B 2PTKA 3VKIA 1VQ9A 2D6FA 4OVAA 3CBOA 1G73A 2YOEA 1J5WA 4ISTA 2JMHA 1I0CA 4F6RC 3RX6A 1M3CA 2H88A 4WCIA 2YLBA 5H6QB 3A8YC 4OGCA 3BE3A 3QOFA 4JJCA 3VJPA 2CBIA 3F57A 1QVPA 4YFSA 1NJIC 2C5KT 1I07A 5LJ3h 3I5RA 2YUQA 1K8AU 3QNUA 3RRCA 1Y57A 1GCQC 2KWHA 2K5BB 2CPTA 3UFEA 4ZI3D 3O1HA 4YSZA 4MDXA 2EQUA 3OY9A 3M56A 2DX1A 4X9CA 3CD6T 2E1HA 3MA9A 2GTOA 2RJFA 3JAME 4YTPA 3FC3A 5GAOn 4ZS2A 5JR9A 3AVRA 2FRWA 4ZN1A 5IAYA 4DA4A 4YT0A 1PM3A 5ETWA 3JC6C 4B3RT 1VQLQ 1R77A 2OTJA 3C0CA 5AQNB 2ZM0A 2ED1A 1K1ZA 2K2VA 5GANj 4AI6A 4J6XA 4QH1A 5GONE 5L3DB 2H8HA 3FRNA 4YJ3E 5HCMA 4L6V5 4JLIA 4YSXA 3A7MA 2RP4A 1BYMA 2H89A 3CMET 4LF9T 4C0ZA 1KQ1A 4QHOA 3PMTA 3IA3A 2CSIA 3M58A 2D5UA 4K0UA 4HFDA 4B9XA 4EV6A 1VQ4A 2ZGWA 3AHUA 3TLWA 4JJBA 3GF5A 2D0UA 1PCXA 2PVOB 3C94A 2QTXA 1ACMB 2EQKA 1IGUA 2A28A 5J39A 3UU4A 4J9HA 1NZ9A 1MMGA 2LDMA 2FJEA 4IUUA 2K3BA 1TU0B 2DL8A 2AKKA 4OYKA 4IHJE 2I0MA 4DO0A 4M75G 4C92G 3I9QA 5FYMA 5GAMg 1X9BA 1K8AC 4UIGA 2ES0A 3AECA 3I0QA 2KRNA 2RF0A 3JV3A 3RDVA 3CQCB 3OS2A 5CVIA 2VVSA 3QC9A 2MOXA 3NTHA 1WLPB 5GAN7 4M7DC 5HCJA 4M78C 4PJOC 1M2OA 3SRZA 1JEGA 1ZSGA 5L8RE 4HKAA 1IBLT 3KINB 3L2RA 1VIEA 3UU5A 3VKHA 1I94T 4M1PA 4LMLA 5FW9A 3RYFE 2VL8A 1UGVA 2PVGB 1KG1A 2DHRA 4KH0B 3RUXA 1AOJA 1UUEA 3TVTA 1VA7A 5DM7R 2FZKB 3OYYA 3I35A 4Z89A 5LJ5f 3G71Q 1FYNA 2H3EB 3ZSSA 4IKFA 1PKTA 3GP8A 2X67A 2CGHA 1SKUB 2EYXA 2L3RA 2DIGA 1H3HA 2NLUA 3ZYMA 2K9GA 3CCUQ 3NFCA 3PUWF 1BU1A 4U7YA 3PE0A 3VS0A 1LKXA 2PQWA 1N33T 1K9MC 1NJIR 1GCQA 1YI2T 3MHXA 3N5LA 1S94A 1ZA1B 4DBFA 3RPUA 1ABQA 2K3WA 3JB9D 4HVWA 4N78D 2QK0A 4J9FA 4BA9A 5ABFA 1R0BG 4FT2A 3RKOA 1RLQC 3CC2A 5HYAA 1ZHCA 1KK7A 3N9OA 3EG1A 2RI2A 2JPFA 3RKXA 1AVZC 3SWHA 1WXUA 3E08A 1VQ5A 3AA6B 2IC6A 2FJBA 5ADXL 1ZLMA 4P1NA 1YJWA 1SEMA 5LCYA 4IIOA 2XIDA 4LUDA 5AQPB 2V7MA 1M8VA 1CSKA 2X0LB 3UUXB 5L3CB 4KX6A 2JQQA 2BE7D 2J62A 2XG8D 5GJWB 5KYXA 3I9YA 1ZUKA 2XQ3A 2BTTA 4MLKA 3UT5E 2VQET 2D0TA 2ZPGB 5CFBA 3RYCE 2YWWA 2DVJA 2FEIA 3H0HA 3BQKA 1NAFA 5FL0A 3EH1A 2I59A 5CB4E 5LJ5j 1U06A 3MEWA 1I1JA 4JYAT 3JSCA 5KYXB 4MMLA 1YHQT 2DO3A 3GN5A 1WR0A 2L89A 3OYBA 3C64A 3DB4A 1YITA 3L39A 2PZ1A 3AT1B 3K8PC 4F04B 3CCRQ 2C0TA 2JIWA 5L3EB 1V29B 2W67A 2EIFA 5JH7E 5AQJB 3G6ET 5TAOA 1TOVA 3OYEA 2DZCA 1K8AR 3JCMP 4PL6A 3A8OB 2LT3A 1WYXA 4DOWA 3VUBA 1TH7A 2J06A 4M7DA 1JRIA 2QEXQ 4PJOA 2CA5A 3CCST 2D8HA 3K3OA 3PFSA 2LM2A 4ZNXA 2EW3A 4ESRA 1N36T 2NUZA 1XZYA 2D0QB 1HG5A 4JZ3A 5D6XA 2YRDA 4C92C 4PLIA 4M75C 4QVDA 4LDXA 4HFBA 4A97A 4BJMA 4H9OC 5HEHA 1JB0E 3I56Q 4M7DB 5FU6C 4PJOB 3H9NA 2FRYA 1OEDE 4QXCB 3AE5A 2BKDN 1QMCA 3RQUA 3CCQA 4HEAA 4ZI2C 4QQ6A 4JI1T 1U8RA 3A8GB 1X43A 3PUXF 2JZ2A 2WWVA 4GIWA 2VKJA 1NPPA 3JADA 5E0OA 2XHCA 5ABHA 5IXFA 2V1RA 3NTKA 2DNXA 5L3GB 3LLRA 2DXUA 2XY8B 3CX6B 5LGNB 2KBTA 4C5HA 3LG7A 3FZLB 1I81A 1WYBA 2R5MA 1W1FA 2AZVA 2BUDA 2YUPA 3TCJA 1GL5A 2X68A 4GOUA 5M4YA 2ZAEA 5GAN4 1VQ7T 1WA7A 4C5GA 3MPUB 1YIJT 4HWIB 2DEQA 4HFEA 1XTDA 2ZPEB 4AFUC 2DL1A 2MAMA 3OBVE 1E1HB 1N6AA 4QX8B 2LRLA 3E0ZA 3HI2A 3X28B 1JO8A 4RKUE 5KE2A 3LBXB 3UDCA 4O4JE 2KWIB 4BI8B 3G4SA 4KUMB 3E1SA 3OQ5A 2JJ9A 2X4YA 2HPJA 3A5XA 3H37A 4IDZA 1O9SA 3M57A 3THKA 1NENA 1T3SA 2QQBA 1WRDA 3RH3A 2CWYA 1UGSB 2CUDA 3OYXA 2M51A 3CKDA 2WDQA 4O6JA 1QVGS 2R6GF 1PWTA 2JS2A 1YJNT 3OYZA 4M4ZA 1NE8A 1SA0E 3KBGA 3N9QA 4E7SA 4XBFB 4OHFA 1V9DA 1UHFA 3UFGA 3HPWA 1WPYA 2EHOC 2IW5B 3O5ZA 5J26A 2FBWA 4KP3C 1WCRA 4ZHQE 1M2VA 4CRIA 5GMKj 4KGZB 4BUGA 5IHYA 1SHZC 1W2BS 1N9SA 1H92A 1NM7A 5AQHB 1KFYA 1NLPC 2E12A 4DR3T 4QVZA 2E9XC 2BKOA 2DLRA 1XQHA 3JCMb 2RHIA 4J83A 1RAHB 4QH5A 1O75A 1AT1B 2VVKA 2VKOA 2DTIA 2LLYA 1M2VB 3OMGA 1VCSA 3E19A 3RBBB 4AMCA 1S72A 3TLVA 4ELZC 3GWHA 1K0XA 1ZOYA 4CN4A 2FL7A 4HCCA 2V8IA 4M7AG 3MK7C 5FVLA 3X20B 4A4HA 2VV5A 3TKLB 2KR3A 3CC7A 5C6SA 5HCKA 5GAMe 5JDQA 5JREA 1KHIA 2X0YA 1D0YA 3H0FA 2VGNA 4M75A 4C92A 2LZ6B 4O2BE 4HTEA 3OYJA 2X9WA 2EQJA 3EG0A 1T72A 1VQNT 1WIEA 2HBWA 2WAUA 4KGVB 3QKJA 4DQ2A 1QVFA 1E7PA 3E22E 3QBYA 3BK9A 5KMGP 4I0UA 5HXSA 4O4LE 3UQ7A 2QYZA 1OU9A 3CK6A 4NPPA 1HCIA 1IZ6A 4C92B 3VKGA 4M75B 1VQPQ 3L2QA 2J1DG 2ZPHB 4IE4A 2RQWA 3OS5A 3CCET 3FDRA 3EDUA 2XZEA 3AE6A 2WBLA 3O1IA 5ABEA 5FU6B 3JCFA 3V8JA 2P4RA 4BI3A 1PD1A 4ZZBA 2F2VA 5JVDE 3AE7A 5FWBA 2YXYA 1VQ9T 2K4YA 2QA4A 4RTTA 2NR4A 3DB3A 5GAOr 1HJDA 2LSIA 3HRTA 2XQ4A 2ATCB 3OYCA 4EB6E 3REBB 2W61A 2XM2A 4A4FA 4O2AE 5GAN6 1D09B 4LF4T 4TVRA 3CMAQ 7AT1B 3T9NA 4BDYA 2XQ6A 4Z8AA 2E41A 2CLYB 1JXOA 1N27A 1H8KA 2AHJB 3SHWA 2C5JA 2CP7A 5AQUB 1YNZA 4RMOA 4O5VA 4NL3A 2W00A 2FVUA 4WBNE 3A5ZB 4M77G 4HFHA 1NEGA 2RPAA 4JV5T 1U5SA 3EG2A 2MBGA 1I6ZA 1BBZA 5EZYE 3LH5A 3QUIA 4F14A 1QKXA 3AE3A 2BZ8A 2X66A 3RYHE 4KHZF 4C90A 5DY9A 4I55E 1UGOA 5LJ5g 4QXHB 5IHIA 1C1AA 2EHOA 4H63V 2LTOA 5IWAT 2QTVA 3RERA 1KJWA 1IXDA 2YRCA 2KVQG 2OTJT 3O9XA 1HYOA 2RM4A 1QQJA 2F2WA 4GY5A 3CCLQ 3VU7H 3F70A 2DETA 3GNGA 2E9XA 2A08A 4PLLA 2Q9QB 4ZI7E 4OMQA 2DK3A 3CBMA 1AEYA 3EFOB 1KNPA 1U1SA 1RABB 2XAHB 4PJNA 1OEDC 5EG2A 3V8LA 1HR0T 2RI3A 3KFVA 3Q5WA 2KXPB 1QUUA 3QIIA 5IXBA 3RNJA 2DJQA 3QYGB 1VQLA 1VQ4T 2DBKA 3MEAA 3JAEA 1B34B 3P50A 5IHKA 4BY6B 1KQSA 4V2SA 4PFZA 3M4YA 4EMHA 2RI5A 4UELA 5FVKA 2GQVA 1U5PA 3M0QA 4H9QC 5C8YE 3UU6A 2YK0A 2HZYA 3ZEHA 1MMDA 2QGGA 4MFRA 1RAAB 3ZKRA 1PC0A 4Q5WA 5JTGA 4U3CA 4C8QF 3AEEA 4QVCA 2XQ8A 5LHHB 4I43B 4C91A 5GMKl 4A98A 5L3BB 2QA7A 3UQ4A 4M7AC 3O4XE 3L1AA 4HA8A 2DMOA 3CCJQ 3Q1JA 2DI4A 2XASB 1ABOA 3JCMV 1R8OB 3TSZA 3CCMA 2CWOA 4BE1A 3AE4A 1KF6A 5GAMh 4C0DC 2W4XA 5GANd 3SFMA 4HCKA 2LX7A 5AQSB 4MZPA 1ZHIA 2XI9A 1P92A 3RI5A 2L3SA 4ZXLA 1T3LA 2L3PA 1VCTA 4IDQA 4TV9E 2PVDB 4QQDA 5L47A 2YSQA 1C6VX 5DQWA 2BZBA 3QWYA 3OVUA 2XU8A 1X2QA 2EYYA 4F8HA 1HNZT 2E3HA 1QKWA 2VURA 4ZEYA 1HX8A 3OYLA 4C8QB 1E6HA 2IG0A 1B7TA 1K0SA 5GANe 4E7ZA 4YTMA 3DTOA 4RCBA 4IGUA 2AZSA 3JCMQ 1KFZA 5DLOA 1MIVA 1E2AA 1Y96A 2MPXC 4D8KA 3M0TA 3P8HA 3K3QC 4A4KA 3CCUA 3P4RA 3DLLA 1Y7XA 3CC2T 2V6XA 2DFUA 2FJDA 3QK6A 2HMAA 4EMKA 5F3JA 3BW1A 2FHDA 2A9UA 4IE0A 4Y92A 2WDRA 1VQ5T 2WS3A 2EAYA 4F17A 4OYJA 3EI0A 3A1PA 4LDUA 4M77C 3PUZF 4YY3T 1YJWT 1V1CA 1VQ8Q 3UULA 3Q5DA 1Y96B 3QJ6A 2LRQA 2BIVA 2CEAA 4FM4B 1OEDA 2UXNB 2HDAA 5CA0E 1VQ6A 2FO0A 2HAXA 3GNFB 4EMKB 3TLSA 2YHTA 1MNDA 2EJ9A 4IUPA 3S3MA 2DIQA 3A8LB 2V26A 4X34A 3UUNA 2EQIA 3H6ZA 4FSSA 2MF2A 4OB1B 1YW0A 2COYA 3MACA 2B8AA 2IIMA 3VV0A 1U1TA 2RB6A 3JB9J 4FW2A 4HVUA 1FXXA 1AZEA 4HGAA 2LT1A 1IBKT 4CC4B 1YITT 5L4HA 2OV9A 4ANJA 5A0DA 4MZTA 3WXMB 3B5MA 4IREA 1RAIB 2CZ0B 3M54A 2AIRB 4ELYC 2IIUA 2X9HA 2HBPA 2JOYA 4HVVA 2WMNA 1HXDA 3RF1A 2D1XA 4QWNB 1BI1A 4M7AA 2XAGB 1M4ZA 1QCNA 2LCLA 2DERA 4R0KA 4JJNK 5FL1A 3FXEB 3N9PA 4IE6A 3ZC0A 2DYIA 4QQGA 5ABGA 2DXTA 1UUSA 1WLXA 3QWXX 4A56A 3ZT5A 3OJAA 1E7OA 2HN2A 3N2OA 4JI4T 4XU3A 3JCMJ 2CE7A 3H0IA 5CO7A 4YHHT 3V8KA 4ORZA 4ATOA 2LVMA 2VGMA 3DP7A 4M7AB 4UV8B 2E64A 1KQ2A 3EHZA 1IJ6A 2PG8A 2YDSA 3NZQA 2KYBA 3EG3A 2Y8DA 5GAN3 2ZPFB 3CCVA 1TUCA 1Y07A 5LJNA 4TNVA 1UFFA 3CCQT 2VKDA 1O3XA 2DRMA 4FIBA 2FPEA 5FXZA 4LF7T 3I5SA 4M77F 3ZPOA 1JNZA 4Z8XA 3QUJA 3ZYKA 2W62A 4K0KT 3V7RA 5LJ3j 2KT8A 4KMCA 3AA7B 3P4WA 3L42A 3VRYA 2E70A 1XNQT 1YKEB 2GF7A 1M3BA 1ZKEA 4TUYE 2EBPA 3H8ZA 5GAN8 1QP3A 1MIYA 3JB9G 3EGDA 2KMFA 1MMNA 2OTLA 3PTAA 2VWFA 1YHQQ 2LOSA 4EIKA 3TU4K 1WHJA 4DV4T 4AKRB 1FIOA 1HNWT 2XPKA 4RUGA 1WQ7A 1W4SA 4OMPA 5HEUA 1BI0A 3OW2P 1W6XA 1W9RA 3ZC1A 3EGDB 3KVBA 3G4ST 5JR9B 3G6EQ 4QKNA 4GK0E 2XQ5A 4IURA 2VKHA 4ZI3C 3UU8A 2D9TA 2MK5A 4M77A 4ZOLE 5HEJA 1N9RA 2V8JA 4TN7B 2X51A 5LJ5e 3AA1B 2DBMA 3CCSQ 5GANh 5LMUT 5HEOA 1G83A 2KE9A 4ZN3A 1ZP0A 1FEWA 3GLXA 1WNLA 4YTLA 4M77B 1XDPA 4X5TA 1N8RU 4II1A 1YCYA 4H9RC 2WM9A 3AAEB 4B3TT 1G2BA 2A37A 1NEKA 2F5TX 4HCZA 1BK2A 3HR0A 4BAYB 2UUBT 2NTXA 1K9AA 2W2UA 3UA7A 1M30A 3ASKA 3CPWP 4R56A 5CA1E 1U3OA 4F7UE 4U7IA 2EWNA 4OMFB 3VRZA 2CH4A 4IUTA 3CX7B 1UE9A 3OYKA 4CI1B 4DR5T 4M7DD 2QG9B 4X20E 3I1AA 4WNKA 1QVGP 1D0ZA 4LDYA 2BG9C 4ZGEB 1QLYA 1IO6A 3VU3C 1SG5A 3MJXA 1MV0B 2W0GA 1I8FA 3PT9A 1S72T 2H3RA 3EDVA 2G6FX 2MIOA 2BVLA 1RI9A 5HY6A 3R84B 2MTQA 3RRWA 2K24A 1EX4A 2CP0A 3AAIA 4KT0E 2SPCA 3RIAA 3CC7T 1S1NA 3G7ZA 1M1KU 1W2BP 4QXBB 2HKQB 4AFSC 3PURA 2EYZA 4VUBA 4TWFA 3PU8A 4PKCC 1JJ2A 1Z8UA 4A53A 3BQIA 3G06A 4PK6A 5HXRA 1B3QA 5C2TA 2HD0A 1G3WA 4R55A 5KCHA 2Z6EA 3CC4Q 3OTOT 3VS5A 4L9IA 3AE1A 4FJOA 4AG2C 4NL2A 4OMLA 4RTWA 1N8RC 1I5OB 5KCOA 3VR9A 5BR8T 3VS1A 2FJAA 3PUQA 2R5AA 1NG2A 5A2QE 3GIBA 4U74A 2X4WA 2CH4W 4F7UG 1X01A 4Q25A 1R8IA 3ZJ2A 3P8BB 4JRKA 3CXCP 3CEYA 2QA4T 2YN6A 4C0GA 1X6GA 3RGLA 2DYBA 5AQTB 1M8MA 3MEUA 5I21A 4BACA 2W66A 1VUBA 3E9GA 2UU9T 1X75C 1AWWA 1MGQA 1QWEA 4ERRA 2QI2A 3CVRA 3NVOA 4LUEA 3VS3A 1UEBA 4EIWA 3ZT7A 3HL6A 5ABFB 3DKMA 3UT1A 2V5DA 5JRCA 5F8PA 4DBQA 4B3ST 1JNRA 5GMKe 4FU6A 4M7DF 4XAXB 4M78F 4GLKA 3QDFA 4PJOF 2WU5A 1GQEA 5JDGA 1M1KC 1F1BB 3CX8B 4OP0A 4JS5A 3ZEFB 1TTHB 5H6RB 2OJ2A 3CMAA 4KGXB 2AXDS 2SEMA 2C0SA 1YJ9Q 5DJQC 4Z88A 4RTVA 4BE2A 2LOPA 5I22A 2RJCA 4AQFC 3MP8A 1K4US 5GMKm 1VQNQ 2BZXA 3CQTA 4N4HA 3UUBA 5IYZE 4DV1T 3MO8A 3QYHB 4WTOB 3F2EA 2BKNA 2D9DA 3VHLA 5L4EA 2UUAT 1SSFA 2JTFA 3QJYA 1WHGA 4LMJA 1JBMA 2EJGA 4COFA 3EABA 1MHNA 2WMOA 2RHXA 2X4XA 4C8QE 3CCEQ 1OULA 2NW8A 3GN5B 2BG9A 1CUNA 3GA8A 4PW8A 1MUZA 2B86A 4C5EA 5KYUA 4ZGDB 4M78A 2QDLA 4UC4A 4YSYA 1VQLT 3Q2MA 4C92D 3TSWA 1YCSB 3JB9I 2WWUA 3HA4A 1KIKA 3OYHA 3ULRB 3CCLA 1VQ9Q 4TWDA 4KHPT 3LSVA 4YJ2E 1TWBA 6AT1B 4NXNT 3I55A 3PGGA 2HCKA 4A4EA 2BG9B 2DD5A 3WAJA 5KYUB 4KRTA 5GAOp 4M78B 1VQKA 4PK5A 3P8DA 3HKBE 1EZZB 2EGEA 3JCMc 1HFAA 3UPUA 2RQTA 2KMTA 4OB2B 3M3ZB 1IBMT 2J7IA 2DWKA 3OW2S 4DIDB 1C0MA 2COWA 5LJ3g 4HCBA 5FP3A 1HNXT 1RACB 3E9FA 4X1IE 4DV7T 2DL4A 1HF8A 5C0MA 2JNGA 3AVSA 2N1GA 3CCMT 2E10A 5JDHA 3O8VA 1BIBA 4CXXA 2O4XA 1QWFA 2YDLA 3OBYA 1N8RR 4L5GA 4BJNA 1OU8A 2YRVA 2RNAA 3AE8A 4OMNA 3L2WA 2OTJQ 2UXXB 3J7Yq 2XSAA 5CIUA 3SEMA 2JVVA 4AQGA 2C0IA 1UB4A 1E6GA 3CCJA 1D1AA 2OA5A 4H63H 2NWBA 1VOMA 5GAN5 3SB2A 4HWFA 1IHVA 3CPWS 4J2CA 3GPLA 4P0BA 4K11A 1TSFA 3KV5A 4H9NC 2GNCA 2WSCE 2J6KA 4HKEA 2QYWA 4MMKA 4AIUA 1T0HA 2QQRA 1LRZA 5CKEA 2Q9QD 3AA0B 4CN1A 1VQ4Q 1YFNA 4TNWA 1TG0A 3IF8B 5CQXA 1OPLA 2KGTA 1K76A 4NS5A 3VS4A 3KDSE 1M1KR 4XQ3A 5GAMd 2LQWA 4N0AC 3ME9A 2PBIA 4M75F 3SWNC 4C92F 2LM9A 3V5UA 4AQFA 3JB9H 3ZMZB 3CCUT 3QZ9B 3RKGA 2GCXA 3W15B 1HSQA 2OAUA 2R57A 1H7CA 1WYCA 1OZ3A 3V7SA 1M5Q1 3QZ5B 3MZKB 2JTEA 2QXFA 4AXPA 1WJRA 5CKFA 2OI3A 1N34T 2NW9A 1N5ZA 2XAQB 2W10A 4DVDA 4AKLA 2ZM2A 3OA6A 1GXIE 2V6YA 5LG3A 2I0NA 1VQ6T 2L3QA 5EC7A 4AG1C 4ZTJA 1B07A 3OYGA 3X25B 4IDNA 3VS6A 3M0UA 3AEFA 4AFZC 2E65A 1J5ET 3WAKA 1IJ5A 2OLTA 2CXFA 3KV4A 2J4GA 5FKYA 2OX7A 1X69A 4XTYA 4DV2T 2V6YB 3JCMf 1VQ8A 1FWZA 3CXCS 2DXCA 1VQMA 2HQEA 2LSGA 1RUWA 4AQYT 1Z9ZA 4RTYA 4HFCA 4OF1A 3KVAA 3PUAA 1NEBA 2CM0A 2K57A 3URGA 2ZLYA 3LW5E 3S4UA 1BR1A 3QDRB 1H641 3EAMA 5GJVB 4AT1B 4IIJE 1WDXA 3LGLA 2RPNA 2PU9B 8ATCB 1L0VA 2CHNA 1TS9A 1WI7A 1AWXA 1PHTA 2JM9A 2WP9A 5L3FB 2RQUA 1UHCA 1M7KA 2E5KA 1YXRA 4CZZB 4FYVB 4CXWA 4J8OA 2IMLA 3CC2Q 4JUYA 1I4K1 2EYWA 4C8QD 4A54A 3JCMW 4JRQA 2MOZA 1QCFA 3HKDE 4DBHA 4BDZA 1T7SA 2LC4A 2RD1A 4UXNB 3HP9A 1OZ2A 2KXDA 1VQ5Q 3CCVT 4XTZA 3NTIA 4KULA 1JXMA 1OYXA 4MDWA 4U72A 1CKAA 1ZX6A 4EZHA 2P84A 5HEGA 2E8IA 3MEVA 2H7VC 3LJCA 3M0RA 3P8CD 4DR2T 3M59A 3TLTA 2FG0A 2JW4A 2O9VA 4FYWB 1KC8U 1X6OA 1YBYA 1TUDA 2AKLA 1XMQT 4X1VA 4V1Av 4J7FA 5A0GA 2P4TA 4RTZA 2V7LA 1I5LA 1EFNA 2LJ3A 4XTVA 1UG1A 3FZHB 2OTLT 4DV0T 4EZ4A 4N0AA 2JN0A 5AQGB 3IQLA 4GYSA 2RJDA 3LGFA 2V7JA 2RN8A 1WX6A 2WSFE 2I2LA 3M0PA 4IUVA 2LHNA 2XQ7A 3C51A 4LE9A 3OYNA 3PIOA 2M02A 2MAWA 2EHOB 3HKCE 2E5VA 5J2UE 4X66T 4GKJT 1Y0MA 1ZUYA 1BR2A 3N2KE 2YT6A 4E6RA 2CZ6B 3VRBA 2CSQA 2O2OA 4JZ4A 2XDDA 2X35A 2HL3A 2EYQA 1Q82U 1VQOQ 5M9OA 1YHQA 4EPCA 4EOZB 1ARKA 1HX1B 2E9XB 5HWXA 4FT4A 3R6OA 3X1DA 3FBZA 3T8OA 1HD3A 2V8SV 3PJAJ 4CC3A 2A0FB 2LQ8A 1XNIA 2WU2A 3HL8A 2BBJA 3K1SA 2C06A 1ZEEA 3OSSC 2K6DA 1J3TA 3CCQQ 2FZCB 5CCAA 5IH2A 3ETUA 3OMCA 4M7AD 1RAFB 3CQXC 2RMOA 3CPFA 2DTOA 4HT8A 2CDTA 4WF2A 3KUFA 2VKNA 4ZS3A 2YDQA 2XKOC 3D0TA 2XICA 1KC8C 3JAFA 3Q9DA 4Z02A 4ILAA 4CI3B 3HHTB 4QT7A 4Z90A 3CD6Q 1ZBJA 4YHJA 4KUIA 5BMVE 2KXCA 5LBQB 4JI2T 3LWHA 3HRUA 1SHFA 1KNZA 3N9NA 3LYIA 4P0AA 5D6YA 2ED0A 1Q7YU 2IAKA 3GMIA 5EK2A 1ZA2B 2MPKA 3UF4A 2JXBA 2O88A 2KSSA 4HWDA 2VASA 2H7OA 4P09A 2GBQA 3G4SQ 2V1QA 2CZ7B 3P4QA 2XQAA 3PUVF 3QSUA 4EAHA 3MP6A 1Q82C 4A4GA 1M27C 4ILUA 1XDOA 3CMEQ 4J9GA 5LJMA 1IGQA 3E2UA 3M5AA 4HT9A 1QP2A 2AT1B 1G8XA 5LXTE 2QGFB 5D6WA 2LE8A 1UTIA 3NRYA 3L09A 5AT1B 2DNUA 2MMPA 3VS7A 5CR2A 4CN6A 4M7DE 1JU5C 3G71A 4PJOE 1IREB 3OS1A 2EGCA 3EFSA 2YUNA 4MBQA 5JDLA 3UUMA 2A7YA 3L2ZA 5I11A 2WSSV 2VXFA 3REAB 3CC4A 3J81E 3OS0A 2GGRA 2VB6A 2CT4A 3ANWA 4KH1B 5KXJA 3CBPA 4M77D 4J9DA 2YDRA 3TLUA 2N9DA 1LVKA 1Q86U 1Y01A 1UDLA 4MHCA 1M90U 2JUFA 2O9SA 4XTUA 4PAGA 1NPRA 2A72A 4GKKT 4LDWA 4YXDA 2RK1A 3FJ5A 1ZQ1A 1S72Q 3RC8A 4M7AF 3ANWB 2DILA 2CKKA 5KE3A 2WCAA 5LYJE 3LFMA 5LB7B 4JUVA 1UGRB 2LKHA 4EDUA 5LJ3f 3HSBA 4KBMB 3EGXA 1Q7YC 2Y6XA 2K7AA 2PJQA 4PK4A 3L8RA 3ZL7C 3D7SB 4LDVA 3CMAT 2VXEA 1YP5A 2Y4YA 5FRNA 2JM8A 4PNIA 2EQMA 5DLQE 1OEDB 3PUYF 3OYFA 2NW7A 4JEHB 4IE7A 4ISSA 5JDFA 3CMLA 2PUKB 2LT4A 3EG9A 4LF8T 4U33A 5GAOl 2QASA 4NIQA 5AQIB 2V7KA 2O01E 5FXXA 1OX8A 3A98A 5FY1A 2QQ9A 5CKHA 3UA6A 2CP6A 1TUGB 2M9UA 4PJMA 4LXCA 4F16A 1YJ9A 4O4IE 5IN1A 4UVCB 4ASKA 3AE2A 2SRCA 1NBEB 1ZSZC 1YI2Q 4BD3A 3KV9A 4DUYT 5F5WA 2QDYB 1KSWA 1KC8R 3ZBDA 3KV6A 2KI7A 3K3NA 2JRKA 2ECZA 4E7IA 2ACXA 1WHKA 2D0NA 1UX5A 3CCLT 4DV6T 5LMNT 3FJPA 3CCRA 2QA4Q 2IUBA 3I55T 1Q86C 1IRXA 2Y4XA 3CCEA 2KZ7B 2V7IA 1XJWB 3KXTA 1HS7A 2DEUA 2EVRA 1M90C 4J5YA 1VQKT 4A63B 2IPOB 2BE9B 2HH7A 2LJ0A 3FHNA 2XK0A 2LJ1A 2QEXA 2C0OA 1Q81R 2CP2A 2PNIA 4C0DB 4EEDA 1FMWA 4DUZT 3C50A 5L2LA 3EHQA 2MWOA 2XTLA 5LG4A 3LH0A 5CAIA 5ECAA 2GFUA 4X62T 1Q82R 3I56A 5LJ5d 2HNIA 2E5QA 5JDNA 1M3AA 2HSEB 2KEAA 4AKIA 3WI3A 3X26B 4DMVA 3JCMg 1W09A 2M6IA 3N2GE 2CHOA 3JC6D 1GCPA 1X79A 4DR7T 2M0OA 4OB0B 1JJ2P 2DF6A 4HE8A 2K3XA 3HTRA 3ZN1B 4E47A 3I0OA 4J9EA 4PFPA 1RAEB 1G3YA 3H41A 1MV3A 4C92E 4M75E 3PIPA 3FB2A 3IEEA 2X3WD 4B9WA 3HFOA 3CCJT 2KNBB 3FZFB 2V1DB 3VUZA 2ROTA 2HN1A 5HAXA 2EPDA 1ZUUA 1LOJA 3AEDA 3HKSA 2I6HA 3I9WA 2NWMA 4L59A 3L3PA 4L0RA 4ILCA 1AHJB 1WHLA 3HRSA 4RTXA 3T1HT 4LD9K 5HXCA 2X9YA 2N2NA 4DV5T 3R6NA 2KT9A 2E5LT 2L0AA 5IT9E 3PDYA 4X1YE 2E4HA 4DBRA 2QQAA 4IL4A 4IUQA 4O8SA 4D8DA 3VS2A 2DM1A 1Q7YR 2KT1A 4JRIA 5KH6A 3UTKA 4E7JA 2DD4A 2VYTA 2ZMAA 3RKWA 5FLXE 1SSHA 2HQXA 3C4XA 3G1JA 3BDLA 1KD1R 4JRPA 1SUMB 3VYHB 2YLCA 4M78D 4PJOD 2KY9A 1LNXA 3EH2A 2CXDA 4UR9A 2XJ7A 2VC8A 4BE0A 1K9MU 5FRMA 1GFDA 1WFWA 5AQMB 3PVLA 2ESWA 1OQKA 3VR8A 3QXEB 2QVAA 5AFUL 2WSEE 2UUCT 1VQ7Q 2B1EA 2YINA 3CCMQ 1ZSZA 1YIJQ 2DE0X 4BI4A 5CK9A 2RA1A 2FPDA 3EAEA 3OYMA 4OFZA 1PD0A 1NLOC 3LK2B 4IDPA 4JJDA 3GBQA 1VQ8T 1VQMT 1ZSZB 8AT1B 4ADZA 2ABLA 2H3JA 5KYNA 1U4QA 5CKBA 2FUPA 3B57A
chains in the Genus database with same CATH topology
3CQGB 3A8HB 4FL6A 4XZCA 4Y91A 4FSXA 2XDPA 3B13A 2PUOB 1K73U 2LX9A 1MIWA 2LSKA 1EIFA 4J7IA 5J1GA 3DLMA 3BQLA 3M55A 1XOVA 1OI1A 4NUVA 2RH2A 2Y90A 1D0XA 1PSFA 5KDMC 3PUSA 3C4SA 4RCCA 1VQPA 2K48A 2F5KA 2K5LA 3OW2A 5FU7C 2BDEA 3DJBA 2IVWA 3ZCIA 1Y71A 2LHRA 3S6WA 4XTXA 2W63A 2YEVC 3J9X1 1G3TA 2CYZB 3PU3A 4I4TE 5J3BA 4XU2A 2C5IT 3KBTA 2LCCA 3V7CA 5LGTB 3OYDA 5JRCB 4ZTFA 3WVEB 1MMAA 3FXDB 4UF0A 1PSEA 3PTRB 4X1KE 4EYUA 2VWAA 2EKOA 3CPWA 5LOVE 4DOVA 1BR4A 3QO3A 1K73C 2R58A 2RA2A 3RESA 1QVGA 2DPPB 3P7IA 5LJ5h 4UF0B 4P5NA 3SS1A 2DZ9A 4XU1A 2P0PA 4H9PC 3V5SA 1BKBA 2A3LA 4M75D 3QPHA 4IE5A 1LVFA 3ONXA 5LBMA 4RG2A 1W2BA 2E6ZA 1JJ2S 3QG1A 4ZI2D 1YD8G 2RHUA 3BDUA 2NOXA 5HKCA 4DNDA 1LJOA 3SD4A 2MI6A 2XQYA 2QGSA 2P0QA 4JDSA 2DXBA 1VQOA 3HKEE 3C95A 4HN9A 4TZ4C 2RO0A 4J6WA 3N5BB 3M65A 4UEMA 2CXLA 3NBXX 5GAOq 2KINB 3JCMd 4OGEA 5FMNA 3FLGA 4XU0A 2XHEB 3JB9F 2NTYA 5HK3A 4JEUB 4Y28E 4CI2B 4WBOA 1YKHB 5EK4A 4HFVA 2EFIA 3CXCA 3C4WA 2L9QA 3HFNA 3WVDB 3SDZA 4C8QG 1UGQB 3PUGA 3KBUA 3OKQA 1FMVA 4QW2A 3ETVA 3CD6A 3N9MA 2O4XB 3LBXA 5DABA 3JCMe 3PNWC 2CLYC 3L2VA 2KDSA 1VIFA 2LJLA 1US7B 4H9SE 1VRBA 3OYIA 4B6XA 2EHOD 2YU1A 5GANg 4M7AE 3U78A 3LX7A 5A0LA 5GAOm 5FU7B 3G71T 4CI0C 4GYRA 3MKDA 3J80E 3UWNA 5FXWA 2M16A 4PJJA 2E9XD 5LHIB 3CMEA 2XAJB 3CC4T 5CKDA 4YLHA 3NRXA 3EUHA 4RG8A 5EK3A 4ME7A 2DVEA 3FBLA 2Q9QC 2F69A 5GMKh 1T98A 4J6YA 4X9DA 5HXHA 4D6WA 1WGSA 2CMRA 2XUEA 5FY0A 2RJEA 2G3RA 1H3ZA 4AKGA 2M67A 5LHGB 3J7AF 4BY6C 3CPZA 2LEHA 4TV8E 2HPLA 4G2AA 2RHZA 3N9LA 1D1BA 3Q5XA 3C98B 1HK9A 1OXZA 5FY7A 1D3BA 5LP6E 2GK9A 3FIFA 5KX5E 3BFMA 4BB7A 1YJ9T 3INZA 4M77E 3ZFJA 1IAPA 4F7UF 5CQYA 1M1GA 2LNVA 1D3BB 4UVBB 5HWYA 3CWZB 4OK0A 3JCMX 3CCRT 4E7KA 5AYFA 1NWMX 1BI3A 3FEOA 3ZCJA 3FB9A 1YI2A 3ZLIA 2QEXT 4CXYA 5HK0A 2A3DA 2KK4A 2ZPBB 3X24B 2NP9A 2KAFA 2ZZDA 3ZMTB 2DKGA 2JMKA 5FNVE 3H3AA 4GK5E 1EZ3A 4F7UA 2DAQA 2CS7A 3S3OA 3I56T 3AAAB 4C8QC 1ZBXA 2YU2A 3ESLA 3S3NA 1WR6A 3SWNA 5JDMA 5GAMf 4F7UB 4PFOA 4XK8E 4MZMA 1Q81U 2K9AA 3AB3B 2L3LA 3JCMh 3ZJ1A 5FROA 1OWAA 3C4ZA 4FI5A 2FYKA 4I50E 3PMIA 2Q9QA 3BY7A 3SWNB 1ZV4X 4LD6A 3JRZA 4EMKC 4KUDK 2A2FX 2EJFA 3OB9A 3M4GA 1DJ7B 4WW0A 3EVYA 3G6EA 5LA6E 1B34A 3OSVA 1QVFS 4N4GA 2K5FA 2G0UA 4C0FA 3RYIE 3M9QA 5LJ3d 2IC9A 3CCSA 5JQGE 2L5QA 3META 1WQWA 5DQVA 2QQSA 2WACA 1MNEA 4OB3B 4PNOA 1Y64B 1BIAA 4EXTA 1QSDA 2LSYA 2CCQA 1UX4A 5I2MA 2LQKA 2ODUA 3L2UA 4E7HA 2JTMA 2ZM8A 5GAMj 2K3YA 1BI2A 1Q81C 2KLQA 2V8KA 2DTHA 3KFWX 2RHYA 5I2SA 5LJ3e 1BR0A 4DMWA 5GMKi 4JS4A 1KD1U 3O1JA 1VQ7A 1HG2A 1YIJA 2X4JA 2X9XA 2XDBA 1FX7A 3OYAA 1RL2A 3RC3A 2RK2A 1RI0A 2L8KA 1D1CA 4M78E 2MYSA 1IZNB 3QHSA 4C8QA 2XD0A 5J2TE 4CQIA 2FB7A 4NOYA 1VQPT 4JLEA 3EFRA 2E6NA 3TEEA 1YJNA 3IBPA 4XTWA 3VYGA 3ZMSB 5JR9C 1M1FA 5LL6S 4PJLA 4TX5A 2PFVA 1KQSS 4C5IA 2L8DA 1UCUA 4JLGA 4G63A 1M9SA 4QX7B 5LGUB 1S35A 2ZCFB 3M53A 2M1HA 3F31A 3NZPA 1KD1C 4EYYR 2ZPIB 3IHRA 2BVMA 5FXVA 2DJZA 2P0KA 2Y48B 3MXZA 5A1LA 1WJSA 2VUBA 3OBWA 1NJIU 4E7LA 1UGPB 3RIRA 2XAFB 1QW1A 4M7DG 2P9BA 1G3SA 4M78G 4PJOG 2ODVA 2KNDA 3U3IA 5HXEA 4MALA 2K5IA 3ZMUB 1WJQA 1AJ3A 4O4HE 4AKHA 3ER0A 3A8MB 3MCAB 1KHCA 2GFAA 3SOLA 1VQNA 5LNKA 1Z0PA 5GAN2 4N4IA 3GOXA 4NUUA 2VK9A 4ZGJB 3RKYA 2LSJA 3RMQA 3ZMVB 4EMGA 3C12A 5GANf 3TREA 3ZN0B 3MP1A 2DWGA 2MWPA 3RMSA 2DCFA 2D2SA 1HTJF 4UV9B 3LK42 4UVAB 3ZYLA 1VQOT 1G5VA 2CZ1B 3LWIA 2KQWA 3LK3B 3VKIA 1VQ9A 2D6FA 4OVAA 3CBOA 1G73A 4ISTA 2JMHA 4F6RC 3RX6A 2YLBA 5H6QB 4OGCA 3VJPA 3F57A 1QVPA 4YFSA 1NJIC 2C5KT 5LJ3h 1K8AU 3RRCA 2KWHA 2K5BB 3UFEA 4ZI3D 3O1HA 4MDXA 2EQUA 3OY9A 3M56A 4X9CA 3CD6T 2E1HA 3MA9A 2RJFA 3JAME 3FC3A 5GAOn 4ZS2A 5JR9A 3AVRA 4ZN1A 5IAYA 4DA4A 5ETWA 3JC6C 2OTJA 2ZM0A 2K2VA 5GANj 4AI6A 4J6XA 5GONE 5L3DB 3FRNA 4YJ3E 4L6V5 4JLIA 2RP4A 1BYMA 3CMET 4C0ZA 1KQ1A 4QHOA 3PMTA 3M58A 2D5UA 4K0UA 4B9XA 1VQ4A 2ZGWA 3AHUA 3GF5A 2D0UA 2PVOB 3C94A 2QTXA 2EQKA 5J39A 1NZ9A 1MMGA 2LDMA 4IUUA 4OYKA 4IHJE 4DO0A 4C92G 4M75G 5FYMA 5GAMg 1K8AC 4UIGA 2ES0A 3I0QA 3CQCB 3OS2A 5CVIA 3QC9A 3NTHA 5GAN7 4M7DC 4M78C 4PJOC 3SRZA 5L8RE 4HKAA 3KINB 3L2RA 1VIEA 3VKHA 4M1PA 3RYFE 2VL8A 2PVGB 1KG1A 2DHRA 3RUXA 5DM7R 3OYYA 5LJ5f 4IKFA 3GP8A 2X67A 2CGHA 2L3RA 2DIGA 2NLUA 3ZYMA 3NFCA 3PE0A 1LKXA 2PQWA 1K9MC 1YI2T 3MHXA 3N5LA 1S94A 3RPUA 3JB9D 4N78D 4BA9A 4FT2A 3RKOA 3CC2A 5HYAA 1ZHCA 1KK7A 3N9OA 2RI2A 2JPFA 3RKXA 3SWHA 3E08A 1VQ5A 3AA6B 2IC6A 5ADXL 1YJWA 5LCYA 2XIDA 2V7MA 1M8VA 2X0LB 3UUXB 5L3CB 2JQQA 2XG8D 3I9YA 4MLKA 3UT5E 2D0TA 2ZPGB 3RYCE 3BQKA 1NAFA 2I59A 5CB4E 5LJ5j 3MEWA 3JSCA 1YHQT 4MMLA 2DO3A 3GN5A 2L89A 3OYBA 3C64A 3DB4A 1YITA 3K8PC 5L3EB 1V29B 2EIFA 5JH7E 3G6ET 5TAOA 3OYEA 2DZCA 3JCMP 4PL6A 3A8OB 2LT3A 4DOWA 3VUBA 1TH7A 4M7DA 1JRIA 4PJOA 2CA5A 3CCST 3K3OA 3PFSA 2D0QB 1HG5A 5D6XA 4C92C 4PLIA 4M75C 4QVDA 4LDXA 4BJMA 4H9OC 1JB0E 4M7DB 5FU6C 4PJOB 4QXCB 2BKDN 3CCQA 4HEAA 4ZI2C 4QQ6A 1U8RA 3A8GB 2JZ2A 4GIWA 2VKJA 1NPPA 5E0OA 2XHCA 3NTKA 2DNXA 5L3GB 3LLRA 2DXUA 3CX6B 5LGNB 4C5HA 3LG7A 1I81A 2R5MA 1WYBA 2BUDA 3TCJA 2X68A 4GOUA 5M4YA 5GAN4 1VQ7T 4C5GA 1YIJT 2DEQA 1XTDA 2ZPEB 2MAMA 3OBVE 1E1HB 1N6AA 4QX8B 3E0ZA 3HI2A 3X28B 4RKUE 5KE2A 3LBXB 3UDCA 4O4JE 2KWIB 4BI8B 3G4SA 4KUMB 3E1SA 3OQ5A 2JJ9A 2X4YA 2HPJA 3A5XA 3H37A 4IDZA 1O9SA 3M57A 2QQBA 1WRDA 3RH3A 2CWYA 1UGSB 3OYXA 3CKDA 4O6JA 1QVGS 1YJNT 3OYZA 1NE8A 1SA0E 3KBGA 3N9QA 4E7SA 4XBFB 4OHFA 1V9DA 3HPWA 1WPYA 2EHOC 2IW5B 5J26A 4KP3C 4ZHQE 4CRIA 5GMKj 4BUGA 5IHYA 1SHZC 1W2BS 1N9SA 2E12A 4QVZA 2E9XC 2DLRA 1XQHA 3JCMb 2RHIA 4J83A 1O75A 2VKOA 2DTIA 3OMGA 3E19A 1S72A 4ELZC 3GWHA 2FL7A 4HCCA 2V8IA 4M7AG 3MK7C 3X20B 4A4HA 2VV5A 3TKLB 3CC7A 5C6SA 5GAMe 5JDQA 5JREA 1KHIA 1D0YA 4C92A 2VGNA 4M75A 4O2BE 4HTEA 3OYJA 2X9WA 2EQJA 1VQNT 2WAUA 3QKJA 4DQ2A 1QVFA 3QBYA 3E22E 3BK9A 5KMGP 5HXSA 4O4LE 1IZ6A 1HCIA 4C92B 3VKGA 4M75B 3L2QA 2J1DG 2ZPHB 4IE4A 3OS5A 3CCET 3FDRA 3EDUA 5FU6B 2WBLA 3O1IA 3V8JA 4BI3A 5JVDE 1VQ9T 2K4YA 2QA4A 3DB3A 5GAOr 2LSIA 3HRTA 3OYCA 4EB6E 2W61A 4A4FA 5GAN6 4O2AE 4TVRA 3T9NA 4BDYA 2E41A 2CLYB 1N27A 2AHJB 2C5JA 4RMOA 4O5VA 4NL3A 2W00A 2FVUA 4WBNE 3A5ZB 4M77G 2MBGA 5EZYE 3QUIA 2X66A 3RYHE 4C90A 5DY9A 4I55E 5LJ5g 4QXHB 2EHOA 4H63V 2LTOA 3RERA 2KVQG 2OTJT 3O9XA 2RM4A 4GY5A 3VU7H 3F70A 3GNGA 2E9XA 4PLLA 2Q9QB 4ZI7E 2DK3A 3CBMA 1U1SA 2XAHB 4PJNA 5EG2A 3V8LA 2RI3A 3Q5WA 2KXPB 1QUUA 3QIIA 3QYGB 1VQLA 1VQ4T 3MEAA 1B34B 4BY6B 1KQSA 4V2SA 3M4YA 4EMHA 2RI5A 4UELA 2GQVA 1U5PA 4H9QC 5C8YE 2YK0A 3ZEHA 1MMDA 4MFRA 4Q5WA 4C8QF 4QVCA 5LHHB 4I43B 4C91A 5GMKl 5L3BB 2QA7A 4M7AC 3O4XE 3L1AA 4HA8A 3Q1JA 2DI4A 2XASB 3JCMV 1R8OB 3CCMA 2CWOA 4BE1A 5GAMh 4C0DC 5GANd 3SFMA 4MZPA 1ZHIA 2XI9A 1P92A 4TV9E 2PVDB 4QQDA 5DQWA 2BZBA 2XU8A 1HX8A 3OYLA 4C8QB 2IG0A 1B7TA 5GANe 4E7ZA 3DTOA 4RCBA 4IGUA 3JCMQ 5DLOA 1MIVA 1Y96A 3P8HA 3K3QC 4A4KA 3CCUA 3DLLA 1Y7XA 3CC2T 3QK6A 4EMKA 5F3JA 3BW1A 2FHDA 4IE0A 1VQ5T 2EAYA 4OYJA 4LDUA 4M77C 1YJWT 3UULA 1Y96B 3QJ6A 2LRQA 2BIVA 2CEAA 4FM4B 2UXNB 1VQ6A 5CA0E 2HAXA 3GNFB 4EMKB 2YHTA 1MNDA 2EJ9A 4IUPA 3S3MA 2DIQA 3A8LB 2V26A 4X34A 3UUNA 3H6ZA 2MF2A 4OB1B 1YW0A 3MACA 2B8AA 3VV0A 1U1TA 2RB6A 3JB9J 1FXXA 4HGAA 2LT1A 1YITT 4ANJA 5A0DA 4MZTA 3WXMB 2CZ0B 3M54A 4ELYC 2X9HA 2HBPA 2JOYA 2WMNA 1HXDA 4QWNB 1BI1A 4M7AA 2XAGB 1M4ZA 2LCLA 4JJNK 3FXEB 3N9PA 4IE6A 3ZC0A 4QQGA 2DXTA 1WLXA 4A56A 3OJAA 3N2OA 4XU3A 3JCMJ 2CE7A 5CO7A 3V8KA 4ATOA 2LVMA 2VGMA 3DP7A 4M7AB 4UV8B 2E64A 1KQ2A 1IJ6A 2PG8A 3NZQA 2Y8DA 5GAN3 2ZPFB 3CCVA 1Y07A 5LJNA 3CCQT 2VKDA 1O3XA 4FIBA 5FXZA 4M77F 3ZPOA 4Z8XA 3QUJA 3ZYKA 2W62A 3V7RA 5LJ3j 4KMCA 3AA7B 3L42A 2E70A 1YKEB 2GF7A 1ZKEA 4TUYE 3H8ZA 5GAN8 1QP3A 1MIYA 3JB9G 2KMFA 1MMNA 2OTLA 3PTAA 2LOSA 3TU4K 4AKRB 1FIOA 1WQ7A 1W4SA 1BI0A 3ZC1A 3KVBA 3G4ST 5JR9B 4QKNA 4GK0E 4IURA 2VKHA 4ZI3C 2D9TA 4M77A 4ZOLE 1N9RA 2V8JA 4TN7B 2X51A 5LJ5e 3AA1B 5GANh 4ZN3A 1FEWA 3GLXA 1WNLA 4YTLA 4M77B 1N8RU 4II1A 1YCYA 4H9RC 2WM9A 3AAEB 2F5TX 4HCZA 3HR0A 4BAYB 2NTXA 3ASKA 4R56A 5CA1E 4F7UE 2EWNA 4OMFB 4IUTA 3CX7B 3OYKA 4CI1B 4M7DD 4X20E 3I1AA 4WNKA 1D0ZA 4LDYA 4ZGEB 3VU3C 3MJXA 2W0GA 1I8FA 3PT9A 1S72T 2H3RA 3EDVA 2BVLA 5HY6A 3R84B 2MTQA 3RRWA 2K24A 3AAIA 4KT0E 2SPCA 3CC7T 3G7ZA 1M1KU 4QXBB 3PURA 4VUBA 3PU8A 4PKCC 1JJ2A 4A53A 3BQIA 4PK6A 5HXRA 2HD0A 1G3WA 4R55A 5KCHA 2Z6EA 4L9IA 4FJOA 4NL2A 1N8RC 5KCOA 3PUQA 2R5AA 5A2QE 3GIBA 4U74A 2X4WA 4F7UG 1X01A 3ZJ2A 3P8BB 4JRKA 3CEYA 2QA4T 4C0GA 3MEUA 5I21A 4BACA 1VUBA 3E9GA 1X75C 1MGQA 4ERRA 2QI2A 3CVRA 1UEBA 4EIWA 3HL6A 3DKMA 3UT1A 5JRCA 5F8PA 4DBQA 5GMKe 4FU6A 4M7DF 4XAXB 4M78F 4GLKA 4PJOF 5JDGA 1M1KC 3CX8B 4OP0A 4JS5A 3ZEFB 5H6RB 3CMAA 2C0SA 5DJQC 4BE2A 2LOPA 2RJCA 4AQFC 3MP8A 5GMKm 4N4HA 5IYZE 3MO8A 3QYHB 3F2EA 3VHLA 3QJYA 1SSFA 2JTFA 1JBMA 2EJGA 1MHNA 2WMOA 2RHXA 2X4XA 4C8QE 2NW8A 3GN5B 1CUNA 3GA8A 4PW8A 4C5EA 4ZGDB 4M78A 4UC4A 1VQLT 3Q2MA 4C92D 3JB9I 2WWUA 3HA4A 3OYHA 3CCLA 4YJ2E 3I55A 3PGGA 4A4EA 2DD5A 3WAJA 5GAOp 4M78B 1VQKA 4PK5A 3P8DA 3HKBE 3JCMc 1HFAA 3UPUA 2KMTA 4OB2B 2DWKA 3OW2S 5LJ3g 4HCBA 5FP3A 3E9FA 4X1IE 1HF8A 5C0MA 2JNGA 3AVSA 2N1GA 3CCMT 2E10A 5JDHA 3O8VA 1BIBA 4CXXA 2O4XA 3OBYA 4L5GA 4BJNA 2YRVA 3L2WA 2UXXB 3J7Yq 5CIUA 2JVVA 4AQGA 1UB4A 3CCJA 1D1AA 2OA5A 4H63H 2NWBA 1VOMA 5GAN5 3SB2A 3CPWS 4J2CA 3GPLA 4P0BA 3KV5A 4H9NC 2WSCE 4HKEA 4MMKA 2QQRA 1LRZA 5CKEA 2Q9QD 3AA0B 3IF8B 5CQXA 4NS5A 3KDSE 4XQ3A 5GAMd 4N0AC 3ME9A 2PBIA 4M75F 3SWNC 4C92F 2LM9A 3V5UA 4AQFA 3JB9H 3ZMZB 3CCUT 3QZ9B 2GCXA 3W15B 2OAUA 2R57A 1H7CA 1WYCA 1OZ3A 3V7SA 1M5Q1 3QZ5B 3MZKB 2QXFA 5CKFA 4AXPA 1WJRA 2NW9A 2XAQB 4DVDA 4AKLA 2ZM2A 3OA6A 1GXIE 1VQ6T 4ZTJA 3OYGA 3X25B 2E65A 3WAKA 1IJ5A 2CXFA 3KV4A 4XTYA 3JCMf 1VQ8A 1FWZA 3CXCS 2DXCA 1VQMA 2HQEA 2LSGA 4OF1A 3KVAA 3PUAA 2K57A 2CM0A 3URGA 2ZLYA 3LW5E 3S4UA 1BR1A 3QDRB 1H641 4IIJE 3LGLA 2PU9B 5L3FB 4CZZB 4CXWA 4J8OA 4JUYA 1I4K1 4C8QD 4A54A 3JCMW 4JRQA 2MOZA 3HKDE 4BDZA 2LC4A 2RD1A 4UXNB 3HP9A 1OZ2A 3CCVT 4XTZA 3NTIA 4KULA 1OYXA 4MDWA 4U72A 4EZHA 2E8IA 3MEVA 2H7VC 3LJCA 3P8CD 3M59A 1KC8U 1X6OA 1YBYA 4V1Av 4J7FA 5A0GA 2P4TA 1I5LA 2V7LA 4XTVA 2OTLT 4EZ4A 4N0AA 2JN0A 4GYSA 2RJDA 3LGFA 2V7JA 2WSFE 2I2LA 4IUVA 2LHNA 3C51A 3OYNA 3PIOA 2EHOB 3HKCE 5J2UE 1BR2A 3N2KE 2CZ6B 2XDDA 2X35A 2EYQA 1Q82U 5M9OA 1YHQA 4EPCA 4EOZB 2E9XB 5HWXA 4FT4A 3R6OA 3FBZA 3T8OA 2LQ8A 1XNIA 3HL8A 2C06A 1ZEEA 3OSSC 5CCAA 3ETUA 3OMCA 4M7AD 3CQXC 3CPFA 2DTOA 4HT8A 4WF2A 3KUFA 4ZS3A 2XKOC 3D0TA 2XICA 1KC8C 3Q9DA 4Z02A 4CI3B 3HHTB 4YHJA 4KUIA 5BMVE 5LBQB 3LWHA 3HRUA 1KNZA 3N9NA 3LYIA 4P0AA 5D6YA 1Q7YU 2IAKA 3GMIA 5EK2A 2KSSA 2VASA 2H7OA 4P09A 2CZ7B 3QSUA 4EAHA 3MP6A 1Q82C 4A4GA 4ILUA 5LJMA 3M5AA 4HT9A 1QP2A 1G8XA 5LXTE 5D6WA 2LE8A 3NRYA 3L09A 2MMPA 5CR2A 4M7DE 3G71A 4PJOE 1IREB 3OS1A 3EFSA 4MBQA 5JDLA 3UUMA 2A7YA 3L2ZA 2WSSV 2VXFA 3CC4A 3J81E 3OS0A 2VB6A 3ANWA 3CBPA 4M77D 2N9DA 1LVKA 1Q86U 4MHCA 1M90U 2JUFA 4XTUA 4PAGA 1NPRA 2A72A 4LDWA 2RK1A 4M7AF 1ZQ1A 3RC8A 3ANWB 2CKKA 5KE3A 4JUVA 3LFMA 5LYJE 1UGRB 4EDUA 5LJ3f 3HSBA 4KBMB 1Q7YC 2Y6XA 2PJQA 4PK4A 3CMAT 4LDVA 2VXEA 2Y4YA 5FRNA 5DLQE 4PNIA 2EQMA 3OYFA 2NW7A 4JEHB 4IE7A 4ISSA 5JDFA 3CMLA 2PUKB 2LT4A 5GAOl 2V7KA 2O01E 5FXXA 5FY1A 2QQ9A 5CKHA 2M9UA 4PJMA 1YJ9A 4O4IE 5IN1A 4UVCB 4ASKA 4BD3A 3KV9A 2QDYB 3ZBDA 3KV6A 3K3NA 2JRKA 4E7IA 2ACXA 1UX5A 3CCLT 3FJPA 3CCRA 3I55T 1Q86C 2Y4XA 3CCEA 2KZ7B 2V7IA 3KXTA 1HS7A 1M90C 4J5YA 1VQKT 2HH7A 3FHNA 2XK0A 2QEXA 4C0DB 1FMWA 3C50A 5L2LA 2MWOA 2XTLA 5LG4A 3LH0A 5CAIA 2GFUA 3I56A 5LJ5d 2HNIA 2E5QA 5JDNA 3X26B 4AKIA 3WI3A 4DMVA 3JCMg 3N2GE 3JC6D 2M0OA 1X79A 4OB0B 4HE8A 2K3XA 3ZN1B 4E47A 3I0OA 4PFPA 1G3YA 4C92E 4M75E 3PIPA 3FB2A 3IEEA 4B9WA 3HFOA 3CCJT 2V1DB 3VUZA 5HAXA 1LOJA 3HKSA 3I9WA 4L59A 3L3PA 4L0RA 1AHJB 3HRSA 4LD9K 5HXCA 2X9YA 2N2NA 3R6NA 2KT9A 5IT9E 3PDYA 4X1YE 4DBRA 2QQAA 4IUQA 4O8SA 4JRIA 5KH6A 3UTKA 4E7JA 2DD4A 2VYTA 2ZMAA 3RKWA 5FLXE 2HQXA 3C4XA 3BDLA 4JRPA 3VYHB 2YLCA 4M78D 4PJOD 2KY9A 1LNXA 4BE0A 2CXDA 2VC8A 1K9MU 5FRMA 3QXEB 2WSEE 5AFUL 2B1EA 2YINA 4BI4A 5CK9A 2RA1A 3EAEA 3OYMA 4OFZA 3LK2B 1VQ8T 1VQMT 4ADZA 2H3JA 1U4QA 5CKBA 3B57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAX B;  4MFR A;  4KBM B;  4L5G A;  2LT1 A;  4ILU A;  2LT3 A;  4KMC A;  2LT4 A;  2EYQ A;  2LQK A; 
#chains in the Genus database with same CATH topology
 2O31 A;  3CQG B;  1RAG B;  3A8H B;  1Q86 R;  4FL6 A;  4XZC A;  2FZG B;  4Y91 A;  4FSX A;  2V5C A;  1M90 R;  2VVN A;  1YN8 A;  2XDP A;  2YUO A;  3B13 A;  1XWM A;  2PUO B;  1K73 U;  1R0C B;  5CJ5 A;  2LX9 A;  1MIW A;  2LSK A;  5C3J A;  2RQR A;  1YJN Q;  2ENM A;  1EIF A;  2NUT A;  2J47 A;  4J7I A;  2J6F A;  3PV0 F;  5J0Z A;  5J1G A;  3DLM A;  3BQL A;  3M55 A;  1XOV A;  1OI1 A;  4NUV A;  2RH2 A;  2Y90 A;  1D0X A;  4U31 A;  5KDM C;  1PSF A;  1SRM A;  3PUS A;  4JI7 T;  3C4S A;  4RCC A;  9ATC B;  3P4P A;  2XSB A;  2K48 A;  1VQP A;  1TXQ A;  2K79 A;  2F5K A;  2K5L A;  2NUT B;  2L2P A;  4DR4 T;  3OW2 A;  5AQF B;  4A5X A;  5FU7 C;  2BDE A;  2MCN A;  2JMC A;  3DJB A;  2IVW A;  3ZCI A;  1Y71 A;  2LHR A;  3PJA A;  3S6W A;  4XTX A;  2A36 A;  2W63 A;  1VQ6 Q;  2YEV C;  3J9X 1;  1G3T A;  2CYZ B;  3PU3 A;  4FW1 A;  4I4T E;  3RIU C;  5J3B A;  4XU2 A;  2C5I T;  3KBT A;  4KI0 F;  2LCC A;  1BB9 A;  3V7C A;  2LMJ A;  5LGT B;  3OYD A;  2F2X A;  1YQ4 A;  5JRC B;  4ZTF A;  3WVE B;  1M62 A;  2W0Z A;  1MMA A;  3FXD B;  4UF0 A;  1FJG T;  1PSE A;  3PTR B;  4X1K E;  4EYU A;  2VWA A;  2EKO A;  1UUR A;  3CPW A;  5LOV E;  4DOV A;  4EGW A;  1BR4 A;  3QO3 A;  1QLB A;  1K73 C;  2R58 A;  3U23 A;  2RA2 A;  3RES A;  2BBH A;  1QVG A;  2DPP B;  4TWH A;  3P7I A;  5LJ5 h;  4UF0 B;  1PRL C;  3NHN A;  4P5N A;  3SS1 A;  2DZ9 A;  5KYW A;  4XU1 A;  2LP5 A;  2P0P A;  4H9P C;  3V5S A;  1BKB A;  2A3L A;  4M75 D;  3QPH A;  4IE5 A;  3ONL C;  4HFI A;  4B3M T;  1OEB A;  1LVF A;  3ONX A;  5LBM A;  4QKU A;  4RG2 A;  1W2B A;  2B76 A;  2E6Z A;  1JJ2 S;  5KYW B;  3QG1 A;  4ZI2 D;  1YD8 G;  2RHU A;  3BDU A;  2NOX A;  5HKC A;  4DND A;  1LJO A;  3SD4 A;  3CCV Q;  4IIM A;  3AEB A;  2XQY A;  2MI6 A;  2QGS A;  2P0Q A;  4JDS A;  2DXB A;  1VQO A;  3HKE E;  2CBJ A;  2ROL A;  3C95 A;  2WB5 A;  4HN9 A;  4TZ4 C;  2RO0 A;  2LQN A;  4J6W A;  3N5B B;  2LNH B;  3M65 A;  4UEM A;  2CXL A;  3AE9 A;  3CIR A;  3NBX X;  2UXC T;  5GAO q;  2KIN B;  3JCM d;  4OGE A;  2KSR A;  1WHM A;  4IDO A;  5FMN A;  2RQV A;  3FLG A;  1KEY A;  4XU0 A;  2XHE B;  2E3I A;  3JB9 F;  2NTY A;  5HK3 A;  3RIF A;  3NMZ C;  2ACZ A;  1V76 A;  4JEU B;  2UXD T;  2BZY A;  4Y28 E;  4CI2 B;  5FWC A;  4WBO A;  1NYG A;  4DEY A;  1YKH B;  1QVF P;  5EK4 A;  4HFV A;  2XQ9 A;  2EFI A;  3CXC A;  2DL5 A;  3C4W A;  4RTU A;  2HKN A;  2L9Q A;  1UK5 A;  3HFN A;  3WVD B;  2OTL Q;  1GBQ A;  3SDZ A;  2NUP A;  4C8Q G;  2BKP A;  1X27 A;  1UGQ B;  4LF5 T;  3PUG A;  3KBU A;  3OKQ A;  1FMV A;  4QW2 A;  1VYV A;  3UU3 A;  3ETV A;  2LRK A;  3CD6 A;  3N9M A;  2O4X B;  3LBX A;  4LNP A;  5DAB A;  3JCM e;  3PNW C;  2CLY C;  1K9M R;  3L2V A;  2NUP B;  2KDS A;  1VIF A;  2LJL A;  2DL3 A;  1US7 B;  1W70 A;  2WDV A;  4H9S E;  5KYY A;  1VRB A;  3OYI A;  4B6X A;  1IB8 A;  3ONJ A;  2EHO D;  2YU1 A;  3RIU A;  5GAN g;  4M7A E;  3U78 A;  5L23 A;  3LX7 A;  4CC7 A;  5A0L A;  2VQF T;  1NYF A;  5GAO m;  5FU7 B;  2JQ9 A;  3G71 T;  4CI0 C;  4GYR A;  3MKD A;  3J80 E;  3UWN A;  5FXW A;  1PRM C;  2M16 A;  2JQK A;  4PJJ A;  1XNR T;  2E9X D;  5LHI B;  5KYY B;  3CME A;  2XAJ B;  1N32 T;  3CC4 T;  5CKD A;  4YLH A;  3NRX A;  5AQL B;  3T1Y T;  3EUH A;  2OAW A;  4GLM A;  4RG8 A;  5EK3 A;  4DV3 T;  4HWC A;  4J9C A;  4ME7 A;  2DVE A;  3FBL A;  2Q9Q C;  2X3X D;  4CC2 A;  2IHR 1;  2F69 A;  5GMK h;  1T98 A;  4J6Y A;  4E2F B;  3H3M A;  1K73 R;  4X9D A;  5HXH A;  3TQ7 P;  2CRB A;  4D6W A;  1WGS A;  2CMR A;  4JI8 T;  3OPC A;  2XUE A;  5FY0 A;  2CT3 A;  2RJE A;  2G3R A;  1H3Z A;  4AKG A;  4LFB T;  2M67 A;  2UXB T;  5LHG B;  2KRM A;  3J7A F;  1QCO A;  3CPZ A;  4BY6 C;  4ILB A;  2LEH A;  4TV8 E;  2HPL A;  4G2A A;  3VRA A;  4GBQ A;  2HHH T;  2RHZ A;  3N9L A;  4DR1 T;  2DLP A;  1LPL A;  1D1B A;  3Q5X A;  3C98 B;  1T0J A;  4LFA T;  2GQI A;  1HK9 A;  1OXZ A;  4AIS A;  2DA9 A;  5FY7 A;  1D3B A;  5LP6 E;  2GK9 A;  1KQS P;  3FIF A;  5KX5 E;  1BCO A;  2Z0W A;  3BFM A;  4BB7 A;  1YJ9 T;  3INZ A;  4M77 E;  1Q95 G;  2BS4 A;  3ZFJ A;  1IAP A;  4F7U F;  2WZI A;  5CQY A;  1OOT A;  1M1G A;  2LNV A;  1D3B B;  4UVB B;  5HWY A;  3CWZ B;  4OK0 A;  3JCM X;  3CCR T;  2WQY A;  4E7K A;  5AYF A;  4YTN A;  2EGA A;  1NWM X;  1BI3 A;  1PNJ A;  3FEO A;  3ZCJ A;  3FB9 A;  1YI2 A;  2COZ A;  3ZLI A;  4X65 T;  2QEX T;  1YJW Q;  3RLF F;  4CXY A;  1UEC A;  5IHN A;  5HK0 A;  2A3D A;  2DRK A;  2KK4 A;  2ZPB B;  3X24 B;  2NYS A;  5AQQ B;  2NP9 A;  2KAF A;  1W0A A;  3ZMT B;  4JI3 T;  2DKG A;  2ZZD A;  2JMK A;  3NGP A;  5FNV E;  3H3A A;  4GK5 E;  2EKH A;  2KYM A;  4FYX B;  1EZ3 A;  4F7U A;  4JBW F;  2CS7 A;  2DAQ A;  3ABV A;  3I56 T;  3S3O A;  2M6B A;  2YKS A;  3AAA B;  4C8Q C;  1ZBX A;  2YU2 A;  5AQO B;  3ESL A;  3SFD A;  2BS2 A;  2QRX A;  1W0B A;  3S3N A;  1Z9Q A;  1WR6 A;  2M0Y A;  2XM1 A;  4NXM T;  1SRL A;  3SWN A;  5JDM A;  2AK5 A;  5GAM f;  4F7U B;  4PFO A;  1YIT Q;  2KRS A;  1OV3 A;  4XK8 E;  4LFC T;  4MZM A;  3P4S A;  2K9A A;  1Q81 U;  3EHR A;  3AB3 B;  2L3L A;  3NPF A;  1WXB A;  3JCM h;  3ZJ1 A;  1SF9 A;  5FRO A;  1AWO A;  3FZK B;  4QH4 A;  4LMK A;  2IDO B;  1OWA A;  1X6B A;  3C4Z A;  4FI5 A;  1DU2 A;  2FYK A;  4I50 E;  3PMI A;  2Q9Q A;  5IUX A;  3BY7 A;  3SWN B;  4AFQ C;  1ZV4 X;  1WHH A;  3EFO A;  4LD6 A;  4JI5 T;  1OX9 A;  3JRZ A;  4EMK C;  4KUD K;  3FZM B;  2A2F X;  2EJF A;  3OB9 A;  3M4G A;  1DJ7 B;  2J05 A;  1VYU A;  3I55 Q;  2FPF A;  4WW0 A;  3EVY A;  3G6E A;  5LA6 E;  1B34 A;  1CHU A;  3OSV A;  1QVF S;  4N4G A;  2K5F A;  1CKB A;  4IL9 A;  1VQK Q;  4LF6 T;  4DR6 T;  2G0U A;  1SPK A;  4C0F A;  3RYI E;  3M9Q A;  2E2A A;  5D7U A;  1J1J A;  5LJ3 d;  4FCY A;  2IC9 A;  3CCS A;  2HEQ A;  5JQG E;  3EGU A;  1SHG A;  2L5Q A;  2JS0 A;  3MET A;  1WQW A;  5DQV A;  3LDQ B;  4B6M A;  2QQS A;  2WAC A;  1MNE A;  4OB3 B;  4PNO A;  1Y64 B;  1LCK A;  2ZM6 T;  1BIA A;  4EXT A;  2JT4 A;  1QSD A;  2LSY A;  2CCQ A;  2JMA A;  1UX4 A;  5I2M A;  4J9B A;  5AQK B;  3RR6 A;  2LQK A;  3RHW A;  2ODU A;  4LN2 A;  3L2U A;  2JTM A;  4E7H A;  2ZM8 A;  2CUB A;  2VL0 A;  5GAM j;  5AQR B;  2K3Y A;  1BI2 A;  1Q81 C;  3M0S A;  2KLQ A;  1UJY A;  4JI0 T;  2V8K A;  4Z91 A;  2DTH A;  3KFW X;  2RHY A;  1BCM A;  1GFC A;  5I2S A;  5LJ3 e;  1OPK A;  1BR0 A;  4HWH A;  4DMW A;  5GMK i;  4JS4 A;  1KD1 U;  3O1J A;  2KRO A;  1HG2 A;  1VQ7 A;  4JPB W;  1YIJ A;  1AZG B;  2X4J A;  1AD5 A;  1UJ0 A;  2X9X A;  2XDB A;  1RAD B;  1FX7 A;  3OYA A;  4ZZC A;  1RL2 A;  3RC3 A;  2RK2 A;  1RI0 A;  2L8K A;  1D1C A;  2HQH A;  2BG9 E;  3AXJ A;  4WYV A;  4M78 E;  2MYS A;  1PKS A;  1KNR A;  1IZN B;  3QHS A;  4C8Q A;  2HSP A;  1GBR A;  2XD0 A;  5J2T E;  4CQI A;  2FB7 A;  3QB5 A;  1YWO A;  4NOY A;  4OMO A;  1VQP T;  1WZO A;  4JLE A;  3EFR A;  2LCS A;  3AXJ B;  1RLP C;  2E6N A;  2GTJ A;  4FYY B;  3TEE A;  4EEB A;  1YJN A;  3IBP A;  4XTW A;  3ZT6 A;  2AE9 A;  3VYG A;  3ZMS B;  5JR9 C;  1M1F A;  2HL5 C;  5LL6 S;  4PJL A;  4TX5 A;  2PFV A;  1KQS S;  1XMO T;  4C5I A;  2L8D A;  1T8B A;  1UCU A;  2DL7 A;  4JLG A;  4G63 A;  2F1L A;  2K2M A;  1M9S A;  3PVQ A;  1A0N B;  4U2Z A;  2X0H A;  4QX7 B;  3CC7 Q;  5LGU B;  1S35 A;  2ZCF B;  3M53 A;  4U2Y A;  2M1H A;  3NKZ A;  3F31 A;  3NZP A;  1JQQ A;  1KD1 C;  1VQM Q;  4EYY R;  2ZPI B;  3IHR A;  2BVM A;  1YQ3 A;  5FXV A;  2DJZ A;  2P0K A;  2Y48 B;  3MXZ A;  1IHW A;  4HXJ A;  5A1L A;  1WJS A;  4JI6 T;  1AWJ A;  2VUB A;  3EGX B;  3OBW A;  1NJI U;  1WFD A;  4OX9 T;  4E7L A;  2F4V T;  2XMF A;  1FMK A;  1UGP B;  2J6O A;  3RIR A;  2XAF B;  2WY2 A;  2WZH A;  1SE7 A;  4DEX A;  1QW1 A;  5CGM A;  4M7D G;  2P9B A;  1G3S A;  5AQV B;  4M78 G;  2ODV A;  2KND A;  4PJO G;  3U3I A;  5HXE A;  1WXT A;  4MAL A;  4X64 T;  2K5I A;  3ZMU B;  1WJQ A;  1AJ3 A;  4O4H E;  1GRI A;  4AKH A;  3AEG A;  3EG9 B;  3ER0 A;  3A8M B;  3MCA B;  1KHC A;  3AEA A;  3SOL A;  4IT4 A;  2GFA A;  1VQN A;  5LNK A;  2CP5 A;  1Z0P A;  3ZST A;  5GAN 2;  4N4I A;  3GOX A;  4NUU A;  2CRE A;  2VK9 A;  2D8J A;  4ZGJ B;  3RKY A;  2LSJ A;  3RMQ A;  4OMM A;  1X2K A;  3RQW A;  3ZMV B;  4WZX A;  4EMG A;  3C12 A;  5GAN f;  1YWP A;  3TRE A;  3NWI A;  3ZN0 B;  3MP1 A;  3QB5 K;  2DWG A;  2LKG A;  3Q5E A;  2MWP A;  2PTF A;  3RMS A;  1PG5 B;  2DCF A;  3UAT A;  2BS3 A;  2D2S A;  1HTJ F;  4UV9 B;  3LK4 2;  4UVA B;  3ZYL A;  1VQO T;  3SFE A;  2QAZ A;  2JQH A;  2CP3 A;  1G5V A;  2CZ1 B;  1VYT A;  4J9I A;  3LWI A;  2KQW A;  3LK3 B;  2PTK A;  3VKI A;  1VQ9 A;  2D6F A;  4OVA A;  3CBO A;  1G73 A;  2YOE A;  1J5W A;  4IST A;  2JMH A;  1I0C A;  4F6R C;  3RX6 A;  1M3C A;  2H88 A;  4WCI A;  2YLB A;  5H6Q B;  3A8Y C;  4OGC A;  3BE3 A;  3QOF A;  4JJC A;  3VJP A;  2CBI A;  3F57 A;  1QVP A;  4YFS A;  1NJI C;  2C5K T;  1I07 A;  5LJ3 h;  3I5R A;  2YUQ A;  1K8A U;  3QNU A;  3RRC A;  1Y57 A;  1GCQ C;  2KWH A;  2K5B B;  2CPT A;  3UFE A;  4ZI3 D;  3O1H A;  4YSZ A;  4MDX A;  2EQU A;  3OY9 A;  3M56 A;  2DX1 A;  4X9C A;  3CD6 T;  2E1H A;  3MA9 A;  2GTO A;  2RJF A;  3JAM E;  4YTP A;  3FC3 A;  5GAO n;  4ZS2 A;  5JR9 A;  3AVR A;  2FRW A;  4ZN1 A;  5IAY A;  4DA4 A;  4YT0 A;  1PM3 A;  5ETW A;  3JC6 C;  4B3R T;  1VQL Q;  1R77 A;  2OTJ A;  3C0C A;  5AQN B;  2ZM0 A;  2ED1 A;  1K1Z A;  2K2V A;  5GAN j;  4AI6 A;  4J6X A;  4QH1 A;  5GON E;  5L3D B;  2H8H A;  3FRN A;  4YJ3 E;  5HCM A;  4L6V 5;  4JLI A;  4YSX A;  3A7M A;  2RP4 A;  1BYM A;  2H89 A;  3CME T;  4LF9 T;  4C0Z A;  1KQ1 A;  4QHO A;  3PMT A;  3IA3 A;  2CSI A;  3M58 A;  2D5U A;  4K0U A;  4HFD A;  4B9X A;  4EV6 A;  1VQ4 A;  2ZGW A;  3AHU A;  3TLW A;  4JJB A;  3GF5 A;  2D0U A;  1PCX A;  2PVO B;  3C94 A;  2QTX A;  1ACM B;  2EQK A;  1IGU A;  2A28 A;  5J39 A;  3UU4 A;  4J9H A;  1NZ9 A;  1MMG A;  2LDM A;  2FJE A;  4IUU A;  2K3B A;  1TU0 B;  2DL8 A;  2AKK A;  4OYK A;  4IHJ E;  2I0M A;  4DO0 A;  4M75 G;  4C92 G;  3I9Q A;  5FYM A;  5GAM g;  1X9B A;  1K8A C;  4UIG A;  2ES0 A;  3AEC A;  3I0Q A;  2KRN A;  2RF0 A;  3JV3 A;  3RDV A;  3CQC B;  3OS2 A;  5CVI A;  2VVS A;  3QC9 A;  2MOX A;  3NTH A;  1WLP B;  5GAN 7;  4M7D C;  5HCJ A;  4M78 C;  4PJO C;  1M2O A;  3SRZ A;  1JEG A;  1ZSG A;  5L8R E;  4HKA A;  1IBL T;  3KIN B;  3L2R A;  1VIE A;  3UU5 A;  3VKH A;  1I94 T;  4M1P A;  4LML A;  5FW9 A;  3RYF E;  2VL8 A;  1UGV A;  2PVG B;  1KG1 A;  2DHR A;  4KH0 B;  3RUX A;  1AOJ A;  1UUE A;  3TVT A;  1VA7 A;  5DM7 R;  2FZK B;  3OYY A;  3I35 A;  4Z89 A;  5LJ5 f;  3G71 Q;  1FYN A;  2H3E B;  3ZSS A;  4IKF A;  1PKT A;  3GP8 A;  2X67 A;  2CGH A;  1SKU B;  2EYX A;  2L3R A;  2DIG A;  1H3H A;  2NLU A;  3ZYM A;  2K9G A;  3CCU Q;  3NFC A;  3PUW F;  1BU1 A;  4U7Y A;  3PE0 A;  3VS0 A;  1LKX A;  2PQW A;  1N33 T;  1K9M C;  1NJI R;  1GCQ A;  1YI2 T;  3MHX A;  3N5L A;  1S94 A;  1ZA1 B;  4DBF A;  3RPU A;  1ABQ A;  2K3W A;  3JB9 D;  4HVW A;  4N78 D;  2QK0 A;  4J9F A;  4BA9 A;  5ABF A;  1R0B G;  4FT2 A;  3RKO A;  1RLQ C;  3CC2 A;  5HYA A;  1ZHC A;  1KK7 A;  3N9O A;  3EG1 A;  2RI2 A;  2JPF A;  3RKX A;  1AVZ C;  3SWH A;  1WXU A;  3E08 A;  1VQ5 A;  3AA6 B;  2IC6 A;  2FJB A;  5ADX L;  1ZLM A;  4P1N A;  1YJW A;  1SEM A;  5LCY A;  4IIO A;  2XID A;  4LUD A;  5AQP B;  2V7M A;  1M8V A;  1CSK A;  2X0L B;  3UUX B;  5L3C B;  4KX6 A;  2JQQ A;  2BE7 D;  2J62 A;  2XG8 D;  5GJW B;  5KYX A;  3I9Y A;  1ZUK A;  2XQ3 A;  2BTT A;  4MLK A;  3UT5 E;  2VQE T;  2D0T A;  2ZPG B;  5CFB A;  3RYC E;  2YWW A;  2DVJ A;  2FEI A;  3H0H A;  3BQK A;  1NAF A;  5FL0 A;  3EH1 A;  2I59 A;  5CB4 E;  5LJ5 j;  1U06 A;  3MEW A;  1I1J A;  4JYA T;  3JSC A;  5KYX B;  4MML A;  1YHQ T;  2DO3 A;  3GN5 A;  1WR0 A;  2L89 A;  3OYB A;  3C64 A;  3DB4 A;  1YIT A;  3L39 A;  2PZ1 A;  3AT1 B;  3K8P C;  4F04 B;  3CCR Q;  2C0T A;  2JIW A;  5L3E B;  1V29 B;  2W67 A;  2EIF A;  5JH7 E;  5AQJ B;  3G6E T;  5TAO A;  1TOV A;  3OYE A;  2DZC A;  1K8A R;  3JCM P;  4PL6 A;  3A8O B;  2LT3 A;  1WYX A;  4DOW A;  3VUB A;  1TH7 A;  2J06 A;  4M7D A;  1JRI A;  2QEX Q;  4PJO A;  2CA5 A;  3CCS T;  2D8H A;  3K3O A;  3PFS A;  2LM2 A;  4ZNX A;  2EW3 A;  4ESR A;  1N36 T;  2NUZ A;  1XZY A;  2D0Q B;  1HG5 A;  4JZ3 A;  5D6X A;  2YRD A;  4C92 C;  4PLI A;  4M75 C;  4QVD A;  4LDX A;  4HFB A;  4A97 A;  4BJM A;  4H9O C;  5HEH A;  1JB0 E;  3I56 Q;  4M7D B;  5FU6 C;  4PJO B;  3H9N A;  2FRY A;  1OED E;  4QXC B;  3AE5 A;  2BKD N;  1QMC A;  3RQU A;  3CCQ A;  4HEA A;  4ZI2 C;  4QQ6 A;  4JI1 T;  1U8R A;  3A8G B;  1X43 A;  3PUX F;  2JZ2 A;  2WWV A;  4GIW A;  2VKJ A;  1NPP A;  3JAD A;  5E0O A;  2XHC A;  5ABH A;  5IXF A;  2V1R A;  3NTK A;  2DNX A;  5L3G B;  3LLR A;  2DXU A;  2XY8 B;  3CX6 B;  5LGN B;  2KBT A;  4C5H A;  3LG7 A;  3FZL B;  1I81 A;  1WYB A;  2R5M A;  1W1F A;  2AZV A;  2BUD A;  2YUP A;  3TCJ A;  1GL5 A;  2X68 A;  4GOU A;  5M4Y A;  2ZAE A;  5GAN 4;  1VQ7 T;  1WA7 A;  4C5G A;  3MPU B;  1YIJ T;  4HWI B;  2DEQ A;  4HFE A;  1XTD A;  2ZPE B;  4AFU C;  2DL1 A;  2MAM A;  3OBV E;  1E1H B;  1N6A A;  4QX8 B;  2LRL A;  3E0Z A;  3HI2 A;  3X28 B;  1JO8 A;  4RKU E;  5KE2 A;  3LBX B;  3UDC A;  4O4J E;  2KWI B;  4BI8 B;  3G4S A;  4KUM B;  3E1S A;  3OQ5 A;  2JJ9 A;  2X4Y A;  2HPJ A;  3A5X A;  3H37 A;  4IDZ A;  1O9S A;  3M57 A;  3THK A;  1NEN A;  1T3S A;  2QQB A;  1WRD A;  3RH3 A;  2CWY A;  1UGS B;  2CUD A;  3OYX A;  2M51 A;  3CKD A;  2WDQ A;  4O6J A;  1QVG S;  2R6G F;  1PWT A;  2JS2 A;  1YJN T;  3OYZ A;  4M4Z A;  1NE8 A;  1SA0 E;  3KBG A;  3N9Q A;  4E7S A;  4XBF B;  4OHF A;  1V9D A;  1UHF A;  3UFG A;  3HPW A;  1WPY A;  2EHO C;  2IW5 B;  3O5Z A;  5J26 A;  2FBW A;  4KP3 C;  1WCR A;  4ZHQ E;  1M2V A;  4CRI A;  5GMK j;  4KGZ B;  4BUG A;  5IHY A;  1SHZ C;  1W2B S;  1N9S A;  1H92 A;  1NM7 A;  5AQH B;  1KFY A;  1NLP C;  2E12 A;  4DR3 T;  4QVZ A;  2E9X C;  2BKO A;  2DLR A;  1XQH A;  3JCM b;  2RHI A;  4J83 A;  1RAH B;  4QH5 A;  1O75 A;  1AT1 B;  2VVK A;  2VKO A;  2DTI A;  2LLY A;  1M2V B;  3OMG A;  1VCS A;  3E19 A;  3RBB B;  4AMC A;  1S72 A;  3TLV A;  4ELZ C;  3GWH A;  1K0X A;  1ZOY A;  4CN4 A;  2FL7 A;  4HCC A;  2V8I A;  4M7A G;  3MK7 C;  5FVL A;  3X20 B;  4A4H A;  2VV5 A;  3TKL B;  2KR3 A;  3CC7 A;  5C6S A;  5HCK A;  5GAM e;  5JDQ A;  5JRE A;  1KHI A;  2X0Y A;  1D0Y A;  3H0F A;  2VGN A;  4M75 A;  4C92 A;  2LZ6 B;  4O2B E;  4HTE A;  3OYJ A;  2X9W A;  2EQJ A;  3EG0 A;  1T72 A;  1VQN T;  1WIE A;  2HBW A;  2WAU A;  4KGV B;  3QKJ A;  4DQ2 A;  1QVF A;  1E7P A;  3E22 E;  3QBY A;  3BK9 A;  5KMG P;  4I0U A;  5HXS A;  4O4L E;  3UQ7 A;  2QYZ A;  1OU9 A;  3CK6 A;  4NPP A;  1HCI A;  1IZ6 A;  4C92 B;  3VKG A;  4M75 B;  1VQP Q;  3L2Q A;  2J1D G;  2ZPH B;  4IE4 A;  2RQW A;  3OS5 A;  3CCE T;  3FDR A;  3EDU A;  2XZE A;  3AE6 A;  2WBL A;  3O1I A;  5ABE A;  5FU6 B;  3JCF A;  3V8J A;  2P4R A;  4BI3 A;  1PD1 A;  4ZZB A;  2F2V A;  5JVD E;  3AE7 A;  5FWB A;  2YXY A;  1VQ9 T;  2K4Y A;  2QA4 A;  4RTT A;  2NR4 A;  3DB3 A;  5GAO r;  1HJD A;  2LSI A;  3HRT A;  2XQ4 A;  2ATC B;  3OYC A;  4EB6 E;  3REB B;  2W61 A;  2XM2 A;  4A4F A;  4O2A E;  5GAN 6;  1D09 B;  4LF4 T;  4TVR A;  3CMA Q;  7AT1 B;  3T9N A;  4BDY A;  2XQ6 A;  4Z8A A;  2E41 A;  2CLY B;  1JXO A;  1N27 A;  1H8K A;  2AHJ B;  3SHW A;  2C5J A;  2CP7 A;  5AQU B;  1YNZ A;  4RMO A;  4O5V A;  4NL3 A;  2W00 A;  2FVU A;  4WBN E;  3A5Z B;  4M77 G;  4HFH A;  1NEG A;  2RPA A;  4JV5 T;  1U5S A;  3EG2 A;  2MBG A;  1I6Z A;  1BBZ A;  5EZY E;  3LH5 A;  3QUI A;  4F14 A;  1QKX A;  3AE3 A;  2BZ8 A;  2X66 A;  3RYH E;  4KHZ F;  4C90 A;  5DY9 A;  4I55 E;  1UGO A;  5LJ5 g;  4QXH B;  5IHI A;  1C1A A;  2EHO A;  4H63 V;  2LTO A;  5IWA T;  2QTV A;  3RER A;  1KJW A;  1IXD A;  2YRC A;  2KVQ G;  2OTJ T;  3O9X A;  1HYO A;  2RM4 A;  1QQJ A;  2F2W A;  4GY5 A;  3CCL Q;  3VU7 H;  3F70 A;  2DET A;  3GNG A;  2E9X A;  2A08 A;  4PLL A;  2Q9Q B;  4ZI7 E;  4OMQ A;  2DK3 A;  3CBM A;  1AEY A;  3EFO B;  1KNP A;  1U1S A;  1RAB B;  2XAH B;  4PJN A;  1OED C;  5EG2 A;  3V8L A;  1HR0 T;  2RI3 A;  3KFV A;  3Q5W A;  2KXP B;  1QUU A;  3QII A;  5IXB A;  3RNJ A;  2DJQ A;  3QYG B;  1VQL A;  1VQ4 T;  2DBK A;  3MEA A;  3JAE A;  1B34 B;  3P50 A;  5IHK A;  4BY6 B;  1KQS A;  4V2S A;  4PFZ A;  3M4Y A;  4EMH A;  2RI5 A;  4UEL A;  5FVK A;  2GQV A;  1U5P A;  3M0Q A;  4H9Q C;  5C8Y E;  3UU6 A;  2YK0 A;  2HZY A;  3ZEH A;  1MMD A;  2QGG A;  4MFR A;  1RAA B;  3ZKR A;  1PC0 A;  4Q5W A;  5JTG A;  4U3C A;  4C8Q F;  3AEE A;  4QVC A;  2XQ8 A;  5LHH B;  4I43 B;  4C91 A;  5GMK l;  4A98 A;  5L3B B;  2QA7 A;  3UQ4 A;  4M7A C;  3O4X E;  3L1A A;  4HA8 A;  2DMO A;  3CCJ Q;  3Q1J A;  2DI4 A;  2XAS B;  1ABO A;  3JCM V;  1R8O B;  3TSZ A;  3CCM A;  2CWO A;  4BE1 A;  3AE4 A;  1KF6 A;  5GAM h;  4C0D C;  2W4X A;  5GAN d;  3SFM A;  4HCK A;  2LX7 A;  5AQS B;  4MZP A;  1ZHI A;  2XI9 A;  1P92 A;  3RI5 A;  2L3S A;  4ZXL A;  1T3L A;  2L3P A;  1VCT A;  4IDQ A;  4TV9 E;  2PVD B;  4QQD A;  5L47 A;  2YSQ A;  1C6V X;  5DQW A;  2BZB A;  3QWY A;  3OVU A;  2XU8 A;  1X2Q A;  2EYY A;  4F8H A;  1HNZ T;  2E3H A;  1QKW A;  2VUR A;  4ZEY A;  1HX8 A;  3OYL A;  4C8Q B;  1E6H A;  2IG0 A;  1B7T A;  1K0S A;  5GAN e;  4E7Z A;  4YTM A;  3DTO A;  4RCB A;  4IGU A;  2AZS A;  3JCM Q;  1KFZ A;  5DLO A;  1MIV A;  1E2A A;  1Y96 A;  2MPX C;  4D8K A;  3M0T A;  3P8H A;  3K3Q C;  4A4K A;  3CCU A;  3P4R A;  3DLL A;  1Y7X A;  3CC2 T;  2V6X A;  2DFU A;  2FJD A;  3QK6 A;  2HMA A;  4EMK A;  5F3J A;  3BW1 A;  2FHD A;  2A9U A;  4IE0 A;  4Y92 A;  2WDR A;  1VQ5 T;  2WS3 A;  2EAY A;  4F17 A;  4OYJ A;  3EI0 A;  3A1P A;  4LDU A;  4M77 C;  3PUZ F;  4YY3 T;  1YJW T;  1V1C A;  1VQ8 Q;  3UUL A;  3Q5D A;  1Y96 B;  3QJ6 A;  2LRQ A;  2BIV A;  2CEA A;  4FM4 B;  1OED A;  2UXN B;  2HDA A;  5CA0 E;  1VQ6 A;  2FO0 A;  2HAX A;  3GNF B;  4EMK B;  3TLS A;  2YHT A;  1MND A;  2EJ9 A;  4IUP A;  3S3M A;  2DIQ A;  3A8L B;  2V26 A;  4X34 A;  3UUN A;  2EQI A;  3H6Z A;  4FSS A;  2MF2 A;  4OB1 B;  1YW0 A;  2COY A;  3MAC A;  2B8A A;  2IIM A;  3VV0 A;  1U1T A;  2RB6 A;  3JB9 J;  4FW2 A;  4HVU A;  1FXX A;  1AZE A;  4HGA A;  2LT1 A;  1IBK T;  4CC4 B;  1YIT T;  5L4H A;  2OV9 A;  4ANJ A;  5A0D A;  4MZT A;  3WXM B;  3B5M A;  4IRE A;  1RAI B;  2CZ0 B;  3M54 A;  2AIR B;  4ELY C;  2IIU A;  2X9H A;  2HBP A;  2JOY A;  4HVV A;  2WMN A;  1HXD A;  3RF1 A;  2D1X A;  4QWN B;  1BI1 A;  4M7A A;  2XAG B;  1M4Z A;  1QCN A;  2LCL A;  2DER A;  4R0K A;  4JJN K;  5FL1 A;  3FXE B;  3N9P A;  4IE6 A;  3ZC0 A;  2DYI A;  4QQG A;  5ABG A;  2DXT A;  1UUS A;  1WLX A;  3QWX X;  4A56 A;  3ZT5 A;  3OJA A;  1E7O A;  2HN2 A;  3N2O A;  4JI4 T;  4XU3 A;  3JCM J;  2CE7 A;  3H0I A;  5CO7 A;  4YHH T;  3V8K A;  4ORZ A;  4ATO A;  2LVM A;  2VGM A;  3DP7 A;  4M7A B;  4UV8 B;  2E64 A;  1KQ2 A;  3EHZ A;  1IJ6 A;  2PG8 A;  2YDS A;  3NZQ A;  2KYB A;  3EG3 A;  2Y8D A;  5GAN 3;  2ZPF B;  3CCV A;  1TUC A;  1Y07 A;  5LJN A;  4TNV A;  1UFF A;  3CCQ T;  2VKD A;  1O3X A;  2DRM A;  4FIB A;  2FPE A;  5FXZ A;  4LF7 T;  3I5S A;  4M77 F;  3ZPO A;  1JNZ A;  4Z8X A;  3QUJ A;  3ZYK A;  2W62 A;  4K0K T;  3V7R A;  5LJ3 j;  2KT8 A;  4KMC A;  3AA7 B;  3P4W A;  3L42 A;  3VRY A;  2E70 A;  1XNQ T;  1YKE B;  2GF7 A;  1M3B A;  1ZKE A;  4TUY E;  2EBP A;  3H8Z A;  5GAN 8;  1QP3 A;  1MIY A;  3JB9 G;  3EGD A;  2KMF A;  1MMN A;  2OTL A;  3PTA A;  2VWF A;  1YHQ Q;  2LOS A;  4EIK A;  3TU4 K;  1WHJ A;  4DV4 T;  4AKR B;  1FIO A;  1HNW T;  2XPK A;  4RUG A;  1WQ7 A;  1W4S A;  4OMP A;  5HEU A;  1BI0 A;  3OW2 P;  1W6X A;  1W9R A;  3ZC1 A;  3EGD B;  3KVB A;  3G4S T;  5JR9 B;  3G6E Q;  4QKN A;  4GK0 E;  2XQ5 A;  4IUR A;  2VKH A;  4ZI3 C;  3UU8 A;  2D9T A;  2MK5 A;  4M77 A;  4ZOL E;  5HEJ A;  1N9R A;  2V8J A;  4TN7 B;  2X51 A;  5LJ5 e;  3AA1 B;  2DBM A;  3CCS Q;  5GAN h;  5LMU T;  5HEO A;  1G83 A;  2KE9 A;  4ZN3 A;  1ZP0 A;  1FEW A;  3GLX A;  1WNL A;  4YTL A;  4M77 B;  1XDP A;  4X5T A;  1N8R U;  4II1 A;  1YCY A;  4H9R C;  2WM9 A;  3AAE B;  4B3T T;  1G2B A;  2A37 A;  1NEK A;  2F5T X;  4HCZ A;  1BK2 A;  3HR0 A;  4BAY B;  2UUB T;  2NTX A;  1K9A A;  2W2U A;  3UA7 A;  1M30 A;  3ASK A;  3CPW P;  4R56 A;  5CA1 E;  1U3O A;  4F7U E;  4U7I A;  2EWN A;  4OMF B;  3VRZ A;  2CH4 A;  4IUT A;  3CX7 B;  1UE9 A;  3OYK A;  4CI1 B;  4DR5 T;  4M7D D;  2QG9 B;  4X20 E;  3I1A A;  4WNK A;  1QVG P;  1D0Z A;  4LDY A;  2BG9 C;  4ZGE B;  1QLY A;  1IO6 A;  3VU3 C;  1SG5 A;  3MJX A;  1MV0 B;  2W0G A;  1I8F A;  3PT9 A;  1S72 T;  2H3R A;  3EDV A;  2G6F X;  2MIO A;  2BVL A;  1RI9 A;  5HY6 A;  3R84 B;  2MTQ A;  3RRW A;  2K24 A;  1EX4 A;  2CP0 A;  3AAI A;  4KT0 E;  2SPC A;  3RIA A;  3CC7 T;  1S1N A;  3G7Z A;  1M1K U;  1W2B P;  4QXB B;  2HKQ B;  4AFS C;  3PUR A;  2EYZ A;  4VUB A;  4TWF A;  3PU8 A;  4PKC C;  1JJ2 A;  1Z8U A;  4A53 A;  3BQI A;  3G06 A;  4PK6 A;  5HXR A;  1B3Q A;  5C2T A;  2HD0 A;  1G3W A;  4R55 A;  5KCH A;  2Z6E A;  3CC4 Q;  3OTO T;  3VS5 A;  4L9I A;  3AE1 A;  4FJO A;  4AG2 C;  4NL2 A;  4OML A;  4RTW A;  1N8R C;  1I5O B;  5KCO A;  3VR9 A;  5BR8 T;  3VS1 A;  2FJA A;  3PUQ A;  2R5A A;  1NG2 A;  5A2Q E;  3GIB A;  4U74 A;  2X4W A;  2CH4 W;  4F7U G;  1X01 A;  4Q25 A;  1R8I A;  3ZJ2 A;  3P8B B;  4JRK A;  3CXC P;  3CEY A;  2QA4 T;  2YN6 A;  4C0G A;  1X6G A;  3RGL A;  2DYB A;  5AQT B;  1M8M A;  3MEU A;  5I21 A;  4BAC A;  2W66 A;  1VUB A;  3E9G A;  2UU9 T;  1X75 C;  1AWW A;  1MGQ A;  1QWE A;  4ERR A;  2QI2 A;  3CVR A;  3NVO A;  4LUE A;  3VS3 A;  1UEB A;  4EIW A;  3ZT7 A;  3HL6 A;  5ABF B;  3DKM A;  3UT1 A;  2V5D A;  5JRC A;  5F8P A;  4DBQ A;  4B3S T;  1JNR A;  5GMK e;  4FU6 A;  4M7D F;  4XAX B;  4M78 F;  4GLK A;  3QDF A;  4PJO F;  2WU5 A;  1GQE A;  5JDG A;  1M1K C;  1F1B B;  3CX8 B;  4OP0 A;  4JS5 A;  3ZEF B;  1TTH B;  5H6R B;  2OJ2 A;  3CMA A;  4KGX B;  2AXD S;  2SEM A;  2C0S A;  1YJ9 Q;  5DJQ C;  4Z88 A;  4RTV A;  4BE2 A;  2LOP A;  5I22 A;  2RJC A;  4AQF C;  3MP8 A;  1K4U S;  5GMK m;  1VQN Q;  2BZX A;  3CQT A;  4N4H A;  3UUB A;  5IYZ E;  4DV1 T;  3MO8 A;  3QYH B;  4WTO B;  3F2E A;  2BKN A;  2D9D A;  3VHL A;  5L4E A;  2UUA T;  1SSF A;  2JTF A;  3QJY A;  1WHG A;  4LMJ A;  1JBM A;  2EJG A;  4COF A;  3EAB A;  1MHN A;  2WMO A;  2RHX A;  2X4X A;  4C8Q E;  3CCE Q;  1OUL A;  2NW8 A;  3GN5 B;  2BG9 A;  1CUN A;  3GA8 A;  4PW8 A;  1MUZ A;  2B86 A;  4C5E A;  5KYU A;  4ZGD B;  4M78 A;  2QDL A;  4UC4 A;  4YSY A;  1VQL T;  3Q2M A;  4C92 D;  3TSW A;  1YCS B;  3JB9 I;  2WWU A;  3HA4 A;  1KIK A;  3OYH A;  3ULR B;  3CCL A;  1VQ9 Q;  4TWD A;  4KHP T;  3LSV A;  4YJ2 E;  1TWB A;  6AT1 B;  4NXN T;  3I55 A;  3PGG A;  2HCK A;  4A4E A;  2BG9 B;  2DD5 A;  3WAJ A;  5KYU B;  4KRT A;  5GAO p;  4M78 B;  1VQK A;  4PK5 A;  3P8D A;  3HKB E;  1EZZ B;  2EGE A;  3JCM c;  1HFA A;  3UPU A;  2RQT A;  2KMT A;  4OB2 B;  3M3Z B;  1IBM T;  2J7I A;  2DWK A;  3OW2 S;  4DID B;  1C0M A;  2COW A;  5LJ3 g;  4HCB A;  5FP3 A;  1HNX T;  1RAC B;  3E9F A;  4X1I E;  4DV7 T;  2DL4 A;  1HF8 A;  5C0M A;  2JNG A;  3AVS A;  2N1G A;  3CCM T;  2E10 A;  5JDH A;  3O8V A;  1BIB A;  4CXX A;  2O4X A;  1QWF A;  2YDL A;  3OBY A;  1N8R R;  4L5G A;  4BJN A;  1OU8 A;  2YRV A;  2RNA A;  3AE8 A;  4OMN A;  3L2W A;  2OTJ Q;  2UXX B;  3J7Y q;  2XSA A;  5CIU A;  3SEM A;  2JVV A;  4AQG A;  2C0I A;  1UB4 A;  1E6G A;  3CCJ A;  1D1A A;  2OA5 A;  4H63 H;  2NWB A;  1VOM A;  5GAN 5;  3SB2 A;  4HWF A;  1IHV A;  3CPW S;  4J2C A;  3GPL A;  4P0B A;  4K11 A;  1TSF A;  3KV5 A;  4H9N C;  2GNC A;  2WSC E;  2J6K A;  4HKE A;  2QYW A;  4MMK A;  4AIU A;  1T0H A;  2QQR A;  1LRZ A;  5CKE A;  2Q9Q D;  3AA0 B;  4CN1 A;  1VQ4 Q;  1YFN A;  4TNW A;  1TG0 A;  3IF8 B;  5CQX A;  1OPL A;  2KGT A;  1K76 A;  4NS5 A;  3VS4 A;  3KDS E;  1M1K R;  4XQ3 A;  5GAM d;  2LQW A;  4N0A C;  3ME9 A;  2PBI A;  4M75 F;  3SWN C;  4C92 F;  2LM9 A;  3V5U A;  4AQF A;  3JB9 H;  3ZMZ B;  3CCU T;  3QZ9 B;  3RKG A;  2GCX A;  3W15 B;  1HSQ A;  2OAU A;  2R57 A;  1H7C A;  1WYC A;  1OZ3 A;  3V7S A;  1M5Q 1;  3QZ5 B;  3MZK B;  2JTE A;  2QXF A;  4AXP A;  1WJR A;  5CKF A;  2OI3 A;  1N34 T;  2NW9 A;  1N5Z A;  2XAQ B;  2W10 A;  4DVD A;  4AKL A;  2ZM2 A;  3OA6 A;  1GXI E;  2V6Y A;  5LG3 A;  2I0N A;  1VQ6 T;  2L3Q A;  5EC7 A;  4AG1 C;  4ZTJ A;  1B07 A;  3OYG A;  3X25 B;  4IDN A;  3VS6 A;  3M0U A;  3AEF A;  4AFZ C;  2E65 A;  1J5E T;  3WAK A;  1IJ5 A;  2OLT A;  2CXF A;  3KV4 A;  2J4G A;  5FKY A;  2OX7 A;  1X69 A;  4XTY A;  4DV2 T;  2V6Y B;  3JCM f;  1VQ8 A;  1FWZ A;  3CXC S;  2DXC A;  1VQM A;  2HQE A;  2LSG A;  1RUW A;  4AQY T;  1Z9Z A;  4RTY A;  4HFC A;  4OF1 A;  3KVA A;  3PUA A;  1NEB A;  2CM0 A;  2K57 A;  3URG A;  2ZLY A;  3LW5 E;  3S4U A;  1BR1 A;  3QDR B;  1H64 1;  3EAM A;  5GJV B;  4AT1 B;  4IIJ E;  1WDX A;  3LGL A;  2RPN A;  2PU9 B;  8ATC B;  1L0V A;  2CHN A;  1TS9 A;  1WI7 A;  1AWX A;  1PHT A;  2JM9 A;  2WP9 A;  5L3F B;  2RQU A;  1UHC A;  1M7K A;  2E5K A;  1YXR A;  4CZZ B;  4FYV B;  4CXW A;  4J8O A;  2IML A;  3CC2 Q;  4JUY A;  1I4K 1;  2EYW A;  4C8Q D;  4A54 A;  3JCM W;  4JRQ A;  2MOZ A;  1QCF A;  3HKD E;  4DBH A;  4BDZ A;  1T7S A;  2LC4 A;  2RD1 A;  4UXN B;  3HP9 A;  1OZ2 A;  2KXD A;  1VQ5 Q;  3CCV T;  4XTZ A;  3NTI A;  4KUL A;  1JXM A;  1OYX A;  4MDW A;  4U72 A;  1CKA A;  1ZX6 A;  4EZH A;  2P84 A;  5HEG A;  2E8I A;  3MEV A;  2H7V C;  3LJC A;  3M0R A;  3P8C D;  4DR2 T;  3M59 A;  3TLT A;  2FG0 A;  2JW4 A;  2O9V A;  4FYW B;  1KC8 U;  1X6O A;  1YBY A;  1TUD A;  2AKL A;  1XMQ T;  4X1V A;  4V1A v;  4J7F A;  5A0G A;  2P4T A;  4RTZ A;  2V7L A;  1I5L A;  1EFN A;  2LJ3 A;  4XTV A;  1UG1 A;  3FZH B;  2OTL T;  4DV0 T;  4EZ4 A;  4N0A A;  2JN0 A;  5AQG B;  3IQL A;  4GYS A;  2RJD A;  3LGF A;  2V7J A;  2RN8 A;  1WX6 A;  2WSF E;  2I2L A;  3M0P A;  4IUV A;  2LHN A;  2XQ7 A;  3C51 A;  4LE9 A;  3OYN A;  3PIO A;  2M02 A;  2MAW A;  2EHO B;  3HKC E;  2E5V A;  5J2U E;  4X66 T;  4GKJ T;  1Y0M A;  1ZUY A;  1BR2 A;  3N2K E;  2YT6 A;  4E6R A;  2CZ6 B;  3VRB A;  2CSQ A;  2O2O A;  4JZ4 A;  2XDD A;  2X35 A;  2HL3 A;  2EYQ A;  1Q82 U;  1VQO Q;  5M9O A;  1YHQ A;  4EPC A;  4EOZ B;  1ARK A;  1HX1 B;  2E9X B;  5HWX A;  4FT4 A;  3R6O A;  3X1D A;  3FBZ A;  3T8O A;  1HD3 A;  2V8S V;  3PJA J;  4CC3 A;  2A0F B;  2LQ8 A;  1XNI A;  2WU2 A;  3HL8 A;  2BBJ A;  3K1S A;  2C06 A;  1ZEE A;  3OSS C;  2K6D A;  1J3T A;  3CCQ Q;  2FZC B;  5CCA A;  5IH2 A;  3ETU A;  3OMC A;  4M7A D;  1RAF B;  3CQX C;  2RMO A;  3CPF A;  2DTO A;  4HT8 A;  2CDT A;  4WF2 A;  3KUF A;  2VKN A;  4ZS3 A;  2YDQ A;  2XKO C;  3D0T A;  2XIC A;  1KC8 C;  3JAF A;  3Q9D A;  4Z02 A;  4ILA A;  4CI3 B;  3HHT B;  4QT7 A;  4Z90 A;  3CD6 Q;  1ZBJ A;  4YHJ A;  4KUI A;  5BMV E;  2KXC A;  5LBQ B;  4JI2 T;  3LWH A;  3HRU A;  1SHF A;  1KNZ A;  3N9N A;  3LYI A;  4P0A A;  5D6Y A;  2ED0 A;  1Q7Y U;  2IAK A;  3GMI A;  5EK2 A;  1ZA2 B;  2MPK A;  3UF4 A;  2JXB A;  2O88 A;  2KSS A;  4HWD A;  2VAS A;  2H7O A;  4P09 A;  2GBQ A;  3G4S Q;  2V1Q A;  2CZ7 B;  3P4Q A;  2XQA A;  3PUV F;  3QSU A;  4EAH A;  3MP6 A;  1Q82 C;  4A4G A;  1M27 C;  4ILU A;  1XDO A;  3CME Q;  4J9G A;  5LJM A;  1IGQ A;  3E2U A;  3M5A A;  4HT9 A;  1QP2 A;  2AT1 B;  1G8X A;  5LXT E;  2QGF B;  5D6W A;  2LE8 A;  1UTI A;  3NRY A;  3L09 A;  5AT1 B;  2DNU A;  2MMP A;  3VS7 A;  5CR2 A;  4CN6 A;  4M7D E;  1JU5 C;  3G71 A;  4PJO E;  1IRE B;  3OS1 A;  2EGC A;  3EFS A;  2YUN A;  4MBQ A;  5JDL A;  3UUM A;  2A7Y A;  3L2Z A;  5I11 A;  2WSS V;  2VXF A;  3REA B;  3CC4 A;  3J81 E;  3OS0 A;  2GGR A;  2VB6 A;  2CT4 A;  3ANW A;  4KH1 B;  5KXJ A;  3CBP A;  4M77 D;  4J9D A;  2YDR A;  3TLU A;  2N9D A;  1LVK A;  1Q86 U;  1Y01 A;  1UDL A;  4MHC A;  1M90 U;  2JUF A;  2O9S A;  4XTU A;  4PAG A;  1NPR A;  2A72 A;  4GKK T;  4LDW A;  4YXD A;  2RK1 A;  3FJ5 A;  1ZQ1 A;  1S72 Q;  3RC8 A;  4M7A F;  3ANW B;  2DIL A;  2CKK A;  5KE3 A;  2WCA A;  5LYJ E;  3LFM A;  5LB7 B;  4JUV A;  1UGR B;  2LKH A;  4EDU A;  5LJ3 f;  3HSB A;  4KBM B;  3EGX A;  1Q7Y C;  2Y6X A;  2K7A A;  2PJQ A;  4PK4 A;  3L8R A;  3ZL7 C;  3D7S B;  4LDV A;  3CMA T;  2VXE A;  1YP5 A;  2Y4Y A;  5FRN A;  2JM8 A;  4PNI A;  2EQM A;  5DLQ E;  1OED B;  3PUY F;  3OYF A;  2NW7 A;  4JEH B;  4IE7 A;  4ISS A;  5JDF A;  3CML A;  2PUK B;  2LT4 A;  3EG9 A;  4LF8 T;  4U33 A;  5GAO l;  2QAS A;  4NIQ A;  5AQI B;  2V7K A;  2O01 E;  5FXX A;  1OX8 A;  3A98 A;  5FY1 A;  2QQ9 A;  5CKH A;  3UA6 A;  2CP6 A;  1TUG B;  2M9U A;  4PJM A;  4LXC A;  4F16 A;  1YJ9 A;  4O4I E;  5IN1 A;  4UVC B;  4ASK A;  3AE2 A;  2SRC A;  1NBE B;  1ZSZ C;  1YI2 Q;  4BD3 A;  3KV9 A;  4DUY T;  5F5W A;  2QDY B;  1KSW A;  1KC8 R;  3ZBD A;  3KV6 A;  2KI7 A;  3K3N A;  2JRK A;  2ECZ A;  4E7I A;  2ACX A;  1WHK A;  2D0N A;  1UX5 A;  3CCL T;  4DV6 T;  5LMN T;  3FJP A;  3CCR A;  2QA4 Q;  2IUB A;  3I55 T;  1Q86 C;  1IRX A;  2Y4X A;  3CCE A;  2KZ7 B;  2V7I A;  1XJW B;  3KXT A;  1HS7 A;  2DEU A;  2EVR A;  1M90 C;  4J5Y A;  1VQK T;  4A63 B;  2IPO B;  2BE9 B;  2HH7 A;  2LJ0 A;  3FHN A;  2XK0 A;  2LJ1 A;  2QEX A;  2C0O A;  1Q81 R;  2CP2 A;  2PNI A;  4C0D B;  4EED A;  1FMW A;  4DUZ T;  3C50 A;  5L2L A;  3EHQ A;  2MWO A;  2XTL A;  5LG4 A;  3LH0 A;  5CAI A;  5ECA A;  2GFU A;  4X62 T;  1Q82 R;  3I56 A;  5LJ5 d;  2HNI A;  2E5Q A;  5JDN A;  1M3A A;  2HSE B;  2KEA A;  4AKI A;  3WI3 A;  3X26 B;  4DMV A;  3JCM g;  1W09 A;  2M6I A;  3N2G E;  2CHO A;  3JC6 D;  1GCP A;  1X79 A;  4DR7 T;  2M0O A;  4OB0 B;  1JJ2 P;  2DF6 A;  4HE8 A;  2K3X A;  3HTR A;  3ZN1 B;  4E47 A;  3I0O A;  4J9E A;  4PFP A;  1RAE B;  1G3Y A;  3H41 A;  1MV3 A;  4C92 E;  4M75 E;  3PIP A;  3FB2 A;  3IEE A;  2X3W D;  4B9W A;  3HFO A;  3CCJ T;  2KNB B;  3FZF B;  2V1D B;  3VUZ A;  2ROT A;  2HN1 A;  5HAX A;  2EPD A;  1ZUU A;  1LOJ A;  3AED A;  3HKS A;  2I6H A;  3I9W A;  2NWM A;  4L59 A;  3L3P A;  4L0R A;  4ILC A;  1AHJ B;  1WHL A;  3HRS A;  4RTX A;  3T1H T;  4LD9 K;  5HXC A;  2X9Y A;  2N2N A;  4DV5 T;  3R6N A;  2KT9 A;  2E5L T;  2L0A A;  5IT9 E;  3PDY A;  4X1Y E;  2E4H A;  4DBR A;  2QQA A;  4IL4 A;  4IUQ A;  4O8S A;  4D8D A;  3VS2 A;  2DM1 A;  1Q7Y R;  2KT1 A;  4JRI A;  5KH6 A;  3UTK A;  4E7J A;  2DD4 A;  2VYT A;  2ZMA A;  3RKW A;  5FLX E;  1SSH A;  2HQX A;  3C4X A;  3G1J A;  3BDL A;  1KD1 R;  4JRP A;  1SUM B;  3VYH B;  2YLC A;  4M78 D;  4PJO D;  2KY9 A;  1LNX A;  3EH2 A;  2CXD A;  4UR9 A;  2XJ7 A;  2VC8 A;  4BE0 A;  1K9M U;  5FRM A;  1GFD A;  1WFW A;  5AQM B;  3PVL A;  2ESW A;  1OQK A;  3VR8 A;  3QXE B;  2QVA A;  5AFU L;  2WSE E;  2UUC T;  1VQ7 Q;  2B1E A;  2YIN A;  3CCM Q;  1ZSZ A;  1YIJ Q;  2DE0 X;  4BI4 A;  5CK9 A;  2RA1 A;  2FPD A;  3EAE A;  3OYM A;  4OFZ A;  1PD0 A;  1NLO C;  3LK2 B;  4IDP A;  4JJD A;  3GBQ A;  1VQ8 T;  1VQM T;  1ZSZ B;  8AT1 B;  4ADZ A;  2ABL A;  2H3J A;  5KYN A;  1U4Q A;  5CKB A;  2FUP A;  3B57 A; 
#chains in the Genus database with same CATH homology
 3CQG B;  3A8H B;  4FL6 A;  4XZC A;  4Y91 A;  4FSX A;  2XDP A;  3B13 A;  2PUO B;  1K73 U;  2LX9 A;  1MIW A;  2LSK A;  1EIF A;  4J7I A;  5J1G A;  3DLM A;  3BQL A;  3M55 A;  1XOV A;  1OI1 A;  4NUV A;  2RH2 A;  2Y90 A;  1D0X A;  1PSF A;  5KDM C;  3PUS A;  3C4S A;  4RCC A;  1VQP A;  2K48 A;  2F5K A;  2K5L A;  3OW2 A;  5FU7 C;  2BDE A;  3DJB A;  2IVW A;  3ZCI A;  1Y71 A;  2LHR A;  3S6W A;  4XTX A;  2W63 A;  2YEV C;  3J9X 1;  1G3T A;  2CYZ B;  3PU3 A;  4I4T E;  5J3B A;  4XU2 A;  2C5I T;  3KBT A;  2LCC A;  3V7C A;  5LGT B;  3OYD A;  5JRC B;  4ZTF A;  3WVE B;  1MMA A;  3FXD B;  4UF0 A;  1PSE A;  3PTR B;  4X1K E;  4EYU A;  2VWA A;  2EKO A;  3CPW A;  5LOV E;  4DOV A;  1BR4 A;  3QO3 A;  1K73 C;  2R58 A;  2RA2 A;  3RES A;  1QVG A;  2DPP B;  3P7I A;  5LJ5 h;  4UF0 B;  4P5N A;  3SS1 A;  2DZ9 A;  4XU1 A;  2P0P A;  4H9P C;  3V5S A;  1BKB A;  2A3L A;  4M75 D;  3QPH A;  4IE5 A;  1LVF A;  3ONX A;  5LBM A;  4RG2 A;  1W2B A;  2E6Z A;  1JJ2 S;  3QG1 A;  4ZI2 D;  1YD8 G;  2RHU A;  3BDU A;  2NOX A;  5HKC A;  4DND A;  1LJO A;  3SD4 A;  2MI6 A;  2XQY A;  2QGS A;  2P0Q A;  4JDS A;  2DXB A;  1VQO A;  3HKE E;  3C95 A;  4HN9 A;  4TZ4 C;  2RO0 A;  4J6W A;  3N5B B;  3M65 A;  4UEM A;  2CXL A;  3NBX X;  5GAO q;  2KIN B;  3JCM d;  4OGE A;  5FMN A;  3FLG A;  4XU0 A;  2XHE B;  3JB9 F;  2NTY A;  5HK3 A;  4JEU B;  4Y28 E;  4CI2 B;  4WBO A;  1YKH B;  5EK4 A;  4HFV A;  2EFI A;  3CXC A;  3C4W A;  2L9Q A;  3HFN A;  3WVD B;  3SDZ A;  4C8Q G;  1UGQ B;  3PUG A;  3KBU A;  3OKQ A;  1FMV A;  4QW2 A;  3ETV A;  3CD6 A;  3N9M A;  2O4X B;  3LBX A;  5DAB A;  3JCM e;  3PNW C;  2CLY C;  3L2V A;  2KDS A;  1VIF A;  2LJL A;  1US7 B;  4H9S E;  1VRB A;  3OYI A;  4B6X A;  2EHO D;  2YU1 A;  5GAN g;  4M7A E;  3U78 A;  3LX7 A;  5A0L A;  5GAO m;  5FU7 B;  3G71 T;  4CI0 C;  4GYR A;  3MKD A;  3J80 E;  3UWN A;  5FXW A;  2M16 A;  4PJJ A;  2E9X D;  5LHI B;  3CME A;  2XAJ B;  3CC4 T;  5CKD A;  4YLH A;  3NRX A;  3EUH A;  4RG8 A;  5EK3 A;  4ME7 A;  2DVE A;  3FBL A;  2Q9Q C;  2F69 A;  5GMK h;  1T98 A;  4J6Y A;  4X9D A;  5HXH A;  4D6W A;  1WGS A;  2CMR A;  2XUE A;  5FY0 A;  2RJE A;  2G3R A;  1H3Z A;  4AKG A;  2M67 A;  5LHG B;  3J7A F;  4BY6 C;  3CPZ A;  2LEH A;  4TV8 E;  2HPL A;  4G2A A;  2RHZ A;  3N9L A;  1D1B A;  3Q5X A;  3C98 B;  1HK9 A;  1OXZ A;  5FY7 A;  1D3B A;  5LP6 E;  2GK9 A;  3FIF A;  5KX5 E;  3BFM A;  4BB7 A;  1YJ9 T;  3INZ A;  4M77 E;  3ZFJ A;  1IAP A;  4F7U F;  5CQY A;  1M1G A;  2LNV A;  1D3B B;  4UVB B;  5HWY A;  3CWZ B;  4OK0 A;  3JCM X;  3CCR T;  4E7K A;  5AYF A;  1NWM X;  1BI3 A;  3FEO A;  3ZCJ A;  3FB9 A;  1YI2 A;  3ZLI A;  2QEX T;  4CXY A;  5HK0 A;  2A3D A;  2KK4 A;  2ZPB B;  3X24 B;  2NP9 A;  2KAF A;  2ZZD A;  3ZMT B;  2DKG A;  2JMK A;  5FNV E;  3H3A A;  4GK5 E;  1EZ3 A;  4F7U A;  2DAQ A;  2CS7 A;  3S3O A;  3I56 T;  3AAA B;  4C8Q C;  1ZBX A;  2YU2 A;  3ESL A;  3S3N A;  1WR6 A;  3SWN A;  5JDM A;  5GAM f;  4F7U B;  4PFO A;  4XK8 E;  4MZM A;  1Q81 U;  2K9A A;  3AB3 B;  2L3L A;  3JCM h;  3ZJ1 A;  5FRO A;  1OWA A;  3C4Z A;  4FI5 A;  2FYK A;  4I50 E;  3PMI A;  2Q9Q A;  3BY7 A;  3SWN B;  1ZV4 X;  4LD6 A;  3JRZ A;  4EMK C;  4KUD K;  2A2F X;  2EJF A;  3OB9 A;  3M4G A;  1DJ7 B;  4WW0 A;  3EVY A;  3G6E A;  5LA6 E;  1B34 A;  3OSV A;  1QVF S;  4N4G A;  2K5F A;  2G0U A;  4C0F A;  3RYI E;  3M9Q A;  5LJ3 d;  2IC9 A;  3CCS A;  5JQG E;  2L5Q A;  3MET A;  1WQW A;  5DQV A;  2QQS A;  2WAC A;  1MNE A;  4OB3 B;  4PNO A;  1Y64 B;  1BIA A;  4EXT A;  1QSD A;  2LSY A;  2CCQ A;  1UX4 A;  5I2M A;  2LQK A;  2ODU A;  3L2U A;  4E7H A;  2JTM A;  2ZM8 A;  5GAM j;  2K3Y A;  1BI2 A;  1Q81 C;  2KLQ A;  2V8K A;  2DTH A;  3KFW X;  2RHY A;  5I2S A;  5LJ3 e;  1BR0 A;  4DMW A;  5GMK i;  4JS4 A;  1KD1 U;  3O1J A;  1VQ7 A;  1HG2 A;  1YIJ A;  2X4J A;  2X9X A;  2XDB A;  1FX7 A;  3OYA A;  1RL2 A;  3RC3 A;  2RK2 A;  1RI0 A;  2L8K A;  1D1C A;  4M78 E;  2MYS A;  1IZN B;  3QHS A;  4C8Q A;  2XD0 A;  5J2T E;  4CQI A;  2FB7 A;  4NOY A;  1VQP T;  4JLE A;  3EFR A;  2E6N A;  3TEE A;  1YJN A;  3IBP A;  4XTW A;  3VYG A;  3ZMS B;  5JR9 C;  1M1F A;  5LL6 S;  4PJL A;  4TX5 A;  2PFV A;  1KQS S;  4C5I A;  2L8D A;  1UCU A;  4JLG A;  4G63 A;  1M9S A;  4QX7 B;  5LGU B;  1S35 A;  2ZCF B;  3M53 A;  2M1H A;  3F31 A;  3NZP A;  1KD1 C;  4EYY R;  2ZPI B;  3IHR A;  2BVM A;  5FXV A;  2DJZ A;  2P0K A;  2Y48 B;  3MXZ A;  5A1L A;  1WJS A;  2VUB A;  3OBW A;  1NJI U;  4E7L A;  1UGP B;  3RIR A;  2XAF B;  1QW1 A;  4M7D G;  2P9B A;  1G3S A;  4M78 G;  4PJO G;  2ODV A;  2KND A;  3U3I A;  5HXE A;  4MAL A;  2K5I A;  3ZMU B;  1WJQ A;  1AJ3 A;  4O4H E;  4AKH A;  3ER0 A;  3A8M B;  3MCA B;  1KHC A;  2GFA A;  3SOL A;  1VQN A;  5LNK A;  1Z0P A;  5GAN 2;  4N4I A;  3GOX A;  4NUU A;  2VK9 A;  4ZGJ B;  3RKY A;  2LSJ A;  3RMQ A;  3ZMV B;  4EMG A;  3C12 A;  5GAN f;  3TRE A;  3ZN0 B;  3MP1 A;  2DWG A;  2MWP A;  3RMS A;  2DCF A;  2D2S A;  1HTJ F;  4UV9 B;  3LK4 2;  4UVA B;  3ZYL A;  1VQO T;  1G5V A;  2CZ1 B;  3LWI A;  2KQW A;  3LK3 B;  3VKI A;  1VQ9 A;  2D6F A;  4OVA A;  3CBO A;  1G73 A;  4IST A;  2JMH A;  4F6R C;  3RX6 A;  2YLB A;  5H6Q B;  4OGC A;  3VJP A;  3F57 A;  1QVP A;  4YFS A;  1NJI C;  2C5K T;  5LJ3 h;  1K8A U;  3RRC A;  2KWH A;  2K5B B;  3UFE A;  4ZI3 D;  3O1H A;  4MDX A;  2EQU A;  3OY9 A;  3M56 A;  4X9C A;  3CD6 T;  2E1H A;  3MA9 A;  2RJF A;  3JAM E;  3FC3 A;  5GAO n;  4ZS2 A;  5JR9 A;  3AVR A;  4ZN1 A;  5IAY A;  4DA4 A;  5ETW A;  3JC6 C;  2OTJ A;  2ZM0 A;  2K2V A;  5GAN j;  4AI6 A;  4J6X A;  5GON E;  5L3D B;  3FRN A;  4YJ3 E;  4L6V 5;  4JLI A;  2RP4 A;  1BYM A;  3CME T;  4C0Z A;  1KQ1 A;  4QHO A;  3PMT A;  3M58 A;  2D5U A;  4K0U A;  4B9X A;  1VQ4 A;  2ZGW A;  3AHU A;  3GF5 A;  2D0U A;  2PVO B;  3C94 A;  2QTX A;  2EQK A;  5J39 A;  1NZ9 A;  1MMG A;  2LDM A;  4IUU A;  4OYK A;  4IHJ E;  4DO0 A;  4C92 G;  4M75 G;  5FYM A;  5GAM g;  1K8A C;  4UIG A;  2ES0 A;  3I0Q A;  3CQC B;  3OS2 A;  5CVI A;  3QC9 A;  3NTH A;  5GAN 7;  4M7D C;  4M78 C;  4PJO C;  3SRZ A;  5L8R E;  4HKA A;  3KIN B;  3L2R A;  1VIE A;  3VKH A;  4M1P A;  3RYF E;  2VL8 A;  2PVG B;  1KG1 A;  2DHR A;  3RUX A;  5DM7 R;  3OYY A;  5LJ5 f;  4IKF A;  3GP8 A;  2X67 A;  2CGH A;  2L3R A;  2DIG A;  2NLU A;  3ZYM A;  3NFC A;  3PE0 A;  1LKX A;  2PQW A;  1K9M C;  1YI2 T;  3MHX A;  3N5L A;  1S94 A;  3RPU A;  3JB9 D;  4N78 D;  4BA9 A;  4FT2 A;  3RKO A;  3CC2 A;  5HYA A;  1ZHC A;  1KK7 A;  3N9O A;  2RI2 A;  2JPF A;  3RKX A;  3SWH A;  3E08 A;  1VQ5 A;  3AA6 B;  2IC6 A;  5ADX L;  1YJW A;  5LCY A;  2XID A;  2V7M A;  1M8V A;  2X0L B;  3UUX B;  5L3C B;  2JQQ A;  2XG8 D;  3I9Y A;  4MLK A;  3UT5 E;  2D0T A;  2ZPG B;  3RYC E;  3BQK A;  1NAF A;  2I59 A;  5CB4 E;  5LJ5 j;  3MEW A;  3JSC A;  1YHQ T;  4MML A;  2DO3 A;  3GN5 A;  2L89 A;  3OYB A;  3C64 A;  3DB4 A;  1YIT A;  3K8P C;  5L3E B;  1V29 B;  2EIF A;  5JH7 E;  3G6E T;  5TAO A;  3OYE A;  2DZC A;  3JCM P;  4PL6 A;  3A8O B;  2LT3 A;  4DOW A;  3VUB A;  1TH7 A;  4M7D A;  1JRI A;  4PJO A;  2CA5 A;  3CCS T;  3K3O A;  3PFS A;  2D0Q B;  1HG5 A;  5D6X A;  4C92 C;  4PLI A;  4M75 C;  4QVD A;  4LDX A;  4BJM A;  4H9O C;  1JB0 E;  4M7D B;  5FU6 C;  4PJO B;  4QXC B;  2BKD N;  3CCQ A;  4HEA A;  4ZI2 C;  4QQ6 A;  1U8R A;  3A8G B;  2JZ2 A;  4GIW A;  2VKJ A;  1NPP A;  5E0O A;  2XHC A;  3NTK A;  2DNX A;  5L3G B;  3LLR A;  2DXU A;  3CX6 B;  5LGN B;  4C5H A;  3LG7 A;  1I81 A;  2R5M A;  1WYB A;  2BUD A;  3TCJ A;  2X68 A;  4GOU A;  5M4Y A;  5GAN 4;  1VQ7 T;  4C5G A;  1YIJ T;  2DEQ A;  1XTD A;  2ZPE B;  2MAM A;  3OBV E;  1E1H B;  1N6A A;  4QX8 B;  3E0Z A;  3HI2 A;  3X28 B;  4RKU E;  5KE2 A;  3LBX B;  3UDC A;  4O4J E;  2KWI B;  4BI8 B;  3G4S A;  4KUM B;  3E1S A;  3OQ5 A;  2JJ9 A;  2X4Y A;  2HPJ A;  3A5X A;  3H37 A;  4IDZ A;  1O9S A;  3M57 A;  2QQB A;  1WRD A;  3RH3 A;  2CWY A;  1UGS B;  3OYX A;  3CKD A;  4O6J A;  1QVG S;  1YJN T;  3OYZ A;  1NE8 A;  1SA0 E;  3KBG A;  3N9Q A;  4E7S A;  4XBF B;  4OHF A;  1V9D A;  3HPW A;  1WPY A;  2EHO C;  2IW5 B;  5J26 A;  4KP3 C;  4ZHQ E;  4CRI A;  5GMK j;  4BUG A;  5IHY A;  1SHZ C;  1W2B S;  1N9S A;  2E12 A;  4QVZ A;  2E9X C;  2DLR A;  1XQH A;  3JCM b;  2RHI A;  4J83 A;  1O75 A;  2VKO A;  2DTI A;  3OMG A;  3E19 A;  1S72 A;  4ELZ C;  3GWH A;  2FL7 A;  4HCC A;  2V8I A;  4M7A G;  3MK7 C;  3X20 B;  4A4H A;  2VV5 A;  3TKL B;  3CC7 A;  5C6S A;  5GAM e;  5JDQ A;  5JRE A;  1KHI A;  1D0Y A;  4C92 A;  2VGN A;  4M75 A;  4O2B E;  4HTE A;  3OYJ A;  2X9W A;  2EQJ A;  1VQN T;  2WAU A;  3QKJ A;  4DQ2 A;  1QVF A;  3QBY A;  3E22 E;  3BK9 A;  5KMG P;  5HXS A;  4O4L E;  1IZ6 A;  1HCI A;  4C92 B;  3VKG A;  4M75 B;  3L2Q A;  2J1D G;  2ZPH B;  4IE4 A;  3OS5 A;  3CCE T;  3FDR A;  3EDU A;  5FU6 B;  2WBL A;  3O1I A;  3V8J A;  4BI3 A;  5JVD E;  1VQ9 T;  2K4Y A;  2QA4 A;  3DB3 A;  5GAO r;  2LSI A;  3HRT A;  3OYC A;  4EB6 E;  2W61 A;  4A4F A;  5GAN 6;  4O2A E;  4TVR A;  3T9N A;  4BDY A;  2E41 A;  2CLY B;  1N27 A;  2AHJ B;  2C5J A;  4RMO A;  4O5V A;  4NL3 A;  2W00 A;  2FVU A;  4WBN E;  3A5Z B;  4M77 G;  2MBG A;  5EZY E;  3QUI A;  2X66 A;  3RYH E;  4C90 A;  5DY9 A;  4I55 E;  5LJ5 g;  4QXH B;  2EHO A;  4H63 V;  2LTO A;  3RER A;  2KVQ G;  2OTJ T;  3O9X A;  2RM4 A;  4GY5 A;  3VU7 H;  3F70 A;  3GNG A;  2E9X A;  4PLL A;  2Q9Q B;  4ZI7 E;  2DK3 A;  3CBM A;  1U1S A;  2XAH B;  4PJN A;  5EG2 A;  3V8L A;  2RI3 A;  3Q5W A;  2KXP B;  1QUU A;  3QII A;  3QYG B;  1VQL A;  1VQ4 T;  3MEA A;  1B34 B;  4BY6 B;  1KQS A;  4V2S A;  3M4Y A;  4EMH A;  2RI5 A;  4UEL A;  2GQV A;  1U5P A;  4H9Q C;  5C8Y E;  2YK0 A;  3ZEH A;  1MMD A;  4MFR A;  4Q5W A;  4C8Q F;  4QVC A;  5LHH B;  4I43 B;  4C91 A;  5GMK l;  5L3B B;  2QA7 A;  4M7A C;  3O4X E;  3L1A A;  4HA8 A;  3Q1J A;  2DI4 A;  2XAS B;  3JCM V;  1R8O B;  3CCM A;  2CWO A;  4BE1 A;  5GAM h;  4C0D C;  5GAN d;  3SFM A;  4MZP A;  1ZHI A;  2XI9 A;  1P92 A;  4TV9 E;  2PVD B;  4QQD A;  5DQW A;  2BZB A;  2XU8 A;  1HX8 A;  3OYL A;  4C8Q B;  2IG0 A;  1B7T A;  5GAN e;  4E7Z A;  3DTO A;  4RCB A;  4IGU A;  3JCM Q;  5DLO A;  1MIV A;  1Y96 A;  3P8H A;  3K3Q C;  4A4K A;  3CCU A;  3DLL A;  1Y7X A;  3CC2 T;  3QK6 A;  4EMK A;  5F3J A;  3BW1 A;  2FHD A;  4IE0 A;  1VQ5 T;  2EAY A;  4OYJ A;  4LDU A;  4M77 C;  1YJW T;  3UUL A;  1Y96 B;  3QJ6 A;  2LRQ A;  2BIV A;  2CEA A;  4FM4 B;  2UXN B;  1VQ6 A;  5CA0 E;  2HAX A;  3GNF B;  4EMK B;  2YHT A;  1MND A;  2EJ9 A;  4IUP A;  3S3M A;  2DIQ A;  3A8L B;  2V26 A;  4X34 A;  3UUN A;  3H6Z A;  2MF2 A;  4OB1 B;  1YW0 A;  3MAC A;  2B8A A;  3VV0 A;  1U1T A;  2RB6 A;  3JB9 J;  1FXX A;  4HGA A;  2LT1 A;  1YIT T;  4ANJ A;  5A0D A;  4MZT A;  3WXM B;  2CZ0 B;  3M54 A;  4ELY C;  2X9H A;  2HBP A;  2JOY A;  2WMN A;  1HXD A;  4QWN B;  1BI1 A;  4M7A A;  2XAG B;  1M4Z A;  2LCL A;  4JJN K;  3FXE B;  3N9P A;  4IE6 A;  3ZC0 A;  4QQG A;  2DXT A;  1WLX A;  4A56 A;  3OJA A;  3N2O A;  4XU3 A;  3JCM J;  2CE7 A;  5CO7 A;  3V8K A;  4ATO A;  2LVM A;  2VGM A;  3DP7 A;  4M7A B;  4UV8 B;  2E64 A;  1KQ2 A;  1IJ6 A;  2PG8 A;  3NZQ A;  2Y8D A;  5GAN 3;  2ZPF B;  3CCV A;  1Y07 A;  5LJN A;  3CCQ T;  2VKD A;  1O3X A;  4FIB A;  5FXZ A;  4M77 F;  3ZPO A;  4Z8X A;  3QUJ A;  3ZYK A;  2W62 A;  3V7R A;  5LJ3 j;  4KMC A;  3AA7 B;  3L42 A;  2E70 A;  1YKE B;  2GF7 A;  1ZKE A;  4TUY E;  3H8Z A;  5GAN 8;  1QP3 A;  1MIY A;  3JB9 G;  2KMF A;  1MMN A;  2OTL A;  3PTA A;  2LOS A;  3TU4 K;  4AKR B;  1FIO A;  1WQ7 A;  1W4S A;  1BI0 A;  3ZC1 A;  3KVB A;  3G4S T;  5JR9 B;  4QKN A;  4GK0 E;  4IUR A;  2VKH A;  4ZI3 C;  2D9T A;  4M77 A;  4ZOL E;  1N9R A;  2V8J A;  4TN7 B;  2X51 A;  5LJ5 e;  3AA1 B;  5GAN h;  4ZN3 A;  1FEW A;  3GLX A;  1WNL A;  4YTL A;  4M77 B;  1N8R U;  4II1 A;  1YCY A;  4H9R C;  2WM9 A;  3AAE B;  2F5T X;  4HCZ A;  3HR0 A;  4BAY B;  2NTX A;  3ASK A;  4R56 A;  5CA1 E;  4F7U E;  2EWN A;  4OMF B;  4IUT A;  3CX7 B;  3OYK A;  4CI1 B;  4M7D D;  4X20 E;  3I1A A;  4WNK A;  1D0Z A;  4LDY A;  4ZGE B;  3VU3 C;  3MJX A;  2W0G A;  1I8F A;  3PT9 A;  1S72 T;  2H3R A;  3EDV A;  2BVL A;  5HY6 A;  3R84 B;  2MTQ A;  3RRW A;  2K24 A;  3AAI A;  4KT0 E;  2SPC A;  3CC7 T;  3G7Z A;  1M1K U;  4QXB B;  3PUR A;  4VUB A;  3PU8 A;  4PKC C;  1JJ2 A;  4A53 A;  3BQI A;  4PK6 A;  5HXR A;  2HD0 A;  1G3W A;  4R55 A;  5KCH A;  2Z6E A;  4L9I A;  4FJO A;  4NL2 A;  1N8R C;  5KCO A;  3PUQ A;  2R5A A;  5A2Q E;  3GIB A;  4U74 A;  2X4W A;  4F7U G;  1X01 A;  3ZJ2 A;  3P8B B;  4JRK A;  3CEY A;  2QA4 T;  4C0G A;  3MEU A;  5I21 A;  4BAC A;  1VUB A;  3E9G A;  1X75 C;  1MGQ A;  4ERR A;  2QI2 A;  3CVR A;  1UEB A;  4EIW A;  3HL6 A;  3DKM A;  3UT1 A;  5JRC A;  5F8P A;  4DBQ A;  5GMK e;  4FU6 A;  4M7D F;  4XAX B;  4M78 F;  4GLK A;  4PJO F;  5JDG A;  1M1K C;  3CX8 B;  4OP0 A;  4JS5 A;  3ZEF B;  5H6R B;  3CMA A;  2C0S A;  5DJQ C;  4BE2 A;  2LOP A;  2RJC A;  4AQF C;  3MP8 A;  5GMK m;  4N4H A;  5IYZ E;  3MO8 A;  3QYH B;  3F2E A;  3VHL A;  3QJY A;  1SSF A;  2JTF A;  1JBM A;  2EJG A;  1MHN A;  2WMO A;  2RHX A;  2X4X A;  4C8Q E;  2NW8 A;  3GN5 B;  1CUN A;  3GA8 A;  4PW8 A;  4C5E A;  4ZGD B;  4M78 A;  4UC4 A;  1VQL T;  3Q2M A;  4C92 D;  3JB9 I;  2WWU A;  3HA4 A;  3OYH A;  3CCL A;  4YJ2 E;  3I55 A;  3PGG A;  4A4E A;  2DD5 A;  3WAJ A;  5GAO p;  4M78 B;  1VQK A;  4PK5 A;  3P8D A;  3HKB E;  3JCM c;  1HFA A;  3UPU A;  2KMT A;  4OB2 B;  2DWK A;  3OW2 S;  5LJ3 g;  4HCB A;  5FP3 A;  3E9F A;  4X1I E;  1HF8 A;  5C0M A;  2JNG A;  3AVS A;  2N1G A;  3CCM T;  2E10 A;  5JDH A;  3O8V A;  1BIB A;  4CXX A;  2O4X A;  3OBY A;  4L5G A;  4BJN A;  2YRV A;  3L2W A;  2UXX B;  3J7Y q;  5CIU A;  2JVV A;  4AQG A;  1UB4 A;  3CCJ A;  1D1A A;  2OA5 A;  4H63 H;  2NWB A;  1VOM A;  5GAN 5;  3SB2 A;  3CPW S;  4J2C A;  3GPL A;  4P0B A;  3KV5 A;  4H9N C;  2WSC E;  4HKE A;  4MMK A;  2QQR A;  1LRZ A;  5CKE A;  2Q9Q D;  3AA0 B;  3IF8 B;  5CQX A;  4NS5 A;  3KDS E;  4XQ3 A;  5GAM d;  4N0A C;  3ME9 A;  2PBI A;  4M75 F;  3SWN C;  4C92 F;  2LM9 A;  3V5U A;  4AQF A;  3JB9 H;  3ZMZ B;  3CCU T;  3QZ9 B;  2GCX A;  3W15 B;  2OAU A;  2R57 A;  1H7C A;  1WYC A;  1OZ3 A;  3V7S A;  1M5Q 1;  3QZ5 B;  3MZK B;  2QXF A;  5CKF A;  4AXP A;  1WJR A;  2NW9 A;  2XAQ B;  4DVD A;  4AKL A;  2ZM2 A;  3OA6 A;  1GXI E;  1VQ6 T;  4ZTJ A;  3OYG A;  3X25 B;  2E65 A;  3WAK A;  1IJ5 A;  2CXF A;  3KV4 A;  4XTY A;  3JCM f;  1VQ8 A;  1FWZ A;  3CXC S;  2DXC A;  1VQM A;  2HQE A;  2LSG A;  4OF1 A;  3KVA A;  3PUA A;  2K57 A;  2CM0 A;  3URG A;  2ZLY A;  3LW5 E;  3S4U A;  1BR1 A;  3QDR B;  1H64 1;  4IIJ E;  3LGL A;  2PU9 B;  5L3F B;  4CZZ B;  4CXW A;  4J8O A;  4JUY A;  1I4K 1;  4C8Q D;  4A54 A;  3JCM W;  4JRQ A;  2MOZ A;  3HKD E;  4BDZ A;  2LC4 A;  2RD1 A;  4UXN B;  3HP9 A;  1OZ2 A;  3CCV T;  4XTZ A;  3NTI A;  4KUL A;  1OYX A;  4MDW A;  4U72 A;  4EZH A;  2E8I A;  3MEV A;  2H7V C;  3LJC A;  3P8C D;  3M59 A;  1KC8 U;  1X6O A;  1YBY A;  4V1A v;  4J7F A;  5A0G A;  2P4T A;  1I5L A;  2V7L A;  4XTV A;  2OTL T;  4EZ4 A;  4N0A A;  2JN0 A;  4GYS A;  2RJD A;  3LGF A;  2V7J A;  2WSF E;  2I2L A;  4IUV A;  2LHN A;  3C51 A;  3OYN A;  3PIO A;  2EHO B;  3HKC E;  5J2U E;  1BR2 A;  3N2K E;  2CZ6 B;  2XDD A;  2X35 A;  2EYQ A;  1Q82 U;  5M9O A;  1YHQ A;  4EPC A;  4EOZ B;  2E9X B;  5HWX A;  4FT4 A;  3R6O A;  3FBZ A;  3T8O A;  2LQ8 A;  1XNI A;  3HL8 A;  2C06 A;  1ZEE A;  3OSS C;  5CCA A;  3ETU A;  3OMC A;  4M7A D;  3CQX C;  3CPF A;  2DTO A;  4HT8 A;  4WF2 A;  3KUF A;  4ZS3 A;  2XKO C;  3D0T A;  2XIC A;  1KC8 C;  3Q9D A;  4Z02 A;  4CI3 B;  3HHT B;  4YHJ A;  4KUI A;  5BMV E;  5LBQ B;  3LWH A;  3HRU A;  1KNZ A;  3N9N A;  3LYI A;  4P0A A;  5D6Y A;  1Q7Y U;  2IAK A;  3GMI A;  5EK2 A;  2KSS A;  2VAS A;  2H7O A;  4P09 A;  2CZ7 B;  3QSU A;  4EAH A;  3MP6 A;  1Q82 C;  4A4G A;  4ILU A;  5LJM A;  3M5A A;  4HT9 A;  1QP2 A;  1G8X A;  5LXT E;  5D6W A;  2LE8 A;  3NRY A;  3L09 A;  2MMP A;  5CR2 A;  4M7D E;  3G71 A;  4PJO E;  1IRE B;  3OS1 A;  3EFS A;  4MBQ A;  5JDL A;  3UUM A;  2A7Y A;  3L2Z A;  2WSS V;  2VXF A;  3CC4 A;  3J81 E;  3OS0 A;  2VB6 A;  3ANW A;  3CBP A;  4M77 D;  2N9D A;  1LVK A;  1Q86 U;  4MHC A;  1M90 U;  2JUF A;  4XTU A;  4PAG A;  1NPR A;  2A72 A;  4LDW A;  2RK1 A;  4M7A F;  1ZQ1 A;  3RC8 A;  3ANW B;  2CKK A;  5KE3 A;  4JUV A;  3LFM A;  5LYJ E;  1UGR B;  4EDU A;  5LJ3 f;  3HSB A;  4KBM B;  1Q7Y C;  2Y6X A;  2PJQ A;  4PK4 A;  3CMA T;  4LDV A;  2VXE A;  2Y4Y A;  5FRN A;  5DLQ E;  4PNI A;  2EQM A;  3OYF A;  2NW7 A;  4JEH B;  4IE7 A;  4ISS A;  5JDF A;  3CML A;  2PUK B;  2LT4 A;  5GAO l;  2V7K A;  2O01 E;  5FXX A;  5FY1 A;  2QQ9 A;  5CKH A;  2M9U A;  4PJM A;  1YJ9 A;  4O4I E;  5IN1 A;  4UVC B;  4ASK A;  4BD3 A;  3KV9 A;  2QDY B;  3ZBD A;  3KV6 A;  3K3N A;  2JRK A;  4E7I A;  2ACX A;  1UX5 A;  3CCL T;  3FJP A;  3CCR A;  3I55 T;  1Q86 C;  2Y4X A;  3CCE A;  2KZ7 B;  2V7I A;  3KXT A;  1HS7 A;  1M90 C;  4J5Y A;  1VQK T;  2HH7 A;  3FHN A;  2XK0 A;  2QEX A;  4C0D B;  1FMW A;  3C50 A;  5L2L A;  2MWO A;  2XTL A;  5LG4 A;  3LH0 A;  5CAI A;  2GFU A;  3I56 A;  5LJ5 d;  2HNI A;  2E5Q A;  5JDN A;  3X26 B;  4AKI A;  3WI3 A;  4DMV A;  3JCM g;  3N2G E;  3JC6 D;  2M0O A;  1X79 A;  4OB0 B;  4HE8 A;  2K3X A;  3ZN1 B;  4E47 A;  3I0O A;  4PFP A;  1G3Y A;  4C92 E;  4M75 E;  3PIP A;  3FB2 A;  3IEE A;  4B9W A;  3HFO A;  3CCJ T;  2V1D B;  3VUZ A;  5HAX A;  1LOJ A;  3HKS A;  3I9W A;  4L59 A;  3L3P A;  4L0R A;  1AHJ B;  3HRS A;  4LD9 K;  5HXC A;  2X9Y A;  2N2N A;  3R6N A;  2KT9 A;  5IT9 E;  3PDY A;  4X1Y E;  4DBR A;  2QQA A;  4IUQ A;  4O8S A;  4JRI A;  5KH6 A;  3UTK A;  4E7J A;  2DD4 A;  2VYT A;  2ZMA A;  3RKW A;  5FLX E;  2HQX A;  3C4X A;  3BDL A;  4JRP A;  3VYH B;  2YLC A;  4M78 D;  4PJO D;  2KY9 A;  1LNX A;  4BE0 A;  2CXD A;  2VC8 A;  1K9M U;  5FRM A;  3QXE B;  2WSE E;  5AFU L;  2B1E A;  2YIN A;  4BI4 A;  5CK9 A;  2RA1 A;  3EAE A;  3OYM A;  4OFZ A;  3LK2 B;  1VQ8 T;  1VQM T;  4ADZ A;  2H3J A;  1U4Q A;  5CKB A;  3B57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...