4XAXB

Crystal structure of thermus thermophilus card in complex with the thermus aquaticus rna polymerase beta1 domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CarD uses a minor groove wedge mechanism to stabilize the RNA polymerase open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription regulator
molecule keywords DNA-directed RNA polymerase subunit beta domain 1
total genus 47
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4xaxB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xaxB01
4ILUA 4XAXB 4KBMB 4MFRA 2EYQA 4KMCA 2LT4A 2LT3A 4L5GA 2LQKA 2LT1A
chains in the Genus database with same CATH superfamily
4UELA 4EYUA 2RK2A 4FYXB 2FUPA 4G2AA 4LF8T 4KUMB 2D1XA 3I5SA 4R55A 1N8RU 1QVFA 5LHGB 1YQ3A 5JRCB 4HCCA 4AXPA 3KXTA 3QYGB 3QKJA 3MKDA 4PJMA 1G3SA 3QIIA 3LW5E 1OEDA 3CPWS 1UFFA 2EIFA 5JR9B 1WHLA 5AQHB 2QDLA 4X1KE 1N6AA 3VRAA 2AT1B 4JJBA 4M7AB 4DR7T 2BS4A 4U74A 5FU7C 2RHXA 3M65A 4GLKA 1H8KA 3CQTA 2K24A 2L9QA 5EZYE 5CQYA 4X62T 3RKXA 5GAN5 3TVTA 1QVGA 4HN9A 2E9XD 5HXSA 2DLRA 5EC7A 2AKKA 2E5KA 2V7IA 5EK2A 5LYJE 1E7OA 3IQLA 5I11A 4DEXA 1JU5C 3M54A 1L0VA 2H3EB 3CCVQ 5LG4A 4DUZT 3LLRA 4LF7T 1WA7A 1VQPT 2XQ8A 5I21A 1GXIE 3IF8B 5TAOA 3RDVA 2IPOB 1KHIA 3RIFA 1SRLA 4NUVA 4O4LE 5DQVA 4HA8A 1I4K1 2B1EA 1RABB 3OYKA 4KT0E 4MDXA 2XQAA 4YJ3E 4OMMA 5HEUA 5CCAA 4YSZA 1H3HA 3RR6A 3KV9A 1OZ2A 3NPFA 3ZPOA 1OEDB 3OYHA 4U7YA 4HFBA 1M2OA 2CCQA 3CKDA 4FYVB 1OU9A 2XM1A 4P0BA 1NBEB 2QA4Q 3JC6C 2EJFA 1M90C 2X9YA 1SUMB 3QDFA 3O1IA 4DV5T 3ZCIA 1KSWA 5LG3A 4EOZB 3I55T 3RPUA 4X20E 1ARKA 2M67A 4FSSA 1VYTA 4JDSA 2OX7A 4JI5T 3EUHA 4LD6A 1O3XA 4PNOA 3ZKRA 3CC4T 2M1HA 1M62A 2IIUA 4FI5A 4M7DA 3OYGA 5LJ5j 4U2YA 5AQKB 1M27C 2H3JA 3M0RA 2EGCA 2CP7A 3CCEQ 5LGUB 1YITQ 2FRWA 4HWIB 3PUAA 3RKOA 3RGLA 4LDUA 5CGMA 1QWEA 2D8HA 4LDWA 3CX8B 2I0MA 5HEOA 3Q9DA 5L3FB 2D8JA 4AKGA 1ZLMA 2E5VA 2XDPA 4HFDA 2LTOA 3ZMSB 5JR9C 2M16A 2E4HA 2RI3A 2YDSA 3OVUA 4HFIA 4HGAA 2V5DA 4F6RC 1ZHCA 3EGUA 1YJNQ 2VKOA 3GBQA 1I6ZA 1TH7A 1BR2A 3AE3A 3UU3A 1TTHB 4JUVA 2EQUA 1YIJT 1ABOA 3CD6A 3CIRA 4AKLA 2XDDA 2V1RA 1HS7A 4C92E 4X9DA 4HVWA 5J2TE 2F2VA 1VQOQ 2FZCB 2WQYA 2CSQA 4BDYA 3AE2A 4I4TE 2NUPB 1UUEA 4U72A 5L8RE 1VOMA 1C1AA 2FJEA 1KJWA 1QVPA 3OYMA 4NL3A 2Q9QC 1MUZA 4CN4A 2CSIA 2CLYB 2MOZA 4LDXA 2DWGA 2DXTA 4MHCA 2RJFA 2X68A 3L2UA 1UG1A 2YU2A 5FP3A 3CWZB 4IE0A 2WMOA 3UUMA 4OK0A 3ZYLA 2LSYA 3H3MA 2DVEA 4FW1A 1JJ2S 2X3WD 4IE4A 3KFVA 5KH6A 3LWHA 1UCUA 3FZLB 4X66T 3OYFA 3CC4Q 3SWNC 4J9CA 3FRNA 4AQFA 2EHOB 2RQWA 1WHKA 3TCJA 5GAN8 4DMWA 3ZN0B 2L5QA 3CCET 4LNPA 4C92B 4MZMA 2CPTA 1YFNA 1QWFA 3FB9A 1UX5A 2FBWA 5CAIA 4U31A 2JTEA 2YWWA 1YJWA 4OF1A 2WMNA 2EVRA 1VIEA 1BR0A 2IDOB 4Y28E 2ZPEB 3RHWA 3VUZA 5GANj 3CC4A 3RERA 2W0GA 2JTMA 1B34A 3ZFJA 4LMJA 1PG5B 4BI8B 2LOSA 3J80E 2UXCT 1ZP0A 2JQ9A 1WQWA 2LJLA 1Q82R 1YD8G 4J5YA 2QYWA 5LP6E 4EGWA 2KRMA 4TV8E 1I1JA 3GPLA 1MMGA 3BFMA 3AEFA 2UU9T 1V1CA 3OYAA 1UK5A 9ATCB 5JREA 2DCFA 1QCNA 2X3XD 1RAFB 2DNXA 4E47A 1ZOYA 3G71Q 3H0FA 4JPBW 5FVKA 4M1PA 5FL0A 5JQGE 4GKKT 2WZHA 1BR4A 5L3GB 1HFAA 2GGRA 4KH0B 3SHWA 5CIUA 4M7DF 3F2EA 4QHOA 1JQQA 3PUGA 3ZC0A 2K6DA 2RJDA 4QX7B 3H9NA 3CC2Q 4EPCA 3SOLA 5AQSB 5L3BB 1NEGA 3RH3A 2CWOA 1YIJQ 4B9XA 1S72A 1RAAB 4K0UA 2LCLA 3ZCJA 1XMQT 1YWOA 2RPNA 3G7ZA 3UT1A 3KV5A 4BACA 3O8VA 1QKWA 4AIUA 3TREA 3P7IA 1UJYA 3OYEA 2E64A 1K0XA 4PW8A 4JZ4A 4TZ4C 2LT3A 1RAGB 2J1DG 3MZKB 3C95A 4M77E 3BQKA 5AQIB 1G3YA 1N32T 2HQEA 4AG2C 5ABEA 5IXBA 4PLLA 4XTZA 1J3TA 3SWNA 4JI4T 3LDQB 2KY9A 3A5XA 2DEUA 2K79A 3QB5A 5ABGA 3EGDB 3S3NA 1WR0A 1E7PA 2ODVA 1IBKT 4C0FA 3OSVA 2RH2A 5IHNA 3CCLT 2EHOC 2UXNB 2R57A 4AQYT 4OVAA 3DTOA 5LBMA 2E3HA 4CI3B 5HKCA 5IHIA 2ED1A 4FIBA 1ZHIA 2DL8A 4HKEA 2BUDA 3I56Q 1ZV4X 1K8AU 3THKA 4RG2A 2XAHB 1RUWA 2VKJA 1B3QA 3FIFA 2DL3A 4M77C 2DRMA 1Q7YC 2MAMA 1ZSZB 3INZA 3ANWB 2LX9A 3CCVT 3REAB 2JS0A 1S94A 2E10A 3TSZA 1I8FA 5L3CB 1NLOC 4J7IA 2W63A 4IREA 4U2ZA 4BJMA 1ZSZC 1M3BA 1K9MR 3L2WA 2QDYB 2HSEB 2F5KA 2CBJA 5IH2A 1QCFA 3ASKA 3VR9A 3K3NA 3AECA 3S6WA 5KYUB 3JCMe 1FJGT 2P0PA 5C8YE 3JCFA 4II1A 2WBLA 5A1LA 4X65T 1UTIA 4M78E 3JB9I 4PJOB 2VVNA 4BI3A 2PVOB 5GMKl 1BCMA 5IXFA 3AE5A 1CKBA 1QQJA 4ZN3A 2CRBA 3P4PA 2I2LA 1D0XA 3P4RA 4ZGDB 4M7DE 1D0YA 4JI7T 2EKOA 4YTLA 2G6FX 3QBYA 4Z90A 4AQFC 5LJ3g 4EAHA 5JDFA 2YDLA 1Q82C 3G06A 1KD1U 1Y0MA 1FX7A 4M75D 5FU6C 1NENA 2A3LA 4PJOG 2XG8D 5DLOA 4BD3A 3EGXA 1LCKA 3CMLA 4C0GA 4HTEA 5HXHA 1Y01A 4LDVA 1FEWA 5KYXB 5HEGA 2GTJA 4HKAA 2EJGA 4UVAB 1UHCA 3C94A 3HI2A 2Q9QA 5AQUB 2YKSA 2F2XA 3N9NA 3FBLA 2NW7A 2COZA 5GAN7 3RQWA 2ZPGB 2JQKA 4RTXA 4UF0A 2A36A 3P8HA 5AQQB 3OS1A 3CCMA 4A5XA 5C3JA 1WHGA 3DKMA 2WZIA 3P4QA 4F8HA 2HKNA 3OS5A 2LP5A 3BE3A 3CXCA 2RHYA 2ACXA 3GNGA 2Y90A 2XUEA 3CD6Q 3P8CD 3CC2T 4J9EA 1JO8A 2LQNA 5FMNA 1D1AA 5FYMA 4YTPA 2V7KA 2CKKA 3A98A 2JQQA 5LXTE 2EQKA 3M4GA 1IB8A 2NW8A 1K1ZA 1D09B 1M9SA 2VL8A 3OYBA 4EZ4A 2RQRA 1WCRA 1PC0A 1N8RC 1KIKA 4PFOA 4ISTA 4LD9K 4JLIA 2VWAA 4CXXA 3VS6A 2X4YA 5JDHA 2DE0X 3ZC1A 1PHTA 1X75C 1X79A 5LJ5g 4YHJA 1UJ0A 3KBTA 1AJ3A 4BE0A 3HTRA 2GNCA 2O4XA 2BZ8A 3N9OA 1UURA 5M9OA 2GQVA 1VQ6T 3NZPA 6AT1B 1BR1A 4IL9A 4BY6C 2D0TA 2Y4XA 4IKFA 4JEHB 3RRCA 4BE1A 2K9AA 3EAEA 1PKSA 2K9GA 5CVIA 2MWPA 4DOWA 2LQKA 2V26A 2PJQA 5GMKi 2WCAA 4TV9E 4JRQA 4MMLA 4M77G 4ME7A 2BE9B 5IHKA 4QWNB 3F31A 1M2VB 4KGXB 2CHNA 4KH1B 1AZEA 3OYCA 4M77D 4DV3T 1VQMA 2H7VC 1WR6A 4XTWA 3V5UA 4DV1T 4RTUA 1Q86U 5CJ5A 4ZI2C 4YJ2E 2E1HA 1VQ4A 2QGFB 4PAGA 3AB3B 4NUUA 2V6YB 2N1GA 1GBRA 3AE7A 2A2FX 3ONXA 3L8RA 3RRWA 3CCMQ 4IUUA 5AYFA 2G3RA 3OSSC 3AVSA 5GONE 1QVFS 1PRLC 2DYBA 1KQSS 2KT9A 3LBXB 2DI4A 1MGQA 3A8OB 3HKBE 5ECAA 1H92A 3O1HA 5GMKj 1SHZC 4OMFB 2HKQB 1Q95G 3VKGA 2OTJQ 4H9PC 2DIQA 2HD0A 3MP8A 4M7AG 1FYNA 4M7AA 5JDMA 4A4HA 1Q86C 3L2ZA 4A56A 2KR3A 3P8DA 2CXFA 5F3JA 2YLBA 3AEAA 4RTZA 3RIUA 2YN6A 1YQ4A 4FT2A 1VQ7A 3D7SB 2VGNA 3MJXA 3RKYA 4N4HA 3CX7B 2F69A 4DBHA 2YT6A 4KUDK 5GAOl 1WYXA 1QVGS 4A98A 2X9HA 4GBQA 2MF2A 4JI3T 4M75C 2P0QA 2BS2A 3BK9A 3A1PA 3L2QA 1UGSB 5FWBA 1JXMA 3K8PC 2DBKA 2KVQG 2X51A 3NMZC 3MK7C 2OAUA 4XTYA 3I56T 1YI2Q 1E6GA 3REBB 1LJOA 4YY3T 1M30A 3NRXA 2AZVA 3HRTA 3Q5DA 4YLHA 1FWZA 3VRZA 5AQOB 3IA3A 2KQWA 2XQ4A 4HVVA 1KNRA 3CMEQ 1K8AC 1VQLQ 3RC3A 3MEVA 1TSFA 1T7SA 1BYMA 3I9YA 2RD1A 1JJ2A 2WU5A 3LK3B 1TWBA 1MNDA 3EHQA 2KYBA 1NAFA 1D1CA 3V7RA 4DR1T 2DJZA 2PU9B 1W0AA 2ZAEA 1BIBA 5CQXA 2WDQA 5LB7B 4OMOA 3M55A 1YJNT 4AG1C 3ZJ1A 5EK3A 4E7ZA 1E1HB 4YT0A 5ABFA 2DK3A 3PUWF 2EW3A 1KHCA 3ULRB 3CCSA 3BDLA 3M0QA 3H0HA 4EIKA 4TUYE 2QQRA 5KMGP 4M7DG 4AI6A 3RF1A 4F16A 1XZYA 4KHZF 2AXDS 4AFUC 2EKHA 2FZKB 3JCMJ 4CC4B 2DFUA 2EYWA 3F70A 3PUSA 3VKHA 2JMCA 1M1KC 1K9MU 3HR0A 1G8XA 3SFMA 4DUYT 2CT4A 4RMOA 1UGRB 3UUBA 1VQ8A 1NEKA 3EG3A 2CUBA 3ER0A 2PFVA 2LSJA 3OJAA 2DX1A 4KX6A 1B7TA 1W9RA 1IGUA 2DL1A 4AFQC 2CP2A 2JXBA 3UPUA 2JQHA 3FB2A 4J6YA 1Z0PA 3Q5WA 4F7UF 1I81A 3A8GB 3CC2A 5FWCA 3J7AF 3EFSA 3ETVA 5LJ5h 5CA0E 5IUXA 2IIMA 4A53A 4GOUA 5LJ5f 4CI1B 5GAN4 1G3WA 3CCSQ 3UFEA 1N9SA 3QWYA 3VR8A 3J7Yq 3H37A 4EEBA 4C92A 4C0DC 2GCXA 3E9GA 5J1GA 1A0NB 4J6WA 1LKXA 2KEAA 3AE6A 3KV6A 1ZUKA 1K73U 5HWYA 4XZCA 5L47A 4H9RC 1M1KR 1Q7YR 3P4SA 4XTXA 2EHOA 4ZZCA 4M77B 2YOEA 5J2UE 2DJQA 5IYZE 2NLUA 5CKEA 2FJAA 1KQSP 4Q25A 4ZHQE 1VQKQ 5LMUT 4TWHA 3DB3A 1AWOA 3SFDA 3B13A 2R58A 3NTHA 3VS1A 2MPKA 3CC7Q 2HL3A 3DLLA 3FC3A 2LCSA 3CCLA 1N36T 2P0KA 4TWDA 1T3SA 4KI0F 2EQIA 3OS2A 1SHGA 2MTQA 3MACA 1W4SA 3CCJA 3WI3A 2OV9A 3GLXA 2QGGA 3FZFB 5LCYA 4H9NC 3U23A 2KT1A 1YJWQ 3HFOA 4F04B 1K76A 1WZOA 3JCMh 5L4EA 4R0KA 4RG8A 2RP4A 3LJCA 5JDGA 1N27A 2BE7D 2VVSA 4ADZA 4ERRA 2XD0A 1XNIA 5DJQC 2MAWA 5JDQA 4XTVA 2HH7A 3SRZA 5LA6E 3ESLA 4IDOA 2CZ7B 2FYKA 4QW2A 2QEXT 1K8AR 1YCSB 2LSIA 2CEAA 2MPXC 3KBGA 4Z88A 4N0AC 1P92A 2D0NA 4BAYB 4EMKA 3EFRA 2BBHA 3PT9A 4H9SE 4DBQA 1IRXA 2E12A 4GYRA 5JDLA 4CC2A 1KG1A 1QLBA 3EFOB 4UF0B 2BG9E 3PUXF 3KVAA 4YTMA 4CXYA 3SD4A 1UEBA 5D6XA 5D6YA 1YKHB 4HCKA 2V7MA 4AFZC 2RMOA 2PZ1A 2EYXA 1VQOA 2HNIA 4M7DB 3M58A 2CDTA 2YHTA 1VQ4Q 4DNDA 2Y4YA 2VASA 2LNHB 4M78D 3G71T 4N0AA 2KMFA 5GAN6 2JUFA 3QK6A 4GKJT 4LXCA 3EDVA 2MK5A 4B3ST 1Z9QA 1YNZA 3MA9A 3Q1JA 2JM8A 1VQ8Q 3VHLA 2QTXA 1UE9A 1W6XA 1MV0B 4I50E 4QT7A 1YHQT 2DWKA 1RI9A 4QKNA 2X4WA 1Q7YU 1K9MC 1M1KU 1RADB 2IUBA 2FG0A 2Z6EA 5BR8T 3L2VA 2RA2A 3SB2A 2BDEA 4ZI3C 1LNXA 3M5AA 5GANe 5AQTB 3I35A 3Q2MA 5LOVE 2YRCA 2DBMA 3T1YT 3MPUB 2QA7A 3CCMT 1IZNB 4DV7T 1N5ZA 3EI0A 4WF2A 3CCEA 1EX4A 4B6MA 2X0LB 4C92G 2J47A 4JEUB 2UUCT 2BIVA 4WBNE 3ONLC 4QH1A 2L8KA 4E7JA 2CM0A 2J7IA 1F1BB 2FZGB 4ISSA 2HAXA 4LFCT 3CMAT 2A28A 3K3QC 5FXXA 2KSRA 2JJ9A 2RNAA 3JCMb 3JCMc 2DPPB 3E9FA 3CK6A 3KUFA 3JC6D 4P0AA 2R5MA 4B3RT 2QG9B 1OEDE 3QO3A 1I94T 2CT3A 3S3OA 1YHQA 5C2TA 4UVCB 2RI2A 1HTJF 3PUQA 1I07A 2O2OA 3A7MA 4LF9T 1SRMA 1YITT 3NRYA 2C5IT 2XSAA 4X1IE 3LH5A 3JAEA 3CPWP 2KYMA 1KC8C 2VQET 1VCTA 5KYXA 3CBOA 4Z8AA 5LBQB 3SWHA 1RAHB 4CC7A 3LGLA 2F4VT 3CXCP 1GL5A 1ZBJA 3TLVA 2DL4A 2DERA 2A08A 3EGDA 3ME9A 1U3OA 5LJNA 5JDNA 2XMFA 4KGVB 5JR9A 2YSQA 5A0DA 2CZ6B 3HL6A 4MFRA 3RYFE 1AOJA 5KYYA 2XAJB 1KEYA 4OHFA 5GAN3 2KWIB 5GAOm 4E7LA 4CN6A 3MCAB 1G2BA 1S1NA 3LSVA 4IIMA 3PFSA 5JVDE 3KVBA 3GN5A 5FLXE 1Y07A 4PJOA 3UQ4A 3G4SA 1W2BS 3FHNA 4FW2A 3JAFA 3C98B 3HL8A 2CWYA 2XHEB 4A4GA 2VXEA 3Q5EA 1ZSGA 4C8QG 4DO0A 2SRCA 1QSDA 3UQ7A 4LUEA 2CS7A 2XK0A 1Y96B 1WHMA 5KYUA 2RPAA 3EGXB 2JIWA 2Y48B 4NXNT 2XAQB 2W61A 2E6NA 1J5WA 2BG9B 1PRMC 3AXJA 4C8QF 1G3TA 1PM3A 3QB5K 2XU8A 2I6HA 4HWDA 2DMOA 5GAN2 3PNWC 4X5TA 1HNZT 4E6RA 1HCIA 1IXDA 3OBVE 2O31A 3CD6T 1RAEB 2AK5A 5FKYA 2Q9QD 1O9SA 1HG5A 2J4GA 2CLYC 2C0TA 2ROLA 1I5OB 2WS3A 2CP5A 2FVUA 2OLTA 3WAJA 4XU2A 3VYHB 5JRCA 3OA6A 3OW2S 1YJNA 2IW5B 3P8BB 4HFHA 4DBFA 4JJNK 1VQ4T 3K1SA 2VURA 3RIUC 2LRKA 4EMHA 2C06A 3FZMB 2NUTA 5L3DB 4QXBB 3EVYA 1J5ET 4M75A 2KI7A 1X01A 2KZ7B 4FT4A 5ETWA 2ACZA 3N9MA 1T0HA 2ECZA 4O5VA 3PJAA 2BKNA 3OB9A 3V7SA 2D2SA 3CCQA 4Z89A 1TUDA 1HK9A 2DXBA 5FROA 2DETA 5BMVE 4O8SA 3CMET 2KAFA 2V6YA 1VQLT 3JB9H 4JZ3A 2H89A 2O9SA 4DMVA 3HP9A 5KYWB 4UV8B 2PQWA 3L1AA 3OY9A 4QVZA 1PSFA 2XDBA 2CZ1B 2L8DA 3I0QA 5J0ZA 2LRQA 2KXDA 2LX7A 2V8JA 2ZZDA 4GK5E 4ILBA 2K5FA 5GANh 2LE8A 1WHHA 5FVLA 3AEDA 3JADA 3ZMZB 3MO8A 4X34A 2NP9A 4M7AE 3ZT5A 2BVMA 4HEAA 4AFSC 4IUVA 3OMGA 1KD1R 1HJDA 3ZSSA 2CXLA 3C12A 3FDRA 3CMAQ 4IDPA 3M3ZB 1NPRA 1Y71A 1OQKA 4CN1A 1JRIA 3G4ST 1WNLA 1NG2A 4EEDA 2DA9A 5DM7R 3EG0A 4C0ZA 5FRMA 4HFVA 3E1SA 5AQPB 2FPDA 2XI9A 2RF0A 1XDPA 2YUPA 3W15B 2HHHT 1TU0B 4LF6T 2IHR1 1E6HA 3J9X1 1V29B 4F7UG 3EG2A 2JMKA 3QC9A 2CH4A 2IC6A 2WWVA 4PNIA 3JCMd 2M51A 2KLQA 5J39A 4BI4A 1VQ5Q 1KFYA 2NR4A 2H3RA 3CPZA 2K4YA 2KSSA 3I9QA 2JW4A 4J9BA 4OMQA 4L6V5 2W0ZA 1PWTA 3UUNA 3CCVA 4D6WA 1HF8A 2L3LA 2XTLA 4DV2T 2KWHA 3CCST 1QW1A 1S35A 4I0UA 2JNGA 3JCMf 2LHNA 3AA0B 1NYFA 3V7CA 2NWMA 1X6GA 1WLXA 4QXCB 4DBRA 2NUPA 2ZGWA 2KGTA 4TNWA 1OI1A 3OQ5A 2EQJA 4N78D 4PK6A 5AQLB 3QJ6A 1VQNA 3ZEHA 4C92F 2XAFB 1NEBA 5DABA 1HNXT 1AEYA 3D0TA 1XTDA 2C0IA 3FXEB 1MMAA 4NS5A 2W00A 2HL5C 3R6OA 2E5QA 5HEHA 3DB4A 2KRNA 1E2AA 4OMLA 5I2MA 4ZEYA 1ZBXA 3HPWA 3HHTB 3G6EQ 2PTKA 2EYQA 3N5BB 4M78A 1TUGB 4CC3A 2PUOB 3EH2A 4IURA 5H6QB 3UATA 2X67A 5HK0A 1CUNA 5AFUL 4J9FA 4DEYA 1AZGB 5A0GA 4DOVA 3O5ZA 2DEQA 1MMNA 2UUBT 2J6KA 5FU7B 5GMKe 2J6FA 2WSCE 2W4XA 1TS9A 2O01E 1Y7XA 2WSEE 1IAPA 2VK9A 1JNZA 3BY7A 2VXFA 3QZ9B 5D6WA 1AWWA 1AT1B 5AQVB 1U5SA 3DLMA 2CMRA 4MDWA 1U5PA 4L0RA 4ZXLA 4ANJA 1OPKA 3M0SA 2LM9A 5LHIB 3OYYA 5HCJA 2QEXQ 5L4HA 3C50A 3RYCE 2LNVA 3QZ5B 4M75E 4V2SA 2QYZA 2BZBA 4EB6E 3PGGA 5GAOp 4O6JA 2LM2A 3AA6B 4CXWA 4C8QB 3GOXA 3IHRA 2JN0A 1Z9ZA 3AEBA 3KINB 4M7AF 2RHZA 1GRIA 2QRXA 4U33A 3JB9D 2CE7A 2W62A 2CUDA 2KK4A 3BQLA 4PK5A 3FXDB 1I0CA 1KD1C 2BKOA 1Q82U 2K3XA 4BE2A 2VKDA 5ADXL 4EMGA 3ZYKA 2E5LT 3CC7T 1KC8U 2KXPB 2N9DA 1HXDA 2K3YA 4UV9B 2VQFT 4QH4A 2HQXA 3VS0A 5HXCA 3QNUA 2NUZA 2DAQA 2UXBT 2F2WA 1MNEA 1LOJA 2YEVC 3VRBA 2PBIA 2QXFA 3O4XE 4F7UB 3IBPA 3G1JA 2CGHA 2C5KT 3L39A 4C5GA 4GLMA 4LMKA 2MI6A 1Q81R 2V1DB 2QQAA 1OPLA 3ETUA 3AE4A 2LMJA 1KQ2A 3PU8A 1UGQB 1M90U 3A8LB 5CKBA 2HN2A 2EFIA 4C8QE 4Y91A 4C92D 3HRSA 3CMEA 1VQLA 1HG2A 3MEUA 4AMCA 4UIGA 5AQFB 4QX8B 2WDVA 1HX1B 1BCOA 4CI0C 2KXCA 2LQ8A 1B34B 3RYIE 1X6BA 3OMCA 4GY5A 5ABFB 1GCQC 2WU2A 1RAIB 4P5NA 3X24B 3AAAB 4EYYR 1PSEA 1UB4A 4HFEA 3ZMVB 4C91A 3MHXA 1WYBA 5CO7A 5HYAA 2NUTB 4OYKA 1SA0E 5F5WA 1X2QA 1PNJA 4MLKA 3K3OA 4IDNA 4WZXA 1IGQA 5C6SA 1JEGA 1HYOA 1OWAA 4JLGA 4XBFB 1SEMA 3M0TA 3NTIA 3X28B 1N34T 4F17A 4DV0T 4JJCA 3CCJQ 2YUQA 1KNZA 1VQKA 2PVGB 7AT1B 4ZI3D 4BB7A 4EXTA 3HKSA 4IUTA 3J81E 4Q5WA 1WI7A 1Z8UA 4I43B 1BIAA 4OB2B 2RB6A 5DLQE 3IEEA 3FZKB 2GQIA 1IBMT 3CX6B 3MP6A 3ONJA 4M7AC 3B5MA 3EHZA 1RLPC 3MP1A 3PUZF 1H641 2PG8A 3R84B 1R0BG 1M3AA 1UUSA 4JYAT 2P4TA 3QJYA 2VVKA 1YJ9T 3GIBA 2AE9A 2DD5A 2C5JA 1XNQT 4Z8XA 1VQPA 4JV5T 1UGVA 5KYWA 1K0SA 3PV0F 4ZZBA 3E2UA 3T1HT 4JI1T 1LVKA 1VQMQ 2X66A 2X9WA 4FCYA 1K73C 2Y8DA 4HVUA 1ZUYA 2QTVA 4ATOA 4RTTA 3RX6A 3JV3A 2A9UA 3EDUA 1WXUA 2PNIA 5KE3A 1T8BA 1VQKT 4L9IA 3NZQA 2PVDB 1XNRT 2W2UA 1OU8A 4EZHA 4M75B 5DQWA 2A3DA 2WDRA 2FL7A 2X4XA 3N9QA 2N2NA 3TLSA 4ORZA 1Q86R 1NLPC 1RACB 3HKEE 4J83A 4G63A 1JJ2P 1M5Q1 2ES0A 5HY6A 1FMKA 3N9PA 4K0KT 3GP8A 1UGOA 3ZJ2A 1U1TA 3VUBA 4KP3C 4A97A 1YIJA 4IT4A 2L3QA 3JSCA 4TNVA 1AHJB 2E9XA 2FO0A 3DJBA 4PJOD 4IL4A 5CR2A 2KE9A 1M2VA 4M7DC 3I9WA 4PFPA 1W2BP 2DL7A 1SPKA 2OTLA 4OYJA 1ZX6A 3JCMQ 3V8JA 4OFZA 2B76A 3CBMA 4ZGEB 2B8AA 2W66A 2AIRB 4J9DA 3AA1B 4V1Av 3EG9B 2QVAA 5HCKA 2YDQA 4JI0T 3OBYA 3OS0A 5CB4E 2O9VA 1GCPA 1D0ZA 1ZA1B 1G83A 1BK2A 2E70A 1OEDC 2XSBA 2J6OA 1YI2A 5GANd 4PJOE 4J7FA 5HK3A 1OXZA 3I0OA 2HZYA 5IN1A 1PKTA 3AT1B 4RTVA 4MALA 3LGFA 2RJEA 2M02A 2ZPBB 4DV4T 5KYYB 1VQ9T 4P09A 4TN7B 1X27A 3CCUA 3LWIA 3OW2P 2BZXA 5LJ3h 4EV6A 1MIVA 5FU6B 1IREB 1Y96A 1UX4A 2XQ7A 4K11A 4A63B 3QPHA 2LT4A 2PTFA 4JI6T 4LDYA 4BY6B 4HCBA 1Q81C 3GWHA 3KDSE 4QQDA 2SEMA 4O2BE 2G0UA 4E7HA 4KBMB 2XQ6A 3CQCB 2IC9A 2LRLA 5HCMA 1W1FA 2MCNA 4RKUE 1VYVA 4LF5T 3ZT6A 2W10A 4PJOC 1B07A 4XU3A 2RHIA 3P50A 5AT1B 4PLIA 3G4SQ 2M6BA 3AXJB 3NVOA 1VQ5A 2KNBB 1M4ZA 1N8RR 5D7UA 2AHJB 2QAZA 3AEEA 4PFZA 3UF4A 1HX8A 3BQIA 3L09A 3CEYA 2H88A 8ATCB 4JI8T 3UU6A 4OX9T 1IBLT 5CKDA 2EGAA 2FEIA 3OKQA 3ABVA 5FY0A 3SEMA 2E8IA 3TEEA 2HEQA 1IZ6A 3PTRB 3PUYF 1QCOA 3H8ZA 4IUQA 3ZBDA 3CMAA 2MBGA 4KHPT 1BI2A 3RLFF 1QUUA 3PMTA 3E22E 2Y6XA 1YJWT 5L23A 1US7B 2HPJA 1OV3A 3VS3A 3QOFA 2VGMA 2WB5A 4FYWB 4O4HE 3RESA 2FJDA 1YITA 4EMKC 1ZEEA 5CA1E 3OYIA 1PD1A 4X1VA 2RQVA 2AZSA 1TUCA 1VQ6A 2V8KA 3VS2A 3F57A 4KULA 1SHFA 2MOXA 3G6ET 4C90A 1NJIR 4OMNA 3TU4K 2YDRA 3UU8A 2E9XC 3LK42 3VU3C 1WJQA 3JAME 1H3ZA 4ELZC 3EABA 2YINA 3HA4A 3LK2B 1YBYA 3RC8A 3CBPA 3CCJT 1C0MA 2DZ9A 4QVCA 3RKWA 2LKHA 2CP6A 1R0CB 4M78F 3QYHB 4JUYA 1R77A 4Y92A 2FPEA 3WVEB 5LNKA 1BI3A 2V7LA 4PJOF 3EH1A 3I55Q 1R8OB 3TQ7P 5L2LA 4IE6A 2A0FB 3CPWA 4QKUA 1WJRA 3OYXA 3SFEA 3C0CA 1S72Q 4DR4T 2KT8A 5LJ3e 3R6NA 4RTYA 4R56A 5F8PA 5FL1A 4EDUA 2GK9A 4IIOA 3MXZA 2QA4A 2WSSV 3O1JA 2ZPFB 4JS5A 2JPFA 5LHHB 1TOVA 2JVVA 4QQGA 4YHHT 2VKHA 3JB9J 3VV0A 5J3BA 2C0OA 2HN1A 1MHNA 1WXBA 5IHYA 2RI5A 4C0DB 2KNDA 2QQBA 1EZZB 3WVDB 2VWFA 2VYTA 2IAKA 2DXUA 2F1LA 5LJ3j 5A2QE 2F5TX 1M3CA 4A54A 4LFBT 4TVRA 3HKCE 1HNWT 2D0QB 2OJ2A 1KNPA 2PUKB 3QXEB 4C92C 4NL2A 2GF7A 4C5EA 4AISA 1KF6A 1NYGA 2K7AA 3A8HB 3QG1A 5LL6S 2E65A 1GQEA 2A72A 4C8QC 3QSUA 3VKIA 3TLUA 2VL0A 3FJ5A 4WW0A 1ZUUA 4QXHB 2CP0A 1K9AA 1TXQA 4C5HA 1VQNT 2P9BA 3URGA 2UUAT 4IIJE 4E7IA 1NE8A 5LJMA 2BG9C 2OAWA 1EFNA 4OGEA 1CKAA 2Q9QB 3RI5A 1NM7A 4GIWA 2HQHA 2E41A 5E0OA 1IO6A 1GCQA 4PK4A 2BBJA 1WPYA 2CH4W 2VB6A 3L2RA 5FRNA 4B3MT 2R5AA 5LGTB 3BW1A 3EG1A 8AT1B 1M90R 2DKGA 5EG2A 2XZEA 4ZGJB 1VYUA 1QVGP 5FY7A 2SPCA 1YHQQ 1VA7A 2L2PA 4DR5T 3CC7A 2GBQA 4JRPA 4U7IA 2KBTA 3JCMg 3C4ZA 2QQ9A 2XIDA 2YUOA 1W09A 5HEJA 4WTOB 3C4SA 3JCMW 4OMPA 2XPKA 4NPPA 3ZL7C 4F7UE 1KC8R 3KBUA 2RK1A 3L3PA 3QDRB 4X9CA 2K3BA 4J6XA 3NHNA 4N4GA 1N33T 2K48A 1M1GA 4ASKA 1AWJA 4HT9A 1RLQC 2V8IA 2LHRA 5GAOq 1K73R 5GAMd 1QVFP 3O9XA 3CXCS 3VJPA 4KMCA 1LPLA 1GBQA 2UXDT 4UC4A 2NW9A 2LEHA 2BZYA 1WLPB 2M9UA 3RNJA 2O4XB 4ZS3A 4ZNXA 2JTFA 3X26B 1QP3A 3JRZA 1AD5A 5KDMC 4IUPA 4E7KA 3GN5B 3C4XA 3UU4A 2COWA 1WGSA 2VC8A 1VQOT 4LN2A 3UT5E 2E9XB 5LMNT 2LT1A 1YJ9A 2LJ0A 2X0YA 4YFSA 4BJNA 4IE7A 5GAOr 5ABHA 2QQSA 4YSXA 1VQMT 4UR9A 3V8LA 4JJDA 2DTHA 3M0PA 3EAMA 3JB9F 4EMKB 2ESWA 3CCQQ 2MWOA 1T3LA 1MIWA 4M7AD 4B9WA 1NJIC 4CZZB 2L3PA 5GAMf 4JI2T 4WBOA 2DXCA 5GAMh 2XHCA 4ZTJA 2JZ2A 1MMDA 2XY8B 2XKOC 3PVLA 5FNVE 3VS5A 3UU5A 3M59A 1OX9A 4FL6A 4HWCA 1QMCA 3WXMB 5A0LA 2FPFA 3G6EA 3ZT7A 4LUDA 2EYYA 3ZMTB 1ACMB 3LH0A 3NKZA 2RQUA 2W67A 4YSYA 2H8HA 1T72A 2LCCA 1BKBA 2D0UA 4JBWF 3H0IA 3UFGA 4GK0E 1QLYA 2YRDA 3RQUA 2XASB 5LJ3f 4F7UA 5GAOn 3TLWA 2WAUA 1X6OA 2RN8A 4LF4T 3X1DA 1MIYA 5AQJB 1M1FA 1WFWA 4WNKA 3C4WA 2VKNA 2K2VA 2K5LA 1FXXA 4DR2T 3M0UA 5FXZA 4TX5A 2JMHA 4QQ6A 1DU2A 1YXRA 4PJNA 1VQNQ 4CI2B 1WJSA 2YXYA 4DQ2A 2J06A 1I5LA 4C8QA 4IDQA 3KFWX 2LJ1A 3N9LA 1GFCA 4KRTA 4DV6T 5AQMB 3NBXX 4H9QC 2JOYA 4BUGA 2HBWA 2GFAA 5KCHA 2X35A 3CPFA 5HXRA 2DZCA 3N2GE 1ZQ1A 2KROA 4IE5A 5GMKm 1W70A 1VQ9A 2KINB 4P1NA 4L59A 4M77F 2OTJA 2DO3A 2OTLT 2VUBA 3CVRA 4OB3B 4M78G 1MV3A 1BBZA 4J9GA 3NGPA 2X9XA 4A4FA 1CHUA 2K5BB 3ZMUB 1V76A 3RKGA 1VQ7T 3JCMX 4A4EA 3PJAJ 2DTIA 4WYVA 3X25B 2RO0A 1YW0A 1WHJA 3FLGA 4B6XA 3A8YC 4KGZB 5J26A 1K4US 1D1BA 1OEBA 2NYSA 4IHJE 2K2MA 1UECA 3S3MA 4X1YE 1XMOT 4JRKA 4ZI7E 2WACA 2YUNA 2XQ9A 2YK0A 3V8KA 3UWNA 3N2KE 3ZLIA 4N4IA 3KV4A 2P84A 4HCZA 4TWFA 3QUIA 1U8RA 4M78B 1UGPB 2LJ3A 3SS1A 5LJ5e 1NJIU 2L89A 2EGEA 2DM1A 2BKPA 3I1AA 3LBXA 2MIOA 3GA8A 3H3AA 3S4UA 1M8MA 2HPLA 4O4JE 4AKIA 2OTLQ 4HFCA 4XU1A 3PE0A 2QGSA 3RUXA 4ILAA 4B3TT 5CK9A 2L3SA 3N5LA 2LKGA 5FXWA 2DHRA 5H6RB 1JXOA 2V1QA 3UA6A 4ZTFA 1KQ1A 1KFZA 1R8IA 1AWXA 3A5ZB 1OULA 2CREA 1XOVA 4YTNA 4RCBA 1IHWA 2NTYA 3X20B 1JB0E 2RJCA 1T0JA 5FW9A 3TLTA 2CA5A 3M57A 5KX5E 2RA1A 2CBIA 2EWNA 2DD4A 2P4RA 4XQ3A 2EHOD 4NXMT 2JRKA 1BI0A 2A7YA 4E2FB 2V8SV 1YWPA 3CCQT 2HSPA 2UXXB 4DA4A 2CP3A 3U78A 2V7JA 5JTGA 2FJBA 3AE8A 4MBQA 1TG0A 2J05A 2RM4A 5GAMj 1KQSA 3LG7A 2WSFE 5HWXA 3SWNB 2ABLA 5EK4A 3P4WA 3OYLA 2ZM8A 3TKLB 2HBPA 4ZN1A 4HWFA 1ZA2B 2VV5A 3PMIA 1VQPQ 3Q5XA 2WP9A 1VIFA 4OB0B 1X9BA 3OPCA 4M75F 1GFDA 5GANf 1G73A 2NTXA 2ZM0A 4ZI2D 2LDMA 4H63V 4D8DA 5CKFA 2QK0A 3PTAA 2ZCFB 1SF9A 1VQ9Q 5GAMe 4IGUA 4MZTA 1IJ5A 1YN8A 4ZOLE 4C5IA 2LLYA 2DIGA 5HXEA 4MMKA 1VCSA 3PUVF 3VS4A 2E2AA 3FBZA 2COYA 4DR3T 1X69A 1SG5A 2FB7A 2L0AA 1VQ7Q 3EHRA 4RCCA 1VRBA 2J62A 2MYSA 3C51A 4C8QD 2BKDN 1DJ7B 3V5SA 2FRYA 2K3WA 2QA4T 3RYHE 1SSHA 3RBBB 5AQNB 2ROTA 2LSKA 2ZLYA 3NWIA 1PCXA 2CYZB 4AT1B 2K57A 3L42A 2WM9A 3PIOA 1AVZC 3PVQA 3QUJA 4RTWA 2KMTA 1XQHA 5LGNB 2E6ZA 2LC4A 4LFAT 5GANg 1XWMA 5GMKh 4X64T 1IHVA 4QH5A 2DLPA 2JT4A 3FZHB 3CCLQ 4ILUA 3UDCA 1W0BA 1Y64B 1YKEB 3U3IA 3H6ZA 1RI0A 3VU7H 3CQXC 3BDUA 3TSWA 3VRYA 1BU1A 5IT9E 4A4KA 1SSFA 3OW2A 4HWHA 1XDOA 4U3CA 3HRUA 3CCRA 4DIDB 3E19A 4UVBB 1ZSZA 1T98A 4BDZA 5L3EB 4KUIA 3HKDE 5IAYA 4DR6T 1EZ3A 2ZMAA 2YLCA 3B57A 2XQ5A 4PL6A 2EQMA 2JS2A 4AKHA 1HSQA 3I5RA 1NPPA 1KK7A 2L3RA 4HE8A 4O4IE 5KCOA 3ZEFB 2D9TA 3M4YA 4UEMA 2JMAA 2RHUA 4QVDA 3OYDA 2DNUA 4M78C 2MMPA 3NFCA 3LX7A 1HR0T 3META 4CRIA 2BVLA 2DL5A 2XQ3A 4XU0A 4F14A 5GJVB 1Y57A 4MZPA 3OYJA 2V6XA 2ZPHB 1VUBA 2JM9A 2YU1A 3OTOT 2LZ6B 1YJ9Q 2BTTA 2QI2A 3ANWA 5HAXA 4BA9A 2XICA 3MEWA 2X0HA 4JRIA 1XJWB 4IDZA 3AAEB 5GAMg 2LSGA 3GNFB 3VYGA 3GMIA 1SKUB 2DYIA 4M7DD 1FMWA 1C6VX 1CSKA 3HSBA 2NWBA 1D3BA 2D5UA 5CFBA 1OZ3A 2CZ0B 2KDSA 4D8KA 3CCRT 4OP0A 3RMSA 2OA5A 4Z91A 2LQWA 4AQGA 1U06A 2BG9A 1HD3A 2IG0A 2M0YA 5JH7E 1G5VA 4JS4A 3PDYA 4ESRA 4L5GA 1YP5A 2E3IA 2Z0WA 1WYCA 3WAKA 5KE2A 3FJPA 3SDZA 3ZN1B 3AVRA 5M4YA 4JLEA 4PJJA 4M77A 1H7CA 3OBWA 2D9DA 1PD0A 3GF5A 1WIEA 2ZPIB 1WRDA 3QHSA 5AQRB 2CXDA 2ED0A 2XAGB 1ABQA 1J1JA 3H41A 3JCMP 2ZM2A 1SE7A 4UXNB 2EYZA 2QASA 4NIQA 3E0ZA 5DY9A 2ATCB 2ODUA 3VS7A 5IWAT 3G71A 4OB1B 2ENMA 2HDAA 2D6FA 3M56A 3AEGA 3EFOA 1WFDA 1LRZA 3CCRQ 3T8OA 1EIFA 1ZKEA 2B86A 3A8MB 2C0SA 4OGCA 1FMVA 3M53A 2WWUA 1LVFA 4EIWA 4J9IA 1M7KA 2M6IA 3RIRA 4FYYB 2H7OA 5C0MA 5I2SA 3PURA 3AAIA 3MEAA 1YCYA 3N2OA 4I55E 1YI2T 4CQIA 4COFA 4PKCC 1IJ6A 1BI1A 2NOXA 2IMLA 4LE9A 1VQ8T 2R6GF 3FEOA 1N9RA 1BB9A 1NWMX 3NTKA 2ZM6T 1D3BB 1WDXA 2EBPA 1WXTA 3CCUT 4FJOA 3UUXB 4XK8E 3OYNA 3PU3A 1OX8A 4DVDA 3OYZA 3RIAA 3UTKA 2XJ7A 4XAXB 3EG9A 5FXVA 4J2CA 4FSXA 2WY2A 1O75A 2DILA 1Q81U 1S72T 2KRSA 5LJ3d 3M9QA 2RQTA 3LFMA 4HT8A 2IVWA 1JBMA 1WQ7A 1OYXA 2V5CA 2OI3A 3PIPA 2M0OA 3AHUA 3E08A 3C64A 1UHFA 4ZS2A 4H63H 3HFNA 4NOYA 2EJ9A 3RMQA 3I56A 3UULA 2EAYA 2HMAA 2LOPA 4ELYC 4AKRB 3CCUQ 3CQGB 2GTOA 2BS3A 2DVJA 2AKLA 4FU6A 4XTUA 2GFUA 3JCMV 4E7SA 5KXJA 4LMLA 1UDLA 1U4QA 1FIOA 3T9NA 3I55A 5LJ5d 4H9OC 1X2KA 3DP7A 2YRVA 3AA7B 5FY1A 4FM4B 4J8OA 4HXJA 1X43A 2EPDA 1RL2A 5I22A 2DF6A 2HCKA 2X4JA 3LYIA 2XQYA 3AE9A 4O2AE 5GJWB 5AQGB 4PJLA 2OTJT 3UA7A 2I0NA 3QWXX 3JB9G 3ZYMA 1QKXA 5CKHA 4M75G 4Z02A 2DRKA 5KYNA 2CHOA 4J9HA 2O88A 2A37A 3ZSTA 1WX6A 3AE1A 1V9DA 1QP2A 4M4ZA 2QEXA 4GYSA 2LVMA 1W2BA 4ILCA 2DTOA 4RUGA 1VQ5T 4WCIA 1NZ9A 1OOTA 2K5IA 1U1SA 1M8VA 1JNRA 2XM2A 1VQ6Q 4YXDA 4VUBA 2FHDA 2I59A
chains in the Genus database with same CATH topology
4UELA 4EYUA 2RK2A 4G2AA 1N8RU 4KUMB 4R55A 1QVFA 5LHGB 5JRCB 4HCCA 4AXPA 3KXTA 3QYGB 3QKJA 3MKDA 4PJMA 1G3SA 3QIIA 3LW5E 3CPWS 2EIFA 5JR9B 4X1KE 1N6AA 4M7AB 4U74A 5FU7C 2RHXA 3M65A 4GLKA 2K24A 2L9QA 5EZYE 5CQYA 3RKXA 5GAN5 1QVGA 4HN9A 2E9XD 5HXSA 2DLRA 2V7IA 5EK2A 5LYJE 3M54A 5LG4A 3LLRA 1VQPT 5I21A 1GXIE 3IF8B 5TAOA 1KHIA 4NUVA 4O4LE 5DQVA 4HA8A 1I4K1 2B1EA 3OYKA 4KT0E 4MDXA 4YJ3E 5CCAA 3KV9A 1OZ2A 3ZPOA 3OYHA 2CCQA 3CKDA 4P0BA 3JC6C 2EJFA 1M90C 2X9YA 3O1IA 3ZCIA 4EOZB 3I55T 3RPUA 4X20E 2M67A 4JDSA 3EUHA 4LD6A 1O3XA 4PNOA 3CC4T 2M1HA 4FI5A 4M7DA 3OYGA 5LJ5j 2H3JA 5LGUB 3PUAA 3RKOA 4LDUA 4LDWA 3CX8B 3Q9DA 5L3FB 4AKGA 2XDPA 2LTOA 3ZMSB 5JR9C 2M16A 2RI3A 4HGAA 4F6RC 1ZHCA 2VKOA 1TH7A 1BR2A 4JUVA 1YIJT 2EQUA 3CD6A 4AKLA 2XDDA 1HS7A 4C92E 4X9DA 5J2TE 4BDYA 4I4TE 4U72A 5L8RE 1VOMA 1QVPA 3OYMA 4NL3A 2Q9QC 2CLYB 2MOZA 4LDXA 2DWGA 2DXTA 4MHCA 2RJFA 2X68A 3L2UA 2YU2A 5FP3A 3CWZB 4IE0A 2WMOA 3UUMA 4OK0A 3ZYLA 2LSYA 2DVEA 1JJ2S 4IE4A 5KH6A 3LWHA 1UCUA 3OYFA 3SWNC 3FRNA 4AQFA 2EHOB 3TCJA 5GAN8 4DMWA 3ZN0B 2L5QA 3CCET 4C92B 4MZMA 3FB9A 1UX5A 5CAIA 1YJWA 4OF1A 2WMNA 1VIEA 1BR0A 4Y28E 2ZPEB 5GANj 3CC4A 3RERA 2W0GA 2JTMA 1B34A 3ZFJA 4BI8B 2LOSA 3J80E 1WQWA 2LJLA 1YD8G 4J5YA 5LP6E 4TV8E 3GPLA 1MMGA 3BFMA 3OYAA 5JREA 2DCFA 2DNXA 4E47A 4M1PA 5JQGE 1BR4A 5L3GB 1HFAA 5CIUA 4M7DF 3F2EA 4QHOA 3PUGA 3ZC0A 2RJDA 4QX7B 4EPCA 3SOLA 5L3BB 3RH3A 2CWOA 4B9XA 1S72A 4K0UA 2LCLA 3ZCJA 3G7ZA 3UT1A 3KV5A 4BACA 3O8VA 3TREA 3OYEA 3P7IA 2E64A 4PW8A 4TZ4C 2LT3A 2J1DG 3MZKB 3C95A 4M77E 3BQKA 2HQEA 1G3YA 4PLLA 4XTZA 3SWNA 2KY9A 3A5XA 3S3NA 2ODVA 4C0FA 3OSVA 2RH2A 3CCLT 2EHOC 2UXNB 2R57A 4OVAA 3DTOA 5LBMA 5HKCA 4CI3B 4FIBA 1ZHIA 4HKEA 2BUDA 1K8AU 1ZV4X 4RG2A 2XAHB 2VKJA 3FIFA 4M77C 1Q7YC 2MAMA 3INZA 3ANWB 2LX9A 3CCVT 1S94A 2E10A 1I8FA 5L3CB 4J7IA 2W63A 4BJMA 3L2WA 2QDYB 2F5KA 3ASKA 3K3NA 3S6WA 3JCMe 2P0PA 5C8YE 4II1A 2WBLA 5A1LA 4M78E 3JB9I 4PJOB 4BI3A 2PVOB 5GMKl 4ZN3A 2I2LA 1D0XA 4ZGDB 4M7DE 1D0YA 2EKOA 4YTLA 3QBYA 4AQFC 5LJ3g 4EAHA 5JDFA 1Q82C 1KD1U 1FX7A 4M75D 5FU6C 2A3LA 4PJOG 2XG8D 5DLOA 4BD3A 3CMLA 4C0GA 4HTEA 5HXHA 4LDVA 1FEWA 4HKAA 2EJGA 4UVAB 3C94A 3HI2A 2Q9QA 3N9NA 3FBLA 2NW7A 5GAN7 2ZPGB 4UF0A 3P8HA 3OS1A 3CCMA 3DKMA 3CXCA 3OS5A 2RHYA 2ACXA 3GNGA 2Y90A 2XUEA 3P8CD 3CC2T 5FMNA 1D1AA 5FYMA 2V7KA 2CKKA 2JQQA 5LXTE 2EQKA 3M4GA 2NW8A 1M9SA 2VL8A 3OYBA 4EZ4A 1N8RC 4PFOA 4ISTA 4LD9K 4JLIA 2VWAA 4CXXA 2X4YA 5JDHA 3ZC1A 1X75C 1X79A 5LJ5g 4YHJA 3KBTA 1AJ3A 4BE0A 2O4XA 3N9OA 5M9OA 2GQVA 1VQ6T 3NZPA 1BR1A 4BY6C 2D0TA 2Y4XA 4IKFA 4JEHB 3RRCA 4BE1A 2K9AA 3EAEA 5CVIA 2MWPA 4DOWA 2LQKA 2V26A 2PJQA 5GMKi 4TV9E 4JRQA 4MMLA 4M77G 4ME7A 4QWNB 3F31A 3OYCA 4M77D 1VQMA 2H7VC 1WR6A 4XTWA 3V5UA 1Q86U 4ZI2C 4YJ2E 2E1HA 1VQ4A 4PAGA 3AB3B 4NUUA 2N1GA 2A2FX 3ONXA 3RRWA 4IUUA 5AYFA 2G3RA 3OSSC 3AVSA 5GONE 1QVFS 1KQSS 2KT9A 3LBXB 2DI4A 1MGQA 3A8OB 3HKBE 3O1HA 5GMKj 1SHZC 4OMFB 3VKGA 4H9PC 2DIQA 2HD0A 3MP8A 4M7AG 4M7AA 5JDMA 4A4HA 1Q86C 3L2ZA 4A56A 3P8DA 2CXFA 5F3JA 2YLBA 4FT2A 1VQ7A 2VGNA 3MJXA 3RKYA 4N4HA 3CX7B 2F69A 4KUDK 5GAOl 1QVGS 2X9HA 2MF2A 4M75C 2P0QA 3BK9A 3L2QA 1UGSB 3K8PC 2KVQG 2X51A 3MK7C 2OAUA 4XTYA 3I56T 1LJOA 3NRXA 3HRTA 4YLHA 1FWZA 2KQWA 1K8AC 3RC3A 3MEVA 1BYMA 3I9YA 2RD1A 1JJ2A 3LK3B 1MNDA 1NAFA 1D1CA 3V7RA 2DJZA 2PU9B 1BIBA 5CQXA 3M55A 1YJNT 3ZJ1A 5EK3A 4E7ZA 1E1HB 2DK3A 1KHCA 3CCSA 3BDLA 4TUYE 2QQRA 5KMGP 4M7DG 4AI6A 3JCMJ 3F70A 3PUSA 3VKHA 1M1KC 1K9MU 3HR0A 1G8XA 3SFMA 4RMOA 1UGRB 1VQ8A 3ER0A 2PFVA 2LSJA 3OJAA 1B7TA 3UPUA 3FB2A 4J6YA 1Z0PA 3Q5WA 4F7UF 1I81A 3A8GB 3CC2A 3J7AF 3EFSA 3ETVA 5LJ5h 5CA0E 4A53A 4GOUA 5LJ5f 4CI1B 5GAN4 1G3WA 3UFEA 1N9SA 3J7Yq 3H37A 4C92A 4C0DC 2GCXA 3E9GA 5J1GA 4J6WA 1LKXA 3KV6A 1K73U 5HWYA 4XZCA 4H9RC 4XTXA 2EHOA 4M77B 2NLUA 5J2UE 5IYZE 5CKEA 4ZHQE 3DB3A 3B13A 2R58A 3NTHA 3DLLA 3FC3A 3CCLA 2P0KA 3CCJA 3OS2A 2MTQA 3MACA 1W4SA 3WI3A 3GLXA 5LCYA 4H9NC 3HFOA 3JCMh 4RG8A 2RP4A 3LJCA 5JDGA 1N27A 4ADZA 4ERRA 2XD0A 1XNIA 5DJQC 5JDQA 4XTVA 2HH7A 3SRZA 5LA6E 3ESLA 2CZ7B 2FYKA 4QW2A 2QEXT 2LSIA 2CEAA 3KBGA 4N0AC 1P92A 4BAYB 4EMKA 3EFRA 3PT9A 4H9SE 4DBQA 2E12A 4GYRA 5JDLA 1KG1A 4UF0B 3KVAA 4CXYA 3SD4A 1UEBA 5D6XA 5D6YA 1YKHB 2V7MA 1VQOA 2HNIA 4M7DB 3M58A 2YHTA 4DNDA 2Y4YA 2VASA 4M78D 3G71T 4N0AA 2KMFA 5GAN6 2JUFA 3QK6A 3EDVA 3MA9A 3Q1JA 3VHLA 2QTXA 4I50E 1YHQT 2DWKA 1Q7YU 4QKNA 2X4WA 1K9MC 1M1KU 2Z6EA 3L2VA 2RA2A 3SB2A 2BDEA 4ZI3C 1LNXA 3M5AA 5GANe 3Q2MA 5LOVE 2QA7A 3CCMT 1IZNB 4WF2A 3CCEA 2X0LB 4C92G 4JEUB 2BIVA 4WBNE 2L8KA 4E7JA 2CM0A 4ISSA 2HAXA 3CMAT 3K3QC 5FXXA 2JJ9A 3JCMb 3JCMc 2DPPB 3E9FA 3KUFA 3JC6D 4P0AA 2R5MA 3QO3A 3S3OA 1YHQA 4UVCB 2RI2A 1HTJF 3PUQA 1YITT 3NRYA 2C5IT 4X1IE 1KC8C 3CBOA 5LBQB 3SWHA 3LGLA 3ME9A 5LJNA 5JDNA 5JR9A 5A0DA 2CZ6B 3HL6A 4MFRA 3RYFE 2XAJB 4OHFA 5GAN3 5GAOm 2KWIB 4E7LA 3MCAB 3PFSA 5JVDE 3KVBA 3GN5A 5FLXE 1Y07A 4PJOA 3G4SA 1W2BS 3FHNA 3C98B 3HL8A 2CWYA 2XHEB 4A4GA 2VXEA 4C8QG 4DO0A 1QSDA 2CS7A 2XK0A 1Y96B 2Y48B 2XAQB 2W61A 2E6NA 4C8QF 1G3TA 2XU8A 5GAN2 3PNWC 1HCIA 3OBVE 3CD6T 2Q9QD 1O9SA 1HG5A 2CLYC 2FVUA 4XU2A 3WAJA 3VYHB 3OA6A 3OW2S 5JRCA 1YJNA 2IW5B 3P8BB 4JJNK 1VQ4T 4EMHA 2C06A 5L3DB 4QXBB 3EVYA 4M75A 4FT4A 2KZ7B 1X01A 5ETWA 3N9MA 4O5VA 3OB9A 3V7SA 2D2SA 3CCQA 1HK9A 2DXBA 5FROA 5BMVE 4O8SA 3CMET 2KAFA 1VQLT 3JB9H 4DMVA 3HP9A 4UV8B 2PQWA 3L1AA 3OY9A 4QVZA 1PSFA 2XDBA 2CZ1B 2L8DA 3I0QA 2LRQA 2V8JA 2ZZDA 4GK5E 2K5FA 5GANh 2LE8A 3ZMZB 3MO8A 4X34A 2NP9A 4M7AE 2BVMA 4HEAA 4IUVA 3OMGA 2CXLA 3C12A 3FDRA 1NPRA 1Y71A 1JRIA 3G4ST 1WNLA 5DM7R 5FRMA 4C0ZA 4HFVA 3E1SA 2XI9A 3W15B 3J9X1 1V29B 4F7UG 2JMKA 3QC9A 2IC6A 4PNIA 3JCMd 2KLQA 5J39A 4BI4A 2H3RA 3CPZA 2K4YA 2KSSA 4L6V5 3UUNA 3CCVA 4D6WA 1HF8A 2L3LA 2XTLA 3CCST 2KWHA 1QW1A 1S35A 2JNGA 3JCMf 2LHNA 3AA0B 3V7CA 3OQ5A 1WLXA 4QXCB 4DBRA 3X20B 2ZGWA 1OI1A 2EQJA 4N78D 4PK6A 1VQNA 3QJ6A 3ZEHA 4C92F 2XAFB 5DABA 3D0TA 1XTDA 3FXEB 1MMAA 4NS5A 2W00A 3R6OA 2E5QA 3DB4A 5I2MA 1ZBXA 3HPWA 3HHTB 2EYQA 3N5BB 4M78A 2PUOB 4IURA 5H6QB 2X67A 5HK0A 1CUNA 5AFUL 5A0GA 4DOVA 2DEQA 1MMNA 5FU7B 5GMKe 2WSCE 2O01E 1Y7XA 2WSEE 1IAPA 2VK9A 3BY7A 2VXFA 3QZ9B 5D6WA 3DLMA 2CMRA 4MDWA 1U5PA 4L0RA 4ANJA 3OYYA 2LM9A 5LHIB 2LNVA 3C50A 3RYCE 3QZ5B 4M75E 4V2SA 2BZBA 4EB6E 3PGGA 5GAOp 4O6JA 3AA6B 4CXWA 4C8QB 3GOXA 3IHRA 2JN0A 3KINB 4M7AF 2RHZA 3JB9D 2CE7A 2W62A 2KK4A 3BQLA 4PK5A 3FXDB 1KD1C 1Q82U 2K3XA 4BE2A 2VKDA 5ADXL 4EMGA 3ZYKA 3CC7T 1KC8U 2KXPB 2N9DA 1HXDA 2K3YA 4UV9B 2HQXA 5HXCA 2DAQA 1MNEA 1LOJA 2YEVC 2PBIA 2QXFA 3O4XE 4F7UB 3IBPA 2CGHA 2C5KT 4C5GA 2MI6A 2V1DB 2QQAA 3ETUA 1KQ2A 3PU8A 1UGQB 1M90U 3A8LB 5CKBA 2EFIA 4C8QE 4Y91A 4C92D 3HRSA 3CMEA 1VQLA 1HG2A 3MEUA 4UIGA 4QX8B 4CI0C 2LQ8A 1B34B 3RYIE 3OMCA 4GY5A 4P5NA 3X24B 3AAAB 4EYYR 1PSEA 1UB4A 3ZMVB 4C91A 5CO7A 3MHXA 1WYBA 3VUZA 5HYAA 4OYKA 1SA0E 4MLKA 3K3OA 5C6SA 1OWAA 4JLGA 4XBFB 3NTIA 3X28B 1VQKA 1KNZA 2PVGB 4ZI3D 4BB7A 4EXTA 3HKSA 4IUTA 3J81E 4Q5WA 4I43B 1BIAA 4OB2B 2RB6A 5DLQE 3IEEA 3CX6B 3MP6A 4M7AC 3MP1A 1H641 2PG8A 3R84B 3QJYA 2P4TA 1YJ9T 3GIBA 2DD5A 2C5JA 4Z8XA 1VQPA 1LVKA 2X66A 2X9WA 1K73C 2Y8DA 4ATOA 3RX6A 3EDUA 5KE3A 1VQKT 4L9IA 2PVDB 3NZQA 4EZHA 4M75B 5DQWA 2A3DA 2FL7A 2X4XA 3N9QA 2N2NA 4J83A 3HKEE 4G63A 1M5Q1 2ES0A 5HY6A 3N9PA 3GP8A 3ZJ2A 1U1TA 3VUBA 4KP3C 1YIJA 3JSCA 1AHJB 2E9XA 3DJBA 4PJOD 5CR2A 4M7DC 3I9WA 4PFPA 2OTLA 4OYJA 3JCMQ 3V8JA 4OFZA 3CBMA 4ZGEB 2B8AA 3AA1B 4V1Av 3OBYA 3OS0A 5CB4E 1D0ZA 2E70A 1YI2A 5GANd 4PJOE 4J7FA 5HK3A 1OXZA 3I0OA 5IN1A 4MALA 3LGFA 2RJEA 2ZPBB 1VQ9T 4P09A 4TN7B 3CCUA 3LWIA 5LJ3h 1MIVA 5FU6B 1IREB 1Y96A 1UX4A 3QPHA 2LT4A 4LDYA 4BY6B 4HCBA 1Q81C 3GWHA 3KDSE 4QQDA 4O2BE 2G0UA 4E7HA 4KBMB 3CQCB 2IC9A 4RKUE 4PJOC 4XU3A 2RHIA 4PLIA 1VQ5A 1M4ZA 2AHJB 1HX8A 3BQIA 3L09A 3CEYA 5CKDA 3OKQA 5FY0A 2E8IA 3TEEA 1IZ6A 3PTRB 4IUQA 3H8ZA 3ZBDA 3CMAA 2MBGA 1BI2A 1QUUA 3PMTA 3E22E 2Y6XA 1YJWT 1US7B 2HPJA 2VGMA 4O4HE 3RESA 1YITA 4EMKC 1ZEEA 5CA1E 3OYIA 1VQ6A 2V8KA 3F57A 4KULA 3G6ET 4C90A 3TU4K 2E9XC 3LK42 3VU3C 1WJQA 3JAME 1H3ZA 4ELZC 2YINA 3HA4A 3LK2B 1YBYA 3RC8A 3CBPA 3CCJT 2DZ9A 4QVCA 3RKWA 4M78F 3QYHB 4JUYA 3WVEB 5LNKA 1BI3A 2V7LA 4PJOF 1R8OB 5L2LA 4IE6A 3CPWA 1WJRA 3OYXA 5LJ3e 3R6NA 4R56A 5F8PA 4EDUA 2GK9A 3MXZA 2QA4A 2WSSV 3O1JA 2ZPFB 4JS5A 2JPFA 5LHHB 2JVVA 4QQGA 3JB9J 2VKHA 3VV0A 5J3BA 1MHNA 5IHYA 2RI5A 4C0DB 2KNDA 2QQBA 3WVDB 2VYTA 2IAKA 2DXUA 5LJ3j 5A2QE 2F5TX 4A54A 4TVRA 4C92C 3HKCE 2PUKB 2D0QB 3QXEB 4NL2A 2GF7A 4C5EA 3A8HB 3QG1A 5LL6S 2E65A 2A72A 4C8QC 3QSUA 3VKIA 4WW0A 4QXHB 4C5HA 1VQNT 2P9BA 3URGA 4IIJE 4E7IA 1NE8A 5LJMA 4OGEA 2Q9QB 4GIWA 2E41A 5E0OA 1WPYA 4PK4A 2VB6A 3L2RA 5FRNA 2R5AA 5LGTB 3BW1A 2DKGA 5EG2A 4ZGJB 5FY7A 2SPCA 3CC7A 4JRPA 3JCMg 3C4ZA 2QQ9A 2XIDA 3C4SA 3JCMW 4F7UE 3KBUA 2RK1A 3L3PA 3QDRB 4X9CA 4J6XA 4N4GA 2K48A 1M1GA 4ASKA 4HT9A 2V8IA 5GAOq 2LHRA 5GAMd 3O9XA 3CXCS 3VJPA 4KMCA 4UC4A 2NW9A 2LEHA 2M9UA 2O4XB 4ZS3A 2JTFA 3X26B 1QP3A 3JRZA 5KDMC 4IUPA 4E7KA 3GN5B 3C4XA 2VC8A 1WGSA 1VQOT 3UT5E 2E9XB 2LT1A 1YJ9A 4YFSA 4BJNA 4IE7A 5GAOr 2QQSA 1VQMT 3V8LA 2DTHA 3JB9F 4EMKB 2MWOA 1MIWA 4M7AD 4B9WA 1NJIC 4CZZB 5GAMf 4WBOA 2DXCA 5GAMh 2XHCA 4ZTJA 2JZ2A 1MMDA 2XKOC 5FNVE 3M59A 4FL6A 5A0LA 3WXMB 3G6EA 3ZMTB 3LH0A 2LCCA 1BKBA 2D0UA 4GK0E 5LJ3f 2XASB 4F7UA 5GAOn 2WAUA 1X6OA 1MIYA 1M1FA 4WNKA 3C4WA 2K2VA 2K5LA 1FXXA 5FXZA 4TX5A 2JMHA 4QQ6A 4PJNA 4CI2B 1WJSA 4DQ2A 1I5LA 4C8QA 3KFWX 3N9LA 3NBXX 4H9QC 2JOYA 4BUGA 2GFAA 5KCHA 2X35A 3CPFA 5HXRA 2DZCA 3N2GE 1ZQ1A 4IE5A 5GMKm 1VQ9A 2KINB 4L59A 4M77F 2OTJA 2DO3A 2OTLT 2VUBA 3CVRA 4OB3B 4M78G 2X9XA 4A4FA 2K5BB 3ZMUB 1VQ7T 3JCMX 4A4EA 2DTIA 3X25B 2RO0A 1YW0A 3FLGA 4B6XA 5J26A 1D1BA 4IHJE 3S3MA 4X1YE 4JRKA 4ZI7E 2WACA 2YK0A 3V8KA 3UWNA 3N2KE 3ZLIA 4N4IA 3KV4A 4HCZA 3QUIA 1U8RA 4M78B 1UGPB 3SS1A 5LJ5e 1NJIU 2L89A 3I1AA 3LBXA 3GA8A 3H3AA 3S4UA 2HPLA 4O4JE 4AKIA 4XU1A 3PE0A 2QGSA 3RUXA 5CK9A 3N5LA 5FXWA 2DHRA 5H6RB 4ZTFA 1KQ1A 3A5ZB 1XOVA 4RCBA 2NTYA 1JB0E 2RJCA 2CA5A 3M57A 5KX5E 2RA1A 2EWNA 2DD4A 4XQ3A 2EHOD 2JRKA 1BI0A 2A7YA 3CCQT 2UXXB 4DA4A 3U78A 2V7JA 4MBQA 2RM4A 5GAMj 1KQSA 3LG7A 2WSFE 5HWXA 3SWNB 5EK4A 3OYLA 2ZM8A 3TKLB 2HBPA 4ZN1A 2VV5A 3PMIA 3Q5XA 1VIFA 4OB0B 4M75F 5GANf 1G73A 2NTXA 2ZM0A 4ZI2D 2LDMA 4H63V 3PTAA 5CKFA 2ZCFB 5GAMe 4IGUA 4MZTA 1IJ5A 4ZOLE 4C5IA 2DIGA 5HXEA 4MMKA 3FBZA 2FB7A 4RCCA 1VRBA 2MYSA 3C51A 4C8QD 2BKDN 1DJ7B 3V5SA 2QA4T 3RYHE 2LSKA 2ZLYA 2CYZB 2K57A 3L42A 2WM9A 3PIOA 3QUJA 2KMTA 1XQHA 5LGNB 2E6ZA 2LC4A 5GANg 5GMKh 4ILUA 3UDCA 3H6ZA 1Y64B 1YKEB 3U3IA 1RI0A 3VU7H 3CQXC 3BDUA 5IT9E 4A4KA 1SSFA 3OW2A 3HRUA 3CCRA 3E19A 4UVBB 1T98A 4BDZA 5L3EB 4KUIA 3HKDE 5IAYA 1EZ3A 2ZMAA 2YLCA 3B57A 4PL6A 2EQMA 4AKHA 1NPPA 1KK7A 2L3RA 4HE8A 4O4IE 5KCOA 3ZEFB 2D9TA 3M4YA 4UEMA 2RHUA 4QVDA 3OYDA 4M78C 2MMPA 3NFCA 3LX7A 3META 4CRIA 2BVLA 4XU0A 4MZPA 3OYJA 2ZPHB 1VUBA 2YU1A 4JRIA 2QI2A 3ANWA 5HAXA 4BA9A 2XICA 3MEWA 5GAMg 4IDZA 3AAEB 2LSGA 3GNFB 3VYGA 3GMIA 4M7DD 1FMWA 3HSBA 2NWBA 1D3BA 2D5UA 1OZ3A 2CZ0B 2KDSA 3CCRT 4OP0A 3RMSA 2OA5A 4AQGA 2IG0A 5JH7E 1G5VA 4JS4A 3PDYA 4L5GA 1WYCA 3WAKA 5KE2A 3FJPA 3SDZA 3ZN1B 3AVRA 5M4YA 4JLEA 4PJJA 4M77A 1H7CA 3OBWA 3GF5A 2ZPIB 1WRDA 3QHSA 2CXDA 2XAGB 3JCMP 2ZM2A 4UXNB 3E0ZA 5DY9A 2ODUA 3G71A 4OB1B 2D6FA 3M56A 1LRZA 3T8OA 1EIFA 1ZKEA 3A8MB 2C0SA 4OGCA 1FMVA 3M53A 2WWUA 1LVFA 4EIWA 3RIRA 2H7OA 5C0MA 5I2SA 3PURA 3AAIA 3MEAA 1YCYA 3N2OA 4I55E 1YI2T 4CQIA 4PKCC 1IJ6A 1BI1A 2NOXA 1VQ8T 3FEOA 1N9RA 1NWMX 3NTKA 1D3BB 3CCUT 4FJOA 3UUXB 4XK8E 3OYNA 3PU3A 4DVDA 3OYZA 3UTKA 4XAXB 5FXVA 4J2CA 4FSXA 1O75A 1Q81U 1S72T 5LJ3d 3M9QA 3LFMA 4HT8A 2IVWA 1JBMA 1WQ7A 1OYXA 3PIPA 2M0OA 3AHUA 3E08A 3C64A 4ZS2A 4H63H 3HFNA 4NOYA 2EJ9A 3RMQA 3I56A 3UULA 2EAYA 2LOPA 4ELYC 4AKRB 3CQGB 3JCMV 4FU6A 4XTUA 2GFUA 4E7SA 1U4QA 1FIOA 3T9NA 3I55A 5LJ5d 4H9OC 3DP7A 2YRVA 3AA7B 5FY1A 4FM4B 4J8OA 1RL2A 2X4JA 3LYIA 2XQYA 4O2AE 4PJLA 2OTJT 3JB9G 3ZYMA 5CKHA 4M75G 4Z02A 1V9DA 1QP2A 2QEXA 4GYSA 2LVMA 1W2BA 2DTOA 1VQ5T 1NZ9A 2K5IA 1U1SA 1M8VA 4VUBA 2FHDA 2I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILU A;  4XAX B;  4KBM B;  4MFR A;  2EYQ A;  4KMC A;  2LT4 A;  2LT3 A;  4L5G A;  2LQK A;  2LT1 A; 
#chains in the Genus database with same CATH topology
 4UEL A;  4EYU A;  2RK2 A;  4FYX B;  2FUP A;  4G2A A;  4LF8 T;  4KUM B;  2D1X A;  3I5S A;  4R55 A;  1N8R U;  1QVF A;  5LHG B;  1YQ3 A;  5JRC B;  4HCC A;  4AXP A;  3KXT A;  3QYG B;  3QKJ A;  3MKD A;  4PJM A;  1G3S A;  3QII A;  3LW5 E;  1OED A;  3CPW S;  1UFF A;  2EIF A;  5JR9 B;  1WHL A;  5AQH B;  2QDL A;  4X1K E;  1N6A A;  3VRA A;  2AT1 B;  4JJB A;  4M7A B;  4DR7 T;  2BS4 A;  4U74 A;  5FU7 C;  2RHX A;  3M65 A;  4GLK A;  1H8K A;  3CQT A;  2K24 A;  2L9Q A;  5EZY E;  5CQY A;  4X62 T;  3RKX A;  5GAN 5;  3TVT A;  1QVG A;  4HN9 A;  2E9X D;  5HXS A;  2DLR A;  5EC7 A;  2AKK A;  2E5K A;  2V7I A;  5EK2 A;  5LYJ E;  1E7O A;  3IQL A;  5I11 A;  4DEX A;  1JU5 C;  3M54 A;  1L0V A;  2H3E B;  3CCV Q;  5LG4 A;  4DUZ T;  3LLR A;  4LF7 T;  1WA7 A;  1VQP T;  2XQ8 A;  5I21 A;  1GXI E;  3IF8 B;  5TAO A;  3RDV A;  2IPO B;  1KHI A;  3RIF A;  1SRL A;  4NUV A;  4O4L E;  5DQV A;  4HA8 A;  1I4K 1;  2B1E A;  1RAB B;  3OYK A;  4KT0 E;  4MDX A;  2XQA A;  4YJ3 E;  4OMM A;  5HEU A;  5CCA A;  4YSZ A;  1H3H A;  3RR6 A;  3KV9 A;  1OZ2 A;  3NPF A;  3ZPO A;  1OED B;  3OYH A;  4U7Y A;  4HFB A;  1M2O A;  2CCQ A;  3CKD A;  4FYV B;  1OU9 A;  2XM1 A;  4P0B A;  1NBE B;  2QA4 Q;  3JC6 C;  2EJF A;  1M90 C;  2X9Y A;  1SUM B;  3QDF A;  3O1I A;  4DV5 T;  3ZCI A;  1KSW A;  5LG3 A;  4EOZ B;  3I55 T;  3RPU A;  4X20 E;  1ARK A;  2M67 A;  4FSS A;  1VYT A;  4JDS A;  2OX7 A;  4JI5 T;  3EUH A;  4LD6 A;  1O3X A;  4PNO A;  3ZKR A;  3CC4 T;  2M1H A;  1M62 A;  2IIU A;  4FI5 A;  4M7D A;  3OYG A;  5LJ5 j;  4U2Y A;  5AQK B;  1M27 C;  2H3J A;  3M0R A;  2EGC A;  2CP7 A;  3CCE Q;  5LGU B;  1YIT Q;  2FRW A;  4HWI B;  3PUA A;  3RKO A;  3RGL A;  4LDU A;  5CGM A;  1QWE A;  2D8H A;  4LDW A;  3CX8 B;  2I0M A;  5HEO A;  3Q9D A;  5L3F B;  2D8J A;  4AKG A;  1ZLM A;  2E5V A;  2XDP A;  4HFD A;  2LTO A;  3ZMS B;  5JR9 C;  2M16 A;  2E4H A;  2RI3 A;  2YDS A;  3OVU A;  4HFI A;  4HGA A;  2V5D A;  4F6R C;  1ZHC A;  3EGU A;  1YJN Q;  2VKO A;  3GBQ A;  1I6Z A;  1TH7 A;  1BR2 A;  3AE3 A;  3UU3 A;  1TTH B;  4JUV A;  2EQU A;  1YIJ T;  1ABO A;  3CD6 A;  3CIR A;  4AKL A;  2XDD A;  2V1R A;  1HS7 A;  4C92 E;  4X9D A;  4HVW A;  5J2T E;  2F2V A;  1VQO Q;  2FZC B;  2WQY A;  2CSQ A;  4BDY A;  3AE2 A;  4I4T E;  2NUP B;  1UUE A;  4U72 A;  5L8R E;  1VOM A;  1C1A A;  2FJE A;  1KJW A;  1QVP A;  3OYM A;  4NL3 A;  2Q9Q C;  1MUZ A;  4CN4 A;  2CSI A;  2CLY B;  2MOZ A;  4LDX A;  2DWG A;  2DXT A;  4MHC A;  2RJF A;  2X68 A;  3L2U A;  1UG1 A;  2YU2 A;  5FP3 A;  3CWZ B;  4IE0 A;  2WMO A;  3UUM A;  4OK0 A;  3ZYL A;  2LSY A;  3H3M A;  2DVE A;  4FW1 A;  1JJ2 S;  2X3W D;  4IE4 A;  3KFV A;  5KH6 A;  3LWH A;  1UCU A;  3FZL B;  4X66 T;  3OYF A;  3CC4 Q;  3SWN C;  4J9C A;  3FRN A;  4AQF A;  2EHO B;  2RQW A;  1WHK A;  3TCJ A;  5GAN 8;  4DMW A;  3ZN0 B;  2L5Q A;  3CCE T;  4LNP A;  4C92 B;  4MZM A;  2CPT A;  1YFN A;  1QWF A;  3FB9 A;  1UX5 A;  2FBW A;  5CAI A;  4U31 A;  2JTE A;  2YWW A;  1YJW A;  4OF1 A;  2WMN A;  2EVR A;  1VIE A;  1BR0 A;  2IDO B;  4Y28 E;  2ZPE B;  3RHW A;  3VUZ A;  5GAN j;  3CC4 A;  3RER A;  2W0G A;  2JTM A;  1B34 A;  3ZFJ A;  4LMJ A;  1PG5 B;  4BI8 B;  2LOS A;  3J80 E;  2UXC T;  1ZP0 A;  2JQ9 A;  1WQW A;  2LJL A;  1Q82 R;  1YD8 G;  4J5Y A;  2QYW A;  5LP6 E;  4EGW A;  2KRM A;  4TV8 E;  1I1J A;  3GPL A;  1MMG A;  3BFM A;  3AEF A;  2UU9 T;  1V1C A;  3OYA A;  1UK5 A;  9ATC B;  5JRE A;  2DCF A;  1QCN A;  2X3X D;  1RAF B;  2DNX A;  4E47 A;  1ZOY A;  3G71 Q;  3H0F A;  4JPB W;  5FVK A;  4M1P A;  5FL0 A;  5JQG E;  4GKK T;  2WZH A;  1BR4 A;  5L3G B;  1HFA A;  2GGR A;  4KH0 B;  3SHW A;  5CIU A;  4M7D F;  3F2E A;  4QHO A;  1JQQ A;  3PUG A;  3ZC0 A;  2K6D A;  2RJD A;  4QX7 B;  3H9N A;  3CC2 Q;  4EPC A;  3SOL A;  5AQS B;  5L3B B;  1NEG A;  3RH3 A;  2CWO A;  1YIJ Q;  4B9X A;  1S72 A;  1RAA B;  4K0U A;  2LCL A;  3ZCJ A;  1XMQ T;  1YWO A;  2RPN A;  3G7Z A;  3UT1 A;  3KV5 A;  4BAC A;  3O8V A;  1QKW A;  4AIU A;  3TRE A;  3P7I A;  1UJY A;  3OYE A;  2E64 A;  1K0X A;  4PW8 A;  4JZ4 A;  4TZ4 C;  2LT3 A;  1RAG B;  2J1D G;  3MZK B;  3C95 A;  4M77 E;  3BQK A;  5AQI B;  1G3Y A;  1N32 T;  2HQE A;  4AG2 C;  5ABE A;  5IXB A;  4PLL A;  4XTZ A;  1J3T A;  3SWN A;  4JI4 T;  3LDQ B;  2KY9 A;  3A5X A;  2DEU A;  2K79 A;  3QB5 A;  5ABG A;  3EGD B;  3S3N A;  1WR0 A;  1E7P A;  2ODV A;  1IBK T;  4C0F A;  3OSV A;  2RH2 A;  5IHN A;  3CCL T;  2EHO C;  2UXN B;  2R57 A;  4AQY T;  4OVA A;  3DTO A;  5LBM A;  2E3H A;  4CI3 B;  5HKC A;  5IHI A;  2ED1 A;  4FIB A;  1ZHI A;  2DL8 A;  4HKE A;  2BUD A;  3I56 Q;  1ZV4 X;  1K8A U;  3THK A;  4RG2 A;  2XAH B;  1RUW A;  2VKJ A;  1B3Q A;  3FIF A;  2DL3 A;  4M77 C;  2DRM A;  1Q7Y C;  2MAM A;  1ZSZ B;  3INZ A;  3ANW B;  2LX9 A;  3CCV T;  3REA B;  2JS0 A;  1S94 A;  2E10 A;  3TSZ A;  1I8F A;  5L3C B;  1NLO C;  4J7I A;  2W63 A;  4IRE A;  4U2Z A;  4BJM A;  1ZSZ C;  1M3B A;  1K9M R;  3L2W A;  2QDY B;  2HSE B;  2F5K A;  2CBJ A;  5IH2 A;  1QCF A;  3ASK A;  3VR9 A;  3K3N A;  3AEC A;  3S6W A;  5KYU B;  3JCM e;  1FJG T;  2P0P A;  5C8Y E;  3JCF A;  4II1 A;  2WBL A;  5A1L A;  4X65 T;  1UTI A;  4M78 E;  3JB9 I;  4PJO B;  2VVN A;  4BI3 A;  2PVO B;  5GMK l;  1BCM A;  5IXF A;  3AE5 A;  1CKB A;  1QQJ A;  4ZN3 A;  2CRB A;  3P4P A;  2I2L A;  1D0X A;  3P4R A;  4ZGD B;  4M7D E;  1D0Y A;  4JI7 T;  2EKO A;  4YTL A;  2G6F X;  3QBY A;  4Z90 A;  4AQF C;  5LJ3 g;  4EAH A;  5JDF A;  2YDL A;  1Q82 C;  3G06 A;  1KD1 U;  1Y0M A;  1FX7 A;  4M75 D;  5FU6 C;  1NEN A;  2A3L A;  4PJO G;  2XG8 D;  5DLO A;  4BD3 A;  3EGX A;  1LCK A;  3CML A;  4C0G A;  4HTE A;  5HXH A;  1Y01 A;  4LDV A;  1FEW A;  5KYX B;  5HEG A;  2GTJ A;  4HKA A;  2EJG A;  4UVA B;  1UHC A;  3C94 A;  3HI2 A;  2Q9Q A;  5AQU B;  2YKS A;  2F2X A;  3N9N A;  3FBL A;  2NW7 A;  2COZ A;  5GAN 7;  3RQW A;  2ZPG B;  2JQK A;  4RTX A;  4UF0 A;  2A36 A;  3P8H A;  5AQQ B;  3OS1 A;  3CCM A;  4A5X A;  5C3J A;  1WHG A;  3DKM A;  2WZI A;  3P4Q A;  4F8H A;  2HKN A;  3OS5 A;  2LP5 A;  3BE3 A;  3CXC A;  2RHY A;  2ACX A;  3GNG A;  2Y90 A;  2XUE A;  3CD6 Q;  3P8C D;  3CC2 T;  4J9E A;  1JO8 A;  2LQN A;  5FMN A;  1D1A A;  5FYM A;  4YTP A;  2V7K A;  2CKK A;  3A98 A;  2JQQ A;  5LXT E;  2EQK A;  3M4G A;  1IB8 A;  2NW8 A;  1K1Z A;  1D09 B;  1M9S A;  2VL8 A;  3OYB A;  4EZ4 A;  2RQR A;  1WCR A;  1PC0 A;  1N8R C;  1KIK A;  4PFO A;  4IST A;  4LD9 K;  4JLI A;  2VWA A;  4CXX A;  3VS6 A;  2X4Y A;  5JDH A;  2DE0 X;  3ZC1 A;  1PHT A;  1X75 C;  1X79 A;  5LJ5 g;  4YHJ A;  1UJ0 A;  3KBT A;  1AJ3 A;  4BE0 A;  3HTR A;  2GNC A;  2O4X A;  2BZ8 A;  3N9O A;  1UUR A;  5M9O A;  2GQV A;  1VQ6 T;  3NZP A;  6AT1 B;  1BR1 A;  4IL9 A;  4BY6 C;  2D0T A;  2Y4X A;  4IKF A;  4JEH B;  3RRC A;  4BE1 A;  2K9A A;  3EAE A;  1PKS A;  2K9G A;  5CVI A;  2MWP A;  4DOW A;  2LQK A;  2V26 A;  2PJQ A;  5GMK i;  2WCA A;  4TV9 E;  4JRQ A;  4MML A;  4M77 G;  4ME7 A;  2BE9 B;  5IHK A;  4QWN B;  3F31 A;  1M2V B;  4KGX B;  2CHN A;  4KH1 B;  1AZE A;  3OYC A;  4M77 D;  4DV3 T;  1VQM A;  2H7V C;  1WR6 A;  4XTW A;  3V5U A;  4DV1 T;  4RTU A;  1Q86 U;  5CJ5 A;  4ZI2 C;  4YJ2 E;  2E1H A;  1VQ4 A;  2QGF B;  4PAG A;  3AB3 B;  4NUU A;  2V6Y B;  2N1G A;  1GBR A;  3AE7 A;  2A2F X;  3ONX A;  3L8R A;  3RRW A;  3CCM Q;  4IUU A;  5AYF A;  2G3R A;  3OSS C;  3AVS A;  5GON E;  1QVF S;  1PRL C;  2DYB A;  1KQS S;  2KT9 A;  3LBX B;  2DI4 A;  1MGQ A;  3A8O B;  3HKB E;  5ECA A;  1H92 A;  3O1H A;  5GMK j;  1SHZ C;  4OMF B;  2HKQ B;  1Q95 G;  3VKG A;  2OTJ Q;  4H9P C;  2DIQ A;  2HD0 A;  3MP8 A;  4M7A G;  1FYN A;  4M7A A;  5JDM A;  4A4H A;  1Q86 C;  3L2Z A;  4A56 A;  2KR3 A;  3P8D A;  2CXF A;  5F3J A;  2YLB A;  3AEA A;  4RTZ A;  3RIU A;  2YN6 A;  1YQ4 A;  4FT2 A;  1VQ7 A;  3D7S B;  2VGN A;  3MJX A;  3RKY A;  4N4H A;  3CX7 B;  2F69 A;  4DBH A;  2YT6 A;  4KUD K;  5GAO l;  1WYX A;  1QVG S;  4A98 A;  2X9H A;  4GBQ A;  2MF2 A;  4JI3 T;  4M75 C;  2P0Q A;  2BS2 A;  3BK9 A;  3A1P A;  3L2Q A;  1UGS B;  5FWB A;  1JXM A;  3K8P C;  2DBK A;  2KVQ G;  2X51 A;  3NMZ C;  3MK7 C;  2OAU A;  4XTY A;  3I56 T;  1YI2 Q;  1E6G A;  3REB B;  1LJO A;  4YY3 T;  1M30 A;  3NRX A;  2AZV A;  3HRT A;  3Q5D A;  4YLH A;  1FWZ A;  3VRZ A;  5AQO B;  3IA3 A;  2KQW A;  2XQ4 A;  4HVV A;  1KNR A;  3CME Q;  1K8A C;  1VQL Q;  3RC3 A;  3MEV A;  1TSF A;  1T7S A;  1BYM A;  3I9Y A;  2RD1 A;  1JJ2 A;  2WU5 A;  3LK3 B;  1TWB A;  1MND A;  3EHQ A;  2KYB A;  1NAF A;  1D1C A;  3V7R A;  4DR1 T;  2DJZ A;  2PU9 B;  1W0A A;  2ZAE A;  1BIB A;  5CQX A;  2WDQ A;  5LB7 B;  4OMO A;  3M55 A;  1YJN T;  4AG1 C;  3ZJ1 A;  5EK3 A;  4E7Z A;  1E1H B;  4YT0 A;  5ABF A;  2DK3 A;  3PUW F;  2EW3 A;  1KHC A;  3ULR B;  3CCS A;  3BDL A;  3M0Q A;  3H0H A;  4EIK A;  4TUY E;  2QQR A;  5KMG P;  4M7D G;  4AI6 A;  3RF1 A;  4F16 A;  1XZY A;  4KHZ F;  2AXD S;  4AFU C;  2EKH A;  2FZK B;  3JCM J;  4CC4 B;  2DFU A;  2EYW A;  3F70 A;  3PUS A;  3VKH A;  2JMC A;  1M1K C;  1K9M U;  3HR0 A;  1G8X A;  3SFM A;  4DUY T;  2CT4 A;  4RMO A;  1UGR B;  3UUB A;  1VQ8 A;  1NEK A;  3EG3 A;  2CUB A;  3ER0 A;  2PFV A;  2LSJ A;  3OJA A;  2DX1 A;  4KX6 A;  1B7T A;  1W9R A;  1IGU A;  2DL1 A;  4AFQ C;  2CP2 A;  2JXB A;  3UPU A;  2JQH A;  3FB2 A;  4J6Y A;  1Z0P A;  3Q5W A;  4F7U F;  1I81 A;  3A8G B;  3CC2 A;  5FWC A;  3J7A F;  3EFS A;  3ETV A;  5LJ5 h;  5CA0 E;  5IUX A;  2IIM A;  4A53 A;  4GOU A;  5LJ5 f;  4CI1 B;  5GAN 4;  1G3W A;  3CCS Q;  3UFE A;  1N9S A;  3QWY A;  3VR8 A;  3J7Y q;  3H37 A;  4EEB A;  4C92 A;  4C0D C;  2GCX A;  3E9G A;  5J1G A;  1A0N B;  4J6W A;  1LKX A;  2KEA A;  3AE6 A;  3KV6 A;  1ZUK A;  1K73 U;  5HWY A;  4XZC A;  5L47 A;  4H9R C;  1M1K R;  1Q7Y R;  3P4S A;  4XTX A;  2EHO A;  4ZZC A;  4M77 B;  2YOE A;  5J2U E;  2DJQ A;  5IYZ E;  2NLU A;  5CKE A;  2FJA A;  1KQS P;  4Q25 A;  4ZHQ E;  1VQK Q;  5LMU T;  4TWH A;  3DB3 A;  1AWO A;  3SFD A;  3B13 A;  2R58 A;  3NTH A;  3VS1 A;  2MPK A;  3CC7 Q;  2HL3 A;  3DLL A;  3FC3 A;  2LCS A;  3CCL A;  1N36 T;  2P0K A;  4TWD A;  1T3S A;  4KI0 F;  2EQI A;  3OS2 A;  1SHG A;  2MTQ A;  3MAC A;  1W4S A;  3CCJ A;  3WI3 A;  2OV9 A;  3GLX A;  2QGG A;  3FZF B;  5LCY A;  4H9N C;  3U23 A;  2KT1 A;  1YJW Q;  3HFO A;  4F04 B;  1K76 A;  1WZO A;  3JCM h;  5L4E A;  4R0K A;  4RG8 A;  2RP4 A;  3LJC A;  5JDG A;  1N27 A;  2BE7 D;  2VVS A;  4ADZ A;  4ERR A;  2XD0 A;  1XNI A;  5DJQ C;  2MAW A;  5JDQ A;  4XTV A;  2HH7 A;  3SRZ A;  5LA6 E;  3ESL A;  4IDO A;  2CZ7 B;  2FYK A;  4QW2 A;  2QEX T;  1K8A R;  1YCS B;  2LSI A;  2CEA A;  2MPX C;  3KBG A;  4Z88 A;  4N0A C;  1P92 A;  2D0N A;  4BAY B;  4EMK A;  3EFR A;  2BBH A;  3PT9 A;  4H9S E;  4DBQ A;  1IRX A;  2E12 A;  4GYR A;  5JDL A;  4CC2 A;  1KG1 A;  1QLB A;  3EFO B;  4UF0 B;  2BG9 E;  3PUX F;  3KVA A;  4YTM A;  4CXY A;  3SD4 A;  1UEB A;  5D6X A;  5D6Y A;  1YKH B;  4HCK A;  2V7M A;  4AFZ C;  2RMO A;  2PZ1 A;  2EYX A;  1VQO A;  2HNI A;  4M7D B;  3M58 A;  2CDT A;  2YHT A;  1VQ4 Q;  4DND A;  2Y4Y A;  2VAS A;  2LNH B;  4M78 D;  3G71 T;  4N0A A;  2KMF A;  5GAN 6;  2JUF A;  3QK6 A;  4GKJ T;  4LXC A;  3EDV A;  2MK5 A;  4B3S T;  1Z9Q A;  1YNZ A;  3MA9 A;  3Q1J A;  2JM8 A;  1VQ8 Q;  3VHL A;  2QTX A;  1UE9 A;  1W6X A;  1MV0 B;  4I50 E;  4QT7 A;  1YHQ T;  2DWK A;  1RI9 A;  4QKN A;  2X4W A;  1Q7Y U;  1K9M C;  1M1K U;  1RAD B;  2IUB A;  2FG0 A;  2Z6E A;  5BR8 T;  3L2V A;  2RA2 A;  3SB2 A;  2BDE A;  4ZI3 C;  1LNX A;  3M5A A;  5GAN e;  5AQT B;  3I35 A;  3Q2M A;  5LOV E;  2YRC A;  2DBM A;  3T1Y T;  3MPU B;  2QA7 A;  3CCM T;  1IZN B;  4DV7 T;  1N5Z A;  3EI0 A;  4WF2 A;  3CCE A;  1EX4 A;  4B6M A;  2X0L B;  4C92 G;  2J47 A;  4JEU B;  2UUC T;  2BIV A;  4WBN E;  3ONL C;  4QH1 A;  2L8K A;  4E7J A;  2CM0 A;  2J7I A;  1F1B B;  2FZG B;  4ISS A;  2HAX A;  4LFC T;  3CMA T;  2A28 A;  3K3Q C;  5FXX A;  2KSR A;  2JJ9 A;  2RNA A;  3JCM b;  3JCM c;  2DPP B;  3E9F A;  3CK6 A;  3KUF A;  3JC6 D;  4P0A A;  2R5M A;  4B3R T;  2QG9 B;  1OED E;  3QO3 A;  1I94 T;  2CT3 A;  3S3O A;  1YHQ A;  5C2T A;  4UVC B;  2RI2 A;  1HTJ F;  3PUQ A;  1I07 A;  2O2O A;  3A7M A;  4LF9 T;  1SRM A;  1YIT T;  3NRY A;  2C5I T;  2XSA A;  4X1I E;  3LH5 A;  3JAE A;  3CPW P;  2KYM A;  1KC8 C;  2VQE T;  1VCT A;  5KYX A;  3CBO A;  4Z8A A;  5LBQ B;  3SWH A;  1RAH B;  4CC7 A;  3LGL A;  2F4V T;  3CXC P;  1GL5 A;  1ZBJ A;  3TLV A;  2DL4 A;  2DER A;  2A08 A;  3EGD A;  3ME9 A;  1U3O A;  5LJN A;  5JDN A;  2XMF A;  4KGV B;  5JR9 A;  2YSQ A;  5A0D A;  2CZ6 B;  3HL6 A;  4MFR A;  3RYF E;  1AOJ A;  5KYY A;  2XAJ B;  1KEY A;  4OHF A;  5GAN 3;  2KWI B;  5GAO m;  4E7L A;  4CN6 A;  3MCA B;  1G2B A;  1S1N A;  3LSV A;  4IIM A;  3PFS A;  5JVD E;  3KVB A;  3GN5 A;  5FLX E;  1Y07 A;  4PJO A;  3UQ4 A;  3G4S A;  1W2B S;  3FHN A;  4FW2 A;  3JAF A;  3C98 B;  3HL8 A;  2CWY A;  2XHE B;  4A4G A;  2VXE A;  3Q5E A;  1ZSG A;  4C8Q G;  4DO0 A;  2SRC A;  1QSD A;  3UQ7 A;  4LUE A;  2CS7 A;  2XK0 A;  1Y96 B;  1WHM A;  5KYU A;  2RPA A;  3EGX B;  2JIW A;  2Y48 B;  4NXN T;  2XAQ B;  2W61 A;  2E6N A;  1J5W A;  2BG9 B;  1PRM C;  3AXJ A;  4C8Q F;  1G3T A;  1PM3 A;  3QB5 K;  2XU8 A;  2I6H A;  4HWD A;  2DMO A;  5GAN 2;  3PNW C;  4X5T A;  1HNZ T;  4E6R A;  1HCI A;  1IXD A;  3OBV E;  2O31 A;  3CD6 T;  1RAE B;  2AK5 A;  5FKY A;  2Q9Q D;  1O9S A;  1HG5 A;  2J4G A;  2CLY C;  2C0T A;  2ROL A;  1I5O B;  2WS3 A;  2CP5 A;  2FVU A;  2OLT A;  3WAJ A;  4XU2 A;  3VYH B;  5JRC A;  3OA6 A;  3OW2 S;  1YJN A;  2IW5 B;  3P8B B;  4HFH A;  4DBF A;  4JJN K;  1VQ4 T;  3K1S A;  2VUR A;  3RIU C;  2LRK A;  4EMH A;  2C06 A;  3FZM B;  2NUT A;  5L3D B;  4QXB B;  3EVY A;  1J5E T;  4M75 A;  2KI7 A;  1X01 A;  2KZ7 B;  4FT4 A;  5ETW A;  2ACZ A;  3N9M A;  1T0H A;  2ECZ A;  4O5V A;  3PJA A;  2BKN A;  3OB9 A;  3V7S A;  2D2S A;  3CCQ A;  4Z89 A;  1TUD A;  1HK9 A;  2DXB A;  5FRO A;  2DET A;  5BMV E;  4O8S A;  3CME T;  2KAF A;  2V6Y A;  1VQL T;  3JB9 H;  4JZ3 A;  2H89 A;  2O9S A;  4DMV A;  3HP9 A;  5KYW B;  4UV8 B;  2PQW A;  3L1A A;  3OY9 A;  4QVZ A;  1PSF A;  2XDB A;  2CZ1 B;  2L8D A;  3I0Q A;  5J0Z A;  2LRQ A;  2KXD A;  2LX7 A;  2V8J A;  2ZZD A;  4GK5 E;  4ILB A;  2K5F A;  5GAN h;  2LE8 A;  1WHH A;  5FVL A;  3AED A;  3JAD A;  3ZMZ B;  3MO8 A;  4X34 A;  2NP9 A;  4M7A E;  3ZT5 A;  2BVM A;  4HEA A;  4AFS C;  4IUV A;  3OMG A;  1KD1 R;  1HJD A;  3ZSS A;  2CXL A;  3C12 A;  3FDR A;  3CMA Q;  4IDP A;  3M3Z B;  1NPR A;  1Y71 A;  1OQK A;  4CN1 A;  1JRI A;  3G4S T;  1WNL A;  1NG2 A;  4EED A;  2DA9 A;  5DM7 R;  3EG0 A;  4C0Z A;  5FRM A;  4HFV A;  3E1S A;  5AQP B;  2FPD A;  2XI9 A;  2RF0 A;  1XDP A;  2YUP A;  3W15 B;  2HHH T;  1TU0 B;  4LF6 T;  2IHR 1;  1E6H A;  3J9X 1;  1V29 B;  4F7U G;  3EG2 A;  2JMK A;  3QC9 A;  2CH4 A;  2IC6 A;  2WWV A;  4PNI A;  3JCM d;  2M51 A;  2KLQ A;  5J39 A;  4BI4 A;  1VQ5 Q;  1KFY A;  2NR4 A;  2H3R A;  3CPZ A;  2K4Y A;  2KSS A;  3I9Q A;  2JW4 A;  4J9B A;  4OMQ A;  4L6V 5;  2W0Z A;  1PWT A;  3UUN A;  3CCV A;  4D6W A;  1HF8 A;  2L3L A;  2XTL A;  4DV2 T;  2KWH A;  3CCS T;  1QW1 A;  1S35 A;  4I0U A;  2JNG A;  3JCM f;  2LHN A;  3AA0 B;  1NYF A;  3V7C A;  2NWM A;  1X6G A;  1WLX A;  4QXC B;  4DBR A;  2NUP A;  2ZGW A;  2KGT A;  4TNW A;  1OI1 A;  3OQ5 A;  2EQJ A;  4N78 D;  4PK6 A;  5AQL B;  3QJ6 A;  1VQN A;  3ZEH A;  4C92 F;  2XAF B;  1NEB A;  5DAB A;  1HNX T;  1AEY A;  3D0T A;  1XTD A;  2C0I A;  3FXE B;  1MMA A;  4NS5 A;  2W00 A;  2HL5 C;  3R6O A;  2E5Q A;  5HEH A;  3DB4 A;  2KRN A;  1E2A A;  4OML A;  5I2M A;  4ZEY A;  1ZBX A;  3HPW A;  3HHT B;  3G6E Q;  2PTK A;  2EYQ A;  3N5B B;  4M78 A;  1TUG B;  4CC3 A;  2PUO B;  3EH2 A;  4IUR A;  5H6Q B;  3UAT A;  2X67 A;  5HK0 A;  1CUN A;  5AFU L;  4J9F A;  4DEY A;  1AZG B;  5A0G A;  4DOV A;  3O5Z A;  2DEQ A;  1MMN A;  2UUB T;  2J6K A;  5FU7 B;  5GMK e;  2J6F A;  2WSC E;  2W4X A;  1TS9 A;  2O01 E;  1Y7X A;  2WSE E;  1IAP A;  2VK9 A;  1JNZ A;  3BY7 A;  2VXF A;  3QZ9 B;  5D6W A;  1AWW A;  1AT1 B;  5AQV B;  1U5S A;  3DLM A;  2CMR A;  4MDW A;  1U5P A;  4L0R A;  4ZXL A;  4ANJ A;  1OPK A;  3M0S A;  2LM9 A;  5LHI B;  3OYY A;  5HCJ A;  2QEX Q;  5L4H A;  3C50 A;  3RYC E;  2LNV A;  3QZ5 B;  4M75 E;  4V2S A;  2QYZ A;  2BZB A;  4EB6 E;  3PGG A;  5GAO p;  4O6J A;  2LM2 A;  3AA6 B;  4CXW A;  4C8Q B;  3GOX A;  3IHR A;  2JN0 A;  1Z9Z A;  3AEB A;  3KIN B;  4M7A F;  2RHZ A;  1GRI A;  2QRX A;  4U33 A;  3JB9 D;  2CE7 A;  2W62 A;  2CUD A;  2KK4 A;  3BQL A;  4PK5 A;  3FXD B;  1I0C A;  1KD1 C;  2BKO A;  1Q82 U;  2K3X A;  4BE2 A;  2VKD A;  5ADX L;  4EMG A;  3ZYK A;  2E5L T;  3CC7 T;  1KC8 U;  2KXP B;  2N9D A;  1HXD A;  2K3Y A;  4UV9 B;  2VQF T;  4QH4 A;  2HQX A;  3VS0 A;  5HXC A;  3QNU A;  2NUZ A;  2DAQ A;  2UXB T;  2F2W A;  1MNE A;  1LOJ A;  2YEV C;  3VRB A;  2PBI A;  2QXF A;  3O4X E;  4F7U B;  3IBP A;  3G1J A;  2CGH A;  2C5K T;  3L39 A;  4C5G A;  4GLM A;  4LMK A;  2MI6 A;  1Q81 R;  2V1D B;  2QQA A;  1OPL A;  3ETU A;  3AE4 A;  2LMJ A;  1KQ2 A;  3PU8 A;  1UGQ B;  1M90 U;  3A8L B;  5CKB A;  2HN2 A;  2EFI A;  4C8Q E;  4Y91 A;  4C92 D;  3HRS A;  3CME A;  1VQL A;  1HG2 A;  3MEU A;  4AMC A;  4UIG A;  5AQF B;  4QX8 B;  2WDV A;  1HX1 B;  1BCO A;  4CI0 C;  2KXC A;  2LQ8 A;  1B34 B;  3RYI E;  1X6B A;  3OMC A;  4GY5 A;  5ABF B;  1GCQ C;  2WU2 A;  1RAI B;  4P5N A;  3X24 B;  3AAA B;  4EYY R;  1PSE A;  1UB4 A;  4HFE A;  3ZMV B;  4C91 A;  3MHX A;  1WYB A;  5CO7 A;  5HYA A;  2NUT B;  4OYK A;  1SA0 E;  5F5W A;  1X2Q A;  1PNJ A;  4MLK A;  3K3O A;  4IDN A;  4WZX A;  1IGQ A;  5C6S A;  1JEG A;  1HYO A;  1OWA A;  4JLG A;  4XBF B;  1SEM A;  3M0T A;  3NTI A;  3X28 B;  1N34 T;  4F17 A;  4DV0 T;  4JJC A;  3CCJ Q;  2YUQ A;  1KNZ A;  1VQK A;  2PVG B;  7AT1 B;  4ZI3 D;  4BB7 A;  4EXT A;  3HKS A;  4IUT A;  3J81 E;  4Q5W A;  1WI7 A;  1Z8U A;  4I43 B;  1BIA A;  4OB2 B;  2RB6 A;  5DLQ E;  3IEE A;  3FZK B;  2GQI A;  1IBM T;  3CX6 B;  3MP6 A;  3ONJ A;  4M7A C;  3B5M A;  3EHZ A;  1RLP C;  3MP1 A;  3PUZ F;  1H64 1;  2PG8 A;  3R84 B;  1R0B G;  1M3A A;  1UUS A;  4JYA T;  2P4T A;  3QJY A;  2VVK A;  1YJ9 T;  3GIB A;  2AE9 A;  2DD5 A;  2C5J A;  1XNQ T;  4Z8X A;  1VQP A;  4JV5 T;  1UGV A;  5KYW A;  1K0S A;  3PV0 F;  4ZZB A;  3E2U A;  3T1H T;  4JI1 T;  1LVK A;  1VQM Q;  2X66 A;  2X9W A;  4FCY A;  1K73 C;  2Y8D A;  4HVU A;  1ZUY A;  2QTV A;  4ATO A;  4RTT A;  3RX6 A;  3JV3 A;  2A9U A;  3EDU A;  1WXU A;  2PNI A;  5KE3 A;  1T8B A;  1VQK T;  4L9I A;  3NZQ A;  2PVD B;  1XNR T;  2W2U A;  1OU8 A;  4EZH A;  4M75 B;  5DQW A;  2A3D A;  2WDR A;  2FL7 A;  2X4X A;  3N9Q A;  2N2N A;  3TLS A;  4ORZ A;  1Q86 R;  1NLP C;  1RAC B;  3HKE E;  4J83 A;  4G63 A;  1JJ2 P;  1M5Q 1;  2ES0 A;  5HY6 A;  1FMK A;  3N9P A;  4K0K T;  3GP8 A;  1UGO A;  3ZJ2 A;  1U1T A;  3VUB A;  4KP3 C;  4A97 A;  1YIJ A;  4IT4 A;  2L3Q A;  3JSC A;  4TNV A;  1AHJ B;  2E9X A;  2FO0 A;  3DJB A;  4PJO D;  4IL4 A;  5CR2 A;  2KE9 A;  1M2V A;  4M7D C;  3I9W A;  4PFP A;  1W2B P;  2DL7 A;  1SPK A;  2OTL A;  4OYJ A;  1ZX6 A;  3JCM Q;  3V8J A;  4OFZ A;  2B76 A;  3CBM A;  4ZGE B;  2B8A A;  2W66 A;  2AIR B;  4J9D A;  3AA1 B;  4V1A v;  3EG9 B;  2QVA A;  5HCK A;  2YDQ A;  4JI0 T;  3OBY A;  3OS0 A;  5CB4 E;  2O9V A;  1GCP A;  1D0Z A;  1ZA1 B;  1G83 A;  1BK2 A;  2E70 A;  1OED C;  2XSB A;  2J6O A;  1YI2 A;  5GAN d;  4PJO E;  4J7F A;  5HK3 A;  1OXZ A;  3I0O A;  2HZY A;  5IN1 A;  1PKT A;  3AT1 B;  4RTV A;  4MAL A;  3LGF A;  2RJE A;  2M02 A;  2ZPB B;  4DV4 T;  5KYY B;  1VQ9 T;  4P09 A;  4TN7 B;  1X27 A;  3CCU A;  3LWI A;  3OW2 P;  2BZX A;  5LJ3 h;  4EV6 A;  1MIV A;  5FU6 B;  1IRE B;  1Y96 A;  1UX4 A;  2XQ7 A;  4K11 A;  4A63 B;  3QPH A;  2LT4 A;  2PTF A;  4JI6 T;  4LDY A;  4BY6 B;  4HCB A;  1Q81 C;  3GWH A;  3KDS E;  4QQD A;  2SEM A;  4O2B E;  2G0U A;  4E7H A;  4KBM B;  2XQ6 A;  3CQC B;  2IC9 A;  2LRL A;  5HCM A;  1W1F A;  2MCN A;  4RKU E;  1VYV A;  4LF5 T;  3ZT6 A;  2W10 A;  4PJO C;  1B07 A;  4XU3 A;  2RHI A;  3P50 A;  5AT1 B;  4PLI A;  3G4S Q;  2M6B A;  3AXJ B;  3NVO A;  1VQ5 A;  2KNB B;  1M4Z A;  1N8R R;  5D7U A;  2AHJ B;  2QAZ A;  3AEE A;  4PFZ A;  3UF4 A;  1HX8 A;  3BQI A;  3L09 A;  3CEY A;  2H88 A;  8ATC B;  4JI8 T;  3UU6 A;  4OX9 T;  1IBL T;  5CKD A;  2EGA A;  2FEI A;  3OKQ A;  3ABV A;  5FY0 A;  3SEM A;  2E8I A;  3TEE A;  2HEQ A;  1IZ6 A;  3PTR B;  3PUY F;  1QCO A;  3H8Z A;  4IUQ A;  3ZBD A;  3CMA A;  2MBG A;  4KHP T;  1BI2 A;  3RLF F;  1QUU A;  3PMT A;  3E22 E;  2Y6X A;  1YJW T;  5L23 A;  1US7 B;  2HPJ A;  1OV3 A;  3VS3 A;  3QOF A;  2VGM A;  2WB5 A;  4FYW B;  4O4H E;  3RES A;  2FJD A;  1YIT A;  4EMK C;  1ZEE A;  5CA1 E;  3OYI A;  1PD1 A;  4X1V A;  2RQV A;  2AZS A;  1TUC A;  1VQ6 A;  2V8K A;  3VS2 A;  3F57 A;  4KUL A;  1SHF A;  2MOX A;  3G6E T;  4C90 A;  1NJI R;  4OMN A;  3TU4 K;  2YDR A;  3UU8 A;  2E9X C;  3LK4 2;  3VU3 C;  1WJQ A;  3JAM E;  1H3Z A;  4ELZ C;  3EAB A;  2YIN A;  3HA4 A;  3LK2 B;  1YBY A;  3RC8 A;  3CBP A;  3CCJ T;  1C0M A;  2DZ9 A;  4QVC A;  3RKW A;  2LKH A;  2CP6 A;  1R0C B;  4M78 F;  3QYH B;  4JUY A;  1R77 A;  4Y92 A;  2FPE A;  3WVE B;  5LNK A;  1BI3 A;  2V7L A;  4PJO F;  3EH1 A;  3I55 Q;  1R8O B;  3TQ7 P;  5L2L A;  4IE6 A;  2A0F B;  3CPW A;  4QKU A;  1WJR A;  3OYX A;  3SFE A;  3C0C A;  1S72 Q;  4DR4 T;  2KT8 A;  5LJ3 e;  3R6N A;  4RTY A;  4R56 A;  5F8P A;  5FL1 A;  4EDU A;  2GK9 A;  4IIO A;  3MXZ A;  2QA4 A;  2WSS V;  3O1J A;  2ZPF B;  4JS5 A;  2JPF A;  5LHH B;  1TOV A;  2JVV A;  4QQG A;  4YHH T;  2VKH A;  3JB9 J;  3VV0 A;  5J3B A;  2C0O A;  2HN1 A;  1MHN A;  1WXB A;  5IHY A;  2RI5 A;  4C0D B;  2KND A;  2QQB A;  1EZZ B;  3WVD B;  2VWF A;  2VYT A;  2IAK A;  2DXU A;  2F1L A;  5LJ3 j;  5A2Q E;  2F5T X;  1M3C A;  4A54 A;  4LFB T;  4TVR A;  3HKC E;  1HNW T;  2D0Q B;  2OJ2 A;  1KNP A;  2PUK B;  3QXE B;  4C92 C;  4NL2 A;  2GF7 A;  4C5E A;  4AIS A;  1KF6 A;  1NYG A;  2K7A A;  3A8H B;  3QG1 A;  5LL6 S;  2E65 A;  1GQE A;  2A72 A;  4C8Q C;  3QSU A;  3VKI A;  3TLU A;  2VL0 A;  3FJ5 A;  4WW0 A;  1ZUU A;  4QXH B;  2CP0 A;  1K9A A;  1TXQ A;  4C5H A;  1VQN T;  2P9B A;  3URG A;  2UUA T;  4IIJ E;  4E7I A;  1NE8 A;  5LJM A;  2BG9 C;  2OAW A;  1EFN A;  4OGE A;  1CKA A;  2Q9Q B;  3RI5 A;  1NM7 A;  4GIW A;  2HQH A;  2E41 A;  5E0O A;  1IO6 A;  1GCQ A;  4PK4 A;  2BBJ A;  1WPY A;  2CH4 W;  2VB6 A;  3L2R A;  5FRN A;  4B3M T;  2R5A A;  5LGT B;  3BW1 A;  3EG1 A;  8AT1 B;  1M90 R;  2DKG A;  5EG2 A;  2XZE A;  4ZGJ B;  1VYU A;  1QVG P;  5FY7 A;  2SPC A;  1YHQ Q;  1VA7 A;  2L2P A;  4DR5 T;  3CC7 A;  2GBQ A;  4JRP A;  4U7I A;  2KBT A;  3JCM g;  3C4Z A;  2QQ9 A;  2XID A;  2YUO A;  1W09 A;  5HEJ A;  4WTO B;  3C4S A;  3JCM W;  4OMP A;  2XPK A;  4NPP A;  3ZL7 C;  4F7U E;  1KC8 R;  3KBU A;  2RK1 A;  3L3P A;  3QDR B;  4X9C A;  2K3B A;  4J6X A;  3NHN A;  4N4G A;  1N33 T;  2K48 A;  1M1G A;  4ASK A;  1AWJ A;  4HT9 A;  1RLQ C;  2V8I A;  2LHR A;  5GAO q;  1K73 R;  5GAM d;  1QVF P;  3O9X A;  3CXC S;  3VJP A;  4KMC A;  1LPL A;  1GBQ A;  2UXD T;  4UC4 A;  2NW9 A;  2LEH A;  2BZY A;  1WLP B;  2M9U A;  3RNJ A;  2O4X B;  4ZS3 A;  4ZNX A;  2JTF A;  3X26 B;  1QP3 A;  3JRZ A;  1AD5 A;  5KDM C;  4IUP A;  4E7K A;  3GN5 B;  3C4X A;  3UU4 A;  2COW A;  1WGS A;  2VC8 A;  1VQO T;  4LN2 A;  3UT5 E;  2E9X B;  5LMN T;  2LT1 A;  1YJ9 A;  2LJ0 A;  2X0Y A;  4YFS A;  4BJN A;  4IE7 A;  5GAO r;  5ABH A;  2QQS A;  4YSX A;  1VQM T;  4UR9 A;  3V8L A;  4JJD A;  2DTH A;  3M0P A;  3EAM A;  3JB9 F;  4EMK B;  2ESW A;  3CCQ Q;  2MWO A;  1T3L A;  1MIW A;  4M7A D;  4B9W A;  1NJI C;  4CZZ B;  2L3P A;  5GAM f;  4JI2 T;  4WBO A;  2DXC A;  5GAM h;  2XHC A;  4ZTJ A;  2JZ2 A;  1MMD A;  2XY8 B;  2XKO C;  3PVL A;  5FNV E;  3VS5 A;  3UU5 A;  3M59 A;  1OX9 A;  4FL6 A;  4HWC A;  1QMC A;  3WXM B;  5A0L A;  2FPF A;  3G6E A;  3ZT7 A;  4LUD A;  2EYY A;  3ZMT B;  1ACM B;  3LH0 A;  3NKZ A;  2RQU A;  2W67 A;  4YSY A;  2H8H A;  1T72 A;  2LCC A;  1BKB A;  2D0U A;  4JBW F;  3H0I A;  3UFG A;  4GK0 E;  1QLY A;  2YRD A;  3RQU A;  2XAS B;  5LJ3 f;  4F7U A;  5GAO n;  3TLW A;  2WAU A;  1X6O A;  2RN8 A;  4LF4 T;  3X1D A;  1MIY A;  5AQJ B;  1M1F A;  1WFW A;  4WNK A;  3C4W A;  2VKN A;  2K2V A;  2K5L A;  1FXX A;  4DR2 T;  3M0U A;  5FXZ A;  4TX5 A;  2JMH A;  4QQ6 A;  1DU2 A;  1YXR A;  4PJN A;  1VQN Q;  4CI2 B;  1WJS A;  2YXY A;  4DQ2 A;  2J06 A;  1I5L A;  4C8Q A;  4IDQ A;  3KFW X;  2LJ1 A;  3N9L A;  1GFC A;  4KRT A;  4DV6 T;  5AQM B;  3NBX X;  4H9Q C;  2JOY A;  4BUG A;  2HBW A;  2GFA A;  5KCH A;  2X35 A;  3CPF A;  5HXR A;  2DZC A;  3N2G E;  1ZQ1 A;  2KRO A;  4IE5 A;  5GMK m;  1W70 A;  1VQ9 A;  2KIN B;  4P1N A;  4L59 A;  4M77 F;  2OTJ A;  2DO3 A;  2OTL T;  2VUB A;  3CVR A;  4OB3 B;  4M78 G;  1MV3 A;  1BBZ A;  4J9G A;  3NGP A;  2X9X A;  4A4F A;  1CHU A;  2K5B B;  3ZMU B;  1V76 A;  3RKG A;  1VQ7 T;  3JCM X;  4A4E A;  3PJA J;  2DTI A;  4WYV A;  3X25 B;  2RO0 A;  1YW0 A;  1WHJ A;  3FLG A;  4B6X A;  3A8Y C;  4KGZ B;  5J26 A;  1K4U S;  1D1B A;  1OEB A;  2NYS A;  4IHJ E;  2K2M A;  1UEC A;  3S3M A;  4X1Y E;  1XMO T;  4JRK A;  4ZI7 E;  2WAC A;  2YUN A;  2XQ9 A;  2YK0 A;  3V8K A;  3UWN A;  3N2K E;  3ZLI A;  4N4I A;  3KV4 A;  2P84 A;  4HCZ A;  4TWF A;  3QUI A;  1U8R A;  4M78 B;  1UGP B;  2LJ3 A;  3SS1 A;  5LJ5 e;  1NJI U;  2L89 A;  2EGE A;  2DM1 A;  2BKP A;  3I1A A;  3LBX A;  2MIO A;  3GA8 A;  3H3A A;  3S4U A;  1M8M A;  2HPL A;  4O4J E;  4AKI A;  2OTL Q;  4HFC A;  4XU1 A;  3PE0 A;  2QGS A;  3RUX A;  4ILA A;  4B3T T;  5CK9 A;  2L3S A;  3N5L A;  2LKG A;  5FXW A;  2DHR A;  5H6R B;  1JXO A;  2V1Q A;  3UA6 A;  4ZTF A;  1KQ1 A;  1KFZ A;  1R8I A;  1AWX A;  3A5Z B;  1OUL A;  2CRE A;  1XOV A;  4YTN A;  4RCB A;  1IHW A;  2NTY A;  3X20 B;  1JB0 E;  2RJC A;  1T0J A;  5FW9 A;  3TLT A;  2CA5 A;  3M57 A;  5KX5 E;  2RA1 A;  2CBI A;  2EWN A;  2DD4 A;  2P4R A;  4XQ3 A;  2EHO D;  4NXM T;  2JRK A;  1BI0 A;  2A7Y A;  4E2F B;  2V8S V;  1YWP A;  3CCQ T;  2HSP A;  2UXX B;  4DA4 A;  2CP3 A;  3U78 A;  2V7J A;  5JTG A;  2FJB A;  3AE8 A;  4MBQ A;  1TG0 A;  2J05 A;  2RM4 A;  5GAM j;  1KQS A;  3LG7 A;  2WSF E;  5HWX A;  3SWN B;  2ABL A;  5EK4 A;  3P4W A;  3OYL A;  2ZM8 A;  3TKL B;  2HBP A;  4ZN1 A;  4HWF A;  1ZA2 B;  2VV5 A;  3PMI A;  1VQP Q;  3Q5X A;  2WP9 A;  1VIF A;  4OB0 B;  1X9B A;  3OPC A;  4M75 F;  1GFD A;  5GAN f;  1G73 A;  2NTX A;  2ZM0 A;  4ZI2 D;  2LDM A;  4H63 V;  4D8D A;  5CKF A;  2QK0 A;  3PTA A;  2ZCF B;  1SF9 A;  1VQ9 Q;  5GAM e;  4IGU A;  4MZT A;  1IJ5 A;  1YN8 A;  4ZOL E;  4C5I A;  2LLY A;  2DIG A;  5HXE A;  4MMK A;  1VCS A;  3PUV F;  3VS4 A;  2E2A A;  3FBZ A;  2COY A;  4DR3 T;  1X69 A;  1SG5 A;  2FB7 A;  2L0A A;  1VQ7 Q;  3EHR A;  4RCC A;  1VRB A;  2J62 A;  2MYS A;  3C51 A;  4C8Q D;  2BKD N;  1DJ7 B;  3V5S A;  2FRY A;  2K3W A;  2QA4 T;  3RYH E;  1SSH A;  3RBB B;  5AQN B;  2ROT A;  2LSK A;  2ZLY A;  3NWI A;  1PCX A;  2CYZ B;  4AT1 B;  2K57 A;  3L42 A;  2WM9 A;  3PIO A;  1AVZ C;  3PVQ A;  3QUJ A;  4RTW A;  2KMT A;  1XQH A;  5LGN B;  2E6Z A;  2LC4 A;  4LFA T;  5GAN g;  1XWM A;  5GMK h;  4X64 T;  1IHV A;  4QH5 A;  2DLP A;  2JT4 A;  3FZH B;  3CCL Q;  4ILU A;  3UDC A;  1W0B A;  1Y64 B;  1YKE B;  3U3I A;  3H6Z A;  1RI0 A;  3VU7 H;  3CQX C;  3BDU A;  3TSW A;  3VRY A;  1BU1 A;  5IT9 E;  4A4K A;  1SSF A;  3OW2 A;  4HWH A;  1XDO A;  4U3C A;  3HRU A;  3CCR A;  4DID B;  3E19 A;  4UVB B;  1ZSZ A;  1T98 A;  4BDZ A;  5L3E B;  4KUI A;  3HKD E;  5IAY A;  4DR6 T;  1EZ3 A;  2ZMA A;  2YLC A;  3B57 A;  2XQ5 A;  4PL6 A;  2EQM A;  2JS2 A;  4AKH A;  1HSQ A;  3I5R A;  1NPP A;  1KK7 A;  2L3R A;  4HE8 A;  4O4I E;  5KCO A;  3ZEF B;  2D9T A;  3M4Y A;  4UEM A;  2JMA A;  2RHU A;  4QVD A;  3OYD A;  2DNU A;  4M78 C;  2MMP A;  3NFC A;  3LX7 A;  1HR0 T;  3MET A;  4CRI A;  2BVL A;  2DL5 A;  2XQ3 A;  4XU0 A;  4F14 A;  5GJV B;  1Y57 A;  4MZP A;  3OYJ A;  2V6X A;  2ZPH B;  1VUB A;  2JM9 A;  2YU1 A;  3OTO T;  2LZ6 B;  1YJ9 Q;  2BTT A;  2QI2 A;  3ANW A;  5HAX A;  4BA9 A;  2XIC A;  3MEW A;  2X0H A;  4JRI A;  1XJW B;  4IDZ A;  3AAE B;  5GAM g;  2LSG A;  3GNF B;  3VYG A;  3GMI A;  1SKU B;  2DYI A;  4M7D D;  1FMW A;  1C6V X;  1CSK A;  3HSB A;  2NWB A;  1D3B A;  2D5U A;  5CFB A;  1OZ3 A;  2CZ0 B;  2KDS A;  4D8K A;  3CCR T;  4OP0 A;  3RMS A;  2OA5 A;  4Z91 A;  2LQW A;  4AQG A;  1U06 A;  2BG9 A;  1HD3 A;  2IG0 A;  2M0Y A;  5JH7 E;  1G5V A;  4JS4 A;  3PDY A;  4ESR A;  4L5G A;  1YP5 A;  2E3I A;  2Z0W A;  1WYC A;  3WAK A;  5KE2 A;  3FJP A;  3SDZ A;  3ZN1 B;  3AVR A;  5M4Y A;  4JLE A;  4PJJ A;  4M77 A;  1H7C A;  3OBW A;  2D9D A;  1PD0 A;  3GF5 A;  1WIE A;  2ZPI B;  1WRD A;  3QHS A;  5AQR B;  2CXD A;  2ED0 A;  2XAG B;  1ABQ A;  1J1J A;  3H41 A;  3JCM P;  2ZM2 A;  1SE7 A;  4UXN B;  2EYZ A;  2QAS A;  4NIQ A;  3E0Z A;  5DY9 A;  2ATC B;  2ODU A;  3VS7 A;  5IWA T;  3G71 A;  4OB1 B;  2ENM A;  2HDA A;  2D6F A;  3M56 A;  3AEG A;  3EFO A;  1WFD A;  1LRZ A;  3CCR Q;  3T8O A;  1EIF A;  1ZKE A;  2B86 A;  3A8M B;  2C0S A;  4OGC A;  1FMV A;  3M53 A;  2WWU A;  1LVF A;  4EIW A;  4J9I A;  1M7K A;  2M6I A;  3RIR A;  4FYY B;  2H7O A;  5C0M A;  5I2S A;  3PUR A;  3AAI A;  3MEA A;  1YCY A;  3N2O A;  4I55 E;  1YI2 T;  4CQI A;  4COF A;  4PKC C;  1IJ6 A;  1BI1 A;  2NOX A;  2IML A;  4LE9 A;  1VQ8 T;  2R6G F;  3FEO A;  1N9R A;  1BB9 A;  1NWM X;  3NTK A;  2ZM6 T;  1D3B B;  1WDX A;  2EBP A;  1WXT A;  3CCU T;  4FJO A;  3UUX B;  4XK8 E;  3OYN A;  3PU3 A;  1OX8 A;  4DVD A;  3OYZ A;  3RIA A;  3UTK A;  2XJ7 A;  4XAX B;  3EG9 A;  5FXV A;  4J2C A;  4FSX A;  2WY2 A;  1O75 A;  2DIL A;  1Q81 U;  1S72 T;  2KRS A;  5LJ3 d;  3M9Q A;  2RQT A;  3LFM A;  4HT8 A;  2IVW A;  1JBM A;  1WQ7 A;  1OYX A;  2V5C A;  2OI3 A;  3PIP A;  2M0O A;  3AHU A;  3E08 A;  3C64 A;  1UHF A;  4ZS2 A;  4H63 H;  3HFN A;  4NOY A;  2EJ9 A;  3RMQ A;  3I56 A;  3UUL A;  2EAY A;  2HMA A;  2LOP A;  4ELY C;  4AKR B;  3CCU Q;  3CQG B;  2GTO A;  2BS3 A;  2DVJ A;  2AKL A;  4FU6 A;  4XTU A;  2GFU A;  3JCM V;  4E7S A;  5KXJ A;  4LML A;  1UDL A;  1U4Q A;  1FIO A;  3T9N A;  3I55 A;  5LJ5 d;  4H9O C;  1X2K A;  3DP7 A;  2YRV A;  3AA7 B;  5FY1 A;  4FM4 B;  4J8O A;  4HXJ A;  1X43 A;  2EPD A;  1RL2 A;  5I22 A;  2DF6 A;  2HCK A;  2X4J A;  3LYI A;  2XQY A;  3AE9 A;  4O2A E;  5GJW B;  5AQG B;  4PJL A;  2OTJ T;  3UA7 A;  2I0N A;  3QWX X;  3JB9 G;  3ZYM A;  1QKX A;  5CKH A;  4M75 G;  4Z02 A;  2DRK A;  5KYN A;  2CHO A;  4J9H A;  2O88 A;  2A37 A;  3ZST A;  1WX6 A;  3AE1 A;  1V9D A;  1QP2 A;  4M4Z A;  2QEX A;  4GYS A;  2LVM A;  1W2B A;  4ILC A;  2DTO A;  4RUG A;  1VQ5 T;  4WCI A;  1NZ9 A;  1OOT A;  2K5I A;  1U1S A;  1M8V A;  1JNR A;  2XM2 A;  1VQ6 Q;  4YXD A;  4VUB A;  2FHD A;  2I59 A; 
#chains in the Genus database with same CATH homology
 4UEL A;  4EYU A;  2RK2 A;  4G2A A;  1N8R U;  4KUM B;  4R55 A;  1QVF A;  5LHG B;  5JRC B;  4HCC A;  4AXP A;  3KXT A;  3QYG B;  3QKJ A;  3MKD A;  4PJM A;  1G3S A;  3QII A;  3LW5 E;  3CPW S;  2EIF A;  5JR9 B;  4X1K E;  1N6A A;  4M7A B;  4U74 A;  5FU7 C;  2RHX A;  3M65 A;  4GLK A;  2K24 A;  2L9Q A;  5EZY E;  5CQY A;  3RKX A;  5GAN 5;  1QVG A;  4HN9 A;  2E9X D;  5HXS A;  2DLR A;  2V7I A;  5EK2 A;  5LYJ E;  3M54 A;  5LG4 A;  3LLR A;  1VQP T;  5I21 A;  1GXI E;  3IF8 B;  5TAO A;  1KHI A;  4NUV A;  4O4L E;  5DQV A;  4HA8 A;  1I4K 1;  2B1E A;  3OYK A;  4KT0 E;  4MDX A;  4YJ3 E;  5CCA A;  3KV9 A;  1OZ2 A;  3ZPO A;  3OYH A;  2CCQ A;  3CKD A;  4P0B A;  3JC6 C;  2EJF A;  1M90 C;  2X9Y A;  3O1I A;  3ZCI A;  4EOZ B;  3I55 T;  3RPU A;  4X20 E;  2M67 A;  4JDS A;  3EUH A;  4LD6 A;  1O3X A;  4PNO A;  3CC4 T;  2M1H A;  4FI5 A;  4M7D A;  3OYG A;  5LJ5 j;  2H3J A;  5LGU B;  3PUA A;  3RKO A;  4LDU A;  4LDW A;  3CX8 B;  3Q9D A;  5L3F B;  4AKG A;  2XDP A;  2LTO A;  3ZMS B;  5JR9 C;  2M16 A;  2RI3 A;  4HGA A;  4F6R C;  1ZHC A;  2VKO A;  1TH7 A;  1BR2 A;  4JUV A;  1YIJ T;  2EQU A;  3CD6 A;  4AKL A;  2XDD A;  1HS7 A;  4C92 E;  4X9D A;  5J2T E;  4BDY A;  4I4T E;  4U72 A;  5L8R E;  1VOM A;  1QVP A;  3OYM A;  4NL3 A;  2Q9Q C;  2CLY B;  2MOZ A;  4LDX A;  2DWG A;  2DXT A;  4MHC A;  2RJF A;  2X68 A;  3L2U A;  2YU2 A;  5FP3 A;  3CWZ B;  4IE0 A;  2WMO A;  3UUM A;  4OK0 A;  3ZYL A;  2LSY A;  2DVE A;  1JJ2 S;  4IE4 A;  5KH6 A;  3LWH A;  1UCU A;  3OYF A;  3SWN C;  3FRN A;  4AQF A;  2EHO B;  3TCJ A;  5GAN 8;  4DMW A;  3ZN0 B;  2L5Q A;  3CCE T;  4C92 B;  4MZM A;  3FB9 A;  1UX5 A;  5CAI A;  1YJW A;  4OF1 A;  2WMN A;  1VIE A;  1BR0 A;  4Y28 E;  2ZPE B;  5GAN j;  3CC4 A;  3RER A;  2W0G A;  2JTM A;  1B34 A;  3ZFJ A;  4BI8 B;  2LOS A;  3J80 E;  1WQW A;  2LJL A;  1YD8 G;  4J5Y A;  5LP6 E;  4TV8 E;  3GPL A;  1MMG A;  3BFM A;  3OYA A;  5JRE A;  2DCF A;  2DNX A;  4E47 A;  4M1P A;  5JQG E;  1BR4 A;  5L3G B;  1HFA A;  5CIU A;  4M7D F;  3F2E A;  4QHO A;  3PUG A;  3ZC0 A;  2RJD A;  4QX7 B;  4EPC A;  3SOL A;  5L3B B;  3RH3 A;  2CWO A;  4B9X A;  1S72 A;  4K0U A;  2LCL A;  3ZCJ A;  3G7Z A;  3UT1 A;  3KV5 A;  4BAC A;  3O8V A;  3TRE A;  3OYE A;  3P7I A;  2E64 A;  4PW8 A;  4TZ4 C;  2LT3 A;  2J1D G;  3MZK B;  3C95 A;  4M77 E;  3BQK A;  2HQE A;  1G3Y A;  4PLL A;  4XTZ A;  3SWN A;  2KY9 A;  3A5X A;  3S3N A;  2ODV A;  4C0F A;  3OSV A;  2RH2 A;  3CCL T;  2EHO C;  2UXN B;  2R57 A;  4OVA A;  3DTO A;  5LBM A;  5HKC A;  4CI3 B;  4FIB A;  1ZHI A;  4HKE A;  2BUD A;  1K8A U;  1ZV4 X;  4RG2 A;  2XAH B;  2VKJ A;  3FIF A;  4M77 C;  1Q7Y C;  2MAM A;  3INZ A;  3ANW B;  2LX9 A;  3CCV T;  1S94 A;  2E10 A;  1I8F A;  5L3C B;  4J7I A;  2W63 A;  4BJM A;  3L2W A;  2QDY B;  2F5K A;  3ASK A;  3K3N A;  3S6W A;  3JCM e;  2P0P A;  5C8Y E;  4II1 A;  2WBL A;  5A1L A;  4M78 E;  3JB9 I;  4PJO B;  4BI3 A;  2PVO B;  5GMK l;  4ZN3 A;  2I2L A;  1D0X A;  4ZGD B;  4M7D E;  1D0Y A;  2EKO A;  4YTL A;  3QBY A;  4AQF C;  5LJ3 g;  4EAH A;  5JDF A;  1Q82 C;  1KD1 U;  1FX7 A;  4M75 D;  5FU6 C;  2A3L A;  4PJO G;  2XG8 D;  5DLO A;  4BD3 A;  3CML A;  4C0G A;  4HTE A;  5HXH A;  4LDV A;  1FEW A;  4HKA A;  2EJG A;  4UVA B;  3C94 A;  3HI2 A;  2Q9Q A;  3N9N A;  3FBL A;  2NW7 A;  5GAN 7;  2ZPG B;  4UF0 A;  3P8H A;  3OS1 A;  3CCM A;  3DKM A;  3CXC A;  3OS5 A;  2RHY A;  2ACX A;  3GNG A;  2Y90 A;  2XUE A;  3P8C D;  3CC2 T;  5FMN A;  1D1A A;  5FYM A;  2V7K A;  2CKK A;  2JQQ A;  5LXT E;  2EQK A;  3M4G A;  2NW8 A;  1M9S A;  2VL8 A;  3OYB A;  4EZ4 A;  1N8R C;  4PFO A;  4IST A;  4LD9 K;  4JLI A;  2VWA A;  4CXX A;  2X4Y A;  5JDH A;  3ZC1 A;  1X75 C;  1X79 A;  5LJ5 g;  4YHJ A;  3KBT A;  1AJ3 A;  4BE0 A;  2O4X A;  3N9O A;  5M9O A;  2GQV A;  1VQ6 T;  3NZP A;  1BR1 A;  4BY6 C;  2D0T A;  2Y4X A;  4IKF A;  4JEH B;  3RRC A;  4BE1 A;  2K9A A;  3EAE A;  5CVI A;  2MWP A;  4DOW A;  2LQK A;  2V26 A;  2PJQ A;  5GMK i;  4TV9 E;  4JRQ A;  4MML A;  4M77 G;  4ME7 A;  4QWN B;  3F31 A;  3OYC A;  4M77 D;  1VQM A;  2H7V C;  1WR6 A;  4XTW A;  3V5U A;  1Q86 U;  4ZI2 C;  4YJ2 E;  2E1H A;  1VQ4 A;  4PAG A;  3AB3 B;  4NUU A;  2N1G A;  2A2F X;  3ONX A;  3RRW A;  4IUU A;  5AYF A;  2G3R A;  3OSS C;  3AVS A;  5GON E;  1QVF S;  1KQS S;  2KT9 A;  3LBX B;  2DI4 A;  1MGQ A;  3A8O B;  3HKB E;  3O1H A;  5GMK j;  1SHZ C;  4OMF B;  3VKG A;  4H9P C;  2DIQ A;  2HD0 A;  3MP8 A;  4M7A G;  4M7A A;  5JDM A;  4A4H A;  1Q86 C;  3L2Z A;  4A56 A;  3P8D A;  2CXF A;  5F3J A;  2YLB A;  4FT2 A;  1VQ7 A;  2VGN A;  3MJX A;  3RKY A;  4N4H A;  3CX7 B;  2F69 A;  4KUD K;  5GAO l;  1QVG S;  2X9H A;  2MF2 A;  4M75 C;  2P0Q A;  3BK9 A;  3L2Q A;  1UGS B;  3K8P C;  2KVQ G;  2X51 A;  3MK7 C;  2OAU A;  4XTY A;  3I56 T;  1LJO A;  3NRX A;  3HRT A;  4YLH A;  1FWZ A;  2KQW A;  1K8A C;  3RC3 A;  3MEV A;  1BYM A;  3I9Y A;  2RD1 A;  1JJ2 A;  3LK3 B;  1MND A;  1NAF A;  1D1C A;  3V7R A;  2DJZ A;  2PU9 B;  1BIB A;  5CQX A;  3M55 A;  1YJN T;  3ZJ1 A;  5EK3 A;  4E7Z A;  1E1H B;  2DK3 A;  1KHC A;  3CCS A;  3BDL A;  4TUY E;  2QQR A;  5KMG P;  4M7D G;  4AI6 A;  3JCM J;  3F70 A;  3PUS A;  3VKH A;  1M1K C;  1K9M U;  3HR0 A;  1G8X A;  3SFM A;  4RMO A;  1UGR B;  1VQ8 A;  3ER0 A;  2PFV A;  2LSJ A;  3OJA A;  1B7T A;  3UPU A;  3FB2 A;  4J6Y A;  1Z0P A;  3Q5W A;  4F7U F;  1I81 A;  3A8G B;  3CC2 A;  3J7A F;  3EFS A;  3ETV A;  5LJ5 h;  5CA0 E;  4A53 A;  4GOU A;  5LJ5 f;  4CI1 B;  5GAN 4;  1G3W A;  3UFE A;  1N9S A;  3J7Y q;  3H37 A;  4C92 A;  4C0D C;  2GCX A;  3E9G A;  5J1G A;  4J6W A;  1LKX A;  3KV6 A;  1K73 U;  5HWY A;  4XZC A;  4H9R C;  4XTX A;  2EHO A;  4M77 B;  2NLU A;  5J2U E;  5IYZ E;  5CKE A;  4ZHQ E;  3DB3 A;  3B13 A;  2R58 A;  3NTH A;  3DLL A;  3FC3 A;  3CCL A;  2P0K A;  3CCJ A;  3OS2 A;  2MTQ A;  3MAC A;  1W4S A;  3WI3 A;  3GLX A;  5LCY A;  4H9N C;  3HFO A;  3JCM h;  4RG8 A;  2RP4 A;  3LJC A;  5JDG A;  1N27 A;  4ADZ A;  4ERR A;  2XD0 A;  1XNI A;  5DJQ C;  5JDQ A;  4XTV A;  2HH7 A;  3SRZ A;  5LA6 E;  3ESL A;  2CZ7 B;  2FYK A;  4QW2 A;  2QEX T;  2LSI A;  2CEA A;  3KBG A;  4N0A C;  1P92 A;  4BAY B;  4EMK A;  3EFR A;  3PT9 A;  4H9S E;  4DBQ A;  2E12 A;  4GYR A;  5JDL A;  1KG1 A;  4UF0 B;  3KVA A;  4CXY A;  3SD4 A;  1UEB A;  5D6X A;  5D6Y A;  1YKH B;  2V7M A;  1VQO A;  2HNI A;  4M7D B;  3M58 A;  2YHT A;  4DND A;  2Y4Y A;  2VAS A;  4M78 D;  3G71 T;  4N0A A;  2KMF A;  5GAN 6;  2JUF A;  3QK6 A;  3EDV A;  3MA9 A;  3Q1J A;  3VHL A;  2QTX A;  4I50 E;  1YHQ T;  2DWK A;  1Q7Y U;  4QKN A;  2X4W A;  1K9M C;  1M1K U;  2Z6E A;  3L2V A;  2RA2 A;  3SB2 A;  2BDE A;  4ZI3 C;  1LNX A;  3M5A A;  5GAN e;  3Q2M A;  5LOV E;  2QA7 A;  3CCM T;  1IZN B;  4WF2 A;  3CCE A;  2X0L B;  4C92 G;  4JEU B;  2BIV A;  4WBN E;  2L8K A;  4E7J A;  2CM0 A;  4ISS A;  2HAX A;  3CMA T;  3K3Q C;  5FXX A;  2JJ9 A;  3JCM b;  3JCM c;  2DPP B;  3E9F A;  3KUF A;  3JC6 D;  4P0A A;  2R5M A;  3QO3 A;  3S3O A;  1YHQ A;  4UVC B;  2RI2 A;  1HTJ F;  3PUQ A;  1YIT T;  3NRY A;  2C5I T;  4X1I E;  1KC8 C;  3CBO A;  5LBQ B;  3SWH A;  3LGL A;  3ME9 A;  5LJN A;  5JDN A;  5JR9 A;  5A0D A;  2CZ6 B;  3HL6 A;  4MFR A;  3RYF E;  2XAJ B;  4OHF A;  5GAN 3;  5GAO m;  2KWI B;  4E7L A;  3MCA B;  3PFS A;  5JVD E;  3KVB A;  3GN5 A;  5FLX E;  1Y07 A;  4PJO A;  3G4S A;  1W2B S;  3FHN A;  3C98 B;  3HL8 A;  2CWY A;  2XHE B;  4A4G A;  2VXE A;  4C8Q G;  4DO0 A;  1QSD A;  2CS7 A;  2XK0 A;  1Y96 B;  2Y48 B;  2XAQ B;  2W61 A;  2E6N A;  4C8Q F;  1G3T A;  2XU8 A;  5GAN 2;  3PNW C;  1HCI A;  3OBV E;  3CD6 T;  2Q9Q D;  1O9S A;  1HG5 A;  2CLY C;  2FVU A;  4XU2 A;  3WAJ A;  3VYH B;  3OA6 A;  3OW2 S;  5JRC A;  1YJN A;  2IW5 B;  3P8B B;  4JJN K;  1VQ4 T;  4EMH A;  2C06 A;  5L3D B;  4QXB B;  3EVY A;  4M75 A;  4FT4 A;  2KZ7 B;  1X01 A;  5ETW A;  3N9M A;  4O5V A;  3OB9 A;  3V7S A;  2D2S A;  3CCQ A;  1HK9 A;  2DXB A;  5FRO A;  5BMV E;  4O8S A;  3CME T;  2KAF A;  1VQL T;  3JB9 H;  4DMV A;  3HP9 A;  4UV8 B;  2PQW A;  3L1A A;  3OY9 A;  4QVZ A;  1PSF A;  2XDB A;  2CZ1 B;  2L8D A;  3I0Q A;  2LRQ A;  2V8J A;  2ZZD A;  4GK5 E;  2K5F A;  5GAN h;  2LE8 A;  3ZMZ B;  3MO8 A;  4X34 A;  2NP9 A;  4M7A E;  2BVM A;  4HEA A;  4IUV A;  3OMG A;  2CXL A;  3C12 A;  3FDR A;  1NPR A;  1Y71 A;  1JRI A;  3G4S T;  1WNL A;  5DM7 R;  5FRM A;  4C0Z A;  4HFV A;  3E1S A;  2XI9 A;  3W15 B;  3J9X 1;  1V29 B;  4F7U G;  2JMK A;  3QC9 A;  2IC6 A;  4PNI A;  3JCM d;  2KLQ A;  5J39 A;  4BI4 A;  2H3R A;  3CPZ A;  2K4Y A;  2KSS A;  4L6V 5;  3UUN A;  3CCV A;  4D6W A;  1HF8 A;  2L3L A;  2XTL A;  3CCS T;  2KWH A;  1QW1 A;  1S35 A;  2JNG A;  3JCM f;  2LHN A;  3AA0 B;  3V7C A;  3OQ5 A;  1WLX A;  4QXC B;  4DBR A;  3X20 B;  2ZGW A;  1OI1 A;  2EQJ A;  4N78 D;  4PK6 A;  1VQN A;  3QJ6 A;  3ZEH A;  4C92 F;  2XAF B;  5DAB A;  3D0T A;  1XTD A;  3FXE B;  1MMA A;  4NS5 A;  2W00 A;  3R6O A;  2E5Q A;  3DB4 A;  5I2M A;  1ZBX A;  3HPW A;  3HHT B;  2EYQ A;  3N5B B;  4M78 A;  2PUO B;  4IUR A;  5H6Q B;  2X67 A;  5HK0 A;  1CUN A;  5AFU L;  5A0G A;  4DOV A;  2DEQ A;  1MMN A;  5FU7 B;  5GMK e;  2WSC E;  2O01 E;  1Y7X A;  2WSE E;  1IAP A;  2VK9 A;  3BY7 A;  2VXF A;  3QZ9 B;  5D6W A;  3DLM A;  2CMR A;  4MDW A;  1U5P A;  4L0R A;  4ANJ A;  3OYY A;  2LM9 A;  5LHI B;  2LNV A;  3C50 A;  3RYC E;  3QZ5 B;  4M75 E;  4V2S A;  2BZB A;  4EB6 E;  3PGG A;  5GAO p;  4O6J A;  3AA6 B;  4CXW A;  4C8Q B;  3GOX A;  3IHR A;  2JN0 A;  3KIN B;  4M7A F;  2RHZ A;  3JB9 D;  2CE7 A;  2W62 A;  2KK4 A;  3BQL A;  4PK5 A;  3FXD B;  1KD1 C;  1Q82 U;  2K3X A;  4BE2 A;  2VKD A;  5ADX L;  4EMG A;  3ZYK A;  3CC7 T;  1KC8 U;  2KXP B;  2N9D A;  1HXD A;  2K3Y A;  4UV9 B;  2HQX A;  5HXC A;  2DAQ A;  1MNE A;  1LOJ A;  2YEV C;  2PBI A;  2QXF A;  3O4X E;  4F7U B;  3IBP A;  2CGH A;  2C5K T;  4C5G A;  2MI6 A;  2V1D B;  2QQA A;  3ETU A;  1KQ2 A;  3PU8 A;  1UGQ B;  1M90 U;  3A8L B;  5CKB A;  2EFI A;  4C8Q E;  4Y91 A;  4C92 D;  3HRS A;  3CME A;  1VQL A;  1HG2 A;  3MEU A;  4UIG A;  4QX8 B;  4CI0 C;  2LQ8 A;  1B34 B;  3RYI E;  3OMC A;  4GY5 A;  4P5N A;  3X24 B;  3AAA B;  4EYY R;  1PSE A;  1UB4 A;  3ZMV B;  4C91 A;  5CO7 A;  3MHX A;  1WYB A;  3VUZ A;  5HYA A;  4OYK A;  1SA0 E;  4MLK A;  3K3O A;  5C6S A;  1OWA A;  4JLG A;  4XBF B;  3NTI A;  3X28 B;  1VQK A;  1KNZ A;  2PVG B;  4ZI3 D;  4BB7 A;  4EXT A;  3HKS A;  4IUT A;  3J81 E;  4Q5W A;  4I43 B;  1BIA A;  4OB2 B;  2RB6 A;  5DLQ E;  3IEE A;  3CX6 B;  3MP6 A;  4M7A C;  3MP1 A;  1H64 1;  2PG8 A;  3R84 B;  3QJY A;  2P4T A;  1YJ9 T;  3GIB A;  2DD5 A;  2C5J A;  4Z8X A;  1VQP A;  1LVK A;  2X66 A;  2X9W A;  1K73 C;  2Y8D A;  4ATO A;  3RX6 A;  3EDU A;  5KE3 A;  1VQK T;  4L9I A;  2PVD B;  3NZQ A;  4EZH A;  4M75 B;  5DQW A;  2A3D A;  2FL7 A;  2X4X A;  3N9Q A;  2N2N A;  4J83 A;  3HKE E;  4G63 A;  1M5Q 1;  2ES0 A;  5HY6 A;  3N9P A;  3GP8 A;  3ZJ2 A;  1U1T A;  3VUB A;  4KP3 C;  1YIJ A;  3JSC A;  1AHJ B;  2E9X A;  3DJB A;  4PJO D;  5CR2 A;  4M7D C;  3I9W A;  4PFP A;  2OTL A;  4OYJ A;  3JCM Q;  3V8J A;  4OFZ A;  3CBM A;  4ZGE B;  2B8A A;  3AA1 B;  4V1A v;  3OBY A;  3OS0 A;  5CB4 E;  1D0Z A;  2E70 A;  1YI2 A;  5GAN d;  4PJO E;  4J7F A;  5HK3 A;  1OXZ A;  3I0O A;  5IN1 A;  4MAL A;  3LGF A;  2RJE A;  2ZPB B;  1VQ9 T;  4P09 A;  4TN7 B;  3CCU A;  3LWI A;  5LJ3 h;  1MIV A;  5FU6 B;  1IRE B;  1Y96 A;  1UX4 A;  3QPH A;  2LT4 A;  4LDY A;  4BY6 B;  4HCB A;  1Q81 C;  3GWH A;  3KDS E;  4QQD A;  4O2B E;  2G0U A;  4E7H A;  4KBM B;  3CQC B;  2IC9 A;  4RKU E;  4PJO C;  4XU3 A;  2RHI A;  4PLI A;  1VQ5 A;  1M4Z A;  2AHJ B;  1HX8 A;  3BQI A;  3L09 A;  3CEY A;  5CKD A;  3OKQ A;  5FY0 A;  2E8I A;  3TEE A;  1IZ6 A;  3PTR B;  4IUQ A;  3H8Z A;  3ZBD A;  3CMA A;  2MBG A;  1BI2 A;  1QUU A;  3PMT A;  3E22 E;  2Y6X A;  1YJW T;  1US7 B;  2HPJ A;  2VGM A;  4O4H E;  3RES A;  1YIT A;  4EMK C;  1ZEE A;  5CA1 E;  3OYI A;  1VQ6 A;  2V8K A;  3F57 A;  4KUL A;  3G6E T;  4C90 A;  3TU4 K;  2E9X C;  3LK4 2;  3VU3 C;  1WJQ A;  3JAM E;  1H3Z A;  4ELZ C;  2YIN A;  3HA4 A;  3LK2 B;  1YBY A;  3RC8 A;  3CBP A;  3CCJ T;  2DZ9 A;  4QVC A;  3RKW A;  4M78 F;  3QYH B;  4JUY A;  3WVE B;  5LNK A;  1BI3 A;  2V7L A;  4PJO F;  1R8O B;  5L2L A;  4IE6 A;  3CPW A;  1WJR A;  3OYX A;  5LJ3 e;  3R6N A;  4R56 A;  5F8P A;  4EDU A;  2GK9 A;  3MXZ A;  2QA4 A;  2WSS V;  3O1J A;  2ZPF B;  4JS5 A;  2JPF A;  5LHH B;  2JVV A;  4QQG A;  3JB9 J;  2VKH A;  3VV0 A;  5J3B A;  1MHN A;  5IHY A;  2RI5 A;  4C0D B;  2KND A;  2QQB A;  3WVD B;  2VYT A;  2IAK A;  2DXU A;  5LJ3 j;  5A2Q E;  2F5T X;  4A54 A;  4TVR A;  4C92 C;  3HKC E;  2PUK B;  2D0Q B;  3QXE B;  4NL2 A;  2GF7 A;  4C5E A;  3A8H B;  3QG1 A;  5LL6 S;  2E65 A;  2A72 A;  4C8Q C;  3QSU A;  3VKI A;  4WW0 A;  4QXH B;  4C5H A;  1VQN T;  2P9B A;  3URG A;  4IIJ E;  4E7I A;  1NE8 A;  5LJM A;  4OGE A;  2Q9Q B;  4GIW A;  2E41 A;  5E0O A;  1WPY A;  4PK4 A;  2VB6 A;  3L2R A;  5FRN A;  2R5A A;  5LGT B;  3BW1 A;  2DKG A;  5EG2 A;  4ZGJ B;  5FY7 A;  2SPC A;  3CC7 A;  4JRP A;  3JCM g;  3C4Z A;  2QQ9 A;  2XID A;  3C4S A;  3JCM W;  4F7U E;  3KBU A;  2RK1 A;  3L3P A;  3QDR B;  4X9C A;  4J6X A;  4N4G A;  2K48 A;  1M1G A;  4ASK A;  4HT9 A;  2V8I A;  5GAO q;  2LHR A;  5GAM d;  3O9X A;  3CXC S;  3VJP A;  4KMC A;  4UC4 A;  2NW9 A;  2LEH A;  2M9U A;  2O4X B;  4ZS3 A;  2JTF A;  3X26 B;  1QP3 A;  3JRZ A;  5KDM C;  4IUP A;  4E7K A;  3GN5 B;  3C4X A;  2VC8 A;  1WGS A;  1VQO T;  3UT5 E;  2E9X B;  2LT1 A;  1YJ9 A;  4YFS A;  4BJN A;  4IE7 A;  5GAO r;  2QQS A;  1VQM T;  3V8L A;  2DTH A;  3JB9 F;  4EMK B;  2MWO A;  1MIW A;  4M7A D;  4B9W A;  1NJI C;  4CZZ B;  5GAM f;  4WBO A;  2DXC A;  5GAM h;  2XHC A;  4ZTJ A;  2JZ2 A;  1MMD A;  2XKO C;  5FNV E;  3M59 A;  4FL6 A;  5A0L A;  3WXM B;  3G6E A;  3ZMT B;  3LH0 A;  2LCC A;  1BKB A;  2D0U A;  4GK0 E;  5LJ3 f;  2XAS B;  4F7U A;  5GAO n;  2WAU A;  1X6O A;  1MIY A;  1M1F A;  4WNK A;  3C4W A;  2K2V A;  2K5L A;  1FXX A;  5FXZ A;  4TX5 A;  2JMH A;  4QQ6 A;  4PJN A;  4CI2 B;  1WJS A;  4DQ2 A;  1I5L A;  4C8Q A;  3KFW X;  3N9L A;  3NBX X;  4H9Q C;  2JOY A;  4BUG A;  2GFA A;  5KCH A;  2X35 A;  3CPF A;  5HXR A;  2DZC A;  3N2G E;  1ZQ1 A;  4IE5 A;  5GMK m;  1VQ9 A;  2KIN B;  4L59 A;  4M77 F;  2OTJ A;  2DO3 A;  2OTL T;  2VUB A;  3CVR A;  4OB3 B;  4M78 G;  2X9X A;  4A4F A;  2K5B B;  3ZMU B;  1VQ7 T;  3JCM X;  4A4E A;  2DTI A;  3X25 B;  2RO0 A;  1YW0 A;  3FLG A;  4B6X A;  5J26 A;  1D1B A;  4IHJ E;  3S3M A;  4X1Y E;  4JRK A;  4ZI7 E;  2WAC A;  2YK0 A;  3V8K A;  3UWN A;  3N2K E;  3ZLI A;  4N4I A;  3KV4 A;  4HCZ A;  3QUI A;  1U8R A;  4M78 B;  1UGP B;  3SS1 A;  5LJ5 e;  1NJI U;  2L89 A;  3I1A A;  3LBX A;  3GA8 A;  3H3A A;  3S4U A;  2HPL A;  4O4J E;  4AKI A;  4XU1 A;  3PE0 A;  2QGS A;  3RUX A;  5CK9 A;  3N5L A;  5FXW A;  2DHR A;  5H6R B;  4ZTF A;  1KQ1 A;  3A5Z B;  1XOV A;  4RCB A;  2NTY A;  1JB0 E;  2RJC A;  2CA5 A;  3M57 A;  5KX5 E;  2RA1 A;  2EWN A;  2DD4 A;  4XQ3 A;  2EHO D;  2JRK A;  1BI0 A;  2A7Y A;  3CCQ T;  2UXX B;  4DA4 A;  3U78 A;  2V7J A;  4MBQ A;  2RM4 A;  5GAM j;  1KQS A;  3LG7 A;  2WSF E;  5HWX A;  3SWN B;  5EK4 A;  3OYL A;  2ZM8 A;  3TKL B;  2HBP A;  4ZN1 A;  2VV5 A;  3PMI A;  3Q5X A;  1VIF A;  4OB0 B;  4M75 F;  5GAN f;  1G73 A;  2NTX A;  2ZM0 A;  4ZI2 D;  2LDM A;  4H63 V;  3PTA A;  5CKF A;  2ZCF B;  5GAM e;  4IGU A;  4MZT A;  1IJ5 A;  4ZOL E;  4C5I A;  2DIG A;  5HXE A;  4MMK A;  3FBZ A;  2FB7 A;  4RCC A;  1VRB A;  2MYS A;  3C51 A;  4C8Q D;  2BKD N;  1DJ7 B;  3V5S A;  2QA4 T;  3RYH E;  2LSK A;  2ZLY A;  2CYZ B;  2K57 A;  3L42 A;  2WM9 A;  3PIO A;  3QUJ A;  2KMT A;  1XQH A;  5LGN B;  2E6Z A;  2LC4 A;  5GAN g;  5GMK h;  4ILU A;  3UDC A;  3H6Z A;  1Y64 B;  1YKE B;  3U3I A;  1RI0 A;  3VU7 H;  3CQX C;  3BDU A;  5IT9 E;  4A4K A;  1SSF A;  3OW2 A;  3HRU A;  3CCR A;  3E19 A;  4UVB B;  1T98 A;  4BDZ A;  5L3E B;  4KUI A;  3HKD E;  5IAY A;  1EZ3 A;  2ZMA A;  2YLC A;  3B57 A;  4PL6 A;  2EQM A;  4AKH A;  1NPP A;  1KK7 A;  2L3R A;  4HE8 A;  4O4I E;  5KCO A;  3ZEF B;  2D9T A;  3M4Y A;  4UEM A;  2RHU A;  4QVD A;  3OYD A;  4M78 C;  2MMP A;  3NFC A;  3LX7 A;  3MET A;  4CRI A;  2BVL A;  4XU0 A;  4MZP A;  3OYJ A;  2ZPH B;  1VUB A;  2YU1 A;  4JRI A;  2QI2 A;  3ANW A;  5HAX A;  4BA9 A;  2XIC A;  3MEW A;  5GAM g;  4IDZ A;  3AAE B;  2LSG A;  3GNF B;  3VYG A;  3GMI A;  4M7D D;  1FMW A;  3HSB A;  2NWB A;  1D3B A;  2D5U A;  1OZ3 A;  2CZ0 B;  2KDS A;  3CCR T;  4OP0 A;  3RMS A;  2OA5 A;  4AQG A;  2IG0 A;  5JH7 E;  1G5V A;  4JS4 A;  3PDY A;  4L5G A;  1WYC A;  3WAK A;  5KE2 A;  3FJP A;  3SDZ A;  3ZN1 B;  3AVR A;  5M4Y A;  4JLE A;  4PJJ A;  4M77 A;  1H7C A;  3OBW A;  3GF5 A;  2ZPI B;  1WRD A;  3QHS A;  2CXD A;  2XAG B;  3JCM P;  2ZM2 A;  4UXN B;  3E0Z A;  5DY9 A;  2ODU A;  3G71 A;  4OB1 B;  2D6F A;  3M56 A;  1LRZ A;  3T8O A;  1EIF A;  1ZKE A;  3A8M B;  2C0S A;  4OGC A;  1FMV A;  3M53 A;  2WWU A;  1LVF A;  4EIW A;  3RIR A;  2H7O A;  5C0M A;  5I2S A;  3PUR A;  3AAI A;  3MEA A;  1YCY A;  3N2O A;  4I55 E;  1YI2 T;  4CQI A;  4PKC C;  1IJ6 A;  1BI1 A;  2NOX A;  1VQ8 T;  3FEO A;  1N9R A;  1NWM X;  3NTK A;  1D3B B;  3CCU T;  4FJO A;  3UUX B;  4XK8 E;  3OYN A;  3PU3 A;  4DVD A;  3OYZ A;  3UTK A;  4XAX B;  5FXV A;  4J2C A;  4FSX A;  1O75 A;  1Q81 U;  1S72 T;  5LJ3 d;  3M9Q A;  3LFM A;  4HT8 A;  2IVW A;  1JBM A;  1WQ7 A;  1OYX A;  3PIP A;  2M0O A;  3AHU A;  3E08 A;  3C64 A;  4ZS2 A;  4H63 H;  3HFN A;  4NOY A;  2EJ9 A;  3RMQ A;  3I56 A;  3UUL A;  2EAY A;  2LOP A;  4ELY C;  4AKR B;  3CQG B;  3JCM V;  4FU6 A;  4XTU A;  2GFU A;  4E7S A;  1U4Q A;  1FIO A;  3T9N A;  3I55 A;  5LJ5 d;  4H9O C;  3DP7 A;  2YRV A;  3AA7 B;  5FY1 A;  4FM4 B;  4J8O A;  1RL2 A;  2X4J A;  3LYI A;  2XQY A;  4O2A E;  4PJL A;  2OTJ T;  3JB9 G;  3ZYM A;  5CKH A;  4M75 G;  4Z02 A;  1V9D A;  1QP2 A;  2QEX A;  4GYS A;  2LVM A;  1W2B A;  2DTO A;  1VQ5 T;  1NZ9 A;  2K5I A;  1U1S A;  1M8V A;  4VUB A;  2FHD A;  2I59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...