4XAXB

Crystal structure of thermus thermophilus card in complex with the thermus aquaticus rna polymerase beta1 domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords DNA-directed RNA polymerase subunit beta domain 1
publication title CarD uses a minor groove wedge mechanism to stabilize the RNA polymerase open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 47
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4xaxB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xaxB01
4ILUA 4KBMB 4XAXB 2LT3A 2LT1A 4L5GA 2EYQA 2LQKA 2LT4A 4KMCA 4MFRA
chains in the Genus database with same CATH superfamily
4U3CA 2KI7A 1ZA1B 4J7IA 1XNQT 1WHJA 1YP5A 1E6HA 2D0NA 3RMSA 3M57A 4NXNT 3ZJ1A 2DAQA 3PVLA 3OYDA 2VC8A 4M7DB 4U72A 4C92E 3TLSA 3WXMB 3CC2A 2EYYA 2HKNA 2IC9A 4HKAA 4X64T 5I22A 4O4LE 4IE0A 2ROLA 2CM0A 3C4XA 3QC9A 3H41A 3T1HT 2XICA 3CCRA 2WWUA 1K4US 5CB4E 1UURA 4O6JA 3R6OA 5LJ3f 2CXLA 2XSBA 3N2OA 3SWNA 6AT1B 3CCLA 4X20E 1SUMB 5JRCB 3CMLA 3KVBA 2DIQA 4ILUA 4UV8B 3JCMW 1EX4A 4C8QC 1JB0E 2W00A 1MMGA 2RJFA 4M4ZA 4EPCA 1MV3A 2XSAA 1WPYA 2H7OA 4EIWA 2ESWA 3V7SA 2JT4A 4UF0B 4XU0A 3SD4A 5KYNA 2VKDA 2FBWA 5ABGA 5L2LA 1IBKT 1MUZA 1S35A 1QMCA 1M1KU 3CCSQ 2EVRA 2WMNA 3Q9DA 4KI0F 1XWMA 3JB9F 3ZMZB 1XOVA 2FZCB 1I0CA 4PJLA 2CA5A 3JAEA 5HXCA 1FXXA 2CZ0B 1TTHB 4DR3T 2JXBA 1NPRA 4R55A 1C6VX 5FU7B 1SE7A 4N4GA 2KSRA 1UUEA 1ZEEA 2Y6XA 3GWHA 3ONXA 4XTXA 3A8GB 2HQEA 4ASKA 3J9X1 4C5GA 2RQVA 2K48A 2UXCT 1KD1C 1YKHB 2GTOA 2V26A 1O3XA 3CX7B 1FIOA 4Z8XA 1C0MA 1TWBA 3O5ZA 4DBRA 3M54A 3EGDB 2YRDA 3M0RA 4EIKA 2C5KT 5C3JA 4FI5A 1VQ9T 1W0AA 1UTIA 5LOVE 4A98A 2X4JA 5EK2A 3CPFA 4M78B 3RI5A 4B6XA 4OB0B 3VYHB 3VS1A 2E4HA 3WI3A 3VU3C 2QGSA 4N0AC 4IL4A 4WCIA 2KGTA 3SB2A 4FYVB 4GYRA 3I9YA 1KFZA 3BFMA 4GY5A 5CA0E 3H0HA 2IVWA 3VKIA 4BE1A 1XMQT 3NRYA 3MPUB 1NJIR 1PWTA 5LJ3d 4JI2T 4KBMB 4J9FA 4JI5T 4CI3B 5HKCA 4JBWF 3C0CA 2D1XA 2M02A 3EHQA 5C0MA 3O9XA 5L4HA 1IHVA 1YN8A 2V5CA 2XMFA 3EG2A 3OQ5A 3RKXA 2DHRA 2F1LA 1YIJA 4OHFA 5LJMA 2WSSV 2VKNA 4C92B 2NUZA 1VCTA 3RLFF 2HPJA 4KMCA 4JPBW 1H7CA 1GRIA 2LSKA 4ZI2C 2YUQA 1Y64B 3C95A 3CEYA 1OEBA 3EG0A 2PFVA 2CH4W 1YITA 4PFZA 4DR1T 4F6RC 5KYYA 1YFNA 4IUUA 2JTEA 4JI4T 2EFIA 3QJ6A 4RCBA 4WBNE 1YIJT 3UU8A 2DXTA 3HKDE 3OYNA 2LMJA 4J83A 2RQWA 2RM4A 4UVCB 2DVJA 4DA4A 1M2OA 1H8KA 3BQLA 1QLBA 5JR9B 4IREA 4HFIA 5FVLA 1J5ET 5GAN4 4ERRA 3BW1A 3CCMT 4HCCA 3ZFJA 1PHTA 1YITT 3V8KA 1WJSA 3U78A 3AEDA 2QEXT 4DBHA 3ZCJA 2PVGB 3UFEA 2C5JA 2QASA 4BDYA 1G3SA 2CS7A 4OMPA 4ISTA 1YI2T 4YFSA 2C5IT 1HXDA 1Q86C 4K11A 2WQYA 3E08A 1M7KA 2Q9QB 2AHJB 2LRLA 3RC8A 4NL3A 4ZS3A 3A8OB 1Y57A 2QQBA 4IIMA 2D9DA 3PUQA 5FKYA 4LF8T 3P8DA 3EGXB 2MCNA 3KINB 1NZ9A 4GOUA 5GAN6 1T72A 3AVRA 3OW2P 3I0OA 4Z91A 4A5XA 3FB9A 2X0LB 3ABVA 1QVGA 1UHCA 4O4IE 4FM4B 2WDVA 4C8QF 2ES0A 4IE4A 5FRMA 3I56Q 1UK5A 5HEJA 4C8QG 2PVDB 4E7IA 2K2VA 2KXPB 3AE9A 1QVPA 1XJWB 4F7UG 5GMKj 3UU5A 3QXEB 2M0OA 3OMCA 1GCQC 5GAOp 4DR5T 3M0UA 5EG2A 4XTUA 2DL1A 4HFCA 3JC6D 2J1DG 1Z9ZA 4L5GA 2VWFA 3UA7A 2X4WA 1SSHA 5HK0A 2VGMA 5JDMA 4QQDA 3Q5XA 4AFSC 2HKQB 3BDUA 4I0UA 2CPTA 3CX8B 3I0QA 2KBTA 1AT1B 2GCXA 1PSFA 3ZYMA 2E5LT 2B1EA 4TVRA 2DLRA 4UEMA 3M5AA 3X26B 2CBJA 2ZPFB 4JUVA 5LHHB 4QH1A 4TNWA 4LF4T 1OPLA 1B34B 3P4RA 5HXHA 3LW5E 3PUVF 5TAOA 4BI4A 3P4WA 2FJBA 2PTFA 2OAUA 4K0KT 1NJIU 1KNZA 4RTTA 2IAKA 4FW1A 5LJ5f 1WHKA 5I11A 3DLLA 3L8RA 2MOXA 3ER0A 2GBQA 2HN2A 4OGCA 1ABQA 4M77D 5LL6S 3Q5EA 2MAMA 2O88A 2DLPA 1AOJA 1ZQ1A 2WB5A 4PFOA 2FVUA 3PIPA 1UGOA 5HXSA 3NGPA 2FJAA 4IDNA 2XQAA 4YT0A 3OSSC 3N9PA 1IBMT 4H9NC 2I2LA 4HWHA 3DP7A 1Z9QA 4MZPA 2WZHA 1N32T 4IUPA 2KRSA 4QT7A 1OZ2A 3V8LA 3INZA 1M9SA 2QRXA 3EAEA 2RHYA 3CMAT 2EYQA 4XTZA 2EKHA 4QVCA 2RJDA 3M9QA 3A5XA 1N34T 3ZL7C 2RB6A 5CVIA 2CREA 4KGVB 1PG5B 3QUJA 4DEXA 1WLXA 2XTLA 3HFNA 4M77A 3PURA 3EG3A 3FBZA 1T3SA 2K57A 3QYGB 2MI6A 2ROTA 2E9XB 2GTJA 4DOWA 4H9RC 3CCUQ 2A2FX 5JDNA 4EYYR 1S94A 2LKGA 4JI7T 4J9GA 5KYWA 4JJNK 4M7AE 4PJNA 4BJMA 2YSQA 2HH7A 3V8JA 3M65A 3RIUC 4ZI7E 1EZZB 1UX5A 3HP9A 1HYOA 1YXRA 5FW9A 2A08A 2XDDA 4DUZT 3JCMc 1N8RU 1N33T 3EGUA 5KCHA 3CXCA 2GQIA 2LT1A 2B86A 1VQMQ 1HFAA 1OV3A 2CZ7B 5KCOA 5FXVA 4M77C 1ZUYA 2XAGB 3LX7A 1IRXA 3FZKB 3E9GA 1QCFA 1R77A 3AEGA 2DTIA 2DXBA 3ZPOA 2K5FA 2ECZA 2YLCA 5LJ5d 1VQNQ 1EIFA 4LNPA 3OYGA 1UDLA 3HR0A 1SF9A 4F8HA 3CPWP 1IHWA 1Y0MA 3VS2A 3S3MA 4C92D 3PNWC 4PL6A 2PJQA 1UB4A 2J62A 1B07A 4A4EA 2FRYA 1VQ8A 4CXYA 2D8HA 1M1KC 1AHJB 2XUEA 3IEEA 2GFAA 4RTXA 4IHJE 4AKIA 1FMVA 3CCSA 4GKJT 5I21A 3OB9A 2VKOA 1E7OA 4OMLA 3O4XE 1Q7YU 2UUCT 3FDRA 5DLOA 2DVEA 1LVKA 5FWBA 3PUWF 2XQ5A 3CBPA 3RIAA 2L3SA 2VQFT 4A53A 2MBGA 1OZ3A 1NYGA 3EFSA 1M1FA 5IHNA 2P0PA 1I5OB 2YDSA 1YNZA 3AE3A 3FJPA 4C92A 4QWNB 1WCRA 3F31A 2LQ8A 3GMIA 2RJEA 5HWYA 2DF6A 1BK2A 5LJ5j 2LNHB 2XDPA 2X67A 3CQCB 2ENMA 4QXBB 3JCFA 4BA9A 1Q81R 2Q9QD 5L47A 1HCIA 3RX6A 5LCYA 2G0UA 3RKOA 1QVGS 3O8VA 2LJ0A 3HKCE 3UUMA 4JJDA 1VQKT 2CP5A 4FL6A 3J7AF 1YWPA 3RQWA 1WXTA 4X9CA 2FUPA 1W9RA 2FJEA 5LJ3e 4M75E 1AWWA 3CD6Q 2BTTA 3GIBA 3AEAA 2MPXC 1AWJA 4AISA 1QLYA 3CBOA 1OEDC 4DBQA 4RTZA 2RQTA 2F5KA 4BE2A 3L2QA 4N4HA 2WZIA 2HL3A 3DB4A 2V7KA 2FB7A 2WDQA 2Q9QA 3DJBA 1Y7XA 1ZOYA 2NWMA 3OS1A 3CXCP 2IUBA 1KIKA 3K1SA 4B9WA 4AKRB 5LXTE 3WAKA 4IE7A 4U33A 1J3TA 4E7HA 1MHNA 2NW9A 4DV0T 4F14A 3HL8A 5DY9A 2BE7D 3AT1B 2LJ1A 1D1BA 3UF4A 4NUVA 1QKXA 2RN8A 3ZJ2A 3U23A 3CPWS 4X66T 1UGVA 4IE6A 3BDLA 4B3MT 4AQGA 2RI2A 3KFWX 4P0AA 5FXZA 5J2TE 4FT4A 2WP9A 1TH7A 3D7SB 2C0SA 2OTJQ 4JI8T 2ED0A 2RHZA 2K79A 5LGUB 4JYAT 1JBMA 1ZUKA 3EH1A 5GMKe 4NXMT 3LK3B 2V6XA 2YEVC 2DM1A 3V5UA 4HCZA 2KROA 3CX6B 2Y48B 1QKWA 2K4YA 3JCMd 2NP9A 5GJWB 1RAAB 1I4K1 1YJWA 4LDXA 1BU1A 1VQOA 1KFYA 4AKGA 3C64A 4HFHA 2LDMA 4OMFB 4JRKA 3JB9I 3NZPA 5LGNB 3FZLB 3OA6A 2VL0A 3AEFA 4HFDA 5IHKA 1NENA 2PUOB 3THKA 2PVOB 3MP1A 4I43B 2BG9E 1B34A 1JNZA 3E19A 3P4QA 4X65T 3FBLA 1I8FA 4BAYB 2P0KA 4EB6E 1T8BA 4PJOE 3IBPA 2Z6EA 1K76A 3LGFA 5AQPB 5HK3A 5E0OA 2V8IA 3CCVQ 5FP3A 4M77F 3IQLA 4NIQA 1CHUA 3RH3A 2V1RA 1SSFA 2YINA 2YUNA 3C4WA 2E9XD 2QA7A 3PDYA 3NZQA 2R57A 5GAOn 5CKBA 4D8KA 5FLXE 2MYSA 2KWHA 4NUUA 1JQQA 3I56A 5ABHA 2VK9A 2GFUA 1V29B 2YLBA 3ETVA 3LK2B 3ME9A 2J06A 4AFZC 2RQUA 3CCQQ 4M7DE 2SPCA 4YSYA 3PTAA 1GFDA 2KRMA 2QYZA 2XG8D 3CXCS 3A7MA 2JN0A 2RP4A 2O31A 2LM2A 5L3CB 2LOPA 4M75B 2QAZA 2QQ9A 3FRNA 1BYMA 4C5EA 4QQ6A 2X3XD 5GMKh 2E9XA 4PK5A 2XQ3A 1VA7A 2DE0X 2VKHA 3ZC0A 2WSEE 3I56T 3UQ7A 3PT9A 5GAN5 3PUXF 2BKDN 2DJZA 1HX8A 5LJ3g 3EG9B 2OTLQ 2HCKA 2WAUA 3QZ9B 1D3BB 2CXFA 5KYXB 3LFMA 3FXDB 4QXCB 5KDMC 3AA1B 1NJIC 1N6AA 4HVUA 4P1NA 1YCSB 2G6FX 2X3WD 3PVQA 3JSCA 1B7TA 4Z88A 4ZTFA 3SEMA 4LXCA 1QVFP 2O2OA 2RI3A 1ZP0A 3O1HA 3GNFB 4JEUB 1QQJA 4LN2A 5GAN7 2YU2A 2CT4A 1NWMX 2HSEB 4EEDA 1NEBA 1MMAA 2ZCFB 2VGNA 1I81A 4I55E 5GANf 2GK9A 1MMNA 5KYUB 5D7UA 3CMAQ 3A8LB 1Y96B 4YJ3E 2K3YA 2CLYB 4GIWA 2RHUA 2ODUA 3ZT5A 2UU9T 1U5SA 2CYZB 3T1YT 2HL5C 2L3RA 4BY6C 2BS3A 3LWIA 4DV3T 5FY7A 5FRNA 2MAWA 2YK0A 3H9NA 3IF8B 1S1NA 2XQ6A 3RF1A 5CKEA 3KXTA 1KSWA 2EQMA 2YWWA 4E7SA 3RMQA 2XQ9A 1AWXA 1UX4A 4OX9T 2CCQA 5FY1A 4ILAA 4IUVA 3CCUA 3G71A 3M0PA 4M78E 4FCYA 3UDCA 2LSIA 4CXWA 5M9OA 1VQ4A 5L4EA 5HCJA 3HSBA 4MZMA 1RLPC 2DEUA 4ELZC 5H6RB 3VRAA 2WACA 2X4XA 4EMGA 4PJOB 2KT8A 1K9MR 2EGAA 2K9GA 3B57A 4AG1C 4FYYB 4QX8B 1HR0T 3CQGB 4CC4B 5GMKm 2JJ9A 3GA8A 5LJ5e 1K73R 3F2EA 1TU0B 1G73A 1VQMA 4WNKA 1PRLC 1W09A 1AD5A 4U74A 1LJOA 3KV6A 5IAYA 4HWDA 2HZYA 1AJ3A 1VQPQ 1JJ2P 4M7AD 4XU2A 3PFSA 1VQNA 4JLIA 4AQFA 3N9QA 3QDFA 2E8IA 3V7CA 4M1PA 5L3DB 1VQMT 1NAFA 1ZBJA 5JTGA 2BUDA 1K8AR 2KT9A 3SS1A 3IHRA 3OBWA 5GANd 4FSSA 2J6FA 1Q7YC 2KVQG 1T98A 1AWOA 1VQNT 4UC4A 4M7AA 3UTKA 3UUXB 2YXYA 3O1IA 2JMCA 1XNRT 2V8SV 2NUTA 1RAGB 3V5SA 5CIUA 1RACB 2HMAA 3SFEA 4XTWA 2BZXA 1BB9A 1BBZA 3P8BB 3PMTA 1IGQA 3JB9G 5HY6A 5CKDA 3HKBE 1VQ7Q 2LP5A 3VKGA 1ZX6A 1WXUA 3MEUA 1BI3A 2H3RA 5CJ5A 1OU9A 2RA1A 3G6EQ 2V7JA 4IDPA 1OULA 5D6WA 2CKKA 3C51A 4EYUA 1QP3A 3VS0A 1VQ9A 3E9FA 2XAJB 2LE8A 2LC4A 4O2AE 2NW8A 1VQKQ 3PU3A 3R84B 3L3PA 4DQ2A 5LJ5h 2DBKA 4IDQA 3HHTB 1X69A 4F04B 3SWNC 4V1Av 4Q25A 5AQSB 4YLHA 5GANj 2PNIA 3PJAJ 3N5BB 2FZKB 1IBLT 4ZGEB 2X35A 1ZA2B 2ZM2A 3C12A 2JUFA 4KUIA 1WLPB 2DL7A 2HPLA 3QYHB 1T7SA 1LKXA 4C5HA 2XAFB 3M58A 5FROA 2YU1A 4WW0A 4YXDA 4TZ4C 2EJGA 1C1AA 4HWCA 2K2MA 3JV3A 1V1CA 2BE9B 4GK5E 4U31A 2D9TA 3OW2A 3NTKA 2KXCA 3CD6T 2NW7A 1X6OA 2ZM0A 2XY8B 2DI4A 3REAB 3EG1A 2UXBT 3N9LA 4OFZA 4TV9E 3J80E 1UGSB 4M75D 4L6V5 1E7PA 1UEBA 2J6OA 1Y71A 1FYNA 2RK1A 1M90U 5CGMA 2P4TA 4ZNXA 3AAAB 4J9CA 1K9MU 4P09A 2CHOA 3HI2A 1SRMA 1TOVA 1MV0B 1M8MA 3RGLA 3JCMe 2EIFA 2M6BA 1RAIB 2K7AA 9ATCB 4PLLA 2QYWA 5FYMA 3HFOA 2UUBT 2MWPA 3N9NA 4DV5T 2RA2A 5LJ5g 3I55Q 4DUYT 1PNJA 4J8OA 3CCMA 2E6NA 4M75A 5LMUT 2NWBA 1M1GA 2RMOA 1GQEA 3OYHA 5IT9E 2QEXA 1WHMA 1YI2A 4J6XA 4J9EA 2KEAA 1Y07A 2OTJT 2GGRA 5F8PA 3FHNA 2DX1A 2K3XA 3OYZA 1UGQB 3ZMUB 1D3BA 5LJ3j 4QKUA 3GF5A 3META 2W67A 4RG8A 2QGGA 2Y4YA 2K3BA 2LSGA 5HCKA 4RG2A 2CWOA 4IIOA 4LUDA 3LK42 2HHHT 4ISSA 5KE3A 3I35A 2E10A 1BR2A 3EUHA 2K5BB 5L8RE 2JTFA 3G1JA 2KNBB 2KR3A 2RH2A 2ZMAA 4V2SA 1VIFA 2GQVA 1HNZT 4A4FA 3PGGA 4HGAA 4OYJA 3ZMTB 1WDXA 3EFOB 3X20B 5KYUA 2CEAA 3NBXX 4UVAB 2FJDA 2KLQA 3G4ST 2DWKA 4XZCA 2LTOA 3MA9A 2D8JA 1UFFA 5HEOA 1IJ5A 4E7LA 1OPKA 3CCVT 3A8HB 2AZVA 3JCMh 2MOZA 2IIUA 4KT0E 2CZ1B 1YQ3A 3VU7H 4PJOD 5AQRB 1OYXA 1OOTA 4CI1B 4JRIA 3M3ZB 1ABOA 1WGSA 4LF9T 2O4XB 1KHIA 2A3DA 1Z0PA 5DQVA 3RYCE 2L2PA 2EYWA 1VOMA 1WQWA 2X9WA 3CCQT 4IL9A 2CE7A 2OTLA 2BG9A 2D0TA 3MZKB 4AFQC 4F16A 4N78D 4M7DD 3TSZA 3VR9A 2V6YA 5IWAT 5GAMf 4LF7T 3PV0F 3VS5A 4PJOA 3OJAA 2IIMA 3OYLA 2XK0A 2MF2A 1WYBA 1SHGA 2WM9A 3CPZA 2CUBA 3ULRB 1HNWT 4RCCA 1SHFA 1YKEB 4ILBA 2JNGA 2L8DA 3L09A 4RUGA 3UT5E 2BZ8A 4J5YA 3EDUA 5ABFA 3KFVA 2OTLT 3VV0A 3RYHE 1BR1A 4B9XA 4EMKB 3OYEA 3EDVA 1TUDA 2K5IA 1D1AA 2XM2A 3BY7A 3FLGA 3CPWA 4U7YA 4LF6T 4M7DA 1VQ6Q 3OY9A 3CMAA 2WSFE 3OS0A 4JLGA 4EZHA 2BZBA 4M7AF 4HE8A 1RI9A 2EJFA 2DYBA 2W0GA 2EWNA 3JCMg 3OMGA 3RKGA 1JNRA 2FEIA 2R5MA 4TV8E 1X6BA 1NYFA 1NEGA 1AVZC 2BG9C 1I5LA 4P0BA 2NUPB 4RMOA 3LH0A 5JRCA 1BI1A 4AT1B 5AQVB 1T0HA 3T9NA 4MHCA 1M30A 4FW2A 5C2TA 3RR6A 3RIFA 1PCXA 4NL2A 5GAN2 3UATA 2KRNA 1SEMA 2RD1A 2NLUA 4AMCA 3N2KE 2WY2A 2O9VA 1BIAA 4J6WA 3I9WA 5AQGB 3UA6A 2XHCA 4F7UE 4UF0A 1AZGB 3OYJA 3Q2MA 3VS6A 3L1AA 4G2AA 3UU6A 2A7YA 1Q82R 4HT9A 2KAFA 1KD1R 1ZSZB 1YD8G 1NM7A 4HN9A 1LVFA 3JC6C 5LBMA 2WU5A 3OW2S 1G3WA 5CA1E 4DIDB 4M7DC 5IYZE 3RRCA 5AQHB 4ZXLA 1BCOA 3UUBA 3FZFB 3C4SA 2P0QA 3OBYA 2J05A 4RTWA 3X28B 3PJAA 5GAN8 2CP0A 2DWGA 4XBFB 3EHRA 5JDFA 2ZPBB 4M78D 2Y8DA 2UUAT 3RRWA 1GBQA 2IW5B 3ZCIA 4Q5WA 2XJ7A 1NBEB 5GAMd 4X1IE 3AA6B 3EAMA 2QA4Q 1PD0A 4X62T 4ZEYA 2EW3A 2DL8A 5GANe 2XQYA 4U7IA 3AEEA 3EGDA 4GKKT 2VL8A 1BI2A 5J3BA 2AXDS 4LUEA 1JXOA 3CC4Q 5CK9A 3H0IA 2YHTA 2UXDT 1PC0A 2A0FB 3RYIE 2LX9A 1Z8UA 1CKBA 4A54A 3CCET 3M4YA 4QVDA 2JW4A 4M78A 4GK0E 2KWIB 1B3QA 1VQPT 4B3ST 2FPFA 2R6GF 2DXUA 2WWVA 3PE0A 3P8HA 1T3LA 2EHOB 1QCNA 4LDYA 4LD9K 3C50A 3NFCA 1GXIE 4KHZF 4DR2T 1XMOT 1R8OB 4X9DA 3ZSTA 3KV5A 3M59A 4M75F 1S72Q 4XAXB 2NOXA 1X79A 1ARKA 4EAHA 5FU7C 4IGUA 5A1LA 4O2BE 5LG4A 1TS9A 2JS2A 2K6DA 5GAMj 3CC2Q 4AQYT 2YDQA 3A5ZB 1IB8A 2D2SA 4XTYA 4ANJA 4DNDA 4KGZB 1RAHB 3CCRQ 3AA7B 2E12A 3JAME 2OA5A 3M0TA 2CT3A 3SWHA 1VQKA 3KBGA 3ZT6A 1M2VB 1WHGA 3DLMA 4LDWA 3W15B 2DBMA 2K24A 4M78C 4ZN1A 1VQ7T 4QW2A 1WFDA 4HT8A 2XU8A 1XTDA 4ADZA 3G6ET 5AQKB 4B3TT 1EZ3A 4EEBA 1LRZA 1N27A 1I1JA 3RNJA 4LFBT 5GANh 2RPNA 4KGXB 2DCFA 4DR6T 1PRMC 1W1FA 5LYJE 1KQSP 4RTYA 3RYFE 1RADB 2AE9A 5JR9A 4C8QB 2QDYB 3JCMX 3OYMA 2IPOB 4OP0A 1VQLT 3FB2A 4F7UB 2KY9A 5HYAA 5AQMB 2DL3A 2E64A 4OMNA 1ZUUA 1TXQA 1W2BP 2SEMA 2ED1A 3L2UA 3TEEA 4Z8AA 1BR0A 4X1KE 5HXEA 5A0GA 3RERA 2VVKA 3B5MA 5JDLA 2E5VA 3CWZB 3KBTA 4A4GA 1I07A 1M90C 2A36A 4C92C 3M4GA 1AZEA 3AE7A 4KH1B 4EV6A 1Q82U 1K9MC 2DNXA 1M3BA 1M3CA 3AE6A 3EFOA 3WAJA 1ZKEA 5BMVE 5HCMA 3EGXA 3EH2A 4DBFA 2W62A 4KX6A 1OQKA 4B6MA 4LDVA 1KK7A 1N9RA 2HSPA 1J5WA 3D0TA 3SWNB 2PU9B 2A9UA 5CR2A 4XK8E 2QTXA 2JOYA 4YSXA 2W63A 2GNCA 4Y91A 1IJ6A 3PU8A 3T8OA 2EGEA 4H9SE 1D0ZA 2I0NA 3ETUA 5JR9C 1D09B 2WCAA 1GFCA 1U06A 4MALA 3CCJQ 2J4GA 5LGTB 3F57A 3LWHA 4WTOB 2COYA 2V5DA 5GANg 2MPKA 4DOVA 1M62A 2PQWA 3OYIA 2CP3A 1KJWA 2HD0A 4AIUA 3I55T 4C91A 4M7DF 3L39A 2Q9QC 1U5PA 1PD1A 1QVFA 2DL5A 3WVDB 1W4SA 5EZYE 4C0FA 5CKHA 4P5NA 4QKNA 1JO8A 3AECA 4GLKA 3QUIA 1FWZA 5LJ3h 2L8KA 2KK4A 3SHWA 3TQ7P 1JXMA 3LH5A 3OYAA 2N1GA 2XHEB 1MNEA 1U1SA 4BI8B 2HBWA 4A97A 4EMKA 3OS5A 2HQXA 4QX7B 3E1SA 3QO3A 2IHR1 3G4SQ 2HEQA 4LFCT 2LLYA 5FNVE 3JCMQ 2LCLA 3QJYA 1WIEA 3X25B 1ZSGA 2XM1A 4JJBA 5FXWA 5IH2A 4M77G 1NE8A 3ZN1B 1WRDA 2QQSA 2F2WA 4LDUA 4HFBA 3X1DA 2X68A 4HFEA 2L5QA 4RKUE 1W2BS 1VQ5T 3Q5DA 4IDZA 1ZHIA 3PMIA 2UXXB 2NUPA 4DMVA 4R0KA 3ASKA 2XQ8A 1FMWA 3BK9A 3QB5A 1VCSA 4AKHA 1WXBA 2DPPB 5IUXA 5DABA 4HWFA 4Z02A 2BBJA 1H3HA 1V9DA 1JU5C 2M6IA 2JM8A 3QDRB 2BZYA 4OK0A 1Q81U 1G8XA 1LCKA 1MIWA 5CKFA 2DTHA 4IT4A 5HAXA 4MZTA 4LFAT 3MXZA 1D0YA 2QVAA 1ZSZA 5DQWA 3ZN0B 3LDQB 3SFMA 2E3HA 1H641 2EYXA 4IUTA 2W10A 2E2AA 5A0LA 2RI5A 3N9OA 5J26A 3E2UA 1JJ2A 5LBQB 2L3PA 2ACXA 4JJCA 2HAXA 1IAPA 2COWA 5GAOl 3FEOA 3M55A 4ATOA 4M78F 3S3NA 2AIRB 5GAOm 1NLPC 5L23A 1VQ6A 5F3JA 2EHOD 4N4IA 4Y92A 3SOLA 1XQHA 3OYCA 2IDOB 2WS3A 3SFDA 2COZA 4BDZA 2M1HA 3ZC1A 2OJ2A 1LPLA 1WX6A 1HJDA 2EKOA 2R58A 2JQHA 2BKOA 4C0DC 2BVMA 2E9XC 1VQ6T 5JDHA 1BCMA 3RESA 5GAN3 3HKEE 4J9HA 2L3QA 3MEAA 4E7KA 2EHOA 3P50A 4C92F 4EDUA 2E65A 3NPFA 4BE0A 1JEGA 3AHUA 1BR4A 3ZBDA 4C92G 4BB7A 3RIRA 2D6FA 5ECAA 2X9HA 1NG2A 2LCSA 2NTXA 5HXRA 4PLIA 5AT1B 4A4HA 5L3BB 4X34A 1MMDA 2E6ZA 1K0SA 4MBQA 4OYKA 5GAMe 3BQKA 4WBOA 3CQXC 2R5AA 1KF6A 2DL4A 3GP8A 1UUSA 3WVEB 4OMOA 4O5VA 3F70A 5L3FB 2FPEA 5LA6E 3LLRA 4C8QD 2KZ7B 3MK7C 1XNIA 2QDLA 2LKHA 2C0TA 3ZEHA 2LJLA 4O4HE 2MWOA 3NTIA 1HG5A 1N36T 3S6WA 2EJ9A 3AXJB 4JS4A 2I6HA 3PTRB 2QA4A 2P9BA 3AVSA 3G06A 3EVYA 2KSSA 2DEQA 2LZ6B 2Z0WA 3CMET 4CN4A 4MDWA 3PUSA 4KP3C 3KV4A 3OYFA 3CC7Q 4PNOA 1KQ2A 5J1GA 1CKAA 7AT1B 3CC4A 3CCEQ 3RHWA 3LJCA 4WZXA 3LYIA 4H63V 2VQET 3HPWA 2OI3A 2X4YA 2WMOA 4L59A 3P7IA 3TLUA 4DEYA 1X75C 3A1PA 3K8PC 3HRTA 4C8QA 5L3GB 4EXTA 1RABB 1WJQA 4TUYE 2CHNA 2XQ4A 2NYSA 4ELYC 2QA4T 2NTYA 4OB3B 4F7UA 4JI1T 2P84A 4XU1A 1YHQQ 2V8KA 1E1HB 3MACA 1NLOC 2A28A 2H8HA 2A3LA 3EI0A 4PK6A 3CC4T 3N2GE 1S72A 2SRCA 4ZGDB 3MJXA 1RUWA 2LSYA 2EYZA 3J7Yq 2QG9B 2LQWA 3QG1A 3ONJA 1QVFS 1OX9A 4MMKA 2F2XA 4EZ4A 4CI0C 4AG2C 3OYKA 3CK6A 4FT2A 5AYFA 1FJGT 2DILA 4EGWA 1A0NB 5GAMh 3FC3A 1D1CA 1RL2A 3M56A 1S72T 2YDLA 1XZYA 2XZEA 3AE4A 4YJ2E 1N5ZA 3UPUA 3OTOT 4CQIA 3VYGA 1UJYA 5FU6C 3UFGA 2HNIA 1PSEA 4OGEA 2E70A 3DTOA 3CC2T 1OX8A 3OS2A 5I2MA 2DERA 2CRBA 4MFRA 2LRQA 4AQFC 3NWIA 1SG5A 4M77B 3UUNA 5LP6E 4CN1A 1VQ8Q 2VASA 5FMNA 3CCRT 5FVKA 2ZM6T 4ILCA 1YCYA 3HRUA 4WYVA 2FRWA 3NVOA 2LJ3A 3CCLT 2BIVA 1VQLQ 4N0AA 3O1JA 1M3AA 5D6XA 5I2SA 3CD6A 5LG3A 3I9QA 4FU6A 1GL5A 3S3OA 4ZI2D 1KC8R 3GBQA 1JRIA 4J9BA 3QWYA 4M7AC 5KYWB 3LSVA 3MO8A 1ACMB 2IG0A 1U4QA 2YRCA 1M27C 2VV5A 4ZTJA 2VURA 2VB6A 5JVDE 2GF7A 2C0OA 1Q82C 1WYXA 3V7RA 4G63A 4JI0T 1G3TA 4QVZA 4A63B 4UR9A 1X9BA 2X0YA 2CGHA 2D5UA 2QQAA 2QK0A 4ZHQE 1JJ2S 3C98B 3JAFA 3Q5WA 5GAMg 1K1ZA 4ESRA 2QXFA 4PFPA 3OSVA 4TWFA 1UGRB 2CZ6B 1PKSA 3UU3A 2E41A 4FIBA 2HQHA 4NS5A 2L0AA 2I59A 5HEGA 2XKOC 1QW1A 4FYWB 5AQUB 2KXDA 1G3YA 1OI1A 3EFRA 3CCJA 2OTJA 2X9YA 1YBYA 2DRMA 4TN7B 1HX1B 3HRSA 4TX5A 2UXNB 5DJQC 1SKUB 2EAYA 2XI9A 2Y90A 1K73U 4JLEA 1T0JA 4ZS2A 2JTMA 3K3OA 3URGA 1RLQC 2ZLYA 2DD4A 3H0FA 8ATCB 5LJNA 4YY3T 2DD5A 1OEDB 2QTVA 4IE5A 1US7B 4LE9A 4DV1T 3CCJT 2OLTA 3EG9A 2WSCE 1CUNA 3GN5B 1WFWA 2XIDA 1WHHA 1OXZA 4E47A 4HVWA 1SPKA 2J47A 4ZZCA 1F1BB 2VYTA 1EFNA 3ZSSA 2AKKA 5KYXA 2DJQA 1U8RA 4UIGA 2DZCA 1NPPA 4C90A 1WR6A 1K8AU 2KMTA 5GAOq 3G4SA 3GNGA 1G2BA 2L9QA 1GCPA 2JVVA 5J2UE 3IA3A 3CCVA 2BKNA 3PUAA 3H3AA 3LBXB 5LB7B 3CKDA 4UVBB 3MEVA 4C5IA 1VQ5Q 4YTMA 5ETWA 3ZMSB 4HA8A 1U3OA 2JRKA 3M0QA 4M75C 1WQ7A 4AFUC 1YJWQ 2JZ2A 3AAEB 2J6KA 3ZKRA 2JQ9A 2QI2A 1Y96A 4J9DA 3CCQA 1VQOQ 1GCQA 2KT1A 2DNUA 3RKYA 2E5QA 1AEYA 1RAFB 2W4XA 2H3JA 1IO6A 2K5LA 1YJ9Q 4DV2T 1Q81C 4CZZB 4CXXA 4CI2B 4TNVA 5CQYA 1I94T 3VRBA 4OB1B 2YT6A 1M5Q1 2HBPA 5KE2A 4RTVA 1N8RR 4A56A 2KQWA 4ZN3A 1HNXT 3B13A 4CC2A 1KG1A 2EQIA 1WNLA 1VYTA 4IKFA 2ACZA 2RPAA 1KC8U 4B3RT 2CP2A 4PNIA 2LNVA 3TLTA 2BVLA 3E22E 3L2ZA 4D8DA 2RQRA 1W70A 4MDXA 3AB3B 2W0ZA 4U2ZA 1YJNQ 4F7UF 4H63H 1TSFA 4CRIA 3AXJA 5JH7E 4DR7T 3K3NA 4JV5T 1X27A 2LM9A 2CLYC 4JI6T 2J7IA 3QBYA 3VS7A 1X43A 5ADXL 3BQIA 3L2RA 3UQ4A 4K0UA 5HWXA 3NHNA 3DB3A 3MEWA 3JCMb 3KUFA 3UU4A 2XASB 4BUGA 1Q7YR 1IZNB 1HK9A 1X01A 2M9UA 3HKSA 2EQKA 1R0BG 1W6XA 3VUZA 1FEWA 2OX7A 1L0VA 3QPHA 4YHHT 2QQRA 1KEYA 4M7AG 4NOYA 4ME7A 4YTLA 4JZ3A 1KHCA 2XDBA 4ORZA 3TVTA 4JS5A 3JB9J 2C06A 3CBMA 2V1QA 2E3IA 3JCMP 2X66A 1QWFA 1HD3A 5LHGB 3RKWA 4FSXA 5DLQE 2IMLA 1YW0A 1VRBA 5IHIA 2RHIA 2X51A 2E5KA 2I0MA 2E1HA 2CH4A 1ZV4X 2Y4XA 4PJOC 5C8YE 3VJPA 4C8QE 2LT4A 5HEUA 2BS4A 3FXEB 2FYKA 4H9OC 4AXPA 3FJ5A 2RNAA 4PJMA 2LT3A 3A8MB 3JRZA 5BR8T 1I6ZA 3N5LA 3QB5K 2MTQA 2BDEA 4J7FA 2WU2A 3RIUA 2HDAA 4Y28E 2VVSA 1ZHCA 2PG8A 4A4KA 5HEHA 3CMEQ 4E7JA 2H7VC 3MP6A 4Z89A 3ONLC 2W61A 5AQNB 2NR4A 3QHSA 1KQSA 2KYMA 1MIVA 3CC7A 4I50E 2RK2A 3BE3A 3P4SA 4HFVA 3TKLB 1WYCA 2DA9A 3CCEA 3NTHA 4C0DB 1MIYA 4XQ3A 3RUXA 2XPKA 1NEKA 2LX7A 4NPPA 1W2BA 4X1YE 5GMKi 1VQPA 2A37A 2QGFB 4BY6B 1CSKA 1QVGP 3G71Q 2YDRA 3L2VA 2BKPA 2BS2A 2FPDA 4WF2A 2KINB 2YN6A 1K9AA 1WR0A 1YHQA 1X2QA 1VQ4Q 3CC7T 4YSZA 4HEAA 1ZBXA 4VUBA 1UGPB 3RQUA 1XDOA 3NMZC 3HTRA 3ESLA 3L2WA 3HA4A 1R8IA 5KX5E 3SRZA 3KVAA 2M16A 3H3MA 5LHIB 5EC7A 1UCUA 2DIGA 4II1A 2M51A 5F5WA 1QUUA 1UECA 2RF0A 3A98A 2JMAA 5JDGA 2YOEA 4DMWA 1G83A 4BI3A 2LQKA 5ABEA 3RDVA 1YHQT 1O75A 3H37A 2W2UA 3OBVE 1VIEA 2ZAEA 4RTUA 2X0HA 5AQOB 3QIIA 3OYYA 4ZOLE 4ZI3D 2JS0A 4M75G 5FL1A 2FG0A 3OYBA 3CQTA 3QSUA 2D0UA 4L0RA 3AE2A 3MHXA 4F17A 3PUYF 1KNRA 2WBLA 2DTOA 1VQ7A 2M0YA 1J1JA 4DV4T 4O4JE 3VR8A 4O8SA 1IREB 4UXNB 3RC3A 2CP7A 3G6EA 1PM3A 2PTKA 4MMLA 3ZT7A 4HXJA 3I1AA 3ANWB 3HL6A 4PJJA 4ZGJB 3CCLQ 4AI6A 1BIBA 1WHLA 1WA7A 4L9IA 5JDQA 2DFUA 2DYIA 4BACA 3RPUA 1VQLA 3X24B 2RHXA 5CCAA 4JDSA 1RAEB 3ZLIA 3TSWA 4DO0A 3ZMVB 1OEDA 2G3RA 5A2QE 4LMKA 2CSIA 2VWAA 1Q86R 2D0QB 3ZYKA 4GYSA 3GN5A 1BI0A 2EBPA 4KH0B 1VQ8T 1IGUA 3S4UA 4H9QC 2B76A 2YRVA 1HTJF 2EPDA 3JCMf 4QH4A 3CCST 4KUMB 3E0ZA 2CWYA 4HCBA 3OYXA 4LD6A 2H3EB 3U3IA 3VS3A 2ZZDA 3JADA 3KDSE 4OF1A 1YWOA 4HWIB 2B8AA 2ZPEB 1VQ9Q 2LRKA 2KMFA 1M4ZA 3LBXA 3NRXA 5FU6B 3AA0B 1P92A 2DXCA 4E6RA 4J9IA 4BD3A 3TCJA 1KD1U 2DK3A 3VS4A 5IXFA 1HF8A 4ZI3C 2YUPA 2DO3A 3C94A 4E7ZA 1K0XA 3VKHA 3AE8A 3H6ZA 4JRQA 2K3WA 3OVUA 2V7IA 5AQTB 1K73C 4PKCC 3I55A 2FL7A 1Y01A 5AQFB 1V76A 4PJOF 2RO0A 2X9XA 4X5TA 1SA0E 2IC6A 4PJOG 2AZSA 1RI0A 1XDPA 2XAQB 4HKEA 2ZM8A 1E6GA 3EHZA 2KE9A 2ZGWA 3GLXA 2O4XA 1HSQA 2LHNA 2JMHA 3P4PA 4IIJE 4M7AB 2LEHA 3PUGA 1TUGB 3A8YC 1TG0A 1OWAA 2NUTB 4D6WA 3GOXA 4OMQA 3JB9H 4J6YA 2JMKA 3OKQA 4E2FB 2JQKA 3J81E 1UE9A 4QH5A 4YHJA 2PUKB 3JB9D 2F69A 3G7ZA 3TU4K 3M53A 2AKLA 4M7DG 1K8AC 1W0BA 1YQ4A 1U1TA 4OMMA 5L3EB 2PZ1A 1YIJQ 4BJNA 5KH6A 2F2VA 3MCAB 1QSDA 3NKZA 3L42A 1GBRA 1H3ZA 1HS7A 4MLKA 2CDTA 3QWXX 3GPLA 3Q1JA 3CCMQ 1VQ5A 4QXHB 4GBQA 3AAIA 4JUYA 3AE5A 3AEBA 1YITQ 4UELA 2VXEA 5LNKA 5M4YA 3KBUA 5H6QB 2KDSA 2XD0A 3TREA 2MK5A 2QEXQ 1X2KA 1X6GA 2AK5A 2N9DA 2FHDA 5AQQB 1QWEA 2O9SA 4JZ4A 3UULA 2DMOA 4IUQA 1KQSS 1YI2Q 5FL0A 3CIRA 2EQUA 3VUBA 4CC7A 5J39A 1E2AA 4TWDA 5AQJB 1YJ9A 1VUBA 1TUCA 2KNDA 4CN6A 1WI7A 1WJRA 2DZ9A 5EK4A 1VYVA 1FX7A 1MNDA 3SDZA 5LMNT 2JPFA 5IHYA 4LMJA 4OVAA 3N9MA 5GAOr 1IZ6A 2P4RA 4PK4A 3ZYLA 2KYBA 1LNXA 4JRPA 4ZZBA 1YJWT 1O9SA 1QP2A 1PKTA 4C0GA 1VQOT 1DU2A 2LOSA 5AQIB 1KC8C 3LGLA 1Q86U 2LQNA 5FY0A 1YJ9T 3AE1A 3I5SA 2EGCA 5AFUL 2N2NA 1N9SA 4LMLA 3TLVA 2LCCA 4DR4T 3CVRA 4PAGA 4EMKC 1YJNA 3P8CD 1FMKA 1SHZC 2XAHB 4DVDA 4I4TE 5JREA 2JIWA 1G5VA 3FZMB 3JCMV 2LSJA 1SRLA 2YUOA 2L89A 4UV9B 1ZLMA 5GONE 4GLMA 2PBIA 3QOFA 2VUBA 1HG2A 4JI3T 2AT1B 4M78G 4Z90A 5AQLB 4H9PC 3RBBB 5KYYB 5IXBA 2CP6A 4U2YA 2FZGB 2ZPIB 4QQGA 2XQ7A 1YJNT 2CMRA 2MIOA 2OAWA 5CQXA 3VRYA 1DJ7B 3UT1A 2DRKA 3UWNA 5JQGE 8AT1B 1M1KR 2HN1A 3QKJA 5A0DA 2CUDA 3PUZF 4R56A 4QHOA 1M8VA 5DM7R 2LVMA 3JCMJ 3DKMA 2V1DB 4JEHB 4YTPA 4M77E 1OU8A 2W66A 3QZ5B 2JQQA 4XU3A 5KMGP 3H8ZA 3REBB 4HTEA 1ZSZC 3ZEFB 3VHLA 2ZPHB 3LG7A 2H88A 1KQ1A 2A72A 2CSQA 2VXFA 4LF5T 2DKGA 2V7MA 2JM9A 4PW8A 2MMPA 3MKDA 2VKJA 1R0CB 4J2CA 3K3QC 1H92A 2K9AA 1VYUA 5FXXA 4TWHA 4C0ZA 2CXDA 1UHFA 4IDOA 5J0ZA 2F4VT 5CO7A 3CMEA 3R6NA 3PIOA 1Q95G 2H89A 4KUDK 3QNUA 5EK3A 5CFBA 4HCKA 4KULA 2V8JA 3FIFA 4FJOA 2O01E 4DV6T 3KV9A 4HVVA 4KRTA 5GJVB 3FZHB 3ANWA 2RJCA 4XTVA 1D0XA 2V7LA 4OB2B 2YKSA 2F5TX 3QK6A 1M2VA 2ABLA 4EMHA 2ATCB 4IURA 1IXDA 4FYXB 1QCOA 4YTNA 5FWCA 3OPCA 2OV9A 2ZPGB 2M67A 3MP8A 5D6YA 4EOZB 3C4ZA 2BBHA 2WDRA 2BG9B 3TLWA 2EHOC 4COFA 2FO0A 2C0IA 1M90R 3M0SA 2V6YB 2CBIA 1BKBA 3I5RA 2VVNA 5KXJA 1UG1A 1LOJA 5C6SA 4AKLA 5IN1A 2DETA 1UJ0A 5CAIA 4DV7T 1WZOA 2LHRA 1KNPA 4X1VA 3G71T 2L3LA 3CCUT 1MGQA 3VRZA 5GMKl 2ODVA 1N8RC 2EQJA 4CC3A 1OEDE 4KHPT 3EABA 5ABFB 1VQ4T
chains in the Genus database with same CATH topology
4J7IA 3RMSA 3M57A 3ZJ1A 2DAQA 3OYDA 4M7DB 2VC8A 4U72A 4C92E 3WXMB 3CC2A 2IC9A 4HKAA 4O4LE 4IE0A 2CM0A 3C4XA 3QC9A 2XICA 3CCRA 2WWUA 5CB4E 4O6JA 3R6OA 5LJ3f 2CXLA 3N2OA 3CCLA 3SWNA 4X20E 5JRCB 3CMLA 3KVBA 2DIQA 4ILUA 4UV8B 3JCMW 4C8QC 1JB0E 2W00A 1MMGA 2RJFA 4EPCA 1WPYA 2H7OA 4EIWA 3V7SA 4UF0B 4XU0A 3SD4A 2VKDA 5L2LA 1S35A 1M1KU 2WMNA 3Q9DA 3JB9F 3ZMZB 1XOVA 4PJLA 2CA5A 5HXCA 2CZ0B 1FXXA 1NPRA 4R55A 5FU7B 4N4GA 1ZEEA 2Y6XA 3GWHA 3ONXA 4XTXA 3A8GB 2HQEA 4ASKA 3J9X1 4C5GA 2K48A 1KD1C 1YKHB 2V26A 1O3XA 3CX7B 1FIOA 4Z8XA 4DBRA 3M54A 2C5KT 4FI5A 1VQ9T 5LOVE 2X4JA 5EK2A 3CPFA 4M78B 4B6XA 4OB0B 3VYHB 3WI3A 3VU3C 2QGSA 4N0AC 3SB2A 4GYRA 3I9YA 3BFMA 4GY5A 5CA0E 2IVWA 3VKIA 4BE1A 3NRYA 5LJ3d 4KBMB 4CI3B 5HKCA 5C0MA 3O9XA 1YIJA 3OQ5A 3RKXA 2DHRA 4OHFA 5LJMA 2WSSV 4C92B 2HPJA 4KMCA 1H7CA 2LSKA 4ZI2C 3C95A 1Y64B 3CEYA 2PFVA 1YITA 4F6RC 4IUUA 2EFIA 3QJ6A 4RCBA 4WBNE 1YIJT 2DXTA 3HKDE 3OYNA 4J83A 2RM4A 4UVCB 4DA4A 3BQLA 5GAN4 5JR9B 3CCMT 4ERRA 3BW1A 4HCCA 3ZFJA 1YITT 3V8KA 1WJSA 3U78A 4BDYA 2QEXT 3ZCJA 2PVGB 3UFEA 2C5JA 1G3SA 2CS7A 4ISTA 1YI2T 4YFSA 2C5IT 1HXDA 1Q86C 3E08A 2Q9QB 2AHJB 3RC8A 4NL3A 4ZS3A 3A8OB 2QQBA 3PUQA 3P8DA 3KINB 1NZ9A 4GOUA 5GAN6 3AVRA 3I0OA 3FB9A 2X0LB 1QVGA 4O4IE 4FM4B 4C8QF 2ES0A 4IE4A 5FRMA 4C8QG 2PVDB 4E7IA 2K2VA 2KXPB 4F7UG 1QVPA 5GMKj 3QXEB 2M0OA 3OMCA 5GAOp 5EG2A 4XTUA 3JC6D 2J1DG 4L5GA 2X4WA 5HK0A 2VGMA 5JDMA 4QQDA 3Q5XA 3BDUA 3CX8B 3I0QA 2GCXA 1PSFA 3ZYMA 2B1EA 4TVRA 2DLRA 4UEMA 3M5AA 3X26B 2ZPFB 4JUVA 5LHHB 1B34B 5HXHA 3LW5E 5TAOA 4BI4A 2OAUA 1NJIU 1KNZA 2IAKA 5LJ5f 3DLLA 3ER0A 4OGCA 4M77D 5LL6S 2MAMA 1ZQ1A 4PFOA 2FVUA 3PIPA 5HXSA 3OSSC 3N9PA 4H9NC 2I2LA 3DP7A 4MZPA 4IUPA 3V8LA 1OZ2A 3INZA 1M9SA 3EAEA 2RHYA 3CMAT 2EYQA 4XTZA 4QVCA 2RJDA 3M9QA 3A5XA 2RB6A 5CVIA 3QUJA 1WLXA 2XTLA 3HFNA 4M77A 3PURA 3FBZA 2K57A 3QYGB 2MI6A 2E9XB 4DOWA 4H9RC 2A2FX 5JDNA 4EYYR 1S94A 4JJNK 4M7AE 4PJNA 4BJMA 2HH7A 3V8JA 3M65A 4ZI7E 1UX5A 3HP9A 1N8RU 2XDDA 3JCMc 5KCHA 3CXCA 2LT1A 1HFAA 2CZ7B 5KCOA 5FXVA 4M77C 2XAGB 3LX7A 3E9GA 2DTIA 2DXBA 3ZPOA 2K5FA 2YLCA 5LJ5d 1EIFA 3OYGA 3HR0A 3S3MA 4C92D 3PNWC 4PL6A 2PJQA 1UB4A 1VQ8A 4A4EA 4CXYA 1M1KC 1AHJB 2XUEA 3IEEA 2GFAA 4IHJE 4AKIA 1FMVA 3CCSA 5I21A 3OB9A 2VKOA 3O4XE 1Q7YU 3FDRA 5DLOA 2DVEA 1LVKA 3CBPA 4A53A 2MBGA 1OZ3A 3EFSA 1M1FA 2P0PA 3FJPA 4C92A 4QWNB 3F31A 2LQ8A 3GMIA 2RJEA 5HWYA 5LJ5j 2XDPA 2X67A 3CQCB 4QXBB 4BA9A 2Q9QD 1HCIA 3RX6A 5LCYA 2G0UA 3RKOA 1QVGS 3O8VA 3HKCE 3UUMA 1VQKT 4FL6A 3J7AF 4X9CA 5LJ3e 4M75E 3GIBA 3CBOA 4DBQA 2F5KA 4BE2A 3L2QA 4N4HA 3DB4A 2V7KA 2FB7A 2Q9QA 3DJBA 1Y7XA 3OS1A 4B9WA 4AKRB 5LXTE 3WAKA 4IE7A 4E7HA 1MHNA 2NW9A 3HL8A 5DY9A 1D1BA 4NUVA 3ZJ2A 3CPWS 4IE6A 3BDLA 4AQGA 2RI2A 3KFWX 4P0AA 5FXZA 5J2TE 4FT4A 1TH7A 2C0SA 2RHZA 5LGUB 1JBMA 5GMKe 3LK3B 2YEVC 3V5UA 4HCZA 3CX6B 2Y48B 3JCMd 2K4YA 2NP9A 1I4K1 1YJWA 4LDXA 1VQOA 4AKGA 3C64A 2LDMA 4OMFB 4JRKA 3JB9I 3NZPA 5LGNB 3OA6A 2PUOB 2PVOB 3MP1A 4I43B 1B34A 3E19A 3FBLA 1I8FA 4BAYB 2P0KA 4EB6E 4PJOE 3IBPA 2Z6EA 5HK3A 3LGFA 5E0OA 2V8IA 5FP3A 4M77F 3RH3A 1SSFA 2YINA 3C4WA 2E9XD 2QA7A 3PDYA 3NZQA 2R57A 5GAOn 5CKBA 5FLXE 2MYSA 2KWHA 4NUUA 3I56A 2VK9A 2GFUA 1V29B 2YLBA 3ETVA 3LK2B 3ME9A 4M7DE 2SPCA 3PTAA 2XG8D 3CXCS 2JN0A 2RP4A 5L3CB 2LOPA 4M75B 2QQ9A 3FRNA 1BYMA 4C5EA 4QQ6A 5GMKh 2E9XA 4PK5A 2WSEE 3I56T 2VKHA 3ZC0A 3PT9A 5GAN5 2BKDN 2DJZA 1HX8A 5LJ3g 2WAUA 3QZ9B 1D3BB 2CXFA 3LFMA 3FXDB 4QXCB 5KDMC 3AA1B 1NJIC 1N6AA 3JSCA 1B7TA 4ZTFA 2RI3A 3O1HA 3GNFB 4JEUB 5GAN7 2YU2A 1NWMX 1MMAA 2ZCFB 2VGNA 1I81A 4I55E 5GANf 2GK9A 1MMNA 3A8LB 1Y96B 4YJ3E 2K3YA 2CLYB 4GIWA 2RHUA 2ODUA 2CYZB 2L3RA 3LWIA 4BY6C 5FRNA 5FY7A 2YK0A 3KXTA 3IF8B 5CKEA 2EQMA 4E7SA 3RMQA 1UX4A 2CCQA 5FY1A 4IUVA 3CCUA 3G71A 4M78E 3UDCA 2LSIA 4CXWA 5M9OA 1VQ4A 3HSBA 4MZMA 4ELZC 5H6RB 2WACA 2X4XA 4EMGA 4PJOB 3B57A 4QX8B 3CQGB 5GMKm 2JJ9A 3GA8A 5LJ5e 3F2EA 1G73A 1VQMA 4WNKA 4U74A 1LJOA 3KV6A 5IAYA 1AJ3A 4M7AD 4XU2A 3PFSA 1VQNA 4JLIA 4AQFA 3N9QA 2E8IA 3V7CA 4M1PA 5L3DB 1VQMT 1NAFA 2BUDA 2KT9A 3SS1A 3IHRA 3OBWA 5GANd 1Q7YC 2KVQG 1T98A 1VQNT 4UC4A 4M7AA 3UTKA 3UUXB 3O1IA 3V5SA 5CIUA 4XTWA 3P8BB 3PMTA 3JB9G 5HY6A 5CKDA 3HKBE 3VKGA 3MEUA 1BI3A 2H3RA 2RA1A 2V7JA 5D6WA 2CKKA 3C51A 4EYUA 1QP3A 1VQ9A 3E9FA 2XAJB 2LE8A 2LC4A 4O2AE 2NW8A 3PU3A 3R84B 3L3PA 4DQ2A 5LJ5h 3HHTB 3SWNC 4V1Av 4YLHA 5GANj 3N5BB 4ZGEB 2X35A 2ZM2A 2JUFA 4KUIA 2HPLA 3QYHB 1LKXA 4C5HA 2XAFB 3M58A 5FROA 2YU1A 4WW0A 2EJGA 4TZ4C 4GK5E 2D9TA 3OW2A 3NTKA 3CD6T 2NW7A 1X6OA 2ZM0A 2DI4A 3N9LA 4OFZA 4TV9E 3J80E 1UGSB 4M75D 4L6V5 1UEBA 1Y71A 2RK1A 1M90U 2P4TA 3AAAB 1K9MU 4P09A 3HI2A 3JCMe 2EIFA 4PLLA 5FYMA 3HFOA 2MWPA 3N9NA 2RA2A 5LJ5g 3CCMA 4J8OA 2E6NA 4M75A 2NWBA 1M1GA 3OYHA 5IT9E 2QEXA 1YI2A 4J6XA 2OTJT 1Y07A 5F8PA 3FHNA 2K3XA 3OYZA 1UGQB 3ZMUB 1D3BA 5LJ3j 3GF5A 3META 4RG8A 2Y4YA 2LSGA 4RG2A 2CWOA 3LK42 5KE3A 4ISSA 2E10A 1BR2A 3EUHA 2K5BB 5L8RE 2JTFA 2RH2A 2ZMAA 4V2SA 1VIFA 2GQVA 4A4FA 3PGGA 4HGAA 4OYJA 3ZMTB 3X20B 2CEAA 3NBXX 4UVAB 2KLQA 3G4ST 2DWKA 4XZCA 2LTOA 3MA9A 1IJ5A 4E7LA 3CCVT 3A8HB 3JCMh 2MOZA 4KT0E 2CZ1B 4PJOD 3VU7H 1OYXA 4CI1B 4JRIA 1WGSA 2O4XB 1KHIA 2A3DA 1Z0PA 5DQVA 3RYCE 1VOMA 1WQWA 2X9WA 3CCQT 2CE7A 2OTLA 2D0TA 3MZKB 4N78D 4M7DD 5GAMf 4PJOA 3OJAA 3OYLA 2XK0A 2MF2A 1WYBA 2WM9A 3CPZA 4RCCA 1YKEB 2JNGA 2L8DA 3L09A 2OTLT 3UT5E 4J5YA 3EDUA 3VV0A 3RYHE 1BR1A 4B9XA 4EMKB 3OYEA 3EDVA 2K5IA 3BY7A 1D1AA 3FLGA 3CPWA 4M7DA 3OY9A 3CMAA 2WSFE 3OS0A 4JLGA 4EZHA 2BZBA 4M7AF 4HE8A 2EJFA 2W0GA 2EWNA 3JCMg 3OMGA 2R5MA 4TV8E 1I5LA 4P0BA 4RMOA 3LH0A 5JRCA 1BI1A 3T9NA 4MHCA 4NL2A 5GAN2 2RD1A 2NLUA 3N2KE 1BIAA 4J6WA 3I9WA 4F7UE 2XHCA 4UF0A 3OYJA 3Q2MA 3L1AA 4G2AA 2A7YA 4HT9A 2KAFA 1YD8G 4HN9A 1LVFA 3JC6C 5LBMA 3OW2S 1G3WA 5CA1E 4M7DC 5IYZE 3RRCA 3C4SA 2P0QA 3OBYA 3X28B 5GAN8 2DWGA 4XBFB 5JDFA 2ZPBB 4M78D 2Y8DA 3RRWA 2IW5B 3ZCIA 4Q5WA 5GAMd 4X1IE 3AA6B 5GANe 2XQYA 1BI2A 2VL8A 5J3BA 5CK9A 2YHTA 2LX9A 3RYIE 4A54A 3CCET 3M4YA 4QVDA 4M78A 4GK0E 2KWIB 1VQPT 2DXUA 3PE0A 3P8HA 2EHOB 4LDYA 4LD9K 3C50A 3NFCA 1GXIE 1R8OB 4X9DA 3KV5A 3M59A 4M75F 4XAXB 2NOXA 1X79A 4EAHA 5FU7C 4IGUA 5A1LA 4O2BE 5LG4A 5GAMj 3A5ZB 2D2SA 4XTYA 4ANJA 4DNDA 3AA7B 2E12A 3JAME 2OA5A 1VQKA 3SWHA 3KBGA 3DLMA 4LDWA 3W15B 4M78C 2K24A 4ZN1A 1VQ7T 4QW2A 4HT8A 2XU8A 1XTDA 4ADZA 3G6ET 1EZ3A 1LRZA 1N27A 5GANh 2DCFA 5LYJE 3RYFE 3OYMA 5JR9A 4C8QB 2QDYB 3JCMX 4OP0A 1VQLT 3FB2A 4F7UB 2KY9A 5HYAA 2E64A 3L2UA 3TEEA 1BR0A 4X1KE 5HXEA 5A0GA 3RERA 5JDLA 3CWZB 3KBTA 4A4GA 1M90C 4C92C 3M4GA 1Q82U 1K9MC 2DNXA 3WAJA 1ZKEA 5BMVE 2W62A 4LDVA 1KK7A 1N9RA 3D0TA 3SWNB 2PU9B 5CR2A 4XK8E 2QTXA 2JOYA 2W63A 4Y91A 1IJ6A 3PU8A 3T8OA 4H9SE 1D0ZA 3ETUA 5JR9C 4MALA 5LGTB 3F57A 3LWHA 5GANg 4DOVA 2PQWA 3OYIA 2HD0A 3I55T 4M7DF 4C91A 2Q9QC 1U5PA 1QVFA 3WVDB 1W4SA 5EZYE 4C0FA 5CKHA 4P5NA 4QKNA 4GLKA 3QUIA 1FWZA 5LJ3h 2L8KA 2KK4A 3OYAA 2N1GA 2XHEB 1MNEA 1U1SA 4BI8B 4EMKA 3OS5A 2HQXA 4QX7B 3E1SA 3QO3A 5FNVE 3JCMQ 2LCLA 3QJYA 3X25B 5FXWA 4M77G 1NE8A 3ZN1B 1WRDA 2QQSA 4LDUA 2X68A 2L5QA 4RKUE 1W2BS 1VQ5T 3PMIA 4IDZA 1ZHIA 2UXXB 4DMVA 3ASKA 1FMWA 3BK9A 4AKHA 2DPPB 5DABA 4Z02A 1V9DA 3QDRB 4OK0A 1Q81U 1G8XA 1MIWA 5CKFA 2DTHA 5HAXA 4MZTA 3MXZA 1D0YA 5DQWA 3ZN0B 3SFMA 4IUTA 1H641 5A0LA 2RI5A 3N9OA 5J26A 1JJ2A 5LBQB 2ACXA 2HAXA 1IAPA 5GAOl 3FEOA 3M55A 4ATOA 4M78F 3S3NA 5GAOm 1VQ6A 5F3JA 2EHOD 4N4IA 3SOLA 1XQHA 3OYCA 4BDZA 2M1HA 3ZC1A 2EKOA 2R58A 4C0DC 2BVMA 2E9XC 1VQ6T 5JDHA 3RESA 5GAN3 3HKEE 3MEAA 4E7KA 2EHOA 4C92F 4EDUA 2E65A 4BE0A 3AHUA 1BR4A 3ZBDA 4C92G 4BB7A 3RIRA 2D6FA 2X9HA 2NTXA 5HXRA 4PLIA 4A4HA 5L3BB 4X34A 1MMDA 2E6ZA 4MBQA 4OYKA 5GAMe 3BQKA 4WBOA 3CQXC 2R5AA 3GP8A 3WVEB 4O5VA 3F70A 5L3FB 3LLRA 5LA6E 4C8QD 2KZ7B 3MK7C 1XNIA 3ZEHA 2LJLA 4O4HE 2MWOA 3NTIA 1HG5A 3S6WA 2EJ9A 4JS4A 3PTRB 2QA4A 2P9BA 3AVSA 3EVYA 2KSSA 2DEQA 3CMET 4MDWA 3PUSA 4KP3C 3KV4A 3OYFA 4PNOA 1KQ2A 5J1GA 3CC4A 3LJCA 3LYIA 4H63V 3HPWA 2X4YA 2WMOA 4L59A 3P7IA 1X75C 4C8QA 3K8PC 3HRTA 5L3GB 4EXTA 1WJQA 4TUYE 4ELYC 2QA4T 2NTYA 4OB3B 4F7UA 4XU1A 2V8KA 1E1HB 3MACA 2A3LA 4PK6A 3CC4T 3N2GE 1S72A 4ZGDB 3MJXA 2LSYA 3J7Yq 3QG1A 1QVFS 4MMKA 4EZ4A 4CI0C 3OYKA 4FT2A 5AYFA 5GAMh 3FC3A 1D1CA 1RL2A 3M56A 1S72T 3UPUA 4YJ2E 4CQIA 3VYGA 5FU6C 2HNIA 1PSEA 4OGEA 2E70A 3DTOA 3CC2T 3OS2A 5I2MA 4MFRA 2LRQA 4AQFC 4M77B 3UUNA 5LP6E 2VASA 5FMNA 3CCRT 1YCYA 3HRUA 3CCLT 2BIVA 4N0AA 3O1JA 5D6XA 5I2SA 3CD6A 4FU6A 3S3OA 4ZI2D 1JRIA 4M7AC 3MO8A 2IG0A 1U4QA 2VV5A 4ZTJA 2VB6A 5JVDE 2GF7A 1Q82C 3V7RA 4G63A 1G3TA 4QVZA 2CGHA 2D5UA 4ZHQE 1JJ2S 3C98B 3Q5WA 5GAMg 2QXFA 4PFPA 3OSVA 1UGRB 2CZ6B 2E41A 4FIBA 4NS5A 2I59A 2XKOC 1QW1A 1G3YA 1OI1A 3EFRA 3CCJA 2OTJA 2X9YA 1YBYA 4TN7B 3HRSA 4TX5A 2UXNB 5DJQC 2EAYA 2XI9A 1K73U 2Y90A 4JLEA 4ZS2A 2JTMA 3K3OA 3URGA 2ZLYA 2DD4A 5LJNA 2DD5A 4IE5A 1US7B 3CCJT 2WSCE 1CUNA 3GN5B 2XIDA 1OXZA 4E47A 2VYTA 1U8RA 4UIGA 2DZCA 1NPPA 4C90A 1WR6A 1K8AU 2KMTA 5GAOq 3G4SA 3GNGA 2L9QA 2JVVA 5J2UE 3CCVA 3PUAA 3H3AA 3LBXB 3CKDA 4UVBB 3MEVA 4C5IA 3ZMSB 5ETWA 4HA8A 2JRKA 4M75C 1WQ7A 2JZ2A 3AAEB 2QI2A 1Y96A 3CCQA 3RKYA 2E5QA 2H3JA 2K5LA 1Q81C 4CZZB 4CXXA 4CI2B 5CQYA 4OB1B 1M5Q1 2HBPA 5KE2A 4A56A 2KQWA 4ZN3A 3B13A 1KG1A 1WNLA 4IKFA 1KC8U 4PNIA 2LNVA 2BVLA 3E22E 3L2ZA 4MDXA 3AB3B 4F7UF 4H63H 4CRIA 5JH7E 3K3NA 2LM9A 2CLYC 3QBYA 5ADXL 3BQIA 3L2RA 4K0UA 5HWXA 3JCMb 3DB3A 3MEWA 3KUFA 2XASB 4BUGA 1IZNB 1HK9A 1X01A 2M9UA 3HKSA 2EQKA 3VUZA 1FEWA 3QPHA 2QQRA 4M7AG 4NOYA 4ME7A 4YTLA 1KHCA 2XDBA 4JS5A 3JB9J 2C06A 3CBMA 3JCMP 2X66A 5LHGB 3RKWA 4FSXA 5DLQE 1YW0A 1VRBA 2RHIA 2X51A 2E1HA 2Y4XA 1ZV4X 4PJOC 5C8YE 3VJPA 4C8QE 2LT4A 3FXEB 2FYKA 4H9OC 4AXPA 4PJMA 2LT3A 3A8MB 3JRZA 3N5LA 2MTQA 2BDEA 4J7FA 4Y28E 1ZHCA 2PG8A 4A4KA 4E7JA 2H7VC 3MP6A 2W61A 1KQSA 3QHSA 1MIVA 3CC7A 4I50E 2RK2A 4HFVA 3TKLB 1WYCA 3CCEA 3NTHA 4C0DB 1MIYA 4XQ3A 3RUXA 1W2BA 4X1YE 5GMKi 1VQPA 4BY6B 3L2VA 4WF2A 2KINB 1YHQA 3CC7T 4HEAA 1ZBXA 4VUBA 1UGPB 3ESLA 3L2WA 3HA4A 5KX5E 3SRZA 3KVAA 2M16A 5LHIB 1UCUA 2DIGA 4II1A 1QUUA 5JDGA 4BI3A 4DMWA 2LQKA 1YHQT 1O75A 3H37A 3OBVE 1VIEA 3QIIA 3OYYA 4ZOLE 4ZI3D 4M75G 3OYBA 3QSUA 2D0UA 4L0RA 3MHXA 2WBLA 2DTOA 1VQ7A 4O4JE 4O8SA 1IREB 4UXNB 3RC3A 3G6EA 4MMLA 3I1AA 3ANWB 3HL6A 4PJJA 4ZGJB 4AI6A 1BIBA 4L9IA 5JDQA 4BACA 3RPUA 1VQLA 3X24B 2RHXA 5CCAA 4JDSA 3ZLIA 4DO0A 3ZMVB 2G3RA 5A2QE 2VWAA 2D0QB 3ZYKA 4GYSA 3GN5A 1BI0A 1VQ8T 3S4UA 4H9QC 2YRVA 1HTJF 3JCMf 3CCST 4KUMB 3E0ZA 2CWYA 4HCBA 3OYXA 4LD6A 3U3IA 2ZZDA 3KDSE 4OF1A 2B8AA 2ZPEB 2KMFA 1M4ZA 3LBXA 3NRXA 5FU6B 3AA0B 1P92A 2DXCA 4BD3A 3TCJA 1KD1U 2DK3A 1HF8A 4ZI3C 2DO3A 3C94A 4E7ZA 3VKHA 3H6ZA 4JRQA 2V7IA 1K73C 4PKCC 3I55A 2FL7A 4PJOF 2RO0A 2X9XA 1SA0E 2IC6A 4PJOG 1RI0A 2XAQB 4HKEA 2ZM8A 2ZGWA 3GLXA 2O4XA 2LHNA 2JMHA 4M7AB 4IIJE 2LEHA 3PUGA 1OWAA 4D6WA 3GOXA 3JB9H 4J6YA 2JMKA 3OKQA 3J81E 4YHJA 2PUKB 3JB9D 2F69A 3G7ZA 3TU4K 3M53A 4M7DG 1K8AC 1U1TA 5L3EB 4BJNA 5KH6A 3MCAB 1QSDA 3L42A 1H3ZA 1HS7A 4MLKA 3GPLA 3Q1JA 1VQ5A 4QXHB 3AAIA 4JUYA 4UELA 2VXEA 5LNKA 5M4YA 3KBUA 5H6QB 2KDSA 2XD0A 3TREA 2FHDA 2N9DA 1KQSS 3UULA 4IUQA 3VUBA 2EQUA 5J39A 1YJ9A 1VUBA 2KNDA 1WJRA 2DZ9A 5EK4A 1FX7A 1MNDA 3SDZA 2JPFA 5IHYA 4OVAA 3N9MA 5GAOr 1IZ6A 4PK4A 3ZYLA 1LNXA 4JRPA 1YJWT 1O9SA 1QP2A 4C0GA 1VQOT 2LOSA 1KC8C 3LGLA 1Q86U 1YJ9T 5FY0A 5AFUL 2N2NA 1N9SA 2LCCA 3CVRA 4PAGA 4EMKC 1YJNA 3P8CD 1SHZC 2XAHB 4DVDA 4I4TE 5JREA 1G5VA 3JCMV 2LSJA 2L89A 4UV9B 5GONE 2PBIA 2VUBA 1HG2A 4M78G 4H9PC 2ZPIB 4QQGA 1YJNT 2CMRA 5CQXA 1DJ7B 3UT1A 3UWNA 5JQGE 3QKJA 5A0DA 1M8VA 4R56A 4QHOA 5DM7R 2LVMA 3JCMJ 3DKMA 2V1DB 4JEHB 4M77E 4XU3A 3QZ5B 2JQQA 5KMGP 3H8ZA 4HTEA 3ZEFB 3VHLA 2ZPHB 3LG7A 1KQ1A 2A72A 2VXFA 2DKGA 2V7MA 2MMPA 4PW8A 3MKDA 2VKJA 4J2CA 3K3QC 2K9AA 5FXXA 4C0ZA 2CXDA 5CO7A 3CMEA 3R6NA 3PIOA 4KUDK 5EK3A 4KULA 2V8JA 3FIFA 4FJOA 2O01E 3KV9A 3ANWA 2RJCA 4XTVA 1D0XA 2V7LA 4OB2B 2F5TX 3QK6A 4EMHA 4IURA 2ZPGB 2M67A 3MP8A 5D6YA 4EOZB 3C4ZA 2EHOC 1BKBA 5C6SA 1LOJA 4AKLA 5IN1A 5CAIA 2LHRA 3CCUT 3G71T 2L3LA 1MGQA 5GMKl 2ODVA 1N8RC 2EQJA 2QQAA 3C12A 1VQ4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILU A;  4KBM B;  4XAX B;  2LT3 A;  2LT1 A;  4L5G A;  2EYQ A;  2LQK A;  2LT4 A;  4KMC A;  4MFR A; 
#chains in the Genus database with same CATH topology
 4U3C A;  2KI7 A;  1ZA1 B;  4J7I A;  1XNQ T;  1WHJ A;  1YP5 A;  1E6H A;  2D0N A;  3RMS A;  3M57 A;  4NXN T;  3ZJ1 A;  2DAQ A;  3PVL A;  3OYD A;  2VC8 A;  4M7D B;  4U72 A;  4C92 E;  3TLS A;  3WXM B;  3CC2 A;  2EYY A;  2HKN A;  2IC9 A;  4HKA A;  4X64 T;  5I22 A;  4O4L E;  4IE0 A;  2ROL A;  2CM0 A;  3C4X A;  3QC9 A;  3H41 A;  3T1H T;  2XIC A;  3CCR A;  2WWU A;  1K4U S;  5CB4 E;  1UUR A;  4O6J A;  3R6O A;  5LJ3 f;  2CXL A;  2XSB A;  3N2O A;  3SWN A;  6AT1 B;  3CCL A;  4X20 E;  1SUM B;  5JRC B;  3CML A;  3KVB A;  2DIQ A;  4ILU A;  4UV8 B;  3JCM W;  1EX4 A;  4C8Q C;  1JB0 E;  2W00 A;  1MMG A;  2RJF A;  4M4Z A;  4EPC A;  1MV3 A;  2XSA A;  1WPY A;  2H7O A;  4EIW A;  2ESW A;  3V7S A;  2JT4 A;  4UF0 B;  4XU0 A;  3SD4 A;  5KYN A;  2VKD A;  2FBW A;  5ABG A;  5L2L A;  1IBK T;  1MUZ A;  1S35 A;  1QMC A;  1M1K U;  3CCS Q;  2EVR A;  2WMN A;  3Q9D A;  4KI0 F;  1XWM A;  3JB9 F;  3ZMZ B;  1XOV A;  2FZC B;  1I0C A;  4PJL A;  2CA5 A;  3JAE A;  5HXC A;  1FXX A;  2CZ0 B;  1TTH B;  4DR3 T;  2JXB A;  1NPR A;  4R55 A;  1C6V X;  5FU7 B;  1SE7 A;  4N4G A;  2KSR A;  1UUE A;  1ZEE A;  2Y6X A;  3GWH A;  3ONX A;  4XTX A;  3A8G B;  2HQE A;  4ASK A;  3J9X 1;  4C5G A;  2RQV A;  2K48 A;  2UXC T;  1KD1 C;  1YKH B;  2GTO A;  2V26 A;  1O3X A;  3CX7 B;  1FIO A;  4Z8X A;  1C0M A;  1TWB A;  3O5Z A;  4DBR A;  3M54 A;  3EGD B;  2YRD A;  3M0R A;  4EIK A;  2C5K T;  5C3J A;  4FI5 A;  1VQ9 T;  1W0A A;  1UTI A;  5LOV E;  4A98 A;  2X4J A;  5EK2 A;  3CPF A;  4M78 B;  3RI5 A;  4B6X A;  4OB0 B;  3VYH B;  3VS1 A;  2E4H A;  3WI3 A;  3VU3 C;  2QGS A;  4N0A C;  4IL4 A;  4WCI A;  2KGT A;  3SB2 A;  4FYV B;  4GYR A;  3I9Y A;  1KFZ A;  3BFM A;  4GY5 A;  5CA0 E;  3H0H A;  2IVW A;  3VKI A;  4BE1 A;  1XMQ T;  3NRY A;  3MPU B;  1NJI R;  1PWT A;  5LJ3 d;  4JI2 T;  4KBM B;  4J9F A;  4JI5 T;  4CI3 B;  5HKC A;  4JBW F;  3C0C A;  2D1X A;  2M02 A;  3EHQ A;  5C0M A;  3O9X A;  5L4H A;  1IHV A;  1YN8 A;  2V5C A;  2XMF A;  3EG2 A;  3OQ5 A;  3RKX A;  2DHR A;  2F1L A;  1YIJ A;  4OHF A;  5LJM A;  2WSS V;  2VKN A;  4C92 B;  2NUZ A;  1VCT A;  3RLF F;  2HPJ A;  4KMC A;  4JPB W;  1H7C A;  1GRI A;  2LSK A;  4ZI2 C;  2YUQ A;  1Y64 B;  3C95 A;  3CEY A;  1OEB A;  3EG0 A;  2PFV A;  2CH4 W;  1YIT A;  4PFZ A;  4DR1 T;  4F6R C;  5KYY A;  1YFN A;  4IUU A;  2JTE A;  4JI4 T;  2EFI A;  3QJ6 A;  4RCB A;  4WBN E;  1YIJ T;  3UU8 A;  2DXT A;  3HKD E;  3OYN A;  2LMJ A;  4J83 A;  2RQW A;  2RM4 A;  4UVC B;  2DVJ A;  4DA4 A;  1M2O A;  1H8K A;  3BQL A;  1QLB A;  5JR9 B;  4IRE A;  4HFI A;  5FVL A;  1J5E T;  5GAN 4;  4ERR A;  3BW1 A;  3CCM T;  4HCC A;  3ZFJ A;  1PHT A;  1YIT T;  3V8K A;  1WJS A;  3U78 A;  3AED A;  2QEX T;  4DBH A;  3ZCJ A;  2PVG B;  3UFE A;  2C5J A;  2QAS A;  4BDY A;  1G3S A;  2CS7 A;  4OMP A;  4IST A;  1YI2 T;  4YFS A;  2C5I T;  1HXD A;  1Q86 C;  4K11 A;  2WQY A;  3E08 A;  1M7K A;  2Q9Q B;  2AHJ B;  2LRL A;  3RC8 A;  4NL3 A;  4ZS3 A;  3A8O B;  1Y57 A;  2QQB A;  4IIM A;  2D9D A;  3PUQ A;  5FKY A;  4LF8 T;  3P8D A;  3EGX B;  2MCN A;  3KIN B;  1NZ9 A;  4GOU A;  5GAN 6;  1T72 A;  3AVR A;  3OW2 P;  3I0O A;  4Z91 A;  4A5X A;  3FB9 A;  2X0L B;  3ABV A;  1QVG A;  1UHC A;  4O4I E;  4FM4 B;  2WDV A;  4C8Q F;  2ES0 A;  4IE4 A;  5FRM A;  3I56 Q;  1UK5 A;  5HEJ A;  4C8Q G;  2PVD B;  4E7I A;  2K2V A;  2KXP B;  3AE9 A;  1QVP A;  1XJW B;  4F7U G;  5GMK j;  3UU5 A;  3QXE B;  2M0O A;  3OMC A;  1GCQ C;  5GAO p;  4DR5 T;  3M0U A;  5EG2 A;  4XTU A;  2DL1 A;  4HFC A;  3JC6 D;  2J1D G;  1Z9Z A;  4L5G A;  2VWF A;  3UA7 A;  2X4W A;  1SSH A;  5HK0 A;  2VGM A;  5JDM A;  4QQD A;  3Q5X A;  4AFS C;  2HKQ B;  3BDU A;  4I0U A;  2CPT A;  3CX8 B;  3I0Q A;  2KBT A;  1AT1 B;  2GCX A;  1PSF A;  3ZYM A;  2E5L T;  2B1E A;  4TVR A;  2DLR A;  4UEM A;  3M5A A;  3X26 B;  2CBJ A;  2ZPF B;  4JUV A;  5LHH B;  4QH1 A;  4TNW A;  4LF4 T;  1OPL A;  1B34 B;  3P4R A;  5HXH A;  3LW5 E;  3PUV F;  5TAO A;  4BI4 A;  3P4W A;  2FJB A;  2PTF A;  2OAU A;  4K0K T;  1NJI U;  1KNZ A;  4RTT A;  2IAK A;  4FW1 A;  5LJ5 f;  1WHK A;  5I11 A;  3DLL A;  3L8R A;  2MOX A;  3ER0 A;  2GBQ A;  2HN2 A;  4OGC A;  1ABQ A;  4M77 D;  5LL6 S;  3Q5E A;  2MAM A;  2O88 A;  2DLP A;  1AOJ A;  1ZQ1 A;  2WB5 A;  4PFO A;  2FVU A;  3PIP A;  1UGO A;  5HXS A;  3NGP A;  2FJA A;  4IDN A;  2XQA A;  4YT0 A;  3OSS C;  3N9P A;  1IBM T;  4H9N C;  2I2L A;  4HWH A;  3DP7 A;  1Z9Q A;  4MZP A;  2WZH A;  1N32 T;  4IUP A;  2KRS A;  4QT7 A;  1OZ2 A;  3V8L A;  3INZ A;  1M9S A;  2QRX A;  3EAE A;  2RHY A;  3CMA T;  2EYQ A;  4XTZ A;  2EKH A;  4QVC A;  2RJD A;  3M9Q A;  3A5X A;  1N34 T;  3ZL7 C;  2RB6 A;  5CVI A;  2CRE A;  4KGV B;  1PG5 B;  3QUJ A;  4DEX A;  1WLX A;  2XTL A;  3HFN A;  4M77 A;  3PUR A;  3EG3 A;  3FBZ A;  1T3S A;  2K57 A;  3QYG B;  2MI6 A;  2ROT A;  2E9X B;  2GTJ A;  4DOW A;  4H9R C;  3CCU Q;  2A2F X;  5JDN A;  4EYY R;  1S94 A;  2LKG A;  4JI7 T;  4J9G A;  5KYW A;  4JJN K;  4M7A E;  4PJN A;  4BJM A;  2YSQ A;  2HH7 A;  3V8J A;  3M65 A;  3RIU C;  4ZI7 E;  1EZZ B;  1UX5 A;  3HP9 A;  1HYO A;  1YXR A;  5FW9 A;  2A08 A;  2XDD A;  4DUZ T;  3JCM c;  1N8R U;  1N33 T;  3EGU A;  5KCH A;  3CXC A;  2GQI A;  2LT1 A;  2B86 A;  1VQM Q;  1HFA A;  1OV3 A;  2CZ7 B;  5KCO A;  5FXV A;  4M77 C;  1ZUY A;  2XAG B;  3LX7 A;  1IRX A;  3FZK B;  3E9G A;  1QCF A;  1R77 A;  3AEG A;  2DTI A;  2DXB A;  3ZPO A;  2K5F A;  2ECZ A;  2YLC A;  5LJ5 d;  1VQN Q;  1EIF A;  4LNP A;  3OYG A;  1UDL A;  3HR0 A;  1SF9 A;  4F8H A;  3CPW P;  1IHW A;  1Y0M A;  3VS2 A;  3S3M A;  4C92 D;  3PNW C;  4PL6 A;  2PJQ A;  1UB4 A;  2J62 A;  1B07 A;  4A4E A;  2FRY A;  1VQ8 A;  4CXY A;  2D8H A;  1M1K C;  1AHJ B;  2XUE A;  3IEE A;  2GFA A;  4RTX A;  4IHJ E;  4AKI A;  1FMV A;  3CCS A;  4GKJ T;  5I21 A;  3OB9 A;  2VKO A;  1E7O A;  4OML A;  3O4X E;  1Q7Y U;  2UUC T;  3FDR A;  5DLO A;  2DVE A;  1LVK A;  5FWB A;  3PUW F;  2XQ5 A;  3CBP A;  3RIA A;  2L3S A;  2VQF T;  4A53 A;  2MBG A;  1OZ3 A;  1NYG A;  3EFS A;  1M1F A;  5IHN A;  2P0P A;  1I5O B;  2YDS A;  1YNZ A;  3AE3 A;  3FJP A;  4C92 A;  4QWN B;  1WCR A;  3F31 A;  2LQ8 A;  3GMI A;  2RJE A;  5HWY A;  2DF6 A;  1BK2 A;  5LJ5 j;  2LNH B;  2XDP A;  2X67 A;  3CQC B;  2ENM A;  4QXB B;  3JCF A;  4BA9 A;  1Q81 R;  2Q9Q D;  5L47 A;  1HCI A;  3RX6 A;  5LCY A;  2G0U A;  3RKO A;  1QVG S;  3O8V A;  2LJ0 A;  3HKC E;  3UUM A;  4JJD A;  1VQK T;  2CP5 A;  4FL6 A;  3J7A F;  1YWP A;  3RQW A;  1WXT A;  4X9C A;  2FUP A;  1W9R A;  2FJE A;  5LJ3 e;  4M75 E;  1AWW A;  3CD6 Q;  2BTT A;  3GIB A;  3AEA A;  2MPX C;  1AWJ A;  4AIS A;  1QLY A;  3CBO A;  1OED C;  4DBQ A;  4RTZ A;  2RQT A;  2F5K A;  4BE2 A;  3L2Q A;  4N4H A;  2WZI A;  2HL3 A;  3DB4 A;  2V7K A;  2FB7 A;  2WDQ A;  2Q9Q A;  3DJB A;  1Y7X A;  1ZOY A;  2NWM A;  3OS1 A;  3CXC P;  2IUB A;  1KIK A;  3K1S A;  4B9W A;  4AKR B;  5LXT E;  3WAK A;  4IE7 A;  4U33 A;  1J3T A;  4E7H A;  1MHN A;  2NW9 A;  4DV0 T;  4F14 A;  3HL8 A;  5DY9 A;  2BE7 D;  3AT1 B;  2LJ1 A;  1D1B A;  3UF4 A;  4NUV A;  1QKX A;  2RN8 A;  3ZJ2 A;  3U23 A;  3CPW S;  4X66 T;  1UGV A;  4IE6 A;  3BDL A;  4B3M T;  4AQG A;  2RI2 A;  3KFW X;  4P0A A;  5FXZ A;  5J2T E;  4FT4 A;  2WP9 A;  1TH7 A;  3D7S B;  2C0S A;  2OTJ Q;  4JI8 T;  2ED0 A;  2RHZ A;  2K79 A;  5LGU B;  4JYA T;  1JBM A;  1ZUK A;  3EH1 A;  5GMK e;  4NXM T;  3LK3 B;  2V6X A;  2YEV C;  2DM1 A;  3V5U A;  4HCZ A;  2KRO A;  3CX6 B;  2Y48 B;  1QKW A;  2K4Y A;  3JCM d;  2NP9 A;  5GJW B;  1RAA B;  1I4K 1;  1YJW A;  4LDX A;  1BU1 A;  1VQO A;  1KFY A;  4AKG A;  3C64 A;  4HFH A;  2LDM A;  4OMF B;  4JRK A;  3JB9 I;  3NZP A;  5LGN B;  3FZL B;  3OA6 A;  2VL0 A;  3AEF A;  4HFD A;  5IHK A;  1NEN A;  2PUO B;  3THK A;  2PVO B;  3MP1 A;  4I43 B;  2BG9 E;  1B34 A;  1JNZ A;  3E19 A;  3P4Q A;  4X65 T;  3FBL A;  1I8F A;  4BAY B;  2P0K A;  4EB6 E;  1T8B A;  4PJO E;  3IBP A;  2Z6E A;  1K76 A;  3LGF A;  5AQP B;  5HK3 A;  5E0O A;  2V8I A;  3CCV Q;  5FP3 A;  4M77 F;  3IQL A;  4NIQ A;  1CHU A;  3RH3 A;  2V1R A;  1SSF A;  2YIN A;  2YUN A;  3C4W A;  2E9X D;  2QA7 A;  3PDY A;  3NZQ A;  2R57 A;  5GAO n;  5CKB A;  4D8K A;  5FLX E;  2MYS A;  2KWH A;  4NUU A;  1JQQ A;  3I56 A;  5ABH A;  2VK9 A;  2GFU A;  1V29 B;  2YLB A;  3ETV A;  3LK2 B;  3ME9 A;  2J06 A;  4AFZ C;  2RQU A;  3CCQ Q;  4M7D E;  2SPC A;  4YSY A;  3PTA A;  1GFD A;  2KRM A;  2QYZ A;  2XG8 D;  3CXC S;  3A7M A;  2JN0 A;  2RP4 A;  2O31 A;  2LM2 A;  5L3C B;  2LOP A;  4M75 B;  2QAZ A;  2QQ9 A;  3FRN A;  1BYM A;  4C5E A;  4QQ6 A;  2X3X D;  5GMK h;  2E9X A;  4PK5 A;  2XQ3 A;  1VA7 A;  2DE0 X;  2VKH A;  3ZC0 A;  2WSE E;  3I56 T;  3UQ7 A;  3PT9 A;  5GAN 5;  3PUX F;  2BKD N;  2DJZ A;  1HX8 A;  5LJ3 g;  3EG9 B;  2OTL Q;  2HCK A;  2WAU A;  3QZ9 B;  1D3B B;  2CXF A;  5KYX B;  3LFM A;  3FXD B;  4QXC B;  5KDM C;  3AA1 B;  1NJI C;  1N6A A;  4HVU A;  4P1N A;  1YCS B;  2G6F X;  2X3W D;  3PVQ A;  3JSC A;  1B7T A;  4Z88 A;  4ZTF A;  3SEM A;  4LXC A;  1QVF P;  2O2O A;  2RI3 A;  1ZP0 A;  3O1H A;  3GNF B;  4JEU B;  1QQJ A;  4LN2 A;  5GAN 7;  2YU2 A;  2CT4 A;  1NWM X;  2HSE B;  4EED A;  1NEB A;  1MMA A;  2ZCF B;  2VGN A;  1I81 A;  4I55 E;  5GAN f;  2GK9 A;  1MMN A;  5KYU B;  5D7U A;  3CMA Q;  3A8L B;  1Y96 B;  4YJ3 E;  2K3Y A;  2CLY B;  4GIW A;  2RHU A;  2ODU A;  3ZT5 A;  2UU9 T;  1U5S A;  2CYZ B;  3T1Y T;  2HL5 C;  2L3R A;  4BY6 C;  2BS3 A;  3LWI A;  4DV3 T;  5FY7 A;  5FRN A;  2MAW A;  2YK0 A;  3H9N A;  3IF8 B;  1S1N A;  2XQ6 A;  3RF1 A;  5CKE A;  3KXT A;  1KSW A;  2EQM A;  2YWW A;  4E7S A;  3RMQ A;  2XQ9 A;  1AWX A;  1UX4 A;  4OX9 T;  2CCQ A;  5FY1 A;  4ILA A;  4IUV A;  3CCU A;  3G71 A;  3M0P A;  4M78 E;  4FCY A;  3UDC A;  2LSI A;  4CXW A;  5M9O A;  1VQ4 A;  5L4E A;  5HCJ A;  3HSB A;  4MZM A;  1RLP C;  2DEU A;  4ELZ C;  5H6R B;  3VRA A;  2WAC A;  2X4X A;  4EMG A;  4PJO B;  2KT8 A;  1K9M R;  2EGA A;  2K9G A;  3B57 A;  4AG1 C;  4FYY B;  4QX8 B;  1HR0 T;  3CQG B;  4CC4 B;  5GMK m;  2JJ9 A;  3GA8 A;  5LJ5 e;  1K73 R;  3F2E A;  1TU0 B;  1G73 A;  1VQM A;  4WNK A;  1PRL C;  1W09 A;  1AD5 A;  4U74 A;  1LJO A;  3KV6 A;  5IAY A;  4HWD A;  2HZY A;  1AJ3 A;  1VQP Q;  1JJ2 P;  4M7A D;  4XU2 A;  3PFS A;  1VQN A;  4JLI A;  4AQF A;  3N9Q A;  3QDF A;  2E8I A;  3V7C A;  4M1P A;  5L3D B;  1VQM T;  1NAF A;  1ZBJ A;  5JTG A;  2BUD A;  1K8A R;  2KT9 A;  3SS1 A;  3IHR A;  3OBW A;  5GAN d;  4FSS A;  2J6F A;  1Q7Y C;  2KVQ G;  1T98 A;  1AWO A;  1VQN T;  4UC4 A;  4M7A A;  3UTK A;  3UUX B;  2YXY A;  3O1I A;  2JMC A;  1XNR T;  2V8S V;  2NUT A;  1RAG B;  3V5S A;  5CIU A;  1RAC B;  2HMA A;  3SFE A;  4XTW A;  2BZX A;  1BB9 A;  1BBZ A;  3P8B B;  3PMT A;  1IGQ A;  3JB9 G;  5HY6 A;  5CKD A;  3HKB E;  1VQ7 Q;  2LP5 A;  3VKG A;  1ZX6 A;  1WXU A;  3MEU A;  1BI3 A;  2H3R A;  5CJ5 A;  1OU9 A;  2RA1 A;  3G6E Q;  2V7J A;  4IDP A;  1OUL A;  5D6W A;  2CKK A;  3C51 A;  4EYU A;  1QP3 A;  3VS0 A;  1VQ9 A;  3E9F A;  2XAJ B;  2LE8 A;  2LC4 A;  4O2A E;  2NW8 A;  1VQK Q;  3PU3 A;  3R84 B;  3L3P A;  4DQ2 A;  5LJ5 h;  2DBK A;  4IDQ A;  3HHT B;  1X69 A;  4F04 B;  3SWN C;  4V1A v;  4Q25 A;  5AQS B;  4YLH A;  5GAN j;  2PNI A;  3PJA J;  3N5B B;  2FZK B;  1IBL T;  4ZGE B;  2X35 A;  1ZA2 B;  2ZM2 A;  3C12 A;  2JUF A;  4KUI A;  1WLP B;  2DL7 A;  2HPL A;  3QYH B;  1T7S A;  1LKX A;  4C5H A;  2XAF B;  3M58 A;  5FRO A;  2YU1 A;  4WW0 A;  4YXD A;  4TZ4 C;  2EJG A;  1C1A A;  4HWC A;  2K2M A;  3JV3 A;  1V1C A;  2BE9 B;  4GK5 E;  4U31 A;  2D9T A;  3OW2 A;  3NTK A;  2KXC A;  3CD6 T;  2NW7 A;  1X6O A;  2ZM0 A;  2XY8 B;  2DI4 A;  3REA B;  3EG1 A;  2UXB T;  3N9L A;  4OFZ A;  4TV9 E;  3J80 E;  1UGS B;  4M75 D;  4L6V 5;  1E7P A;  1UEB A;  2J6O A;  1Y71 A;  1FYN A;  2RK1 A;  1M90 U;  5CGM A;  2P4T A;  4ZNX A;  3AAA B;  4J9C A;  1K9M U;  4P09 A;  2CHO A;  3HI2 A;  1SRM A;  1TOV A;  1MV0 B;  1M8M A;  3RGL A;  3JCM e;  2EIF A;  2M6B A;  1RAI B;  2K7A A;  9ATC B;  4PLL A;  2QYW A;  5FYM A;  3HFO A;  2UUB T;  2MWP A;  3N9N A;  4DV5 T;  2RA2 A;  5LJ5 g;  3I55 Q;  4DUY T;  1PNJ A;  4J8O A;  3CCM A;  2E6N A;  4M75 A;  5LMU T;  2NWB A;  1M1G A;  2RMO A;  1GQE A;  3OYH A;  5IT9 E;  2QEX A;  1WHM A;  1YI2 A;  4J6X A;  4J9E A;  2KEA A;  1Y07 A;  2OTJ T;  2GGR A;  5F8P A;  3FHN A;  2DX1 A;  2K3X A;  3OYZ A;  1UGQ B;  3ZMU B;  1D3B A;  5LJ3 j;  4QKU A;  3GF5 A;  3MET A;  2W67 A;  4RG8 A;  2QGG A;  2Y4Y A;  2K3B A;  2LSG A;  5HCK A;  4RG2 A;  2CWO A;  4IIO A;  4LUD A;  3LK4 2;  2HHH T;  4ISS A;  5KE3 A;  3I35 A;  2E10 A;  1BR2 A;  3EUH A;  2K5B B;  5L8R E;  2JTF A;  3G1J A;  2KNB B;  2KR3 A;  2RH2 A;  2ZMA A;  4V2S A;  1VIF A;  2GQV A;  1HNZ T;  4A4F A;  3PGG A;  4HGA A;  4OYJ A;  3ZMT B;  1WDX A;  3EFO B;  3X20 B;  5KYU A;  2CEA A;  3NBX X;  4UVA B;  2FJD A;  2KLQ A;  3G4S T;  2DWK A;  4XZC A;  2LTO A;  3MA9 A;  2D8J A;  1UFF A;  5HEO A;  1IJ5 A;  4E7L A;  1OPK A;  3CCV T;  3A8H B;  2AZV A;  3JCM h;  2MOZ A;  2IIU A;  4KT0 E;  2CZ1 B;  1YQ3 A;  3VU7 H;  4PJO D;  5AQR B;  1OYX A;  1OOT A;  4CI1 B;  4JRI A;  3M3Z B;  1ABO A;  1WGS A;  4LF9 T;  2O4X B;  1KHI A;  2A3D A;  1Z0P A;  5DQV A;  3RYC E;  2L2P A;  2EYW A;  1VOM A;  1WQW A;  2X9W A;  3CCQ T;  4IL9 A;  2CE7 A;  2OTL A;  2BG9 A;  2D0T A;  3MZK B;  4AFQ C;  4F16 A;  4N78 D;  4M7D D;  3TSZ A;  3VR9 A;  2V6Y A;  5IWA T;  5GAM f;  4LF7 T;  3PV0 F;  3VS5 A;  4PJO A;  3OJA A;  2IIM A;  3OYL A;  2XK0 A;  2MF2 A;  1WYB A;  1SHG A;  2WM9 A;  3CPZ A;  2CUB A;  3ULR B;  1HNW T;  4RCC A;  1SHF A;  1YKE B;  4ILB A;  2JNG A;  2L8D A;  3L09 A;  4RUG A;  3UT5 E;  2BZ8 A;  4J5Y A;  3EDU A;  5ABF A;  3KFV A;  2OTL T;  3VV0 A;  3RYH E;  1BR1 A;  4B9X A;  4EMK B;  3OYE A;  3EDV A;  1TUD A;  2K5I A;  1D1A A;  2XM2 A;  3BY7 A;  3FLG A;  3CPW A;  4U7Y A;  4LF6 T;  4M7D A;  1VQ6 Q;  3OY9 A;  3CMA A;  2WSF E;  3OS0 A;  4JLG A;  4EZH A;  2BZB A;  4M7A F;  4HE8 A;  1RI9 A;  2EJF A;  2DYB A;  2W0G A;  2EWN A;  3JCM g;  3OMG A;  3RKG A;  1JNR A;  2FEI A;  2R5M A;  4TV8 E;  1X6B A;  1NYF A;  1NEG A;  1AVZ C;  2BG9 C;  1I5L A;  4P0B A;  2NUP B;  4RMO A;  3LH0 A;  5JRC A;  1BI1 A;  4AT1 B;  5AQV B;  1T0H A;  3T9N A;  4MHC A;  1M30 A;  4FW2 A;  5C2T A;  3RR6 A;  3RIF A;  1PCX A;  4NL2 A;  5GAN 2;  3UAT A;  2KRN A;  1SEM A;  2RD1 A;  2NLU A;  4AMC A;  3N2K E;  2WY2 A;  2O9V A;  1BIA A;  4J6W A;  3I9W A;  5AQG B;  3UA6 A;  2XHC A;  4F7U E;  4UF0 A;  1AZG B;  3OYJ A;  3Q2M A;  3VS6 A;  3L1A A;  4G2A A;  3UU6 A;  2A7Y A;  1Q82 R;  4HT9 A;  2KAF A;  1KD1 R;  1ZSZ B;  1YD8 G;  1NM7 A;  4HN9 A;  1LVF A;  3JC6 C;  5LBM A;  2WU5 A;  3OW2 S;  1G3W A;  5CA1 E;  4DID B;  4M7D C;  5IYZ E;  3RRC A;  5AQH B;  4ZXL A;  1BCO A;  3UUB A;  3FZF B;  3C4S A;  2P0Q A;  3OBY A;  2J05 A;  4RTW A;  3X28 B;  3PJA A;  5GAN 8;  2CP0 A;  2DWG A;  4XBF B;  3EHR A;  5JDF A;  2ZPB B;  4M78 D;  2Y8D A;  2UUA T;  3RRW A;  1GBQ A;  2IW5 B;  3ZCI A;  4Q5W A;  2XJ7 A;  1NBE B;  5GAM d;  4X1I E;  3AA6 B;  3EAM A;  2QA4 Q;  1PD0 A;  4X62 T;  4ZEY A;  2EW3 A;  2DL8 A;  5GAN e;  2XQY A;  4U7I A;  3AEE A;  3EGD A;  4GKK T;  2VL8 A;  1BI2 A;  5J3B A;  2AXD S;  4LUE A;  1JXO A;  3CC4 Q;  5CK9 A;  3H0I A;  2YHT A;  2UXD T;  1PC0 A;  2A0F B;  3RYI E;  2LX9 A;  1Z8U A;  1CKB A;  4A54 A;  3CCE T;  3M4Y A;  4QVD A;  2JW4 A;  4M78 A;  4GK0 E;  2KWI B;  1B3Q A;  1VQP T;  4B3S T;  2FPF A;  2R6G F;  2DXU A;  2WWV A;  3PE0 A;  3P8H A;  1T3L A;  2EHO B;  1QCN A;  4LDY A;  4LD9 K;  3C50 A;  3NFC A;  1GXI E;  4KHZ F;  4DR2 T;  1XMO T;  1R8O B;  4X9D A;  3ZST A;  3KV5 A;  3M59 A;  4M75 F;  1S72 Q;  4XAX B;  2NOX A;  1X79 A;  1ARK A;  4EAH A;  5FU7 C;  4IGU A;  5A1L A;  4O2B E;  5LG4 A;  1TS9 A;  2JS2 A;  2K6D A;  5GAM j;  3CC2 Q;  4AQY T;  2YDQ A;  3A5Z B;  1IB8 A;  2D2S A;  4XTY A;  4ANJ A;  4DND A;  4KGZ B;  1RAH B;  3CCR Q;  3AA7 B;  2E12 A;  3JAM E;  2OA5 A;  3M0T A;  2CT3 A;  3SWH A;  1VQK A;  3KBG A;  3ZT6 A;  1M2V B;  1WHG A;  3DLM A;  4LDW A;  3W15 B;  2DBM A;  2K24 A;  4M78 C;  4ZN1 A;  1VQ7 T;  4QW2 A;  1WFD A;  4HT8 A;  2XU8 A;  1XTD A;  4ADZ A;  3G6E T;  5AQK B;  4B3T T;  1EZ3 A;  4EEB A;  1LRZ A;  1N27 A;  1I1J A;  3RNJ A;  4LFB T;  5GAN h;  2RPN A;  4KGX B;  2DCF A;  4DR6 T;  1PRM C;  1W1F A;  5LYJ E;  1KQS P;  4RTY A;  3RYF E;  1RAD B;  2AE9 A;  5JR9 A;  4C8Q B;  2QDY B;  3JCM X;  3OYM A;  2IPO B;  4OP0 A;  1VQL T;  3FB2 A;  4F7U B;  2KY9 A;  5HYA A;  5AQM B;  2DL3 A;  2E64 A;  4OMN A;  1ZUU A;  1TXQ A;  1W2B P;  2SEM A;  2ED1 A;  3L2U A;  3TEE A;  4Z8A A;  1BR0 A;  4X1K E;  5HXE A;  5A0G A;  3RER A;  2VVK A;  3B5M A;  5JDL A;  2E5V A;  3CWZ B;  3KBT A;  4A4G A;  1I07 A;  1M90 C;  2A36 A;  4C92 C;  3M4G A;  1AZE A;  3AE7 A;  4KH1 B;  4EV6 A;  1Q82 U;  1K9M C;  2DNX A;  1M3B A;  1M3C A;  3AE6 A;  3EFO A;  3WAJ A;  1ZKE A;  5BMV E;  5HCM A;  3EGX A;  3EH2 A;  4DBF A;  2W62 A;  4KX6 A;  1OQK A;  4B6M A;  4LDV A;  1KK7 A;  1N9R A;  2HSP A;  1J5W A;  3D0T A;  3SWN B;  2PU9 B;  2A9U A;  5CR2 A;  4XK8 E;  2QTX A;  2JOY A;  4YSX A;  2W63 A;  2GNC A;  4Y91 A;  1IJ6 A;  3PU8 A;  3T8O A;  2EGE A;  4H9S E;  1D0Z A;  2I0N A;  3ETU A;  5JR9 C;  1D09 B;  2WCA A;  1GFC A;  1U06 A;  4MAL A;  3CCJ Q;  2J4G A;  5LGT B;  3F57 A;  3LWH A;  4WTO B;  2COY A;  2V5D A;  5GAN g;  2MPK A;  4DOV A;  1M62 A;  2PQW A;  3OYI A;  2CP3 A;  1KJW A;  2HD0 A;  4AIU A;  3I55 T;  4C91 A;  4M7D F;  3L39 A;  2Q9Q C;  1U5P A;  1PD1 A;  1QVF A;  2DL5 A;  3WVD B;  1W4S A;  5EZY E;  4C0F A;  5CKH A;  4P5N A;  4QKN A;  1JO8 A;  3AEC A;  4GLK A;  3QUI A;  1FWZ A;  5LJ3 h;  2L8K A;  2KK4 A;  3SHW A;  3TQ7 P;  1JXM A;  3LH5 A;  3OYA A;  2N1G A;  2XHE B;  1MNE A;  1U1S A;  4BI8 B;  2HBW A;  4A97 A;  4EMK A;  3OS5 A;  2HQX A;  4QX7 B;  3E1S A;  3QO3 A;  2IHR 1;  3G4S Q;  2HEQ A;  4LFC T;  2LLY A;  5FNV E;  3JCM Q;  2LCL A;  3QJY A;  1WIE A;  3X25 B;  1ZSG A;  2XM1 A;  4JJB A;  5FXW A;  5IH2 A;  4M77 G;  1NE8 A;  3ZN1 B;  1WRD A;  2QQS A;  2F2W A;  4LDU A;  4HFB A;  3X1D A;  2X68 A;  4HFE A;  2L5Q A;  4RKU E;  1W2B S;  1VQ5 T;  3Q5D A;  4IDZ A;  1ZHI A;  3PMI A;  2UXX B;  2NUP A;  4DMV A;  4R0K A;  3ASK A;  2XQ8 A;  1FMW A;  3BK9 A;  3QB5 A;  1VCS A;  4AKH A;  1WXB A;  2DPP B;  5IUX A;  5DAB A;  4HWF A;  4Z02 A;  2BBJ A;  1H3H A;  1V9D A;  1JU5 C;  2M6I A;  2JM8 A;  3QDR B;  2BZY A;  4OK0 A;  1Q81 U;  1G8X A;  1LCK A;  1MIW A;  5CKF A;  2DTH A;  4IT4 A;  5HAX A;  4MZT A;  4LFA T;  3MXZ A;  1D0Y A;  2QVA A;  1ZSZ A;  5DQW A;  3ZN0 B;  3LDQ B;  3SFM A;  2E3H A;  1H64 1;  2EYX A;  4IUT A;  2W10 A;  2E2A A;  5A0L A;  2RI5 A;  3N9O A;  5J26 A;  3E2U A;  1JJ2 A;  5LBQ B;  2L3P A;  2ACX A;  4JJC A;  2HAX A;  1IAP A;  2COW A;  5GAO l;  3FEO A;  3M55 A;  4ATO A;  4M78 F;  3S3N A;  2AIR B;  5GAO m;  1NLP C;  5L23 A;  1VQ6 A;  5F3J A;  2EHO D;  4N4I A;  4Y92 A;  3SOL A;  1XQH A;  3OYC A;  2IDO B;  2WS3 A;  3SFD A;  2COZ A;  4BDZ A;  2M1H A;  3ZC1 A;  2OJ2 A;  1LPL A;  1WX6 A;  1HJD A;  2EKO A;  2R58 A;  2JQH A;  2BKO A;  4C0D C;  2BVM A;  2E9X C;  1VQ6 T;  5JDH A;  1BCM A;  3RES A;  5GAN 3;  3HKE E;  4J9H A;  2L3Q A;  3MEA A;  4E7K A;  2EHO A;  3P50 A;  4C92 F;  4EDU A;  2E65 A;  3NPF A;  4BE0 A;  1JEG A;  3AHU A;  1BR4 A;  3ZBD A;  4C92 G;  4BB7 A;  3RIR A;  2D6F A;  5ECA A;  2X9H A;  1NG2 A;  2LCS A;  2NTX A;  5HXR A;  4PLI A;  5AT1 B;  4A4H A;  5L3B B;  4X34 A;  1MMD A;  2E6Z A;  1K0S A;  4MBQ A;  4OYK A;  5GAM e;  3BQK A;  4WBO A;  3CQX C;  2R5A A;  1KF6 A;  2DL4 A;  3GP8 A;  1UUS A;  3WVE B;  4OMO A;  4O5V A;  3F70 A;  5L3F B;  2FPE A;  5LA6 E;  3LLR A;  4C8Q D;  2KZ7 B;  3MK7 C;  1XNI A;  2QDL A;  2LKH A;  2C0T A;  3ZEH A;  2LJL A;  4O4H E;  2MWO A;  3NTI A;  1HG5 A;  1N36 T;  3S6W A;  2EJ9 A;  3AXJ B;  4JS4 A;  2I6H A;  3PTR B;  2QA4 A;  2P9B A;  3AVS A;  3G06 A;  3EVY A;  2KSS A;  2DEQ A;  2LZ6 B;  2Z0W A;  3CME T;  4CN4 A;  4MDW A;  3PUS A;  4KP3 C;  3KV4 A;  3OYF A;  3CC7 Q;  4PNO A;  1KQ2 A;  5J1G A;  1CKA A;  7AT1 B;  3CC4 A;  3CCE Q;  3RHW A;  3LJC A;  4WZX A;  3LYI A;  4H63 V;  2VQE T;  3HPW A;  2OI3 A;  2X4Y A;  2WMO A;  4L59 A;  3P7I A;  3TLU A;  4DEY A;  1X75 C;  3A1P A;  3K8P C;  3HRT A;  4C8Q A;  5L3G B;  4EXT A;  1RAB B;  1WJQ A;  4TUY E;  2CHN A;  2XQ4 A;  2NYS A;  4ELY C;  2QA4 T;  2NTY A;  4OB3 B;  4F7U A;  4JI1 T;  2P84 A;  4XU1 A;  1YHQ Q;  2V8K A;  1E1H B;  3MAC A;  1NLO C;  2A28 A;  2H8H A;  2A3L A;  3EI0 A;  4PK6 A;  3CC4 T;  3N2G E;  1S72 A;  2SRC A;  4ZGD B;  3MJX A;  1RUW A;  2LSY A;  2EYZ A;  3J7Y q;  2QG9 B;  2LQW A;  3QG1 A;  3ONJ A;  1QVF S;  1OX9 A;  4MMK A;  2F2X A;  4EZ4 A;  4CI0 C;  4AG2 C;  3OYK A;  3CK6 A;  4FT2 A;  5AYF A;  1FJG T;  2DIL A;  4EGW A;  1A0N B;  5GAM h;  3FC3 A;  1D1C A;  1RL2 A;  3M56 A;  1S72 T;  2YDL A;  1XZY A;  2XZE A;  3AE4 A;  4YJ2 E;  1N5Z A;  3UPU A;  3OTO T;  4CQI A;  3VYG A;  1UJY A;  5FU6 C;  3UFG A;  2HNI A;  1PSE A;  4OGE A;  2E70 A;  3DTO A;  3CC2 T;  1OX8 A;  3OS2 A;  5I2M A;  2DER A;  2CRB A;  4MFR A;  2LRQ A;  4AQF C;  3NWI A;  1SG5 A;  4M77 B;  3UUN A;  5LP6 E;  4CN1 A;  1VQ8 Q;  2VAS A;  5FMN A;  3CCR T;  5FVK A;  2ZM6 T;  4ILC A;  1YCY A;  3HRU A;  4WYV A;  2FRW A;  3NVO A;  2LJ3 A;  3CCL T;  2BIV A;  1VQL Q;  4N0A A;  3O1J A;  1M3A A;  5D6X A;  5I2S A;  3CD6 A;  5LG3 A;  3I9Q A;  4FU6 A;  1GL5 A;  3S3O A;  4ZI2 D;  1KC8 R;  3GBQ A;  1JRI A;  4J9B A;  3QWY A;  4M7A C;  5KYW B;  3LSV A;  3MO8 A;  1ACM B;  2IG0 A;  1U4Q A;  2YRC A;  1M27 C;  2VV5 A;  4ZTJ A;  2VUR A;  2VB6 A;  5JVD E;  2GF7 A;  2C0O A;  1Q82 C;  1WYX A;  3V7R A;  4G63 A;  4JI0 T;  1G3T A;  4QVZ A;  4A63 B;  4UR9 A;  1X9B A;  2X0Y A;  2CGH A;  2D5U A;  2QQA A;  2QK0 A;  4ZHQ E;  1JJ2 S;  3C98 B;  3JAF A;  3Q5W A;  5GAM g;  1K1Z A;  4ESR A;  2QXF A;  4PFP A;  3OSV A;  4TWF A;  1UGR B;  2CZ6 B;  1PKS A;  3UU3 A;  2E41 A;  4FIB A;  2HQH A;  4NS5 A;  2L0A A;  2I59 A;  5HEG A;  2XKO C;  1QW1 A;  4FYW B;  5AQU B;  2KXD A;  1G3Y A;  1OI1 A;  3EFR A;  3CCJ A;  2OTJ A;  2X9Y A;  1YBY A;  2DRM A;  4TN7 B;  1HX1 B;  3HRS A;  4TX5 A;  2UXN B;  5DJQ C;  1SKU B;  2EAY A;  2XI9 A;  2Y90 A;  1K73 U;  4JLE A;  1T0J A;  4ZS2 A;  2JTM A;  3K3O A;  3URG A;  1RLQ C;  2ZLY A;  2DD4 A;  3H0F A;  8ATC B;  5LJN A;  4YY3 T;  2DD5 A;  1OED B;  2QTV A;  4IE5 A;  1US7 B;  4LE9 A;  4DV1 T;  3CCJ T;  2OLT A;  3EG9 A;  2WSC E;  1CUN A;  3GN5 B;  1WFW A;  2XID A;  1WHH A;  1OXZ A;  4E47 A;  4HVW A;  1SPK A;  2J47 A;  4ZZC A;  1F1B B;  2VYT A;  1EFN A;  3ZSS A;  2AKK A;  5KYX A;  2DJQ A;  1U8R A;  4UIG A;  2DZC A;  1NPP A;  4C90 A;  1WR6 A;  1K8A U;  2KMT A;  5GAO q;  3G4S A;  3GNG A;  1G2B A;  2L9Q A;  1GCP A;  2JVV A;  5J2U E;  3IA3 A;  3CCV A;  2BKN A;  3PUA A;  3H3A A;  3LBX B;  5LB7 B;  3CKD A;  4UVB B;  3MEV A;  4C5I A;  1VQ5 Q;  4YTM A;  5ETW A;  3ZMS B;  4HA8 A;  1U3O A;  2JRK A;  3M0Q A;  4M75 C;  1WQ7 A;  4AFU C;  1YJW Q;  2JZ2 A;  3AAE B;  2J6K A;  3ZKR A;  2JQ9 A;  2QI2 A;  1Y96 A;  4J9D A;  3CCQ A;  1VQO Q;  1GCQ A;  2KT1 A;  2DNU A;  3RKY A;  2E5Q A;  1AEY A;  1RAF B;  2W4X A;  2H3J A;  1IO6 A;  2K5L A;  1YJ9 Q;  4DV2 T;  1Q81 C;  4CZZ B;  4CXX A;  4CI2 B;  4TNV A;  5CQY A;  1I94 T;  3VRB A;  4OB1 B;  2YT6 A;  1M5Q 1;  2HBP A;  5KE2 A;  4RTV A;  1N8R R;  4A56 A;  2KQW A;  4ZN3 A;  1HNX T;  3B13 A;  4CC2 A;  1KG1 A;  2EQI A;  1WNL A;  1VYT A;  4IKF A;  2ACZ A;  2RPA A;  1KC8 U;  4B3R T;  2CP2 A;  4PNI A;  2LNV A;  3TLT A;  2BVL A;  3E22 E;  3L2Z A;  4D8D A;  2RQR A;  1W70 A;  4MDX A;  3AB3 B;  2W0Z A;  4U2Z A;  1YJN Q;  4F7U F;  4H63 H;  1TSF A;  4CRI A;  3AXJ A;  5JH7 E;  4DR7 T;  3K3N A;  4JV5 T;  1X27 A;  2LM9 A;  2CLY C;  4JI6 T;  2J7I A;  3QBY A;  3VS7 A;  1X43 A;  5ADX L;  3BQI A;  3L2R A;  3UQ4 A;  4K0U A;  5HWX A;  3NHN A;  3DB3 A;  3MEW A;  3JCM b;  3KUF A;  3UU4 A;  2XAS B;  4BUG A;  1Q7Y R;  1IZN B;  1HK9 A;  1X01 A;  2M9U A;  3HKS A;  2EQK A;  1R0B G;  1W6X A;  3VUZ A;  1FEW A;  2OX7 A;  1L0V A;  3QPH A;  4YHH T;  2QQR A;  1KEY A;  4M7A G;  4NOY A;  4ME7 A;  4YTL A;  4JZ3 A;  1KHC A;  2XDB A;  4ORZ A;  3TVT A;  4JS5 A;  3JB9 J;  2C06 A;  3CBM A;  2V1Q A;  2E3I A;  3JCM P;  2X66 A;  1QWF A;  1HD3 A;  5LHG B;  3RKW A;  4FSX A;  5DLQ E;  2IML A;  1YW0 A;  1VRB A;  5IHI A;  2RHI A;  2X51 A;  2E5K A;  2I0M A;  2E1H A;  2CH4 A;  1ZV4 X;  2Y4X A;  4PJO C;  5C8Y E;  3VJP A;  4C8Q E;  2LT4 A;  5HEU A;  2BS4 A;  3FXE B;  2FYK A;  4H9O C;  4AXP A;  3FJ5 A;  2RNA A;  4PJM A;  2LT3 A;  3A8M B;  3JRZ A;  5BR8 T;  1I6Z A;  3N5L A;  3QB5 K;  2MTQ A;  2BDE A;  4J7F A;  2WU2 A;  3RIU A;  2HDA A;  4Y28 E;  2VVS A;  1ZHC A;  2PG8 A;  4A4K A;  5HEH A;  3CME Q;  4E7J A;  2H7V C;  3MP6 A;  4Z89 A;  3ONL C;  2W61 A;  5AQN B;  2NR4 A;  3QHS A;  1KQS A;  2KYM A;  1MIV A;  3CC7 A;  4I50 E;  2RK2 A;  3BE3 A;  3P4S A;  4HFV A;  3TKL B;  1WYC A;  2DA9 A;  3CCE A;  3NTH A;  4C0D B;  1MIY A;  4XQ3 A;  3RUX A;  2XPK A;  1NEK A;  2LX7 A;  4NPP A;  1W2B A;  4X1Y E;  5GMK i;  1VQP A;  2A37 A;  2QGF B;  4BY6 B;  1CSK A;  1QVG P;  3G71 Q;  2YDR A;  3L2V A;  2BKP A;  2BS2 A;  2FPD A;  4WF2 A;  2KIN B;  2YN6 A;  1K9A A;  1WR0 A;  1YHQ A;  1X2Q A;  1VQ4 Q;  3CC7 T;  4YSZ A;  4HEA A;  1ZBX A;  4VUB A;  1UGP B;  3RQU A;  1XDO A;  3NMZ C;  3HTR A;  3ESL A;  3L2W A;  3HA4 A;  1R8I A;  5KX5 E;  3SRZ A;  3KVA A;  2M16 A;  3H3M A;  5LHI B;  5EC7 A;  1UCU A;  2DIG A;  4II1 A;  2M51 A;  5F5W A;  1QUU A;  1UEC A;  2RF0 A;  3A98 A;  2JMA A;  5JDG A;  2YOE A;  4DMW A;  1G83 A;  4BI3 A;  2LQK A;  5ABE A;  3RDV A;  1YHQ T;  1O75 A;  3H37 A;  2W2U A;  3OBV E;  1VIE A;  2ZAE A;  4RTU A;  2X0H A;  5AQO B;  3QII A;  3OYY A;  4ZOL E;  4ZI3 D;  2JS0 A;  4M75 G;  5FL1 A;  2FG0 A;  3OYB A;  3CQT A;  3QSU A;  2D0U A;  4L0R A;  3AE2 A;  3MHX A;  4F17 A;  3PUY F;  1KNR A;  2WBL A;  2DTO A;  1VQ7 A;  2M0Y A;  1J1J A;  4DV4 T;  4O4J E;  3VR8 A;  4O8S A;  1IRE B;  4UXN B;  3RC3 A;  2CP7 A;  3G6E A;  1PM3 A;  2PTK A;  4MML A;  3ZT7 A;  4HXJ A;  3I1A A;  3ANW B;  3HL6 A;  4PJJ A;  4ZGJ B;  3CCL Q;  4AI6 A;  1BIB A;  1WHL A;  1WA7 A;  4L9I A;  5JDQ A;  2DFU A;  2DYI A;  4BAC A;  3RPU A;  1VQL A;  3X24 B;  2RHX A;  5CCA A;  4JDS A;  1RAE B;  3ZLI A;  3TSW A;  4DO0 A;  3ZMV B;  1OED A;  2G3R A;  5A2Q E;  4LMK A;  2CSI A;  2VWA A;  1Q86 R;  2D0Q B;  3ZYK A;  4GYS A;  3GN5 A;  1BI0 A;  2EBP A;  4KH0 B;  1VQ8 T;  1IGU A;  3S4U A;  4H9Q C;  2B76 A;  2YRV A;  1HTJ F;  2EPD A;  3JCM f;  4QH4 A;  3CCS T;  4KUM B;  3E0Z A;  2CWY A;  4HCB A;  3OYX A;  4LD6 A;  2H3E B;  3U3I A;  3VS3 A;  2ZZD A;  3JAD A;  3KDS E;  4OF1 A;  1YWO A;  4HWI B;  2B8A A;  2ZPE B;  1VQ9 Q;  2LRK A;  2KMF A;  1M4Z A;  3LBX A;  3NRX A;  5FU6 B;  3AA0 B;  1P92 A;  2DXC A;  4E6R A;  4J9I A;  4BD3 A;  3TCJ A;  1KD1 U;  2DK3 A;  3VS4 A;  5IXF A;  1HF8 A;  4ZI3 C;  2YUP A;  2DO3 A;  3C94 A;  4E7Z A;  1K0X A;  3VKH A;  3AE8 A;  3H6Z A;  4JRQ A;  2K3W A;  3OVU A;  2V7I A;  5AQT B;  1K73 C;  4PKC C;  3I55 A;  2FL7 A;  1Y01 A;  5AQF B;  1V76 A;  4PJO F;  2RO0 A;  2X9X A;  4X5T A;  1SA0 E;  2IC6 A;  4PJO G;  2AZS A;  1RI0 A;  1XDP A;  2XAQ B;  4HKE A;  2ZM8 A;  1E6G A;  3EHZ A;  2KE9 A;  2ZGW A;  3GLX A;  2O4X A;  1HSQ A;  2LHN A;  2JMH A;  3P4P A;  4IIJ E;  4M7A B;  2LEH A;  3PUG A;  1TUG B;  3A8Y C;  1TG0 A;  1OWA A;  2NUT B;  4D6W A;  3GOX A;  4OMQ A;  3JB9 H;  4J6Y A;  2JMK A;  3OKQ A;  4E2F B;  2JQK A;  3J81 E;  1UE9 A;  4QH5 A;  4YHJ A;  2PUK B;  3JB9 D;  2F69 A;  3G7Z A;  3TU4 K;  3M53 A;  2AKL A;  4M7D G;  1K8A C;  1W0B A;  1YQ4 A;  1U1T A;  4OMM A;  5L3E B;  2PZ1 A;  1YIJ Q;  4BJN A;  5KH6 A;  2F2V A;  3MCA B;  1QSD A;  3NKZ A;  3L42 A;  1GBR A;  1H3Z A;  1HS7 A;  4MLK A;  2CDT A;  3QWX X;  3GPL A;  3Q1J A;  3CCM Q;  1VQ5 A;  4QXH B;  4GBQ A;  3AAI A;  4JUY A;  3AE5 A;  3AEB A;  1YIT Q;  4UEL A;  2VXE A;  5LNK A;  5M4Y A;  3KBU A;  5H6Q B;  2KDS A;  2XD0 A;  3TRE A;  2MK5 A;  2QEX Q;  1X2K A;  1X6G A;  2AK5 A;  2N9D A;  2FHD A;  5AQQ B;  1QWE A;  2O9S A;  4JZ4 A;  3UUL A;  2DMO A;  4IUQ A;  1KQS S;  1YI2 Q;  5FL0 A;  3CIR A;  2EQU A;  3VUB A;  4CC7 A;  5J39 A;  1E2A A;  4TWD A;  5AQJ B;  1YJ9 A;  1VUB A;  1TUC A;  2KND A;  4CN6 A;  1WI7 A;  1WJR A;  2DZ9 A;  5EK4 A;  1VYV A;  1FX7 A;  1MND A;  3SDZ A;  5LMN T;  2JPF A;  5IHY A;  4LMJ A;  4OVA A;  3N9M A;  5GAO r;  1IZ6 A;  2P4R A;  4PK4 A;  3ZYL A;  2KYB A;  1LNX A;  4JRP A;  4ZZB A;  1YJW T;  1O9S A;  1QP2 A;  1PKT A;  4C0G A;  1VQO T;  1DU2 A;  2LOS A;  5AQI B;  1KC8 C;  3LGL A;  1Q86 U;  2LQN A;  5FY0 A;  1YJ9 T;  3AE1 A;  3I5S A;  2EGC A;  5AFU L;  2N2N A;  1N9S A;  4LML A;  3TLV A;  2LCC A;  4DR4 T;  3CVR A;  4PAG A;  4EMK C;  1YJN A;  3P8C D;  1FMK A;  1SHZ C;  2XAH B;  4DVD A;  4I4T E;  5JRE A;  2JIW A;  1G5V A;  3FZM B;  3JCM V;  2LSJ A;  1SRL A;  2YUO A;  2L89 A;  4UV9 B;  1ZLM A;  5GON E;  4GLM A;  2PBI A;  3QOF A;  2VUB A;  1HG2 A;  4JI3 T;  2AT1 B;  4M78 G;  4Z90 A;  5AQL B;  4H9P C;  3RBB B;  5KYY B;  5IXB A;  2CP6 A;  4U2Y A;  2FZG B;  2ZPI B;  4QQG A;  2XQ7 A;  1YJN T;  2CMR A;  2MIO A;  2OAW A;  5CQX A;  3VRY A;  1DJ7 B;  3UT1 A;  2DRK A;  3UWN A;  5JQG E;  8AT1 B;  1M1K R;  2HN1 A;  3QKJ A;  5A0D A;  2CUD A;  3PUZ F;  4R56 A;  4QHO A;  1M8V A;  5DM7 R;  2LVM A;  3JCM J;  3DKM A;  2V1D B;  4JEH B;  4YTP A;  4M77 E;  1OU8 A;  2W66 A;  3QZ5 B;  2JQQ A;  4XU3 A;  5KMG P;  3H8Z A;  3REB B;  4HTE A;  1ZSZ C;  3ZEF B;  3VHL A;  2ZPH B;  3LG7 A;  2H88 A;  1KQ1 A;  2A72 A;  2CSQ A;  2VXF A;  4LF5 T;  2DKG A;  2V7M A;  2JM9 A;  4PW8 A;  2MMP A;  3MKD A;  2VKJ A;  1R0C B;  4J2C A;  3K3Q C;  1H92 A;  2K9A A;  1VYU A;  5FXX A;  4TWH A;  4C0Z A;  2CXD A;  1UHF A;  4IDO A;  5J0Z A;  2F4V T;  5CO7 A;  3CME A;  3R6N A;  3PIO A;  1Q95 G;  2H89 A;  4KUD K;  3QNU A;  5EK3 A;  5CFB A;  4HCK A;  4KUL A;  2V8J A;  3FIF A;  4FJO A;  2O01 E;  4DV6 T;  3KV9 A;  4HVV A;  4KRT A;  5GJV B;  3FZH B;  3ANW A;  2RJC A;  4XTV A;  1D0X A;  2V7L A;  4OB2 B;  2YKS A;  2F5T X;  3QK6 A;  1M2V A;  2ABL A;  4EMH A;  2ATC B;  4IUR A;  1IXD A;  4FYX B;  1QCO A;  4YTN A;  5FWC A;  3OPC A;  2OV9 A;  2ZPG B;  2M67 A;  3MP8 A;  5D6Y A;  4EOZ B;  3C4Z A;  2BBH A;  2WDR A;  2BG9 B;  3TLW A;  2EHO C;  4COF A;  2FO0 A;  2C0I A;  1M90 R;  3M0S A;  2V6Y B;  2CBI A;  1BKB A;  3I5R A;  2VVN A;  5KXJ A;  1UG1 A;  1LOJ A;  5C6S A;  4AKL A;  5IN1 A;  2DET A;  1UJ0 A;  5CAI A;  4DV7 T;  1WZO A;  2LHR A;  1KNP A;  4X1V A;  3G71 T;  2L3L A;  3CCU T;  1MGQ A;  3VRZ A;  5GMK l;  2ODV A;  1N8R C;  2EQJ A;  4CC3 A;  1OED E;  4KHP T;  3EAB A;  5ABF B;  1VQ4 T; 
#chains in the Genus database with same CATH homology
 4J7I A;  3RMS A;  3M57 A;  3ZJ1 A;  2DAQ A;  3OYD A;  4M7D B;  2VC8 A;  4U72 A;  4C92 E;  3WXM B;  3CC2 A;  2IC9 A;  4HKA A;  4O4L E;  4IE0 A;  2CM0 A;  3C4X A;  3QC9 A;  2XIC A;  3CCR A;  2WWU A;  5CB4 E;  4O6J A;  3R6O A;  5LJ3 f;  2CXL A;  3N2O A;  3CCL A;  3SWN A;  4X20 E;  5JRC B;  3CML A;  3KVB A;  2DIQ A;  4ILU A;  4UV8 B;  3JCM W;  4C8Q C;  1JB0 E;  2W00 A;  1MMG A;  2RJF A;  4EPC A;  1WPY A;  2H7O A;  4EIW A;  3V7S A;  4UF0 B;  4XU0 A;  3SD4 A;  2VKD A;  5L2L A;  1S35 A;  1M1K U;  2WMN A;  3Q9D A;  3JB9 F;  3ZMZ B;  1XOV A;  4PJL A;  2CA5 A;  5HXC A;  2CZ0 B;  1FXX A;  1NPR A;  4R55 A;  5FU7 B;  4N4G A;  1ZEE A;  2Y6X A;  3GWH A;  3ONX A;  4XTX A;  3A8G B;  2HQE A;  4ASK A;  3J9X 1;  4C5G A;  2K48 A;  1KD1 C;  1YKH B;  2V26 A;  1O3X A;  3CX7 B;  1FIO A;  4Z8X A;  4DBR A;  3M54 A;  2C5K T;  4FI5 A;  1VQ9 T;  5LOV E;  2X4J A;  5EK2 A;  3CPF A;  4M78 B;  4B6X A;  4OB0 B;  3VYH B;  3WI3 A;  3VU3 C;  2QGS A;  4N0A C;  3SB2 A;  4GYR A;  3I9Y A;  3BFM A;  4GY5 A;  5CA0 E;  2IVW A;  3VKI A;  4BE1 A;  3NRY A;  5LJ3 d;  4KBM B;  4CI3 B;  5HKC A;  5C0M A;  3O9X A;  1YIJ A;  3OQ5 A;  3RKX A;  2DHR A;  4OHF A;  5LJM A;  2WSS V;  4C92 B;  2HPJ A;  4KMC A;  1H7C A;  2LSK A;  4ZI2 C;  3C95 A;  1Y64 B;  3CEY A;  2PFV A;  1YIT A;  4F6R C;  4IUU A;  2EFI A;  3QJ6 A;  4RCB A;  4WBN E;  1YIJ T;  2DXT A;  3HKD E;  3OYN A;  4J83 A;  2RM4 A;  4UVC B;  4DA4 A;  3BQL A;  5GAN 4;  5JR9 B;  3CCM T;  4ERR A;  3BW1 A;  4HCC A;  3ZFJ A;  1YIT T;  3V8K A;  1WJS A;  3U78 A;  4BDY A;  2QEX T;  3ZCJ A;  2PVG B;  3UFE A;  2C5J A;  1G3S A;  2CS7 A;  4IST A;  1YI2 T;  4YFS A;  2C5I T;  1HXD A;  1Q86 C;  3E08 A;  2Q9Q B;  2AHJ B;  3RC8 A;  4NL3 A;  4ZS3 A;  3A8O B;  2QQB A;  3PUQ A;  3P8D A;  3KIN B;  1NZ9 A;  4GOU A;  5GAN 6;  3AVR A;  3I0O A;  3FB9 A;  2X0L B;  1QVG A;  4O4I E;  4FM4 B;  4C8Q F;  2ES0 A;  4IE4 A;  5FRM A;  4C8Q G;  2PVD B;  4E7I A;  2K2V A;  2KXP B;  4F7U G;  1QVP A;  5GMK j;  3QXE B;  2M0O A;  3OMC A;  5GAO p;  5EG2 A;  4XTU A;  3JC6 D;  2J1D G;  4L5G A;  2X4W A;  5HK0 A;  2VGM A;  5JDM A;  4QQD A;  3Q5X A;  3BDU A;  3CX8 B;  3I0Q A;  2GCX A;  1PSF A;  3ZYM A;  2B1E A;  4TVR A;  2DLR A;  4UEM A;  3M5A A;  3X26 B;  2ZPF B;  4JUV A;  5LHH B;  1B34 B;  5HXH A;  3LW5 E;  5TAO A;  4BI4 A;  2OAU A;  1NJI U;  1KNZ A;  2IAK A;  5LJ5 f;  3DLL A;  3ER0 A;  4OGC A;  4M77 D;  5LL6 S;  2MAM A;  1ZQ1 A;  4PFO A;  2FVU A;  3PIP A;  5HXS A;  3OSS C;  3N9P A;  4H9N C;  2I2L A;  3DP7 A;  4MZP A;  4IUP A;  3V8L A;  1OZ2 A;  3INZ A;  1M9S A;  3EAE A;  2RHY A;  3CMA T;  2EYQ A;  4XTZ A;  4QVC A;  2RJD A;  3M9Q A;  3A5X A;  2RB6 A;  5CVI A;  3QUJ A;  1WLX A;  2XTL A;  3HFN A;  4M77 A;  3PUR A;  3FBZ A;  2K57 A;  3QYG B;  2MI6 A;  2E9X B;  4DOW A;  4H9R C;  2A2F X;  5JDN A;  4EYY R;  1S94 A;  4JJN K;  4M7A E;  4PJN A;  4BJM A;  2HH7 A;  3V8J A;  3M65 A;  4ZI7 E;  1UX5 A;  3HP9 A;  1N8R U;  2XDD A;  3JCM c;  5KCH A;  3CXC A;  2LT1 A;  1HFA A;  2CZ7 B;  5KCO A;  5FXV A;  4M77 C;  2XAG B;  3LX7 A;  3E9G A;  2DTI A;  2DXB A;  3ZPO A;  2K5F A;  2YLC A;  5LJ5 d;  1EIF A;  3OYG A;  3HR0 A;  3S3M A;  4C92 D;  3PNW C;  4PL6 A;  2PJQ A;  1UB4 A;  1VQ8 A;  4A4E A;  4CXY A;  1M1K C;  1AHJ B;  2XUE A;  3IEE A;  2GFA A;  4IHJ E;  4AKI A;  1FMV A;  3CCS A;  5I21 A;  3OB9 A;  2VKO A;  3O4X E;  1Q7Y U;  3FDR A;  5DLO A;  2DVE A;  1LVK A;  3CBP A;  4A53 A;  2MBG A;  1OZ3 A;  3EFS A;  1M1F A;  2P0P A;  3FJP A;  4C92 A;  4QWN B;  3F31 A;  2LQ8 A;  3GMI A;  2RJE A;  5HWY A;  5LJ5 j;  2XDP A;  2X67 A;  3CQC B;  4QXB B;  4BA9 A;  2Q9Q D;  1HCI A;  3RX6 A;  5LCY A;  2G0U A;  3RKO A;  1QVG S;  3O8V A;  3HKC E;  3UUM A;  1VQK T;  4FL6 A;  3J7A F;  4X9C A;  5LJ3 e;  4M75 E;  3GIB A;  3CBO A;  4DBQ A;  2F5K A;  4BE2 A;  3L2Q A;  4N4H A;  3DB4 A;  2V7K A;  2FB7 A;  2Q9Q A;  3DJB A;  1Y7X A;  3OS1 A;  4B9W A;  4AKR B;  5LXT E;  3WAK A;  4IE7 A;  4E7H A;  1MHN A;  2NW9 A;  3HL8 A;  5DY9 A;  1D1B A;  4NUV A;  3ZJ2 A;  3CPW S;  4IE6 A;  3BDL A;  4AQG A;  2RI2 A;  3KFW X;  4P0A A;  5FXZ A;  5J2T E;  4FT4 A;  1TH7 A;  2C0S A;  2RHZ A;  5LGU B;  1JBM A;  5GMK e;  3LK3 B;  2YEV C;  3V5U A;  4HCZ A;  3CX6 B;  2Y48 B;  3JCM d;  2K4Y A;  2NP9 A;  1I4K 1;  1YJW A;  4LDX A;  1VQO A;  4AKG A;  3C64 A;  2LDM A;  4OMF B;  4JRK A;  3JB9 I;  3NZP A;  5LGN B;  3OA6 A;  2PUO B;  2PVO B;  3MP1 A;  4I43 B;  1B34 A;  3E19 A;  3FBL A;  1I8F A;  4BAY B;  2P0K A;  4EB6 E;  4PJO E;  3IBP A;  2Z6E A;  5HK3 A;  3LGF A;  5E0O A;  2V8I A;  5FP3 A;  4M77 F;  3RH3 A;  1SSF A;  2YIN A;  3C4W A;  2E9X D;  2QA7 A;  3PDY A;  3NZQ A;  2R57 A;  5GAO n;  5CKB A;  5FLX E;  2MYS A;  2KWH A;  4NUU A;  3I56 A;  2VK9 A;  2GFU A;  1V29 B;  2YLB A;  3ETV A;  3LK2 B;  3ME9 A;  4M7D E;  2SPC A;  3PTA A;  2XG8 D;  3CXC S;  2JN0 A;  2RP4 A;  5L3C B;  2LOP A;  4M75 B;  2QQ9 A;  3FRN A;  1BYM A;  4C5E A;  4QQ6 A;  5GMK h;  2E9X A;  4PK5 A;  2WSE E;  3I56 T;  2VKH A;  3ZC0 A;  3PT9 A;  5GAN 5;  2BKD N;  2DJZ A;  1HX8 A;  5LJ3 g;  2WAU A;  3QZ9 B;  1D3B B;  2CXF A;  3LFM A;  3FXD B;  4QXC B;  5KDM C;  3AA1 B;  1NJI C;  1N6A A;  3JSC A;  1B7T A;  4ZTF A;  2RI3 A;  3O1H A;  3GNF B;  4JEU B;  5GAN 7;  2YU2 A;  1NWM X;  1MMA A;  2ZCF B;  2VGN A;  1I81 A;  4I55 E;  5GAN f;  2GK9 A;  1MMN A;  3A8L B;  1Y96 B;  4YJ3 E;  2K3Y A;  2CLY B;  4GIW A;  2RHU A;  2ODU A;  2CYZ B;  2L3R A;  3LWI A;  4BY6 C;  5FRN A;  5FY7 A;  2YK0 A;  3KXT A;  3IF8 B;  5CKE A;  2EQM A;  4E7S A;  3RMQ A;  1UX4 A;  2CCQ A;  5FY1 A;  4IUV A;  3CCU A;  3G71 A;  4M78 E;  3UDC A;  2LSI A;  4CXW A;  5M9O A;  1VQ4 A;  3HSB A;  4MZM A;  4ELZ C;  5H6R B;  2WAC A;  2X4X A;  4EMG A;  4PJO B;  3B57 A;  4QX8 B;  3CQG B;  5GMK m;  2JJ9 A;  3GA8 A;  5LJ5 e;  3F2E A;  1G73 A;  1VQM A;  4WNK A;  4U74 A;  1LJO A;  3KV6 A;  5IAY A;  1AJ3 A;  4M7A D;  4XU2 A;  3PFS A;  1VQN A;  4JLI A;  4AQF A;  3N9Q A;  2E8I A;  3V7C A;  4M1P A;  5L3D B;  1VQM T;  1NAF A;  2BUD A;  2KT9 A;  3SS1 A;  3IHR A;  3OBW A;  5GAN d;  1Q7Y C;  2KVQ G;  1T98 A;  1VQN T;  4UC4 A;  4M7A A;  3UTK A;  3UUX B;  3O1I A;  3V5S A;  5CIU A;  4XTW A;  3P8B B;  3PMT A;  3JB9 G;  5HY6 A;  5CKD A;  3HKB E;  3VKG A;  3MEU A;  1BI3 A;  2H3R A;  2RA1 A;  2V7J A;  5D6W A;  2CKK A;  3C51 A;  4EYU A;  1QP3 A;  1VQ9 A;  3E9F A;  2XAJ B;  2LE8 A;  2LC4 A;  4O2A E;  2NW8 A;  3PU3 A;  3R84 B;  3L3P A;  4DQ2 A;  5LJ5 h;  3HHT B;  3SWN C;  4V1A v;  4YLH A;  5GAN j;  3N5B B;  4ZGE B;  2X35 A;  2ZM2 A;  2JUF A;  4KUI A;  2HPL A;  3QYH B;  1LKX A;  4C5H A;  2XAF B;  3M58 A;  5FRO A;  2YU1 A;  4WW0 A;  2EJG A;  4TZ4 C;  4GK5 E;  2D9T A;  3OW2 A;  3NTK A;  3CD6 T;  2NW7 A;  1X6O A;  2ZM0 A;  2DI4 A;  3N9L A;  4OFZ A;  4TV9 E;  3J80 E;  1UGS B;  4M75 D;  4L6V 5;  1UEB A;  1Y71 A;  2RK1 A;  1M90 U;  2P4T A;  3AAA B;  1K9M U;  4P09 A;  3HI2 A;  3JCM e;  2EIF A;  4PLL A;  5FYM A;  3HFO A;  2MWP A;  3N9N A;  2RA2 A;  5LJ5 g;  3CCM A;  4J8O A;  2E6N A;  4M75 A;  2NWB A;  1M1G A;  3OYH A;  5IT9 E;  2QEX A;  1YI2 A;  4J6X A;  2OTJ T;  1Y07 A;  5F8P A;  3FHN A;  2K3X A;  3OYZ A;  1UGQ B;  3ZMU B;  1D3B A;  5LJ3 j;  3GF5 A;  3MET A;  4RG8 A;  2Y4Y A;  2LSG A;  4RG2 A;  2CWO A;  3LK4 2;  5KE3 A;  4ISS A;  2E10 A;  1BR2 A;  3EUH A;  2K5B B;  5L8R E;  2JTF A;  2RH2 A;  2ZMA A;  4V2S A;  1VIF A;  2GQV A;  4A4F A;  3PGG A;  4HGA A;  4OYJ A;  3ZMT B;  3X20 B;  2CEA A;  3NBX X;  4UVA B;  2KLQ A;  3G4S T;  2DWK A;  4XZC A;  2LTO A;  3MA9 A;  1IJ5 A;  4E7L A;  3CCV T;  3A8H B;  3JCM h;  2MOZ A;  4KT0 E;  2CZ1 B;  4PJO D;  3VU7 H;  1OYX A;  4CI1 B;  4JRI A;  1WGS A;  2O4X B;  1KHI A;  2A3D A;  1Z0P A;  5DQV A;  3RYC E;  1VOM A;  1WQW A;  2X9W A;  3CCQ T;  2CE7 A;  2OTL A;  2D0T A;  3MZK B;  4N78 D;  4M7D D;  5GAM f;  4PJO A;  3OJA A;  3OYL A;  2XK0 A;  2MF2 A;  1WYB A;  2WM9 A;  3CPZ A;  4RCC A;  1YKE B;  2JNG A;  2L8D A;  3L09 A;  2OTL T;  3UT5 E;  4J5Y A;  3EDU A;  3VV0 A;  3RYH E;  1BR1 A;  4B9X A;  4EMK B;  3OYE A;  3EDV A;  2K5I A;  3BY7 A;  1D1A A;  3FLG A;  3CPW A;  4M7D A;  3OY9 A;  3CMA A;  2WSF E;  3OS0 A;  4JLG A;  4EZH A;  2BZB A;  4M7A F;  4HE8 A;  2EJF A;  2W0G A;  2EWN A;  3JCM g;  3OMG A;  2R5M A;  4TV8 E;  1I5L A;  4P0B A;  4RMO A;  3LH0 A;  5JRC A;  1BI1 A;  3T9N A;  4MHC A;  4NL2 A;  5GAN 2;  2RD1 A;  2NLU A;  3N2K E;  1BIA A;  4J6W A;  3I9W A;  4F7U E;  2XHC A;  4UF0 A;  3OYJ A;  3Q2M A;  3L1A A;  4G2A A;  2A7Y A;  4HT9 A;  2KAF A;  1YD8 G;  4HN9 A;  1LVF A;  3JC6 C;  5LBM A;  3OW2 S;  1G3W A;  5CA1 E;  4M7D C;  5IYZ E;  3RRC A;  3C4S A;  2P0Q A;  3OBY A;  3X28 B;  5GAN 8;  2DWG A;  4XBF B;  5JDF A;  2ZPB B;  4M78 D;  2Y8D A;  3RRW A;  2IW5 B;  3ZCI A;  4Q5W A;  5GAM d;  4X1I E;  3AA6 B;  5GAN e;  2XQY A;  1BI2 A;  2VL8 A;  5J3B A;  5CK9 A;  2YHT A;  2LX9 A;  3RYI E;  4A54 A;  3CCE T;  3M4Y A;  4QVD A;  4M78 A;  4GK0 E;  2KWI B;  1VQP T;  2DXU A;  3PE0 A;  3P8H A;  2EHO B;  4LDY A;  4LD9 K;  3C50 A;  3NFC A;  1GXI E;  1R8O B;  4X9D A;  3KV5 A;  3M59 A;  4M75 F;  4XAX B;  2NOX A;  1X79 A;  4EAH A;  5FU7 C;  4IGU A;  5A1L A;  4O2B E;  5LG4 A;  5GAM j;  3A5Z B;  2D2S A;  4XTY A;  4ANJ A;  4DND A;  3AA7 B;  2E12 A;  3JAM E;  2OA5 A;  1VQK A;  3SWH A;  3KBG A;  3DLM A;  4LDW A;  3W15 B;  4M78 C;  2K24 A;  4ZN1 A;  1VQ7 T;  4QW2 A;  4HT8 A;  2XU8 A;  1XTD A;  4ADZ A;  3G6E T;  1EZ3 A;  1LRZ A;  1N27 A;  5GAN h;  2DCF A;  5LYJ E;  3RYF E;  3OYM A;  5JR9 A;  4C8Q B;  2QDY B;  3JCM X;  4OP0 A;  1VQL T;  3FB2 A;  4F7U B;  2KY9 A;  5HYA A;  2E64 A;  3L2U A;  3TEE A;  1BR0 A;  4X1K E;  5HXE A;  5A0G A;  3RER A;  5JDL A;  3CWZ B;  3KBT A;  4A4G A;  1M90 C;  4C92 C;  3M4G A;  1Q82 U;  1K9M C;  2DNX A;  3WAJ A;  1ZKE A;  5BMV E;  2W62 A;  4LDV A;  1KK7 A;  1N9R A;  3D0T A;  3SWN B;  2PU9 B;  5CR2 A;  4XK8 E;  2QTX A;  2JOY A;  2W63 A;  4Y91 A;  1IJ6 A;  3PU8 A;  3T8O A;  4H9S E;  1D0Z A;  3ETU A;  5JR9 C;  4MAL A;  5LGT B;  3F57 A;  3LWH A;  5GAN g;  4DOV A;  2PQW A;  3OYI A;  2HD0 A;  3I55 T;  4M7D F;  4C91 A;  2Q9Q C;  1U5P A;  1QVF A;  3WVD B;  1W4S A;  5EZY E;  4C0F A;  5CKH A;  4P5N A;  4QKN A;  4GLK A;  3QUI A;  1FWZ A;  5LJ3 h;  2L8K A;  2KK4 A;  3OYA A;  2N1G A;  2XHE B;  1MNE A;  1U1S A;  4BI8 B;  4EMK A;  3OS5 A;  2HQX A;  4QX7 B;  3E1S A;  3QO3 A;  5FNV E;  3JCM Q;  2LCL A;  3QJY A;  3X25 B;  5FXW A;  4M77 G;  1NE8 A;  3ZN1 B;  1WRD A;  2QQS A;  4LDU A;  2X68 A;  2L5Q A;  4RKU E;  1W2B S;  1VQ5 T;  3PMI A;  4IDZ A;  1ZHI A;  2UXX B;  4DMV A;  3ASK A;  1FMW A;  3BK9 A;  4AKH A;  2DPP B;  5DAB A;  4Z02 A;  1V9D A;  3QDR B;  4OK0 A;  1Q81 U;  1G8X A;  1MIW A;  5CKF A;  2DTH A;  5HAX A;  4MZT A;  3MXZ A;  1D0Y A;  5DQW A;  3ZN0 B;  3SFM A;  4IUT A;  1H64 1;  5A0L A;  2RI5 A;  3N9O A;  5J26 A;  1JJ2 A;  5LBQ B;  2ACX A;  2HAX A;  1IAP A;  5GAO l;  3FEO A;  3M55 A;  4ATO A;  4M78 F;  3S3N A;  5GAO m;  1VQ6 A;  5F3J A;  2EHO D;  4N4I A;  3SOL A;  1XQH A;  3OYC A;  4BDZ A;  2M1H A;  3ZC1 A;  2EKO A;  2R58 A;  4C0D C;  2BVM A;  2E9X C;  1VQ6 T;  5JDH A;  3RES A;  5GAN 3;  3HKE E;  3MEA A;  4E7K A;  2EHO A;  4C92 F;  4EDU A;  2E65 A;  4BE0 A;  3AHU A;  1BR4 A;  3ZBD A;  4C92 G;  4BB7 A;  3RIR A;  2D6F A;  2X9H A;  2NTX A;  5HXR A;  4PLI A;  4A4H A;  5L3B B;  4X34 A;  1MMD A;  2E6Z A;  4MBQ A;  4OYK A;  5GAM e;  3BQK A;  4WBO A;  3CQX C;  2R5A A;  3GP8 A;  3WVE B;  4O5V A;  3F70 A;  5L3F B;  3LLR A;  5LA6 E;  4C8Q D;  2KZ7 B;  3MK7 C;  1XNI A;  3ZEH A;  2LJL A;  4O4H E;  2MWO A;  3NTI A;  1HG5 A;  3S6W A;  2EJ9 A;  4JS4 A;  3PTR B;  2QA4 A;  2P9B A;  3AVS A;  3EVY A;  2KSS A;  2DEQ A;  3CME T;  4MDW A;  3PUS A;  4KP3 C;  3KV4 A;  3OYF A;  4PNO A;  1KQ2 A;  5J1G A;  3CC4 A;  3LJC A;  3LYI A;  4H63 V;  3HPW A;  2X4Y A;  2WMO A;  4L59 A;  3P7I A;  1X75 C;  4C8Q A;  3K8P C;  3HRT A;  5L3G B;  4EXT A;  1WJQ A;  4TUY E;  4ELY C;  2QA4 T;  2NTY A;  4OB3 B;  4F7U A;  4XU1 A;  2V8K A;  1E1H B;  3MAC A;  2A3L A;  4PK6 A;  3CC4 T;  3N2G E;  1S72 A;  4ZGD B;  3MJX A;  2LSY A;  3J7Y q;  3QG1 A;  1QVF S;  4MMK A;  4EZ4 A;  4CI0 C;  3OYK A;  4FT2 A;  5AYF A;  5GAM h;  3FC3 A;  1D1C A;  1RL2 A;  3M56 A;  1S72 T;  3UPU A;  4YJ2 E;  4CQI A;  3VYG A;  5FU6 C;  2HNI A;  1PSE A;  4OGE A;  2E70 A;  3DTO A;  3CC2 T;  3OS2 A;  5I2M A;  4MFR A;  2LRQ A;  4AQF C;  4M77 B;  3UUN A;  5LP6 E;  2VAS A;  5FMN A;  3CCR T;  1YCY A;  3HRU A;  3CCL T;  2BIV A;  4N0A A;  3O1J A;  5D6X A;  5I2S A;  3CD6 A;  4FU6 A;  3S3O A;  4ZI2 D;  1JRI A;  4M7A C;  3MO8 A;  2IG0 A;  1U4Q A;  2VV5 A;  4ZTJ A;  2VB6 A;  5JVD E;  2GF7 A;  1Q82 C;  3V7R A;  4G63 A;  1G3T A;  4QVZ A;  2CGH A;  2D5U A;  4ZHQ E;  1JJ2 S;  3C98 B;  3Q5W A;  5GAM g;  2QXF A;  4PFP A;  3OSV A;  1UGR B;  2CZ6 B;  2E41 A;  4FIB A;  4NS5 A;  2I59 A;  2XKO C;  1QW1 A;  1G3Y A;  1OI1 A;  3EFR A;  3CCJ A;  2OTJ A;  2X9Y A;  1YBY A;  4TN7 B;  3HRS A;  4TX5 A;  2UXN B;  5DJQ C;  2EAY A;  2XI9 A;  1K73 U;  2Y90 A;  4JLE A;  4ZS2 A;  2JTM A;  3K3O A;  3URG A;  2ZLY A;  2DD4 A;  5LJN A;  2DD5 A;  4IE5 A;  1US7 B;  3CCJ T;  2WSC E;  1CUN A;  3GN5 B;  2XID A;  1OXZ A;  4E47 A;  2VYT A;  1U8R A;  4UIG A;  2DZC A;  1NPP A;  4C90 A;  1WR6 A;  1K8A U;  2KMT A;  5GAO q;  3G4S A;  3GNG A;  2L9Q A;  2JVV A;  5J2U E;  3CCV A;  3PUA A;  3H3A A;  3LBX B;  3CKD A;  4UVB B;  3MEV A;  4C5I A;  3ZMS B;  5ETW A;  4HA8 A;  2JRK A;  4M75 C;  1WQ7 A;  2JZ2 A;  3AAE B;  2QI2 A;  1Y96 A;  3CCQ A;  3RKY A;  2E5Q A;  2H3J A;  2K5L A;  1Q81 C;  4CZZ B;  4CXX A;  4CI2 B;  5CQY A;  4OB1 B;  1M5Q 1;  2HBP A;  5KE2 A;  4A56 A;  2KQW A;  4ZN3 A;  3B13 A;  1KG1 A;  1WNL A;  4IKF A;  1KC8 U;  4PNI A;  2LNV A;  2BVL A;  3E22 E;  3L2Z A;  4MDX A;  3AB3 B;  4F7U F;  4H63 H;  4CRI A;  5JH7 E;  3K3N A;  2LM9 A;  2CLY C;  3QBY A;  5ADX L;  3BQI A;  3L2R A;  4K0U A;  5HWX A;  3JCM b;  3DB3 A;  3MEW A;  3KUF A;  2XAS B;  4BUG A;  1IZN B;  1HK9 A;  1X01 A;  2M9U A;  3HKS A;  2EQK A;  3VUZ A;  1FEW A;  3QPH A;  2QQR A;  4M7A G;  4NOY A;  4ME7 A;  4YTL A;  1KHC A;  2XDB A;  4JS5 A;  3JB9 J;  2C06 A;  3CBM A;  3JCM P;  2X66 A;  5LHG B;  3RKW A;  4FSX A;  5DLQ E;  1YW0 A;  1VRB A;  2RHI A;  2X51 A;  2E1H A;  2Y4X A;  1ZV4 X;  4PJO C;  5C8Y E;  3VJP A;  4C8Q E;  2LT4 A;  3FXE B;  2FYK A;  4H9O C;  4AXP A;  4PJM A;  2LT3 A;  3A8M B;  3JRZ A;  3N5L A;  2MTQ A;  2BDE A;  4J7F A;  4Y28 E;  1ZHC A;  2PG8 A;  4A4K A;  4E7J A;  2H7V C;  3MP6 A;  2W61 A;  1KQS A;  3QHS A;  1MIV A;  3CC7 A;  4I50 E;  2RK2 A;  4HFV A;  3TKL B;  1WYC A;  3CCE A;  3NTH A;  4C0D B;  1MIY A;  4XQ3 A;  3RUX A;  1W2B A;  4X1Y E;  5GMK i;  1VQP A;  4BY6 B;  3L2V A;  4WF2 A;  2KIN B;  1YHQ A;  3CC7 T;  4HEA A;  1ZBX A;  4VUB A;  1UGP B;  3ESL A;  3L2W A;  3HA4 A;  5KX5 E;  3SRZ A;  3KVA A;  2M16 A;  5LHI B;  1UCU A;  2DIG A;  4II1 A;  1QUU A;  5JDG A;  4BI3 A;  4DMW A;  2LQK A;  1YHQ T;  1O75 A;  3H37 A;  3OBV E;  1VIE A;  3QII A;  3OYY A;  4ZOL E;  4ZI3 D;  4M75 G;  3OYB A;  3QSU A;  2D0U A;  4L0R A;  3MHX A;  2WBL A;  2DTO A;  1VQ7 A;  4O4J E;  4O8S A;  1IRE B;  4UXN B;  3RC3 A;  3G6E A;  4MML A;  3I1A A;  3ANW B;  3HL6 A;  4PJJ A;  4ZGJ B;  4AI6 A;  1BIB A;  4L9I A;  5JDQ A;  4BAC A;  3RPU A;  1VQL A;  3X24 B;  2RHX A;  5CCA A;  4JDS A;  3ZLI A;  4DO0 A;  3ZMV B;  2G3R A;  5A2Q E;  2VWA A;  2D0Q B;  3ZYK A;  4GYS A;  3GN5 A;  1BI0 A;  1VQ8 T;  3S4U A;  4H9Q C;  2YRV A;  1HTJ F;  3JCM f;  3CCS T;  4KUM B;  3E0Z A;  2CWY A;  4HCB A;  3OYX A;  4LD6 A;  3U3I A;  2ZZD A;  3KDS E;  4OF1 A;  2B8A A;  2ZPE B;  2KMF A;  1M4Z A;  3LBX A;  3NRX A;  5FU6 B;  3AA0 B;  1P92 A;  2DXC A;  4BD3 A;  3TCJ A;  1KD1 U;  2DK3 A;  1HF8 A;  4ZI3 C;  2DO3 A;  3C94 A;  4E7Z A;  3VKH A;  3H6Z A;  4JRQ A;  2V7I A;  1K73 C;  4PKC C;  3I55 A;  2FL7 A;  4PJO F;  2RO0 A;  2X9X A;  1SA0 E;  2IC6 A;  4PJO G;  1RI0 A;  2XAQ B;  4HKE A;  2ZM8 A;  2ZGW A;  3GLX A;  2O4X A;  2LHN A;  2JMH A;  4M7A B;  4IIJ E;  2LEH A;  3PUG A;  1OWA A;  4D6W A;  3GOX A;  3JB9 H;  4J6Y A;  2JMK A;  3OKQ A;  3J81 E;  4YHJ A;  2PUK B;  3JB9 D;  2F69 A;  3G7Z A;  3TU4 K;  3M53 A;  4M7D G;  1K8A C;  1U1T A;  5L3E B;  4BJN A;  5KH6 A;  3MCA B;  1QSD A;  3L42 A;  1H3Z A;  1HS7 A;  4MLK A;  3GPL A;  3Q1J A;  1VQ5 A;  4QXH B;  3AAI A;  4JUY A;  4UEL A;  2VXE A;  5LNK A;  5M4Y A;  3KBU A;  5H6Q B;  2KDS A;  2XD0 A;  3TRE A;  2FHD A;  2N9D A;  1KQS S;  3UUL A;  4IUQ A;  3VUB A;  2EQU A;  5J39 A;  1YJ9 A;  1VUB A;  2KND A;  1WJR A;  2DZ9 A;  5EK4 A;  1FX7 A;  1MND A;  3SDZ A;  2JPF A;  5IHY A;  4OVA A;  3N9M A;  5GAO r;  1IZ6 A;  4PK4 A;  3ZYL A;  1LNX A;  4JRP A;  1YJW T;  1O9S A;  1QP2 A;  4C0G A;  1VQO T;  2LOS A;  1KC8 C;  3LGL A;  1Q86 U;  1YJ9 T;  5FY0 A;  5AFU L;  2N2N A;  1N9S A;  2LCC A;  3CVR A;  4PAG A;  4EMK C;  1YJN A;  3P8C D;  1SHZ C;  2XAH B;  4DVD A;  4I4T E;  5JRE A;  1G5V A;  3JCM V;  2LSJ A;  2L89 A;  4UV9 B;  5GON E;  2PBI A;  2VUB A;  1HG2 A;  4M78 G;  4H9P C;  2ZPI B;  4QQG A;  1YJN T;  2CMR A;  5CQX A;  1DJ7 B;  3UT1 A;  3UWN A;  5JQG E;  3QKJ A;  5A0D A;  1M8V A;  4R56 A;  4QHO A;  5DM7 R;  2LVM A;  3JCM J;  3DKM A;  2V1D B;  4JEH B;  4M77 E;  4XU3 A;  3QZ5 B;  2JQQ A;  5KMG P;  3H8Z A;  4HTE A;  3ZEF B;  3VHL A;  2ZPH B;  3LG7 A;  1KQ1 A;  2A72 A;  2VXF A;  2DKG A;  2V7M A;  2MMP A;  4PW8 A;  3MKD A;  2VKJ A;  4J2C A;  3K3Q C;  2K9A A;  5FXX A;  4C0Z A;  2CXD A;  5CO7 A;  3CME A;  3R6N A;  3PIO A;  4KUD K;  5EK3 A;  4KUL A;  2V8J A;  3FIF A;  4FJO A;  2O01 E;  3KV9 A;  3ANW A;  2RJC A;  4XTV A;  1D0X A;  2V7L A;  4OB2 B;  2F5T X;  3QK6 A;  4EMH A;  4IUR A;  2ZPG B;  2M67 A;  3MP8 A;  5D6Y A;  4EOZ B;  3C4Z A;  2EHO C;  1BKB A;  5C6S A;  1LOJ A;  4AKL A;  5IN1 A;  5CAI A;  2LHR A;  3CCU T;  3G71 T;  2L3L A;  1MGQ A;  5GMK l;  2ODV A;  1N8R C;  2EQJ A;  2QQA A;  3C12 A;  1VQ4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...