3A7MA

Structure of flit, the flagellar type iii chaperone for flid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
TSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQSTRQKSLNNAYGRLSGMLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the regulatory mechanisms of interactions of the flagellar type III chaperone FliT with its binding partners.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation, chaperone
molecule keywords Flagellar protein fliT
total genus 41
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3a7mA01
3NKZA 3H3MA 3A7MA
chains in the Genus database with same CATH superfamily
5E0OA 5FMNA 5LHIB 1HNZT 2ODVA 4A56A 4JLEA 1G73A 4Z8XA 3P4WA 4TWHA 3IF8B 2HPLA 3ZN1B 4IL4A 5JDFA 3PUSA 5C8YE 4DV1T 2L8KA 3RGLA 1UURA 2BVMA 2J47A 5HXEA 3RRWA 2CMRA 3A7MA 2VL0A 2XASB 3DJBA 3ONJA 3PJAJ 4TV8E 4DMWA 3OYZA 2Q9QC 4AKLA 5JDQA 4JI7T 3RYCE 5JRCA 4QXCB 2MAWA 3EAMA 3GN5B 3LG7A 4MLKA 4O4LE 2JQ9A 3HI2A 4KI0F 2QA7A 3OJAA 3J9X1 4DIDB 4CZZB 3LDQB 3Q5WA 4H9NC 5JR9C 3AE7A 4ZI2C 3BQKA 3PJAA 2XAGB 4GIWA 3RYIE 4COFA 3RX6A 4ZHQE 2UXBT 3LK2B 4X1IE 2JQKA 1T8BA 3JC6D 3SFDA 4QX8B 3I0OA 5F5WA 4AIUA 3ZMUB 1US7B 5HCMA 2AE9A 4LMJA 4C90A 3EHZA 2CHNA 2V7LA 3M3ZB 3NRYA 4H9SE 1N33T 1SE7A 3ZPOA 5FXWA 2VB6A 1KNZA 3CVRA 1E2AA 4YJ3E 3UUBA 1VCTA 4ILCA 2J1DG 2XUEA 2YDQA 2YOEA 2W63A 2MTQA 4QKNA 5AQPB 1QSDA 4HWIB 2MBGA 3LK42 3I9WA 2AXDS 1ZOYA 4TUYE 4LF8T 3UFEA 1U4QA 3E22E 3J7Yq 5JDHA 4DUZT 3CPZA 1ZV4X 4AQFC 2CXLA 4AQYT 5AQHB 3N2KE 2V7IA 4EEDA 2IC6A 1XNQT 2E8IA 2H89A 2PJQA 1MIWA 2VL8A 3CX7B 5EK2A 5L2LA 1IAPA 2R6GF 3L8RA 3PUQA 4GYRA 4IDZA 3AA6B 4L5GA 5FL1A 1WFDA 2JRKA 3OKQA 2JMKA 4A5XA 1IBKT 1XDPA 3OBVE 3FXDB 1IBMT 2LJLA 1FJGT 2XQYA 3CIRA 4I0UA 3MA9A 1UX4A 5CGMA 4JI6T 1ZHCA 4AKIA 4TWFA 2YDRA 2D2SA 3N9LA 2WAUA 3P4QA 2Q9QB 4HFHA 4X5TA 2E5LT 2A72A 4ZZCA 5L3CB 1IBLT 4LF9T 4YSZA 1KK7A 1UCUA 5LA6E 3P4PA 3TLUA 2V7MA 3F31A 3ZYLA 4O4IE 3VRAA 4DR7T 1XDOA 3GA8A 2NP9A 1N34T 5LGUB 4QWNB 2FJEA 1FMVA 2DHRA 3AXJB 2WY2A 2IC9A 4DR1T 2XM2A 3QB5A 3EABA 3I1AA 3UU4A 4BA9A 2LRLA 5J2TE 4B6XA 4PFPA 3CMLA 2X0HA 3FHNA 3PUYF 2XY8B 1WRDA 1J5ET 2HHHT 1M62A 2WM9A 5HWXA 3RI5A 3ZCJA 4GKJT 5JRCB 3U3IA 4DV0T 3ZC0A 1LRZA 2A2FX 4WW0A 3RYFE 2H88A 4WNKA 3AEAA 2W4XA 2X9YA 2D9DA 4ZI2D 1MNEA 4AKGA 2PFVA 3AXJA 1ZEEA 3V5SA 2YU1A 4CXYA 2JQHA 4U2ZA 3AVRA 1IJ5A 5FVKA 4GKKT 4F8HA 1CHUA 5LOVE 4EZ4A 2BKNA 4E7ZA 3NWIA 2H7VC 4U72A 3UQ7A 3AA1B 3KINB 4IIJE 2D0UA 3ANWA 4WYVA 2BS2A 2KXPB 4YHHT 1AJ3A 2CM0A 2IAKA 2K5BB 3RQUA 4Z91A 4DO0A 2E9XC 2WMNA 2N1GA 3IA3A 2GK9A 3CX6B 2UXXB 1MMGA 4HFBA 4TWDA 5FL0A 1G8XA 2DWGA 3L39A 3WI3A 3HKEE 3QC9A 4DVDA 2DWKA 2ZM2A 3AA7B 4YLHA 4ZI3C 3UU3A 2V8SV 4QH1A 3AEEA 4P1NA 5AQSB 5HEUA 3P50A 3PTRB 3P4SA 5AQUB 5ABGA 2MOZA 4UIGA 3RIUC 5JREA 3N9OA 3UUMA 1YKEB 3O4XE 4NIQA 2WB5A 4DV2T 2BG9B 2L3LA 2LOPA 3Q2MA 4JI2T 4ZXLA 3C51A 3PURA 5AQGB 2VVSA 3LBXB 2CA5A 3PU8A 4O2AE 2BG9E 4HEAA 4UV9B 5FY0A 2W00A 3RKGA 4DBRA 2LE8A 5FXXA 2BKPA 5LG3A 3PDYA 4ILUA 4HWDA 2PTFA 3RF1A 2J62A 4X62T 3T1YT 3MKDA 5LNKA 4ZZBA 5L3BB 1E1HB 4DUYT 5JDLA 5IUXA 2XZEA 1YW0A 2WS3A 3PUGA 4AQFA 5H6QB 3AEBA 4UV8B 4CXWA 2NTYA 1MMDA 1D0XA 4LF7T 3TKLB 4NXNT 2NWBA 1T72A 1IZNB 2IIUA 5LBQB 3UU5A 3QUJA 5AQMB 1S94A 3O1JA 4TNVA 5HCJA 3TLSA 3ESLA 2D5UA 4UF0A 5FXZA 2LSKA 3PE0A 3QOFA 2UU9T 2E2AA 2ZM0A 2F4VT 3AE6A 3RIFA 5HWYA 4IE7A 4ZOLE 3WAJA 3D0TA 5KDMC 1KNPA 3KFWX 2XAHB 3ZC1A 2V5DA 2BVLA 2J4GA 2VWAA 3AECA 4HFCA 4PFOA 3I9YA 1BR4A 2Y8DA 4CN1A 2V26A 3VKHA 4O2BE 4TN7B 3ZT7A 2BS4A 2WCAA 2CRBA 1V9DA 4I50E 4HFVA 5LYJE 1E7PA 2CXDA 1UUSA 1BR0A 3ZEFB 3ZMZB 1T98A 2LM2A 2CWYA 2JIWA 1B7TA 3KV5A 3SOLA 4I55E 4DV3T 2V5CA 4P0AA 3UTKA 3HKBE 4ISTA 4WBNE 4YSYA 1NENA 1D1AA 4HFDA 2W66A 5LCYA 1XNRT 1W0AA 2Y48B 4HWFA 1WR6A 4UXNB 1MIVA 1HX8A 2WU5A 2Z6EA 2YN6A 4LFAT 4IREA 4K0UA 3JADA 1I94T 3NKZA 2W62A 3FZMB 2I59A 3H3MA 4B3RT 4U33A 3NBXX 2OV9A 3P7IA 1WLXA 4HWHA 3C64A 2PBIA 4UVCB 3SRZA 2XQ7A 4LMKA 3Q5DA 3OPCA 1UK5A 2KT9A 3QNUA 2KLQA 5TAOA 5J0ZA 1ZKEA 1FMWA 3AE5A 5BMVE 5ABEA 5LMNT 4DV7T 1Y01A 1LVFA 1GQEA 2VKJA 2CBIA 4AKRB 3EDVA 3QK6A 5L4EA 1LKXA 5AQJB 1YXRA 4HKAA 1UGOA 2YKSA 2SPCA 1D0ZA 4JEHB 2WDRA 1J1JA 2X0LB 3AE3A 2CE7A 4IE5A 2VKHA 5GONE 4IDNA 2BG9A 2KWIB 1MMAA 3AEDA 4U2YA 3VKGA 2EHOD 2IMLA 2ODUA 4H63V 5ABHA 1NEKA 3LBXA 3KBUA 5LGTB 2LSGA 4H9QC 5DABA 5AQNB 3PUAA 5KMGP 3CQGB 4X1KE 4AQGA 4DR3T 3EI0A 1IJ6A 4YTMA 5HEOA 3RIUA 3Q5XA 3VU7H 5H6RB 2MYSA 2V7KA 3EVYA 5L3FB 2XPKA 4OYJA 3PUVF 2HH7A 5J1GA 1FEWA 3CKDA 2XAQB 4YFSA 3LFMA 3H3AA 4ADZA 2XQ9A 4BAYB 5AQLB 4ZEYA 3LK3B 4NPPA 4UVAB 2WDVA 4YTNA 1YQ3A 3N9PA 3C98B 3KV9A 3AE4A 2OLTA 2XHEB 4EEBA 5JTGA 2FUPA 2ZM8A 5L3DB 3AE9A 3AEGA 4O4JE 1D1CA 2RA1A 4L0RA 4EXTA 5BR8T 2ZLYA 3TLTA 5HYAA 3CK6A 4N78D 3VR9A 3AEFA 2X9HA 3RKOA 5LBMA 1D1BA 2V6YB 1HF8A 3O1HA 5CJ5A 2I0MA 2WU2A 3AB3B 2K9AA 3AVSA 3N9QA 4H9PC 1HNXT 4GK5E 3AE1A 4H9RC 4YTPA 2FJAA 2N2NA 2LSIA 3ZCIA 3OTOT 4JI3T 1BR1A 2WZHA 4IE0A 2X68A 2WMOA 4PJLA 4EB6E 4UEMA 2ZM6T 4ZI3D 2XAFB 4V1Av 2VKOA 4A98A 2BKOA 3LSVA 4HFEA 3K3QC 1J5WA 3UUXB 5JDNA 5ABFB 4O4HE 2V6YA 1U5PA 4PK6A 4KHPT 2K24A 3L09A 4KMCA 3IBPA 4YHJA 2IUBA 4TV9E 3E0ZA 4BJNA 4KBMB 3UFGA 4YXDA 4NUVA 2DI4A 2LHRA 4GOUA 4AKHA 4DV6T 2ES0A 4WBOA 1OEDE 4G63A 3ZMTB 3UU8A 3OYXA 1KNRA 1HX1B 2LSJA 3JCFA 3UUNA 4YSXA 4DV5T 2IDOB 5LJMA 2A9UA 2C5KT 4J2CA 1HG2A 5AQFB 2XM1A 4AI6A 1CUNA 2KNDA 3NZPA 2X66A 5JH7E 2XQ8A 2QGSA 1N36T 3T1HT 1XWMA 2DL1A 2YINA 3P4RA 3W15B 3NZQA 4CI2B 3KBTA 3P8CD 3ZYKA 5JDGA 2ACXA 1HG5A 4YT0A 3ANWB 5C3JA 1D0YA 2WP9A 3FZHB 4OFZA 4QXBB 3GN5A 1HNWT 3GWHA 2VKDA 4JEUB 4X65T 3PUXF 3KDSE 4IE6A 2CHOA 3AA0B 2VASA 3IHRA 4QHOA 5FY1A 5JVDE 4U7IA 3L3PA 4HFIA 4CXXA 5LXTE 5AQIB 3O1IA 3N2OA 3PV0F 4DR2T 1N32T 3MXZA 2B1EA 2W2UA 1YKHB 2Q9QD 4IDPA 5HAXA 5F8PA 1JNRA 4EV6A 3ETVA 5A1LA 2H7OA 2LKHA 1W0BA 2LLYA 2XQAA 5FP3A 1Z8UA 4ILBA 1KEYA 3FBLA 3N9MA 4X1YE 4XZCA 1OEDA 1XZYA 3K1SA 4IE4A 4OHFA 4OK0A 4JI0T 2VQFT 2W67A 2M6BA 4MHCA 2JMHA 2WBLA 4P09A 2WWVA 2Q9QA 2I6HA 3R6NA 4IDQA 2VQET 2NW9A 3MK7C 3RHWA 2B76A 4IHJE 1LVKA 1MNDA 3AAEB 2QYWA 2DNXA 2KWHA 3ONXA 2Y6XA 4UELA 3EDUA 4B3ST 4LF5T 5EZYE 2N9DA 3U78A 2LRKA 3RQWA 3E08A 1L0VA 4KHZF 2BBHA 4DR4T 5EK4A 3K8PC 2UXDT 4I4TE 3WAKA 1HFAA 4DV4T 2X9WA 2FBWA 1X79A 3ETUA 4E7SA 4ZS2A 4YJ2E 2D0TA 2X51A 3FZLB 4AXPA 5LB7B 3Q9DA 2P9BA 5FNVE 2BZBA 4KUMB 3G06A 2VVNA 2E9XA 1X9BA 4U7YA 4OYKA 5LJNA 2DCFA 5JDMA 4IL9A 3BQLA 2BBJA 3AE2A 4X20E 2JPFA 4C91A 3RRCA 2QRXA 4EYUA 3KVBA 3V5UA 2JJ9A 4EOZB 3N2GE 2VURA 1KF6A 4CI3B 3JC6C 2RPAA 3RC8A 3UULA 3Q5EA 3ZLIA 1QUUA 2E9XB 3ABVA 4HN9A 4PJNA 4FI5A 2EHOC 1NWMX 2VK9A 2YDSA 3KV6A 2IW5B 4NUUA 4ZI7E 3PUWF 2UUAT 5KX5E 3S4UA 3B57A 4QH5A 3JAEA 3VHLA 2XTLA 3C4WA 3SFEA 5FKYA 3C50A 4A97A 5F3JA 2IHR1 2UXNB 2ACZA 2QVAA 3AAAB 3HA4A 4K0KT 5LP6E 1HTJF 3AAIA 4JI1T 3I0QA 5LHGB 2CLYB 4PJJA 2MPKA 4HGAA 4XBFB 4ZS3A 4NXMT 2LKGA 2NW8A 4CQIA 3N9NA 4G2AA 3ONLC 4I43B 5DQVA 2EHOA 5AQTB 3EUHA 2M67A 2YU2A 1W9RA 1ZP0A 2CBJA 1MMNA 5HXRA 5HEJA 3R84B 3B5MA 4MBQA 5AQVB 2KMFA 2H3RA 2A3DA 1NAFA 3DP7A 3PU3A 3VR8A 2W61A 1I6ZA 5IYZE 4ASKA 2XQ3A 4QX7B 1WYCA 1OEDB 2X9XA 3HL6A 3RC3A 4X64T 4DR5T 1VOMA 2FJDA 3CWZB 4YY3T 4O8SA 2LSYA 5EK3A 3CQCB 5AQOB 2XQ5A 2NOXA 4GK0E 2LHNA 1WCRA 4ILAA 2EHOB 2JQQA 4M1PA 4UF0B 5JR9B 4PK5A 3HKDE 4HE8A 3MJXA 3ZT6A 3IEEA 2X67A 3BQIA 4HTEA 2CEAA 2UUBT 1YD8G 2XQ4A 4CN4A 4B3TT 2LM9A 5HXHA 3X1DA 2FJBA 2WZIA 2V1DB 4LF6T 5L3EB 4IDOA 4AISA 2G0UA 4XAXB 5IWAT 1HS7A 4P0BA 2KINB 3FZKB 3UT5E 3A5XA 1M7KA 3MZKB 3GMIA 5IHYA 1VCSA 1VRBA 2XSBA 1JNZA 4ERRA 2CXFA 2HN1A 2C0SA 4F6RC 3ZJ1A 1KFYA 3VRBA 1Z0PA 3K3NA 4WZXA 4JV5T 4Z90A 5FY7A 1UX5A 3BK9A 5AQKB 3RPUA 3ZMVB 3A8YC 3DTOA 5AFUL 3RIAA 3ZSTA 4UR9A 3CX8B 5ADXL 2V6XA 2CWOA 5CB4E 5LHHB 2E5VA 3K3OA 3FB2A 5CFBA 3SS1A 1HCIA 4PNIA 1W09A 2RP4A 2YK0A 1OXZA 3C4XA 3ZMSB 2LEHA 5ABFA 1MIYA 4X66T 5LGNB 4QH4A 1BR2A 3B13A 5AQRB 3QB5K 4MALA 2KSRA 1HR0T 4GYSA 5C2TA 4UVBB 4LFBT 4DNDA 3FZFB 5DJQC 2OA5A 1O3XA 1OEDC 4KX6A 4OX9T 2XSAA 3RYHE 2C5JA 3TLVA 3ZJ2A 4ANJA 4DR6T 4PAGA 2E9XD 2K48A 3LJCA 3T8OA 2XQ6A 1R8IA 4JYAT 3AE8A 4PJMA 5FXVA 1DU2A 3OVUA 4JBWF 4LFCT 3JAFA 4JI5T 3KV4A 4PW8A 5FYMA 4ISSA 5HEHA 5LG4A 3N5LA 5FVLA 3FBZA 4TX5A 4B3MT 2XJ7A 4IGUA 2BG9C 1QLBA 2M6IA 4DMVA 2CLYC 3O9XA 2UUCT 1WYBA 5L47A 1EZ3A 4U3CA 3TLWA 4LF4T 2PG8A 4JI4T 1SUMB 3ZN0B 5AQQB 5J2UE 5JR9A 3HKCE 3ZYMA 3ZSSA 2BS3A 1OWAA 1T7SA 4MFRA 5HXCA 3ZT5A 1XMOT 3H37A 4H9OC 2YEVC 3F57A 1SHZC 2HN2A 5DQWA 3RLFF 2LT3A 3UQ4A 5HEGA 4EIWA 4DBQA 2HPJA 1Y64B 3UU6A 5HXSA 2DLRA 3NRXA 3PUZF 4U31A 2XAJB 5ETWA 3CQXC 3C4ZA 3FXEB 4H63H 4KP3C 4Q25A 1SA0E 4JUYA 2WWUA 4PK4A 2X0YA 4EGWA 2LOSA 3KVAA 2L9QA 4BJMA 4FJOA 2WSSV 3M65A 5LMUT 3F2EA 1H7CA 1WR0A 4TNWA 3RH3A 4EZHA 2KZ7B 5L4HA 1XMQT 2V7JA 2NW7A 2CPTA 2WDQA 2NTXA 5KXJA 5M4YA 2BDEA 5L3GB 4JI8T 5CA0E 3NVOA 5JQGE 4HWCA 4U74A 4LMLA 4TZ4C 2C5IT 5CA1E 3SWHA 2UXCT 1FIOA 1YQ4A 3ZKRA 2ZMAA 2CCQA 2K3WA 4CN6A 4IT4A 2W0GA 4EAHA 4QXHB 4EYYR 4CI1B 1S35A 3HR0A 3MACA 2WQYA 4L9IA 2NR4A
chains in the Genus database with same CATH topology
3NKZA 3H3MA 3A7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKZ A;  3H3M A;  3A7M A; 
#chains in the Genus database with same CATH topology
 5E0O A;  5FMN A;  5LHI B;  1HNZ T;  2ODV A;  4A56 A;  4JLE A;  1G73 A;  4Z8X A;  3P4W A;  4TWH A;  3IF8 B;  2HPL A;  3ZN1 B;  4IL4 A;  5JDF A;  3PUS A;  5C8Y E;  4DV1 T;  2L8K A;  3RGL A;  1UUR A;  2BVM A;  2J47 A;  5HXE A;  3RRW A;  2CMR A;  3A7M A;  2VL0 A;  2XAS B;  3DJB A;  3ONJ A;  3PJA J;  4TV8 E;  4DMW A;  3OYZ A;  2Q9Q C;  4AKL A;  5JDQ A;  4JI7 T;  3RYC E;  5JRC A;  4QXC B;  2MAW A;  3EAM A;  3GN5 B;  3LG7 A;  4MLK A;  4O4L E;  2JQ9 A;  3HI2 A;  4KI0 F;  2QA7 A;  3OJA A;  3J9X 1;  4DID B;  4CZZ B;  3LDQ B;  3Q5W A;  4H9N C;  5JR9 C;  3AE7 A;  4ZI2 C;  3BQK A;  3PJA A;  2XAG B;  4GIW A;  3RYI E;  4COF A;  3RX6 A;  4ZHQ E;  2UXB T;  3LK2 B;  4X1I E;  2JQK A;  1T8B A;  3JC6 D;  3SFD A;  4QX8 B;  3I0O A;  5F5W A;  4AIU A;  3ZMU B;  1US7 B;  5HCM A;  2AE9 A;  4LMJ A;  4C90 A;  3EHZ A;  2CHN A;  2V7L A;  3M3Z B;  3NRY A;  4H9S E;  1N33 T;  1SE7 A;  3ZPO A;  5FXW A;  2VB6 A;  1KNZ A;  3CVR A;  1E2A A;  4YJ3 E;  3UUB A;  1VCT A;  4ILC A;  2J1D G;  2XUE A;  2YDQ A;  2YOE A;  2W63 A;  2MTQ A;  4QKN A;  5AQP B;  1QSD A;  4HWI B;  2MBG A;  3LK4 2;  3I9W A;  2AXD S;  1ZOY A;  4TUY E;  4LF8 T;  3UFE A;  1U4Q A;  3E22 E;  3J7Y q;  5JDH A;  4DUZ T;  3CPZ A;  1ZV4 X;  4AQF C;  2CXL A;  4AQY T;  5AQH B;  3N2K E;  2V7I A;  4EED A;  2IC6 A;  1XNQ T;  2E8I A;  2H89 A;  2PJQ A;  1MIW A;  2VL8 A;  3CX7 B;  5EK2 A;  5L2L A;  1IAP A;  2R6G F;  3L8R A;  3PUQ A;  4GYR A;  4IDZ A;  3AA6 B;  4L5G A;  5FL1 A;  1WFD A;  2JRK A;  3OKQ A;  2JMK A;  4A5X A;  1IBK T;  1XDP A;  3OBV E;  3FXD B;  1IBM T;  2LJL A;  1FJG T;  2XQY A;  3CIR A;  4I0U A;  3MA9 A;  1UX4 A;  5CGM A;  4JI6 T;  1ZHC A;  4AKI A;  4TWF A;  2YDR A;  2D2S A;  3N9L A;  2WAU A;  3P4Q A;  2Q9Q B;  4HFH A;  4X5T A;  2E5L T;  2A72 A;  4ZZC A;  5L3C B;  1IBL T;  4LF9 T;  4YSZ A;  1KK7 A;  1UCU A;  5LA6 E;  3P4P A;  3TLU A;  2V7M A;  3F31 A;  3ZYL A;  4O4I E;  3VRA A;  4DR7 T;  1XDO A;  3GA8 A;  2NP9 A;  1N34 T;  5LGU B;  4QWN B;  2FJE A;  1FMV A;  2DHR A;  3AXJ B;  2WY2 A;  2IC9 A;  4DR1 T;  2XM2 A;  3QB5 A;  3EAB A;  3I1A A;  3UU4 A;  4BA9 A;  2LRL A;  5J2T E;  4B6X A;  4PFP A;  3CML A;  2X0H A;  3FHN A;  3PUY F;  2XY8 B;  1WRD A;  1J5E T;  2HHH T;  1M62 A;  2WM9 A;  5HWX A;  3RI5 A;  3ZCJ A;  4GKJ T;  5JRC B;  3U3I A;  4DV0 T;  3ZC0 A;  1LRZ A;  2A2F X;  4WW0 A;  3RYF E;  2H88 A;  4WNK A;  3AEA A;  2W4X A;  2X9Y A;  2D9D A;  4ZI2 D;  1MNE A;  4AKG A;  2PFV A;  3AXJ A;  1ZEE A;  3V5S A;  2YU1 A;  4CXY A;  2JQH A;  4U2Z A;  3AVR A;  1IJ5 A;  5FVK A;  4GKK T;  4F8H A;  1CHU A;  5LOV E;  4EZ4 A;  2BKN A;  4E7Z A;  3NWI A;  2H7V C;  4U72 A;  3UQ7 A;  3AA1 B;  3KIN B;  4IIJ E;  2D0U A;  3ANW A;  4WYV A;  2BS2 A;  2KXP B;  4YHH T;  1AJ3 A;  2CM0 A;  2IAK A;  2K5B B;  3RQU A;  4Z91 A;  4DO0 A;  2E9X C;  2WMN A;  2N1G A;  3IA3 A;  2GK9 A;  3CX6 B;  2UXX B;  1MMG A;  4HFB A;  4TWD A;  5FL0 A;  1G8X A;  2DWG A;  3L39 A;  3WI3 A;  3HKE E;  3QC9 A;  4DVD A;  2DWK A;  2ZM2 A;  3AA7 B;  4YLH A;  4ZI3 C;  3UU3 A;  2V8S V;  4QH1 A;  3AEE A;  4P1N A;  5AQS B;  5HEU A;  3P50 A;  3PTR B;  3P4S A;  5AQU B;  5ABG A;  2MOZ A;  4UIG A;  3RIU C;  5JRE A;  3N9O A;  3UUM A;  1YKE B;  3O4X E;  4NIQ A;  2WB5 A;  4DV2 T;  2BG9 B;  2L3L A;  2LOP A;  3Q2M A;  4JI2 T;  4ZXL A;  3C51 A;  3PUR A;  5AQG B;  2VVS A;  3LBX B;  2CA5 A;  3PU8 A;  4O2A E;  2BG9 E;  4HEA A;  4UV9 B;  5FY0 A;  2W00 A;  3RKG A;  4DBR A;  2LE8 A;  5FXX A;  2BKP A;  5LG3 A;  3PDY A;  4ILU A;  4HWD A;  2PTF A;  3RF1 A;  2J62 A;  4X62 T;  3T1Y T;  3MKD A;  5LNK A;  4ZZB A;  5L3B B;  1E1H B;  4DUY T;  5JDL A;  5IUX A;  2XZE A;  1YW0 A;  2WS3 A;  3PUG A;  4AQF A;  5H6Q B;  3AEB A;  4UV8 B;  4CXW A;  2NTY A;  1MMD A;  1D0X A;  4LF7 T;  3TKL B;  4NXN T;  2NWB A;  1T72 A;  1IZN B;  2IIU A;  5LBQ B;  3UU5 A;  3QUJ A;  5AQM B;  1S94 A;  3O1J A;  4TNV A;  5HCJ A;  3TLS A;  3ESL A;  2D5U A;  4UF0 A;  5FXZ A;  2LSK A;  3PE0 A;  3QOF A;  2UU9 T;  2E2A A;  2ZM0 A;  2F4V T;  3AE6 A;  3RIF A;  5HWY A;  4IE7 A;  4ZOL E;  3WAJ A;  3D0T A;  5KDM C;  1KNP A;  3KFW X;  2XAH B;  3ZC1 A;  2V5D A;  2BVL A;  2J4G A;  2VWA A;  3AEC A;  4HFC A;  4PFO A;  3I9Y A;  1BR4 A;  2Y8D A;  4CN1 A;  2V26 A;  3VKH A;  4O2B E;  4TN7 B;  3ZT7 A;  2BS4 A;  2WCA A;  2CRB A;  1V9D A;  4I50 E;  4HFV A;  5LYJ E;  1E7P A;  2CXD A;  1UUS A;  1BR0 A;  3ZEF B;  3ZMZ B;  1T98 A;  2LM2 A;  2CWY A;  2JIW A;  1B7T A;  3KV5 A;  3SOL A;  4I55 E;  4DV3 T;  2V5C A;  4P0A A;  3UTK A;  3HKB E;  4IST A;  4WBN E;  4YSY A;  1NEN A;  1D1A A;  4HFD A;  2W66 A;  5LCY A;  1XNR T;  1W0A A;  2Y48 B;  4HWF A;  1WR6 A;  4UXN B;  1MIV A;  1HX8 A;  2WU5 A;  2Z6E A;  2YN6 A;  4LFA T;  4IRE A;  4K0U A;  3JAD A;  1I94 T;  3NKZ A;  2W62 A;  3FZM B;  2I59 A;  3H3M A;  4B3R T;  4U33 A;  3NBX X;  2OV9 A;  3P7I A;  1WLX A;  4HWH A;  3C64 A;  2PBI A;  4UVC B;  3SRZ A;  2XQ7 A;  4LMK A;  3Q5D A;  3OPC A;  1UK5 A;  2KT9 A;  3QNU A;  2KLQ A;  5TAO A;  5J0Z A;  1ZKE A;  1FMW A;  3AE5 A;  5BMV E;  5ABE A;  5LMN T;  4DV7 T;  1Y01 A;  1LVF A;  1GQE A;  2VKJ A;  2CBI A;  4AKR B;  3EDV A;  3QK6 A;  5L4E A;  1LKX A;  5AQJ B;  1YXR A;  4HKA A;  1UGO A;  2YKS A;  2SPC A;  1D0Z A;  4JEH B;  2WDR A;  1J1J A;  2X0L B;  3AE3 A;  2CE7 A;  4IE5 A;  2VKH A;  5GON E;  4IDN A;  2BG9 A;  2KWI B;  1MMA A;  3AED A;  4U2Y A;  3VKG A;  2EHO D;  2IML A;  2ODU A;  4H63 V;  5ABH A;  1NEK A;  3LBX A;  3KBU A;  5LGT B;  2LSG A;  4H9Q C;  5DAB A;  5AQN B;  3PUA A;  5KMG P;  3CQG B;  4X1K E;  4AQG A;  4DR3 T;  3EI0 A;  1IJ6 A;  4YTM A;  5HEO A;  3RIU A;  3Q5X A;  3VU7 H;  5H6R B;  2MYS A;  2V7K A;  3EVY A;  5L3F B;  2XPK A;  4OYJ A;  3PUV F;  2HH7 A;  5J1G A;  1FEW A;  3CKD A;  2XAQ B;  4YFS A;  3LFM A;  3H3A A;  4ADZ A;  2XQ9 A;  4BAY B;  5AQL B;  4ZEY A;  3LK3 B;  4NPP A;  4UVA B;  2WDV A;  4YTN A;  1YQ3 A;  3N9P A;  3C98 B;  3KV9 A;  3AE4 A;  2OLT A;  2XHE B;  4EEB A;  5JTG A;  2FUP A;  2ZM8 A;  5L3D B;  3AE9 A;  3AEG A;  4O4J E;  1D1C A;  2RA1 A;  4L0R A;  4EXT A;  5BR8 T;  2ZLY A;  3TLT A;  5HYA A;  3CK6 A;  4N78 D;  3VR9 A;  3AEF A;  2X9H A;  3RKO A;  5LBM A;  1D1B A;  2V6Y B;  1HF8 A;  3O1H A;  5CJ5 A;  2I0M A;  2WU2 A;  3AB3 B;  2K9A A;  3AVS A;  3N9Q A;  4H9P C;  1HNX T;  4GK5 E;  3AE1 A;  4H9R C;  4YTP A;  2FJA A;  2N2N A;  2LSI A;  3ZCI A;  3OTO T;  4JI3 T;  1BR1 A;  2WZH A;  4IE0 A;  2X68 A;  2WMO A;  4PJL A;  4EB6 E;  4UEM A;  2ZM6 T;  4ZI3 D;  2XAF B;  4V1A v;  2VKO A;  4A98 A;  2BKO A;  3LSV A;  4HFE A;  3K3Q C;  1J5W A;  3UUX B;  5JDN A;  5ABF B;  4O4H E;  2V6Y A;  1U5P A;  4PK6 A;  4KHP T;  2K24 A;  3L09 A;  4KMC A;  3IBP A;  4YHJ A;  2IUB A;  4TV9 E;  3E0Z A;  4BJN A;  4KBM B;  3UFG A;  4YXD A;  4NUV A;  2DI4 A;  2LHR A;  4GOU A;  4AKH A;  4DV6 T;  2ES0 A;  4WBO A;  1OED E;  4G63 A;  3ZMT B;  3UU8 A;  3OYX A;  1KNR A;  1HX1 B;  2LSJ A;  3JCF A;  3UUN A;  4YSX A;  4DV5 T;  2IDO B;  5LJM A;  2A9U A;  2C5K T;  4J2C A;  1HG2 A;  5AQF B;  2XM1 A;  4AI6 A;  1CUN A;  2KND A;  3NZP A;  2X66 A;  5JH7 E;  2XQ8 A;  2QGS A;  1N36 T;  3T1H T;  1XWM A;  2DL1 A;  2YIN A;  3P4R A;  3W15 B;  3NZQ A;  4CI2 B;  3KBT A;  3P8C D;  3ZYK A;  5JDG A;  2ACX A;  1HG5 A;  4YT0 A;  3ANW B;  5C3J A;  1D0Y A;  2WP9 A;  3FZH B;  4OFZ A;  4QXB B;  3GN5 A;  1HNW T;  3GWH A;  2VKD A;  4JEU B;  4X65 T;  3PUX F;  3KDS E;  4IE6 A;  2CHO A;  3AA0 B;  2VAS A;  3IHR A;  4QHO A;  5FY1 A;  5JVD E;  4U7I A;  3L3P A;  4HFI A;  4CXX A;  5LXT E;  5AQI B;  3O1I A;  3N2O A;  3PV0 F;  4DR2 T;  1N32 T;  3MXZ A;  2B1E A;  2W2U A;  1YKH B;  2Q9Q D;  4IDP A;  5HAX A;  5F8P A;  1JNR A;  4EV6 A;  3ETV A;  5A1L A;  2H7O A;  2LKH A;  1W0B A;  2LLY A;  2XQA A;  5FP3 A;  1Z8U A;  4ILB A;  1KEY A;  3FBL A;  3N9M A;  4X1Y E;  4XZC A;  1OED A;  1XZY A;  3K1S A;  4IE4 A;  4OHF A;  4OK0 A;  4JI0 T;  2VQF T;  2W67 A;  2M6B A;  4MHC A;  2JMH A;  2WBL A;  4P09 A;  2WWV A;  2Q9Q A;  2I6H A;  3R6N A;  4IDQ A;  2VQE T;  2NW9 A;  3MK7 C;  3RHW A;  2B76 A;  4IHJ E;  1LVK A;  1MND A;  3AAE B;  2QYW A;  2DNX A;  2KWH A;  3ONX A;  2Y6X A;  4UEL A;  3EDU A;  4B3S T;  4LF5 T;  5EZY E;  2N9D A;  3U78 A;  2LRK A;  3RQW A;  3E08 A;  1L0V A;  4KHZ F;  2BBH A;  4DR4 T;  5EK4 A;  3K8P C;  2UXD T;  4I4T E;  3WAK A;  1HFA A;  4DV4 T;  2X9W A;  2FBW A;  1X79 A;  3ETU A;  4E7S A;  4ZS2 A;  4YJ2 E;  2D0T A;  2X51 A;  3FZL B;  4AXP A;  5LB7 B;  3Q9D A;  2P9B A;  5FNV E;  2BZB A;  4KUM B;  3G06 A;  2VVN A;  2E9X A;  1X9B A;  4U7Y A;  4OYK A;  5LJN A;  2DCF A;  5JDM A;  4IL9 A;  3BQL A;  2BBJ A;  3AE2 A;  4X20 E;  2JPF A;  4C91 A;  3RRC A;  2QRX A;  4EYU A;  3KVB A;  3V5U A;  2JJ9 A;  4EOZ B;  3N2G E;  2VUR A;  1KF6 A;  4CI3 B;  3JC6 C;  2RPA A;  3RC8 A;  3UUL A;  3Q5E A;  3ZLI A;  1QUU A;  2E9X B;  3ABV A;  4HN9 A;  4PJN A;  4FI5 A;  2EHO C;  1NWM X;  2VK9 A;  2YDS A;  3KV6 A;  2IW5 B;  4NUU A;  4ZI7 E;  3PUW F;  2UUA T;  5KX5 E;  3S4U A;  3B57 A;  4QH5 A;  3JAE A;  3VHL A;  2XTL A;  3C4W A;  3SFE A;  5FKY A;  3C50 A;  4A97 A;  5F3J A;  2IHR 1;  2UXN B;  2ACZ A;  2QVA A;  3AAA B;  3HA4 A;  4K0K T;  5LP6 E;  1HTJ F;  3AAI A;  4JI1 T;  3I0Q A;  5LHG B;  2CLY B;  4PJJ A;  2MPK A;  4HGA A;  4XBF B;  4ZS3 A;  4NXM T;  2LKG A;  2NW8 A;  4CQI A;  3N9N A;  4G2A A;  3ONL C;  4I43 B;  5DQV A;  2EHO A;  5AQT B;  3EUH A;  2M67 A;  2YU2 A;  1W9R A;  1ZP0 A;  2CBJ A;  1MMN A;  5HXR A;  5HEJ A;  3R84 B;  3B5M A;  4MBQ A;  5AQV B;  2KMF A;  2H3R A;  2A3D A;  1NAF A;  3DP7 A;  3PU3 A;  3VR8 A;  2W61 A;  1I6Z A;  5IYZ E;  4ASK A;  2XQ3 A;  4QX7 B;  1WYC A;  1OED B;  2X9X A;  3HL6 A;  3RC3 A;  4X64 T;  4DR5 T;  1VOM A;  2FJD A;  3CWZ B;  4YY3 T;  4O8S A;  2LSY A;  5EK3 A;  3CQC B;  5AQO B;  2XQ5 A;  2NOX A;  4GK0 E;  2LHN A;  1WCR A;  4ILA A;  2EHO B;  2JQQ A;  4M1P A;  4UF0 B;  5JR9 B;  4PK5 A;  3HKD E;  4HE8 A;  3MJX A;  3ZT6 A;  3IEE A;  2X67 A;  3BQI A;  4HTE A;  2CEA A;  2UUB T;  1YD8 G;  2XQ4 A;  4CN4 A;  4B3T T;  2LM9 A;  5HXH A;  3X1D A;  2FJB A;  2WZI A;  2V1D B;  4LF6 T;  5L3E B;  4IDO A;  4AIS A;  2G0U A;  4XAX B;  5IWA T;  1HS7 A;  4P0B A;  2KIN B;  3FZK B;  3UT5 E;  3A5X A;  1M7K A;  3MZK B;  3GMI A;  5IHY A;  1VCS A;  1VRB A;  2XSB A;  1JNZ A;  4ERR A;  2CXF A;  2HN1 A;  2C0S A;  4F6R C;  3ZJ1 A;  1KFY A;  3VRB A;  1Z0P A;  3K3N A;  4WZX A;  4JV5 T;  4Z90 A;  5FY7 A;  1UX5 A;  3BK9 A;  5AQK B;  3RPU A;  3ZMV B;  3A8Y C;  3DTO A;  5AFU L;  3RIA A;  3ZST A;  4UR9 A;  3CX8 B;  5ADX L;  2V6X A;  2CWO A;  5CB4 E;  5LHH B;  2E5V A;  3K3O A;  3FB2 A;  5CFB A;  3SS1 A;  1HCI A;  4PNI A;  1W09 A;  2RP4 A;  2YK0 A;  1OXZ A;  3C4X A;  3ZMS B;  2LEH A;  5ABF A;  1MIY A;  4X66 T;  5LGN B;  4QH4 A;  1BR2 A;  3B13 A;  5AQR B;  3QB5 K;  4MAL A;  2KSR A;  1HR0 T;  4GYS A;  5C2T A;  4UVB B;  4LFB T;  4DND A;  3FZF B;  5DJQ C;  2OA5 A;  1O3X A;  1OED C;  4KX6 A;  4OX9 T;  2XSA A;  3RYH E;  2C5J A;  3TLV A;  3ZJ2 A;  4ANJ A;  4DR6 T;  4PAG A;  2E9X D;  2K48 A;  3LJC A;  3T8O A;  2XQ6 A;  1R8I A;  4JYA T;  3AE8 A;  4PJM A;  5FXV A;  1DU2 A;  3OVU A;  4JBW F;  4LFC T;  3JAF A;  4JI5 T;  3KV4 A;  4PW8 A;  5FYM A;  4ISS A;  5HEH A;  5LG4 A;  3N5L A;  5FVL A;  3FBZ A;  4TX5 A;  4B3M T;  2XJ7 A;  4IGU A;  2BG9 C;  1QLB A;  2M6I A;  4DMV A;  2CLY C;  3O9X A;  2UUC T;  1WYB A;  5L47 A;  1EZ3 A;  4U3C A;  3TLW A;  4LF4 T;  2PG8 A;  4JI4 T;  1SUM B;  3ZN0 B;  5AQQ B;  5J2U E;  5JR9 A;  3HKC E;  3ZYM A;  3ZSS A;  2BS3 A;  1OWA A;  1T7S A;  4MFR A;  5HXC A;  3ZT5 A;  1XMO T;  3H37 A;  4H9O C;  2YEV C;  3F57 A;  1SHZ C;  2HN2 A;  5DQW A;  3RLF F;  2LT3 A;  3UQ4 A;  5HEG A;  4EIW A;  4DBQ A;  2HPJ A;  1Y64 B;  3UU6 A;  5HXS A;  2DLR A;  3NRX A;  3PUZ F;  4U31 A;  2XAJ B;  5ETW A;  3CQX C;  3C4Z A;  3FXE B;  4H63 H;  4KP3 C;  4Q25 A;  1SA0 E;  4JUY A;  2WWU A;  4PK4 A;  2X0Y A;  4EGW A;  2LOS A;  3KVA A;  2L9Q A;  4BJM A;  4FJO A;  2WSS V;  3M65 A;  5LMU T;  3F2E A;  1H7C A;  1WR0 A;  4TNW A;  3RH3 A;  4EZH A;  2KZ7 B;  5L4H A;  1XMQ T;  2V7J A;  2NW7 A;  2CPT A;  2WDQ A;  2NTX A;  5KXJ A;  5M4Y A;  2BDE A;  5L3G B;  4JI8 T;  5CA0 E;  3NVO A;  5JQG E;  4HWC A;  4U74 A;  4LML A;  4TZ4 C;  2C5I T;  5CA1 E;  3SWH A;  2UXC T;  1FIO A;  1YQ4 A;  3ZKR A;  2ZMA A;  2CCQ A;  2K3W A;  4CN6 A;  4IT4 A;  2W0G A;  4EAH A;  4QXH B;  4EYY R;  4CI1 B;  1S35 A;  3HR0 A;  3MAC A;  2WQY A;  4L9I A;  2NR4 A; 
#chains in the Genus database with same CATH homology
 3NKZ A;  3H3M A;  3A7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...