3A7MA

Structure of flit, the flagellar type iii chaperone for flid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
TSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQSTRQKSLNNAYGRLSGMLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein fliT
publication title Structural insight into the regulatory mechanisms of interactions of the flagellar type III chaperone FliT with its binding partners.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation, chaperone
total genus 41
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3a7mA01
3H3MA 3A7MA 3NKZA
chains in the Genus database with same CATH superfamily
1XMOT 3BQIA 3G06A 1HX1B 3ZMSB 5JH7E 1HF8A 4GYSA 3N2GE 3M3ZB 3GA8A 2D0UA 3ZN0B 3JCFA 5ETWA 3P4WA 1UX5A 4GYRA 4O4IE 1DU2A 3UUXB 1V9DA 2KMFA 5DJQC 3B13A 3TLSA 2V26A 3EDVA 4IGUA 4C91A 3EUHA 1KFYA 3ZYKA 4YTPA 4ANJA 2R6GF 4WYVA 1ZP0A 3BK9A 3A7MA 2LT3A 1LVFA 2ZLYA 4EOZB 4Z8XA 5L4HA 3N9QA 2JMKA 3LK3B 4A98A 2JRKA 2V5DA 5HEHA 4CN1A 2ES0A 2NR4A 4LFBT 3UUMA 2D0TA 2XAFB 2CM0A 3RI5A 4X65T 1KNRA 2W4XA 1KNPA 2UXCT 3F57A 2XQYA 1WYCA 3KDSE 1IJ6A 1ZHCA 2V8SV 1MMGA 4YSYA 2LJLA 3C64A 4PFOA 4LF9T 4CI1B 1MMAA 2CBJA 4KX6A 3H3AA 2BS4A 1I94T 4HFVA 3PDYA 5LP6E 5KX5E 4IE5A 1R8IA 2PJQA 2IIUA 2X0YA 3IHRA 3HA4A 5F5WA 2YU1A 2KLQA 3EABA 4QH4A 2H3RA 4Q25A 4H9QC 5HCMA 3HI2A 4ZI2D 2YU2A 4I4TE 1YQ3A 5JDQA 4XBFB 3PUAA 2XQ3A 1MMNA 3AXJA 4I0UA 3CKDA 2V5CA 3N2OA 4ZHQE 3KVBA 2A2FX 4HFHA 4ISTA 4JI4T 2KT9A 4PK5A 4EV6A 3HKEE 3Q5WA 3HKBE 3GMIA 3JAEA 5LMUT 4U3CA 3AXJB 2YINA 4GK5E 4DBQA 5AQJB 3PV0F 2AXDS 3UULA 1AJ3A 2JPFA 1NENA 3AVRA 4PJNA 2C5KT 4CI3B 1JNZA 2IC6A 3D0TA 5CB4E 1D0YA 2VKHA 1FEWA 4JI8T 2K9AA 1J1JA 2XASB 2X68A 3AEEA 5LGTB 4F6RC 5HEJA 3ZYLA 5LJMA 2XSBA 4JEHB 1HCIA 4UV8B 1SE7A 4I50E 1HTJF 3LSVA 4ILUA 4KHPT 3RYIE 3ESLA 4UR9A 3AAIA 3U78A 5HXEA 4DR1T 2MYSA 4PJJA 2D2SA 2XSAA 1S35A 2UUBT 3RQUA 2V7LA 3ONJA 3IBPA 2V7KA 1S94A 4IHJE 4HKAA 4LFCT 3CK6A 3ZMUB 3QB5A 4KBMB 4IDZA 4CI2B 1J5ET 2W0GA 4A56A 4E7ZA 4DV2T 2CCQA 3ZT7A 3I1AA 3AE7A 4YSXA 2VVNA 3ETUA 4DR5T 3KVAA 2DL1A 1CHUA 2B1EA 1L0VA 2LEHA 3NKZA 4QXBB 3PJAA 4LMJA 1KK7A 3AAEB 4PK6A 4DV4T 3CIRA 2OLTA 4H9PC 1N33T 3RC8A 1GQEA 4X1KE 1QUUA 4DR2T 2VQET 2BVLA 4PAGA 2H7OA 5FYMA 3UU3A 4H9NC 3Q5XA 2W00A 5JTGA 4X5TA 4X1IE 4P09A 2NTXA 4NUUA 3HL6A 2CA5A 5GONE 2E2AA 3N9PA 1NEKA 3C50A 4GKKT 4N78D 1HFAA 2LSYA 3LDQB 3OBVE 2V6YA 4KHZF 4FI5A 4IDNA 2E9XD 2MPKA 4UELA 3B5MA 4QX8B 1YKEB 2QYWA 4YHJA 2ODVA 5LBQB 3TLTA 1Y64B 2PFVA 5AQOB 5EZYE 1FJGT 2DWKA 2ZM2A 2GK9A 2V6YB 5JDGA 2LSJA 2NP9A 2XQAA 4NXMT 3AE4A 3SFDA 1MIWA 4TN7B 2Q9QD 4H9OC 3KV6A 2KWHA 3UU4A 4AQFC 2F4VT 4DV6T 2NTYA 3MXZA 4YTNA 4DR4T 4QH1A 2NWBA 4ERRA 4DV7T 1OXZA 3AEBA 2C5JA 1OWAA 5AQPB 4CXWA 1UCUA 1WCRA 2YDSA 3RRCA 1IBMT 3E0ZA 3FZHB 2BZBA 3QNUA 3I0OA 3ETVA 2XTLA 2ACXA 5CFBA 1U5PA 3GWHA 4ILCA 4DV5T 4TWDA 2WU5A 4CN6A 3K3QC 5AQNB 5H6QB 2E8IA 3AE2A 2JQQA 4X62T 3ZJ2A 4EZ4A 4EEDA 4X20E 3R6NA 4WBNE 4YTMA 5EK3A 2CMRA 2H7VC 5LJNA 4CXYA 2HPLA 2XQ5A 2BS2A 3JC6C 3LK2B 4U74A 3WAJA 2LM9A 3P50A 1B7TA 1UX4A 4OX9T 2DLRA 1BR2A 4MALA 2IW5B 3P7IA 5L47A 3L3PA 3AEGA 2XZEA 1US7B 2Y6XA 3PUZF 3FHNA 3C4WA 4DNDA 2V7MA 3C4XA 3ZC0A 2WMOA 2PG8A 4UEMA 2NW9A 2FJAA 3SRZA 3Q2MA 2ODUA 4TV8E 5LXTE 3NVOA 4H9SE 3UT5E 3UTKA 4IE6A 5DQVA 4ZI3C 4PJMA 1N32T 2CBIA 1KNZA 4HWDA 5TAOA 2CLYB 2CLYC 2IC9A 1ZV4X 2VASA 3QC9A 4A5XA 3R84B 3HKDE 4O2BE 2CEAA 3OJAA 5L3EB 5FVLA 2WDRA 2B76A 2WDQA 2WU2A 2K24A 2XAQB 4GOUA 4TNWA 3X1DA 2D9DA 5BMVE 5CA1E 4DVDA 3CQCB 3DJBA 5KMGP 5FNVE 3PTRB 5FXXA 1D1BA 3LFMA 1FMVA 2VURA 2G0UA 5HCJA 1J5WA 1U4QA 3KBTA 2LLYA 5L3DB 1XMQT 5AQUB 2JQHA 3N9OA 4HFDA 1EZ3A 3EHZA 1XZYA 5LNKA 4YLHA 4JI6T 2LKHA 4Z91A 2YKSA 4JI2T 5IWAT 2JQ9A 4IL9A 3L09A 2KNDA 3N5LA 1ZKEA 4PK4A 3P4QA 4H9RC 3AA7B 4YY3T 4B3ST 4MHCA 2MBGA 2XQ6A 4PFPA 2IMLA 4J2CA 2LM2A 5LGUB 1FMWA 2EHOA 2V6XA 4WW0A 3I0QA 2JMHA 4DBRA 1HG5A 5AQIB 2XM2A 5ABGA 3UU6A 1MIYA 4DIDB 2W66A 3K1SA 3N2KE 1M62A 4U7IA 3F2EA 5AQVB 5LBMA 5FP3A 3ZN1B 4L9IA 4HFEA 2EHOB 2EHOC 2VVSA 4LF4T 3TLVA 4CZZB 4MBQA 4IL4A 2K5BB 5F3JA 2IHR1 4NUVA 4HE8A 4ZEYA 2W61A 2K3WA 3CX8B 1G8XA 2BBJA 1WR6A 4KUMB 2QVAA 5M4YA 3RC3A 5JDMA 3UU8A 3PJAJ 4WNKA 5L4EA 3ZEFB 5C2TA 4DV0T 4AQYT 4HFBA 1XDPA 4AQGA 3PUVF 5JREA 3RHWA 3CMLA 1HS7A 2X67A 3ANWA 1QSDA 3O9XA 2P9BA 3AA6B 5H6RB 2XY8B 4CN4A 5LHIB 3PUYF 4EIWA 2Z6EA 3EI0A 4JYAT 1WR0A 5FXZA 4CQIA 2CWOA 3DP7A 2WS3A 3ANWB 3PU3A 3L8RA 3UUBA 1YKHB 4XZCA 1O3XA 4HGAA 5CJ5A 4HN9A 2HH7A 3QK6A 5J2UE 3ABVA 4P0BA 5DABA 5C8YE 2JJ9A 3EVYA 4K0KT 3PUQA 4IE0A 5HXSA 2QA7A 4QH5A 1WLXA 2UXNB 1NAFA 5ADXL 4YJ2E 1XNQT 3MACA 2CWYA 2CHOA 4HWIB 3I9YA 2KWIB 5EK4A 2X51A 3TLWA 3A5XA 2X66A 4UVAB 4U33A 4U2ZA 3MA9A 1YD8G 2YOEA 1G73A 5FY0A 2UU9T 2WZIA 2J1DG 2FJEA 3TKLB 5HWYA 3PUWF 3Q9DA 3PE0A 4ZZBA 3AE6A 2KSRA 3RQWA 2LSIA 4GIWA 2LSKA 3RH3A 3ZCIA 4HWCA 4JI5T 3QB5K 1HNWT 3L39A 4JI7T 4MFRA 2KZ7B 5AQFB 3AE9A 5FXWA 5AFUL 4JI0T 1X9BA 4TWFA 3VKHA 3K3NA 5FKYA 2VQFT 5LYJE 4AQFA 5AQKB 1IZNB 4X1YE 2V1DB 3C4ZA 4BAYB 2J62A 2VKJA 2UUCT 4TV9E 4HFIA 3OTOT 4LF8T 2V7JA 5C3JA 4O4JE 3PUXF 2DHRA 3RKGA 1VCSA 4NIQA 3AVSA 2XHEB 4UVBB 2FJDA 4M1PA 3CQXC 5CGMA 5BR8T 5J0ZA 2XQ9A 4AKIA 4QXCB 3FZLB 3KINB 4IE4A 3M65A 3TLUA 4HFCA 2W62A 4DMWA 3ONXA 3ZC1A 3CWZB 2LRLA 4A97A 3FXEB 2XM1A 1UK5A 2VKDA 1VOMA 4GKJT 1UURA 4ZI3D 3OPCA 3ZKRA 1ZEEA 2Y8DA 4G2AA 1UUSA 2E5LT 4B3TT 4JLEA 4EYYR 3PU8A 4ILAA 4NXNT 4DUZT 4P1NA 4DR6T 2VL8A 3HKCE 3K8PC 1XWMA 3KFWX 2J47A 3ZJ1A 3T8OA 4WBOA 3RYHE 2YDQA 2X0HA 2L9QA 3VKGA 1N34T 4YFSA 3MZKB 1XNRT 4EAHA 3ZCJA 4AKRB 5IHYA 1D1CA 3F31A 2BKOA 1D0XA 4U7YA 4COFA 3NRYA 4HWFA 5AQMB 5AQGB 2WM9A 3Q5DA 2LRKA 3FZKB 5JDHA 3NBXX 5AQLB 1BR1A 5FMNA 2L8KA 1SA0E 4JBWF 4LMLA 5JDFA 4U2YA 3VR8A 3RGLA 2UXXB 4UXNB 4ZS2A 2WZHA 2XPKA 3PURA 4DUYT 3WAKA 2BKPA 1W9RA 2WY2A 2XJ7A 4U31A 2LE8A 3ZLIA 1YQ4A 1YW0A 3RF1A 2CHNA 5L3BB 1IJ5A 4JI1T 2DNXA 5J1GA 5JQGE 3FZFB 2LHRA 2ACZA 3RPUA 3AA0B 2X9WA 4ILBA 2EHOD 2E5VA 3T1YT 5HWXA 1W0BA 4BJMA 3VRAA 3K3OA 2FJBA 2WCAA 2IDOB 3EDUA 4QKNA 4ADZA 3U3IA 2ZMAA 3I9WA 3BQKA 2N9DA 2A3DA 3QOFA 3CX6B 3RRWA 5FL0A 3RLFF 4IREA 2VL0A 1KEYA 1MIVA 1T8BA 1ZOYA 4ZS3A 4QHOA 3KV5A 3J7Yq 4UF0A 3UFEA 2IAKA 4IIJE 3KV9A 4OHFA 3UQ4A 3LJCA 2RPAA 2NOXA 4O4LE 3AA1B 3ZPOA 5LGNB 3IA3A 4ZOLE 5AQTB 4YSZA 4IE7A 1I6ZA 2OV9A 2VK9A 2WMNA 2C5IT 3RIFA 3O4XE 3LBXA 3E22E 3KV4A 4UF0B 2ZM8A 1BR0A 4TWHA 5FY7A 4UIGA 4EB6E 2UUAT 1MNDA 3MKDA 3RYFE 2XQ4A 3ZSSA 1T72A 3LK42 2HN1A 4P0AA 4FJOA 4PJLA 3O1JA 5LG3A 3LBXB 3GN5A 3C98B 4AKLA 4HTEA 4WZXA 4Z90A 2OA5A 1YXRA 4LF7T 5JDLA 1HNXT 2WSSV 2W2UA 5IUXA 4H63V 5HXCA 2UXBT 3AECA 5CA0E 5LHHB 3GN5B 4B3RT 1IBKT 3H37A 2BS3A 5ABFA 5KXJA 2VB6A 2BKNA 2WDVA 2I6HA 4EEBA 5L2LA 1FIOA 1QLBA 2QGSA 4YXDA 5FY1A 2MOZA 4KMCA 4C90A 3RYCE 5E0OA 2X9XA 2WAUA 3RX6A 3HR0A 5AQQB 1HR0T 5ABFB 2C0SA 2J4GA 3AEAA 4O4HE 3FZMB 3IEEA 2WWUA 5EK2A 2X9HA 2I59A 2NW8A 4KP3C 5HEGA 3N9LA 2LSGA 4DV1T 2CE7A 2KINB 4DO0A 2BBHA 4OYKA 4EZHA 5LG4A 2X9YA 2BDEA 5FXVA 2WWVA 3VRBA 2SPCA 4LFAT 1SHZC 2HHHT 2RA1A 3AEDA 1MMDA 2V7IA 2A9UA 4EYUA 4OFZA 2FBWA 4MLKA 2Y48B 3UQ7A 5HXRA 5LCYA 5JVDE 3FB2A 3ZMTB 2KXPB 2XAJB 5AQSB 3AEFA 4E7SA 4IT4A 4QWNB 3UFGA 4NPPA 5LA6E 2XUEA 2DWGA 3J9X1 5JDNA 3JAFA 3W15B 4X66T 5LB7B 3V5SA 2PBIA 5KDMC 2N1GA 3VR9A 2CXLA 3AE8A 3O1HA 3SWHA 3JADA 2HPJA 3ONLC 5AQHB 2DCFA 4ZI2C 4TX5A 1E2AA 5LMNT 2MAWA 3AB3B 3IF8B 3VU7H 5LHGB 2BG9E 2IUBA 4EGWA 3FBLA 2ZM6T 1MNEA 5HEOA 1T98A 2BVMA 4XAXB 2M67A 2LOSA 1VCTA 3AE1A 1HG2A 4UV9B 2YK0A 3NZQA 3PUGA 3RIAA 2M6BA 1LRZA 2W67A 1JNRA 5A1LA 1HX8A 1M7KA 1W09A 2AE9A 4LMKA 5AQRB 4QXHB 4KI0F 3RKOA 2ZM0A 5HAXA 2H89A 4ASKA 1XDOA 3NRXA 3N9MA 4ZZCA 3QUJA 1N36T 3OKQA 5FL1A 4CXXA 2YN6A 4B6XA 4HEAA 4IDPA 3JC6D 1E7PA 5L3CB 4IDQA 2XAHB 2RP4A 4YHHT 2LHNA 4YJ3E 4PNIA 5LOVE 5ABEA 4B3MT 1LVKA 2K48A 1IBLT 3ZSTA 3V5UA 4L0RA 3SS1A 4EXTA 2X0LB 4DMVA 5HXHA 4L5GA 5JRCA 3AAAB 1WFDA 2JIWA 4JEUB 4JI3T 2FUPA 4G63A 4AI6A 2BG9A 1OEDE 3SOLA 3MK7C 2WB5A 4OYJA 2HN2A 4H63H 2LKGA 1IAPA 5HYAA 2DI4A 4QX7B 4TNVA 3N9NA 3B57A 2XQ8A 5JRCB 1VRBA 4TUYE 4AKGA 2WP9A 2L3LA 3DTOA 3AE3A 3VHLA 3CX7B 2XQ7A 3CQGB 4HWHA 2BG9B 2BG9C 1CUNA 3LG7A 3OVUA 3P4RA 2D5UA 5FVKA 4F8HA 4U72A 4AIUA 1UGOA 3P4SA 5F8PA 3OYXA 4DV3T 1D1AA 3ZT6A 5L3FB 5ABHA 3KBUA 1KF6A 3P8CD 4UVCB 2YEVC 3S4UA 3ZT5A 1X79A 3SFEA 2E9XA 2H88A 2UXDT 2N2NA 2M6IA 3NZPA 1Y01A 4IDOA 4BJNA 1H7CA 2I0MA 4X64T 5JR9A 2E9XB 2E9XC 4GK0E 5J2TE 3UU5A 3C51A 5HEUA 5L3GB 2W63A 3EAMA 2MTQA 1Z0PA 2Q9QA 3NWIA 4OK0A 1SUMB 1E1HB 2CXFA 3P4PA 2XAGB 3H3MA 4O8SA 1OEDA 3E08A 5JR9B 5JR9C 3WI3A 4ZI7E 3UUNA 4ZXLA 1WRDA 3AE5A 4V1Av 4LF5T 3MJXA 5IYZE 2Q9QB 2Q9QC 3OYZA 5DQWA 4I55E 2YDRA 2PTFA 3ZYMA 3T1HT 3ZMVB 2WBLA 4AKHA 1OEDB 1OEDC 3ZMZB 1BR4A 3Q5EA 4DR7T 3O1IA 4LF6T 4DR3T 3FXDB 4JUYA 4JV5T 1NWMX 4I43B 2CPTA 3CVRA 2VKOA 2A72A 4BA9A 1Z8UA 3A8YC 2JQKA 3RIUA 1LKXA 2NW7A 1WYBA 1W0AA 2LOPA 3FBZA 4K0UA 4YT0A 4PW8A 4AISA 3PUSA 4ISSA 1HNZT 1D0ZA 2CRBA 2VWAA 1T7SA 2CXDA 4O2AE 2WQYA 4AXPA 4TZ4C 3BQLA 3RIUC 2QRXA 3CPZA
chains in the Genus database with same CATH topology
3H3MA 3A7MA 3NKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3M A;  3A7M A;  3NKZ A; 
#chains in the Genus database with same CATH topology
 1XMO T;  3BQI A;  3G06 A;  1HX1 B;  3ZMS B;  5JH7 E;  1HF8 A;  4GYS A;  3N2G E;  3M3Z B;  3GA8 A;  2D0U A;  3ZN0 B;  3JCF A;  5ETW A;  3P4W A;  1UX5 A;  4GYR A;  4O4I E;  1DU2 A;  3UUX B;  1V9D A;  2KMF A;  5DJQ C;  3B13 A;  3TLS A;  2V26 A;  3EDV A;  4IGU A;  4C91 A;  3EUH A;  1KFY A;  3ZYK A;  4YTP A;  4ANJ A;  2R6G F;  4WYV A;  1ZP0 A;  3BK9 A;  3A7M A;  2LT3 A;  1LVF A;  2ZLY A;  4EOZ B;  4Z8X A;  5L4H A;  3N9Q A;  2JMK A;  3LK3 B;  4A98 A;  2JRK A;  2V5D A;  5HEH A;  4CN1 A;  2ES0 A;  2NR4 A;  4LFB T;  3UUM A;  2D0T A;  2XAF B;  2CM0 A;  3RI5 A;  4X65 T;  1KNR A;  2W4X A;  1KNP A;  2UXC T;  3F57 A;  2XQY A;  1WYC A;  3KDS E;  1IJ6 A;  1ZHC A;  2V8S V;  1MMG A;  4YSY A;  2LJL A;  3C64 A;  4PFO A;  4LF9 T;  4CI1 B;  1MMA A;  2CBJ A;  4KX6 A;  3H3A A;  2BS4 A;  1I94 T;  4HFV A;  3PDY A;  5LP6 E;  5KX5 E;  4IE5 A;  1R8I A;  2PJQ A;  2IIU A;  2X0Y A;  3IHR A;  3HA4 A;  5F5W A;  2YU1 A;  2KLQ A;  3EAB A;  4QH4 A;  2H3R A;  4Q25 A;  4H9Q C;  5HCM A;  3HI2 A;  4ZI2 D;  2YU2 A;  4I4T E;  1YQ3 A;  5JDQ A;  4XBF B;  3PUA A;  2XQ3 A;  1MMN A;  3AXJ A;  4I0U A;  3CKD A;  2V5C A;  3N2O A;  4ZHQ E;  3KVB A;  2A2F X;  4HFH A;  4IST A;  4JI4 T;  2KT9 A;  4PK5 A;  4EV6 A;  3HKE E;  3Q5W A;  3HKB E;  3GMI A;  3JAE A;  5LMU T;  4U3C A;  3AXJ B;  2YIN A;  4GK5 E;  4DBQ A;  5AQJ B;  3PV0 F;  2AXD S;  3UUL A;  1AJ3 A;  2JPF A;  1NEN A;  3AVR A;  4PJN A;  2C5K T;  4CI3 B;  1JNZ A;  2IC6 A;  3D0T A;  5CB4 E;  1D0Y A;  2VKH A;  1FEW A;  4JI8 T;  2K9A A;  1J1J A;  2XAS B;  2X68 A;  3AEE A;  5LGT B;  4F6R C;  5HEJ A;  3ZYL A;  5LJM A;  2XSB A;  4JEH B;  1HCI A;  4UV8 B;  1SE7 A;  4I50 E;  1HTJ F;  3LSV A;  4ILU A;  4KHP T;  3RYI E;  3ESL A;  4UR9 A;  3AAI A;  3U78 A;  5HXE A;  4DR1 T;  2MYS A;  4PJJ A;  2D2S A;  2XSA A;  1S35 A;  2UUB T;  3RQU A;  2V7L A;  3ONJ A;  3IBP A;  2V7K A;  1S94 A;  4IHJ E;  4HKA A;  4LFC T;  3CK6 A;  3ZMU B;  3QB5 A;  4KBM B;  4IDZ A;  4CI2 B;  1J5E T;  2W0G A;  4A56 A;  4E7Z A;  4DV2 T;  2CCQ A;  3ZT7 A;  3I1A A;  3AE7 A;  4YSX A;  2VVN A;  3ETU A;  4DR5 T;  3KVA A;  2DL1 A;  1CHU A;  2B1E A;  1L0V A;  2LEH A;  3NKZ A;  4QXB B;  3PJA A;  4LMJ A;  1KK7 A;  3AAE B;  4PK6 A;  4DV4 T;  3CIR A;  2OLT A;  4H9P C;  1N33 T;  3RC8 A;  1GQE A;  4X1K E;  1QUU A;  4DR2 T;  2VQE T;  2BVL A;  4PAG A;  2H7O A;  5FYM A;  3UU3 A;  4H9N C;  3Q5X A;  2W00 A;  5JTG A;  4X5T A;  4X1I E;  4P09 A;  2NTX A;  4NUU A;  3HL6 A;  2CA5 A;  5GON E;  2E2A A;  3N9P A;  1NEK A;  3C50 A;  4GKK T;  4N78 D;  1HFA A;  2LSY A;  3LDQ B;  3OBV E;  2V6Y A;  4KHZ F;  4FI5 A;  4IDN A;  2E9X D;  2MPK A;  4UEL A;  3B5M A;  4QX8 B;  1YKE B;  2QYW A;  4YHJ A;  2ODV A;  5LBQ B;  3TLT A;  1Y64 B;  2PFV A;  5AQO B;  5EZY E;  1FJG T;  2DWK A;  2ZM2 A;  2GK9 A;  2V6Y B;  5JDG A;  2LSJ A;  2NP9 A;  2XQA A;  4NXM T;  3AE4 A;  3SFD A;  1MIW A;  4TN7 B;  2Q9Q D;  4H9O C;  3KV6 A;  2KWH A;  3UU4 A;  4AQF C;  2F4V T;  4DV6 T;  2NTY A;  3MXZ A;  4YTN A;  4DR4 T;  4QH1 A;  2NWB A;  4ERR A;  4DV7 T;  1OXZ A;  3AEB A;  2C5J A;  1OWA A;  5AQP B;  4CXW A;  1UCU A;  1WCR A;  2YDS A;  3RRC A;  1IBM T;  3E0Z A;  3FZH B;  2BZB A;  3QNU A;  3I0O A;  3ETV A;  2XTL A;  2ACX A;  5CFB A;  1U5P A;  3GWH A;  4ILC A;  4DV5 T;  4TWD A;  2WU5 A;  4CN6 A;  3K3Q C;  5AQN B;  5H6Q B;  2E8I A;  3AE2 A;  2JQQ A;  4X62 T;  3ZJ2 A;  4EZ4 A;  4EED A;  4X20 E;  3R6N A;  4WBN E;  4YTM A;  5EK3 A;  2CMR A;  2H7V C;  5LJN A;  4CXY A;  2HPL A;  2XQ5 A;  2BS2 A;  3JC6 C;  3LK2 B;  4U74 A;  3WAJ A;  2LM9 A;  3P50 A;  1B7T A;  1UX4 A;  4OX9 T;  2DLR A;  1BR2 A;  4MAL A;  2IW5 B;  3P7I A;  5L47 A;  3L3P A;  3AEG A;  2XZE A;  1US7 B;  2Y6X A;  3PUZ F;  3FHN A;  3C4W A;  4DND A;  2V7M A;  3C4X A;  3ZC0 A;  2WMO A;  2PG8 A;  4UEM A;  2NW9 A;  2FJA A;  3SRZ A;  3Q2M A;  2ODU A;  4TV8 E;  5LXT E;  3NVO A;  4H9S E;  3UT5 E;  3UTK A;  4IE6 A;  5DQV A;  4ZI3 C;  4PJM A;  1N32 T;  2CBI A;  1KNZ A;  4HWD A;  5TAO A;  2CLY B;  2CLY C;  2IC9 A;  1ZV4 X;  2VAS A;  3QC9 A;  4A5X A;  3R84 B;  3HKD E;  4O2B E;  2CEA A;  3OJA A;  5L3E B;  5FVL A;  2WDR A;  2B76 A;  2WDQ A;  2WU2 A;  2K24 A;  2XAQ B;  4GOU A;  4TNW A;  3X1D A;  2D9D A;  5BMV E;  5CA1 E;  4DVD A;  3CQC B;  3DJB A;  5KMG P;  5FNV E;  3PTR B;  5FXX A;  1D1B A;  3LFM A;  1FMV A;  2VUR A;  2G0U A;  5HCJ A;  1J5W A;  1U4Q A;  3KBT A;  2LLY A;  5L3D B;  1XMQ T;  5AQU B;  2JQH A;  3N9O A;  4HFD A;  1EZ3 A;  3EHZ A;  1XZY A;  5LNK A;  4YLH A;  4JI6 T;  2LKH A;  4Z91 A;  2YKS A;  4JI2 T;  5IWA T;  2JQ9 A;  4IL9 A;  3L09 A;  2KND A;  3N5L A;  1ZKE A;  4PK4 A;  3P4Q A;  4H9R C;  3AA7 B;  4YY3 T;  4B3S T;  4MHC A;  2MBG A;  2XQ6 A;  4PFP A;  2IML A;  4J2C A;  2LM2 A;  5LGU B;  1FMW A;  2EHO A;  2V6X A;  4WW0 A;  3I0Q A;  2JMH A;  4DBR A;  1HG5 A;  5AQI B;  2XM2 A;  5ABG A;  3UU6 A;  1MIY A;  4DID B;  2W66 A;  3K1S A;  3N2K E;  1M62 A;  4U7I A;  3F2E A;  5AQV B;  5LBM A;  5FP3 A;  3ZN1 B;  4L9I A;  4HFE A;  2EHO B;  2EHO C;  2VVS A;  4LF4 T;  3TLV A;  4CZZ B;  4MBQ A;  4IL4 A;  2K5B B;  5F3J A;  2IHR 1;  4NUV A;  4HE8 A;  4ZEY A;  2W61 A;  2K3W A;  3CX8 B;  1G8X A;  2BBJ A;  1WR6 A;  4KUM B;  2QVA A;  5M4Y A;  3RC3 A;  5JDM A;  3UU8 A;  3PJA J;  4WNK A;  5L4E A;  3ZEF B;  5C2T A;  4DV0 T;  4AQY T;  4HFB A;  1XDP A;  4AQG A;  3PUV F;  5JRE A;  3RHW A;  3CML A;  1HS7 A;  2X67 A;  3ANW A;  1QSD A;  3O9X A;  2P9B A;  3AA6 B;  5H6R B;  2XY8 B;  4CN4 A;  5LHI B;  3PUY F;  4EIW A;  2Z6E A;  3EI0 A;  4JYA T;  1WR0 A;  5FXZ A;  4CQI A;  2CWO A;  3DP7 A;  2WS3 A;  3ANW B;  3PU3 A;  3L8R A;  3UUB A;  1YKH B;  4XZC A;  1O3X A;  4HGA A;  5CJ5 A;  4HN9 A;  2HH7 A;  3QK6 A;  5J2U E;  3ABV A;  4P0B A;  5DAB A;  5C8Y E;  2JJ9 A;  3EVY A;  4K0K T;  3PUQ A;  4IE0 A;  5HXS A;  2QA7 A;  4QH5 A;  1WLX A;  2UXN B;  1NAF A;  5ADX L;  4YJ2 E;  1XNQ T;  3MAC A;  2CWY A;  2CHO A;  4HWI B;  3I9Y A;  2KWI B;  5EK4 A;  2X51 A;  3TLW A;  3A5X A;  2X66 A;  4UVA B;  4U33 A;  4U2Z A;  3MA9 A;  1YD8 G;  2YOE A;  1G73 A;  5FY0 A;  2UU9 T;  2WZI A;  2J1D G;  2FJE A;  3TKL B;  5HWY A;  3PUW F;  3Q9D A;  3PE0 A;  4ZZB A;  3AE6 A;  2KSR A;  3RQW A;  2LSI A;  4GIW A;  2LSK A;  3RH3 A;  3ZCI A;  4HWC A;  4JI5 T;  3QB5 K;  1HNW T;  3L39 A;  4JI7 T;  4MFR A;  2KZ7 B;  5AQF B;  3AE9 A;  5FXW A;  5AFU L;  4JI0 T;  1X9B A;  4TWF A;  3VKH A;  3K3N A;  5FKY A;  2VQF T;  5LYJ E;  4AQF A;  5AQK B;  1IZN B;  4X1Y E;  2V1D B;  3C4Z A;  4BAY B;  2J62 A;  2VKJ A;  2UUC T;  4TV9 E;  4HFI A;  3OTO T;  4LF8 T;  2V7J A;  5C3J A;  4O4J E;  3PUX F;  2DHR A;  3RKG A;  1VCS A;  4NIQ A;  3AVS A;  2XHE B;  4UVB B;  2FJD A;  4M1P A;  3CQX C;  5CGM A;  5BR8 T;  5J0Z A;  2XQ9 A;  4AKI A;  4QXC B;  3FZL B;  3KIN B;  4IE4 A;  3M65 A;  3TLU A;  4HFC A;  2W62 A;  4DMW A;  3ONX A;  3ZC1 A;  3CWZ B;  2LRL A;  4A97 A;  3FXE B;  2XM1 A;  1UK5 A;  2VKD A;  1VOM A;  4GKJ T;  1UUR A;  4ZI3 D;  3OPC A;  3ZKR A;  1ZEE A;  2Y8D A;  4G2A A;  1UUS A;  2E5L T;  4B3T T;  4JLE A;  4EYY R;  3PU8 A;  4ILA A;  4NXN T;  4DUZ T;  4P1N A;  4DR6 T;  2VL8 A;  3HKC E;  3K8P C;  1XWM A;  3KFW X;  2J47 A;  3ZJ1 A;  3T8O A;  4WBO A;  3RYH E;  2YDQ A;  2X0H A;  2L9Q A;  3VKG A;  1N34 T;  4YFS A;  3MZK B;  1XNR T;  4EAH A;  3ZCJ A;  4AKR B;  5IHY A;  1D1C A;  3F31 A;  2BKO A;  1D0X A;  4U7Y A;  4COF A;  3NRY A;  4HWF A;  5AQM B;  5AQG B;  2WM9 A;  3Q5D A;  2LRK A;  3FZK B;  5JDH A;  3NBX X;  5AQL B;  1BR1 A;  5FMN A;  2L8K A;  1SA0 E;  4JBW F;  4LML A;  5JDF A;  4U2Y A;  3VR8 A;  3RGL A;  2UXX B;  4UXN B;  4ZS2 A;  2WZH A;  2XPK A;  3PUR A;  4DUY T;  3WAK A;  2BKP A;  1W9R A;  2WY2 A;  2XJ7 A;  4U31 A;  2LE8 A;  3ZLI A;  1YQ4 A;  1YW0 A;  3RF1 A;  2CHN A;  5L3B B;  1IJ5 A;  4JI1 T;  2DNX A;  5J1G A;  5JQG E;  3FZF B;  2LHR A;  2ACZ A;  3RPU A;  3AA0 B;  2X9W A;  4ILB A;  2EHO D;  2E5V A;  3T1Y T;  5HWX A;  1W0B A;  4BJM A;  3VRA A;  3K3O A;  2FJB A;  2WCA A;  2IDO B;  3EDU A;  4QKN A;  4ADZ A;  3U3I A;  2ZMA A;  3I9W A;  3BQK A;  2N9D A;  2A3D A;  3QOF A;  3CX6 B;  3RRW A;  5FL0 A;  3RLF F;  4IRE A;  2VL0 A;  1KEY A;  1MIV A;  1T8B A;  1ZOY A;  4ZS3 A;  4QHO A;  3KV5 A;  3J7Y q;  4UF0 A;  3UFE A;  2IAK A;  4IIJ E;  3KV9 A;  4OHF A;  3UQ4 A;  3LJC A;  2RPA A;  2NOX A;  4O4L E;  3AA1 B;  3ZPO A;  5LGN B;  3IA3 A;  4ZOL E;  5AQT B;  4YSZ A;  4IE7 A;  1I6Z A;  2OV9 A;  2VK9 A;  2WMN A;  2C5I T;  3RIF A;  3O4X E;  3LBX A;  3E22 E;  3KV4 A;  4UF0 B;  2ZM8 A;  1BR0 A;  4TWH A;  5FY7 A;  4UIG A;  4EB6 E;  2UUA T;  1MND A;  3MKD A;  3RYF E;  2XQ4 A;  3ZSS A;  1T72 A;  3LK4 2;  2HN1 A;  4P0A A;  4FJO A;  4PJL A;  3O1J A;  5LG3 A;  3LBX B;  3GN5 A;  3C98 B;  4AKL A;  4HTE A;  4WZX A;  4Z90 A;  2OA5 A;  1YXR A;  4LF7 T;  5JDL A;  1HNX T;  2WSS V;  2W2U A;  5IUX A;  4H63 V;  5HXC A;  2UXB T;  3AEC A;  5CA0 E;  5LHH B;  3GN5 B;  4B3R T;  1IBK T;  3H37 A;  2BS3 A;  5ABF A;  5KXJ A;  2VB6 A;  2BKN A;  2WDV A;  2I6H A;  4EEB A;  5L2L A;  1FIO A;  1QLB A;  2QGS A;  4YXD A;  5FY1 A;  2MOZ A;  4KMC A;  4C90 A;  3RYC E;  5E0O A;  2X9X A;  2WAU A;  3RX6 A;  3HR0 A;  5AQQ B;  1HR0 T;  5ABF B;  2C0S A;  2J4G A;  3AEA A;  4O4H E;  3FZM B;  3IEE A;  2WWU A;  5EK2 A;  2X9H A;  2I59 A;  2NW8 A;  4KP3 C;  5HEG A;  3N9L A;  2LSG A;  4DV1 T;  2CE7 A;  2KIN B;  4DO0 A;  2BBH A;  4OYK A;  4EZH A;  5LG4 A;  2X9Y A;  2BDE A;  5FXV A;  2WWV A;  3VRB A;  2SPC A;  4LFA T;  1SHZ C;  2HHH T;  2RA1 A;  3AED A;  1MMD A;  2V7I A;  2A9U A;  4EYU A;  4OFZ A;  2FBW A;  4MLK A;  2Y48 B;  3UQ7 A;  5HXR A;  5LCY A;  5JVD E;  3FB2 A;  3ZMT B;  2KXP B;  2XAJ B;  5AQS B;  3AEF A;  4E7S A;  4IT4 A;  4QWN B;  3UFG A;  4NPP A;  5LA6 E;  2XUE A;  2DWG A;  3J9X 1;  5JDN A;  3JAF A;  3W15 B;  4X66 T;  5LB7 B;  3V5S A;  2PBI A;  5KDM C;  2N1G A;  3VR9 A;  2CXL A;  3AE8 A;  3O1H A;  3SWH A;  3JAD A;  2HPJ A;  3ONL C;  5AQH B;  2DCF A;  4ZI2 C;  4TX5 A;  1E2A A;  5LMN T;  2MAW A;  3AB3 B;  3IF8 B;  3VU7 H;  5LHG B;  2BG9 E;  2IUB A;  4EGW A;  3FBL A;  2ZM6 T;  1MNE A;  5HEO A;  1T98 A;  2BVM A;  4XAX B;  2M67 A;  2LOS A;  1VCT A;  3AE1 A;  1HG2 A;  4UV9 B;  2YK0 A;  3NZQ A;  3PUG A;  3RIA A;  2M6B A;  1LRZ A;  2W67 A;  1JNR A;  5A1L A;  1HX8 A;  1M7K A;  1W09 A;  2AE9 A;  4LMK A;  5AQR B;  4QXH B;  4KI0 F;  3RKO A;  2ZM0 A;  5HAX A;  2H89 A;  4ASK A;  1XDO A;  3NRX A;  3N9M A;  4ZZC A;  3QUJ A;  1N36 T;  3OKQ A;  5FL1 A;  4CXX A;  2YN6 A;  4B6X A;  4HEA A;  4IDP A;  3JC6 D;  1E7P A;  5L3C B;  4IDQ A;  2XAH B;  2RP4 A;  4YHH T;  2LHN A;  4YJ3 E;  4PNI A;  5LOV E;  5ABE A;  4B3M T;  1LVK A;  2K48 A;  1IBL T;  3ZST A;  3V5U A;  4L0R A;  3SS1 A;  4EXT A;  2X0L B;  4DMV A;  5HXH A;  4L5G A;  5JRC A;  3AAA B;  1WFD A;  2JIW A;  4JEU B;  4JI3 T;  2FUP A;  4G63 A;  4AI6 A;  2BG9 A;  1OED E;  3SOL A;  3MK7 C;  2WB5 A;  4OYJ A;  2HN2 A;  4H63 H;  2LKG A;  1IAP A;  5HYA A;  2DI4 A;  4QX7 B;  4TNV A;  3N9N A;  3B57 A;  2XQ8 A;  5JRC B;  1VRB A;  4TUY E;  4AKG A;  2WP9 A;  2L3L A;  3DTO A;  3AE3 A;  3VHL A;  3CX7 B;  2XQ7 A;  3CQG B;  4HWH A;  2BG9 B;  2BG9 C;  1CUN A;  3LG7 A;  3OVU A;  3P4R A;  2D5U A;  5FVK A;  4F8H A;  4U72 A;  4AIU A;  1UGO A;  3P4S A;  5F8P A;  3OYX A;  4DV3 T;  1D1A A;  3ZT6 A;  5L3F B;  5ABH A;  3KBU A;  1KF6 A;  3P8C D;  4UVC B;  2YEV C;  3S4U A;  3ZT5 A;  1X79 A;  3SFE A;  2E9X A;  2H88 A;  2UXD T;  2N2N A;  2M6I A;  3NZP A;  1Y01 A;  4IDO A;  4BJN A;  1H7C A;  2I0M A;  4X64 T;  5JR9 A;  2E9X B;  2E9X C;  4GK0 E;  5J2T E;  3UU5 A;  3C51 A;  5HEU A;  5L3G B;  2W63 A;  3EAM A;  2MTQ A;  1Z0P A;  2Q9Q A;  3NWI A;  4OK0 A;  1SUM B;  1E1H B;  2CXF A;  3P4P A;  2XAG B;  3H3M A;  4O8S A;  1OED A;  3E08 A;  5JR9 B;  5JR9 C;  3WI3 A;  4ZI7 E;  3UUN A;  4ZXL A;  1WRD A;  3AE5 A;  4V1A v;  4LF5 T;  3MJX A;  5IYZ E;  2Q9Q B;  2Q9Q C;  3OYZ A;  5DQW A;  4I55 E;  2YDR A;  2PTF A;  3ZYM A;  3T1H T;  3ZMV B;  2WBL A;  4AKH A;  1OED B;  1OED C;  3ZMZ B;  1BR4 A;  3Q5E A;  4DR7 T;  3O1I A;  4LF6 T;  4DR3 T;  3FXD B;  4JUY A;  4JV5 T;  1NWM X;  4I43 B;  2CPT A;  3CVR A;  2VKO A;  2A72 A;  4BA9 A;  1Z8U A;  3A8Y C;  2JQK A;  3RIU A;  1LKX A;  2NW7 A;  1WYB A;  1W0A A;  2LOP A;  3FBZ A;  4K0U A;  4YT0 A;  4PW8 A;  4AIS A;  3PUS A;  4ISS A;  1HNZ T;  1D0Z A;  2CRB A;  2VWA A;  1T7S A;  2CXD A;  4O2A E;  2WQY A;  4AXP A;  4TZ4 C;  3BQL A;  3RIU C;  2QRX A;  3CPZ A; 
#chains in the Genus database with same CATH homology
 3H3M A;  3A7M A;  3NKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...