3A7MA

Structure of flit, the flagellar type iii chaperone for flid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
TSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQSTRQKSLNNAYGRLSGMLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein fliT
publication title Structural insight into the regulatory mechanisms of interactions of the flagellar type III chaperone FliT with its binding partners.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation, chaperone
total genus 41
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3a7mA01
3A7MA 3NKZA 3H3MA
chains in the Genus database with same CATH superfamily
2E9XB 2P9BA 2W62A 3ESLA 5JQGE 2RPAA 3HKBE 3UU8A 5CJ5A 1UK5A 4AQYT 3N2OA 2VQET 4YLHA 2YOEA 1ZEEA 3PUQA 3RIUA 4JI3T 2EHOB 2H88A 3GN5B 4U3CA 1LVFA 4IE5A 1HR0T 4K0UA 2KT9A 4KX6A 1SE7A 2JQQA 3KV4A 4NPPA 2BG9C 3B13A 5KMGP 1US7B 2L9QA 4JLEA 3RYFE 3WI3A 2KNDA 3NRXA 4IT4A 3CQCB 1T7SA 3AA0B 3X1DA 2IC9A 4ADZA 3ZC1A 4U2ZA 3AE3A 5J2TE 2CBJA 1WR6A 2WCAA 3OTOT 1HS7A 5AQMB 3E22E 2WWVA 3IHRA 4KBMB 2OV9A 2CLYC 4L9IA 4DUYT 2BVLA 2XQ6A 4DR3T 2UXXB 2XY8B 3B57A 3P7IA 3PJAA 3BQIA 3ANWB 4ZHQE 1MMAA 3Q5XA 5HEUA 5JDLA 4EOZB 1HG5A 2AXDS 2NW7A 2H7OA 3TLTA 4YTPA 5HYAA 3ZJ1A 2V26A 4U7IA 2KINB 3RX6A 4V1Av 4U2YA 2W66A 5AQHB 5J2UE 2PG8A 3PUXF 4OYJA 2H89A 3AECA 5IUXA 4ZOLE 4A5XA 4KI0F 4ILUA 4AISA 2Q9QD 1UUSA 2CPTA 1D1BA 2Y8DA 2PTFA 3CWZB 2M67A 5L47A 3UU3A 5LG3A 4O8SA 2HH7A 2VKDA 5LGNB 4DV2T 1YKEB 1QUUA 4B3RT 4DR4T 2NW9A 4CXYA 2L3LA 2Q9QA 4IGUA 1XZYA 2PBIA 3JAFA 3ZMSB 2KLQA 4KUMB 5JR9C 5J1GA 4JI7T 5AQSB 3AA1B 2IC6A 3Q9DA 4HWIB 4IDNA 4B3MT 2JMHA 4WZXA 4CI3B 2ODVA 3I9WA 3P4RA 4H9NC 2CWOA 2UXNB 4NUUA 5HWYA 4DR6T 2V5CA 4ILBA 3VR9A 4Z8XA 4XAXB 3UULA 4TX5A 5EK2A 2B1EA 4C90A 2W0GA 4UIGA 1IBKT 3ZEFB 2XM1A 3UQ4A 3KVAA 2RA1A 2WMNA 2V7JA 5LBQB 3IF8B 4U74A 4IIJE 3CIRA 2LHRA 2XHEB 2E5LT 2LKGA 4DUZT 2YDRA 2MBGA 4UEMA 1M62A 4EEBA 2LT3A 3E0ZA 2WWUA 3UFGA 1XNQT 1N33T 4PJLA 1GQEA 2IAKA 4X1YE 5FXXA 2VL0A 4HE8A 3H37A 4EV6A 4CN4A 2BG9A 5HXCA 5L3FB 3ZT5A 3ETUA 3KV9A 1FMVA 3RC8A 4TV9E 2XQ9A 2V7MA 4H9SE 3LSVA 2DI4A 2XAGB 2WMOA 1YD8G 3B5MA 2A2FX 3OKQA 2YN6A 4YHJA 4J2CA 3RIFA 3KVBA 3UUMA 4AKHA 4HEAA 3FZMB 3WAJA 2BG9E 5AQFB 4JI5T 5FXVA 1HF8A 5IHYA 1E1HB 1E7PA 3J7Yq 4LFAT 4FI5A 4XZCA 2VKJA 3EI0A 3EHZA 5C3JA 3L8RA 3Q5WA 3PUZF 1SHZC 3VU7H 3OYXA 4ZZBA 2JPFA 3UQ7A 4NXNT 1KNZA 1AJ3A 4LFBT 1Z8UA 2JRKA 5DJQC 5JDHA 2W4XA 2ZM6T 3IBPA 1ZKEA 3OVUA 2BBJA 4LF6T 3DP7A 4AQFC 5FXWA 3LK3B 5LJNA 2D2SA 3ZLIA 2VWAA 3NKZA 3TLVA 3F2EA 2JJ9A 4X1IE 2N1GA 4GKJT 1FIOA 4HTEA 4AKGA 4ASKA 4COFA 2X9WA 5AQKB 3CX7B 4ZS3A 4YSXA 2CXDA 2YINA 3AEFA 3ZCJA 5FP3A 3PUYF 4GYSA 5FL0A 5JR9A 2MTQA 3EUHA 3FB2A 4GIWA 4UF0B 2ZM0A 4IE7A 2CE7A 1IBMT 4KP3C 2X9XA 2HN1A 5L3BB 3P50A 2DCFA 2H7VC 3N9PA 5LB7B 1VOMA 1UX5A 2IW5B 2FJAA 3FZHB 3H3AA 4P09A 2OLTA 3NVOA 1SUMB 2PFVA 2NW8A 1JNZA 2JIWA 3AAEB 4QH1A 5L4HA 2E2AA 3RI5A 4L0RA 2CCQA 4DBQA 2K24A 5TAOA 2YDQA 4QHOA 3ZMZB 4FJOA 5C2TA 1G73A 1L0VA 5JDQA 3L09A 3NZQA 3KBUA 1HNWT 2BKOA 2LSYA 2UXCT 4CXWA 4C91A 4O4JE 5ABGA 1NENA 4H9QC 2JMKA 4TZ4C 1UURA 3ZSTA 4OK0A 5F5WA 2A3DA 3CPZA 4HFVA 1LRZA 3A5XA 3R6NA 4IL4A 5AQGB 3EAMA 3ZMUB 4UXNB 3NRYA 4ZI2C 1Z0PA 5HXEA 4G63A 3LBXB 5EZYE 5L3CB 2WSSV 2IUBA 4KHZF 3KV5A 4BAYB 3FZKB 4OHFA 4HFHA 2X0LB 2UUCT 1VRBA 4DR5T 2BS2A 4TWHA 2V7KA 1YQ3A 5KX5E 5HWXA 5AQUB 2KSRA 2H3RA 3NWIA 4HWDA 4Z91A 2WS3A 4IREA 3GN5A 1J1JA 2V5DA 1DU2A 5LOVE 3RQUA 3AAIA 3PUAA 5DABA 3EDVA 1IBLT 2VVSA 3V5UA 5JH7E 3P4QA 3Q5EA 2VURA 3PTRB 3T8OA 4PK5A 4CXXA 4AQFA 2LHNA 4DVDA 2X51A 4H9OC 4JYAT 3UU4A 3ABVA 2JQ9A 3RC3A 3P4WA 1YXRA 3LG7A 2X68A 3MACA 1MIYA 4HFDA 5FKYA 5HXSA 3D0TA 3EDUA 1MIWA 4HKAA 4U72A 5EK4A 2XSBA 4E7ZA 5KDMC 4ILCA 2WU2A 4HFIA 3QK6A 1UCUA 3OYZA 4DR7T 2CHOA 2LSIA 4P0AA 3A8YC 1J5WA 4PAGA 4GK5E 2ACXA 1WRDA 4ZI3C 4QWNB 2XUEA 3ANWA 3TKLB 4AIUA 2D9DA 1W0AA 5JRCB 3C4WA 2BVMA 3ETVA 2J4GA 5JVDE 4A98A 2X0YA 3RF1A 4EZ4A 3RIAA 3ONLC 5LYJE 3A7MA 4AKIA 4NIQA 4JBWF 2Y48B 5ABEA 3LDQB 4M1PA 4LMJA 4IE4A 2ZLYA 1IJ6A 3AEAA 3UFEA 4JI4T 4O4IE 5F8PA 2BS3A 3ZMVB 1OWAA 2LOPA 2HHHT 4IL9A 5ABFA 2VQFT 3QNUA 3BQKA 1FMWA 3CX8B 5AQLB 4ZI2D 5ETWA 3CQGB 5FXZA 4DV5T 1ZHCA 4P0BA 4PFOA 2R6GF 5AQJB 3QOFA 4IDOA 3RHWA 3AA7B 4QXCB 5LJMA 2J47A 4A97A 2CWYA 4NUVA 1XNRT 5AQIB 1HX8A 3TLUA 5KXJA 4U7YA 5ABHA 2Z6EA 2NTYA 2KWHA 4DV0T 2NR4A 1BR4A 1KF6A 5DQVA 5HXRA 4PJMA 4UR9A 4ILAA 2ZMAA 2BS4A 3O1IA 4TWFA 3AE8A 2CBIA 4DMWA 4DV3T 3JCFA 1KK7A 4GOUA 4DV6T 4UVBB 4B6XA 3C50A 5AQTB 3K3QC 4AI6A 2XASB 2K48A 5LGTB 3UUXB 1G8XA 3AE2A 3HI2A 2FJEA 2E8IA 3FBLA 4PFPA 1OEDB 5FNVE 3NZPA 3FXDB 5LMNT 2RP4A 3LK2B 3HKEE 1W09A 2CEAA 3VRAA 1S94A 3QC9A 4JI1T 1D0ZA 3CVRA 4YJ2E 2BZBA 5LHHB 4CN6A 2NTXA 2DL1A 5FL1A 4GK0E 4ZI3D 4TWDA 2UUBT 3TLWA 3V5SA 2LKHA 3OPCA 3K3OA 3ZKRA 5FY1A 3KINB 4HFEA 2D0UA 4EAHA 2XSAA 4YTNA 5LA6E 2VL8A 4H9RC 2XM2A 1YKHB 4HN9A 3HL6A 2E9XC 2X0HA 2XQ8A 3AE4A 1QSDA 3I0OA 2V6XA 1X79A 3AE5A 5BR8T 1D1AA 3NBXX 1EZ3A 2J1DG 3RH3A 4X1KE 2W2UA 3N9NA 3AXJB 1KNRA 2X67A 3PDYA 4E7SA 2EHOC 4EYYR 3BK9A 3M65A 5HXHA 2FUPA 3SFDA 2V1DB 2DHRA 5CA0E 2XQYA 4I55E 1I6ZA 4YTMA 5JDNA 4JI6T 4JI8T 1ZV4X 5JDMA 4DV7T 2LSKA 3KBTA 3HA4A 3AB3B 2MOZA 2KZ7B 3F57A 5CFBA 4Z90A 3JC6C 2CLYB 2J62A 4IE0A 2YKSA 4H63V 1CUNA 3HR0A 4PJNA 3BQLA 1IAPA 3RQWA 2LE8A 3RRWA 4UF0A 2BKNA 4X20E 3T1YT 4ISSA 4DO0A 4X66T 2XQ3A 3PUVF 4LF9T 1KEYA 3DTOA 5AQPB 2UXBT 2NWBA 3N9MA 4IDQA 2XAFB 2XQ4A 1NWMX 2WDVA 2V6YB 3RKGA 2UU9T 4U31A 4PNIA 3FZLB 1XDOA 2MYSA 4I43B 4YY3T 1BR2A 1O3XA 4F6RC 1I94T 2G0UA 4YXDA 3KDSE 3ZN0B 3AE7A 5J0ZA 4UELA 4HWCA 2FJBA 2W61A 4NXMT 1W0BA 5IWAT 5LMUT 2YU1A 2N9DA 5HCMA 2ODUA 4JEUB 4DV4T 5FY7A 3AVRA 2AE9A 2QYWA 4MFRA 1UGOA 3AAAB 2CXLA 3CX6B 3I1AA 3EVYA 5JDGA 1HTJF 4WW0A 5FYMA 1NAFA 3ONXA 3ZYKA 3OJAA 3PE0A 4DR1T 4TUYE 1D0YA 3Q2MA 3I0QA 2BDEA 2Y6XA 2XZEA 3CQXC 4B3ST 1WLXA 3HKDE 3ZT6A 2E9XD 5LBMA 3RYIE 5LCYA 3MJXA 5FY0A 3TLSA 1T8BA 4TN7B 2F4VT 3GA8A 3ZMTB 2CXFA 1QLBA 3RLFF 4LF8T 4MLKA 4BJNA 1BR1A 2XAJB 2X9HA 2M6IA 2KXPB 3AA6B 4CN1A 4WNKA 2E9XA 2BBHA 2EHOD 2L8KA 3M3ZB 4UV9B 4LMLA 3UUBA 2WDQA 4YJ3E 1OEDC 3IA3A 2V7LA 4PJJA 3N2GE 5HEHA 1WYBA 3AEEA 1OXZA 4EIWA 4AKRB 4KMCA 3MZKB 1N36T 2C5JA 2LRLA 2WY2A 4QXBB 3JC6D 4O2BE 2QA7A 4ANJA 1X9BA 2EHOA 1MMDA 3RRCA 3JADA 3R84B 2MPKA 3PUGA 5JDFA 4YSZA 3SS1A 3C51A 4DMVA 5HAXA 2I59A 3AEBA 4AXPA 3ZSSA 4ZS2A 2WDRA 1WCRA 4LMKA 5JREA 2GK9A 2LJLA 4HGAA 5HEGA 5M4YA 2CHNA 2XJ7A 3RKOA 1Y64B 5LGUB 4P1NA 4TNVA 3AEDA 5CGMA 2XQ7A 2JQHA 3SFEA 1D0XA 5HEJA 1IJ5A 4DIDB 4I50E 3RYCE 4A56A 3H3MA 2BKPA 3EABA 3I9YA 3VKGA 4EEDA 5JRCA 4MALA 1SA0E 2HPJA 1V9DA 4EGWA 2LSGA 4ZI7E 4OX9T 2WQYA 2HN2A 2W00A 1HFAA 3K8PC 4N78D 1VCSA 3DJBA 5JTGA 4U33A 3UUNA 2HPLA 2WM9A 2N2NA 3MK7C 2VKOA 5LXTE 2WB5A 3KV6A 2DNXA 3S4UA 4TNWA 3RGLA 4CI1B 4YFSA 3GMIA 1XMOT 5FVKA 2KWIB 3FXEB 4KHPT 2CM0A 3L3PA 5BMVE 2VASA 3GWHA 1WR0A 4TV8E 5HEOA 1WFDA 4MHCA 5IYZE 3ZCIA 3ZC0A 1KFYA 2CA5A 3QB5K 3AE6A 4XBFB 4JEHB 2DLRA 1T72A 2PJQA 3J9X1 2W67A 3P4SA 3ZT7A 4QKNA 5LHGB 3JAEA 4DNDA 4F8HA 5LP6E 4IE6A 1B7TA 4H63H 3N9OA 2LLYA 2LEHA 4HFBA 3VKHA 3C4ZA 3PURA 4ERRA 2E5VA 4WYVA 1H7CA 5HCJA 5AQVB 3QUJA 4EXTA 4ZXLA 2YK0A 3ZYMA 2LRKA 3LJCA 3VHLA 2VK9A 3O1HA 3VR8A 1LVKA 5AQNB 1Y01A 5ABFB 4O4HE 1N34T 4O2AE 4LF5T 4LF7T 3PJAJ 1HX1B 4ISTA 1OEDA 1ZP0A 1W9RA 2YU2A 4L5GA 2I6HA 2JQKA 5A1LA 4HWHA 5L3EB 3O1JA 3IEEA 1YQ4A 2Q9QB 3U3IA 3P8CD 4CI2B 4WBOA 3RYHE 2XTLA 1MIVA 2YEVC 1UX4A 2IMLA 1XWMA 1OEDE 2QGSA 3FHNA 3SOLA 4LFCT 4X64T 4ZEYA 3G06A 1J5ET 2D0TA 5ADXL 2W63A 3PUWF 1NEKA 1E2AA 2B76A 4JI2T 5AQQB 2ES0A 2IDOB 3LFMA 1HCIA 4OYKA 5FVLA 4X62T 2CMRA 3T1HT 3P4PA 1WYCA 1U4QA 4IDZA 5AQRB 2NOXA 4Q25A 2XQAA 2XPKA 2C0SA 3N5LA 1MNDA 2D5UA 5H6QB 2LM2A 3AXJA 3N9LA 4EYUA 1M7KA 4DBRA 4AQGA 2ZM8A 2VVNA 3ZYLA 3QB5A 3OBVE 5C8YE 4HFCA 5AQOB 1D1CA 2BG9B 2DWKA 1KNPA 3CKDA 3ZN1B 3LK42 2I0MA 1T98A 4UV8B 4CZZB 2C5IT 3L39A 5GONE 4EB6E 2DWGA 4IDPA 1XMQT 5CB4E 3RPUA 3UU6A 3K1SA 3O9XA 1FJGT 2LOSA 2QVAA 5FMNA 2UXDT 4JI0T 3UTKA 3W15B 4JV5T 3F31A 3C98B 2LM9A 2M6BA 3PU3A 1MMGA 2FJDA 3FBZA 2K3WA 5E0OA 2K5BB 3AE1A 1MMNA 3ZJ2A 4GKKT 4HWFA 1HG2A 4JUYA 1CHUA 1HNXT 3MKDA 4YSYA 3RIUC 2FBWA 2V8SV 3FZFB 4X65T 2V6YA 3MA9A 1R8IA 1LKXA 2K9AA 2SPCA 2WU5A 2LSJA 4H9PC 2YDSA 4QXHB 2UUAT 2X9YA 2A9UA 4PK4A 1N32T 1S35A 2XQ5A 3AVSA 5L4EA 2WBLA 1XDPA 3MXZA 3U78A 3N9QA 4BA9A 4EZHA 4AKLA 4DR2T 5L2LA 3CK6A 5LHIB 4LF4T 3E08A 3C64A 4I4TE 4ZZCA 1FEWA 2ACZA 5JR9B 3O4XE 2WP9A 5LNKA 3ZPOA 4YT0A 3HKCE 2VB6A 3SWHA 1BR0A 4G2AA 2QRXA 3UU5A 2ZM2A 2MAWA 3PV0F 3VRBA 3N2KE 5L3DB 2WAUA 4YHHT 2IIUA 2KMFA 4I0UA 2OA5A 2A72A 3KFWX 3LBXA 4MBQA 3PUSA 4QX8B 5F3JA 4QH5A 2VKHA 5L3GB 1VCTA 4GYRA 5AFUL 3UT5E 4O4LE 4UVAB 2WZIA 4QX7B 1HNZT 1JNRA 3ONJA 4OFZA 3PU8A 2IHR1 2Q9QC 3AE9A 1YW0A 3WAKA 5DQWA 4B3TT 3AEGA 2X66A 2WZHA 4PK6A 4DV1T 4K0KT 2C5KT 4IHJE 4PW8A 3SRZA 1MNEA 2V7IA 4QH4A 3C4XA 3CMLA 1IZNB 1ZOYA 2XAQB 1U5PA 2XAHB 5LG4A 4CQIA 3K3NA 3Q5DA 5CA1E 4UVCB 2CRBA 4WBNE 4BJMA 2NP9A 4X5TA 5EK3A 5H6RB
chains in the Genus database with same CATH topology
3A7MA 3NKZA 3H3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7M A;  3NKZ A;  3H3M A; 
#chains in the Genus database with same CATH topology
 2E9X B;  2P9B A;  2W62 A;  3ESL A;  5JQG E;  2RPA A;  3HKB E;  3UU8 A;  5CJ5 A;  1UK5 A;  4AQY T;  3N2O A;  2VQE T;  4YLH A;  2YOE A;  1ZEE A;  3PUQ A;  3RIU A;  4JI3 T;  2EHO B;  2H88 A;  3GN5 B;  4U3C A;  1LVF A;  4IE5 A;  1HR0 T;  4K0U A;  2KT9 A;  4KX6 A;  1SE7 A;  2JQQ A;  3KV4 A;  4NPP A;  2BG9 C;  3B13 A;  5KMG P;  1US7 B;  2L9Q A;  4JLE A;  3RYF E;  3WI3 A;  2KND A;  3NRX A;  4IT4 A;  3CQC B;  1T7S A;  3AA0 B;  3X1D A;  2IC9 A;  4ADZ A;  3ZC1 A;  4U2Z A;  3AE3 A;  5J2T E;  2CBJ A;  1WR6 A;  2WCA A;  3OTO T;  1HS7 A;  5AQM B;  3E22 E;  2WWV A;  3IHR A;  4KBM B;  2OV9 A;  2CLY C;  4L9I A;  4DUY T;  2BVL A;  2XQ6 A;  4DR3 T;  2UXX B;  2XY8 B;  3B57 A;  3P7I A;  3PJA A;  3BQI A;  3ANW B;  4ZHQ E;  1MMA A;  3Q5X A;  5HEU A;  5JDL A;  4EOZ B;  1HG5 A;  2AXD S;  2NW7 A;  2H7O A;  3TLT A;  4YTP A;  5HYA A;  3ZJ1 A;  2V26 A;  4U7I A;  2KIN B;  3RX6 A;  4V1A v;  4U2Y A;  2W66 A;  5AQH B;  5J2U E;  2PG8 A;  3PUX F;  4OYJ A;  2H89 A;  3AEC A;  5IUX A;  4ZOL E;  4A5X A;  4KI0 F;  4ILU A;  4AIS A;  2Q9Q D;  1UUS A;  2CPT A;  1D1B A;  2Y8D A;  2PTF A;  3CWZ B;  2M67 A;  5L47 A;  3UU3 A;  5LG3 A;  4O8S A;  2HH7 A;  2VKD A;  5LGN B;  4DV2 T;  1YKE B;  1QUU A;  4B3R T;  4DR4 T;  2NW9 A;  4CXY A;  2L3L A;  2Q9Q A;  4IGU A;  1XZY A;  2PBI A;  3JAF A;  3ZMS B;  2KLQ A;  4KUM B;  5JR9 C;  5J1G A;  4JI7 T;  5AQS B;  3AA1 B;  2IC6 A;  3Q9D A;  4HWI B;  4IDN A;  4B3M T;  2JMH A;  4WZX A;  4CI3 B;  2ODV A;  3I9W A;  3P4R A;  4H9N C;  2CWO A;  2UXN B;  4NUU A;  5HWY A;  4DR6 T;  2V5C A;  4ILB A;  3VR9 A;  4Z8X A;  4XAX B;  3UUL A;  4TX5 A;  5EK2 A;  2B1E A;  4C90 A;  2W0G A;  4UIG A;  1IBK T;  3ZEF B;  2XM1 A;  3UQ4 A;  3KVA A;  2RA1 A;  2WMN A;  2V7J A;  5LBQ B;  3IF8 B;  4U74 A;  4IIJ E;  3CIR A;  2LHR A;  2XHE B;  2E5L T;  2LKG A;  4DUZ T;  2YDR A;  2MBG A;  4UEM A;  1M62 A;  4EEB A;  2LT3 A;  3E0Z A;  2WWU A;  3UFG A;  1XNQ T;  1N33 T;  4PJL A;  1GQE A;  2IAK A;  4X1Y E;  5FXX A;  2VL0 A;  4HE8 A;  3H37 A;  4EV6 A;  4CN4 A;  2BG9 A;  5HXC A;  5L3F B;  3ZT5 A;  3ETU A;  3KV9 A;  1FMV A;  3RC8 A;  4TV9 E;  2XQ9 A;  2V7M A;  4H9S E;  3LSV A;  2DI4 A;  2XAG B;  2WMO A;  1YD8 G;  3B5M A;  2A2F X;  3OKQ A;  2YN6 A;  4YHJ A;  4J2C A;  3RIF A;  3KVB A;  3UUM A;  4AKH A;  4HEA A;  3FZM B;  3WAJ A;  2BG9 E;  5AQF B;  4JI5 T;  5FXV A;  1HF8 A;  5IHY A;  1E1H B;  1E7P A;  3J7Y q;  4LFA T;  4FI5 A;  4XZC A;  2VKJ A;  3EI0 A;  3EHZ A;  5C3J A;  3L8R A;  3Q5W A;  3PUZ F;  1SHZ C;  3VU7 H;  3OYX A;  4ZZB A;  2JPF A;  3UQ7 A;  4NXN T;  1KNZ A;  1AJ3 A;  4LFB T;  1Z8U A;  2JRK A;  5DJQ C;  5JDH A;  2W4X A;  2ZM6 T;  3IBP A;  1ZKE A;  3OVU A;  2BBJ A;  4LF6 T;  3DP7 A;  4AQF C;  5FXW A;  3LK3 B;  5LJN A;  2D2S A;  3ZLI A;  2VWA A;  3NKZ A;  3TLV A;  3F2E A;  2JJ9 A;  4X1I E;  2N1G A;  4GKJ T;  1FIO A;  4HTE A;  4AKG A;  4ASK A;  4COF A;  2X9W A;  5AQK B;  3CX7 B;  4ZS3 A;  4YSX A;  2CXD A;  2YIN A;  3AEF A;  3ZCJ A;  5FP3 A;  3PUY F;  4GYS A;  5FL0 A;  5JR9 A;  2MTQ A;  3EUH A;  3FB2 A;  4GIW A;  4UF0 B;  2ZM0 A;  4IE7 A;  2CE7 A;  1IBM T;  4KP3 C;  2X9X A;  2HN1 A;  5L3B B;  3P50 A;  2DCF A;  2H7V C;  3N9P A;  5LB7 B;  1VOM A;  1UX5 A;  2IW5 B;  2FJA A;  3FZH B;  3H3A A;  4P09 A;  2OLT A;  3NVO A;  1SUM B;  2PFV A;  2NW8 A;  1JNZ A;  2JIW A;  3AAE B;  4QH1 A;  5L4H A;  2E2A A;  3RI5 A;  4L0R A;  2CCQ A;  4DBQ A;  2K24 A;  5TAO A;  2YDQ A;  4QHO A;  3ZMZ B;  4FJO A;  5C2T A;  1G73 A;  1L0V A;  5JDQ A;  3L09 A;  3NZQ A;  3KBU A;  1HNW T;  2BKO A;  2LSY A;  2UXC T;  4CXW A;  4C91 A;  4O4J E;  5ABG A;  1NEN A;  4H9Q C;  2JMK A;  4TZ4 C;  1UUR A;  3ZST A;  4OK0 A;  5F5W A;  2A3D A;  3CPZ A;  4HFV A;  1LRZ A;  3A5X A;  3R6N A;  4IL4 A;  5AQG B;  3EAM A;  3ZMU B;  4UXN B;  3NRY A;  4ZI2 C;  1Z0P A;  5HXE A;  4G63 A;  3LBX B;  5EZY E;  5L3C B;  2WSS V;  2IUB A;  4KHZ F;  3KV5 A;  4BAY B;  3FZK B;  4OHF A;  4HFH A;  2X0L B;  2UUC T;  1VRB A;  4DR5 T;  2BS2 A;  4TWH A;  2V7K A;  1YQ3 A;  5KX5 E;  5HWX A;  5AQU B;  2KSR A;  2H3R A;  3NWI A;  4HWD A;  4Z91 A;  2WS3 A;  4IRE A;  3GN5 A;  1J1J A;  2V5D A;  1DU2 A;  5LOV E;  3RQU A;  3AAI A;  3PUA A;  5DAB A;  3EDV A;  1IBL T;  2VVS A;  3V5U A;  5JH7 E;  3P4Q A;  3Q5E A;  2VUR A;  3PTR B;  3T8O A;  4PK5 A;  4CXX A;  4AQF A;  2LHN A;  4DVD A;  2X51 A;  4H9O C;  4JYA T;  3UU4 A;  3ABV A;  2JQ9 A;  3RC3 A;  3P4W A;  1YXR A;  3LG7 A;  2X68 A;  3MAC A;  1MIY A;  4HFD A;  5FKY A;  5HXS A;  3D0T A;  3EDU A;  1MIW A;  4HKA A;  4U72 A;  5EK4 A;  2XSB A;  4E7Z A;  5KDM C;  4ILC A;  2WU2 A;  4HFI A;  3QK6 A;  1UCU A;  3OYZ A;  4DR7 T;  2CHO A;  2LSI A;  4P0A A;  3A8Y C;  1J5W A;  4PAG A;  4GK5 E;  2ACX A;  1WRD A;  4ZI3 C;  4QWN B;  2XUE A;  3ANW A;  3TKL B;  4AIU A;  2D9D A;  1W0A A;  5JRC B;  3C4W A;  2BVM A;  3ETV A;  2J4G A;  5JVD E;  4A98 A;  2X0Y A;  3RF1 A;  4EZ4 A;  3RIA A;  3ONL C;  5LYJ E;  3A7M A;  4AKI A;  4NIQ A;  4JBW F;  2Y48 B;  5ABE A;  3LDQ B;  4M1P A;  4LMJ A;  4IE4 A;  2ZLY A;  1IJ6 A;  3AEA A;  3UFE A;  4JI4 T;  4O4I E;  5F8P A;  2BS3 A;  3ZMV B;  1OWA A;  2LOP A;  2HHH T;  4IL9 A;  5ABF A;  2VQF T;  3QNU A;  3BQK A;  1FMW A;  3CX8 B;  5AQL B;  4ZI2 D;  5ETW A;  3CQG B;  5FXZ A;  4DV5 T;  1ZHC A;  4P0B A;  4PFO A;  2R6G F;  5AQJ B;  3QOF A;  4IDO A;  3RHW A;  3AA7 B;  4QXC B;  5LJM A;  2J47 A;  4A97 A;  2CWY A;  4NUV A;  1XNR T;  5AQI B;  1HX8 A;  3TLU A;  5KXJ A;  4U7Y A;  5ABH A;  2Z6E A;  2NTY A;  2KWH A;  4DV0 T;  2NR4 A;  1BR4 A;  1KF6 A;  5DQV A;  5HXR A;  4PJM A;  4UR9 A;  4ILA A;  2ZMA A;  2BS4 A;  3O1I A;  4TWF A;  3AE8 A;  2CBI A;  4DMW A;  4DV3 T;  3JCF A;  1KK7 A;  4GOU A;  4DV6 T;  4UVB B;  4B6X A;  3C50 A;  5AQT B;  3K3Q C;  4AI6 A;  2XAS B;  2K48 A;  5LGT B;  3UUX B;  1G8X A;  3AE2 A;  3HI2 A;  2FJE A;  2E8I A;  3FBL A;  4PFP A;  1OED B;  5FNV E;  3NZP A;  3FXD B;  5LMN T;  2RP4 A;  3LK2 B;  3HKE E;  1W09 A;  2CEA A;  3VRA A;  1S94 A;  3QC9 A;  4JI1 T;  1D0Z A;  3CVR A;  4YJ2 E;  2BZB A;  5LHH B;  4CN6 A;  2NTX A;  2DL1 A;  5FL1 A;  4GK0 E;  4ZI3 D;  4TWD A;  2UUB T;  3TLW A;  3V5S A;  2LKH A;  3OPC A;  3K3O A;  3ZKR A;  5FY1 A;  3KIN B;  4HFE A;  2D0U A;  4EAH A;  2XSA A;  4YTN A;  5LA6 E;  2VL8 A;  4H9R C;  2XM2 A;  1YKH B;  4HN9 A;  3HL6 A;  2E9X C;  2X0H A;  2XQ8 A;  3AE4 A;  1QSD A;  3I0O A;  2V6X A;  1X79 A;  3AE5 A;  5BR8 T;  1D1A A;  3NBX X;  1EZ3 A;  2J1D G;  3RH3 A;  4X1K E;  2W2U A;  3N9N A;  3AXJ B;  1KNR A;  2X67 A;  3PDY A;  4E7S A;  2EHO C;  4EYY R;  3BK9 A;  3M65 A;  5HXH A;  2FUP A;  3SFD A;  2V1D B;  2DHR A;  5CA0 E;  2XQY A;  4I55 E;  1I6Z A;  4YTM A;  5JDN A;  4JI6 T;  4JI8 T;  1ZV4 X;  5JDM A;  4DV7 T;  2LSK A;  3KBT A;  3HA4 A;  3AB3 B;  2MOZ A;  2KZ7 B;  3F57 A;  5CFB A;  4Z90 A;  3JC6 C;  2CLY B;  2J62 A;  4IE0 A;  2YKS A;  4H63 V;  1CUN A;  3HR0 A;  4PJN A;  3BQL A;  1IAP A;  3RQW A;  2LE8 A;  3RRW A;  4UF0 A;  2BKN A;  4X20 E;  3T1Y T;  4ISS A;  4DO0 A;  4X66 T;  2XQ3 A;  3PUV F;  4LF9 T;  1KEY A;  3DTO A;  5AQP B;  2UXB T;  2NWB A;  3N9M A;  4IDQ A;  2XAF B;  2XQ4 A;  1NWM X;  2WDV A;  2V6Y B;  3RKG A;  2UU9 T;  4U31 A;  4PNI A;  3FZL B;  1XDO A;  2MYS A;  4I43 B;  4YY3 T;  1BR2 A;  1O3X A;  4F6R C;  1I94 T;  2G0U A;  4YXD A;  3KDS E;  3ZN0 B;  3AE7 A;  5J0Z A;  4UEL A;  4HWC A;  2FJB A;  2W61 A;  4NXM T;  1W0B A;  5IWA T;  5LMU T;  2YU1 A;  2N9D A;  5HCM A;  2ODU A;  4JEU B;  4DV4 T;  5FY7 A;  3AVR A;  2AE9 A;  2QYW A;  4MFR A;  1UGO A;  3AAA B;  2CXL A;  3CX6 B;  3I1A A;  3EVY A;  5JDG A;  1HTJ F;  4WW0 A;  5FYM A;  1NAF A;  3ONX A;  3ZYK A;  3OJA A;  3PE0 A;  4DR1 T;  4TUY E;  1D0Y A;  3Q2M A;  3I0Q A;  2BDE A;  2Y6X A;  2XZE A;  3CQX C;  4B3S T;  1WLX A;  3HKD E;  3ZT6 A;  2E9X D;  5LBM A;  3RYI E;  5LCY A;  3MJX A;  5FY0 A;  3TLS A;  1T8B A;  4TN7 B;  2F4V T;  3GA8 A;  3ZMT B;  2CXF A;  1QLB A;  3RLF F;  4LF8 T;  4MLK A;  4BJN A;  1BR1 A;  2XAJ B;  2X9H A;  2M6I A;  2KXP B;  3AA6 B;  4CN1 A;  4WNK A;  2E9X A;  2BBH A;  2EHO D;  2L8K A;  3M3Z B;  4UV9 B;  4LML A;  3UUB A;  2WDQ A;  4YJ3 E;  1OED C;  3IA3 A;  2V7L A;  4PJJ A;  3N2G E;  5HEH A;  1WYB A;  3AEE A;  1OXZ A;  4EIW A;  4AKR B;  4KMC A;  3MZK B;  1N36 T;  2C5J A;  2LRL A;  2WY2 A;  4QXB B;  3JC6 D;  4O2B E;  2QA7 A;  4ANJ A;  1X9B A;  2EHO A;  1MMD A;  3RRC A;  3JAD A;  3R84 B;  2MPK A;  3PUG A;  5JDF A;  4YSZ A;  3SS1 A;  3C51 A;  4DMV A;  5HAX A;  2I59 A;  3AEB A;  4AXP A;  3ZSS A;  4ZS2 A;  2WDR A;  1WCR A;  4LMK A;  5JRE A;  2GK9 A;  2LJL A;  4HGA A;  5HEG A;  5M4Y A;  2CHN A;  2XJ7 A;  3RKO A;  1Y64 B;  5LGU B;  4P1N A;  4TNV A;  3AED A;  5CGM A;  2XQ7 A;  2JQH A;  3SFE A;  1D0X A;  5HEJ A;  1IJ5 A;  4DID B;  4I50 E;  3RYC E;  4A56 A;  3H3M A;  2BKP A;  3EAB A;  3I9Y A;  3VKG A;  4EED A;  5JRC A;  4MAL A;  1SA0 E;  2HPJ A;  1V9D A;  4EGW A;  2LSG A;  4ZI7 E;  4OX9 T;  2WQY A;  2HN2 A;  2W00 A;  1HFA A;  3K8P C;  4N78 D;  1VCS A;  3DJB A;  5JTG A;  4U33 A;  3UUN A;  2HPL A;  2WM9 A;  2N2N A;  3MK7 C;  2VKO A;  5LXT E;  2WB5 A;  3KV6 A;  2DNX A;  3S4U A;  4TNW A;  3RGL A;  4CI1 B;  4YFS A;  3GMI A;  1XMO T;  5FVK A;  2KWI B;  3FXE B;  4KHP T;  2CM0 A;  3L3P A;  5BMV E;  2VAS A;  3GWH A;  1WR0 A;  4TV8 E;  5HEO A;  1WFD A;  4MHC A;  5IYZ E;  3ZCI A;  3ZC0 A;  1KFY A;  2CA5 A;  3QB5 K;  3AE6 A;  4XBF B;  4JEH B;  2DLR A;  1T72 A;  2PJQ A;  3J9X 1;  2W67 A;  3P4S A;  3ZT7 A;  4QKN A;  5LHG B;  3JAE A;  4DND A;  4F8H A;  5LP6 E;  4IE6 A;  1B7T A;  4H63 H;  3N9O A;  2LLY A;  2LEH A;  4HFB A;  3VKH A;  3C4Z A;  3PUR A;  4ERR A;  2E5V A;  4WYV A;  1H7C A;  5HCJ A;  5AQV B;  3QUJ A;  4EXT A;  4ZXL A;  2YK0 A;  3ZYM A;  2LRK A;  3LJC A;  3VHL A;  2VK9 A;  3O1H A;  3VR8 A;  1LVK A;  5AQN B;  1Y01 A;  5ABF B;  4O4H E;  1N34 T;  4O2A E;  4LF5 T;  4LF7 T;  3PJA J;  1HX1 B;  4IST A;  1OED A;  1ZP0 A;  1W9R A;  2YU2 A;  4L5G A;  2I6H A;  2JQK A;  5A1L A;  4HWH A;  5L3E B;  3O1J A;  3IEE A;  1YQ4 A;  2Q9Q B;  3U3I A;  3P8C D;  4CI2 B;  4WBO A;  3RYH E;  2XTL A;  1MIV A;  2YEV C;  1UX4 A;  2IML A;  1XWM A;  1OED E;  2QGS A;  3FHN A;  3SOL A;  4LFC T;  4X64 T;  4ZEY A;  3G06 A;  1J5E T;  2D0T A;  5ADX L;  2W63 A;  3PUW F;  1NEK A;  1E2A A;  2B76 A;  4JI2 T;  5AQQ B;  2ES0 A;  2IDO B;  3LFM A;  1HCI A;  4OYK A;  5FVL A;  4X62 T;  2CMR A;  3T1H T;  3P4P A;  1WYC A;  1U4Q A;  4IDZ A;  5AQR B;  2NOX A;  4Q25 A;  2XQA A;  2XPK A;  2C0S A;  3N5L A;  1MND A;  2D5U A;  5H6Q B;  2LM2 A;  3AXJ A;  3N9L A;  4EYU A;  1M7K A;  4DBR A;  4AQG A;  2ZM8 A;  2VVN A;  3ZYL A;  3QB5 A;  3OBV E;  5C8Y E;  4HFC A;  5AQO B;  1D1C A;  2BG9 B;  2DWK A;  1KNP A;  3CKD A;  3ZN1 B;  3LK4 2;  2I0M A;  1T98 A;  4UV8 B;  4CZZ B;  2C5I T;  3L39 A;  5GON E;  4EB6 E;  2DWG A;  4IDP A;  1XMQ T;  5CB4 E;  3RPU A;  3UU6 A;  3K1S A;  3O9X A;  1FJG T;  2LOS A;  2QVA A;  5FMN A;  2UXD T;  4JI0 T;  3UTK A;  3W15 B;  4JV5 T;  3F31 A;  3C98 B;  2LM9 A;  2M6B A;  3PU3 A;  1MMG A;  2FJD A;  3FBZ A;  2K3W A;  5E0O A;  2K5B B;  3AE1 A;  1MMN A;  3ZJ2 A;  4GKK T;  4HWF A;  1HG2 A;  4JUY A;  1CHU A;  1HNX T;  3MKD A;  4YSY A;  3RIU C;  2FBW A;  2V8S V;  3FZF B;  4X65 T;  2V6Y A;  3MA9 A;  1R8I A;  1LKX A;  2K9A A;  2SPC A;  2WU5 A;  2LSJ A;  4H9P C;  2YDS A;  4QXH B;  2UUA T;  2X9Y A;  2A9U A;  4PK4 A;  1N32 T;  1S35 A;  2XQ5 A;  3AVS A;  5L4E A;  2WBL A;  1XDP A;  3MXZ A;  3U78 A;  3N9Q A;  4BA9 A;  4EZH A;  4AKL A;  4DR2 T;  5L2L A;  3CK6 A;  5LHI B;  4LF4 T;  3E08 A;  3C64 A;  4I4T E;  4ZZC A;  1FEW A;  2ACZ A;  5JR9 B;  3O4X E;  2WP9 A;  5LNK A;  3ZPO A;  4YT0 A;  3HKC E;  2VB6 A;  3SWH A;  1BR0 A;  4G2A A;  2QRX A;  3UU5 A;  2ZM2 A;  2MAW A;  3PV0 F;  3VRB A;  3N2K E;  5L3D B;  2WAU A;  4YHH T;  2IIU A;  2KMF A;  4I0U A;  2OA5 A;  2A72 A;  3KFW X;  3LBX A;  4MBQ A;  3PUS A;  4QX8 B;  5F3J A;  4QH5 A;  2VKH A;  5L3G B;  1VCT A;  4GYR A;  5AFU L;  3UT5 E;  4O4L E;  4UVA B;  2WZI A;  4QX7 B;  1HNZ T;  1JNR A;  3ONJ A;  4OFZ A;  3PU8 A;  2IHR 1;  2Q9Q C;  3AE9 A;  1YW0 A;  3WAK A;  5DQW A;  4B3T T;  3AEG A;  2X66 A;  2WZH A;  4PK6 A;  4DV1 T;  4K0K T;  2C5K T;  4IHJ E;  4PW8 A;  3SRZ A;  1MNE A;  2V7I A;  4QH4 A;  3C4X A;  3CML A;  1IZN B;  1ZOY A;  2XAQ B;  1U5P A;  2XAH B;  5LG4 A;  4CQI A;  3K3N A;  3Q5D A;  5CA1 E;  4UVC B;  2CRB A;  4WBN E;  4BJM A;  2NP9 A;  4X5T A;  5EK3 A;  5H6R B; 
#chains in the Genus database with same CATH homology
 3A7M A;  3NKZ A;  3H3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...