3A7MA

Structure of flit, the flagellar type iii chaperone for flid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
b'TSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQSTRQKSLNNAYGRLSGMLLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein fliT
publication title Structural insight into the regulatory mechanisms of interactions of the flagellar type III chaperone FliT with its binding partners.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation, chaperone
total genus 41
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3a7mA01
3H3MA 3NKZA 3A7MA
chains in the Genus database with same CATH superfamily
1MNDA 2EHOC 3KFWX 2VVNA 4ZEYA 5L3EB 3RH3A 1MMDA 3AEDA 3UUNA 2YDSA 2MAWA 4JI6T 5AFUL 2H7VC 1X79A 2WP9A 5J2TE 1HF8A 3RPUA 2C5JA 3UQ4A 2X0YA 4MBQA 1T72A 1GQEA 3GN5A 2X68A 3RHWA 1KNRA 3PUQA 4YSZA 4EEDA 1KNPA 5CA1E 3AEAA 2JQ9A 1WYBA 5FXZA 4UELA 2DL1A 2CMRA 2DI4A 3K3NA 2XSBA 2K9AA 4X64T 3FZFB 4PAGA 1YD8G 2LOPA 2NTYA 5FXWA 2D5UA 3NZPA 4EOZB 4YY3T 3AB3B 1HX8A 2QGSA 3Q2MA 1Z8UA 2WQYA 4GK0E 4LFCT 3M65A 2BDEA 3ZT7A 5F8PA 3B13A 5LCYA 3BK9A 3GWHA 1XWMA 2LT3A 2W0GA 2XAGB 3RYIE 3EHZA 2M6BA 2I59A 5FXXA 3MACA 1E2AA 3H3AA 1N33T 2J1DG 4EGWA 3RRWA 2K48A 2PG8A 4CXWA 2YN6A 2H89A 3AE6A 2W4XA 5FL1A 3LK2B 3ZYMA 4AQFC 3FBZA 5LP6E 3C51A 5AQMB 2YEVC 3H37A 1B7TA 1J5ET 4UXNB 3PU3A 4IDQA 4XBFB 3WAKA 4TWHA 4H9PC 4UR9A 1D0YA 2W62A 5HYAA 1IJ6A 1G73A 5JRCB 4O8SA 1Y01A 2LOSA 2K24A 3SWHA 5ADXL 4DIDB 2D2SA 4U74A 2WY2A 4GKJT 4KHPT 5JR9C 4CN1A 4JI5T 4QH5A 4ILUA 3CKDA 4U2ZA 4DV2T 3BQLA 4YT0A 4ZI2D 1HS7A 4JI4T 4Q25A 5FNVE 5E0OA 2VASA 1L0VA 2VKOA 4HWCA 4CXYA 5AQOB 3ONXA 1SE7A 2CWOA 2I6HA 2E8IA 3PUAA 5LG4A 1XDPA 5JDQA 4ZOLE 2FUPA 1YKEB 2VK9A 2XQYA 4MLKA 1O3XA 2IC9A 3PUSA 4CI2B 3I1AA 3VKHA 4PJLA 4PFPA 4ZI3D 5LGNB 4B3ST 4ZI2C 3OVUA 3S4UA 3PDYA 5LHIB 4EYUA 4AKIA 1KNZA 5L47A 2IW5B 3VU7H 1BR4A 1JNRA 5JRCA 5LB7B 2XJ7A 4H9SE 4WBNE 3AEFA 5AQKB 1T7SA 2D0UA 2I0MA 4U33A 1VOMA 2HN1A 3MZKB 4KMCA 4ZI3C 1WR6A 5GONE 3WAJA 3GA8A 2Y6XA 3E22E 2RP4A 5IYZE 2KWIB 3RYCE 4I4TE 2C5IT 3ZMTB 1XNRT 3CPZA 3AXJB 4U3CA 2YDQA 3FZKB 4DV1T 3FZMB 2XM1A 5DQVA 1N32T 1HCIA 2YOEA 5HCJA 3FXEB 2H3RA 5ABFB 3RKGA 2V26A 4K0UA 3UUBA 3FBLA 4TV8E 2BS2A 2IUBA 4Z91A 3UFEA 3UU5A 4P0AA 2BKOA 5LNKA 2IIUA 4YFSA 4TUYE 1UGOA 5DQWA 5DJQC 2CEAA 2E9XB 4IL4A 4EZHA 4OK0A 5FL0A 3LFMA 3AVRA 2BKNA 5JTGA 2WU5A 1D0XA 4AKRB 4HTEA 2NTXA 2XAFB 3EAMA 3ZN0B 4DVDA 3ZEFB 2V1DB 4HFCA 3P4WA 4TWDA 4AISA 1LVKA 4JI1T 5JDNA 2PJQA 5C8YE 3CQXC 3F2EA 2M67A 3AA1B 4DR6T 4H9RC 3NWIA 5FYMA 2E2AA 5J1GA 3OBVE 3OPCA 3KBUA 3AXJA 4O4JE 4TV9E 3DP7A 2W63A 3CK6A 2NW9A 3ZT5A 1BR0A 5AQSB 4X66T 3KV9A 5ABFA 2BS4A 2UXBT 3QB5K 3MA9A 5H6QB 4B3MT 2X0LB 3H3MA 3FXDB 5EZYE 5L4HA 3AEGA 2W61A 3RF1A 5HEOA 3OYZA 5HXRA 2E9XA 5LMUT 2UU9T 3K3OA 1XMQT 2VKHA 4FJOA 2XQ4A 4QHOA 3N9OA 4DR4T 4B3TT 3O1IA 4JI0T 4OHFA 2CLYC 3B57A 2AXDS 2D0TA 4O4HE 4IIJE 3VRBA 1U5PA 2A3DA 1U4QA 2XQ9A 4UV9B 4ZI7E 2WCAA 5KX5E 4KX6A 3I0OA 2WDVA 2VQET 3ZMZB 4DMWA 3C50A 4JI7T 4UEMA 3BQKA 3UUMA 4EV6A 2QYWA 5LOVE 3AE3A 5HXEA 3LDQB 1T98A 2BG9E 4CQIA 1FMVA 1JNZA 4Z8XA 2HHHT 1IAPA 3ETUA 1OEDE 3TLTA 3RQUA 2VL0A 4PNIA 3G06A 4IE4A 5JDGA 2XQ5A 2RA1A 2ES0A 1US7B 2IC6A 1WRDA 2L8KA 3O1HA 2QA7A 4AKLA 5LMNT 2WU2A 5LG3A 3D0TA 4HFDA 3QUJA 2XQ6A 4HGAA 1W0BA 1KFYA 3J7Yq 2CXFA 4AKGA 4YHHT 2CBIA 4WW0A 2E5LT 5AQPB 2IDOB 4TZ4C 3L39A 3JC6D 3JAEA 3ZJ2A 5HCMA 3A8YC 3RIFA 2KXPB 2WWVA 4YXDA 4KBMB 1QUUA 2BKPA 4J2CA 1YXRA 2BG9B 2ZM8A 1ZEEA 3RC3A 1ZHCA 3UTKA 1OEDB 4U31A 4OFZA 5AQUB 3IHRA 4IT4A 2JMKA 1J1JA 2XQAA 2NOXA 3OJAA 2F4VT 2KSRA 2LRLA 4TNWA 3AEEA 3M3ZB 4HFIA 3FB2A 4HWDA 4PJJA 4MALA 2V7KA 2CE7A 3JC6C 4GK5E 3ZYKA 2VVSA 5CFBA 2FJAA 3F31A 3MKDA 4JYAT 3OYXA 4C91A 4ZS2A 4LF7T 5FP3A 1Z0PA 4IL9A 1ZOYA 1HFAA 2MBGA 4COFA 3L3PA 4ZXLA 2Q9QB 3PU8A 4AKHA 1Y64B 2FBWA 5CJ5A 2M6IA 5J2UE 2Y8DA 2KLQA 1HR0T 5AQGB 4PK4A 4IGUA 3JADA 4O4LE 2BG9A 4PJMA 5AQHB 4XZCA 3QC9A 5KMGP 3N5LA 5C2TA 1OEDA 2VL8A 1BR1A 3IF8B 3QB5A 2WS3A 4HEAA 3PE0A 2J47A 2ZM6T 4JI8T 3RIUC 3ZMVB 4DV4T 1I94T 2WZIA 4JLEA 2N1GA 4HFVA 4QKNA 3ABVA 3P4QA 3AE8A 5FXVA 2XQ8A 5JH7E 3QK6A 4UIGA 4LF5T 2ZM2A 1XDOA 2WB5A 2XQ3A 2YKSA 4HN9A 2FJDA 5LA6E 2JRKA 4L9IA 2Q9QA 2LSYA 4DR7T 2E5VA 2GK9A 3V5SA 3TLSA 3CX8B 1N36T 2ACZA 1H7CA 4CN4A 4DR5T 3I0QA 3GMIA 2LJLA 5AQFB 5HXCA 4EEBA 3EDUA 3AAAB 4AI6A 2ODUA 5IUXA 3CX7B 4DV0T 3SOLA 4F8HA 3E08A 2WWUA 4UV8B 2LE8A 2MOZA 4M1PA 3L09A 3JCFA 3KV6A 3UU8A 4QXBB 2LKHA 4ZZBA 2HH7A 4TWFA 3CX6B 3P4SA 3ZLIA 2UXDT 3KVAA 2G0UA 5A1LA 2XPKA 1HX1B 3B5MA 3CQGB 5EK3A 1UURA 2CHOA 1VCSA 4LFAT 2XUEA 1UX5A 1ZKEA 2XTLA 4PJNA 4DV5T 2V8SV 4EYYR 1HG2A 3ETVA 2UUCT 3NZQA 2JQQA 3PV0F 1OXZA 2LRKA 3CQCB 4LF4T 4GIWA 5EK2A 2DLRA 4AQYT 2FJBA 3RYHE 2JQKA 4NXMT 4L5GA 3SFEA 4NXNT 4H9NC 3HA4A 3UU3A 2XAQB 4BAYB 4DMVA 2RPAA 4P0BA 5LYJE 3QNUA 3HKCE 3PJAJ 3AE5A 5AQQB 4X1IE 2VKJA 3CIRA 5JDFA 4Z90A 2CCQA 4X5TA 4I55E 4TN7B 3FZLB 4L0RA 5HEJA 2LSGA 3J9X1 2DHRA 1N34T 4LMLA 4ADZA 4ISSA 4QWNB 2BVLA 4LMJA 4A5XA 5AQVB 5CA0E 3KBTA 3R6NA 2HPLA 2X9HA 2Z6EA 1SHZC 2L9QA 3MXZA 3T1HT 4X1YE 4GYRA 2VURA 4EIWA 2CXDA 2OA5A 4JV5T 2IHR1 4BJMA 4A97A 4X65T 4DO0A 4IE7A 3AE1A 4U2YA 4O2AE 2DWGA 1AJ3A 3OTOT 5LHGB 3A7MA 1BR2A 1X9BA 2ACXA 4KHZF 3ZSSA 1G8XA 4YSYA 3ZYLA 3AAEB 5AQJB 1W9RA 2JMHA 2BZBA 3PUXF 2A72A 4ZS3A 3BQIA 3VKGA 4H9OC 4E7ZA 4X62T 2CWYA 3LBXB 5BR8T 2JQHA 3P8CD 4DBQA 5LBQB 3RRCA 1WFDA 1UUSA 3UQ7A 2H7OA 2YU2A 5AQRB 4JI3T 3UULA 2UUBT 4IDNA 4FI5A 2CM0A 4A98A 2XY8B 3TLWA 3N2KE 5JQGE 3U78A 2AE9A 4HFEA 3RI5A 3EI0A 3RX6A 4TNVA 2V6XA 1SA0E 2PTFA 2WZHA 2NW8A 4CZZB 2XASB 5IHYA 4YJ3E 1QLBA 4DNDA 3RKOA 2X9WA 3FZHB 3UT5E 4HKAA 5HWXA 2W00A 2PBIA 5TAOA 5L4EA 4GYSA 5H6RB 3TLUA 3ANWB 4HFBA 3P4RA 5F5WA 1D1AA 4DR2T 2BBJA 2FJEA 2Q9QD 4EAHA 4UVCB 1MNEA 1HTJF 3LBXA 5L3BB 3KV4A 5JREA 4V1Av 3VRAA 4N78D 3P7IA 3SFDA 2D9DA 5M4YA 2H88A 2J62A 4DBRA 2CBJA 2X51A 3Q9DA 3ONJA 4K0KT 3ESLA 4LMKA 2A9UA 4JI2T 1E1HB 1V9DA 5CB4E 3N9NA 3KV5A 1VRBA 2ZM0A 5L3GB 5FKYA 2C5KT 2DNXA 2XZEA 4QX7B 3ZCJA 2Q9QC 3AECA 4ANJA 3MK7C 5FVKA 2X9YA 5HAXA 4OYJA 3T1YT 5EK4A 3X1DA 3AA6B 3EVYA 2LSKA 4B3RT 2UXNB 3AVSA 1EZ3A 4PW8A 3L8RA 2KT9A 3WI3A 3TKLB 5JDLA 4QH4A 5LJNA 3UFGA 2YDRA 4HWIB 2CLYB 3W15B 1NENA 4WNKA 2N9DA 3Q5EA 3ANWA 2NR4A 1WLXA 3IEEA 2UXCT 4JUYA 5FVLA 3ZMUB 3C4XA 3QOFA 3RLFF 4ERRA 4KP3C 5LBMA 3UU6A 1CUNA 4DV3T 1IZNB 5JDMA 1T8BA 4H63H 1XMOT 1D0ZA 4DV7T 3R84B 1YW0A 4UVBB 3HKEE 3ZSTA 4CI1B 4QX8B 2P9BA 2CA5A 2K3WA 3ONLC 4TX5A 4P1NA 2W67A 2W66A 4BA9A 3N9QA 4LF9T 1UX4A 2KMFA 2VKDA 1LKXA 3HR0A 1NAFA 3N9PA 1UK5A 3SRZA 5AQNB 1FMWA 4CXXA 4NUUA 4X1KE 4NUVA 3RIAA 3NVOA 2YU1A 2WMNA 3AA0B 3RGLA 4LF8T 5ABGA 3PUGA 1LVFA 4O2BE 1IBLT 5LHHB 3NKZA 3EDVA 2C0SA 2XAJB 1OWAA 2VB6A 4IDOA 4ZZCA 4H9QC 5HXSA 3EABA 3ZN1B 2NWBA 5ABHA 3O4XE 3N2OA 2BS3A 2UUAT 2EHOB 2DCFA 3C64A 2LHRA 2Y48B 3OKQA 1MMAA 1W0AA 2A2FX 4ZHQE 1E7PA 3ZMSB 3O1JA 4IDZA 4HFHA 4NIQA 3CMLA 2OV9A 3N9MA 5HXHA 3NRXA 2VQFT 2BVMA 1IJ5A 4IE6A 4NPPA 2WDRA 3JAFA 2CXLA 4QXHB 2HPJA 5L3CB 4X20E 5LJMA 2E9XD 2YK0A 2KNDA 2MTQA 2XAHB 1HNZT 1S94A 5J0ZA 4JBWF 4U72A 1S35A 4AXPA 3PUVF 5FY0A 4ILBA 4G2AA 3KDSE 4AIUA 4KUMB 2IAKA 3AE4A 1D1BA 2X67A 3IA3A 2LEHA 1KF6A 2EHOA 3AE7A 2LM9A 4WYVA 2E9XC 4YTNA 4I50E 5LXTE 1YQ3A 3Q5DA 5FY1A 5CGMA 5ETWA 1MIVA 2JPFA 1YKHB 1J5WA 4I0UA 2ODVA 1NWMX 3NBXX 4XAXB 3VR8A 2R6GF 2J4GA 2YINA 1MIWA 4GKKT 2X9XA 4PK6A 3HL6A 4LFBT 4OYKA 2WDQA 2ZLYA 4H63V 3LK3B 1M7KA 1HNWT 5JDHA 2CPTA 2PFVA 3RC8A 5LGUB 3MJXA 2QVAA 4JEUB 3DJBA 1WR0A 4IE0A 5DABA 4ILAA 3CWZB 2XQ7A 2QRXA 2WSSV 4F6RC 3CVRA 2KWHA 3C4ZA 5F3JA 4YJ2E 2V6YB 3RYFE 3HKDE 4GOUA 5JR9B 4HWHA 5LGTB 4UVAB 1HG5A 2WMOA 4UF0B 5HEGA 4B6XA 3VR9A 2LLYA 1XZYA 4E7SA 1MMNA 2V7LA 1KK7A 3Q5XA 2LSIA 4A56A 5L2LA 1ZV4X 4U7IA 2V5DA 2SPCA 4YTPA 3ZJ1A 4ISTA 3LK42 5FMNA 3AEBA 4HWFA 2NP9A 3I9WA 5AQTB 2L3LA 3ZC0A 2MPKA 5AQIB 4AQFA 4DR1T 5ABEA 1IBKT 3V5UA 3HI2A 3N2GE 2B1EA 3U3IA 3AE2A 1UCUA 3O9XA 3C4WA 3PJAA 2V7JA 1VCTA 1KEYA 3UU4A 4WBOA 4O4IE 2ZMAA 5FY7A 5HWYA 4DR3T 3KINB 4JEHB 4BJNA 2HN2A 3AAIA 4G63A 5AQLB 3Q5WA 3RIUA 2BBHA 4DUYT 3AA7B 2UXXB 4IREA 1LRZA 4EB6E 2V6YA 5JR9A 2XM2A 3P4PA 3VHLA 3EUHA 1HNXT 3IBPA 4HE8A 1ZP0A 2WBLA 2JJ9A 4OX9T 4UF0A 2LKGA 3C98B 3FHNA 3ZT6A 5KDMC 2KZ7B 3TLVA 3I9YA 5L3FB 4YHJA 1IBMT 3RQWA 2X66A 5IWAT 2LSJA 4CN6A 4AQGA 4IDPA 3E0ZA 4C90A 2NW7A 3ZPOA 1R8IA 4DUZT 4DV6T 4MFRA 5KXJA 3K3QC 1SUMB 4MHCA 1DU2A 4EZ4A 2WM9A 3ZCIA 4YLHA 1FIOA 3HKBE 1FJGT 1D1CA 4ILCA 5C3JA 1WYCA 3LG7A 2CHNA 2KINB 4PFOA 3PUWF 2DWKA 3LSVA 3ZC1A 2VWAA 2WAUA 5HEUA 3T8OA 2BG9C 2V5CA 4CI3B 2OLTA 3A5XA 4IE5A 3NRYA 1OEDC 3DTOA 2IMLA 2B76A 3F57A 3PUZF 3K1SA 4YTMA 3PURA 3AE9A 1M62A 4U7YA 4YSXA 2XHEB 2XSAA 2W2UA 1I6ZA 5BMVE 4WZXA 1MIYA 3PUYF 2JIWA 4QXCB 1YQ4A 4EXTA 2LHNA 3GN5B 2EHOD 3K8PC 1QSDA 3P50A 1NEKA 2V7IA 3KVBA 4P09A 1WCRA 1XNQT 5HEHA 2X0HA 3PTRB 4QH1A 2N2NA 3N9LA 2LM2A 2CRBA 4LF6T 1W09A 3SS1A 2MYSA 4I43B 3LJCA 5JVDE 1CHUA 4ASKA 4IHJE 3UUXB 1MMGA 2K5BB 1FEWA 4KI0F 4PK5A 2V7MA 3ZKRA 5L3DB
chains in the Genus database with same CATH topology
3H3MA 3NKZA 3A7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3M A;  3NKZ A;  3A7M A; 
#chains in the Genus database with same CATH topology
 1MND A;  2EHO C;  3KFW X;  2VVN A;  4ZEY A;  5L3E B;  3RH3 A;  1MMD A;  3AED A;  3UUN A;  2YDS A;  2MAW A;  4JI6 T;  5AFU L;  2H7V C;  1X79 A;  2WP9 A;  5J2T E;  1HF8 A;  3RPU A;  2C5J A;  3UQ4 A;  2X0Y A;  4MBQ A;  1T72 A;  1GQE A;  3GN5 A;  2X68 A;  3RHW A;  1KNR A;  3PUQ A;  4YSZ A;  4EED A;  1KNP A;  5CA1 E;  3AEA A;  2JQ9 A;  1WYB A;  5FXZ A;  4UEL A;  2DL1 A;  2CMR A;  2DI4 A;  3K3N A;  2XSB A;  2K9A A;  4X64 T;  3FZF B;  4PAG A;  1YD8 G;  2LOP A;  2NTY A;  5FXW A;  2D5U A;  3NZP A;  4EOZ B;  4YY3 T;  3AB3 B;  1HX8 A;  2QGS A;  3Q2M A;  1Z8U A;  2WQY A;  4GK0 E;  4LFC T;  3M65 A;  2BDE A;  3ZT7 A;  5F8P A;  3B13 A;  5LCY A;  3BK9 A;  3GWH A;  1XWM A;  2LT3 A;  2W0G A;  2XAG B;  3RYI E;  3EHZ A;  2M6B A;  2I59 A;  5FXX A;  3MAC A;  1E2A A;  3H3A A;  1N33 T;  2J1D G;  4EGW A;  3RRW A;  2K48 A;  2PG8 A;  4CXW A;  2YN6 A;  2H89 A;  3AE6 A;  2W4X A;  5FL1 A;  3LK2 B;  3ZYM A;  4AQF C;  3FBZ A;  5LP6 E;  3C51 A;  5AQM B;  2YEV C;  3H37 A;  1B7T A;  1J5E T;  4UXN B;  3PU3 A;  4IDQ A;  4XBF B;  3WAK A;  4TWH A;  4H9P C;  4UR9 A;  1D0Y A;  2W62 A;  5HYA A;  1IJ6 A;  1G73 A;  5JRC B;  4O8S A;  1Y01 A;  2LOS A;  2K24 A;  3SWH A;  5ADX L;  4DID B;  2D2S A;  4U74 A;  2WY2 A;  4GKJ T;  4KHP T;  5JR9 C;  4CN1 A;  4JI5 T;  4QH5 A;  4ILU A;  3CKD A;  4U2Z A;  4DV2 T;  3BQL A;  4YT0 A;  4ZI2 D;  1HS7 A;  4JI4 T;  4Q25 A;  5FNV E;  5E0O A;  2VAS A;  1L0V A;  2VKO A;  4HWC A;  4CXY A;  5AQO B;  3ONX A;  1SE7 A;  2CWO A;  2I6H A;  2E8I A;  3PUA A;  5LG4 A;  1XDP A;  5JDQ A;  4ZOL E;  2FUP A;  1YKE B;  2VK9 A;  2XQY A;  4MLK A;  1O3X A;  2IC9 A;  3PUS A;  4CI2 B;  3I1A A;  3VKH A;  4PJL A;  4PFP A;  4ZI3 D;  5LGN B;  4B3S T;  4ZI2 C;  3OVU A;  3S4U A;  3PDY A;  5LHI B;  4EYU A;  4AKI A;  1KNZ A;  5L47 A;  2IW5 B;  3VU7 H;  1BR4 A;  1JNR A;  5JRC A;  5LB7 B;  2XJ7 A;  4H9S E;  4WBN E;  3AEF A;  5AQK B;  1T7S A;  2D0U A;  2I0M A;  4U33 A;  1VOM A;  2HN1 A;  3MZK B;  4KMC A;  4ZI3 C;  1WR6 A;  5GON E;  3WAJ A;  3GA8 A;  2Y6X A;  3E22 E;  2RP4 A;  5IYZ E;  2KWI B;  3RYC E;  4I4T E;  2C5I T;  3ZMT B;  1XNR T;  3CPZ A;  3AXJ B;  4U3C A;  2YDQ A;  3FZK B;  4DV1 T;  3FZM B;  2XM1 A;  5DQV A;  1N32 T;  1HCI A;  2YOE A;  5HCJ A;  3FXE B;  2H3R A;  5ABF B;  3RKG A;  2V26 A;  4K0U A;  3UUB A;  3FBL A;  4TV8 E;  2BS2 A;  2IUB A;  4Z91 A;  3UFE A;  3UU5 A;  4P0A A;  2BKO A;  5LNK A;  2IIU A;  4YFS A;  4TUY E;  1UGO A;  5DQW A;  5DJQ C;  2CEA A;  2E9X B;  4IL4 A;  4EZH A;  4OK0 A;  5FL0 A;  3LFM A;  3AVR A;  2BKN A;  5JTG A;  2WU5 A;  1D0X A;  4AKR B;  4HTE A;  2NTX A;  2XAF B;  3EAM A;  3ZN0 B;  4DVD A;  3ZEF B;  2V1D B;  4HFC A;  3P4W A;  4TWD A;  4AIS A;  1LVK A;  4JI1 T;  5JDN A;  2PJQ A;  5C8Y E;  3CQX C;  3F2E A;  2M67 A;  3AA1 B;  4DR6 T;  4H9R C;  3NWI A;  5FYM A;  2E2A A;  5J1G A;  3OBV E;  3OPC A;  3KBU A;  3AXJ A;  4O4J E;  4TV9 E;  3DP7 A;  2W63 A;  3CK6 A;  2NW9 A;  3ZT5 A;  1BR0 A;  5AQS B;  4X66 T;  3KV9 A;  5ABF A;  2BS4 A;  2UXB T;  3QB5 K;  3MA9 A;  5H6Q B;  4B3M T;  2X0L B;  3H3M A;  3FXD B;  5EZY E;  5L4H A;  3AEG A;  2W61 A;  3RF1 A;  5HEO A;  3OYZ A;  5HXR A;  2E9X A;  5LMU T;  2UU9 T;  3K3O A;  1XMQ T;  2VKH A;  4FJO A;  2XQ4 A;  4QHO A;  3N9O A;  4DR4 T;  4B3T T;  3O1I A;  4JI0 T;  4OHF A;  2CLY C;  3B57 A;  2AXD S;  2D0T A;  4O4H E;  4IIJ E;  3VRB A;  1U5P A;  2A3D A;  1U4Q A;  2XQ9 A;  4UV9 B;  4ZI7 E;  2WCA A;  5KX5 E;  4KX6 A;  3I0O A;  2WDV A;  2VQE T;  3ZMZ B;  4DMW A;  3C50 A;  4JI7 T;  4UEM A;  3BQK A;  3UUM A;  4EV6 A;  2QYW A;  5LOV E;  3AE3 A;  5HXE A;  3LDQ B;  1T98 A;  2BG9 E;  4CQI A;  1FMV A;  1JNZ A;  4Z8X A;  2HHH T;  1IAP A;  3ETU A;  1OED E;  3TLT A;  3RQU A;  2VL0 A;  4PNI A;  3G06 A;  4IE4 A;  5JDG A;  2XQ5 A;  2RA1 A;  2ES0 A;  1US7 B;  2IC6 A;  1WRD A;  2L8K A;  3O1H A;  2QA7 A;  4AKL A;  5LMN T;  2WU2 A;  5LG3 A;  3D0T A;  4HFD A;  3QUJ A;  2XQ6 A;  4HGA A;  1W0B A;  1KFY A;  3J7Y q;  2CXF A;  4AKG A;  4YHH T;  2CBI A;  4WW0 A;  2E5L T;  5AQP B;  2IDO B;  4TZ4 C;  3L39 A;  3JC6 D;  3JAE A;  3ZJ2 A;  5HCM A;  3A8Y C;  3RIF A;  2KXP B;  2WWV A;  4YXD A;  4KBM B;  1QUU A;  2BKP A;  4J2C A;  1YXR A;  2BG9 B;  2ZM8 A;  1ZEE A;  3RC3 A;  1ZHC A;  3UTK A;  1OED B;  4U31 A;  4OFZ A;  5AQU B;  3IHR A;  4IT4 A;  2JMK A;  1J1J A;  2XQA A;  2NOX A;  3OJA A;  2F4V T;  2KSR A;  2LRL A;  4TNW A;  3AEE A;  3M3Z B;  4HFI A;  3FB2 A;  4HWD A;  4PJJ A;  4MAL A;  2V7K A;  2CE7 A;  3JC6 C;  4GK5 E;  3ZYK A;  2VVS A;  5CFB A;  2FJA A;  3F31 A;  3MKD A;  4JYA T;  3OYX A;  4C91 A;  4ZS2 A;  4LF7 T;  5FP3 A;  1Z0P A;  4IL9 A;  1ZOY A;  1HFA A;  2MBG A;  4COF A;  3L3P A;  4ZXL A;  2Q9Q B;  3PU8 A;  4AKH A;  1Y64 B;  2FBW A;  5CJ5 A;  2M6I A;  5J2U E;  2Y8D A;  2KLQ A;  1HR0 T;  5AQG B;  4PK4 A;  4IGU A;  3JAD A;  4O4L E;  2BG9 A;  4PJM A;  5AQH B;  4XZC A;  3QC9 A;  5KMG P;  3N5L A;  5C2T A;  1OED A;  2VL8 A;  1BR1 A;  3IF8 B;  3QB5 A;  2WS3 A;  4HEA A;  3PE0 A;  2J47 A;  2ZM6 T;  4JI8 T;  3RIU C;  3ZMV B;  4DV4 T;  1I94 T;  2WZI A;  4JLE A;  2N1G A;  4HFV A;  4QKN A;  3ABV A;  3P4Q A;  3AE8 A;  5FXV A;  2XQ8 A;  5JH7 E;  3QK6 A;  4UIG A;  4LF5 T;  2ZM2 A;  1XDO A;  2WB5 A;  2XQ3 A;  2YKS A;  4HN9 A;  2FJD A;  5LA6 E;  2JRK A;  4L9I A;  2Q9Q A;  2LSY A;  4DR7 T;  2E5V A;  2GK9 A;  3V5S A;  3TLS A;  3CX8 B;  1N36 T;  2ACZ A;  1H7C A;  4CN4 A;  4DR5 T;  3I0Q A;  3GMI A;  2LJL A;  5AQF B;  5HXC A;  4EEB A;  3EDU A;  3AAA B;  4AI6 A;  2ODU A;  5IUX A;  3CX7 B;  4DV0 T;  3SOL A;  4F8H A;  3E08 A;  2WWU A;  4UV8 B;  2LE8 A;  2MOZ A;  4M1P A;  3L09 A;  3JCF A;  3KV6 A;  3UU8 A;  4QXB B;  2LKH A;  4ZZB A;  2HH7 A;  4TWF A;  3CX6 B;  3P4S A;  3ZLI A;  2UXD T;  3KVA A;  2G0U A;  5A1L A;  2XPK A;  1HX1 B;  3B5M A;  3CQG B;  5EK3 A;  1UUR A;  2CHO A;  1VCS A;  4LFA T;  2XUE A;  1UX5 A;  1ZKE A;  2XTL A;  4PJN A;  4DV5 T;  2V8S V;  4EYY R;  1HG2 A;  3ETV A;  2UUC T;  3NZQ A;  2JQQ A;  3PV0 F;  1OXZ A;  2LRK A;  3CQC B;  4LF4 T;  4GIW A;  5EK2 A;  2DLR A;  4AQY T;  2FJB A;  3RYH E;  2JQK A;  4NXM T;  4L5G A;  3SFE A;  4NXN T;  4H9N C;  3HA4 A;  3UU3 A;  2XAQ B;  4BAY B;  4DMV A;  2RPA A;  4P0B A;  5LYJ E;  3QNU A;  3HKC E;  3PJA J;  3AE5 A;  5AQQ B;  4X1I E;  2VKJ A;  3CIR A;  5JDF A;  4Z90 A;  2CCQ A;  4X5T A;  4I55 E;  4TN7 B;  3FZL B;  4L0R A;  5HEJ A;  2LSG A;  3J9X 1;  2DHR A;  1N34 T;  4LML A;  4ADZ A;  4ISS A;  4QWN B;  2BVL A;  4LMJ A;  4A5X A;  5AQV B;  5CA0 E;  3KBT A;  3R6N A;  2HPL A;  2X9H A;  2Z6E A;  1SHZ C;  2L9Q A;  3MXZ A;  3T1H T;  4X1Y E;  4GYR A;  2VUR A;  4EIW A;  2CXD A;  2OA5 A;  4JV5 T;  2IHR 1;  4BJM A;  4A97 A;  4X65 T;  4DO0 A;  4IE7 A;  3AE1 A;  4U2Y A;  4O2A E;  2DWG A;  1AJ3 A;  3OTO T;  5LHG B;  3A7M A;  1BR2 A;  1X9B A;  2ACX A;  4KHZ F;  3ZSS A;  1G8X A;  4YSY A;  3ZYL A;  3AAE B;  5AQJ B;  1W9R A;  2JMH A;  2BZB A;  3PUX F;  2A72 A;  4ZS3 A;  3BQI A;  3VKG A;  4H9O C;  4E7Z A;  4X62 T;  2CWY A;  3LBX B;  5BR8 T;  2JQH A;  3P8C D;  4DBQ A;  5LBQ B;  3RRC A;  1WFD A;  1UUS A;  3UQ7 A;  2H7O A;  2YU2 A;  5AQR B;  4JI3 T;  3UUL A;  2UUB T;  4IDN A;  4FI5 A;  2CM0 A;  4A98 A;  2XY8 B;  3TLW A;  3N2K E;  5JQG E;  3U78 A;  2AE9 A;  4HFE A;  3RI5 A;  3EI0 A;  3RX6 A;  4TNV A;  2V6X A;  1SA0 E;  2PTF A;  2WZH A;  2NW8 A;  4CZZ B;  2XAS B;  5IHY A;  4YJ3 E;  1QLB A;  4DND A;  3RKO A;  2X9W A;  3FZH B;  3UT5 E;  4HKA A;  5HWX A;  2W00 A;  2PBI A;  5TAO A;  5L4E A;  4GYS A;  5H6R B;  3TLU A;  3ANW B;  4HFB A;  3P4R A;  5F5W A;  1D1A A;  4DR2 T;  2BBJ A;  2FJE A;  2Q9Q D;  4EAH A;  4UVC B;  1MNE A;  1HTJ F;  3LBX A;  5L3B B;  3KV4 A;  5JRE A;  4V1A v;  3VRA A;  4N78 D;  3P7I A;  3SFD A;  2D9D A;  5M4Y A;  2H88 A;  2J62 A;  4DBR A;  2CBJ A;  2X51 A;  3Q9D A;  3ONJ A;  4K0K T;  3ESL A;  4LMK A;  2A9U A;  4JI2 T;  1E1H B;  1V9D A;  5CB4 E;  3N9N A;  3KV5 A;  1VRB A;  2ZM0 A;  5L3G B;  5FKY A;  2C5K T;  2DNX A;  2XZE A;  4QX7 B;  3ZCJ A;  2Q9Q C;  3AEC A;  4ANJ A;  3MK7 C;  5FVK A;  2X9Y A;  5HAX A;  4OYJ A;  3T1Y T;  5EK4 A;  3X1D A;  3AA6 B;  3EVY A;  2LSK A;  4B3R T;  2UXN B;  3AVS A;  1EZ3 A;  4PW8 A;  3L8R A;  2KT9 A;  3WI3 A;  3TKL B;  5JDL A;  4QH4 A;  5LJN A;  3UFG A;  2YDR A;  4HWI B;  2CLY B;  3W15 B;  1NEN A;  4WNK A;  2N9D A;  3Q5E A;  3ANW A;  2NR4 A;  1WLX A;  3IEE A;  2UXC T;  4JUY A;  5FVL A;  3ZMU B;  3C4X A;  3QOF A;  3RLF F;  4ERR A;  4KP3 C;  5LBM A;  3UU6 A;  1CUN A;  4DV3 T;  1IZN B;  5JDM A;  1T8B A;  4H63 H;  1XMO T;  1D0Z A;  4DV7 T;  3R84 B;  1YW0 A;  4UVB B;  3HKE E;  3ZST A;  4CI1 B;  4QX8 B;  2P9B A;  2CA5 A;  2K3W A;  3ONL C;  4TX5 A;  4P1N A;  2W67 A;  2W66 A;  4BA9 A;  3N9Q A;  4LF9 T;  1UX4 A;  2KMF A;  2VKD A;  1LKX A;  3HR0 A;  1NAF A;  3N9P A;  1UK5 A;  3SRZ A;  5AQN B;  1FMW A;  4CXX A;  4NUU A;  4X1K E;  4NUV A;  3RIA A;  3NVO A;  2YU1 A;  2WMN A;  3AA0 B;  3RGL A;  4LF8 T;  5ABG A;  3PUG A;  1LVF A;  4O2B E;  1IBL T;  5LHH B;  3NKZ A;  3EDV A;  2C0S A;  2XAJ B;  1OWA A;  2VB6 A;  4IDO A;  4ZZC A;  4H9Q C;  5HXS A;  3EAB A;  3ZN1 B;  2NWB A;  5ABH A;  3O4X E;  3N2O A;  2BS3 A;  2UUA T;  2EHO B;  2DCF A;  3C64 A;  2LHR A;  2Y48 B;  3OKQ A;  1MMA A;  1W0A A;  2A2F X;  4ZHQ E;  1E7P A;  3ZMS B;  3O1J A;  4IDZ A;  4HFH A;  4NIQ A;  3CML A;  2OV9 A;  3N9M A;  5HXH A;  3NRX A;  2VQF T;  2BVM A;  1IJ5 A;  4IE6 A;  4NPP A;  2WDR A;  3JAF A;  2CXL A;  4QXH B;  2HPJ A;  5L3C B;  4X20 E;  5LJM A;  2E9X D;  2YK0 A;  2KND A;  2MTQ A;  2XAH B;  1HNZ T;  1S94 A;  5J0Z A;  4JBW F;  4U72 A;  1S35 A;  4AXP A;  3PUV F;  5FY0 A;  4ILB A;  4G2A A;  3KDS E;  4AIU A;  4KUM B;  2IAK A;  3AE4 A;  1D1B A;  2X67 A;  3IA3 A;  2LEH A;  1KF6 A;  2EHO A;  3AE7 A;  2LM9 A;  4WYV A;  2E9X C;  4YTN A;  4I50 E;  5LXT E;  1YQ3 A;  3Q5D A;  5FY1 A;  5CGM A;  5ETW A;  1MIV A;  2JPF A;  1YKH B;  1J5W A;  4I0U A;  2ODV A;  1NWM X;  3NBX X;  4XAX B;  3VR8 A;  2R6G F;  2J4G A;  2YIN A;  1MIW A;  4GKK T;  2X9X A;  4PK6 A;  3HL6 A;  4LFB T;  4OYK A;  2WDQ A;  2ZLY A;  4H63 V;  3LK3 B;  1M7K A;  1HNW T;  5JDH A;  2CPT A;  2PFV A;  3RC8 A;  5LGU B;  3MJX A;  2QVA A;  4JEU B;  3DJB A;  1WR0 A;  4IE0 A;  5DAB A;  4ILA A;  3CWZ B;  2XQ7 A;  2QRX A;  2WSS V;  4F6R C;  3CVR A;  2KWH A;  3C4Z A;  5F3J A;  4YJ2 E;  2V6Y B;  3RYF E;  3HKD E;  4GOU A;  5JR9 B;  4HWH A;  5LGT B;  4UVA B;  1HG5 A;  2WMO A;  4UF0 B;  5HEG A;  4B6X A;  3VR9 A;  2LLY A;  1XZY A;  4E7S A;  1MMN A;  2V7L A;  1KK7 A;  3Q5X A;  2LSI A;  4A56 A;  5L2L A;  1ZV4 X;  4U7I A;  2V5D A;  2SPC A;  4YTP A;  3ZJ1 A;  4IST A;  3LK4 2;  5FMN A;  3AEB A;  4HWF A;  2NP9 A;  3I9W A;  5AQT B;  2L3L A;  3ZC0 A;  2MPK A;  5AQI B;  4AQF A;  4DR1 T;  5ABE A;  1IBK T;  3V5U A;  3HI2 A;  3N2G E;  2B1E A;  3U3I A;  3AE2 A;  1UCU A;  3O9X A;  3C4W A;  3PJA A;  2V7J A;  1VCT A;  1KEY A;  3UU4 A;  4WBO A;  4O4I E;  2ZMA A;  5FY7 A;  5HWY A;  4DR3 T;  3KIN B;  4JEH B;  4BJN A;  2HN2 A;  3AAI A;  4G63 A;  5AQL B;  3Q5W A;  3RIU A;  2BBH A;  4DUY T;  3AA7 B;  2UXX B;  4IRE A;  1LRZ A;  4EB6 E;  2V6Y A;  5JR9 A;  2XM2 A;  3P4P A;  3VHL A;  3EUH A;  1HNX T;  3IBP A;  4HE8 A;  1ZP0 A;  2WBL A;  2JJ9 A;  4OX9 T;  4UF0 A;  2LKG A;  3C98 B;  3FHN A;  3ZT6 A;  5KDM C;  2KZ7 B;  3TLV A;  3I9Y A;  5L3F B;  4YHJ A;  1IBM T;  3RQW A;  2X66 A;  5IWA T;  2LSJ A;  4CN6 A;  4AQG A;  4IDP A;  3E0Z A;  4C90 A;  2NW7 A;  3ZPO A;  1R8I A;  4DUZ T;  4DV6 T;  4MFR A;  5KXJ A;  3K3Q C;  1SUM B;  4MHC A;  1DU2 A;  4EZ4 A;  2WM9 A;  3ZCI A;  4YLH A;  1FIO A;  3HKB E;  1FJG T;  1D1C A;  4ILC A;  5C3J A;  1WYC A;  3LG7 A;  2CHN A;  2KIN B;  4PFO A;  3PUW F;  2DWK A;  3LSV A;  3ZC1 A;  2VWA A;  2WAU A;  5HEU A;  3T8O A;  2BG9 C;  2V5C A;  4CI3 B;  2OLT A;  3A5X A;  4IE5 A;  3NRY A;  1OED C;  3DTO A;  2IML A;  2B76 A;  3F57 A;  3PUZ F;  3K1S A;  4YTM A;  3PUR A;  3AE9 A;  1M62 A;  4U7Y A;  4YSX A;  2XHE B;  2XSA A;  2W2U A;  1I6Z A;  5BMV E;  4WZX A;  1MIY A;  3PUY F;  2JIW A;  4QXC B;  1YQ4 A;  4EXT A;  2LHN A;  3GN5 B;  2EHO D;  3K8P C;  1QSD A;  3P50 A;  1NEK A;  2V7I A;  3KVB A;  4P09 A;  1WCR A;  1XNQ T;  5HEH A;  2X0H A;  3PTR B;  4QH1 A;  2N2N A;  3N9L A;  2LM2 A;  2CRB A;  4LF6 T;  1W09 A;  3SS1 A;  2MYS A;  4I43 B;  3LJC A;  5JVD E;  1CHU A;  4ASK A;  4IHJ E;  3UUX B;  1MMG A;  2K5B B;  1FEW A;  4KI0 F;  4PK5 A;  2V7M A;  3ZKR A;  5L3D B; 
#chains in the Genus database with same CATH homology
 3H3M A;  3NKZ A;  3A7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...