4GK5E

Crystal structure of human rev3-rev7-rev1-polkappa complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
APNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Mitotic spindle assembly checkpoint protein MAD2B
publication title Structural insights into the assembly of human translesion polymerase complexes
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4gk5E00
2LSYA 4GK0E 2LSIA 2LSGA 2N1GA 4FJOA 2LSJA 3VU7H 2LSKA 4BA9A 4EXTA 4GK5E
chains in the Genus database with same CATH superfamily
4C91A 3O4XE 1YKHB 4TV8E 4PFOA 3K8PC 2OA5A 5LHGB 4WW0A 2EHOC 5HEUA 4YSYA 4UXNB 2VB6A 3FBLA 2KNDA 2BKOA 5L47A 5AQVB 3AEGA 3H3MA 4TX5A 5JR9B 4QWNB 5AQGB 2UXNB 4OK0A 3IBPA 3N9OA 4U31A 2CBJA 2RPAA 5CA0E 2CHOA 2Y6XA 5L3CB 2DHRA 1MNEA 3AE1A 1FMVA 3KFWX 4HFBA 2CWOA 2L9QA 4H63H 5AQQB 4EEBA 3U78A 3VR9A 3PUZF 4DR4T 5HXCA 3IF8B 3RH3A 1UX5A 5HWXA 4HFIA 3RIUA 2CEAA 2WZIA 3MA9A 4U7IA 3QNUA 5FXWA 3O1IA 3RRCA 2BG9C 5HYAA 1X79A 4YTPA 5FL1A 3LDQB 4IDPA 2LE8A 4X5TA 1E1HB 1S35A 4HGAA 1ZEEA 2XAGB 5LBQB 4AIUA 5AQOB 3AAEB 1VCSA 4ISTA 1T98A 2LOPA 1N33T 4UF0B 2IHR1 4EEDA 4HWFA 2I0MA 2PBIA 4YSXA 2Y8DA 4WYVA 5DJQC 3TLSA 5JRCA 2PTFA 4P0BA 3LBXB 3I0OA 3PJAA 3N5LA 3CQXC 1UK5A 3AECA 1D1CA 4LFAT 1KEYA 2W62A 4X64T 3ESLA 5C8YE 3C98B 3PUXF 4FJOA 5FL0A 3H3AA 4LF5T 1LKXA 3T1HT 1HS7A 5LGTB 2XQ5A 4DR5T 3N9MA 5EK2A 4N78D 1GQEA 4HE8A 2Q9QC 2CWYA 2MOZA 4WBOA 2VKHA 2M6IA 3NVOA 4X66T 3FB2A 3OYZA 3GMIA 4YSZA 5LHIB 4O2AE 4DIDB 3ZMZB 3J9X1 4HWIB 3B5MA 3DJBA 1IBMT 1U4QA 5CJ5A 2JMHA 2FJBA 5LMNT 3UU3A 3SOLA 5LG3A 2YDSA 2WSSV 1MMDA 3N9LA 4I0UA 3ANWA 3P7IA 3GN5B 3SFDA 2K5BB 4IREA 4B3MT 4H9RC 2Z6EA 4LMJA 1VRBA 4DV2T 3VRBA 4H9QC 3ZMUB 1XNRT 3N2KE 1YW0A 1ZKEA 3RYCE 3ZT6A 2ACXA 5ABFB 3PUVF 5LBMA 2LT3A 2AE9A 3AEBA 4UVBB 3L09A 2H88A 2XY8B 5J2UE 3J7Yq 3HKEE 4ZI7E 1OEDE 4XAXB 5DQWA 3AA7B 3UULA 5EK4A 4UIGA 4EOZB 3C4WA 5KX5E 3V5SA 4X1IE 4HFVA 5AQIB 1MIVA 5LCYA 5H6QB 3AA6B 2LJLA 5J0ZA 1T8BA 4JI5T 4CXYA 2CA5A 2H7VC 3UFEA 2CLYC 1W0BA 3MZKB 1CUNA 2E9XB 4CQIA 3JAEA 4IT4A 5EZYE 2R6GF 3ZCIA 3ZKRA 2D0UA 2BKNA 2WP9A 5EK3A 4PK5A 2XSAA 3P4SA 3F2EA 3HKBE 1XNQT 4KBMB 4IE4A 3ZT7A 2E5VA 3QB5K 4F6RC 3CPZA 3DTOA 2NTXA 4JEHB 2MYSA 5F3JA 4FI5A 2V1DB 3SFEA 4BJNA 2ODVA 3UU8A 4IL9A 2LRKA 5HCJA 4Z8XA 3JADA 4DO0A 5JVDE 2XQYA 2NOXA 2E8IA 1XMQT 4X65T 5IHYA 5JDLA 1Y01A 2G0UA 3ZMTB 5FMNA 3ZT5A 2V6XA 3JC6D 5FYMA 2WZHA 2W2UA 4ZS3A 4UVCB 1OEDB 3K3NA 3EAMA 2V7MA 3RC8A 5LJMA 2BG9E 3OYXA 5JR9A 2JQQA 3AEFA 3AAIA 4ZI2D 4ILAA 5AQTB 4U7YA 3AE5A 3AVSA 1HF8A 3OJAA 3RQUA 5JTGA 1DU2A 1UUSA 1JNZA 4L9IA 2BVLA 4PJNA 4OFZA 2YKSA 4IL4A 2BS3A 4LF9T 4AISA 2WB5A 4U33A 4UV8B 5FNVE 2VQFT 4E7SA 1NWMX 2IC6A 3HI2A 4ZOLE 2YN6A 5HAXA 5IUXA 3ZN0B 3R84B 2YK0A 4Q25A 2NTYA 2L8KA 1LVFA 1W0AA 1FIOA 3PUAA 1HNZT 2MBGA 3RC3A 2XQAA 1R8IA 5C2TA 3EI0A 3NZPA 4UVAB 5JQGE 2X0HA 3C4ZA 4YY3T 3NWIA 4O4JE 4I55E 4PJJA 4JYAT 3MXZA 4NXNT 2JQ9A 2VQET 1VOMA 4ZS2A 4ZZBA 4PJLA 4DBRA 4UF0A 3HR0A 3RIAA 1MMAA 5JDGA 4OX9T 4IDQA 3PU3A 4PK6A 4YLHA 3LBXA 2B1EA 2V7KA 2VASA 3HA4A 4EYYR 2F4VT 4NIQA 4H9SE 1SHZC 4EV6A 1Z0PA 3RYIE 2W61A 2XQ7A 4KI0F 2DLRA 4CI3B 4H63V 2BBJA 3JCFA 5AQPB 5HEOA 4DR3T 3TLUA 4YXDA 3Q2MA 1IBKT 1KF6A 3RHWA 2BG9B 2BS4A 3AE8A 2FJDA 2JIWA 1OXZA 2YOEA 3RRWA 2LSGA 1XDPA 5L3DB 2WMOA 3CK6A 4KX6A 2BKPA 2OV9A 1SE7A 2NWBA 3PURA 3LG7A 2M67A 4HFEA 4EXTA 5LNKA 3QC9A 3LJCA 1OWAA 3P4QA 5HCMA 2L3LA 2XASB 2HPJA 3P50A 4LFCT 1YQ4A 4KHZF 4QH4A 1O3XA 4ANJA 4ERRA 1D1AA 4IGUA 4XZCA 3VR8A 5IYZE 2LM9A 5KXJA 1G8XA 3EABA 5LGNB 2XSBA 5L3GB 4L0RA 4EYUA 3RF1A 3GN5A 2IW5B 3D0TA 4QXCB 5FY0A 1WYBA 5L3EB 2ZM8A 3C51A 2YU2A 3LSVA 2B76A 4TNVA 5ABFA 2IDOB 2WU2A 4ZZCA 2D5UA 5LOVE 2XAJB 4EGWA 4A98A 5KMGP 1HX8A 2YDQA 4IIJE 5FXZA 2FUPA 4U74A 4AQFA 2JQHA 2QGSA 3AA1B 3OPCA 2N2NA 2JJ9A 3AEAA 3L8RA 3P4WA 1HNWT 4AKIA 4O4HE 4PW8A 5JDNA 1WFDA 1SUMB 1KNZA 1MIYA 2GK9A 4IE5A 2W4XA 3MACA 3FBZA 3ONLC 3N2OA 5AQUB 4DV0T 3CX8B 2UU9T 4TN7B 3ONXA 1J5ET 3AAAB 2A72A 2E9XA 4LFBT 3AEDA 1NENA 4JBWF 1M7KA 5BMVE 3EUHA 2C5JA 2LHNA 2XAHB 3M65A 3ZYMA 3E0ZA 3RX6A 4DUZT 4OYKA 2N9DA 4IHJE 2WDQA 4DV6T 2WDVA 4YTNA 3ONJA 4V1Av 2QVAA 1YQ3A 2VL8A 2UUAT 3WI3A 5FY7A 4ZHQE 3GWHA 4DUYT 2VKJA 3NBXX 4AI6A 3IA3A 1W09A 4X1YE 3UQ7A 1KNPA 2DCFA 2DL1A 1ZP0A 2V7LA 4HKAA 3AE7A 4ILUA 4PNIA 2CRBA 3PU8A 4TZ4C 4B3RT 3QOFA 4QXHB 2LLYA 3R6NA 2UUBT 2Y48B 3FXEB 2XQ3A 3RQWA 2ACZA 2K9AA 3Q9DA 2UXDT 4A56A 3ZC1A 5LMUT 3Q5EA 5LP6E 5AQSB 2CLYB 3BQLA 3WAJA 3C64A 3BQIA 1HTJF 3B13A 3NZQA 4IE7A 2AXDS 1OEDA 4U3CA 4PAGA 5FY1A 4YTMA 1MNDA 3AEEA 4IE6A 4QH5A 4ILBA 1S94A 4MALA 4ZXLA 4JI6T 1W9RA 1U5PA 4PFPA 3ZN1B 3W15B 4JI1T 3GA8A 4P09A 2RA1A 2MAWA 4DR1T 4IDOA 4JI3T 1FJGT 4AKHA 2XUEA 5HWYA 4IDZA 2V26A 3HL6A 3DP7A 1X9BA 5JDQA 1UURA 3AE6A 3PUQA 2E5LT 4I50E 3PUSA 2LM2A 1D0YA 4BA9A 3EDUA 3RYFE 4JUYA 2ES0A 2HN1A 4LF7T 3VKHA 5DQVA 2XJ7A 3Q5WA 3BK9A 4CZZB 2XM2A 5AQHB 2X0LB 2NR4A 1WYCA 2NP9A 3RIUC 3PJAJ 5HXRA 4KUMB 5CFBA 3SRZA 2W66A 2KLQA 3EDVA 1ZHCA 2XPKA 2CXFA 4G63A 5KDMC 3P8CD 5LG4A 3ZJ2A 4WBNE 5LA6E 5E0OA 4GKJT 1IBLT 2VURA 3KBUA 4ZEYA 4CXXA 5A1LA 3AE4A 4TNWA 2XQ4A 2CXDA 4QHOA 2SPCA 5HXHA 2PJQA 3T8OA 1D0XA 2BG9A 4HEAA 1HCIA 4EAHA 3UU5A 1KNRA 2HN2A 3ZJ1A 5JDHA 2YU1A 4IDNA 2W00A 2H3RA 5AQNB 3PUWF 4ZI3C 2E9XC 4BJMA 3FXDB 2XQ6A 4DBQA 3LK3B 2VVNA 2PG8A 3A7MA 3ZCJA 2LKGA 3LFMA 4EZHA 5FVLA 5L3FB 2ZM2A 3T1YT 3F57A 2LHRA 2WS3A 4CN1A 2DWGA 2XZEA 3A8YC 3UFGA 3FZHB 4UV9B 3G06A 5FXXA 4HWDA 2D0TA 3VU7H 4DV3T 4DR6T 4DV1T 1AJ3A 3F31A 4JI0T 2LKHA 3L39A 4H9PC 3ZPOA 1I94T 2D9DA 5AQMB 2K24A 3U3IA 5L4EA 1Y64B 3ETVA 4WZXA 2FJAA 4B3TT 3CVRA 1WLXA 4X62T 2P9BA 1WCRA 3MJXA 1SA0E 3AE2A 5L4HA 3ZMVB 4O4LE 2EHOB 5JH7E 4CXWA 3FHNA 3C4XA 5JREA 5LJNA 4MBQA 4AKGA 1WRDA 2MPKA 2ODUA 1G73A 2WM9A 2X67A 3CX6B 3E22E 2JRKA 4NUVA 2UXXB 4JI2T 5ABGA 3PDYA 2MTQA 1NAFA 2NW8A 3O1HA 1OEDC 2JMKA 5JDMA 4CN4A 1Z8UA 4PK4A 2IC9A 2V6YB 2KWHA 4I43B 2V5DA 3IEEA 2DWKA 2IUBA 1KK7A 4O4IE 4DVDA 3FZFB 3CKDA 1MMGA 4A97A 3CX7B 2ZM0A 2CCQA 2VKOA 4TUYE 3VKGA 4DV5T 4AKRB 2XAFB 2CHNA 3SWHA 5CA1E 3N9PA 2XQ8A 3OTOT 2XTLA 3PUGA 5HEJA 1J5WA 5J2TE 2FJEA 3A5XA 4B6XA 4UR9A 2J4GA 4CI2B 3ETUA 5F8PA 1JNRA 3MKDA 1UX4A 1BR1A 2X9YA 1N32T 2UXCT 2IMLA 3AVRA 1BR4A 3E08A 4LMKA 4GK0E 3QK6A 4YJ2E 3QUJA 3P4RA 3IHRA 4YHHT 4NPPA 3I9WA 4QXBB 3CQCB 2LSYA 2YINA 3Q5XA 2WU5A 2N1GA 4DV7T 4JI8T 3L3PA 3ZEFB 1HG2A 3UUXB 4DV4T 1FEWA 2IIUA 2W0GA 3O1JA 2V7IA 5AQLB 3TLTA 3HKCE 4J2CA 4GOUA 4MFRA 1IJ5A 2NW9A 3LK42 2LRLA 3NRYA 5HEHA 1XDOA 5ADXL 3N9NA 4QX8B 1IZNB 4UEMA 2XAQB 2ZLYA 2Q9QB 4LF4T 5AQKB 1D0ZA 5J1GA 2DI4A 2XHEB 3AXJB 1D1BA 5C3JA 2BS2A 2HH7A 4ASKA 2X51A 2NW7A 3ABVA 2W63A 3KBTA 3ZSSA 1WR6A 1YD8G 3FZMB 5CGMA 4EZ4A 2YEVC 5JR9C 5AQJB 2I59A 5ABHA 4GYRA 3VHLA 2EHOD 2X9HA 3PUYF 1KFYA 3KINB 4AQGA 3CMLA 3ZMSB 3ZLIA 5HXEA 1L0VA 2QYWA 2VKDA 4Z91A 2UUCT 4XBFB 2CBIA 3CIRA 4O2BE 2VVSA 3RI5A 4MHCA 4HFDA 4JV5T 3EHZA 4H9NC 5M4YA 1HX1B 4TWDA 4JLEA 4X20E 5TAOA 2QA7A 5LXTE 4HTEA 2A9UA 4HFHA 3CQGB 5JDFA 3P4PA 3K3OA 3CWZB 2BBHA 1J1JA 4LMLA 5LYJE 4DNDA 3ZYKA 4L5GA 3C50A 2KINB 4I4TE 2V8SV 1HFAA 4DMWA 2WAUA 2M6BA 2KZ7B 1BR2A 2WQYA 5ETWA 3ZYLA 2VL0A 4QKNA 2V5CA 4PJMA 2YDRA 3PV0F 1IJ6A 3AB3B 3K1SA 2IAKA 1CHUA 2HPLA 4GKKT 5AQRB 2WWUA 4YT0A 2VK9A 4DMVA 4E7ZA 3OBVE 3RKGA 5FXVA 1UGOA 2FBWA 3B57A 3KV4A 1ZOYA 2X66A 3S4UA 3KV5A 3JAFA 4G2AA 3K3QC 3SS1A 4YJ3E 5LGUB 3I9YA 4GIWA 4QH1A 4TWHA 2C5KT 2A3DA 3TLWA 2KSRA 3OKQA 3BQKA 4U2ZA 2H7OA 3N9QA 4WNKA 3UUBA 3JC6C 1ZV4X 2KWIB 4P0AA 2J62A 1YXRA 3FZKB 4UELA 3RKOA 2JQKA 2Q9QD 2WBLA 4DR7T 2PFVA 4ILCA 3TLVA 5JRCB 2RP4A 2WMNA 3AE9A 1I6ZA 5BR8T 1HNXT 4ZI2C 2BZBA 4HN9A 3RGLA 2EHOA 2LSKA 4COFA 1MMNA 2J1DG 3I0QA 2CE7A 1US7B 5DABA 4TV9E 2E2AA 3TKLB 3I1AA 3RIFA 3MK7C 3KV9A 4H9OC 1HR0T 2CXLA 2V6YA 3UTKA 2VWAA 2HHHT 1QSDA 1WR0A 4K0UA 3RPUA 2CM0A 3QB5A 3EVYA 3FZLB 4A5XA 4YFSA 3NKZA 2I6HA 1FMWA 1N34T 2LEHA 4AQYT 4NXMT 4AQFC 3LK2B 1E7PA 4KMCA 4NUUA 4CI1B 4CN6A 5F5WA 4JEUB 2LOSA 5HEGA 1N36T 3M3ZB 2CPTA 4C90A 3KVBA 3V5UA 3ZC0A 5FVKA 5GONE 3ANWB 2KXPB 4EIWA 1QUUA 2X9XA 2ZMAA 1XMOT 2X68A 2C0SA 2X9WA 3O9XA 3RLFF 4LF8T 2DNXA 4DR2T 3VRAA 4B3ST 4GYSA 1V9DA 5AQFB 2BDEA 3UUMA 1VCTA 3N2GE 4HWHA 4ADZA 2JPFA 4IE0A 3WAKA 4JI7T 4YHJA 1H7CA 3UQ4A 4ISSA 5LB7B 5HXSA 5CB4E 5ABEA 2K3WA 3PTRB 4OYJA 3OVUA 5AFUL 2XQ9A 4F8HA 4EB6E 4GK5E 3UU6A 3AA0B 4LF6T 4HWCA 2V7JA 4AKLA 1M62A 4O8SA 2QRXA 4U2YA 4KP3C 4OHFA 1T72A 4MLKA 1XWMA 2X0YA 4K0KT 2WY2A 1BR0A 1YKEB 3UUNA 3RYHE 2KMFA 2W67A 2Q9QA 3H37A 2ZM6T 2C5IT 1LVKA 2LSJA 2WWVA 5L3BB 5IWAT 5H6RB 3PE0A 3UT5E 4M1PA 3KDSE 4X1KE 4TWFA 3AXJA 4AXPA 4KHPT 1EZ3A 4BAYB 2WCAA 4QX7B 1QLBA 5FP3A 3UU4A 2J47A 2LSIA 1NEKA 2OLTA 3KV6A 5L2LA 4JI4T 2D2SA 4Z90A 4HFCA 5LHHB 4ZI3D 2A2FX 4U72A 2UXBT 2E9XD 2KT9A 1HG5A 3KVAA 1UCUA 1B7TA 1XZYA 2WDRA 1IAPA 4P1NA 2BVMA 1LRZA 3AE3A 3NRXA 1T7SA 2K48A 2CMRA 2XM1A 3HKDE 1MIWA 2H89A 1E2AA 3X1DA 5FKYA 3Q5DA 3ZSTA
chains in the Genus database with same CATH topology
5HWYA 4C91A 4XBFB 3O4XE 1YKHB 3AVSA 2V26A 4IDZA 3HL6A 1HF8A 3DP7A 3OJAA 4TV8E 4PFOA 3K8PC 2OA5A 5JDQA 5LHGB 4O2BE 4WW0A 2EHOC 4L9IA 4MHCA 3PUQA 2BVLA 4UXNB 4H9NC 5M4YA 4PJNA 2VB6A 4I50E 4OFZA 4JLEA 4X20E 5TAOA 3FBLA 2KNDA 2QA7A 3PUSA 1D0YA 5LXTE 4HTEA 4BA9A 3EDUA 3RYFE 4JUYA 4TX5A 2ES0A 4UV8B 5FNVE 5JR9B 3CQGB 4QWNB 5JDFA 4E7SA 3VKHA 5DQVA 2UXNB 1NWMX 2IC6A 3K3OA 3Q5WA 3HI2A 3CWZB 3IBPA 4OK0A 3BK9A 3N9OA 4ZOLE 4CZZB 5HAXA 5CA0E 3ZN0B 2Y6XA 2X0LB 3R84B 5L3CB 5LYJE 1WYCA 2NP9A 2DHRA 2YK0A 2NTYA 1MNEA 4DNDA 1FMVA 5HXRA 3ZYKA 3KFWX 2L8KA 1LVFA 4L5GA 1FIOA 2CWOA 3C50A 4KUMB 3PUAA 2L9QA 3SRZA 4H63H 2MBGA 3RC3A 2KLQA 3EDVA 1ZHCA 2KINB 3U78A 5HXCA 4I4TE 3IF8B 2CXFA 3RH3A 4G63A 1UX5A 5KDMC 1HFAA 3P8CD 4DMWA 5LG4A 2WAUA 5HWXA 3NZPA 3ZJ2A 4WBNE 2CEAA 4UVAB 5JQGE 2KZ7B 1BR2A 3MA9A 5ETWA 3ZYLA 3C4ZA 4QKNA 5E0OA 5LA6E 4O4JE 5FXWA 3O1IA 4I55E 4PJJA 3RRCA 3KBUA 3MXZA 5HYAA 1X79A 1VOMA 4CXXA 5A1LA 4ZS2A 4PJMA 1IJ6A 2LE8A 3AB3B 4PJLA 4UF0A 4DBRA 2CXDA 4QHOA 2IAKA 3HR0A 2HPLA 2SPCA 5HXHA 1MMAA 5JDGA 2WWUA 2PJQA 3T8OA 1E1HB 1S35A 2VK9A 3PU3A 4HGAA 1ZEEA 4DMVA 2XAGB 4E7ZA 4PK6A 4YLHA 1D0XA 3OBVE 3LBXA 5LBQB 2B1EA 2V7KA 4HEAA 5FXVA 3B57A 3AAEB 3KV4A 2VASA 1HCIA 2X66A 3HA4A 4EAHA 3S4UA 4ISTA 3KV5A 4EYYR 1T98A 4H9SE 1SHZC 2LOPA 3ZJ1A 1Z0PA 3RYIE 5JDHA 2W61A 4G2AA 2YU1A 3K3QC 4UF0B 2DLRA 2W00A 3SS1A 4CI3B 2H3RA 2PBIA 2Y8DA 4YJ3E 5DJQC 4H63V 5JRCA 5LGUB 4P0BA 4ZI3C 3I9YA 2E9XC 4GIWA 4BJMA 3Q2MA 3FXDB 3LBXB 3I0OA 4DBQA 2C5KT 3N5LA 3CQXC 3LK3B 2A3DA 1OXZA 1D1CA 2PG8A 3OKQA 3ZCJA 3BQKA 2W62A 3RRWA 2H7OA 2LSGA 3N9QA 4WNKA 5L3DB 2WMOA 3JC6C 3LFMA 4EZHA 5L3FB 1ZV4X 2KWIB 2ZM2A 4P0AA 3ESLA 4UELA 3RKOA 5C8YE 3F57A 2LHRA 2Q9QD 2WBLA 3C98B 2NWBA 3PURA 2PFVA 2DWGA 3LG7A 4FJOA 2M67A 2RP4A 3H3AA 5JRCB 2WMNA 4EXTA 5LNKA 3QC9A 4UV9B 1LKXA 3LJCA 5FXXA 1OWAA 2D0TA 1HS7A 4ZI2C 2BZBA 4HN9A 3VU7H 5LGTB 2L3LA 2EHOA 2XASB 2HPJA 1AJ3A 2LSKA 1MMNA 1O3XA 3N9MA 4ANJA 2J1DG 4ERRA 3I0QA 3F31A 5EK2A 2CE7A 1US7B 5DABA 1D1AA 4N78D 4IGUA 4TV9E 4HE8A 4H9PC 4XZCA 3ZPOA 2K24A 2Q9QC 5IYZE 3U3IA 1Y64B 3ETVA 2LM9A 2CWYA 2MOZA 1G8XA 4WBOA 3TKLB 2VKHA 5LGNB 3I1AA 5L3GB 4L0RA 3CVRA 4EYUA 1WLXA 3MK7C 2P9BA 3MJXA 3KV9A 3GN5A 3FB2A 1SA0E 3OYZA 4H9OC 3ZMVB 3GMIA 5LHIB 4O2AE 2IW5B 2CXLA 3D0TA 4O4LE 3UTKA 2EHOB 2VWAA 3ZMZB 4CXWA 5JH7E 3J9X1 4QXCB 1QSDA 3FHNA 3DJBA 3C4XA 5JREA 5LJNA 4MBQA 1U4QA 4AKGA 5FY0A 1WYBA 1WRDA 5L3EB 2ODUA 2JMHA 2ZM8A 4K0UA 1G73A 2WM9A 3RPUA 2X67A 2CM0A 3C51A 3SOLA 2YU2A 3CX6B 3E22E 2JRKA 2WSSV 4NUVA 3EVYA 2UXXB 1MMDA 3N9LA 4YFSA 3PDYA 3ANWA 1FMWA 2MTQA 1NAFA 2NW8A 3O1HA 2LEHA 2JMKA 3P7IA 4AQFC 2D5UA 5JDMA 3LK2B 3GN5B 4PK4A 5LOVE 2XAJB 2K5BB 2IC9A 4KMCA 4NUUA 4H9RC 2KWHA 2Z6EA 4I43B 4CI1B 5KMGP 1VRBA 1HX8A 4JEUB 4IIJE 3IEEA 2DWKA 1KK7A 2LOSA 4O4IE 5FXZA 4DVDA 4H9QC 3CKDA 4U74A 3ZMUB 4C90A 3KVBA 3N2KE 1MMGA 3V5UA 1YW0A 3CX7B 2ZM0A 4AQFA 3ZC0A 1ZKEA 2CCQA 3RYCE 2QGSA 5GONE 2ACXA 2VKOA 4TUYE 3VKGA 3AA1B 5LBMA 3ANWB 2KXPB 2N2NA 4AKRB 2JJ9A 2LT3A 2XAFB 4EIWA 4UVBB 3L09A 1QUUA 3SWHA 4AKIA 5CA1E 4O4HE 2X9XA 2ZMAA 2X68A 2C0SA 2X9WA 3N9PA 3O9XA 4PW8A 5JDNA 1KNZA 2DNXA 1MIYA 5J2UE 2GK9A 3J7Yq 2XTLA 3PUGA 4GYSA 4IE5A 3MACA 1V9DA 3HKEE 3FBZA 4ZI7E 3N2OA 4XAXB 3CX8B 2BDEA 5DQWA 3UUMA 4TN7B 3N2GE 3ONXA 5J2TE 3AAAB 4ADZA 3A5XA 4B6XA 3AA7B 2JPFA 4CI2B 4IE0A 3UULA 3WAKA 2A72A 2E9XA 4YHJA 3ETUA 5EK4A 5F8PA 1H7CA 3MKDA 1UX4A 4UIGA 1BR1A 4ISSA 3C4WA 4EOZB 2X9YA 5BMVE 5KX5E 3V5SA 5HXSA 4X1IE 5CB4E 3EUHA 4HFVA 3AVRA 3PTRB 4OYJA 1MIVA 5AFUL 2C5JA 5LCYA 1BR4A 2LHNA 2XAHB 3E08A 3M65A 3ZYMA 5H6QB 4EB6E 3AA6B 3E0ZA 3AA0B 2LJLA 4GK0E 3QK6A 4GK5E 3RX6A 4YJ2E 3QUJA 4OYKA 2N9DA 4CXYA 4IHJE 2CA5A 2H7VC 3IHRA 2V7JA 4AKLA 4O8SA 2CLYC 3UFEA 3MZKB 3I9WA 4QXBB 1CUNA 3CQCB 2E9XB 4CQIA 4V1Av 2LSYA 4KP3C 2VL8A 2YINA 4OHFA 3WI3A 3Q5XA 5FY7A 4ZHQE 4MLKA 3GWHA 5EZYE 2VKJA 3NBXX 4AI6A 3ZCIA 2N1GA 1BR0A 1YKEB 2D0UA 5EK3A 4X1YE 3UUNA 4PK5A 3RYHE 2DCFA 3L3PA 3ZEFB 3F2EA 2KMFA 3HKBE 2V7LA 4HKAA 2Q9QA 3H37A 1HG2A 3UUXB 4ILUA 2C5IT 1FEWA 1LVKA 2LSJA 4PNIA 5L3BB 4KBMB 5H6RB 2W0GA 3O1JA 3PE0A 4M1PA 3UT5E 2V7IA 3KDSE 4X1KE 3PU8A 4IE4A 4TZ4C 3HKCE 4J2CA 4GOUA 4QXHB 4MFRA 3R6NA 4AXPA 2Y48B 4F6RC 1IJ5A 3FXEB 2NW9A 3CPZA 3LK42 3NRYA 3DTOA 1EZ3A 5ADXL 2NTXA 4BAYB 4QX7B 2K9AA 3Q9DA 2MYSA 4JEHB 5F3JA 3N9NA 5FP3A 4A56A 3ZC1A 4FI5A 5LP6E 4QX8B 1IZNB 4UEMA 2LSIA 2V1DB 2XAQB 4BJNA 2CLYB 2ZLYA 2Q9QB 3KV6A 5L2LA 3BQLA 3WAJA 1D0ZA 3C64A 3BQIA 1HTJF 2ODVA 5J1GA 3B13A 4Z8XA 5JVDE 2DI4A 4DO0A 2D2SA 3NZQA 2XQYA 4IE7A 2XHEB 1D1BA 4PAGA 5FY1A 5LHHB 2HH7A 1MNDA 2NOXA 2E8IA 4ZI3D 2A2FX 4U72A 4ASKA 2E9XD 2KT9A 2X51A 2NW7A 2W63A 1HG5A 3KBTA 3KVAA 5IHYA 4IE6A 1UCUA 1B7TA 5JDLA 1WR6A 2G0UA 1YD8G 4EZ4A 2YEVC 3ZMTB 5FMNA 5JR9C 1IAPA 1S94A 4MALA 2I59A 3JC6D 4GYRA 2BVMA 1U5PA 2EHOD 1LRZA 3VHLA 4PFPA 2X9HA 3NRXA 5FYMA 3ZN1B 3W15B 4ZS3A 2K48A 2CMRA 3GA8A 4UVCB 3HKDE 1MIWA 4P09A 3K3NA 2RA1A 3KINB 4AQGA 2V7MA 3CMLA 3ZMSB 3RC8A 5LJMA 3ZLIA 3OYXA 5HXEA 5JR9A 2JQQA 4AKHA 2XUEA 2VKDA 3AAIA 4ZI2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSY A;  4GK0 E;  2LSI A;  2LSG A;  2N1G A;  4FJO A;  2LSJ A;  3VU7 H;  2LSK A;  4BA9 A;  4EXT A;  4GK5 E; 
#chains in the Genus database with same CATH topology
 4C91 A;  3O4X E;  1YKH B;  4TV8 E;  4PFO A;  3K8P C;  2OA5 A;  5LHG B;  4WW0 A;  2EHO C;  5HEU A;  4YSY A;  4UXN B;  2VB6 A;  3FBL A;  2KND A;  2BKO A;  5L47 A;  5AQV B;  3AEG A;  3H3M A;  4TX5 A;  5JR9 B;  4QWN B;  5AQG B;  2UXN B;  4OK0 A;  3IBP A;  3N9O A;  4U31 A;  2CBJ A;  2RPA A;  5CA0 E;  2CHO A;  2Y6X A;  5L3C B;  2DHR A;  1MNE A;  3AE1 A;  1FMV A;  3KFW X;  4HFB A;  2CWO A;  2L9Q A;  4H63 H;  5AQQ B;  4EEB A;  3U78 A;  3VR9 A;  3PUZ F;  4DR4 T;  5HXC A;  3IF8 B;  3RH3 A;  1UX5 A;  5HWX A;  4HFI A;  3RIU A;  2CEA A;  2WZI A;  3MA9 A;  4U7I A;  3QNU A;  5FXW A;  3O1I A;  3RRC A;  2BG9 C;  5HYA A;  1X79 A;  4YTP A;  5FL1 A;  3LDQ B;  4IDP A;  2LE8 A;  4X5T A;  1E1H B;  1S35 A;  4HGA A;  1ZEE A;  2XAG B;  5LBQ B;  4AIU A;  5AQO B;  3AAE B;  1VCS A;  4IST A;  1T98 A;  2LOP A;  1N33 T;  4UF0 B;  2IHR 1;  4EED A;  4HWF A;  2I0M A;  2PBI A;  4YSX A;  2Y8D A;  4WYV A;  5DJQ C;  3TLS A;  5JRC A;  2PTF A;  4P0B A;  3LBX B;  3I0O A;  3PJA A;  3N5L A;  3CQX C;  1UK5 A;  3AEC A;  1D1C A;  4LFA T;  1KEY A;  2W62 A;  4X64 T;  3ESL A;  5C8Y E;  3C98 B;  3PUX F;  4FJO A;  5FL0 A;  3H3A A;  4LF5 T;  1LKX A;  3T1H T;  1HS7 A;  5LGT B;  2XQ5 A;  4DR5 T;  3N9M A;  5EK2 A;  4N78 D;  1GQE A;  4HE8 A;  2Q9Q C;  2CWY A;  2MOZ A;  4WBO A;  2VKH A;  2M6I A;  3NVO A;  4X66 T;  3FB2 A;  3OYZ A;  3GMI A;  4YSZ A;  5LHI B;  4O2A E;  4DID B;  3ZMZ B;  3J9X 1;  4HWI B;  3B5M A;  3DJB A;  1IBM T;  1U4Q A;  5CJ5 A;  2JMH A;  2FJB A;  5LMN T;  3UU3 A;  3SOL A;  5LG3 A;  2YDS A;  2WSS V;  1MMD A;  3N9L A;  4I0U A;  3ANW A;  3P7I A;  3GN5 B;  3SFD A;  2K5B B;  4IRE A;  4B3M T;  4H9R C;  2Z6E A;  4LMJ A;  1VRB A;  4DV2 T;  3VRB A;  4H9Q C;  3ZMU B;  1XNR T;  3N2K E;  1YW0 A;  1ZKE A;  3RYC E;  3ZT6 A;  2ACX A;  5ABF B;  3PUV F;  5LBM A;  2LT3 A;  2AE9 A;  3AEB A;  4UVB B;  3L09 A;  2H88 A;  2XY8 B;  5J2U E;  3J7Y q;  3HKE E;  4ZI7 E;  1OED E;  4XAX B;  5DQW A;  3AA7 B;  3UUL A;  5EK4 A;  4UIG A;  4EOZ B;  3C4W A;  5KX5 E;  3V5S A;  4X1I E;  4HFV A;  5AQI B;  1MIV A;  5LCY A;  5H6Q B;  3AA6 B;  2LJL A;  5J0Z A;  1T8B A;  4JI5 T;  4CXY A;  2CA5 A;  2H7V C;  3UFE A;  2CLY C;  1W0B A;  3MZK B;  1CUN A;  2E9X B;  4CQI A;  3JAE A;  4IT4 A;  5EZY E;  2R6G F;  3ZCI A;  3ZKR A;  2D0U A;  2BKN A;  2WP9 A;  5EK3 A;  4PK5 A;  2XSA A;  3P4S A;  3F2E A;  3HKB E;  1XNQ T;  4KBM B;  4IE4 A;  3ZT7 A;  2E5V A;  3QB5 K;  4F6R C;  3CPZ A;  3DTO A;  2NTX A;  4JEH B;  2MYS A;  5F3J A;  4FI5 A;  2V1D B;  3SFE A;  4BJN A;  2ODV A;  3UU8 A;  4IL9 A;  2LRK A;  5HCJ A;  4Z8X A;  3JAD A;  4DO0 A;  5JVD E;  2XQY A;  2NOX A;  2E8I A;  1XMQ T;  4X65 T;  5IHY A;  5JDL A;  1Y01 A;  2G0U A;  3ZMT B;  5FMN A;  3ZT5 A;  2V6X A;  3JC6 D;  5FYM A;  2WZH A;  2W2U A;  4ZS3 A;  4UVC B;  1OED B;  3K3N A;  3EAM A;  2V7M A;  3RC8 A;  5LJM A;  2BG9 E;  3OYX A;  5JR9 A;  2JQQ A;  3AEF A;  3AAI A;  4ZI2 D;  4ILA A;  5AQT B;  4U7Y A;  3AE5 A;  3AVS A;  1HF8 A;  3OJA A;  3RQU A;  5JTG A;  1DU2 A;  1UUS A;  1JNZ A;  4L9I A;  2BVL A;  4PJN A;  4OFZ A;  2YKS A;  4IL4 A;  2BS3 A;  4LF9 T;  4AIS A;  2WB5 A;  4U33 A;  4UV8 B;  5FNV E;  2VQF T;  4E7S A;  1NWM X;  2IC6 A;  3HI2 A;  4ZOL E;  2YN6 A;  5HAX A;  5IUX A;  3ZN0 B;  3R84 B;  2YK0 A;  4Q25 A;  2NTY A;  2L8K A;  1LVF A;  1W0A A;  1FIO A;  3PUA A;  1HNZ T;  2MBG A;  3RC3 A;  2XQA A;  1R8I A;  5C2T A;  3EI0 A;  3NZP A;  4UVA B;  5JQG E;  2X0H A;  3C4Z A;  4YY3 T;  3NWI A;  4O4J E;  4I55 E;  4PJJ A;  4JYA T;  3MXZ A;  4NXN T;  2JQ9 A;  2VQE T;  1VOM A;  4ZS2 A;  4ZZB A;  4PJL A;  4DBR A;  4UF0 A;  3HR0 A;  3RIA A;  1MMA A;  5JDG A;  4OX9 T;  4IDQ A;  3PU3 A;  4PK6 A;  4YLH A;  3LBX A;  2B1E A;  2V7K A;  2VAS A;  3HA4 A;  4EYY R;  2F4V T;  4NIQ A;  4H9S E;  1SHZ C;  4EV6 A;  1Z0P A;  3RYI E;  2W61 A;  2XQ7 A;  4KI0 F;  2DLR A;  4CI3 B;  4H63 V;  2BBJ A;  3JCF A;  5AQP B;  5HEO A;  4DR3 T;  3TLU A;  4YXD A;  3Q2M A;  1IBK T;  1KF6 A;  3RHW A;  2BG9 B;  2BS4 A;  3AE8 A;  2FJD A;  2JIW A;  1OXZ A;  2YOE A;  3RRW A;  2LSG A;  1XDP A;  5L3D B;  2WMO A;  3CK6 A;  4KX6 A;  2BKP A;  2OV9 A;  1SE7 A;  2NWB A;  3PUR A;  3LG7 A;  2M67 A;  4HFE A;  4EXT A;  5LNK A;  3QC9 A;  3LJC A;  1OWA A;  3P4Q A;  5HCM A;  2L3L A;  2XAS B;  2HPJ A;  3P50 A;  4LFC T;  1YQ4 A;  4KHZ F;  4QH4 A;  1O3X A;  4ANJ A;  4ERR A;  1D1A A;  4IGU A;  4XZC A;  3VR8 A;  5IYZ E;  2LM9 A;  5KXJ A;  1G8X A;  3EAB A;  5LGN B;  2XSB A;  5L3G B;  4L0R A;  4EYU A;  3RF1 A;  3GN5 A;  2IW5 B;  3D0T A;  4QXC B;  5FY0 A;  1WYB A;  5L3E B;  2ZM8 A;  3C51 A;  2YU2 A;  3LSV A;  2B76 A;  4TNV A;  5ABF A;  2IDO B;  2WU2 A;  4ZZC A;  2D5U A;  5LOV E;  2XAJ B;  4EGW A;  4A98 A;  5KMG P;  1HX8 A;  2YDQ A;  4IIJ E;  5FXZ A;  2FUP A;  4U74 A;  4AQF A;  2JQH A;  2QGS A;  3AA1 B;  3OPC A;  2N2N A;  2JJ9 A;  3AEA A;  3L8R A;  3P4W A;  1HNW T;  4AKI A;  4O4H E;  4PW8 A;  5JDN A;  1WFD A;  1SUM B;  1KNZ A;  1MIY A;  2GK9 A;  4IE5 A;  2W4X A;  3MAC A;  3FBZ A;  3ONL C;  3N2O A;  5AQU B;  4DV0 T;  3CX8 B;  2UU9 T;  4TN7 B;  3ONX A;  1J5E T;  3AAA B;  2A72 A;  2E9X A;  4LFB T;  3AED A;  1NEN A;  4JBW F;  1M7K A;  5BMV E;  3EUH A;  2C5J A;  2LHN A;  2XAH B;  3M65 A;  3ZYM A;  3E0Z A;  3RX6 A;  4DUZ T;  4OYK A;  2N9D A;  4IHJ E;  2WDQ A;  4DV6 T;  2WDV A;  4YTN A;  3ONJ A;  4V1A v;  2QVA A;  1YQ3 A;  2VL8 A;  2UUA T;  3WI3 A;  5FY7 A;  4ZHQ E;  3GWH A;  4DUY T;  2VKJ A;  3NBX X;  4AI6 A;  3IA3 A;  1W09 A;  4X1Y E;  3UQ7 A;  1KNP A;  2DCF A;  2DL1 A;  1ZP0 A;  2V7L A;  4HKA A;  3AE7 A;  4ILU A;  4PNI A;  2CRB A;  3PU8 A;  4TZ4 C;  4B3R T;  3QOF A;  4QXH B;  2LLY A;  3R6N A;  2UUB T;  2Y48 B;  3FXE B;  2XQ3 A;  3RQW A;  2ACZ A;  2K9A A;  3Q9D A;  2UXD T;  4A56 A;  3ZC1 A;  5LMU T;  3Q5E A;  5LP6 E;  5AQS B;  2CLY B;  3BQL A;  3WAJ A;  3C64 A;  3BQI A;  1HTJ F;  3B13 A;  3NZQ A;  4IE7 A;  2AXD S;  1OED A;  4U3C A;  4PAG A;  5FY1 A;  4YTM A;  1MND A;  3AEE A;  4IE6 A;  4QH5 A;  4ILB A;  1S94 A;  4MAL A;  4ZXL A;  4JI6 T;  1W9R A;  1U5P A;  4PFP A;  3ZN1 B;  3W15 B;  4JI1 T;  3GA8 A;  4P09 A;  2RA1 A;  2MAW A;  4DR1 T;  4IDO A;  4JI3 T;  1FJG T;  4AKH A;  2XUE A;  5HWY A;  4IDZ A;  2V26 A;  3HL6 A;  3DP7 A;  1X9B A;  5JDQ A;  1UUR A;  3AE6 A;  3PUQ A;  2E5L T;  4I50 E;  3PUS A;  2LM2 A;  1D0Y A;  4BA9 A;  3EDU A;  3RYF E;  4JUY A;  2ES0 A;  2HN1 A;  4LF7 T;  3VKH A;  5DQV A;  2XJ7 A;  3Q5W A;  3BK9 A;  4CZZ B;  2XM2 A;  5AQH B;  2X0L B;  2NR4 A;  1WYC A;  2NP9 A;  3RIU C;  3PJA J;  5HXR A;  4KUM B;  5CFB A;  3SRZ A;  2W66 A;  2KLQ A;  3EDV A;  1ZHC A;  2XPK A;  2CXF A;  4G63 A;  5KDM C;  3P8C D;  5LG4 A;  3ZJ2 A;  4WBN E;  5LA6 E;  5E0O A;  4GKJ T;  1IBL T;  2VUR A;  3KBU A;  4ZEY A;  4CXX A;  5A1L A;  3AE4 A;  4TNW A;  2XQ4 A;  2CXD A;  4QHO A;  2SPC A;  5HXH A;  2PJQ A;  3T8O A;  1D0X A;  2BG9 A;  4HEA A;  1HCI A;  4EAH A;  3UU5 A;  1KNR A;  2HN2 A;  3ZJ1 A;  5JDH A;  2YU1 A;  4IDN A;  2W00 A;  2H3R A;  5AQN B;  3PUW F;  4ZI3 C;  2E9X C;  4BJM A;  3FXD B;  2XQ6 A;  4DBQ A;  3LK3 B;  2VVN A;  2PG8 A;  3A7M A;  3ZCJ A;  2LKG A;  3LFM A;  4EZH A;  5FVL A;  5L3F B;  2ZM2 A;  3T1Y T;  3F57 A;  2LHR A;  2WS3 A;  4CN1 A;  2DWG A;  2XZE A;  3A8Y C;  3UFG A;  3FZH B;  4UV9 B;  3G06 A;  5FXX A;  4HWD A;  2D0T A;  3VU7 H;  4DV3 T;  4DR6 T;  4DV1 T;  1AJ3 A;  3F31 A;  4JI0 T;  2LKH A;  3L39 A;  4H9P C;  3ZPO A;  1I94 T;  2D9D A;  5AQM B;  2K24 A;  3U3I A;  5L4E A;  1Y64 B;  3ETV A;  4WZX A;  2FJA A;  4B3T T;  3CVR A;  1WLX A;  4X62 T;  2P9B A;  1WCR A;  3MJX A;  1SA0 E;  3AE2 A;  5L4H A;  3ZMV B;  4O4L E;  2EHO B;  5JH7 E;  4CXW A;  3FHN A;  3C4X A;  5JRE A;  5LJN A;  4MBQ A;  4AKG A;  1WRD A;  2MPK A;  2ODU A;  1G73 A;  2WM9 A;  2X67 A;  3CX6 B;  3E22 E;  2JRK A;  4NUV A;  2UXX B;  4JI2 T;  5ABG A;  3PDY A;  2MTQ A;  1NAF A;  2NW8 A;  3O1H A;  1OED C;  2JMK A;  5JDM A;  4CN4 A;  1Z8U A;  4PK4 A;  2IC9 A;  2V6Y B;  2KWH A;  4I43 B;  2V5D A;  3IEE A;  2DWK A;  2IUB A;  1KK7 A;  4O4I E;  4DVD A;  3FZF B;  3CKD A;  1MMG A;  4A97 A;  3CX7 B;  2ZM0 A;  2CCQ A;  2VKO A;  4TUY E;  3VKG A;  4DV5 T;  4AKR B;  2XAF B;  2CHN A;  3SWH A;  5CA1 E;  3N9P A;  2XQ8 A;  3OTO T;  2XTL A;  3PUG A;  5HEJ A;  1J5W A;  5J2T E;  2FJE A;  3A5X A;  4B6X A;  4UR9 A;  2J4G A;  4CI2 B;  3ETU A;  5F8P A;  1JNR A;  3MKD A;  1UX4 A;  1BR1 A;  2X9Y A;  1N32 T;  2UXC T;  2IML A;  3AVR A;  1BR4 A;  3E08 A;  4LMK A;  4GK0 E;  3QK6 A;  4YJ2 E;  3QUJ A;  3P4R A;  3IHR A;  4YHH T;  4NPP A;  3I9W A;  4QXB B;  3CQC B;  2LSY A;  2YIN A;  3Q5X A;  2WU5 A;  2N1G A;  4DV7 T;  4JI8 T;  3L3P A;  3ZEF B;  1HG2 A;  3UUX B;  4DV4 T;  1FEW A;  2IIU A;  2W0G A;  3O1J A;  2V7I A;  5AQL B;  3TLT A;  3HKC E;  4J2C A;  4GOU A;  4MFR A;  1IJ5 A;  2NW9 A;  3LK4 2;  2LRL A;  3NRY A;  5HEH A;  1XDO A;  5ADX L;  3N9N A;  4QX8 B;  1IZN B;  4UEM A;  2XAQ B;  2ZLY A;  2Q9Q B;  4LF4 T;  5AQK B;  1D0Z A;  5J1G A;  2DI4 A;  2XHE B;  3AXJ B;  1D1B A;  5C3J A;  2BS2 A;  2HH7 A;  4ASK A;  2X51 A;  2NW7 A;  3ABV A;  2W63 A;  3KBT A;  3ZSS A;  1WR6 A;  1YD8 G;  3FZM B;  5CGM A;  4EZ4 A;  2YEV C;  5JR9 C;  5AQJ B;  2I59 A;  5ABH A;  4GYR A;  3VHL A;  2EHO D;  2X9H A;  3PUY F;  1KFY A;  3KIN B;  4AQG A;  3CML A;  3ZMS B;  3ZLI A;  5HXE A;  1L0V A;  2QYW A;  2VKD A;  4Z91 A;  2UUC T;  4XBF B;  2CBI A;  3CIR A;  4O2B E;  2VVS A;  3RI5 A;  4MHC A;  4HFD A;  4JV5 T;  3EHZ A;  4H9N C;  5M4Y A;  1HX1 B;  4TWD A;  4JLE A;  4X20 E;  5TAO A;  2QA7 A;  5LXT E;  4HTE A;  2A9U A;  4HFH A;  3CQG B;  5JDF A;  3P4P A;  3K3O A;  3CWZ B;  2BBH A;  1J1J A;  4LML A;  5LYJ E;  4DND A;  3ZYK A;  4L5G A;  3C50 A;  2KIN B;  4I4T E;  2V8S V;  1HFA A;  4DMW A;  2WAU A;  2M6B A;  2KZ7 B;  1BR2 A;  2WQY A;  5ETW A;  3ZYL A;  2VL0 A;  4QKN A;  2V5C A;  4PJM A;  2YDR A;  3PV0 F;  1IJ6 A;  3AB3 B;  3K1S A;  2IAK A;  1CHU A;  2HPL A;  4GKK T;  5AQR B;  2WWU A;  4YT0 A;  2VK9 A;  4DMV A;  4E7Z A;  3OBV E;  3RKG A;  5FXV A;  1UGO A;  2FBW A;  3B57 A;  3KV4 A;  1ZOY A;  2X66 A;  3S4U A;  3KV5 A;  3JAF A;  4G2A A;  3K3Q C;  3SS1 A;  4YJ3 E;  5LGU B;  3I9Y A;  4GIW A;  4QH1 A;  4TWH A;  2C5K T;  2A3D A;  3TLW A;  2KSR A;  3OKQ A;  3BQK A;  4U2Z A;  2H7O A;  3N9Q A;  4WNK A;  3UUB A;  3JC6 C;  1ZV4 X;  2KWI B;  4P0A A;  2J62 A;  1YXR A;  3FZK B;  4UEL A;  3RKO A;  2JQK A;  2Q9Q D;  2WBL A;  4DR7 T;  2PFV A;  4ILC A;  3TLV A;  5JRC B;  2RP4 A;  2WMN A;  3AE9 A;  1I6Z A;  5BR8 T;  1HNX T;  4ZI2 C;  2BZB A;  4HN9 A;  3RGL A;  2EHO A;  2LSK A;  4COF A;  1MMN A;  2J1D G;  3I0Q A;  2CE7 A;  1US7 B;  5DAB A;  4TV9 E;  2E2A A;  3TKL B;  3I1A A;  3RIF A;  3MK7 C;  3KV9 A;  4H9O C;  1HR0 T;  2CXL A;  2V6Y A;  3UTK A;  2VWA A;  2HHH T;  1QSD A;  1WR0 A;  4K0U A;  3RPU A;  2CM0 A;  3QB5 A;  3EVY A;  3FZL B;  4A5X A;  4YFS A;  3NKZ A;  2I6H A;  1FMW A;  1N34 T;  2LEH A;  4AQY T;  4NXM T;  4AQF C;  3LK2 B;  1E7P A;  4KMC A;  4NUU A;  4CI1 B;  4CN6 A;  5F5W A;  4JEU B;  2LOS A;  5HEG A;  1N36 T;  3M3Z B;  2CPT A;  4C90 A;  3KVB A;  3V5U A;  3ZC0 A;  5FVK A;  5GON E;  3ANW B;  2KXP B;  4EIW A;  1QUU A;  2X9X A;  2ZMA A;  1XMO T;  2X68 A;  2C0S A;  2X9W A;  3O9X A;  3RLF F;  4LF8 T;  2DNX A;  4DR2 T;  3VRA A;  4B3S T;  4GYS A;  1V9D A;  5AQF B;  2BDE A;  3UUM A;  1VCT A;  3N2G E;  4HWH A;  4ADZ A;  2JPF A;  4IE0 A;  3WAK A;  4JI7 T;  4YHJ A;  1H7C A;  3UQ4 A;  4ISS A;  5LB7 B;  5HXS A;  5CB4 E;  5ABE A;  2K3W A;  3PTR B;  4OYJ A;  3OVU A;  5AFU L;  2XQ9 A;  4F8H A;  4EB6 E;  4GK5 E;  3UU6 A;  3AA0 B;  4LF6 T;  4HWC A;  2V7J A;  4AKL A;  1M62 A;  4O8S A;  2QRX A;  4U2Y A;  4KP3 C;  4OHF A;  1T72 A;  4MLK A;  1XWM A;  2X0Y A;  4K0K T;  2WY2 A;  1BR0 A;  1YKE B;  3UUN A;  3RYH E;  2KMF A;  2W67 A;  2Q9Q A;  3H37 A;  2ZM6 T;  2C5I T;  1LVK A;  2LSJ A;  2WWV A;  5L3B B;  5IWA T;  5H6R B;  3PE0 A;  3UT5 E;  4M1P A;  3KDS E;  4X1K E;  4TWF A;  3AXJ A;  4AXP A;  4KHP T;  1EZ3 A;  4BAY B;  2WCA A;  4QX7 B;  1QLB A;  5FP3 A;  3UU4 A;  2J47 A;  2LSI A;  1NEK A;  2OLT A;  3KV6 A;  5L2L A;  4JI4 T;  2D2S A;  4Z90 A;  4HFC A;  5LHH B;  4ZI3 D;  2A2F X;  4U72 A;  2UXB T;  2E9X D;  2KT9 A;  1HG5 A;  3KVA A;  1UCU A;  1B7T A;  1XZY A;  2WDR A;  1IAP A;  4P1N A;  2BVM A;  1LRZ A;  3AE3 A;  3NRX A;  1T7S A;  2K48 A;  2CMR A;  2XM1 A;  3HKD E;  1MIW A;  2H89 A;  1E2A A;  3X1D A;  5FKY A;  3Q5D A;  3ZST A; 
#chains in the Genus database with same CATH homology
 5HWY A;  4C91 A;  4XBF B;  3O4X E;  1YKH B;  3AVS A;  2V26 A;  4IDZ A;  3HL6 A;  1HF8 A;  3DP7 A;  3OJA A;  4TV8 E;  4PFO A;  3K8P C;  2OA5 A;  5JDQ A;  5LHG B;  4O2B E;  4WW0 A;  2EHO C;  4L9I A;  4MHC A;  3PUQ A;  2BVL A;  4UXN B;  4H9N C;  5M4Y A;  4PJN A;  2VB6 A;  4I50 E;  4OFZ A;  4JLE A;  4X20 E;  5TAO A;  3FBL A;  2KND A;  2QA7 A;  3PUS A;  1D0Y A;  5LXT E;  4HTE A;  4BA9 A;  3EDU A;  3RYF E;  4JUY A;  4TX5 A;  2ES0 A;  4UV8 B;  5FNV E;  5JR9 B;  3CQG B;  4QWN B;  5JDF A;  4E7S A;  3VKH A;  5DQV A;  2UXN B;  1NWM X;  2IC6 A;  3K3O A;  3Q5W A;  3HI2 A;  3CWZ B;  3IBP A;  4OK0 A;  3BK9 A;  3N9O A;  4ZOL E;  4CZZ B;  5HAX A;  5CA0 E;  3ZN0 B;  2Y6X A;  2X0L B;  3R84 B;  5L3C B;  5LYJ E;  1WYC A;  2NP9 A;  2DHR A;  2YK0 A;  2NTY A;  1MNE A;  4DND A;  1FMV A;  5HXR A;  3ZYK A;  3KFW X;  2L8K A;  1LVF A;  4L5G A;  1FIO A;  2CWO A;  3C50 A;  4KUM B;  3PUA A;  2L9Q A;  3SRZ A;  4H63 H;  2MBG A;  3RC3 A;  2KLQ A;  3EDV A;  1ZHC A;  2KIN B;  3U78 A;  5HXC A;  4I4T E;  3IF8 B;  2CXF A;  3RH3 A;  4G63 A;  1UX5 A;  5KDM C;  1HFA A;  3P8C D;  4DMW A;  5LG4 A;  2WAU A;  5HWX A;  3NZP A;  3ZJ2 A;  4WBN E;  2CEA A;  4UVA B;  5JQG E;  2KZ7 B;  1BR2 A;  3MA9 A;  5ETW A;  3ZYL A;  3C4Z A;  4QKN A;  5E0O A;  5LA6 E;  4O4J E;  5FXW A;  3O1I A;  4I55 E;  4PJJ A;  3RRC A;  3KBU A;  3MXZ A;  5HYA A;  1X79 A;  1VOM A;  4CXX A;  5A1L A;  4ZS2 A;  4PJM A;  1IJ6 A;  2LE8 A;  3AB3 B;  4PJL A;  4UF0 A;  4DBR A;  2CXD A;  4QHO A;  2IAK A;  3HR0 A;  2HPL A;  2SPC A;  5HXH A;  1MMA A;  5JDG A;  2WWU A;  2PJQ A;  3T8O A;  1E1H B;  1S35 A;  2VK9 A;  3PU3 A;  4HGA A;  1ZEE A;  4DMV A;  2XAG B;  4E7Z A;  4PK6 A;  4YLH A;  1D0X A;  3OBV E;  3LBX A;  5LBQ B;  2B1E A;  2V7K A;  4HEA A;  5FXV A;  3B57 A;  3AAE B;  3KV4 A;  2VAS A;  1HCI A;  2X66 A;  3HA4 A;  4EAH A;  3S4U A;  4IST A;  3KV5 A;  4EYY R;  1T98 A;  4H9S E;  1SHZ C;  2LOP A;  3ZJ1 A;  1Z0P A;  3RYI E;  5JDH A;  2W61 A;  4G2A A;  2YU1 A;  3K3Q C;  4UF0 B;  2DLR A;  2W00 A;  3SS1 A;  4CI3 B;  2H3R A;  2PBI A;  2Y8D A;  4YJ3 E;  5DJQ C;  4H63 V;  5JRC A;  5LGU B;  4P0B A;  4ZI3 C;  3I9Y A;  2E9X C;  4GIW A;  4BJM A;  3Q2M A;  3FXD B;  3LBX B;  3I0O A;  4DBQ A;  2C5K T;  3N5L A;  3CQX C;  3LK3 B;  2A3D A;  1OXZ A;  1D1C A;  2PG8 A;  3OKQ A;  3ZCJ A;  3BQK A;  2W62 A;  3RRW A;  2H7O A;  2LSG A;  3N9Q A;  4WNK A;  5L3D B;  2WMO A;  3JC6 C;  3LFM A;  4EZH A;  5L3F B;  1ZV4 X;  2KWI B;  2ZM2 A;  4P0A A;  3ESL A;  4UEL A;  3RKO A;  5C8Y E;  3F57 A;  2LHR A;  2Q9Q D;  2WBL A;  3C98 B;  2NWB A;  3PUR A;  2PFV A;  2DWG A;  3LG7 A;  4FJO A;  2M67 A;  2RP4 A;  3H3A A;  5JRC B;  2WMN A;  4EXT A;  5LNK A;  3QC9 A;  4UV9 B;  1LKX A;  3LJC A;  5FXX A;  1OWA A;  2D0T A;  1HS7 A;  4ZI2 C;  2BZB A;  4HN9 A;  3VU7 H;  5LGT B;  2L3L A;  2EHO A;  2XAS B;  2HPJ A;  1AJ3 A;  2LSK A;  1MMN A;  1O3X A;  3N9M A;  4ANJ A;  2J1D G;  4ERR A;  3I0Q A;  3F31 A;  5EK2 A;  2CE7 A;  1US7 B;  5DAB A;  1D1A A;  4N78 D;  4IGU A;  4TV9 E;  4HE8 A;  4H9P C;  4XZC A;  3ZPO A;  2K24 A;  2Q9Q C;  5IYZ E;  3U3I A;  1Y64 B;  3ETV A;  2LM9 A;  2CWY A;  2MOZ A;  1G8X A;  4WBO A;  3TKL B;  2VKH A;  5LGN B;  3I1A A;  5L3G B;  4L0R A;  3CVR A;  4EYU A;  1WLX A;  3MK7 C;  2P9B A;  3MJX A;  3KV9 A;  3GN5 A;  3FB2 A;  1SA0 E;  3OYZ A;  4H9O C;  3ZMV B;  3GMI A;  5LHI B;  4O2A E;  2IW5 B;  2CXL A;  3D0T A;  4O4L E;  3UTK A;  2EHO B;  2VWA A;  3ZMZ B;  4CXW A;  5JH7 E;  3J9X 1;  4QXC B;  1QSD A;  3FHN A;  3DJB A;  3C4X A;  5JRE A;  5LJN A;  4MBQ A;  1U4Q A;  4AKG A;  5FY0 A;  1WYB A;  1WRD A;  5L3E B;  2ODU A;  2JMH A;  2ZM8 A;  4K0U A;  1G73 A;  2WM9 A;  3RPU A;  2X67 A;  2CM0 A;  3C51 A;  3SOL A;  2YU2 A;  3CX6 B;  3E22 E;  2JRK A;  2WSS V;  4NUV A;  3EVY A;  2UXX B;  1MMD A;  3N9L A;  4YFS A;  3PDY A;  3ANW A;  1FMW A;  2MTQ A;  1NAF A;  2NW8 A;  3O1H A;  2LEH A;  2JMK A;  3P7I A;  4AQF C;  2D5U A;  5JDM A;  3LK2 B;  3GN5 B;  4PK4 A;  5LOV E;  2XAJ B;  2K5B B;  2IC9 A;  4KMC A;  4NUU A;  4H9R C;  2KWH A;  2Z6E A;  4I43 B;  4CI1 B;  5KMG P;  1VRB A;  1HX8 A;  4JEU B;  4IIJ E;  3IEE A;  2DWK A;  1KK7 A;  2LOS A;  4O4I E;  5FXZ A;  4DVD A;  4H9Q C;  3CKD A;  4U74 A;  3ZMU B;  4C90 A;  3KVB A;  3N2K E;  1MMG A;  3V5U A;  1YW0 A;  3CX7 B;  2ZM0 A;  4AQF A;  3ZC0 A;  1ZKE A;  2CCQ A;  3RYC E;  2QGS A;  5GON E;  2ACX A;  2VKO A;  4TUY E;  3VKG A;  3AA1 B;  5LBM A;  3ANW B;  2KXP B;  2N2N A;  4AKR B;  2JJ9 A;  2LT3 A;  2XAF B;  4EIW A;  4UVB B;  3L09 A;  1QUU A;  3SWH A;  4AKI A;  5CA1 E;  4O4H E;  2X9X A;  2ZMA A;  2X68 A;  2C0S A;  2X9W A;  3N9P A;  3O9X A;  4PW8 A;  5JDN A;  1KNZ A;  2DNX A;  1MIY A;  5J2U E;  2GK9 A;  3J7Y q;  2XTL A;  3PUG A;  4GYS A;  4IE5 A;  3MAC A;  1V9D A;  3HKE E;  3FBZ A;  4ZI7 E;  3N2O A;  4XAX B;  3CX8 B;  2BDE A;  5DQW A;  3UUM A;  4TN7 B;  3N2G E;  3ONX A;  5J2T E;  3AAA B;  4ADZ A;  3A5X A;  4B6X A;  3AA7 B;  2JPF A;  4CI2 B;  4IE0 A;  3UUL A;  3WAK A;  2A72 A;  2E9X A;  4YHJ A;  3ETU A;  5EK4 A;  5F8P A;  1H7C A;  3MKD A;  1UX4 A;  4UIG A;  1BR1 A;  4ISS A;  3C4W A;  4EOZ B;  2X9Y A;  5BMV E;  5KX5 E;  3V5S A;  5HXS A;  4X1I E;  5CB4 E;  3EUH A;  4HFV A;  3AVR A;  3PTR B;  4OYJ A;  1MIV A;  5AFU L;  2C5J A;  5LCY A;  1BR4 A;  2LHN A;  2XAH B;  3E08 A;  3M65 A;  3ZYM A;  5H6Q B;  4EB6 E;  3AA6 B;  3E0Z A;  3AA0 B;  2LJL A;  4GK0 E;  3QK6 A;  4GK5 E;  3RX6 A;  4YJ2 E;  3QUJ A;  4OYK A;  2N9D A;  4CXY A;  4IHJ E;  2CA5 A;  2H7V C;  3IHR A;  2V7J A;  4AKL A;  4O8S A;  2CLY C;  3UFE A;  3MZK B;  3I9W A;  4QXB B;  1CUN A;  3CQC B;  2E9X B;  4CQI A;  4V1A v;  2LSY A;  4KP3 C;  2VL8 A;  2YIN A;  4OHF A;  3WI3 A;  3Q5X A;  5FY7 A;  4ZHQ E;  4MLK A;  3GWH A;  5EZY E;  2VKJ A;  3NBX X;  4AI6 A;  3ZCI A;  2N1G A;  1BR0 A;  1YKE B;  2D0U A;  5EK3 A;  4X1Y E;  3UUN A;  4PK5 A;  3RYH E;  2DCF A;  3L3P A;  3ZEF B;  3F2E A;  2KMF A;  3HKB E;  2V7L A;  4HKA A;  2Q9Q A;  3H37 A;  1HG2 A;  3UUX B;  4ILU A;  2C5I T;  1FEW A;  1LVK A;  2LSJ A;  4PNI A;  5L3B B;  4KBM B;  5H6R B;  2W0G A;  3O1J A;  3PE0 A;  4M1P A;  3UT5 E;  2V7I A;  3KDS E;  4X1K E;  3PU8 A;  4IE4 A;  4TZ4 C;  3HKC E;  4J2C A;  4GOU A;  4QXH B;  4MFR A;  3R6N A;  4AXP A;  2Y48 B;  4F6R C;  1IJ5 A;  3FXE B;  2NW9 A;  3CPZ A;  3LK4 2;  3NRY A;  3DTO A;  1EZ3 A;  5ADX L;  2NTX A;  4BAY B;  4QX7 B;  2K9A A;  3Q9D A;  2MYS A;  4JEH B;  5F3J A;  3N9N A;  5FP3 A;  4A56 A;  3ZC1 A;  4FI5 A;  5LP6 E;  4QX8 B;  1IZN B;  4UEM A;  2LSI A;  2V1D B;  2XAQ B;  4BJN A;  2CLY B;  2ZLY A;  2Q9Q B;  3KV6 A;  5L2L A;  3BQL A;  3WAJ A;  1D0Z A;  3C64 A;  3BQI A;  1HTJ F;  2ODV A;  5J1G A;  3B13 A;  4Z8X A;  5JVD E;  2DI4 A;  4DO0 A;  2D2S A;  3NZQ A;  2XQY A;  4IE7 A;  2XHE B;  1D1B A;  4PAG A;  5FY1 A;  5LHH B;  2HH7 A;  1MND A;  2NOX A;  2E8I A;  4ZI3 D;  2A2F X;  4U72 A;  4ASK A;  2E9X D;  2KT9 A;  2X51 A;  2NW7 A;  2W63 A;  1HG5 A;  3KBT A;  3KVA A;  5IHY A;  4IE6 A;  1UCU A;  1B7T A;  5JDL A;  1WR6 A;  2G0U A;  1YD8 G;  4EZ4 A;  2YEV C;  3ZMT B;  5FMN A;  5JR9 C;  1IAP A;  1S94 A;  4MAL A;  2I59 A;  3JC6 D;  4GYR A;  2BVM A;  1U5P A;  2EHO D;  1LRZ A;  3VHL A;  4PFP A;  2X9H A;  3NRX A;  5FYM A;  3ZN1 B;  3W15 B;  4ZS3 A;  2K48 A;  2CMR A;  3GA8 A;  4UVC B;  3HKD E;  1MIW A;  4P09 A;  3K3N A;  2RA1 A;  3KIN B;  4AQG A;  2V7M A;  3CML A;  3ZMS B;  3RC8 A;  5LJM A;  3ZLI A;  3OYX A;  5HXE A;  5JR9 A;  2JQQ A;  4AKH A;  2XUE A;  2VKD A;  3AAI A;  4ZI2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...