4GK5E

Crystal structure of human rev3-rev7-rev1-polkappa complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
APNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitotic spindle assembly checkpoint protein MAD2B
publication title Structural insights into the assembly of human translesion polymerase complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 34
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4gk5E00
2LSYA 4GK0E 4GK5E 3VU7H 2LSIA 4BA9A 2LSKA 4EXTA 4FJOA 2LSGA 2LSJA 2N1GA
chains in the Genus database with same CATH superfamily
4YSYA 2LEHA 2JIWA 4IGUA 2G0UA 5DJQC 2D5UA 5HXEA 4TUYE 3P50A 4K0KT 1M7KA 3UQ4A 1KFYA 4G2AA 4JI7T 4XZCA 2LHRA 3QC9A 4L9IA 4ZI3C 5C2TA 2X9XA 4UEMA 3E0ZA 1GQEA 3RRWA 2K48A 1G73A 4QH5A 2XPKA 5AQJB 3AE4A 3T1YT 2VK9A 4G63A 5LB7B 1KF6A 4LMLA 2BG9C 3LK3B 1SUMB 2ZLYA 2IUBA 3ETVA 3GWHA 3I9YA 1SE7A 3MA9A 5LJNA 4HKAA 2XSAA 1UK5A 3P7IA 3UTKA 3VKGA 3DP7A 3NBXX 5F8PA 2WQYA 4HFCA 1UX4A 3NWIA 4H9QC 4IDZA 3N9OA 2E9XC 5BMVE 4ZS3A 3RQWA 1MNDA 2UXBT 3RIUC 4JV5T 3J7Yq 4PJNA 3RI5A 1W0AA 5HEHA 5JDNA 4K0UA 3FZMB 1ZHCA 2RP4A 5JDHA 3FBZA 5FVLA 2VKDA 4U33A 4JI8T 4P1NA 5KXJA 3KVAA 3TLSA 1N33T 3EVYA 4GYRA 2C5KT 5FVKA 2WU2A 5LMUT 5LXTE 1U4QA 3RHWA 4LFCT 2CRBA 3P4SA 3AE7A 3CPZA 3C4ZA 3C64A 2E8IA 2CLYB 2XQ8A 3AA6B 2XAGB 2CHOA 4HFHA 3CVRA 4PK5A 2Y6XA 1HFAA 1KNPA 5LP6E 3M65A 4IL4A 5IWAT 3L09A 2QRXA 2I0MA 4EGWA 3PUGA 2UUCT 3VKHA 2UXCT 5EK2A 2OLTA 3HKDE 3Q9DA 2E2AA 4IDOA 3SFEA 1T8BA 2EHOD 2JMHA 1LVKA 2XZEA 1VOMA 2YK0A 5IYZE 1ZEEA 1B7TA 4UIGA 4KHZF 3UU5A 2H3RA 2BZBA 3ONXA 4ANJA 3CQGB 2CXDA 4A56A 3PJAJ 3ABVA 2XJ7A 1XZYA 1BR0A 4PNIA 1W9RA 3C50A 2X67A 2QGSA 4X1YE 4ZEYA 4DV4T 4X64T 2ZM0A 4GIWA 3SFDA 2DL1A 5HWXA 2UXNB 2WDRA 4JYAT 4U3CA 3JC6C 4DR4T 3PJAA 2ZM6T 3L8RA 4B3ST 2X68A 4WNKA 3B13A 1MIVA 4EOZB 3HL6A 3MZKB 1MIWA 5L3CB 4U74A 4TWDA 1NENA 2FUPA 4UVCB 4H9PC 4C90A 3RYIE 3JC6D 2AXDS 1ZP0A 4EYUA 4DR3T 2YEVC 5EK4A 2LSGA 4AXPA 5LNKA 1QSDA 3QB5K 2KNDA 4X65T 5IUXA 1XMOT 3LK42 2CWOA 2NTXA 3AEDA 4YSZA 2HN2A 5L47A 2BG9B 2HH7A 2M6BA 4IE4A 4DUYT 4Z91A 5EZYE 2L3LA 4U7IA 3SS1A 5LOVE 3AECA 4TZ4C 4QH4A 2BKNA 3RLFF 2V1DB 3ZCIA 4O4LE 3AE8A 4ZS2A 2WCAA 3N2GE 3AEFA 1IZNB 2UXDT 2XAHB 4DR5T 3LBXB 4IREA 3HA4A 4CXWA 3LSVA 2YOEA 5TAOA 4LF4T 1FIOA 3G06A 4PJLA 4KUMB 1XNQT 3W15B 3CWZB 1L0VA 2VVSA 1IBKT 4N78D 4QX8B 4HWHA 3I1AA 1KEYA 4HTEA 1DU2A 2W2UA 5FNVE 3IF8B 3N9PA 3Q5EA 4DV1T 1LVFA 3CX8B 2J4GA 5JDGA 4DVDA 4EZ4A 2N1GA 3F2EA 4NUUA 4AKGA 2LOPA 2V6YB 2BG9A 2K3WA 5FY7A 4JI1T 2EHOB 4IHJE 5L4HA 2IHR1 2CM0A 3EDVA 5LG4A 3ZMSB 4FI5A 4CZZB 3ZJ1A 4CI1B 3ETUA 5HXRA 2CXLA 4QXHB 5L3FB 1ZKEA 3KV5A 2VQFT 4UR9A 3A8YC 4YJ3E 2WSSV 2E9XA 2V7IA 3RIUA 1VCSA 5LCYA 3O4XE 3CIRA 1QUUA 1D1BA 3CX6B 2J47A 4C91A 4DR1T 3LBXA 2DNXA 3ZPOA 3LG7A 2LT3A 1V9DA 4UVAB 3RPUA 5ADXL 3FXEB 4IDPA 4WBOA 2QVAA 2WDQA 2W67A 2ZM8A 4TN7B 4O2AE 4YTPA 2IC6A 4H9SE 4UXNB 3EAMA 4DBRA 3N9LA 5FL0A 4ILUA 5KMGP 2A2FX 2WB5A 4B3RT 5LHIB 1MMGA 1OWAA 5AQTB 2JRKA 3RIFA 4ADZA 3Q5WA 4ILCA 3BQLA 3MXZA 2CA5A 4ZOLE 4LFAT 1WR0A 2X0LB 5HCJA 3UULA 4GOUA 4A98A 3ZN1B 4GYSA 3O9XA 2LSYA 2B1EA 2WY2A 1HR0T 1UUSA 4CN1A 4CI2B 3LJCA 2R6GF 1BR2A 4CXYA 4WYVA 4X66T 2D2SA 4QXCB 1E1HB 4JI4T 1HNWT 2DWKA 5H6RB 3K8PC 2KWHA 3VR8A 4AKLA 4L0RA 3S4UA 3RC8A 2WMOA 3AE2A 5CA1E 3OJAA 3LFMA 4KMCA 3F31A 3RYFE 2FJAA 2ODUA 2VB6A 2H89A 1N32T 1WLXA 1WFDA 4DMWA 2ACZA 3AE5A 3CK6A 3NRYA 1HNXT 2KWIB 3RC3A 3ZYKA 1YQ3A 4CQIA 4HWDA 4MHCA 5E0OA 1MMAA 4Z8XA 2YDSA 1XNRT 2BBJA 4O4JE 2JPFA 4OFZA 2K24A 5GONE 4I0UA 4HGAA 3AE9A 3SWHA 1KNZA 1W0BA 3CX7B 4X62T 2NW8A 4ZZCA 2WU5A 5J1GA 3UT5E 2FJEA 4O8SA 1EZ3A 2WAUA 4YXDA 3AA7B 4ZI3D 5FXWA 5AQMB 4UVBB 3P4RA 1D0ZA 2ODVA 4BJMA 3R6NA 1J5WA 5L2LA 3PUYF 4WW0A 4COFA 5AQPB 4YTNA 3ZMVB 1J1JA 1WCRA 4ZXLA 4HEAA 2W62A 4HFIA 3C51A 3FZKB 2HN1A 3AA0B 2XM1A 3QNUA 4TWFA 2D0TA 1M62A 5JR9C 1HX1B 2MTQA 2MYSA 2XQ6A 2DCFA 3T8OA 4AKHA 2V7MA 3R84B 4I50E 2E9XD 2QYWA 3RX6A 1HCIA 3UU3A 3UFEA 3GA8A 2JQQA 4DBQA 2OV9A 3HKBE 2D0UA 1KK7A 1T98A 4DV0T 2LM9A 3HR0A 1D0XA 4EEDA 2XQ5A 5HXSA 1WYCA 2BS2A 4L5GA 3VU7H 4YT0A 4YJ2E 2Y8DA 3IBPA 3IEEA 3FZHB 3P8CD 5AQVB 3BQIA 4Z90A 4TNWA 2NW9A 5KDMC 3ESLA 4AI6A 2DWGA 2XSBA 3MACA 3PV0F 4P0BA 5JRCA 2AE9A 4A97A 2NP9A 4HFBA 2JJ9A 3B5MA 5HCMA 2H7OA 3OYXA 3WAKA 4E7SA 4BA9A 1OEDC 5FXXA 3OPCA 4HFVA 4IIJE 4FJOA 5CJ5A 4TV9E 3KDSE 2LRKA 2PBIA 5DABA 2WZHA 2SPCA 2UXXB 3KBTA 4HWCA 4I55E 4WZXA 3QK6A 3L39A 4PFOA 4U72A 4IE0A 5FXZA 4PJMA 4YHJA 1US7B 1FEWA 4O2BE 4MLKA 5L3EB 2BS4A 3RIAA 2LE8A 1XMQT 4PJJA 3AEEA 2MPKA 1LKXA 1IJ6A 3AXJA 1Z0PA 5L3GB 3OVUA 2B76A 3BK9A 4IT4A 2XQ4A 2UUAT 2I6HA 3AE1A 1NWMX 3AAEB 5M4YA 2CHNA 4JI0T 4ILBA 4UF0B 4PAGA 3N5LA 2KZ7B 4QKNA 1JNRA 1YKHB 2WWVA 2V7KA 2NW7A 2Q9QC 5AFUL 2V26A 5A1LA 5FMNA 4JLEA 1D1CA 3A5XA 3UUXB 2W61A 2JQ9A 4LF8T 2BKOA 2DI4A 4JEHB 4DNDA 3VRBA 1D1AA 2NOXA 4M1PA 5AQRB 3CQXC 4HE8A 3QOFA 3UU8A 1CUNA 4X5TA 3J9X1 3V5SA 4QWNB 5F3JA 3PTRB 4H9OC 4IL9A 3Q5XA 3UUNA 5HYAA 2MBGA 4NXNT 2JQHA 2E9XB 4V1Av 5JDLA 5AQOB 3P4PA 5LBMA 3TLUA 4KBMB 2LKHA 1ZV4X 3TLTA 5JDFA 4UF0A 3RGLA 2LHNA 2V7LA 3M3ZB 1HS7A 5H6QB 4X1IE 2YDQA 2WP9A 2RPAA 2XAFB 1FMVA 5AQIB 3AVRA 5ABHA 4UV9B 4DV3T 4EAHA 4EYYR 3RF1A 3Q2MA 2C5JA 2W66A 3JCFA 2CEAA 2YU2A 1YKEB 2IAKA 5LGNB 1AJ3A 5CGMA 3KV4A 1BR4A 1Z8UA 4BAYB 2V5CA 5HEOA 5FKYA 3ZC1A 1YXRA 2N9DA 4Q25A 2VVNA 2A3DA 4QXBB 4JBWF 2LKGA 4LMJA 4JI6T 5LMNT 5JDMA 2XQ7A 4YHHT 2WS3A 3H3MA 4X1KE 3AAIA 4QHOA 4OK0A 2CWYA 3NZQA 2FBWA 2E5LT 5LA6E 5J2UE 1VCTA 4AQFA 1WRDA 5JR9A 2VL0A 2H7VC 3KVBA 3ZCJA 3IHRA 2KSRA 3JAFA 2W4XA 3AB3B 3LK2B 5C8YE 4IDNA 4ILAA 1NEKA 2CLYC 3C4WA 4YY3T 1UURA 2ES0A 3FXDB 4U31A 4E7ZA 4OYJA 1SHZC 3H37A 3AEBA 3ZMZB 2LSIA 2JQKA 4OYKA 1X9BA 1H7CA 2RA1A 1UCUA 2XAJB 1BR1A 4IDQA 3ZT7A 4CN6A 4EB6E 4PK6A 5JQGE 3ZSSA 2IC9A 4GK5E 3RKGA 2CXFA 4ZI2C 4DR2T 2MAWA 3CKDA 4DR7T 1OEDE 3CQCB 3PU3A 3I0QA 2IMLA 4CXXA 4HWFA 2FJBA 3N2KE 2DLRA 2ZM2A 1W09A 2X0YA 4LF9T 2Q9QB 2CMRA 3QB5A 2YU1A 5AQKB 1U5PA 2H88A 2YKSA 4DIDB 3FB2A 5KX5E 1OEDA 5L4EA 2CCQA 3JAEA 3KINB 3ZSTA 3EI0A 4GKJT 4NIQA 4XBFB 4KP3C 2X9HA 3EDUA 5AQSB 4PFPA 3C4XA 1YQ4A 2C0SA 1ZOYA 3ZEFB 5FYMA 2XQ9A 5FY0A 4GK0E 3KV9A 4I4TE 1MMDA 1VRBA 4YFSA 2A72A 4P0AA 3UUBA 4HFDA 3B57A 4YTMA 1HF8A 4GKKT 2WWUA 3PUWF 3PE0A 5DQWA 5JVDE 1IBMT 4H63V 2M6IA 4BJNA 4TWHA 2GK9A 2NWBA 3MKDA 1S35A 3UUMA 5ABFB 3WI3A 3H3AA 1MIYA 3C98B 4AQGA 2Q9QA 5J0ZA 5FY1A 4LFBT 2PG8A 4HN9A 3ZLIA 4ERRA 2PFVA 2BKPA 5LGTB 3P4QA 1D0YA 4KX6A 2P9BA 1I94T 3GN5B 2VKHA 4LMKA 1OXZA 3PUSA 3PUAA 3ZT5A 4AISA 2IDOB 4LF6T 1E2AA 2W63A 3KBUA 2BVMA 2J62A 5JRCB 4NXMT 3Q5DA 5J2TE 2IIUA 3L3PA 1N36T 3WAJA 4AQFC 3TLVA 3PUVF 3K3QC 3HKEE 5JDQA 4DV2T 4QH1A 2VQET 3RYCE 1NAFA 4QX7B 1CHUA 3N9NA 3E22E 2XAQB 5CA0E 5HEGA 4LF7T 3K1SA 3FBLA 5ABFA 3PUZF 3MK7C 4NPPA 1R8IA 2CPTA 5CFBA 4HFEA 4ZHQE 2F4VT 2XQYA 4DV6T 4X20E 3EUHA 4IE6A 1SA0E 4EEBA 5JTGA 4O4HE 2LSJA 4LF5T 2XASB 3N2OA 2UUBT 2UU9T 4A5XA 3TKLB 2Z6EA 3AXJB 1HG2A 2OA5A 2KXPB 5HEJA 3DJBA 3AAAB 3ZJ2A 3GN5A 5L3BB 2XTLA 3OTOT 1QLBA 3RYHE 4JI5T 2QA7A 3UQ7A 2EHOC 4PK4A 4AIUA 5FP3A 3DTOA 3MJXA 1WYBA 1XDPA 2N2NA 3O1JA 1KNRA 4ZI7E 1MMNA 3ANWB 5C3JA 5LBQB 2WMNA 2J1DG 4YLHA 4MFRA 3AE6A 5LJMA 3NVOA 5CB4E 3RQUA 1HTJF 2IW5B 2KT9A 3CMLA 5LYJE 2PJQA 4I43B 3N9MA 4NUVA 3E08A 4B3MT 3I0OA 3I9WA 4H9RC 2W00A 3OYZA 2I59A 3GMIA 3N9QA 1Y64B 4DR6T 4JEUB 1YW0A 4DUZT 3ZMUB 1O3XA 4IE7A 5FXVA 3OKQA 5L3DB 3V5UA 2PTFA 1HG5A 3PU8A 4MALA 3D0TA 4AKIA 4F6RC 2HPJA 4H9NC 2XHEB 4J2CA 5HXHA 2LM2A 2XQAA 5JH7E 2VL8A 3P4WA 5AQFB 3ONJA 4JI2T 2KMFA 2X66A 2WZIA 3U3IA 3ANWA 1J5ET 4P09A 2MOZA 2ACXA 4F8HA 2BBHA 4CI3B 2A9UA 3JADA 3AA1B 2C5IT 4TNVA 4U2YA 5AQGB 3BQKA 3NKZA 3O1IA 5ETWA 5JREA 4EIWA 3T1HT 2BDEA 4OX9T 1IJ5A 2Y48B 2L8KA 5AQUB 3ONLC 3HI2A 3LDQB 5IHYA 2XM2A 3QUJA 1LRZA 5LHGB 4ISSA 2Q9QD 2XQ3A 5AQHB 2YDRA 3ZN0B 3PUQA 1WR6A 1IBLT 3F57A 4O4IE 2WBLA 1HX8A 2K9AA 3ZKRA 1E7PA 2CE7A 2BS3A 4TV8E 3KV6A 3FZLB 2LLYA 2YINA 3U78A 4JUYA 1FJGT 1X79A 2V7JA 1UGOA 2K5BB 3EHZA 5JR9B 3TLWA 2W0GA 5ABEA 4DMVA 1MNEA 5ABGA 4EZHA 3A7MA 3RRCA 4ASKA 2JMKA 5FL1A 4EXTA 3IA3A 4AQYT 4YSXA 3SRZA 2BG9E 3O1HA 2VURA 2CBJA 4MBQA 4DV7T 1XWMA 2E5VA 5LHHB 2D9DA 5HWYA 3UFGA 1Y01A 4B6XA 2NR4A 2V8SV 3OBVE 4KHPT 3FZFB 3ZT6A 5DQVA 3FHNA 3EABA 2V5DA 5HEUA 4JI3T 4EV6A 2VKOA 2LSKA 5HXCA 1YD8G 3UU6A 1FMWA 5AQQB 3K3NA 4UV8B 3AEGA 4WBNE 1S94A 3K3OA 5EK3A 3VRAA 2X51A 2VASA 2XY8B 2HHHT 4U7YA 1OEDB 5BR8T 2LOSA 4OHFA 2WDVA 4XAXB 3PUXF 4U2ZA 4ZZBA 1JNZA 3AEAA 2XUEA 5F5WA 2NTYA 4B3TT 3ZMTB 3PDYA 3SOLA 2LJLA 3NZPA 5HAXA 2X9YA 3VHLA 3HKCE 5AQLB 3RKOA 2HPLA 4TX5A 2LRLA 2KLQA 3AVSA 3UU4A 2DHRA 5LGUB 2V6XA 2L9QA 2CBIA 4DO0A 3ZYMA 4UELA 1I6ZA 2V6YA 4IE5A 2EHOA 1N34T 2M67A 4HWIB 3VR9A 5LG3A 1G8XA 1HNZT 2YN6A 3AE3A 3ZYLA 2VWAA 4ISTA 1T7SA 3X1DA 1IAPA 4H63H 1UX5A 2BVLA 4ZI2D 2VKJA 4DV5T 2X0HA 3PURA 2X9WA 5AQNB 1XDOA 2ZMAA 4PW8A 1T72A 3KFWX 4CN4A 3RH3A 2FJDA 3ZC0A 3NRXA 2WM9A 4KI0F 2KINB 4AKRB
chains in the Genus database with same CATH topology
2XASB 2CXLA 4QXHB 2LEHA 5L3FB 3N2OA 1ZKEA 3KV5A 1D1CA 4JLEA 4IGUA 3A5XA 3UUXB 4YJ3E 2G0UA 2WSSV 3TKLB 2E9XA 2V7IA 5DJQC 2Z6EA 2W61A 1HG2A 2OA5A 2D5UA 2KXPB 2DI4A 3DJBA 5HXEA 4JEHB 4TUYE 3AAAB 3ZJ2A 3GN5A 5LCYA 4DNDA 3O4XE 5L3BB 2XTLA 1QUUA 1D1AA 2NOXA 4M1PA 3RYHE 2QA7A 3CQXC 1D1BA 3CX6B 4C91A 2EHOC 4PK4A 4HE8A 3LBXA 5FP3A 1CUNA 2DNXA 3DTOA 3MJXA 4G2AA 1WYBA 4XZCA 3ZPOA 2LHRA 3LG7A 3QC9A 3J9X1 3V5SA 4QWNB 2LT3A 1V9DA 4L9IA 2N2NA 3O1JA 4ZI3C 4UVAB 3RPUA 4ZI7E 2X9XA 1MMNA 4UEMA 3ANWB 5ADXL 3FXEB 4WBOA 3E0ZA 5F3JA 3PTRB 4H9OC 5LBQB 3RRWA 2WMNA 3Q5XA 2K48A 3UUNA 2J1DG 5HYAA 2ZM8A 1G73A 4YLHA 4TN7B 2MBGA 4MFRA 5LJMA 4O2AE 5CB4E 2IC6A 1HTJF 4H9SE 4UXNB 2E9XB 2IW5B 4DBRA 4V1Av 3N9LA 5JDLA 2KT9A 3CMLA 4ILUA 5KMGP 5LYJE 2PJQA 2A2FX 2VK9A 4I43B 5LBMA 3N9MA 4G63A 3E08A 4NUVA 4KBMB 3LK3B 5LHIB 2ZLYA 1ZV4X 3I0OA 3I9WA 1MMGA 4H9RC 3ETVA 2W00A 3GWHA 3I9YA 3OYZA 1OWAA 2I59A 3MA9A 5LJNA 3GMIA 4HKAA 5JDFA 2JRKA 3N9QA 4UF0A 4ADZA 1Y64B 3Q5WA 2LHNA 3P7IA 4JEUB 2V7LA 1YW0A 3BQLA 3MXZA 3UTKA 3ZMUB 2CA5A 1HS7A 3DP7A 3VKGA 1O3XA 4ZOLE 5H6QB 3NBXX 4IE7A 4X1IE 5F8PA 2X0LB 5FXVA 1UX4A 4H9QC 3OKQA 3UULA 4GOUA 4IDZA 3N9OA 2E9XC 3ZN1B 4GYSA 3V5UA 2XAFB 5L3DB 3O9XA 2LSYA 1FMVA 2B1EA 5BMVE 4ZS3A 1MNDA 3AVRA 3J7Yq 4UV9B 1HG5A 4CI2B 4EAHA 4PJNA 4EYYR 3LJCA 3PU8A 3Q2MA 2C5JA 4MALA 5JDNA 3D0TA 4AKIA 4F6RC 2CEAA 4K0UA 1BR2A 2YU2A 1YKEB 4CXYA 2HPJA 4H9NC 1ZHCA 2IAKA 2D2SA 2RP4A 2XHEB 5LGNB 4J2CA 5HXHA 5JDHA 1AJ3A 4QXCB 5JH7E 3FBZA 2VL8A 3KV4A 1E1HB 2VKDA 1BR4A 2KMFA 4BAYB 2X66A 3U3IA 3KVAA 3ANWA 4P09A 2MOZA 2DWKA 3EVYA 4GYRA 5H6RB 3ZC1A 2ACXA 2N9DA 3K8PC 2C5KT 2A3DA 2KWHA 4QXBB 4AKLA 4CI3B 4L0RA 3S4UA 3RC8A 3AA1B 5LXTE 2C5IT 1U4QA 2WMOA 5CA1E 3OJAA 5JDMA 3LFMA 4KMCA 3BQKA 3F31A 3O1IA 5ETWA 4X1KE 3RYFE 4EIWA 2BDEA 5JREA 3CPZA 1IJ5A 2ODUA 2Y48B 2VB6A 3C64A 3C4ZA 2E8IA 3AAIA 2CLYB 1WLXA 3AA6B 4OK0A 4QHOA 2CWYA 2L8KA 2XAGB 3NZQA 5IHYA 3HI2A 4DMWA 3CVRA 4PK5A 3NRYA 2Y6XA 1HFAA 3QUJA 2KWIB 3RC3A 1LRZA 5LA6E 3ZYKA 5LHGB 5J2UE 5LP6E 4ISSA 4AQFA 3M65A 3L09A 2Q9QD 1WRDA 5JR9A 4CQIA 2H7VC 4MHCA 3KVBA 1MMAA 5E0OA 4Z8XA 3ZN0B 3ZCJA 3PUQA 3PUGA 1WR6A 3IHRA 3VKHA 5EK2A 4O4JE 2JPFA 3AB3B 3HKDE 3F57A 2K24A 3LK2B 4O4IE 2WBLA 3Q9DA 4OFZA 5C8YE 5GONE 1HX8A 2K9AA 4HGAA 2CE7A 3SWHA 1KNZA 2CLYC 3C4WA 2ES0A 3FXDB 4E7ZA 3CX7B 4OYJA 4TV8E 2EHOD 2JMHA 1LVKA 1SHZC 2NW8A 1VOMA 3H37A 3KV6A 2YK0A 3ZMZB 5J1GA 5IYZE 2LSIA 1ZEEA 3UT5E 2YINA 3U78A 4O8SA 1B7TA 4OYKA 4UIGA 4JUYA 1X79A 1EZ3A 1H7CA 2V7JA 2WAUA 4ZI3D 2RA1A 3AA7B 2K5BB 2XAJB 1UCUA 5FXWA 1BR1A 5JR9B 2W0GA 4EB6E 4DMVA 2H3RA 4PK6A 5JQGE 4UVBB 1MNEA 2BZBA 2IC9A 3ONXA 1D0ZA 4GK5E 2CXFA 3CQGB 4ANJA 2ODVA 2CXDA 4A56A 4EZHA 4ZI2C 4BJMA 3R6NA 3CKDA 3RRCA 4ASKA 2JMKA 5L2LA 4WW0A 4EXTA 3CQCB 1BR0A 4PNIA 3PU3A 3I0QA 3C50A 4CXXA 2X67A 2QGSA 3ZMVB 4X1YE 2ZM0A 4GIWA 4HEAA 2W62A 3SRZA 3C51A 5HWXA 3O1HA 2UXNB 3N2KE 2DLRA 2ZM2A 3AA0B 3JC6C 4MBQA 2Q9QB 2D0TA 2CMRA 5LHHB 2YU1A 2X68A 5HWYA 4WNKA 3B13A 5JR9C 1MIVA 1U5PA 2MTQA 4B6XA 2MYSA 4EOZB 2DCFA 3HL6A 3MZKB 3T8OA 3OBVE 3FB2A 1MIWA 5KX5E 4AKHA 2V7MA 3R84B 5L3CB 2CCQA 5DQVA 4I50E 2E9XD 3FHNA 3KINB 4XBFB 4U74A 3RX6A 1HCIA 4KP3C 3UFEA 2VKOA 4UVCB 2X9HA 3GA8A 3EDUA 2LSKA 4H9PC 4C90A 2JQQA 3RYIE 3JC6D 5HXCA 4PFPA 4DBQA 1YD8G 3HKBE 2D0UA 3C4XA 1KK7A 1T98A 1FMWA 2LM9A 3K3NA 3HR0A 1D0XA 4UV8B 2C0SA 4EYUA 2YEVC 3ZEFB 5EK4A 2LSGA 4AXPA 5FYMA 5LNKA 1QSDA 5FY0A 4GK0E 3KV9A 4I4TE 1MMDA 4WBNE 1VRBA 4YFSA 2A72A 4P0AA 5HXSA 2KNDA 1S94A 3K3OA 3B57A 5EK3A 1WYCA 4L5GA 3VU7H 2X51A 4YJ2E 2Y8DA 3IBPA 1HF8A 2VASA 3IEEA 2WWUA 3LK42 2CWOA 3PE0A 2NTXA 3P8CD 5DQWA 5JVDE 3BQIA 4H63V 4BJNA 2GK9A 2NWBA 3MKDA 2LOSA 4OHFA 4XAXB 2HH7A 1S35A 3UUMA 2NW9A 5KDMC 4IE4A 3ESLA 4AI6A 2DWGA 2XUEA 3MACA 3WI3A 4P0BA 5JRCA 3H3AA 5EZYE 1MIYA 2L3LA 2NTYA 2NP9A 3SS1A 5LOVE 3ZMTB 2JJ9A 3C98B 3PDYA 3SOLA 4AQGA 2Q9QA 2LJLA 2H7OA 3NZPA 4TZ4C 5FY1A 5HAXA 2PG8A 4HN9A 3ZLIA 2X9YA 4ERRA 2PFVA 3OYXA 2V1DB 3WAKA 3VHLA 3HKCE 4E7SA 4BA9A 3ZCIA 4O4LE 5LGTB 3RKOA 2HPLA 4TX5A 2KLQA 3AVSA 4ZS2A 5FXXA 2DHRA 5LGUB 1D0YA 4HFVA 3N2GE 4IIJE 2L9QA 4FJOA 2P9BA 1IZNB 2VKHA 3GN5B 3KDSE 1OXZA 4TV9E 4DO0A 3PUSA 3PUAA 2PBIA 5DABA 2SPCA 2XAHB 3ZYMA 2UXXB 3KBTA 4UELA 4I55E 3LBXB 3QK6A 3HA4A 4CXWA 4PFOA 4U72A 4IE0A 4IE5A 5FXZA 2EHOA 3KBUA 2W63A 5TAOA 2M67A 4PJMA 2BVMA 1G8XA 4YHJA 1US7B 1FIOA 5JRCB 1FEWA 4O2BE 4MLKA 4PJLA 4KUMB 3ZYLA 5L3EB 2VWAA 5J2TE 3W15B 3CWZB 4ISTA 3L3PA 2LE8A 4N78D 4QX8B 3WAJA 4AQFC 4PJJA 3I1AA 5HXRA 4HTEA 5FNVE 3IF8B 3K3QC 3HKEE 3N9PA 5JDQA 1LKXA 1IJ6A 1IAPA 1Z0PA 4H63H 1UX5A 3RYCE 5L3GB 1LVFA 2BVLA 3CX8B 1NAFA 4QX7B 3BK9A 4ZI2D 5JDGA 2VKJA 3N9NA 4DVDA 4EZ4A 2N1GA 3F2EA 3E22E 3PURA 4NUUA 2XAQB 2X9WA 4AKGA 5CA0E 1NWMX 3AAEB 5M4YA 2LOPA 2ZMAA 5FY7A 3FBLA 4PW8A 4UF0B 2EHOB 4IHJE 4PAGA 3MK7C 3N5LA 2KZ7B 2CM0A 4QKNA 4ZHQE 3EDVA 2XQYA 1YKHB 5LG4A 3KFWX 2V7KA 3ZMSB 2NW7A 4FI5A 3RH3A 2Q9QC 4X20E 4CZZB 3EUHA 5AFUL 3ZJ1A 4CI1B 4IE6A 1SA0E 3ZC0A 2V26A 3ETUA 3NRXA 2WM9A 4O4HE 2KINB 5A1LA 4AKRB 2LSJA 5FMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSY A;  4GK0 E;  4GK5 E;  3VU7 H;  2LSI A;  4BA9 A;  2LSK A;  4EXT A;  4FJO A;  2LSG A;  2LSJ A;  2N1G A; 
#chains in the Genus database with same CATH topology
 4YSY A;  2LEH A;  2JIW A;  4IGU A;  2G0U A;  5DJQ C;  2D5U A;  5HXE A;  4TUY E;  3P50 A;  4K0K T;  1M7K A;  3UQ4 A;  1KFY A;  4G2A A;  4JI7 T;  4XZC A;  2LHR A;  3QC9 A;  4L9I A;  4ZI3 C;  5C2T A;  2X9X A;  4UEM A;  3E0Z A;  1GQE A;  3RRW A;  2K48 A;  1G73 A;  4QH5 A;  2XPK A;  5AQJ B;  3AE4 A;  3T1Y T;  2VK9 A;  4G63 A;  5LB7 B;  1KF6 A;  4LML A;  2BG9 C;  3LK3 B;  1SUM B;  2ZLY A;  2IUB A;  3ETV A;  3GWH A;  3I9Y A;  1SE7 A;  3MA9 A;  5LJN A;  4HKA A;  2XSA A;  1UK5 A;  3P7I A;  3UTK A;  3VKG A;  3DP7 A;  3NBX X;  5F8P A;  2WQY A;  4HFC A;  1UX4 A;  3NWI A;  4H9Q C;  4IDZ A;  3N9O A;  2E9X C;  5BMV E;  4ZS3 A;  3RQW A;  1MND A;  2UXB T;  3RIU C;  4JV5 T;  3J7Y q;  4PJN A;  3RI5 A;  1W0A A;  5HEH A;  5JDN A;  4K0U A;  3FZM B;  1ZHC A;  2RP4 A;  5JDH A;  3FBZ A;  5FVL A;  2VKD A;  4U33 A;  4JI8 T;  4P1N A;  5KXJ A;  3KVA A;  3TLS A;  1N33 T;  3EVY A;  4GYR A;  2C5K T;  5FVK A;  2WU2 A;  5LMU T;  5LXT E;  1U4Q A;  3RHW A;  4LFC T;  2CRB A;  3P4S A;  3AE7 A;  3CPZ A;  3C4Z A;  3C64 A;  2E8I A;  2CLY B;  2XQ8 A;  3AA6 B;  2XAG B;  2CHO A;  4HFH A;  3CVR A;  4PK5 A;  2Y6X A;  1HFA A;  1KNP A;  5LP6 E;  3M65 A;  4IL4 A;  5IWA T;  3L09 A;  2QRX A;  2I0M A;  4EGW A;  3PUG A;  2UUC T;  3VKH A;  2UXC T;  5EK2 A;  2OLT A;  3HKD E;  3Q9D A;  2E2A A;  4IDO A;  3SFE A;  1T8B A;  2EHO D;  2JMH A;  1LVK A;  2XZE A;  1VOM A;  2YK0 A;  5IYZ E;  1ZEE A;  1B7T A;  4UIG A;  4KHZ F;  3UU5 A;  2H3R A;  2BZB A;  3ONX A;  4ANJ A;  3CQG B;  2CXD A;  4A56 A;  3PJA J;  3ABV A;  2XJ7 A;  1XZY A;  1BR0 A;  4PNI A;  1W9R A;  3C50 A;  2X67 A;  2QGS A;  4X1Y E;  4ZEY A;  4DV4 T;  4X64 T;  2ZM0 A;  4GIW A;  3SFD A;  2DL1 A;  5HWX A;  2UXN B;  2WDR A;  4JYA T;  4U3C A;  3JC6 C;  4DR4 T;  3PJA A;  2ZM6 T;  3L8R A;  4B3S T;  2X68 A;  4WNK A;  3B13 A;  1MIV A;  4EOZ B;  3HL6 A;  3MZK B;  1MIW A;  5L3C B;  4U74 A;  4TWD A;  1NEN A;  2FUP A;  4UVC B;  4H9P C;  4C90 A;  3RYI E;  3JC6 D;  2AXD S;  1ZP0 A;  4EYU A;  4DR3 T;  2YEV C;  5EK4 A;  2LSG A;  4AXP A;  5LNK A;  1QSD A;  3QB5 K;  2KND A;  4X65 T;  5IUX A;  1XMO T;  3LK4 2;  2CWO A;  2NTX A;  3AED A;  4YSZ A;  2HN2 A;  5L47 A;  2BG9 B;  2HH7 A;  2M6B A;  4IE4 A;  4DUY T;  4Z91 A;  5EZY E;  2L3L A;  4U7I A;  3SS1 A;  5LOV E;  3AEC A;  4TZ4 C;  4QH4 A;  2BKN A;  3RLF F;  2V1D B;  3ZCI A;  4O4L E;  3AE8 A;  4ZS2 A;  2WCA A;  3N2G E;  3AEF A;  1IZN B;  2UXD T;  2XAH B;  4DR5 T;  3LBX B;  4IRE A;  3HA4 A;  4CXW A;  3LSV A;  2YOE A;  5TAO A;  4LF4 T;  1FIO A;  3G06 A;  4PJL A;  4KUM B;  1XNQ T;  3W15 B;  3CWZ B;  1L0V A;  2VVS A;  1IBK T;  4N78 D;  4QX8 B;  4HWH A;  3I1A A;  1KEY A;  4HTE A;  1DU2 A;  2W2U A;  5FNV E;  3IF8 B;  3N9P A;  3Q5E A;  4DV1 T;  1LVF A;  3CX8 B;  2J4G A;  5JDG A;  4DVD A;  4EZ4 A;  2N1G A;  3F2E A;  4NUU A;  4AKG A;  2LOP A;  2V6Y B;  2BG9 A;  2K3W A;  5FY7 A;  4JI1 T;  2EHO B;  4IHJ E;  5L4H A;  2IHR 1;  2CM0 A;  3EDV A;  5LG4 A;  3ZMS B;  4FI5 A;  4CZZ B;  3ZJ1 A;  4CI1 B;  3ETU A;  5HXR A;  2CXL A;  4QXH B;  5L3F B;  1ZKE A;  3KV5 A;  2VQF T;  4UR9 A;  3A8Y C;  4YJ3 E;  2WSS V;  2E9X A;  2V7I A;  3RIU A;  1VCS A;  5LCY A;  3O4X E;  3CIR A;  1QUU A;  1D1B A;  3CX6 B;  2J47 A;  4C91 A;  4DR1 T;  3LBX A;  2DNX A;  3ZPO A;  3LG7 A;  2LT3 A;  1V9D A;  4UVA B;  3RPU A;  5ADX L;  3FXE B;  4IDP A;  4WBO A;  2QVA A;  2WDQ A;  2W67 A;  2ZM8 A;  4TN7 B;  4O2A E;  4YTP A;  2IC6 A;  4H9S E;  4UXN B;  3EAM A;  4DBR A;  3N9L A;  5FL0 A;  4ILU A;  5KMG P;  2A2F X;  2WB5 A;  4B3R T;  5LHI B;  1MMG A;  1OWA A;  5AQT B;  2JRK A;  3RIF A;  4ADZ A;  3Q5W A;  4ILC A;  3BQL A;  3MXZ A;  2CA5 A;  4ZOL E;  4LFA T;  1WR0 A;  2X0L B;  5HCJ A;  3UUL A;  4GOU A;  4A98 A;  3ZN1 B;  4GYS A;  3O9X A;  2LSY A;  2B1E A;  2WY2 A;  1HR0 T;  1UUS A;  4CN1 A;  4CI2 B;  3LJC A;  2R6G F;  1BR2 A;  4CXY A;  4WYV A;  4X66 T;  2D2S A;  4QXC B;  1E1H B;  4JI4 T;  1HNW T;  2DWK A;  5H6R B;  3K8P C;  2KWH A;  3VR8 A;  4AKL A;  4L0R A;  3S4U A;  3RC8 A;  2WMO A;  3AE2 A;  5CA1 E;  3OJA A;  3LFM A;  4KMC A;  3F31 A;  3RYF E;  2FJA A;  2ODU A;  2VB6 A;  2H89 A;  1N32 T;  1WLX A;  1WFD A;  4DMW A;  2ACZ A;  3AE5 A;  3CK6 A;  3NRY A;  1HNX T;  2KWI B;  3RC3 A;  3ZYK A;  1YQ3 A;  4CQI A;  4HWD A;  4MHC A;  5E0O A;  1MMA A;  4Z8X A;  2YDS A;  1XNR T;  2BBJ A;  4O4J E;  2JPF A;  4OFZ A;  2K24 A;  5GON E;  4I0U A;  4HGA A;  3AE9 A;  3SWH A;  1KNZ A;  1W0B A;  3CX7 B;  4X62 T;  2NW8 A;  4ZZC A;  2WU5 A;  5J1G A;  3UT5 E;  2FJE A;  4O8S A;  1EZ3 A;  2WAU A;  4YXD A;  3AA7 B;  4ZI3 D;  5FXW A;  5AQM B;  4UVB B;  3P4R A;  1D0Z A;  2ODV A;  4BJM A;  3R6N A;  1J5W A;  5L2L A;  3PUY F;  4WW0 A;  4COF A;  5AQP B;  4YTN A;  3ZMV B;  1J1J A;  1WCR A;  4ZXL A;  4HEA A;  2W62 A;  4HFI A;  3C51 A;  3FZK B;  2HN1 A;  3AA0 B;  2XM1 A;  3QNU A;  4TWF A;  2D0T A;  1M62 A;  5JR9 C;  1HX1 B;  2MTQ A;  2MYS A;  2XQ6 A;  2DCF A;  3T8O A;  4AKH A;  2V7M A;  3R84 B;  4I50 E;  2E9X D;  2QYW A;  3RX6 A;  1HCI A;  3UU3 A;  3UFE A;  3GA8 A;  2JQQ A;  4DBQ A;  2OV9 A;  3HKB E;  2D0U A;  1KK7 A;  1T98 A;  4DV0 T;  2LM9 A;  3HR0 A;  1D0X A;  4EED A;  2XQ5 A;  5HXS A;  1WYC A;  2BS2 A;  4L5G A;  3VU7 H;  4YT0 A;  4YJ2 E;  2Y8D A;  3IBP A;  3IEE A;  3FZH B;  3P8C D;  5AQV B;  3BQI A;  4Z90 A;  4TNW A;  2NW9 A;  5KDM C;  3ESL A;  4AI6 A;  2DWG A;  2XSB A;  3MAC A;  3PV0 F;  4P0B A;  5JRC A;  2AE9 A;  4A97 A;  2NP9 A;  4HFB A;  2JJ9 A;  3B5M A;  5HCM A;  2H7O A;  3OYX A;  3WAK A;  4E7S A;  4BA9 A;  1OED C;  5FXX A;  3OPC A;  4HFV A;  4IIJ E;  4FJO A;  5CJ5 A;  4TV9 E;  3KDS E;  2LRK A;  2PBI A;  5DAB A;  2WZH A;  2SPC A;  2UXX B;  3KBT A;  4HWC A;  4I55 E;  4WZX A;  3QK6 A;  3L39 A;  4PFO A;  4U72 A;  4IE0 A;  5FXZ A;  4PJM A;  4YHJ A;  1US7 B;  1FEW A;  4O2B E;  4MLK A;  5L3E B;  2BS4 A;  3RIA A;  2LE8 A;  1XMQ T;  4PJJ A;  3AEE A;  2MPK A;  1LKX A;  1IJ6 A;  3AXJ A;  1Z0P A;  5L3G B;  3OVU A;  2B76 A;  3BK9 A;  4IT4 A;  2XQ4 A;  2UUA T;  2I6H A;  3AE1 A;  1NWM X;  3AAE B;  5M4Y A;  2CHN A;  4JI0 T;  4ILB A;  4UF0 B;  4PAG A;  3N5L A;  2KZ7 B;  4QKN A;  1JNR A;  1YKH B;  2WWV A;  2V7K A;  2NW7 A;  2Q9Q C;  5AFU L;  2V26 A;  5A1L A;  5FMN A;  4JLE A;  1D1C A;  3A5X A;  3UUX B;  2W61 A;  2JQ9 A;  4LF8 T;  2BKO A;  2DI4 A;  4JEH B;  4DND A;  3VRB A;  1D1A A;  2NOX A;  4M1P A;  5AQR B;  3CQX C;  4HE8 A;  3QOF A;  3UU8 A;  1CUN A;  4X5T A;  3J9X 1;  3V5S A;  4QWN B;  5F3J A;  3PTR B;  4H9O C;  4IL9 A;  3Q5X A;  3UUN A;  5HYA A;  2MBG A;  4NXN T;  2JQH A;  2E9X B;  4V1A v;  5JDL A;  5AQO B;  3P4P A;  5LBM A;  3TLU A;  4KBM B;  2LKH A;  1ZV4 X;  3TLT A;  5JDF A;  4UF0 A;  3RGL A;  2LHN A;  2V7L A;  3M3Z B;  1HS7 A;  5H6Q B;  4X1I E;  2YDQ A;  2WP9 A;  2RPA A;  2XAF B;  1FMV A;  5AQI B;  3AVR A;  5ABH A;  4UV9 B;  4DV3 T;  4EAH A;  4EYY R;  3RF1 A;  3Q2M A;  2C5J A;  2W66 A;  3JCF A;  2CEA A;  2YU2 A;  1YKE B;  2IAK A;  5LGN B;  1AJ3 A;  5CGM A;  3KV4 A;  1BR4 A;  1Z8U A;  4BAY B;  2V5C A;  5HEO A;  5FKY A;  3ZC1 A;  1YXR A;  2N9D A;  4Q25 A;  2VVN A;  2A3D A;  4QXB B;  4JBW F;  2LKG A;  4LMJ A;  4JI6 T;  5LMN T;  5JDM A;  2XQ7 A;  4YHH T;  2WS3 A;  3H3M A;  4X1K E;  3AAI A;  4QHO A;  4OK0 A;  2CWY A;  3NZQ A;  2FBW A;  2E5L T;  5LA6 E;  5J2U E;  1VCT A;  4AQF A;  1WRD A;  5JR9 A;  2VL0 A;  2H7V C;  3KVB A;  3ZCJ A;  3IHR A;  2KSR A;  3JAF A;  2W4X A;  3AB3 B;  3LK2 B;  5C8Y E;  4IDN A;  4ILA A;  1NEK A;  2CLY C;  3C4W A;  4YY3 T;  1UUR A;  2ES0 A;  3FXD B;  4U31 A;  4E7Z A;  4OYJ A;  1SHZ C;  3H37 A;  3AEB A;  3ZMZ B;  2LSI A;  2JQK A;  4OYK A;  1X9B A;  1H7C A;  2RA1 A;  1UCU A;  2XAJ B;  1BR1 A;  4IDQ A;  3ZT7 A;  4CN6 A;  4EB6 E;  4PK6 A;  5JQG E;  3ZSS A;  2IC9 A;  4GK5 E;  3RKG A;  2CXF A;  4ZI2 C;  4DR2 T;  2MAW A;  3CKD A;  4DR7 T;  1OED E;  3CQC B;  3PU3 A;  3I0Q A;  2IML A;  4CXX A;  4HWF A;  2FJB A;  3N2K E;  2DLR A;  2ZM2 A;  1W09 A;  2X0Y A;  4LF9 T;  2Q9Q B;  2CMR A;  3QB5 A;  2YU1 A;  5AQK B;  1U5P A;  2H88 A;  2YKS A;  4DID B;  3FB2 A;  5KX5 E;  1OED A;  5L4E A;  2CCQ A;  3JAE A;  3KIN B;  3ZST A;  3EI0 A;  4GKJ T;  4NIQ A;  4XBF B;  4KP3 C;  2X9H A;  3EDU A;  5AQS B;  4PFP A;  3C4X A;  1YQ4 A;  2C0S A;  1ZOY A;  3ZEF B;  5FYM A;  2XQ9 A;  5FY0 A;  4GK0 E;  3KV9 A;  4I4T E;  1MMD A;  1VRB A;  4YFS A;  2A72 A;  4P0A A;  3UUB A;  4HFD A;  3B57 A;  4YTM A;  1HF8 A;  4GKK T;  2WWU A;  3PUW F;  3PE0 A;  5DQW A;  5JVD E;  1IBM T;  4H63 V;  2M6I A;  4BJN A;  4TWH A;  2GK9 A;  2NWB A;  3MKD A;  1S35 A;  3UUM A;  5ABF B;  3WI3 A;  3H3A A;  1MIY A;  3C98 B;  4AQG A;  2Q9Q A;  5J0Z A;  5FY1 A;  4LFB T;  2PG8 A;  4HN9 A;  3ZLI A;  4ERR A;  2PFV A;  2BKP A;  5LGT B;  3P4Q A;  1D0Y A;  4KX6 A;  2P9B A;  1I94 T;  3GN5 B;  2VKH A;  4LMK A;  1OXZ A;  3PUS A;  3PUA A;  3ZT5 A;  4AIS A;  2IDO B;  4LF6 T;  1E2A A;  2W63 A;  3KBU A;  2BVM A;  2J62 A;  5JRC B;  4NXM T;  3Q5D A;  5J2T E;  2IIU A;  3L3P A;  1N36 T;  3WAJ A;  4AQF C;  3TLV A;  3PUV F;  3K3Q C;  3HKE E;  5JDQ A;  4DV2 T;  4QH1 A;  2VQE T;  3RYC E;  1NAF A;  4QX7 B;  1CHU A;  3N9N A;  3E22 E;  2XAQ B;  5CA0 E;  5HEG A;  4LF7 T;  3K1S A;  3FBL A;  5ABF A;  3PUZ F;  3MK7 C;  4NPP A;  1R8I A;  2CPT A;  5CFB A;  4HFE A;  4ZHQ E;  2F4V T;  2XQY A;  4DV6 T;  4X20 E;  3EUH A;  4IE6 A;  1SA0 E;  4EEB A;  5JTG A;  4O4H E;  2LSJ A;  4LF5 T;  2XAS B;  3N2O A;  2UUB T;  2UU9 T;  4A5X A;  3TKL B;  2Z6E A;  3AXJ B;  1HG2 A;  2OA5 A;  2KXP B;  5HEJ A;  3DJB A;  3AAA B;  3ZJ2 A;  3GN5 A;  5L3B B;  2XTL A;  3OTO T;  1QLB A;  3RYH E;  4JI5 T;  2QA7 A;  3UQ7 A;  2EHO C;  4PK4 A;  4AIU A;  5FP3 A;  3DTO A;  3MJX A;  1WYB A;  1XDP A;  2N2N A;  3O1J A;  1KNR A;  4ZI7 E;  1MMN A;  3ANW B;  5C3J A;  5LBQ B;  2WMN A;  2J1D G;  4YLH A;  4MFR A;  3AE6 A;  5LJM A;  3NVO A;  5CB4 E;  3RQU A;  1HTJ F;  2IW5 B;  2KT9 A;  3CML A;  5LYJ E;  2PJQ A;  4I43 B;  3N9M A;  4NUV A;  3E08 A;  4B3M T;  3I0O A;  3I9W A;  4H9R C;  2W00 A;  3OYZ A;  2I59 A;  3GMI A;  3N9Q A;  1Y64 B;  4DR6 T;  4JEU B;  1YW0 A;  4DUZ T;  3ZMU B;  1O3X A;  4IE7 A;  5FXV A;  3OKQ A;  5L3D B;  3V5U A;  2PTF A;  1HG5 A;  3PU8 A;  4MAL A;  3D0T A;  4AKI A;  4F6R C;  2HPJ A;  4H9N C;  2XHE B;  4J2C A;  5HXH A;  2LM2 A;  2XQA A;  5JH7 E;  2VL8 A;  3P4W A;  5AQF B;  3ONJ A;  4JI2 T;  2KMF A;  2X66 A;  2WZI A;  3U3I A;  3ANW A;  1J5E T;  4P09 A;  2MOZ A;  2ACX A;  4F8H A;  2BBH A;  4CI3 B;  2A9U A;  3JAD A;  3AA1 B;  2C5I T;  4TNV A;  4U2Y A;  5AQG B;  3BQK A;  3NKZ A;  3O1I A;  5ETW A;  5JRE A;  4EIW A;  3T1H T;  2BDE A;  4OX9 T;  1IJ5 A;  2Y48 B;  2L8K A;  5AQU B;  3ONL C;  3HI2 A;  3LDQ B;  5IHY A;  2XM2 A;  3QUJ A;  1LRZ A;  5LHG B;  4ISS A;  2Q9Q D;  2XQ3 A;  5AQH B;  2YDR A;  3ZN0 B;  3PUQ A;  1WR6 A;  1IBL T;  3F57 A;  4O4I E;  2WBL A;  1HX8 A;  2K9A A;  3ZKR A;  1E7P A;  2CE7 A;  2BS3 A;  4TV8 E;  3KV6 A;  3FZL B;  2LLY A;  2YIN A;  3U78 A;  4JUY A;  1FJG T;  1X79 A;  2V7J A;  1UGO A;  2K5B B;  3EHZ A;  5JR9 B;  3TLW A;  2W0G A;  5ABE A;  4DMV A;  1MNE A;  5ABG A;  4EZH A;  3A7M A;  3RRC A;  4ASK A;  2JMK A;  5FL1 A;  4EXT A;  3IA3 A;  4AQY T;  4YSX A;  3SRZ A;  2BG9 E;  3O1H A;  2VUR A;  2CBJ A;  4MBQ A;  4DV7 T;  1XWM A;  2E5V A;  5LHH B;  2D9D A;  5HWY A;  3UFG A;  1Y01 A;  4B6X A;  2NR4 A;  2V8S V;  3OBV E;  4KHP T;  3FZF B;  3ZT6 A;  5DQV A;  3FHN A;  3EAB A;  2V5D A;  5HEU A;  4JI3 T;  4EV6 A;  2VKO A;  2LSK A;  5HXC A;  1YD8 G;  3UU6 A;  1FMW A;  5AQQ B;  3K3N A;  4UV8 B;  3AEG A;  4WBN E;  1S94 A;  3K3O A;  5EK3 A;  3VRA A;  2X51 A;  2VAS A;  2XY8 B;  2HHH T;  4U7Y A;  1OED B;  5BR8 T;  2LOS A;  4OHF A;  2WDV A;  4XAX B;  3PUX F;  4U2Z A;  4ZZB A;  1JNZ A;  3AEA A;  2XUE A;  5F5W A;  2NTY A;  4B3T T;  3ZMT B;  3PDY A;  3SOL A;  2LJL A;  3NZP A;  5HAX A;  2X9Y A;  3VHL A;  3HKC E;  5AQL B;  3RKO A;  2HPL A;  4TX5 A;  2LRL A;  2KLQ A;  3AVS A;  3UU4 A;  2DHR A;  5LGU B;  2V6X A;  2L9Q A;  2CBI A;  4DO0 A;  3ZYM A;  4UEL A;  1I6Z A;  2V6Y A;  4IE5 A;  2EHO A;  1N34 T;  2M67 A;  4HWI B;  3VR9 A;  5LG3 A;  1G8X A;  1HNZ T;  2YN6 A;  3AE3 A;  3ZYL A;  2VWA A;  4IST A;  1T7S A;  3X1D A;  1IAP A;  4H63 H;  1UX5 A;  2BVL A;  4ZI2 D;  2VKJ A;  4DV5 T;  2X0H A;  3PUR A;  2X9W A;  5AQN B;  1XDO A;  2ZMA A;  4PW8 A;  1T72 A;  3KFW X;  4CN4 A;  3RH3 A;  2FJD A;  3ZC0 A;  3NRX A;  2WM9 A;  4KI0 F;  2KIN B;  4AKR B; 
#chains in the Genus database with same CATH homology
 2XAS B;  2CXL A;  4QXH B;  2LEH A;  5L3F B;  3N2O A;  1ZKE A;  3KV5 A;  1D1C A;  4JLE A;  4IGU A;  3A5X A;  3UUX B;  4YJ3 E;  2G0U A;  2WSS V;  3TKL B;  2E9X A;  2V7I A;  5DJQ C;  2Z6E A;  2W61 A;  1HG2 A;  2OA5 A;  2D5U A;  2KXP B;  2DI4 A;  3DJB A;  5HXE A;  4JEH B;  4TUY E;  3AAA B;  3ZJ2 A;  3GN5 A;  5LCY A;  4DND A;  3O4X E;  5L3B B;  2XTL A;  1QUU A;  1D1A A;  2NOX A;  4M1P A;  3RYH E;  2QA7 A;  3CQX C;  1D1B A;  3CX6 B;  4C91 A;  2EHO C;  4PK4 A;  4HE8 A;  3LBX A;  5FP3 A;  1CUN A;  2DNX A;  3DTO A;  3MJX A;  4G2A A;  1WYB A;  4XZC A;  3ZPO A;  2LHR A;  3LG7 A;  3QC9 A;  3J9X 1;  3V5S A;  4QWN B;  2LT3 A;  1V9D A;  4L9I A;  2N2N A;  3O1J A;  4ZI3 C;  4UVA B;  3RPU A;  4ZI7 E;  2X9X A;  1MMN A;  4UEM A;  3ANW B;  5ADX L;  3FXE B;  4WBO A;  3E0Z A;  5F3J A;  3PTR B;  4H9O C;  5LBQ B;  3RRW A;  2WMN A;  3Q5X A;  2K48 A;  3UUN A;  2J1D G;  5HYA A;  2ZM8 A;  1G73 A;  4YLH A;  4TN7 B;  2MBG A;  4MFR A;  5LJM A;  4O2A E;  5CB4 E;  2IC6 A;  1HTJ F;  4H9S E;  4UXN B;  2E9X B;  2IW5 B;  4DBR A;  4V1A v;  3N9L A;  5JDL A;  2KT9 A;  3CML A;  4ILU A;  5KMG P;  5LYJ E;  2PJQ A;  2A2F X;  2VK9 A;  4I43 B;  5LBM A;  3N9M A;  4G63 A;  3E08 A;  4NUV A;  4KBM B;  3LK3 B;  5LHI B;  2ZLY A;  1ZV4 X;  3I0O A;  3I9W A;  1MMG A;  4H9R C;  3ETV A;  2W00 A;  3GWH A;  3I9Y A;  3OYZ A;  1OWA A;  2I59 A;  3MA9 A;  5LJN A;  3GMI A;  4HKA A;  5JDF A;  2JRK A;  3N9Q A;  4UF0 A;  4ADZ A;  1Y64 B;  3Q5W A;  2LHN A;  3P7I A;  4JEU B;  2V7L A;  1YW0 A;  3BQL A;  3MXZ A;  3UTK A;  3ZMU B;  2CA5 A;  1HS7 A;  3DP7 A;  3VKG A;  1O3X A;  4ZOL E;  5H6Q B;  3NBX X;  4IE7 A;  4X1I E;  5F8P A;  2X0L B;  5FXV A;  1UX4 A;  4H9Q C;  3OKQ A;  3UUL A;  4GOU A;  4IDZ A;  3N9O A;  2E9X C;  3ZN1 B;  4GYS A;  3V5U A;  2XAF B;  5L3D B;  3O9X A;  2LSY A;  1FMV A;  2B1E A;  5BMV E;  4ZS3 A;  1MND A;  3AVR A;  3J7Y q;  4UV9 B;  1HG5 A;  4CI2 B;  4EAH A;  4PJN A;  4EYY R;  3LJC A;  3PU8 A;  3Q2M A;  2C5J A;  4MAL A;  5JDN A;  3D0T A;  4AKI A;  4F6R C;  2CEA A;  4K0U A;  1BR2 A;  2YU2 A;  1YKE B;  4CXY A;  2HPJ A;  4H9N C;  1ZHC A;  2IAK A;  2D2S A;  2RP4 A;  2XHE B;  5LGN B;  4J2C A;  5HXH A;  5JDH A;  1AJ3 A;  4QXC B;  5JH7 E;  3FBZ A;  2VL8 A;  3KV4 A;  1E1H B;  2VKD A;  1BR4 A;  2KMF A;  4BAY B;  2X66 A;  3U3I A;  3KVA A;  3ANW A;  4P09 A;  2MOZ A;  2DWK A;  3EVY A;  4GYR A;  5H6R B;  3ZC1 A;  2ACX A;  2N9D A;  3K8P C;  2C5K T;  2A3D A;  2KWH A;  4QXB B;  4AKL A;  4CI3 B;  4L0R A;  3S4U A;  3RC8 A;  3AA1 B;  5LXT E;  2C5I T;  1U4Q A;  2WMO A;  5CA1 E;  3OJA A;  5JDM A;  3LFM A;  4KMC A;  3BQK A;  3F31 A;  3O1I A;  5ETW A;  4X1K E;  3RYF E;  4EIW A;  2BDE A;  5JRE A;  3CPZ A;  1IJ5 A;  2ODU A;  2Y48 B;  2VB6 A;  3C64 A;  3C4Z A;  2E8I A;  3AAI A;  2CLY B;  1WLX A;  3AA6 B;  4OK0 A;  4QHO A;  2CWY A;  2L8K A;  2XAG B;  3NZQ A;  5IHY A;  3HI2 A;  4DMW A;  3CVR A;  4PK5 A;  3NRY A;  2Y6X A;  1HFA A;  3QUJ A;  2KWI B;  3RC3 A;  1LRZ A;  5LA6 E;  3ZYK A;  5LHG B;  5J2U E;  5LP6 E;  4ISS A;  4AQF A;  3M65 A;  3L09 A;  2Q9Q D;  1WRD A;  5JR9 A;  4CQI A;  2H7V C;  4MHC A;  3KVB A;  1MMA A;  5E0O A;  4Z8X A;  3ZN0 B;  3ZCJ A;  3PUQ A;  3PUG A;  1WR6 A;  3IHR A;  3VKH A;  5EK2 A;  4O4J E;  2JPF A;  3AB3 B;  3HKD E;  3F57 A;  2K24 A;  3LK2 B;  4O4I E;  2WBL A;  3Q9D A;  4OFZ A;  5C8Y E;  5GON E;  1HX8 A;  2K9A A;  4HGA A;  2CE7 A;  3SWH A;  1KNZ A;  2CLY C;  3C4W A;  2ES0 A;  3FXD B;  4E7Z A;  3CX7 B;  4OYJ A;  4TV8 E;  2EHO D;  2JMH A;  1LVK A;  1SHZ C;  2NW8 A;  1VOM A;  3H37 A;  3KV6 A;  2YK0 A;  3ZMZ B;  5J1G A;  5IYZ E;  2LSI A;  1ZEE A;  3UT5 E;  2YIN A;  3U78 A;  4O8S A;  1B7T A;  4OYK A;  4UIG A;  4JUY A;  1X79 A;  1EZ3 A;  1H7C A;  2V7J A;  2WAU A;  4ZI3 D;  2RA1 A;  3AA7 B;  2K5B B;  2XAJ B;  1UCU A;  5FXW A;  1BR1 A;  5JR9 B;  2W0G A;  4EB6 E;  4DMV A;  2H3R A;  4PK6 A;  5JQG E;  4UVB B;  1MNE A;  2BZB A;  2IC9 A;  3ONX A;  1D0Z A;  4GK5 E;  2CXF A;  3CQG B;  4ANJ A;  2ODV A;  2CXD A;  4A56 A;  4EZH A;  4ZI2 C;  4BJM A;  3R6N A;  3CKD A;  3RRC A;  4ASK A;  2JMK A;  5L2L A;  4WW0 A;  4EXT A;  3CQC B;  1BR0 A;  4PNI A;  3PU3 A;  3I0Q A;  3C50 A;  4CXX A;  2X67 A;  2QGS A;  3ZMV B;  4X1Y E;  2ZM0 A;  4GIW A;  4HEA A;  2W62 A;  3SRZ A;  3C51 A;  5HWX A;  3O1H A;  2UXN B;  3N2K E;  2DLR A;  2ZM2 A;  3AA0 B;  3JC6 C;  4MBQ A;  2Q9Q B;  2D0T A;  2CMR A;  5LHH B;  2YU1 A;  2X68 A;  5HWY A;  4WNK A;  3B13 A;  5JR9 C;  1MIV A;  1U5P A;  2MTQ A;  4B6X A;  2MYS A;  4EOZ B;  2DCF A;  3HL6 A;  3MZK B;  3T8O A;  3OBV E;  3FB2 A;  1MIW A;  5KX5 E;  4AKH A;  2V7M A;  3R84 B;  5L3C B;  2CCQ A;  5DQV A;  4I50 E;  2E9X D;  3FHN A;  3KIN B;  4XBF B;  4U74 A;  3RX6 A;  1HCI A;  4KP3 C;  3UFE A;  2VKO A;  4UVC B;  2X9H A;  3GA8 A;  3EDU A;  2LSK A;  4H9P C;  4C90 A;  2JQQ A;  3RYI E;  3JC6 D;  5HXC A;  4PFP A;  4DBQ A;  1YD8 G;  3HKB E;  2D0U A;  3C4X A;  1KK7 A;  1T98 A;  1FMW A;  2LM9 A;  3K3N A;  3HR0 A;  1D0X A;  4UV8 B;  2C0S A;  4EYU A;  2YEV C;  3ZEF B;  5EK4 A;  2LSG A;  4AXP A;  5FYM A;  5LNK A;  1QSD A;  5FY0 A;  4GK0 E;  3KV9 A;  4I4T E;  1MMD A;  4WBN E;  1VRB A;  4YFS A;  2A72 A;  4P0A A;  5HXS A;  2KND A;  1S94 A;  3K3O A;  3B57 A;  5EK3 A;  1WYC A;  4L5G A;  3VU7 H;  2X51 A;  4YJ2 E;  2Y8D A;  3IBP A;  1HF8 A;  2VAS A;  3IEE A;  2WWU A;  3LK4 2;  2CWO A;  3PE0 A;  2NTX A;  3P8C D;  5DQW A;  5JVD E;  3BQI A;  4H63 V;  4BJN A;  2GK9 A;  2NWB A;  3MKD A;  2LOS A;  4OHF A;  4XAX B;  2HH7 A;  1S35 A;  3UUM A;  2NW9 A;  5KDM C;  4IE4 A;  3ESL A;  4AI6 A;  2DWG A;  2XUE A;  3MAC A;  3WI3 A;  4P0B A;  5JRC A;  3H3A A;  5EZY E;  1MIY A;  2L3L A;  2NTY A;  2NP9 A;  3SS1 A;  5LOV E;  3ZMT B;  2JJ9 A;  3C98 B;  3PDY A;  3SOL A;  4AQG A;  2Q9Q A;  2LJL A;  2H7O A;  3NZP A;  4TZ4 C;  5FY1 A;  5HAX A;  2PG8 A;  4HN9 A;  3ZLI A;  2X9Y A;  4ERR A;  2PFV A;  3OYX A;  2V1D B;  3WAK A;  3VHL A;  3HKC E;  4E7S A;  4BA9 A;  3ZCI A;  4O4L E;  5LGT B;  3RKO A;  2HPL A;  4TX5 A;  2KLQ A;  3AVS A;  4ZS2 A;  5FXX A;  2DHR A;  5LGU B;  1D0Y A;  4HFV A;  3N2G E;  4IIJ E;  2L9Q A;  4FJO A;  2P9B A;  1IZN B;  2VKH A;  3GN5 B;  3KDS E;  1OXZ A;  4TV9 E;  4DO0 A;  3PUS A;  3PUA A;  2PBI A;  5DAB A;  2SPC A;  2XAH B;  3ZYM A;  2UXX B;  3KBT A;  4UEL A;  4I55 E;  3LBX B;  3QK6 A;  3HA4 A;  4CXW A;  4PFO A;  4U72 A;  4IE0 A;  4IE5 A;  5FXZ A;  2EHO A;  3KBU A;  2W63 A;  5TAO A;  2M67 A;  4PJM A;  2BVM A;  1G8X A;  4YHJ A;  1US7 B;  1FIO A;  5JRC B;  1FEW A;  4O2B E;  4MLK A;  4PJL A;  4KUM B;  3ZYL A;  5L3E B;  2VWA A;  5J2T E;  3W15 B;  3CWZ B;  4IST A;  3L3P A;  2LE8 A;  4N78 D;  4QX8 B;  3WAJ A;  4AQF C;  4PJJ A;  3I1A A;  5HXR A;  4HTE A;  5FNV E;  3IF8 B;  3K3Q C;  3HKE E;  3N9P A;  5JDQ A;  1LKX A;  1IJ6 A;  1IAP A;  1Z0P A;  4H63 H;  1UX5 A;  3RYC E;  5L3G B;  1LVF A;  2BVL A;  3CX8 B;  1NAF A;  4QX7 B;  3BK9 A;  4ZI2 D;  5JDG A;  2VKJ A;  3N9N A;  4DVD A;  4EZ4 A;  2N1G A;  3F2E A;  3E22 E;  3PUR A;  4NUU A;  2XAQ B;  2X9W A;  4AKG A;  5CA0 E;  1NWM X;  3AAE B;  5M4Y A;  2LOP A;  2ZMA A;  5FY7 A;  3FBL A;  4PW8 A;  4UF0 B;  2EHO B;  4IHJ E;  4PAG A;  3MK7 C;  3N5L A;  2KZ7 B;  2CM0 A;  4QKN A;  4ZHQ E;  3EDV A;  2XQY A;  1YKH B;  5LG4 A;  3KFW X;  2V7K A;  3ZMS B;  2NW7 A;  4FI5 A;  3RH3 A;  2Q9Q C;  4X20 E;  4CZZ B;  3EUH A;  5AFU L;  3ZJ1 A;  4CI1 B;  4IE6 A;  1SA0 E;  3ZC0 A;  2V26 A;  3ETU A;  3NRX A;  2WM9 A;  4O4H E;  2KIN B;  5A1L A;  4AKR B;  2LSJ A;  5FMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...