2LSKA

C-terminal domain of human rev1 in complex with dna-polymerase h (eta)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
95
Chain Sequence
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/protein binding
molecule keywords DNA repair protein REV1
total genus 30
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lskA00
2LSIA 2LSYA 2N1GA 4GK0E 4GK5E 4EXTA 2LSKA 2LSJA 4BA9A 3VU7H 2LSGA 4FJOA
chains in the Genus database with same CATH superfamily
1D0YA 5LG3A 1XZYA 5AFUL 3J9X1 4IDQA 3QK6A 4UV9B 2HPJA 2BVMA 1T98A 4H63H 3VRBA 4DV3T 1CUNA 2KLQA 2LSIA 4H9SE 3AE7A 2E5VA 2J1DG 5AQUB 2JPFA 4JEHB 4EAHA 4ZZCA 4L0RA 4OX9T 4IE0A 2E8IA 4COFA 1YKHB 4FJOA 3TLTA 3M65A 2JMHA 3ZYMA 4EEBA 5AQVB 5JDHA 5L2LA 2CXFA 5HEJA 3VR8A 5JRCB 4Q25A 5L47A 2CLYC 3AXJA 5IWAT 3ZMVB 5HXEA 5LXTE 5HXCA 2RP4A 4Z8XA 3ANWA 3CQXC 1QSDA 4PJNA 4ZI2D 3I1AA 4AKLA 1OEDE 2FJEA 2V7JA 2XQ9A 1FJGT 4IL9A 4DBQA 2E9XC 3ZC0A 4CXXA 2VQET 2LRLA 3AECA 4YY3T 5JTGA 3S4UA 4JLEA 5HCMA 5LGUB 4IDNA 4IDPA 3ZPOA 2V6YB 1G8XA 3TLWA 5J1GA 2JQHA 2BS2A 3U78A 2PG8A 4QXCB 4AQFC 2Z6EA 2I0MA 2FJBA 3JAEA 3PJAA 3ZT6A 3BQLA 2P9BA 5CB4E 4ZI2C 5J2UE 4KHPT 4AQYT 1UK5A 5ABFB 2XQ4A 1E7PA 2KXPB 3HI2A 4PK4A 4WNKA 5JDMA 4B3ST 4FI5A 2B76A 1HCIA 4HFHA 4IIJE 3RIAA 3OKQA 2UUAT 1KNZA 1XMOT 3W15B 1GQEA 2X67A 4YTMA 5FXZA 4QH5A 3AXJB 3PUYF 2LM2A 3PUQA 1WRDA 3ZT5A 5JDGA 2Q9QB 1O3XA 3AA1B 3FXDB 3N9MA 5LJMA 1HTJF 3C51A 1LVFA 4O4LE 3N9OA 4ZZBA 1T72A 4B3TT 2FBWA 3TLVA 4JV5T 4HWHA 3RX6A 2CWYA 2XQ6A 4NPPA 4P1NA 3TLSA 3B57A 3VHLA 4DNDA 2V6YA 2VKJA 2MPKA 5AQGB 2LE8A 3OPCA 2X9XA 3HKBE 3AE8A 4WW0A 4IREA 1H7CA 3N9QA 3AEGA 5L3BB 1FMVA 3ZYKA 1MMNA 3RH3A 2LSYA 2X0HA 5HWYA 3C4ZA 2IUBA 4YSXA 1VCSA 3IBPA 1J1JA 2ZM6T 3UQ7A 2XY8B 3LJCA 3NZQA 5AQKB 1US7B 3UU4A 4EZ4A 5F5WA 1BR0A 1LKXA 3AEBA 4JI8T 3MXZA 4ZI3C 2NW9A 3SFDA 2BBJA 3C64A 4X20E 3C98B 5FYMA 5LOVE 4EOZB 3A8YC 4HFCA 4U74A 1EZ3A 3BQKA 3F31A 3X1DA 3AE1A 4HN9A 4DR7T 2XAGB 1NEKA 5J2TE 3SS1A 3MACA 3ZMSB 4C91A 4OFZA 3L39A 3IA3A 4DUZT 2UXBT 3ESLA 5C2TA 4UF0B 5FY1A 3AAIA 2XSAA 3T8OA 4ADZA 4DMWA 2YOEA 2LLYA 2VKDA 1AJ3A 1I6ZA 2LRKA 4OHFA 2D0UA 3Q5DA 4PFPA 4UF0A 5E0OA 2V1DB 4LFAT 3K3OA 4UV8B 3QUJA 5L4HA 3Q2MA 2YU2A 3N9NA 2NP9A 1W09A 2NW8A 1W9RA 4F6RC 3CVRA 3TLUA 4QX8B 1NWMX 2L3LA 3FBLA 1KK7A 3MK7C 2QA7A 2X0LB 1XMQT 2E5LT 1WCRA 4OYKA 3E0ZA 4CN1A 5FVKA 4DVDA 1MNDA 2XQ5A 2YN6A 3OYZA 3HKCE 2CCQA 2K5BB 3AE3A 4PW8A 4H9OC 3RGLA 3AVSA 5KXJA 2CRBA 2HH7A 4PFOA 1OEDC 2EHOC 1D1BA 1IBKT 1Z0PA 2DWKA 1YW0A 1D1CA 2BZBA 3CX6B 1SA0E 2JIWA 4E7SA 4ZHQE 4BJNA 3HL6A 3EVYA 4DMVA 4DV1T 2OV9A 2W62A 4MALA 2AXDS 4JI2T 2VURA 3RF1A 2CBJA 1R8IA 2YDRA 3MKDA 5FKYA 1UGOA 3FBZA 1QUUA 2XZEA 3MZKB 2Q9QD 2AE9A 2XUEA 3B5MA 4DR3T 5KDMC 4U3CA 4HTEA 3I9WA 5FL1A 2IMLA 3LBXA 4ZXLA 2KZ7B 1YXRA 2NOXA 3CK6A 5LBQB 4LFCT 3P8CD 4UR9A 4AQFA 1HNXT 4HWIB 2K9AA 4CQIA 4CI1B 5FNVE 3RI5A 2V7MA 3LSVA 2CMRA 4A5XA 2ODVA 3KV9A 4O4HE 4I43B 2A72A 3RPUA 4O4IE 3UU5A 1JNZA 3ZMZB 4YT0A 3ZT7A 2X0YA 3IF8B 2N9DA 1IJ5A 3QC9A 2X51A 4U31A 3ZCIA 4HE8A 3JAFA 3ZN0B 1M7KA 2CBIA 2XPKA 3F57A 2R6GF 3RKGA 4X5TA 3NVOA 5CFBA 5L3FB 1B7TA 5LYJE 2B1EA 3CPZA 1D0XA 3AEAA 4JI0T 4HFVA 5IHYA 4YXDA 2DI4A 4UVAB 5GONE 4B3MT 2J47A 3QNUA 3PE0A 2E9XD 2UXXB 3CQGB 3GN5B 2Q9QC 3L8RA 2XSBA 1FMWA 2X9HA 4TN7B 4AISA 4AI6A 1NENA 3LDQB 2XQ3A 4NUUA 3FB2A 3V5SA 2CXDA 3D0TA 2I59A 2K24A 3ONXA 3P4WA 3PUWF 2C5IT 3CMLA 4HGAA 4X1KE 3KVBA 5JDNA 4LF4T 4C90A 2EHOD 4F8HA 5CJ5A 4XBFB 3ZJ2A 2EHOA 1BR2A 1WFDA 2WP9A 3Q5WA 2Y6XA 4DBRA 2VVSA 1UX4A 5JR9B 4DV6T 4ZEYA 4YSYA 2IC6A 4YFSA 5CGMA 2WU5A 2KWHA 3AE2A 4TZ4C 2KINB 3O1IA 5DQVA 3TKLB 4IE4A 2YKSA 3PV0F 2BKNA 2LT3A 4LMJA 4TWDA 4YLHA 4H63V 4A97A 5HXHA 1MNEA 4I4TE 2F4VT 2UXDT 3C50A 2M67A 4KHZF 4TX5A 2CM0A 4ISTA 5AQMB 2D5UA 4G2AA 4M1PA 3SFEA 3U3IA 4AXPA 4ANJA 1UX5A 2H88A 2N1GA 4LF7T 2ACXA 5FXWA 3UULA 2CE7A 5HXSA 4B3RT 4AKIA 2ZMAA 4BA9A 2ZM8A 2X68A 2WMOA 1HX8A 2ZM2A 4JBWF 5LA6E 1ZOYA 5C3JA 4NXNT 4XZCA 3UQ4A 4X66T 2BVLA 3HA4A 3N9LA 2WSSV 4AKGA 1HS7A 2H7VC 2L9QA 2A3DA 4GKJT 4JI4T 2VK9A 3N2KE 5JR9A 4JI3T 2XQ7A 4U2YA 3UFGA 3UFEA 4JI5T 3UU3A 4IE7A 1YQ4A 3WAJA 3P7IA 4GOUA 3KINB 5C8YE 4ZOLE 4KI0F 2KMFA 4WZXA 4HKAA 2NR4A 5ADXL 3LFMA 4TNWA 3N2OA 4QWNB 2CA5A 2UU9T 3I0QA 1NAFA 2DHRA 4P09A 1ZEEA 2PJQA 3RYIE 1OWAA 3RYHE 3AAEB 1OEDB 3RYCE 5LHHB 2IHR1 2D2SA 5JRCA 3IHRA 3K3NA 1D0ZA 4U33A 1ZHCA 1M62A 3ZLIA 2E9XB 2XQ8A 4I55E 5BMVE 5F3JA 4O2BE 5HEGA 1JNRA 3RQUA 3P4RA 4ILAA 2XQYA 3L09A 3UUXB 5L3EB 3KV4A 4OK0A 1XNRT 2KT9A 4IGUA 2HHHT 2BDEA 2V8SV 2BKPA 2G0UA 2J62A 4ILCA 2CLYB 4HWDA 1SHZC 3AAAB 3RRCA 2NW7A 3ZMTB 5J0ZA 5KX5E 4WBNE 2K3WA 5LNKA 4KUMB 2WS3A 1KEYA 5ABHA 2D9DA 3RKOA 1HNWT 3EHZA 3E22E 2PBIA 1U4QA 4ISSA 3J7Yq 4X64T 1IBMT 3ZEFB 1N36T 3HKDE 2ACZA 4CXWA 2XAQB 2N2NA 2VASA 5AQPB 3V5UA 3ZC1A 2DLRA 5AQRB 2DL1A 3BK9A 5HWXA 1XWMA 4U7YA 2LHNA 4PK6A 5A1LA 3RHWA 3ZKRA 1J5ET 2DWGA 3Q5EA 4O4JE 5HEOA 2J4GA 2X9WA 3UT5E 4CI3B 1N32T 2LKHA 3H37A 3PTRB 5JDLA 5JH7E 4LF9T 1MIVA 5AQJB 3ZSTA 5LBMA 2WWUA 5LMNT 2HN2A 4X1IE 2X9YA 2YEVC 4CN6A 5F8PA 4DIDB 4LF6T 2W0GA 4HWFA 1ZKEA 4H9RC 4ZS3A 5L3GB 3FZKB 4PAGA 3GMIA 1HFAA 4JI7T 4EXTA 1BR1A 3G06A 5AQFB 4WBOA 1Z8UA 3AB3B 4IE6A 2BG9C 4KX6A 5JREA 2BS4A 4KBMB 3O1HA 2M6IA 5LGTB 4YTNA 2WDRA 1FEWA 3CWZB 5FXVA 3RRWA 5M4YA 1W0AA 4PJLA 2H3RA 4EGWA 1LVKA 2XM2A 3E08A 2VL0A 3AA7B 3PJAJ 1X9BA 2H7OA 4HFEA 1VRBA 2JQKA 2YINA 3EI0A 3BQIA 3EUHA 1WLXA 3I0OA 1HG2A 3K1SA 3PUVF 2JQ9A 4YTPA 2Y48B 5CA0E 5BR8T 4DR4T 2QRXA 5LB7B 4HWCA 2VB6A 2XQAA 3PUSA 2M6BA 3EABA 2GK9A 3IEEA 3KVAA 4H9QC 1I94T 4DR6T 2ZM0A 5DJQC 1UURA 3P4QA 5DABA 3ZMUB 1WYBA 4A56A 2BG9E 4CXYA 5EZYE 5ABGA 3ZSSA 4XAXB 1N34T 1UUSA 2LJLA 3H3MA 4LFBT 2VWAA 2JQQA 2IC9A 3ETUA 4N78D 4UEMA 2LOPA 2RPAA 3QOFA 2E9XA 2V7LA 3GWHA 2WBLA 3T1YT 3Q5XA 3OJAA 1KNPA 2LOSA 1WR0A 2W61A 3PU3A 4ILBA 4JI6T 4KMCA 4IDZA 5HCJA 1L0VA 1XDOA 3AE9A 4MBQA 4PJMA 3UUNA 5JDQA 4I50E 5LGNB 2NTXA 2LEHA 2IIUA 2UXNB 4QKNA 4DV4T 4QH4A 4AKHA 4ILUA 3OBVE 5LP6E 4MFRA 4EZHA 1VOMA 4DR2T 1OEDA 2OA5A 3ZJ1A 2LM9A 2FJAA 2KSRA 3NWIA 4AQGA 3P50A 2VKHA 4O2AE 3VRAA 4BJMA 3PUGA 3ONJA 4K0UA 2X66A 3SWHA 1KFYA 3B13A 5H6QB 2V5DA 3LK3B 2XAHB 1UCUA 4TUYE 3KFWX 4L9IA 4UVCB 3JCFA 2XM1A 3KV5A 3NKZA 3OYXA 5JDFA 3P4PA 4JUYA 3PURA 3RIUA 3SOLA 5HYAA 2VQFT 4DV2T 2BS3A 5AQQB 5FY7A 2MAWA 3AE6A 3QB5A 5EK3A 3AVRA 3CX8B 4LMKA 2W00A 3NBXX 4X65T 1SE7A 3LBXB 4HFDA 2W4XA 3N5LA 5FVLA 2JJ9A 4YHHT 3PU8A 2CWOA 5EK4A 2IDOB 3NRXA 5L3DB 3DP7A 3FZMB 5LMUT 3C4XA 2L8KA 2WY2A 3VKGA 1IAPA 2YDSA 4YJ3E 5FP3A 1VCTA 2MOZA 4G63A 5TAOA 4HFBA 2MYSA 4KP3C 3ONLC 1BR4A 3UTKA 2QYWA 2YDQA 4YJ2E 2A9UA 4X62T 3KBTA 2UUCT 3K8PC 3RLFF 4LF8T 5JQGE 1S94A 2C5KT 1CHUA 2WQYA 2ODUA 1T8BA 4LF5T 3FHNA 3FZHB 5HXRA 4MHCA 4TWFA 3GA8A 3T1HT 4UIGA 2V26A 2E2AA 1SUMB 3C4WA 4GKKT 4AIUA 2D0TA 1LRZA 5AQIB 3DTOA 2CXLA 2OLTA 2WM9A 4J2CA 4QXBB 3SRZA 3LG7A 3GN5A 1IZNB 2DNXA 2C0SA 2FUPA 2W66A 3PDYA 1DU2A 1WYCA 2XTLA 3QB5K 4H9NC 4YHJA 1KNRA 1YKEB 2W63A 3PUZF 4H9PC 1HG5A 2H89A 5FMNA 4EYUA 4X1YE 3RC8A 3LK42 2UUBT 3A7MA 4E7ZA 4DV0T 3CQCB 4V1Av 5H6RB 4NXMT 2KWIB 1XDPA 2ES0A 2LSKA 5AQNB 1S35A 3JADA 2EHOB 3A5XA 4JI1T 4P0BA 4QHOA 2WDVA 2WMNA 2XHEB 3O9XA 3RC3A 2BG9A 2RA1A 3ZYLA 5JR9C 4UELA 4AKRB 5LG4A 2FJDA 4TNVA 3ZN1B 4CN4A 3AEDA 3NZPA 3FZFB 4EIWA 4DV7T 4U72A 2VL8A 3EAMA 3HR0A 4GK0E 5ABEA 4WYVA 3WI3A 2LKGA 2HN1A 5DQWA 5AQTB 2XASB 3FXEB 4PNIA 4PJJA 5IYZE 4JEUB 1YQ3A 3WAKA 3L3PA 3O4XE 2CEAA 1MMAA 3EDVA 4QH1A 2NTYA 5AQHB 2WZIA 3KBUA 2C5JA 4IL4A 4UXNB 4EYYR 4GK5E 5HAXA 3O1JA 3UU6A 2HPLA 4Z91A 3CKDA 3R84B 2QGSA 1MIYA 1X79A 3AEEA 1HR0T 4L5GA 5JVDE 3VR9A 1G73A 5FXXA 2MTQA 4B6XA 2WAUA 3OTOT 1HNZT 3CX7B 4EB6E 3FZLB 3AE5A 4CI2B 2JMKA 2Y8DA 2V7KA 5ETWA 2DCFA 5LCYA 3N2GE 5FY0A 2MBGA 4CZZB 4LMLA 4QX7B 4DO0A 4NIQA 4HFIA 4GYRA 5AQOB 4EV6A 4ZS2A 2JRKA 2SPCA 3UU8A 5LJNA 3NRYA 2WB5A 5HEUA 3F2EA 4YSZA 1YD8G 2PFVA 4K0KT 4IT4A 2K48A 3KDSE 1MMDA 1HX1B 3I9YA 4GIWA 2YK0A 5AQSB 4TV8E 3RQWA 4DV5T 3PUXF 4DR1T 1KF6A 2CPTA 3LK2B 4NUVA 4IE5A 1V9DA 3RYFE 1IJ6A 4MLKA 2XAFB 4U7IA 4ZI7E 1Y64B 2YU1A 3DJBA 1U5PA 2BKOA 3H3AA 4HEAA 4PK5A 4BAYB 1T7SA 2UXCT 4GYSA 5HEHA 2LSJA 4ASKA 3CIRA 4P0AA 2WU2A 5LHIB 1OXZA 1W0BA 3AA0B 3P4SA 2WZHA 3VU7H 5ABFA 1ZV4X 3R6NA 3PUAA 3OVUA 3M3ZB 2CHNA 3HKEE 4ERRA 4TWHA 2LSGA 5EK2A 2BBHA 2KNDA 1MMGA 1QLBA 4QXHB 2Q9QA 2LHRA 2A2FX 4U2ZA 5L3CB 3ETVA 3K3QC 2XJ7A 3N9PA 1ZP0A 3UUBA 1Y01A 2WDQA 5IUXA 3AEFA 2IW5B 2IAKA 3AE4A 2VKOA 4JYAT 4OYJA 2NWBA 4TV9E 1IBLT 2I6HA 4I0UA 3KV6A 2V7IA 1N33T 3ABVA 1D1AA 4Z90A 4ZI3D 2PTFA 3VKHA 2BG9B 2W67A 5FL0A 4EEDA 1FIOA 5CA1E 3JC6C 4IDOA 3RIFA 5KMGP 2QVAA 2V5CA 2W2UA 2VVNA 1J5WA 2XAJB 1WR6A 3MA9A 3Q9DA 5AQLB 1XNQT 3ZCJA 3EDUA 3MJXA 1MIWA 4O8SA 3JC6D 4IHJE 5LHGB 2WWVA 1E2AA 2ZLYA 3ANWB 5L4EA 2CHOA 3AA6B 1HF8A 4UVBB 4A98A 3RIUC 1E1HB 3UUMA 2WCAA 2V6XA 4DUYT 4DR5T
chains in the Genus database with same CATH topology
1D0YA 5AFUL 3J9X1 4UV9B 3QK6A 2HPJA 2BVMA 1T98A 4H63H 1CUNA 2KLQA 2LSIA 4H9SE 2J1DG 2JPFA 4JEHB 4EAHA 4L0RA 4IE0A 2E8IA 1YKHB 4FJOA 3M65A 2JMHA 3ZYMA 5JDHA 5L2LA 2CXFA 5JRCB 2CLYC 3ZMVB 5HXEA 5LXTE 5HXCA 2RP4A 4Z8XA 3ANWA 3CQXC 1QSDA 4PJNA 4ZI2D 3I1AA 4AKLA 2V7JA 4DBQA 2E9XC 3ZC0A 3S4UA 4JLEA 5LGUB 3ZPOA 1G8XA 5J1GA 3U78A 2PG8A 4QXCB 4AQFC 2Z6EA 4ZI2C 3BQLA 2P9BA 5CB4E 5J2UE 2KXPB 3HI2A 4PK4A 4WNKA 4FI5A 4IIJE 1HCIA 1KNZA 3OKQA 3W15B 2X67A 5FXZA 3PUQA 1WRDA 5JDGA 2Q9QB 1O3XA 3AA1B 3FXDB 3N9MA 5LJMA 1HTJF 3C51A 1LVFA 4O4LE 3N9OA 3RX6A 3VHLA 2CWYA 4DNDA 3B57A 2VKJA 2LE8A 2X9XA 3HKBE 4WW0A 1H7CA 3N9QA 5L3BB 1FMVA 3ZYKA 1MMNA 3RH3A 2LSYA 5HWYA 3C4ZA 3IBPA 3LJCA 3NZQA 4EZ4A 1US7B 1BR0A 1LKXA 3MXZA 4ZI3C 2NW9A 3C64A 4X20E 3C98B 5FYMA 5LOVE 4EOZB 3ZEFB 4U74A 1EZ3A 3BQKA 3F31A 4HN9A 2XAGB 5J2TE 3SS1A 3MACA 3ZMSB 4C91A 4OFZA 3ESLA 4UF0B 5FY1A 3AAIA 3T8OA 4ADZA 4DMWA 2VKDA 1AJ3A 4OHFA 2D0UA 4PFPA 4UF0A 5E0OA 2V1DB 3K3OA 4UV8B 3QUJA 3Q2MA 2YU2A 3N9NA 2NP9A 2NW8A 4F6RC 3CVRA 4QX8B 1NWMX 2L3LA 3FBLA 1KK7A 3MK7C 2QA7A 2X0LB 4OYKA 3E0ZA 4DVDA 1MNDA 3OYZA 3HKCE 2CCQA 2K5BB 4PW8A 4H9OC 3AVSA 2HH7A 4PFOA 2EHOC 1D1BA 1Z0PA 2DWKA 1YW0A 1D1CA 2BZBA 3CX6B 1SA0E 4ZHQE 4E7SA 4BJNA 3HL6A 3EVYA 4DMVA 2W62A 4MALA 3MKDA 3FBZA 1QUUA 3MZKB 2Q9QD 2XUEA 5KDMC 4HTEA 3I9WA 3LBXA 2KZ7B 2NOXA 5LBQB 3P8CD 4AQFA 4CQIA 2K9AA 4CI1B 5FNVE 2V7MA 2CMRA 2ODVA 3KV9A 4O4HE 4I43B 2A72A 3RPUA 4O4IE 3ZMZB 3IF8B 2N9DA 1IJ5A 3QC9A 2X51A 3ZCIA 4HE8A 3ZN0B 3F57A 5L3FB 1B7TA 5LYJE 2B1EA 3CPZA 1D0XA 4HFVA 5IHYA 2DI4A 4UVAB 5GONE 3PE0A 2E9XD 2UXXB 3GN5B 3CQGB 2Q9QC 1FMWA 2X9HA 4TN7B 4AI6A 4NUUA 3FB2A 3V5SA 3D0TA 2CXDA 2I59A 2K24A 3ONXA 4X1KE 4HGAA 2C5IT 3CMLA 5JDNA 3KVBA 4C90A 2EHOD 4XBFB 3ZJ2A 2EHOA 1BR2A 3Q5WA 2Y6XA 4DBRA 1UX4A 5JR9B 2IC6A 4YFSA 2KWHA 3TKLB 4TZ4C 2KINB 3O1IA 5DQVA 4IE4A 2LT3A 5HXHA 4YLHA 4H63V 1MNEA 4I4TE 3C50A 2M67A 4TX5A 2CM0A 4ISTA 4ANJA 2D5UA 4G2AA 4M1PA 3U3IA 4AXPA 1UX5A 2N1GA 4AKIA 2ACXA 5FXWA 3UULA 2CE7A 5HXSA 2ZMAA 4BA9A 2ZM8A 2X68A 2WMOA 1HX8A 2ZM2A 5LA6E 4XZCA 2BVLA 3HA4A 3N9LA 2WSSV 4AKGA 1HS7A 2H7VC 2L9QA 2A3DA 2VK9A 5JR9A 3UFEA 4IE7A 3WAJA 3P7IA 4GOUA 3KINB 5C8YE 4ZOLE 2KMFA 4HKAA 5ADXL 3LFMA 3N2OA 4QWNB 2CA5A 3I0QA 1NAFA 2DHRA 4P09A 1ZEEA 2PJQA 3RYIE 1OWAA 3RYHE 3AAEB 3RYCE 2D2SA 3IHRA 3K3NA 1D0ZA 1ZHCA 3ZLIA 2E9XB 4I55E 5BMVE 5F3JA 4O2BE 2XQYA 3L09A 3UUXB 5L3EB 3KV4A 4OK0A 2KT9A 4IGUA 2BDEA 2G0UA 2CLYB 1SHZC 3AAAB 3RRCA 2NW7A 3ZMTB 5KX5E 4WBNE 5LNKA 4KUMB 3RKOA 4ISSA 3E22E 2PBIA 1U4QA 3J7Yq 3HKDE 4CXWA 2XAQB 2N2NA 2VASA 3V5UA 3ZC1A 2DLRA 5HWXA 3BK9A 2LHNA 4PK6A 5A1LA 2DWGA 4O4JE 4CI3B 2X9WA 3UT5E 3H37A 3PTRB 5JDLA 5JH7E 1MIVA 5LBMA 2WWUA 4X1IE 2X9YA 2YEVC 5F8PA 2W0GA 1ZKEA 4H9RC 4ZS3A 5L3GB 4PAGA 3GMIA 1HFAA 4EXTA 1BR1A 4WBOA 3AB3B 4IE6A 5JREA 4KBMB 3O1HA 5LGTB 1FEWA 3CWZB 5FXVA 3RRWA 5M4YA 4PJLA 2H3RA 1LVKA 3E08A 3AA7B 2H7OA 1VRBA 2YINA 3BQIA 3EUHA 1WLXA 3I0OA 1HG2A 5CA0E 2Y48B 2VB6A 3PUSA 3KVAA 2GK9A 3IEEA 4H9QC 2ZM0A 5DJQC 3ZMUB 5DABA 4CXYA 1WYBA 4A56A 5EZYE 4XAXB 2LJLA 2VWAA 2JQQA 2IC9A 3ETUA 4N78D 4UEMA 2LOPA 2E9XA 2V7LA 3GWHA 2WBLA 3Q5XA 3OJAA 3PU3A 2LOSA 2W61A 4KMCA 4IDZA 4MBQA 4PJMA 3UUNA 5JDQA 4I50E 5LGNB 2NTXA 2LEHA 2UXNB 4QKNA 4AKHA 4ILUA 3OBVE 5LP6E 4MFRA 4EZHA 1VOMA 3ZJ1A 2OA5A 2LM9A 5JDMA 5LHHB 4AQGA 4O2AE 2VKHA 4BJMA 3PUGA 4K0UA 2X66A 3SWHA 3B13A 5H6QB 3LK3B 2XAHB 1UCUA 4TUYE 3KFWX 4L9IA 4UVCB 3KV5A 5HYAA 3OYXA 4JUYA 3PURA 3SOLA 5FY7A 5EK3A 3AVRA 3CX8B 2W00A 3NBXX 3LBXB 3N5LA 5JRCA 2JJ9A 3PU8A 2CWOA 5EK4A 3NRXA 5L3DB 3DP7A 3C4XA 2L8KA 3VKGA 1IAPA 4YJ3E 5FP3A 2MOZA 4G63A 5TAOA 2MYSA 4KP3C 1BR4A 3UTKA 4YJ2E 3KBTA 3K8PC 5JQGE 1S94A 2C5KT 2ODUA 3FHNA 5HXRA 4MHCA 3GA8A 4UIGA 2V26A 3C4WA 2D0TA 1LRZA 3DTOA 2CXLA 2WM9A 4J2CA 4QXBB 3SRZA 3LG7A 3GN5A 1IZNB 2DNXA 2C0SA 3PDYA 1WYCA 2XTLA 4H9NC 4YHJA 5JDFA 1YKEB 2W63A 4E7ZA 4H9PC 1HG5A 5FMNA 4EYUA 4X1YE 3RC8A 3LK42 3CQCB 4V1Av 5H6RB 2KWIB 2ES0A 2LSKA 1S35A 2EHOB 3A5XA 4P0BA 4QHOA 2WMNA 2XHEB 3O9XA 3RC3A 2RA1A 3ZYLA 5JR9C 4UELA 4AKRB 5LG4A 3ZN1B 3NZPA 4EIWA 4U72A 2VL8A 3HR0A 4GK0E 3WI3A 5DQWA 2XASB 3FXEB 4PNIA 4PJJA 5IYZE 4JEUB 3WAKA 4CXXA 3L3PA 3O4XE 2CEAA 1MMAA 3EDVA 2NTYA 4EYYR 3KBUA 2C5JA 4UXNB 4GK5E 5HAXA 3O1JA 2HPLA 3CKDA 3R84B 2QGSA 1MIYA 1X79A 4L5GA 5JVDE 1G73A 5FXXA 2MTQA 4B6XA 2WAUA 3CX7B 4EB6E 4CI2B 2JMKA 2Y8DA 2V7KA 5ETWA 2DCFA 5LCYA 3N2GE 5FY0A 2MBGA 4CZZB 4QX7B 4DO0A 4GYRA 4ZS2A 2JRKA 2SPCA 5LJNA 3NRYA 3F2EA 1YD8G 2PFVA 2K48A 3KDSE 1MMDA 3I9YA 4GIWA 2YK0A 4TV8E 3LK2B 4NUVA 4IE5A 1V9DA 3RYFE 1IJ6A 4MLKA 2XAFB 4ZI7E 1Y64B 2YU1A 3DJBA 1U5PA 3H3AA 4HEAA 4PK5A 4BAYB 4GYSA 2LSJA 4ASKA 4P0AA 5LHIB 1OXZA 3AA0B 3VU7H 1ZV4X 3R6NA 3PUAA 3HKEE 4ERRA 2LSGA 5EK2A 2KNDA 1MMGA 4QXHB 2LHRA 2A2FX 2Q9QA 5L3CB 3ETVA 3K3QC 3N9PA 2IW5B 2IAKA 2VKOA 4OYJA 2NWBA 4TV9E 3KV6A 2V7IA 1D1AA 4ZI3D 3VKHA 1FIOA 5CA1E 3JC6C 5KMGP 2XAJB 3MA9A 3Q9DA 1WR6A 3ZCJA 3EDUA 3MJXA 1MIWA 4O8SA 3JC6D 4IHJE 5LHGB 2ZLYA 3ANWB 3AA6B 1HF8A 4UVBB 1E1HB 3UUMA 3N2KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSI A;  2LSY A;  2N1G A;  4GK0 E;  4GK5 E;  4EXT A;  2LSK A;  2LSJ A;  4BA9 A;  3VU7 H;  2LSG A;  4FJO A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  5LG3 A;  1XZY A;  5AFU L;  3J9X 1;  4IDQ A;  3QK6 A;  4UV9 B;  2HPJ A;  2BVM A;  1T98 A;  4H63 H;  3VRB A;  4DV3 T;  1CUN A;  2KLQ A;  2LSI A;  4H9S E;  3AE7 A;  2E5V A;  2J1D G;  5AQU B;  2JPF A;  4JEH B;  4EAH A;  4ZZC A;  4L0R A;  4OX9 T;  4IE0 A;  2E8I A;  4COF A;  1YKH B;  4FJO A;  3TLT A;  3M65 A;  2JMH A;  3ZYM A;  4EEB A;  5AQV B;  5JDH A;  5L2L A;  2CXF A;  5HEJ A;  3VR8 A;  5JRC B;  4Q25 A;  5L47 A;  2CLY C;  3AXJ A;  5IWA T;  3ZMV B;  5HXE A;  5LXT E;  5HXC A;  2RP4 A;  4Z8X A;  3ANW A;  3CQX C;  1QSD A;  4PJN A;  4ZI2 D;  3I1A A;  4AKL A;  1OED E;  2FJE A;  2V7J A;  2XQ9 A;  1FJG T;  4IL9 A;  4DBQ A;  2E9X C;  3ZC0 A;  4CXX A;  2VQE T;  2LRL A;  3AEC A;  4YY3 T;  5JTG A;  3S4U A;  4JLE A;  5HCM A;  5LGU B;  4IDN A;  4IDP A;  3ZPO A;  2V6Y B;  1G8X A;  3TLW A;  5J1G A;  2JQH A;  2BS2 A;  3U78 A;  2PG8 A;  4QXC B;  4AQF C;  2Z6E A;  2I0M A;  2FJB A;  3JAE A;  3PJA A;  3ZT6 A;  3BQL A;  2P9B A;  5CB4 E;  4ZI2 C;  5J2U E;  4KHP T;  4AQY T;  1UK5 A;  5ABF B;  2XQ4 A;  1E7P A;  2KXP B;  3HI2 A;  4PK4 A;  4WNK A;  5JDM A;  4B3S T;  4FI5 A;  2B76 A;  1HCI A;  4HFH A;  4IIJ E;  3RIA A;  3OKQ A;  2UUA T;  1KNZ A;  1XMO T;  3W15 B;  1GQE A;  2X67 A;  4YTM A;  5FXZ A;  4QH5 A;  3AXJ B;  3PUY F;  2LM2 A;  3PUQ A;  1WRD A;  3ZT5 A;  5JDG A;  2Q9Q B;  1O3X A;  3AA1 B;  3FXD B;  3N9M A;  5LJM A;  1HTJ F;  3C51 A;  1LVF A;  4O4L E;  3N9O A;  4ZZB A;  1T72 A;  4B3T T;  2FBW A;  3TLV A;  4JV5 T;  4HWH A;  3RX6 A;  2CWY A;  2XQ6 A;  4NPP A;  4P1N A;  3TLS A;  3B57 A;  3VHL A;  4DND A;  2V6Y A;  2VKJ A;  2MPK A;  5AQG B;  2LE8 A;  3OPC A;  2X9X A;  3HKB E;  3AE8 A;  4WW0 A;  4IRE A;  1H7C A;  3N9Q A;  3AEG A;  5L3B B;  1FMV A;  3ZYK A;  1MMN A;  3RH3 A;  2LSY A;  2X0H A;  5HWY A;  3C4Z A;  2IUB A;  4YSX A;  1VCS A;  3IBP A;  1J1J A;  2ZM6 T;  3UQ7 A;  2XY8 B;  3LJC A;  3NZQ A;  5AQK B;  1US7 B;  3UU4 A;  4EZ4 A;  5F5W A;  1BR0 A;  1LKX A;  3AEB A;  4JI8 T;  3MXZ A;  4ZI3 C;  2NW9 A;  3SFD A;  2BBJ A;  3C64 A;  4X20 E;  3C98 B;  5FYM A;  5LOV E;  4EOZ B;  3A8Y C;  4HFC A;  4U74 A;  1EZ3 A;  3BQK A;  3F31 A;  3X1D A;  3AE1 A;  4HN9 A;  4DR7 T;  2XAG B;  1NEK A;  5J2T E;  3SS1 A;  3MAC A;  3ZMS B;  4C91 A;  4OFZ A;  3L39 A;  3IA3 A;  4DUZ T;  2UXB T;  3ESL A;  5C2T A;  4UF0 B;  5FY1 A;  3AAI A;  2XSA A;  3T8O A;  4ADZ A;  4DMW A;  2YOE A;  2LLY A;  2VKD A;  1AJ3 A;  1I6Z A;  2LRK A;  4OHF A;  2D0U A;  3Q5D A;  4PFP A;  4UF0 A;  5E0O A;  2V1D B;  4LFA T;  3K3O A;  4UV8 B;  3QUJ A;  5L4H A;  3Q2M A;  2YU2 A;  3N9N A;  2NP9 A;  1W09 A;  2NW8 A;  1W9R A;  4F6R C;  3CVR A;  3TLU A;  4QX8 B;  1NWM X;  2L3L A;  3FBL A;  1KK7 A;  3MK7 C;  2QA7 A;  2X0L B;  1XMQ T;  2E5L T;  1WCR A;  4OYK A;  3E0Z A;  4CN1 A;  5FVK A;  4DVD A;  1MND A;  2XQ5 A;  2YN6 A;  3OYZ A;  3HKC E;  2CCQ A;  2K5B B;  3AE3 A;  4PW8 A;  4H9O C;  3RGL A;  3AVS A;  5KXJ A;  2CRB A;  2HH7 A;  4PFO A;  1OED C;  2EHO C;  1D1B A;  1IBK T;  1Z0P A;  2DWK A;  1YW0 A;  1D1C A;  2BZB A;  3CX6 B;  1SA0 E;  2JIW A;  4E7S A;  4ZHQ E;  4BJN A;  3HL6 A;  3EVY A;  4DMV A;  4DV1 T;  2OV9 A;  2W62 A;  4MAL A;  2AXD S;  4JI2 T;  2VUR A;  3RF1 A;  2CBJ A;  1R8I A;  2YDR A;  3MKD A;  5FKY A;  1UGO A;  3FBZ A;  1QUU A;  2XZE A;  3MZK B;  2Q9Q D;  2AE9 A;  2XUE A;  3B5M A;  4DR3 T;  5KDM C;  4U3C A;  4HTE A;  3I9W A;  5FL1 A;  2IML A;  3LBX A;  4ZXL A;  2KZ7 B;  1YXR A;  2NOX A;  3CK6 A;  5LBQ B;  4LFC T;  3P8C D;  4UR9 A;  4AQF A;  1HNX T;  4HWI B;  2K9A A;  4CQI A;  4CI1 B;  5FNV E;  3RI5 A;  2V7M A;  3LSV A;  2CMR A;  4A5X A;  2ODV A;  3KV9 A;  4O4H E;  4I43 B;  2A72 A;  3RPU A;  4O4I E;  3UU5 A;  1JNZ A;  3ZMZ B;  4YT0 A;  3ZT7 A;  2X0Y A;  3IF8 B;  2N9D A;  1IJ5 A;  3QC9 A;  2X51 A;  4U31 A;  3ZCI A;  4HE8 A;  3JAF A;  3ZN0 B;  1M7K A;  2CBI A;  2XPK A;  3F57 A;  2R6G F;  3RKG A;  4X5T A;  3NVO A;  5CFB A;  5L3F B;  1B7T A;  5LYJ E;  2B1E A;  3CPZ A;  1D0X A;  3AEA A;  4JI0 T;  4HFV A;  5IHY A;  4YXD A;  2DI4 A;  4UVA B;  5GON E;  4B3M T;  2J47 A;  3QNU A;  3PE0 A;  2E9X D;  2UXX B;  3CQG B;  3GN5 B;  2Q9Q C;  3L8R A;  2XSB A;  1FMW A;  2X9H A;  4TN7 B;  4AIS A;  4AI6 A;  1NEN A;  3LDQ B;  2XQ3 A;  4NUU A;  3FB2 A;  3V5S A;  2CXD A;  3D0T A;  2I59 A;  2K24 A;  3ONX A;  3P4W A;  3PUW F;  2C5I T;  3CML A;  4HGA A;  4X1K E;  3KVB A;  5JDN A;  4LF4 T;  4C90 A;  2EHO D;  4F8H A;  5CJ5 A;  4XBF B;  3ZJ2 A;  2EHO A;  1BR2 A;  1WFD A;  2WP9 A;  3Q5W A;  2Y6X A;  4DBR A;  2VVS A;  1UX4 A;  5JR9 B;  4DV6 T;  4ZEY A;  4YSY A;  2IC6 A;  4YFS A;  5CGM A;  2WU5 A;  2KWH A;  3AE2 A;  4TZ4 C;  2KIN B;  3O1I A;  5DQV A;  3TKL B;  4IE4 A;  2YKS A;  3PV0 F;  2BKN A;  2LT3 A;  4LMJ A;  4TWD A;  4YLH A;  4H63 V;  4A97 A;  5HXH A;  1MNE A;  4I4T E;  2F4V T;  2UXD T;  3C50 A;  2M67 A;  4KHZ F;  4TX5 A;  2CM0 A;  4IST A;  5AQM B;  2D5U A;  4G2A A;  4M1P A;  3SFE A;  3U3I A;  4AXP A;  4ANJ A;  1UX5 A;  2H88 A;  2N1G A;  4LF7 T;  2ACX A;  5FXW A;  3UUL A;  2CE7 A;  5HXS A;  4B3R T;  4AKI A;  2ZMA A;  4BA9 A;  2ZM8 A;  2X68 A;  2WMO A;  1HX8 A;  2ZM2 A;  4JBW F;  5LA6 E;  1ZOY A;  5C3J A;  4NXN T;  4XZC A;  3UQ4 A;  4X66 T;  2BVL A;  3HA4 A;  3N9L A;  2WSS V;  4AKG A;  1HS7 A;  2H7V C;  2L9Q A;  2A3D A;  4GKJ T;  4JI4 T;  2VK9 A;  3N2K E;  5JR9 A;  4JI3 T;  2XQ7 A;  4U2Y A;  3UFG A;  3UFE A;  4JI5 T;  3UU3 A;  4IE7 A;  1YQ4 A;  3WAJ A;  3P7I A;  4GOU A;  3KIN B;  5C8Y E;  4ZOL E;  4KI0 F;  2KMF A;  4WZX A;  4HKA A;  2NR4 A;  5ADX L;  3LFM A;  4TNW A;  3N2O A;  4QWN B;  2CA5 A;  2UU9 T;  3I0Q A;  1NAF A;  2DHR A;  4P09 A;  1ZEE A;  2PJQ A;  3RYI E;  1OWA A;  3RYH E;  3AAE B;  1OED B;  3RYC E;  5LHH B;  2IHR 1;  2D2S A;  5JRC A;  3IHR A;  3K3N A;  1D0Z A;  4U33 A;  1ZHC A;  1M62 A;  3ZLI A;  2E9X B;  2XQ8 A;  4I55 E;  5BMV E;  5F3J A;  4O2B E;  5HEG A;  1JNR A;  3RQU A;  3P4R A;  4ILA A;  2XQY A;  3L09 A;  3UUX B;  5L3E B;  3KV4 A;  4OK0 A;  1XNR T;  2KT9 A;  4IGU A;  2HHH T;  2BDE A;  2V8S V;  2BKP A;  2G0U A;  2J62 A;  4ILC A;  2CLY B;  4HWD A;  1SHZ C;  3AAA B;  3RRC A;  2NW7 A;  3ZMT B;  5J0Z A;  5KX5 E;  4WBN E;  2K3W A;  5LNK A;  4KUM B;  2WS3 A;  1KEY A;  5ABH A;  2D9D A;  3RKO A;  1HNW T;  3EHZ A;  3E22 E;  2PBI A;  1U4Q A;  4ISS A;  3J7Y q;  4X64 T;  1IBM T;  3ZEF B;  1N36 T;  3HKD E;  2ACZ A;  4CXW A;  2XAQ B;  2N2N A;  2VAS A;  5AQP B;  3V5U A;  3ZC1 A;  2DLR A;  5AQR B;  2DL1 A;  3BK9 A;  5HWX A;  1XWM A;  4U7Y A;  2LHN A;  4PK6 A;  5A1L A;  3RHW A;  3ZKR A;  1J5E T;  2DWG A;  3Q5E A;  4O4J E;  5HEO A;  2J4G A;  2X9W A;  3UT5 E;  4CI3 B;  1N32 T;  2LKH A;  3H37 A;  3PTR B;  5JDL A;  5JH7 E;  4LF9 T;  1MIV A;  5AQJ B;  3ZST A;  5LBM A;  2WWU A;  5LMN T;  2HN2 A;  4X1I E;  2X9Y A;  2YEV C;  4CN6 A;  5F8P A;  4DID B;  4LF6 T;  2W0G A;  4HWF A;  1ZKE A;  4H9R C;  4ZS3 A;  5L3G B;  3FZK B;  4PAG A;  3GMI A;  1HFA A;  4JI7 T;  4EXT A;  1BR1 A;  3G06 A;  5AQF B;  4WBO A;  1Z8U A;  3AB3 B;  4IE6 A;  2BG9 C;  4KX6 A;  5JRE A;  2BS4 A;  4KBM B;  3O1H A;  2M6I A;  5LGT B;  4YTN A;  2WDR A;  1FEW A;  3CWZ B;  5FXV A;  3RRW A;  5M4Y A;  1W0A A;  4PJL A;  2H3R A;  4EGW A;  1LVK A;  2XM2 A;  3E08 A;  2VL0 A;  3AA7 B;  3PJA J;  1X9B A;  2H7O A;  4HFE A;  1VRB A;  2JQK A;  2YIN A;  3EI0 A;  3BQI A;  3EUH A;  1WLX A;  3I0O A;  1HG2 A;  3K1S A;  3PUV F;  2JQ9 A;  4YTP A;  2Y48 B;  5CA0 E;  5BR8 T;  4DR4 T;  2QRX A;  5LB7 B;  4HWC A;  2VB6 A;  2XQA A;  3PUS A;  2M6B A;  3EAB A;  2GK9 A;  3IEE A;  3KVA A;  4H9Q C;  1I94 T;  4DR6 T;  2ZM0 A;  5DJQ C;  1UUR A;  3P4Q A;  5DAB A;  3ZMU B;  1WYB A;  4A56 A;  2BG9 E;  4CXY A;  5EZY E;  5ABG A;  3ZSS A;  4XAX B;  1N34 T;  1UUS A;  2LJL A;  3H3M A;  4LFB T;  2VWA A;  2JQQ A;  2IC9 A;  3ETU A;  4N78 D;  4UEM A;  2LOP A;  2RPA A;  3QOF A;  2E9X A;  2V7L A;  3GWH A;  2WBL A;  3T1Y T;  3Q5X A;  3OJA A;  1KNP A;  2LOS A;  1WR0 A;  2W61 A;  3PU3 A;  4ILB A;  4JI6 T;  4KMC A;  4IDZ A;  5HCJ A;  1L0V A;  1XDO A;  3AE9 A;  4MBQ A;  4PJM A;  3UUN A;  5JDQ A;  4I50 E;  5LGN B;  2NTX A;  2LEH A;  2IIU A;  2UXN B;  4QKN A;  4DV4 T;  4QH4 A;  4AKH A;  4ILU A;  3OBV E;  5LP6 E;  4MFR A;  4EZH A;  1VOM A;  4DR2 T;  1OED A;  2OA5 A;  3ZJ1 A;  2LM9 A;  2FJA A;  2KSR A;  3NWI A;  4AQG A;  3P50 A;  2VKH A;  4O2A E;  3VRA A;  4BJM A;  3PUG A;  3ONJ A;  4K0U A;  2X66 A;  3SWH A;  1KFY A;  3B13 A;  5H6Q B;  2V5D A;  3LK3 B;  2XAH B;  1UCU A;  4TUY E;  3KFW X;  4L9I A;  4UVC B;  3JCF A;  2XM1 A;  3KV5 A;  3NKZ A;  3OYX A;  5JDF A;  3P4P A;  4JUY A;  3PUR A;  3RIU A;  3SOL A;  5HYA A;  2VQF T;  4DV2 T;  2BS3 A;  5AQQ B;  5FY7 A;  2MAW A;  3AE6 A;  3QB5 A;  5EK3 A;  3AVR A;  3CX8 B;  4LMK A;  2W00 A;  3NBX X;  4X65 T;  1SE7 A;  3LBX B;  4HFD A;  2W4X A;  3N5L A;  5FVL A;  2JJ9 A;  4YHH T;  3PU8 A;  2CWO A;  5EK4 A;  2IDO B;  3NRX A;  5L3D B;  3DP7 A;  3FZM B;  5LMU T;  3C4X A;  2L8K A;  2WY2 A;  3VKG A;  1IAP A;  2YDS A;  4YJ3 E;  5FP3 A;  1VCT A;  2MOZ A;  4G63 A;  5TAO A;  4HFB A;  2MYS A;  4KP3 C;  3ONL C;  1BR4 A;  3UTK A;  2QYW A;  2YDQ A;  4YJ2 E;  2A9U A;  4X62 T;  3KBT A;  2UUC T;  3K8P C;  3RLF F;  4LF8 T;  5JQG E;  1S94 A;  2C5K T;  1CHU A;  2WQY A;  2ODU A;  1T8B A;  4LF5 T;  3FHN A;  3FZH B;  5HXR A;  4MHC A;  4TWF A;  3GA8 A;  3T1H T;  4UIG A;  2V26 A;  2E2A A;  1SUM B;  3C4W A;  4GKK T;  4AIU A;  2D0T A;  1LRZ A;  5AQI B;  3DTO A;  2CXL A;  2OLT A;  2WM9 A;  4J2C A;  4QXB B;  3SRZ A;  3LG7 A;  3GN5 A;  1IZN B;  2DNX A;  2C0S A;  2FUP A;  2W66 A;  3PDY A;  1DU2 A;  1WYC A;  2XTL A;  3QB5 K;  4H9N C;  4YHJ A;  1KNR A;  1YKE B;  2W63 A;  3PUZ F;  4H9P C;  1HG5 A;  2H89 A;  5FMN A;  4EYU A;  4X1Y E;  3RC8 A;  3LK4 2;  2UUB T;  3A7M A;  4E7Z A;  4DV0 T;  3CQC B;  4V1A v;  5H6R B;  4NXM T;  2KWI B;  1XDP A;  2ES0 A;  2LSK A;  5AQN B;  1S35 A;  3JAD A;  2EHO B;  3A5X A;  4JI1 T;  4P0B A;  4QHO A;  2WDV A;  2WMN A;  2XHE B;  3O9X A;  3RC3 A;  2BG9 A;  2RA1 A;  3ZYL A;  5JR9 C;  4UEL A;  4AKR B;  5LG4 A;  2FJD A;  4TNV A;  3ZN1 B;  4CN4 A;  3AED A;  3NZP A;  3FZF B;  4EIW A;  4DV7 T;  4U72 A;  2VL8 A;  3EAM A;  3HR0 A;  4GK0 E;  5ABE A;  4WYV A;  3WI3 A;  2LKG A;  2HN1 A;  5DQW A;  5AQT B;  2XAS B;  3FXE B;  4PNI A;  4PJJ A;  5IYZ E;  4JEU B;  1YQ3 A;  3WAK A;  3L3P A;  3O4X E;  2CEA A;  1MMA A;  3EDV A;  4QH1 A;  2NTY A;  5AQH B;  2WZI A;  3KBU A;  2C5J A;  4IL4 A;  4UXN B;  4EYY R;  4GK5 E;  5HAX A;  3O1J A;  3UU6 A;  2HPL A;  4Z91 A;  3CKD A;  3R84 B;  2QGS A;  1MIY A;  1X79 A;  3AEE A;  1HR0 T;  4L5G A;  5JVD E;  3VR9 A;  1G73 A;  5FXX A;  2MTQ A;  4B6X A;  2WAU A;  3OTO T;  1HNZ T;  3CX7 B;  4EB6 E;  3FZL B;  3AE5 A;  4CI2 B;  2JMK A;  2Y8D A;  2V7K A;  5ETW A;  2DCF A;  5LCY A;  3N2G E;  5FY0 A;  2MBG A;  4CZZ B;  4LML A;  4QX7 B;  4DO0 A;  4NIQ A;  4HFI A;  4GYR A;  5AQO B;  4EV6 A;  4ZS2 A;  2JRK A;  2SPC A;  3UU8 A;  5LJN A;  3NRY A;  2WB5 A;  5HEU A;  3F2E A;  4YSZ A;  1YD8 G;  2PFV A;  4K0K T;  4IT4 A;  2K48 A;  3KDS E;  1MMD A;  1HX1 B;  3I9Y A;  4GIW A;  2YK0 A;  5AQS B;  4TV8 E;  3RQW A;  4DV5 T;  3PUX F;  4DR1 T;  1KF6 A;  2CPT A;  3LK2 B;  4NUV A;  4IE5 A;  1V9D A;  3RYF E;  1IJ6 A;  4MLK A;  2XAF B;  4U7I A;  4ZI7 E;  1Y64 B;  2YU1 A;  3DJB A;  1U5P A;  2BKO A;  3H3A A;  4HEA A;  4PK5 A;  4BAY B;  1T7S A;  2UXC T;  4GYS A;  5HEH A;  2LSJ A;  4ASK A;  3CIR A;  4P0A A;  2WU2 A;  5LHI B;  1OXZ A;  1W0B A;  3AA0 B;  3P4S A;  2WZH A;  3VU7 H;  5ABF A;  1ZV4 X;  3R6N A;  3PUA A;  3OVU A;  3M3Z B;  2CHN A;  3HKE E;  4ERR A;  4TWH A;  2LSG A;  5EK2 A;  2BBH A;  2KND A;  1MMG A;  1QLB A;  4QXH B;  2Q9Q A;  2LHR A;  2A2F X;  4U2Z A;  5L3C B;  3ETV A;  3K3Q C;  2XJ7 A;  3N9P A;  1ZP0 A;  3UUB A;  1Y01 A;  2WDQ A;  5IUX A;  3AEF A;  2IW5 B;  2IAK A;  3AE4 A;  2VKO A;  4JYA T;  4OYJ A;  2NWB A;  4TV9 E;  1IBL T;  2I6H A;  4I0U A;  3KV6 A;  2V7I A;  1N33 T;  3ABV A;  1D1A A;  4Z90 A;  4ZI3 D;  2PTF A;  3VKH A;  2BG9 B;  2W67 A;  5FL0 A;  4EED A;  1FIO A;  5CA1 E;  3JC6 C;  4IDO A;  3RIF A;  5KMG P;  2QVA A;  2V5C A;  2W2U A;  2VVN A;  1J5W A;  2XAJ B;  1WR6 A;  3MA9 A;  3Q9D A;  5AQL B;  1XNQ T;  3ZCJ A;  3EDU A;  3MJX A;  1MIW A;  4O8S A;  3JC6 D;  4IHJ E;  5LHG B;  2WWV A;  1E2A A;  2ZLY A;  3ANW B;  5L4E A;  2CHO A;  3AA6 B;  1HF8 A;  4UVB B;  4A98 A;  3RIU C;  1E1H B;  3UUM A;  2WCA A;  2V6X A;  4DUY T;  4DR5 T; 
#chains in the Genus database with same CATH homology
 1D0Y A;  5AFU L;  3J9X 1;  4UV9 B;  3QK6 A;  2HPJ A;  2BVM A;  1T98 A;  4H63 H;  1CUN A;  2KLQ A;  2LSI A;  4H9S E;  2J1D G;  2JPF A;  4JEH B;  4EAH A;  4L0R A;  4IE0 A;  2E8I A;  1YKH B;  4FJO A;  3M65 A;  2JMH A;  3ZYM A;  5JDH A;  5L2L A;  2CXF A;  5JRC B;  2CLY C;  3ZMV B;  5HXE A;  5LXT E;  5HXC A;  2RP4 A;  4Z8X A;  3ANW A;  3CQX C;  1QSD A;  4PJN A;  4ZI2 D;  3I1A A;  4AKL A;  2V7J A;  4DBQ A;  2E9X C;  3ZC0 A;  3S4U A;  4JLE A;  5LGU B;  3ZPO A;  1G8X A;  5J1G A;  3U78 A;  2PG8 A;  4QXC B;  4AQF C;  2Z6E A;  4ZI2 C;  3BQL A;  2P9B A;  5CB4 E;  5J2U E;  2KXP B;  3HI2 A;  4PK4 A;  4WNK A;  4FI5 A;  4IIJ E;  1HCI A;  1KNZ A;  3OKQ A;  3W15 B;  2X67 A;  5FXZ A;  3PUQ A;  1WRD A;  5JDG A;  2Q9Q B;  1O3X A;  3AA1 B;  3FXD B;  3N9M A;  5LJM A;  1HTJ F;  3C51 A;  1LVF A;  4O4L E;  3N9O A;  3RX6 A;  3VHL A;  2CWY A;  4DND A;  3B57 A;  2VKJ A;  2LE8 A;  2X9X A;  3HKB E;  4WW0 A;  1H7C A;  3N9Q A;  5L3B B;  1FMV A;  3ZYK A;  1MMN A;  3RH3 A;  2LSY A;  5HWY A;  3C4Z A;  3IBP A;  3LJC A;  3NZQ A;  4EZ4 A;  1US7 B;  1BR0 A;  1LKX A;  3MXZ A;  4ZI3 C;  2NW9 A;  3C64 A;  4X20 E;  3C98 B;  5FYM A;  5LOV E;  4EOZ B;  3ZEF B;  4U74 A;  1EZ3 A;  3BQK A;  3F31 A;  4HN9 A;  2XAG B;  5J2T E;  3SS1 A;  3MAC A;  3ZMS B;  4C91 A;  4OFZ A;  3ESL A;  4UF0 B;  5FY1 A;  3AAI A;  3T8O A;  4ADZ A;  4DMW A;  2VKD A;  1AJ3 A;  4OHF A;  2D0U A;  4PFP A;  4UF0 A;  5E0O A;  2V1D B;  3K3O A;  4UV8 B;  3QUJ A;  3Q2M A;  2YU2 A;  3N9N A;  2NP9 A;  2NW8 A;  4F6R C;  3CVR A;  4QX8 B;  1NWM X;  2L3L A;  3FBL A;  1KK7 A;  3MK7 C;  2QA7 A;  2X0L B;  4OYK A;  3E0Z A;  4DVD A;  1MND A;  3OYZ A;  3HKC E;  2CCQ A;  2K5B B;  4PW8 A;  4H9O C;  3AVS A;  2HH7 A;  4PFO A;  2EHO C;  1D1B A;  1Z0P A;  2DWK A;  1YW0 A;  1D1C A;  2BZB A;  3CX6 B;  1SA0 E;  4ZHQ E;  4E7S A;  4BJN A;  3HL6 A;  3EVY A;  4DMV A;  2W62 A;  4MAL A;  3MKD A;  3FBZ A;  1QUU A;  3MZK B;  2Q9Q D;  2XUE A;  5KDM C;  4HTE A;  3I9W A;  3LBX A;  2KZ7 B;  2NOX A;  5LBQ B;  3P8C D;  4AQF A;  4CQI A;  2K9A A;  4CI1 B;  5FNV E;  2V7M A;  2CMR A;  2ODV A;  3KV9 A;  4O4H E;  4I43 B;  2A72 A;  3RPU A;  4O4I E;  3ZMZ B;  3IF8 B;  2N9D A;  1IJ5 A;  3QC9 A;  2X51 A;  3ZCI A;  4HE8 A;  3ZN0 B;  3F57 A;  5L3F B;  1B7T A;  5LYJ E;  2B1E A;  3CPZ A;  1D0X A;  4HFV A;  5IHY A;  2DI4 A;  4UVA B;  5GON E;  3PE0 A;  2E9X D;  2UXX B;  3GN5 B;  3CQG B;  2Q9Q C;  1FMW A;  2X9H A;  4TN7 B;  4AI6 A;  4NUU A;  3FB2 A;  3V5S A;  3D0T A;  2CXD A;  2I59 A;  2K24 A;  3ONX A;  4X1K E;  4HGA A;  2C5I T;  3CML A;  5JDN A;  3KVB A;  4C90 A;  2EHO D;  4XBF B;  3ZJ2 A;  2EHO A;  1BR2 A;  3Q5W A;  2Y6X A;  4DBR A;  1UX4 A;  5JR9 B;  2IC6 A;  4YFS A;  2KWH A;  3TKL B;  4TZ4 C;  2KIN B;  3O1I A;  5DQV A;  4IE4 A;  2LT3 A;  5HXH A;  4YLH A;  4H63 V;  1MNE A;  4I4T E;  3C50 A;  2M67 A;  4TX5 A;  2CM0 A;  4IST A;  4ANJ A;  2D5U A;  4G2A A;  4M1P A;  3U3I A;  4AXP A;  1UX5 A;  2N1G A;  4AKI A;  2ACX A;  5FXW A;  3UUL A;  2CE7 A;  5HXS A;  2ZMA A;  4BA9 A;  2ZM8 A;  2X68 A;  2WMO A;  1HX8 A;  2ZM2 A;  5LA6 E;  4XZC A;  2BVL A;  3HA4 A;  3N9L A;  2WSS V;  4AKG A;  1HS7 A;  2H7V C;  2L9Q A;  2A3D A;  2VK9 A;  5JR9 A;  3UFE A;  4IE7 A;  3WAJ A;  3P7I A;  4GOU A;  3KIN B;  5C8Y E;  4ZOL E;  2KMF A;  4HKA A;  5ADX L;  3LFM A;  3N2O A;  4QWN B;  2CA5 A;  3I0Q A;  1NAF A;  2DHR A;  4P09 A;  1ZEE A;  2PJQ A;  3RYI E;  1OWA A;  3RYH E;  3AAE B;  3RYC E;  2D2S A;  3IHR A;  3K3N A;  1D0Z A;  1ZHC A;  3ZLI A;  2E9X B;  4I55 E;  5BMV E;  5F3J A;  4O2B E;  2XQY A;  3L09 A;  3UUX B;  5L3E B;  3KV4 A;  4OK0 A;  2KT9 A;  4IGU A;  2BDE A;  2G0U A;  2CLY B;  1SHZ C;  3AAA B;  3RRC A;  2NW7 A;  3ZMT B;  5KX5 E;  4WBN E;  5LNK A;  4KUM B;  3RKO A;  4ISS A;  3E22 E;  2PBI A;  1U4Q A;  3J7Y q;  3HKD E;  4CXW A;  2XAQ B;  2N2N A;  2VAS A;  3V5U A;  3ZC1 A;  2DLR A;  5HWX A;  3BK9 A;  2LHN A;  4PK6 A;  5A1L A;  2DWG A;  4O4J E;  4CI3 B;  2X9W A;  3UT5 E;  3H37 A;  3PTR B;  5JDL A;  5JH7 E;  1MIV A;  5LBM A;  2WWU A;  4X1I E;  2X9Y A;  2YEV C;  5F8P A;  2W0G A;  1ZKE A;  4H9R C;  4ZS3 A;  5L3G B;  4PAG A;  3GMI A;  1HFA A;  4EXT A;  1BR1 A;  4WBO A;  3AB3 B;  4IE6 A;  5JRE A;  4KBM B;  3O1H A;  5LGT B;  1FEW A;  3CWZ B;  5FXV A;  3RRW A;  5M4Y A;  4PJL A;  2H3R A;  1LVK A;  3E08 A;  3AA7 B;  2H7O A;  1VRB A;  2YIN A;  3BQI A;  3EUH A;  1WLX A;  3I0O A;  1HG2 A;  5CA0 E;  2Y48 B;  2VB6 A;  3PUS A;  3KVA A;  2GK9 A;  3IEE A;  4H9Q C;  2ZM0 A;  5DJQ C;  3ZMU B;  5DAB A;  4CXY A;  1WYB A;  4A56 A;  5EZY E;  4XAX B;  2LJL A;  2VWA A;  2JQQ A;  2IC9 A;  3ETU A;  4N78 D;  4UEM A;  2LOP A;  2E9X A;  2V7L A;  3GWH A;  2WBL A;  3Q5X A;  3OJA A;  3PU3 A;  2LOS A;  2W61 A;  4KMC A;  4IDZ A;  4MBQ A;  4PJM A;  3UUN A;  5JDQ A;  4I50 E;  5LGN B;  2NTX A;  2LEH A;  2UXN B;  4QKN A;  4AKH A;  4ILU A;  3OBV E;  5LP6 E;  4MFR A;  4EZH A;  1VOM A;  3ZJ1 A;  2OA5 A;  2LM9 A;  5JDM A;  5LHH B;  4AQG A;  4O2A E;  2VKH A;  4BJM A;  3PUG A;  4K0U A;  2X66 A;  3SWH A;  3B13 A;  5H6Q B;  3LK3 B;  2XAH B;  1UCU A;  4TUY E;  3KFW X;  4L9I A;  4UVC B;  3KV5 A;  5HYA A;  3OYX A;  4JUY A;  3PUR A;  3SOL A;  5FY7 A;  5EK3 A;  3AVR A;  3CX8 B;  2W00 A;  3NBX X;  3LBX B;  3N5L A;  5JRC A;  2JJ9 A;  3PU8 A;  2CWO A;  5EK4 A;  3NRX A;  5L3D B;  3DP7 A;  3C4X A;  2L8K A;  3VKG A;  1IAP A;  4YJ3 E;  5FP3 A;  2MOZ A;  4G63 A;  5TAO A;  2MYS A;  4KP3 C;  1BR4 A;  3UTK A;  4YJ2 E;  3KBT A;  3K8P C;  5JQG E;  1S94 A;  2C5K T;  2ODU A;  3FHN A;  5HXR A;  4MHC A;  3GA8 A;  4UIG A;  2V26 A;  3C4W A;  2D0T A;  1LRZ A;  3DTO A;  2CXL A;  2WM9 A;  4J2C A;  4QXB B;  3SRZ A;  3LG7 A;  3GN5 A;  1IZN B;  2DNX A;  2C0S A;  3PDY A;  1WYC A;  2XTL A;  4H9N C;  4YHJ A;  5JDF A;  1YKE B;  2W63 A;  4E7Z A;  4H9P C;  1HG5 A;  5FMN A;  4EYU A;  4X1Y E;  3RC8 A;  3LK4 2;  3CQC B;  4V1A v;  5H6R B;  2KWI B;  2ES0 A;  2LSK A;  1S35 A;  2EHO B;  3A5X A;  4P0B A;  4QHO A;  2WMN A;  2XHE B;  3O9X A;  3RC3 A;  2RA1 A;  3ZYL A;  5JR9 C;  4UEL A;  4AKR B;  5LG4 A;  3ZN1 B;  3NZP A;  4EIW A;  4U72 A;  2VL8 A;  3HR0 A;  4GK0 E;  3WI3 A;  5DQW A;  2XAS B;  3FXE B;  4PNI A;  4PJJ A;  5IYZ E;  4JEU B;  3WAK A;  4CXX A;  3L3P A;  3O4X E;  2CEA A;  1MMA A;  3EDV A;  2NTY A;  4EYY R;  3KBU A;  2C5J A;  4UXN B;  4GK5 E;  5HAX A;  3O1J A;  2HPL A;  3CKD A;  3R84 B;  2QGS A;  1MIY A;  1X79 A;  4L5G A;  5JVD E;  1G73 A;  5FXX A;  2MTQ A;  4B6X A;  2WAU A;  3CX7 B;  4EB6 E;  4CI2 B;  2JMK A;  2Y8D A;  2V7K A;  5ETW A;  2DCF A;  5LCY A;  3N2G E;  5FY0 A;  2MBG A;  4CZZ B;  4QX7 B;  4DO0 A;  4GYR A;  4ZS2 A;  2JRK A;  2SPC A;  5LJN A;  3NRY A;  3F2E A;  1YD8 G;  2PFV A;  2K48 A;  3KDS E;  1MMD A;  3I9Y A;  4GIW A;  2YK0 A;  4TV8 E;  3LK2 B;  4NUV A;  4IE5 A;  1V9D A;  3RYF E;  1IJ6 A;  4MLK A;  2XAF B;  4ZI7 E;  1Y64 B;  2YU1 A;  3DJB A;  1U5P A;  3H3A A;  4HEA A;  4PK5 A;  4BAY B;  4GYS A;  2LSJ A;  4ASK A;  4P0A A;  5LHI B;  1OXZ A;  3AA0 B;  3VU7 H;  1ZV4 X;  3R6N A;  3PUA A;  3HKE E;  4ERR A;  2LSG A;  5EK2 A;  2KND A;  1MMG A;  4QXH B;  2LHR A;  2A2F X;  2Q9Q A;  5L3C B;  3ETV A;  3K3Q C;  3N9P A;  2IW5 B;  2IAK A;  2VKO A;  4OYJ A;  2NWB A;  4TV9 E;  3KV6 A;  2V7I A;  1D1A A;  4ZI3 D;  3VKH A;  1FIO A;  5CA1 E;  3JC6 C;  5KMG P;  2XAJ B;  3MA9 A;  3Q9D A;  1WR6 A;  3ZCJ A;  3EDU A;  3MJX A;  1MIW A;  4O8S A;  3JC6 D;  4IHJ E;  5LHG B;  2ZLY A;  3ANW B;  3AA6 B;  1HF8 A;  4UVB B;  1E1H B;  3UUM A;  3N2K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...