2LSKA

C-terminal domain of human rev1 in complex with dna-polymerase h (eta)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
95
Chain Sequence
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/protein binding
total genus 30
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lskA00
2N1GA 2LSKA 4FJOA 2LSIA 4GK0E 2LSYA 3VU7H 4BA9A 4EXTA 2LSJA 2LSGA 4GK5E
chains in the Genus database with same CATH superfamily
4U7YA 3LBXA 4IREA 4KUMB 4U2ZA 2WBLA 2CPTA 4KBMB 2CWYA 5LHIB 3O1JA 2PG8A 2WDRA 3RRCA 2P9BA 2VL0A 1XNQT 4X62T 3RC8A 4YLHA 5EK4A 3G06A 2EHOA 3OYXA 2OA5A 4KX6A 2QVAA 1UURA 1X79A 3AE5A 3UUBA 2V1DB 3HL6A 2H89A 4TNWA 3J9X1 4EZHA 2V6YA 3U78A 5HXHA 4U72A 3I1AA 2H3RA 1J5WA 1E1HB 2V8SV 5BMVE 2FJBA 2UXBT 3KV5A 3E22E 4B3TT 3A5XA 3AVRA 2DWKA 1FIOA 1QUUA 2VQFT 2UUCT 1ZHCA 5JTGA 5LNKA 4H9RC 4IIJE 2W4XA 2R6GF 1OEDC 2NTYA 2UXCT 3FB2A 2HN1A 3EABA 4A97A 2E2AA 1OEDB 4DR7T 3FZMB 2ZM0A 5H6QB 2J1DG 2DCFA 3AXJA 4DV4T 5J0ZA 2CWOA 5L4HA 3V5UA 4HEAA 1CHUA 3AE7A 2ACZA 3A7MA 1MMDA 2H88A 3ZMTB 3N9OA 4MLKA 5AQUB 3HKBE 3AA7B 4DR2T 4A98A 2W2UA 2Q9QA 1W0AA 2L8KA 3AAIA 3UU4A 5JREA 2CHOA 4UV8B 4I50E 1YQ4A 2XQ8A 4U2YA 3TKLB 3AA6B 4LMLA 2YK0A 2WAUA 3RIUC 2KZ7B 4ZZCA 4HWFA 4EEBA 3I9WA 3MK7C 4YJ3E 3UU5A 5EK3A 3SRZA 5L3EB 4I43B 2D0TA 3NWIA 4H63H 4QH4A 4O8SA 4X64T 4O4JE 3FZKB 3SFDA 3Q5WA 2YKSA 2D2SA 2X66A 1FMWA 3PTRB 1D0XA 4NUVA 1WYBA 4FI5A 3SWHA 2IIUA 5LMUT 2J47A 1XWMA 4I55E 4X65T 2ODVA 4IL4A 4ILCA 3ZCIA 4QXHB 5JDGA 2KT9A 2VKOA 2N2NA 2KWIB 3NRXA 2YDRA 1FMVA 3FHNA 3RIAA 2PTFA 4P09A 2XSAA 4QXBB 2IC9A 3B57A 5LG4A 3RKOA 2XASB 4JI2T 3N2KE 2E9XB 2V7KA 4HFHA 4K0UA 4GK0E 3PUYF 4U33A 2XPKA 4Z8XA 3ETUA 3ZSSA 3HR0A 4TWDA 3EUHA 1E7PA 2XQ9A 2Y8DA 2XSBA 4BAYB 4HWCA 4ZZBA 4AI6A 2PJQA 1N36T 3ONLC 3AECA 2MPKA 4BJNA 2W0GA 4P0AA 5JQGE 3RPUA 3O9XA 4KHPT 1IAPA 5JR9C 3OVUA 4XAXB 5HEJA 1HG2A 5KXJA 4JI6T 4AKIA 5L4EA 5JR9B 3NBXX 4IE6A 4O4IE 1X9BA 4PW8A 4ZXLA 3QC9A 1Y01A 5LHHB 3HKDE 5TAOA 3QUJA 4IDQA 1MMAA 1HNWT 4TWHA 4ILBA 3P8CD 3ZCJA 4EB6E 4DV3T 3IHRA 1BR4A 3C4XA 4PK6A 3J7Yq 2DL1A 4AISA 4H9PC 2CE7A 4AIUA 3CK6A 4GKJT 2W63A 3N9LA 3N9NA 3FZLB 2CXFA 5HEGA 1BR2A 4A5XA 3PUQA 4JI1T 3E08A 5AQOB 4ILAA 4HE8A 2YINA 1SHZC 4PNIA 2JIWA 1L0VA 2WZHA 1DU2A 3KINB 3PU3A 3AEAA 3VR9A 2X67A 4E7ZA 4LF8T 3TLTA 4F8HA 2KXPB 4YTNA 4A56A 3NVOA 2VWAA 3TLVA 1LKXA 4TZ4C 2N1GA 2XY8B 2IAKA 4GYRA 1S94A 5AQGB 1HTJF 4BJMA 3JADA 2KSRA 5CJ5A 3LJCA 3F31A 5L3DB 5AQQB 1MNDA 4ZS2A 2VK9A 5FY1A 4UF0B 2ZMAA 2B76A 2LM2A 2ZM2A 5AQPB 1OXZA 2LSGA 4U31A 3FXDB 2A72A 1CUNA 3AXJB 3IA3A 2K9AA 3MA9A 2ES0A 3OJAA 5GONE 3TLWA 5ABGA 5LOVE 2RPAA 4PJJA 4JEUB 3PUAA 3FBZA 4DR4T 2XQ5A 2H7OA 3ESLA 2FJDA 4CN4A 4C91A 3IF8B 2CXLA 4F6RC 4JI0T 2D0UA 2H7VC 4ISTA 3CQXC 1US7B 2JQHA 1UGOA 2M6IA 2IUBA 2CBJA 2HPJA 3L09A 2DHRA 4YSXA 5LXTE 4YTPA 1JNRA 4CXXA 1Y64B 2N9DA 1I6ZA 1NWMX 3QK6A 4HFVA 1D0ZA 4ASKA 4O2AE 1D1AA 2LRLA 3RKGA 4MALA 4DBQA 2XHEB 4OFZA 3AEEA 4E7SA 4IDNA 2NOXA 3Q5XA 5HXEA 2XAHB 3ONJA 4AQFA 2KMFA 2JMHA 3P4WA 5FXXA 5L3FB 3L39A 4DMWA 5AFUL 4XZCA 3AEFA 3C64A 4ILUA 3RI5A 4LF7T 4PJLA 2I6HA 2CLYC 3FXEB 4YXDA 2XAJB 5FMNA 1V9DA 4TWFA 3K3QC 5A1LA 3Q2MA 4ZI2D 1AJ3A 3CX8B 2FBWA 3ZYKA 3KBTA 2XAFB 1HG5A 4UIGA 5JDHA 5HWYA 4MFRA 3RYHE 3UULA 2HN2A 4HFEA 4NXMT 2I0MA 5ABFA 5AQVB 2W62A 4B3RT 4KP3C 5FXWA 1KNRA 5HWXA 4HFIA 3AE1A 2LHNA 2XQ7A 5JDLA 1HX8A 2AXDS 4DR6T 2V6XA 3Q9DA 3LK42 2WWVA 4MBQA 1MMGA 5JDNA 5KDMC 1M62A 4QWNB 1YXRA 4QHOA 4YY3T 4YFSA 2C0SA 4X66T 5AQFB 3ZYMA 3H3AA 1E2AA 3VRBA 5LCYA 1NEKA 1QLBA 4CN6A 4YSZA 3MJXA 3UTKA 4QX7B 3ZYLA 1W09A 4ZHQE 4I4TE 1J5ET 2FJEA 4B6XA 1HNZT 3RH3A 2YDSA 3KFWX 2X68A 5LB7B 3CKDA 4TNVA 2NWBA 3ZJ2A 1HR0T 3QNUA 2E9XD 3ZMVB 3K3NA 2IMLA 4DV0T 2QRXA 4KHZF 5HEHA 2UUAT 2NTXA 3CWZB 2DNXA 2SPCA 2BZBA 3WI3A 4CI2B 4CI3B 5KMGP 2PFVA 4ZI2C 2UXDT 2UXXB 3PUGA 3JAEA 3ZC1A 5LGTB 2BG9A 2XQ6A 2BBJA 2LSJA 4HWIB 5LGNB 4DR3T 1YD8G 2LRKA 2XQAA 1UCUA 5FVKA 2QA7A 4M1PA 3LFMA 3FZFB 2LKHA 4ZOLE 1XZYA 2DI4A 3MKDA 3PE0A 3W15B 5AQTB 2MAWA 3CX7B 2LLYA 4UEMA 4DMVA 2CEAA 4DV6T 4U7IA 3O1IA 3B5MA 1HCIA 4AKGA 4AXPA 2E8IA 5HCMA 1YQ3A 4X1YE 3BK9A 2J62A 1M7KA 4DUZT 5CB4E 4TUYE 4JYAT 2LE8A 3PUZF 4XBFB 4IGUA 3OPCA 5LBMA 3AE6A 2A2FX 2BVMA 2DLRA 3DTOA 5C2TA 2HPLA 3VU7H 1LVFA 2EHOD 3AA0B 3CMLA 3UFGA 4QH5A 4HWDA 2DWGA 4TN7B 1B7TA 5FY0A 5L3BB 4BA9A 4CXWA 3LG7A 3AE3A 3GN5B 3H3MA 5EK2A 4X20E 3GWHA 2OV9A 5IHYA 3VRAA 2V7JA 3RF1A 1OWAA 3ANWB 5HYAA 2KINB 3AVSA 2JQQA 2E9XC 5L3CB 3ZC0A 5IYZE 2YU2A 5FNVE 4DV7T 4U3CA 1ZP0A 4G63A 2CHNA 4PK5A 3RYIE 5ABEA 1HFAA 4DBRA 1XMOT 4CZZB 5J2UE 2WU5A 1T98A 1G8XA 4IHJE 4LF4T 4MHCA 3PU8A 4N78D 3ZT6A 5IWAT 1HS7A 1VCSA 3HA4A 1D0YA 1R8IA 3ZMSB 2V5CA 4LF5T 4L0RA 2IW5B 5AQMB 1XDOA 3EDVA 3IBPA 1UK5A 3EAMA 1HX1B 4DV1T 3ZMUB 3ZN1B 2Y48B 2X9WA 3LDQB 4ZEYA 5AQHB 1NENA 5BR8T 3VHLA 4CXYA 2Q9QD 3OKQA 2NW7A 3ZEFB 4H9QC 5HXCA 2C5KT 5ABFB 3ZKRA 3LBXB 1WR0A 1WYCA 3D0TA 1WRDA 2KWHA 2LOPA 3EVYA 3ZJ1A 3VR8A 4H9OC 4V1Av 3UU8A 5AQRB 2QGSA 4NUUA 1KNPA 1XDPA 2NR4A 2NP9A 3PV0F 5L2LA 3I0QA 1Z8UA 2EHOC 3AAAB 2LT3A 2JPFA 2LEHA 4C90A 2Z6EA 2EHOB 4LFBT 4OX9T 2D9DA 2PBIA 5FP3A 3KV6A 3AAEB 4YT0A 2IC6A 2XQ3A 2BKOA 1UX5A 1IJ6A 4JV5T 4I0UA 4DNDA 3EI0A 2Y6XA 3ONXA 1OEDA 1YKEB 2K24A 2V6YB 4DV5T 4LF9T 4GYSA 4H9NC 5DABA 4YHJA 3UU6A 2ODUA 2XTLA 2BG9E 5HEOA 3PJAJ 1YW0A 3H37A 2KNDA 3K3OA 1XNRT 4DV2T 3ABVA 4IDOA 5HAXA 2K3WA 3CIRA 5L3GB 5LP6E 2WMOA 4EAHA 3P4PA 3VKGA 2WS3A 3ZMZB 4CN1A 3R84B 4AKLA 1BR0A 3OYZA 2LM9A 2JQ9A 4NIQA 2BS4A 4X5TA 3P4QA 4P0BA 4AKHA 3UUXB 3RQWA 2NW8A 3K8PC 3C51A 2F4VT 3PURA 3RIUA 1KF6A 1WLXA 2BKPA 3ZPOA 3MZKB 1T7SA 4UXNB 4WBNE 5L47A 5H6RB 4QH1A 5F3JA 2VKJA 3UFEA 4UV9B 2Q9QC 4YSYA 3BQIA 3AB3B 5EZYE 5CFBA 2Q9QB 1JNZA 4EOZB 2LOSA 3X1DA 4JLEA 3NZQA 1LVKA 3PJAA 1SUMB 1MNEA 1G73A 2V7MA 2UXNB 4B3ST 4HFBA 5LMNT 4JI3T 2ZM6T 2LKGA 3LK3B 2X9YA 4UELA 4K0KT 2LSIA 4LF6T 2X0YA 4QX8B 2HH7A 3U3IA 4X1KE 4GKKT 3L3PA 1W9RA 5FY7A 3T8OA 4WZXA 1MIVA 1YKHB 4COFA 4EGWA 2YOEA 4JEHB 5CA0E 2VKDA 3OBVE 4Z91A 3O4XE 3KVBA 4B3MT 3WAJA 4H9SE 2WQYA 2L9QA 3ZT7A 5FL1A 3OTOT 5LG3A 2UUBT 2M6BA 2MBGA 4G2AA 3ETVA 1T72A 3JC6D 1IBLT 4OYJA 5LGUB 3UT5E 2M67A 4TV8E 2VVNA 3QB5A 3PUWF 1N33T 3ZSTA 5JDQA 4HTEA 3C4WA 5AQIB 4IL9A 4DUYT 2MYSA 4DVDA 3N2OA 3NRYA 5JDMA 1D1CA 3BQKA 4HWHA 4PJMA 3VKHA 2CA5A 3ZLIA 2IHR1 5FYMA 4O4LE 3AEGA 5HXSA 4AQYT 1ZEEA 2XQYA 3QB5K 3ZN0B 1XMQT 4J2CA 2BKNA 2YU1A 4PFOA 4EXTA 2C5IT 5FVLA 2C5JA 2MTQA 5DJQC 2V7LA 2K48A 2X0LB 4ADZA 2KLQA 2WDVA 2WY2A 2G0UA 2ACXA 3M65A 2CRBA 2AE9A 4O2BE 2V7IA 1ZOYA 3JCFA 1IBMT 1OEDE 2RA1A 4PJNA 4Z90A 1ZV4X 5AQLB 4CI1B 5LJNA 1KEYA 2X9XA 5AQKB 1ZKEA 4O4HE 5FL0A 1U4QA 4OHFA 4U74A 4GK5E 2W00A 4EIWA 4EYYR 4UF0A 4WNKA 4JI8T 4UVCB 1BR1A 3S4UA 1MIWA 3JC6C 3IEEA 3KBUA 3A8YC 3UU3A 3CQGB 3SS1A 1H7CA 4DR1T 4AKRB 5DQVA 4IDPA 4ERRA 1NAFA 4PK4A 2XAGB 4EYUA 5AQNB 4IDZA 1EZ3A 3CPZA 4UVAB 2YDQA 4WW0A 3DP7A 3FBLA 3UUMA 3R6NA 3SOLA 3PUSA 5DQWA 4OK0A 5FXVA 4JI5T 4NPPA 5CA1E 4WYVA 1IZNB 2XUEA 2GK9A 3KV4A 4X1IE 2BVLA 2YN6A 2LHRA 3N9QA 4HN9A 5F5WA 2E5VA 2WP9A 3F57A 5FXZA 2QYWA 3RYCE 1J1JA 4PFPA 3N9MA 3RGLA 4FJOA 2WM9A 3PUXF 1VCTA 4JBWF 3P7IA 3AEBA 4JI7T 5JDFA 2JMKA 5LA6E 4UVBB 2JRKA 3Q5DA 2BS3A 1HNXT 5JVDE 4ANJA 4HKAA 4ZI7E 4GOUA 5J2TE 2MOZA 5JRCA 1N32T 2L3LA 2J4GA 3B13A 4KMCA 2CCQA 3AEDA 5ABHA 4AQFC 4IE5A 2B1EA 3CVRA 1KFYA 5LHGB 3TLUA 3N9PA 2XZEA 5M4YA 5AQJB 2XM1A 2WCAA 3HKCE 5HXRA 3F2EA 3CX6B 4IE7A 4Q25A 2X9HA 4EEDA 3LSVA 2FUPA 2VASA 1Z0PA 3EDUA 2WMNA 3AE9A 3PUVF 2VKHA 3L8RA 2NW9A 2WZIA 4HFCA 4IT4A 4LMKA 2WB5A 3RRWA 5CGMA 3KDSE 2WSSV 3AE2A 1KK7A 2V26A 3ZT5A 3QOFA 3Q5EA 2WU2A 2LSYA 4ZI3D 4EV6A 2W66A 3N5LA 1WCRA 3SFEA 4IE0A 2XM2A 3I0OA 3V5SA 3EHZA 2X51A 5HEUA 3BQLA 4LFAT 2HHHT 5ETWA 5C3JA 2BDEA 3M3ZB 2A9UA 2W67A 2BS2A 3RX6A 3RC3A 2XAQB 3NKZA 2CM0A 1MMNA 3CQCB 1KNZA 2JJ9A 5JH7E 3KV9A 2V5DA 4QXCB 3T1YT 3P50A 1D1BA 1W0BA 2VVSA 2VB6A 2VURA 3K1SA 3P4SA 5E0OA 4KI0F 1U5PA 2OLTA 4AQGA 4LMJA 1IJ5A 3UUNA 3MXZA 2FJAA 2WWUA 2XJ7A 1VRBA 4OYKA 3GMIA 2VQET 2K5BB 3C4ZA 3RQUA 4PAGA 5FKYA 4ZS3A 4EZ4A 3GA8A 3O1HA 3UQ4A 3I9YA 1UUSA 1LRZA 2JQKA 2I59A 2BG9C 2XQ4A 2LSKA 4YTMA 4DO0A 1SA0E 4HGAA 2W61A 4L5GA 5ADXL 2BG9B 5LBQB 3AA1B 2CMRA 2D5UA 2X0HA 2A3DA 3C98B 4ZI3C 4LFCT 3HKEE 4TX5A 1T8BA 4YHHT 4DR5T 1FJGT 1VOMA 2ZLYA 4HFDA 2CBIA 4JI4T 3GN5A 2CXDA 2VL8A 1QSDA 1N34T 1S35A 3ANWA 3RHWA 3HI2A 1WFDA 4QKNA 4YJ2E 3C50A 4JUYA 4P1NA 3TLSA 5LJMA 2E9XA 1MIYA 4GIWA 4TV9E 4L9IA 3MACA 5C8YE 3NZPA 5IUXA 4WBOA 3DJBA 3T1HT 1WR6A 1HF8A 3LK2B 3AE8A 5F8PA 2ZM8A 5HCJA 2WDQA 1FEWA 1GQEA 3UQ7A 2LJLA 3WAKA 3FZHB 4CQIA 2IDOB 2YEVC 4IE4A 5JRCB 3AE4A 3P4RA 2E5LT 2CLYB 4DIDB 3RLFF 3E0ZA 2UU9T 5JR9A 1SE7A 1IBKT 1UX4A 3KVAA 5J1GA 5LYJE 3RIFA 4NXNT 5AQSB 3JAFA 1I94T 3N2GE 5KX5E 1O3XA 4ISSA 2RP4A 3RYFE 2BBHA 4UR9A 3PDYA 4H63V
chains in the Genus database with same CATH topology
3OJAA 5GONE 3LBXA 3UUMA 3ZMUB 5LOVE 3ZN1B 2Y48B 2X9WA 4KUMB 3R6NA 3SOLA 2WBLA 4KBMB 2CWYA 4PJJA 3VHLA 4CXYA 3PUSA 5DQWA 4OK0A 2Q9QD 5FXVA 4JEUB 5LHIB 3PUAA 3O1JA 2PG8A 3FBZA 3RRCA 5CA1E 3OKQA 2P9BA 2H7OA 2NW7A 1IZNB 2XUEA 2GK9A 3ESLA 3KV4A 3RC8A 4YLHA 3ZEFB 5EK4A 4X1IE 4H9QC 5HXCA 2BVLA 2C5KT 2LHRA 3N9QA 4HN9A 3IF8B 2CXLA 4C91A 3LBXB 4F6RC 1WYCA 2EHOA 3OYXA 3D0TA 1WRDA 2KWHA 2LOPA 2OA5A 3EVYA 3F57A 3ZJ1A 5FXZA 1X79A 3RYCE 2D0UA 2H7VC 4H9OC 4V1Av 4ISTA 3CQXC 4PFPA 1US7B 2QGSA 4NUUA 3N9MA 2NP9A 4FJOA 5L2LA 2HPJA 2WM9A 3I0QA 2V1DB 3L09A 2DHRA 3HL6A 2EHOC 3AAAB 5LXTE 2LT3A 3J9X1 2JPFA 4EZHA 3P7IA 4CXXA 3U78A 1Y64B 5HXHA 2N9DA 2LEHA 4C90A 1NWMX 3QK6A 4U72A 4HFVA 1D0ZA 2JMKA 2Z6EA 2H3RA 3I1AA 2EHOB 5JDFA 5LA6E 1E1HB 4O2AE 4ASKA 1D1AA 5BMVE 2PBIA 2JRKA 4UVBB 4MALA 5FP3A 4DBQA 2XHEB 3KV6A 3AAEB 4OFZA 2IC6A 3E22E 3KV5A 4E7SA 1UX5A 1IJ6A 5JVDE 2NOXA 4ANJA 4HKAA 3Q5XA 4ZI7E 3A5XA 2XAHB 2DWKA 3AVRA 4GOUA 5HXEA 4DNDA 4AQFA 1FIOA 1QUUA 5J2TE 2Y6XA 2MOZA 3ONXA 5JRCA 2KMFA 2L3LA 1YKEB 2K24A 2JMHA 4GYSA 4H9NC 1ZHCA 3B13A 5LNKA 5FXXA 4KMCA 5DABA 5L3FB 4H9RC 4YHJA 4DMWA 2CCQA 2ODUA 5AFUL 4XZCA 4IIJE 2XTLA 3C64A 4AQFC 4ILUA 4IE5A 1YW0A 2B1EA 3H37A 3CVRA 2KNDA 5LHGB 2NTYA 3K3OA 4PJLA 2CLYC 3FXEB 2XAJB 3FB2A 5FMNA 5HAXA 1V9DA 3N9PA 3K3QC 5A1LA 3Q2MA 5L3GB 5M4YA 5LP6E 2ZM0A 2WMOA 4EAHA 4ZI2D 1AJ3A 5H6QB 3VKGA 2J1DG 2DCFA 3ZMZB 3CX8B 2CWOA 3R84B 3V5UA 3ZYKA 3KBTA 3MA9A 2XAFB 1HG5A 4UIGA 3HKCE 5JDHA 4AKLA 5HWYA 5HXRA 3F2EA 4MFRA 4HEAA 1BR0A 3CX6B 4IE7A 2X9HA 3OYZA 3RYHE 2LM9A 1MMDA 3ZMTB 2VASA 3N9OA 4MLKA 4P0BA 1Z0PA 3EDUA 3UULA 2WMNA 3AA7B 3HKBE 4AKHA 3UUXB 2VKHA 2NW8A 2NW9A 3K8PC 3C51A 2W62A 3PURA 4KP3C 2Q9QA 5FXWA 2L8KA 3AAIA 3RRWA 5JREA 5HWXA 3KDSE 1WLXA 2WSSV 2LHNA 5JDLA 1HX8A 3ZPOA 1KK7A 4UV8B 2V26A 3MZKB 3Q9DA 4UXNB 4WBNE 4I50E 3LK42 2LSYA 5H6RB 3TKLB 4ZI3D 4MBQA 2VKJA 5F3JA 3AA6B 2YK0A 3N5LA 2WAUA 3UFEA 4UV9B 1MMGA 2Q9QC 5JDNA 5KDMC 2KZ7B 4IE0A 3BQIA 3AB3B 5EZYE 4QWNB 4QHOA 2Q9QB 4EOZB 3I0OA 4YFSA 2LOSA 2C0SA 4JLEA 3V5SA 2X51A 3I9WA 3MK7C 4YJ3E 3NZQA 1LVKA 3ZYMA 5EK3A 3H3AA 1MNEA 3BQLA 3SRZA 5ETWA 1G73A 2V7MA 5L3EB 2BDEA 2UXNB 4I43B 2D0TA 5LCYA 4H63H 4O8SA 4O4JE 3RX6A 3RC3A 2XAQB 3Q5WA 3LK3B 3MJXA 2X9YA 2D2SA 2CM0A 1MMNA 3UTKA 2X66A 3CQCB 1FMWA 3PTRB 1D0XA 4NUVA 1WYBA 1KNZA 2JJ9A 4UELA 4QX7B 3ZYLA 2LSIA 5JH7E 4FI5A 4ZHQE 3KV9A 4I4TE 3SWHA 4QX8B 4QXCB 4B6XA 2HH7A 3U3IA 4I55E 2ODVA 4X1KE 3RH3A 3KFWX 3ZCIA 4QXHB 3L3PA 1D1BA 2VB6A 5FY7A 2X68A 3T8OA 5JDGA 2KT9A 2VKOA 2N2NA 2KWIB 3NRXA 1MIVA 3CKDA 2NWBA 5E0OA 1U5PA 1YKHB 1FMVA 3ZJ2A 3FHNA 4JEHB 5CA0E 2VKDA 2E9XD 3OBVE 4P09A 4AQGA 3ZMVB 4QXBB 3K3NA 2IC9A 3O4XE 3B57A 3KVBA 1IJ5A 3UUNA 3WAJA 4H9SE 5LG4A 3MXZA 2L9QA 2NTXA 3RKOA 3CWZB 2DNXA 2SPCA 2XASB 2BZBA 3N2KE 2WWUA 4G2AA 2MBGA 3WI3A 3ETVA 1VRBA 2E9XB 2V7KA 4OYKA 4CI2B 3JC6D 4CI3B 4K0UA 3GMIA 4GK0E 5KMGP 2PFVA 4OYJA 4ZI2C 2UXXB 5LGUB 3PUGA 2K5BB 3C4ZA 3ZC1A 5LGTB 2M67A 4Z8XA 4PAGA 3UT5E 3ETUA 4ZS3A 3HR0A 2LSJA 4TV8E 3GA8A 4EZ4A 5LGNB 1YD8G 3O1HA 3EUHA 1UCUA 5JDQA 2QA7A 4HTEA 2Y8DA 4M1PA 3I9YA 3LFMA 3C4WA 4BAYB 4ZOLE 1LRZA 2MYSA 2I59A 4DVDA 2DI4A 4AI6A 3MKDA 3N2OA 3PE0A 3W15B 2LSKA 2PJQA 3NRYA 4DO0A 1SA0E 4HGAA 3CX7B 4UEMA 2W61A 4DMVA 2CEAA 4L5GA 4BJNA 5ADXL 2W0GA 5JDMA 4P0AA 1D1CA 3AA1B 3BQKA 5LBQB 5JQGE 4PJMA 3VKHA 2CA5A 2CMRA 3O1IA 3RPUA 3ZLIA 3O9XA 5FYMA 2D5UA 4O4LE 1HCIA 5HXSA 2A3DA 1ZEEA 1IAPA 5JR9C 2XQYA 4AKGA 4XAXB 1HG2A 3ZN0B 4AKIA 3C98B 4J2CA 4ZI3C 4AXPA 5JR9B 2E8IA 2YU1A 3NBXX 4IE6A 3HKEE 4O4IE 4TX5A 1VOMA 4PW8A 3QC9A 4PFOA 5LHHB 4EXTA 3HKDE 2C5IT 4X1YE 3BK9A 5TAOA 3QUJA 2C5JA 2MTQA 3PDYA 5DJQC 2V7LA 1MMAA 2K48A 2X0LB 5CB4E 4ADZA 4TUYE 2KLQA 2ZLYA 2LE8A 4XBFB 3P8CD 3ZCJA 4IGUA 2G0UA 5LBMA 4EB6E 3GN5A 3IHRA 2ACXA 2A2FX 2BVMA 2DLRA 3DTOA 2CXDA 1BR4A 2HPLA 1QSDA 2VL8A 3C4XA 3M65A 4PK6A 3VU7H 3J7Yq 1LVFA 2EHOD 3AA0B 3CMLA 4O2BE 4H9PC 2V7IA 1S35A 3ANWA 2CE7A 3HI2A 2W63A 4QKNA 2DWGA 4TN7B 2RA1A 1B7TA 3N9LA 4PJNA 5FY0A 3N9NA 4YJ2E 1ZV4X 5L3BB 4BA9A 4CI1B 2CXFA 4CXWA 3LG7A 3C50A 5LJNA 4JUYA 1BR2A 5LJMA 3GN5B 2E9XA 2X9XA 1ZKEA 5EK2A 4O4HE 3PUQA 1MIYA 4GIWA 4X20E 1U4QA 4OHFA 3E08A 4HE8A 3GWHA 4TV9E 2YINA 4U74A 1SHZC 5IHYA 2V7JA 4L9IA 1OWAA 3ANWB 3MACA 4GK5E 2W00A 4PNIA 5C8YE 5HYAA 2KINB 3NZPA 3KINB 3PU3A 3AVSA 2JQQA 4EIWA 4WBOA 3DJBA 2E9XC 5L3CB 2X67A 4E7ZA 4EYYR 1WR6A 3ZC0A 5IYZE 1HF8A 3LK2B 2KXPB 5F8PA 2YU2A 4A56A 5FNVE 4UF0A 4WNKA 2VWAA 1LKXA 4UVCB 2ZM8A 4TZ4C 1BR1A 3S4UA 2N1GA 1FEWA 4G63A 2IAKA 2LJLA 4GYRA 1MIWA 3WAKA 3JC6C 4CQIA 4PK5A 1S94A 3RYIE 2YEVC 1HTJF 3IEEA 1HFAA 4IE4A 4BJMA 3KBUA 5JRCB 4DBRA 4CZZB 3CQGB 3LJCA 3SS1A 1H7CA 5J2UE 2CLYB 3F31A 4AKRB 5DQVA 5L3DB 1T98A 1MNDA 4ZS2A 4ERRA 2VK9A 3E0ZA 5FY1A 1NAFA 4UF0B 4PK4A 1G8XA 2ZMAA 4IHJE 4MHCA 5JR9A 3PU8A 4N78D 2XAGB 1UX4A 3KVAA 1HS7A 3HA4A 5J1GA 4EYUA 1D0YA 5LYJE 3ZMSB 4IDZA 1EZ3A 3CPZA 4L0RA 2ZM2A 3N2GE 5KX5E 4UVAB 1O3XA 4ISSA 4WW0A 1OXZA 2LSGA 3DP7A 2IW5B 2RP4A 3FXDB 3EDVA 3RYFE 2A72A 3IBPA 1CUNA 2K9AA 2ES0A 3FBLA 4H63V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1G A;  2LSK A;  4FJO A;  2LSI A;  4GK0 E;  2LSY A;  3VU7 H;  4BA9 A;  4EXT A;  2LSJ A;  2LSG A;  4GK5 E; 
#chains in the Genus database with same CATH topology
 4U7Y A;  3LBX A;  4IRE A;  4KUM B;  4U2Z A;  2WBL A;  2CPT A;  4KBM B;  2CWY A;  5LHI B;  3O1J A;  2PG8 A;  2WDR A;  3RRC A;  2P9B A;  2VL0 A;  1XNQ T;  4X62 T;  3RC8 A;  4YLH A;  5EK4 A;  3G06 A;  2EHO A;  3OYX A;  2OA5 A;  4KX6 A;  2QVA A;  1UUR A;  1X79 A;  3AE5 A;  3UUB A;  2V1D B;  3HL6 A;  2H89 A;  4TNW A;  3J9X 1;  4EZH A;  2V6Y A;  3U78 A;  5HXH A;  4U72 A;  3I1A A;  2H3R A;  1J5W A;  1E1H B;  2V8S V;  5BMV E;  2FJB A;  2UXB T;  3KV5 A;  3E22 E;  4B3T T;  3A5X A;  3AVR A;  2DWK A;  1FIO A;  1QUU A;  2VQF T;  2UUC T;  1ZHC A;  5JTG A;  5LNK A;  4H9R C;  4IIJ E;  2W4X A;  2R6G F;  1OED C;  2NTY A;  2UXC T;  3FB2 A;  2HN1 A;  3EAB A;  4A97 A;  2E2A A;  1OED B;  4DR7 T;  3FZM B;  2ZM0 A;  5H6Q B;  2J1D G;  2DCF A;  3AXJ A;  4DV4 T;  5J0Z A;  2CWO A;  5L4H A;  3V5U A;  4HEA A;  1CHU A;  3AE7 A;  2ACZ A;  3A7M A;  1MMD A;  2H88 A;  3ZMT B;  3N9O A;  4MLK A;  5AQU B;  3HKB E;  3AA7 B;  4DR2 T;  4A98 A;  2W2U A;  2Q9Q A;  1W0A A;  2L8K A;  3AAI A;  3UU4 A;  5JRE A;  2CHO A;  4UV8 B;  4I50 E;  1YQ4 A;  2XQ8 A;  4U2Y A;  3TKL B;  3AA6 B;  4LML A;  2YK0 A;  2WAU A;  3RIU C;  2KZ7 B;  4ZZC A;  4HWF A;  4EEB A;  3I9W A;  3MK7 C;  4YJ3 E;  3UU5 A;  5EK3 A;  3SRZ A;  5L3E B;  4I43 B;  2D0T A;  3NWI A;  4H63 H;  4QH4 A;  4O8S A;  4X64 T;  4O4J E;  3FZK B;  3SFD A;  3Q5W A;  2YKS A;  2D2S A;  2X66 A;  1FMW A;  3PTR B;  1D0X A;  4NUV A;  1WYB A;  4FI5 A;  3SWH A;  2IIU A;  5LMU T;  2J47 A;  1XWM A;  4I55 E;  4X65 T;  2ODV A;  4IL4 A;  4ILC A;  3ZCI A;  4QXH B;  5JDG A;  2KT9 A;  2VKO A;  2N2N A;  2KWI B;  3NRX A;  2YDR A;  1FMV A;  3FHN A;  3RIA A;  2PTF A;  4P09 A;  2XSA A;  4QXB B;  2IC9 A;  3B57 A;  5LG4 A;  3RKO A;  2XAS B;  4JI2 T;  3N2K E;  2E9X B;  2V7K A;  4HFH A;  4K0U A;  4GK0 E;  3PUY F;  4U33 A;  2XPK A;  4Z8X A;  3ETU A;  3ZSS A;  3HR0 A;  4TWD A;  3EUH A;  1E7P A;  2XQ9 A;  2Y8D A;  2XSB A;  4BAY B;  4HWC A;  4ZZB A;  4AI6 A;  2PJQ A;  1N36 T;  3ONL C;  3AEC A;  2MPK A;  4BJN A;  2W0G A;  4P0A A;  5JQG E;  3RPU A;  3O9X A;  4KHP T;  1IAP A;  5JR9 C;  3OVU A;  4XAX B;  5HEJ A;  1HG2 A;  5KXJ A;  4JI6 T;  4AKI A;  5L4E A;  5JR9 B;  3NBX X;  4IE6 A;  4O4I E;  1X9B A;  4PW8 A;  4ZXL A;  3QC9 A;  1Y01 A;  5LHH B;  3HKD E;  5TAO A;  3QUJ A;  4IDQ A;  1MMA A;  1HNW T;  4TWH A;  4ILB A;  3P8C D;  3ZCJ A;  4EB6 E;  4DV3 T;  3IHR A;  1BR4 A;  3C4X A;  4PK6 A;  3J7Y q;  2DL1 A;  4AIS A;  4H9P C;  2CE7 A;  4AIU A;  3CK6 A;  4GKJ T;  2W63 A;  3N9L A;  3N9N A;  3FZL B;  2CXF A;  5HEG A;  1BR2 A;  4A5X A;  3PUQ A;  4JI1 T;  3E08 A;  5AQO B;  4ILA A;  4HE8 A;  2YIN A;  1SHZ C;  4PNI A;  2JIW A;  1L0V A;  2WZH A;  1DU2 A;  3KIN B;  3PU3 A;  3AEA A;  3VR9 A;  2X67 A;  4E7Z A;  4LF8 T;  3TLT A;  4F8H A;  2KXP B;  4YTN A;  4A56 A;  3NVO A;  2VWA A;  3TLV A;  1LKX A;  4TZ4 C;  2N1G A;  2XY8 B;  2IAK A;  4GYR A;  1S94 A;  5AQG B;  1HTJ F;  4BJM A;  3JAD A;  2KSR A;  5CJ5 A;  3LJC A;  3F31 A;  5L3D B;  5AQQ B;  1MND A;  4ZS2 A;  2VK9 A;  5FY1 A;  4UF0 B;  2ZMA A;  2B76 A;  2LM2 A;  2ZM2 A;  5AQP B;  1OXZ A;  2LSG A;  4U31 A;  3FXD B;  2A72 A;  1CUN A;  3AXJ B;  3IA3 A;  2K9A A;  3MA9 A;  2ES0 A;  3OJA A;  5GON E;  3TLW A;  5ABG A;  5LOV E;  2RPA A;  4PJJ A;  4JEU B;  3PUA A;  3FBZ A;  4DR4 T;  2XQ5 A;  2H7O A;  3ESL A;  2FJD A;  4CN4 A;  4C91 A;  3IF8 B;  2CXL A;  4F6R C;  4JI0 T;  2D0U A;  2H7V C;  4IST A;  3CQX C;  1US7 B;  2JQH A;  1UGO A;  2M6I A;  2IUB A;  2CBJ A;  2HPJ A;  3L09 A;  2DHR A;  4YSX A;  5LXT E;  4YTP A;  1JNR A;  4CXX A;  1Y64 B;  2N9D A;  1I6Z A;  1NWM X;  3QK6 A;  4HFV A;  1D0Z A;  4ASK A;  4O2A E;  1D1A A;  2LRL A;  3RKG A;  4MAL A;  4DBQ A;  2XHE B;  4OFZ A;  3AEE A;  4E7S A;  4IDN A;  2NOX A;  3Q5X A;  5HXE A;  2XAH B;  3ONJ A;  4AQF A;  2KMF A;  2JMH A;  3P4W A;  5FXX A;  5L3F B;  3L39 A;  4DMW A;  5AFU L;  4XZC A;  3AEF A;  3C64 A;  4ILU A;  3RI5 A;  4LF7 T;  4PJL A;  2I6H A;  2CLY C;  3FXE B;  4YXD A;  2XAJ B;  5FMN A;  1V9D A;  4TWF A;  3K3Q C;  5A1L A;  3Q2M A;  4ZI2 D;  1AJ3 A;  3CX8 B;  2FBW A;  3ZYK A;  3KBT A;  2XAF B;  1HG5 A;  4UIG A;  5JDH A;  5HWY A;  4MFR A;  3RYH E;  3UUL A;  2HN2 A;  4HFE A;  4NXM T;  2I0M A;  5ABF A;  5AQV B;  2W62 A;  4B3R T;  4KP3 C;  5FXW A;  1KNR A;  5HWX A;  4HFI A;  3AE1 A;  2LHN A;  2XQ7 A;  5JDL A;  1HX8 A;  2AXD S;  4DR6 T;  2V6X A;  3Q9D A;  3LK4 2;  2WWV A;  4MBQ A;  1MMG A;  5JDN A;  5KDM C;  1M62 A;  4QWN B;  1YXR A;  4QHO A;  4YY3 T;  4YFS A;  2C0S A;  4X66 T;  5AQF B;  3ZYM A;  3H3A A;  1E2A A;  3VRB A;  5LCY A;  1NEK A;  1QLB A;  4CN6 A;  4YSZ A;  3MJX A;  3UTK A;  4QX7 B;  3ZYL A;  1W09 A;  4ZHQ E;  4I4T E;  1J5E T;  2FJE A;  4B6X A;  1HNZ T;  3RH3 A;  2YDS A;  3KFW X;  2X68 A;  5LB7 B;  3CKD A;  4TNV A;  2NWB A;  3ZJ2 A;  1HR0 T;  3QNU A;  2E9X D;  3ZMV B;  3K3N A;  2IML A;  4DV0 T;  2QRX A;  4KHZ F;  5HEH A;  2UUA T;  2NTX A;  3CWZ B;  2DNX A;  2SPC A;  2BZB A;  3WI3 A;  4CI2 B;  4CI3 B;  5KMG P;  2PFV A;  4ZI2 C;  2UXD T;  2UXX B;  3PUG A;  3JAE A;  3ZC1 A;  5LGT B;  2BG9 A;  2XQ6 A;  2BBJ A;  2LSJ A;  4HWI B;  5LGN B;  4DR3 T;  1YD8 G;  2LRK A;  2XQA A;  1UCU A;  5FVK A;  2QA7 A;  4M1P A;  3LFM A;  3FZF B;  2LKH A;  4ZOL E;  1XZY A;  2DI4 A;  3MKD A;  3PE0 A;  3W15 B;  5AQT B;  2MAW A;  3CX7 B;  2LLY A;  4UEM A;  4DMV A;  2CEA A;  4DV6 T;  4U7I A;  3O1I A;  3B5M A;  1HCI A;  4AKG A;  4AXP A;  2E8I A;  5HCM A;  1YQ3 A;  4X1Y E;  3BK9 A;  2J62 A;  1M7K A;  4DUZ T;  5CB4 E;  4TUY E;  4JYA T;  2LE8 A;  3PUZ F;  4XBF B;  4IGU A;  3OPC A;  5LBM A;  3AE6 A;  2A2F X;  2BVM A;  2DLR A;  3DTO A;  5C2T A;  2HPL A;  3VU7 H;  1LVF A;  2EHO D;  3AA0 B;  3CML A;  3UFG A;  4QH5 A;  4HWD A;  2DWG A;  4TN7 B;  1B7T A;  5FY0 A;  5L3B B;  4BA9 A;  4CXW A;  3LG7 A;  3AE3 A;  3GN5 B;  3H3M A;  5EK2 A;  4X20 E;  3GWH A;  2OV9 A;  5IHY A;  3VRA A;  2V7J A;  3RF1 A;  1OWA A;  3ANW B;  5HYA A;  2KIN B;  3AVS A;  2JQQ A;  2E9X C;  5L3C B;  3ZC0 A;  5IYZ E;  2YU2 A;  5FNV E;  4DV7 T;  4U3C A;  1ZP0 A;  4G63 A;  2CHN A;  4PK5 A;  3RYI E;  5ABE A;  1HFA A;  4DBR A;  1XMO T;  4CZZ B;  5J2U E;  2WU5 A;  1T98 A;  1G8X A;  4IHJ E;  4LF4 T;  4MHC A;  3PU8 A;  4N78 D;  3ZT6 A;  5IWA T;  1HS7 A;  1VCS A;  3HA4 A;  1D0Y A;  1R8I A;  3ZMS B;  2V5C A;  4LF5 T;  4L0R A;  2IW5 B;  5AQM B;  1XDO A;  3EDV A;  3IBP A;  1UK5 A;  3EAM A;  1HX1 B;  4DV1 T;  3ZMU B;  3ZN1 B;  2Y48 B;  2X9W A;  3LDQ B;  4ZEY A;  5AQH B;  1NEN A;  5BR8 T;  3VHL A;  4CXY A;  2Q9Q D;  3OKQ A;  2NW7 A;  3ZEF B;  4H9Q C;  5HXC A;  2C5K T;  5ABF B;  3ZKR A;  3LBX B;  1WR0 A;  1WYC A;  3D0T A;  1WRD A;  2KWH A;  2LOP A;  3EVY A;  3ZJ1 A;  3VR8 A;  4H9O C;  4V1A v;  3UU8 A;  5AQR B;  2QGS A;  4NUU A;  1KNP A;  1XDP A;  2NR4 A;  2NP9 A;  3PV0 F;  5L2L A;  3I0Q A;  1Z8U A;  2EHO C;  3AAA B;  2LT3 A;  2JPF A;  2LEH A;  4C90 A;  2Z6E A;  2EHO B;  4LFB T;  4OX9 T;  2D9D A;  2PBI A;  5FP3 A;  3KV6 A;  3AAE B;  4YT0 A;  2IC6 A;  2XQ3 A;  2BKO A;  1UX5 A;  1IJ6 A;  4JV5 T;  4I0U A;  4DND A;  3EI0 A;  2Y6X A;  3ONX A;  1OED A;  1YKE B;  2K24 A;  2V6Y B;  4DV5 T;  4LF9 T;  4GYS A;  4H9N C;  5DAB A;  4YHJ A;  3UU6 A;  2ODU A;  2XTL A;  2BG9 E;  5HEO A;  3PJA J;  1YW0 A;  3H37 A;  2KND A;  3K3O A;  1XNR T;  4DV2 T;  3ABV A;  4IDO A;  5HAX A;  2K3W A;  3CIR A;  5L3G B;  5LP6 E;  2WMO A;  4EAH A;  3P4P A;  3VKG A;  2WS3 A;  3ZMZ B;  4CN1 A;  3R84 B;  4AKL A;  1BR0 A;  3OYZ A;  2LM9 A;  2JQ9 A;  4NIQ A;  2BS4 A;  4X5T A;  3P4Q A;  4P0B A;  4AKH A;  3UUX B;  3RQW A;  2NW8 A;  3K8P C;  3C51 A;  2F4V T;  3PUR A;  3RIU A;  1KF6 A;  1WLX A;  2BKP A;  3ZPO A;  3MZK B;  1T7S A;  4UXN B;  4WBN E;  5L47 A;  5H6R B;  4QH1 A;  5F3J A;  2VKJ A;  3UFE A;  4UV9 B;  2Q9Q C;  4YSY A;  3BQI A;  3AB3 B;  5EZY E;  5CFB A;  2Q9Q B;  1JNZ A;  4EOZ B;  2LOS A;  3X1D A;  4JLE A;  3NZQ A;  1LVK A;  3PJA A;  1SUM B;  1MNE A;  1G73 A;  2V7M A;  2UXN B;  4B3S T;  4HFB A;  5LMN T;  4JI3 T;  2ZM6 T;  2LKG A;  3LK3 B;  2X9Y A;  4UEL A;  4K0K T;  2LSI A;  4LF6 T;  2X0Y A;  4QX8 B;  2HH7 A;  3U3I A;  4X1K E;  4GKK T;  3L3P A;  1W9R A;  5FY7 A;  3T8O A;  4WZX A;  1MIV A;  1YKH B;  4COF A;  4EGW A;  2YOE A;  4JEH B;  5CA0 E;  2VKD A;  3OBV E;  4Z91 A;  3O4X E;  3KVB A;  4B3M T;  3WAJ A;  4H9S E;  2WQY A;  2L9Q A;  3ZT7 A;  5FL1 A;  3OTO T;  5LG3 A;  2UUB T;  2M6B A;  2MBG A;  4G2A A;  3ETV A;  1T72 A;  3JC6 D;  1IBL T;  4OYJ A;  5LGU B;  3UT5 E;  2M67 A;  4TV8 E;  2VVN A;  3QB5 A;  3PUW F;  1N33 T;  3ZST A;  5JDQ A;  4HTE A;  3C4W A;  5AQI B;  4IL9 A;  4DUY T;  2MYS A;  4DVD A;  3N2O A;  3NRY A;  5JDM A;  1D1C A;  3BQK A;  4HWH A;  4PJM A;  3VKH A;  2CA5 A;  3ZLI A;  2IHR 1;  5FYM A;  4O4L E;  3AEG A;  5HXS A;  4AQY T;  1ZEE A;  2XQY A;  3QB5 K;  3ZN0 B;  1XMQ T;  4J2C A;  2BKN A;  2YU1 A;  4PFO A;  4EXT A;  2C5I T;  5FVL A;  2C5J A;  2MTQ A;  5DJQ C;  2V7L A;  2K48 A;  2X0L B;  4ADZ A;  2KLQ A;  2WDV A;  2WY2 A;  2G0U A;  2ACX A;  3M65 A;  2CRB A;  2AE9 A;  4O2B E;  2V7I A;  1ZOY A;  3JCF A;  1IBM T;  1OED E;  2RA1 A;  4PJN A;  4Z90 A;  1ZV4 X;  5AQL B;  4CI1 B;  5LJN A;  1KEY A;  2X9X A;  5AQK B;  1ZKE A;  4O4H E;  5FL0 A;  1U4Q A;  4OHF A;  4U74 A;  4GK5 E;  2W00 A;  4EIW A;  4EYY R;  4UF0 A;  4WNK A;  4JI8 T;  4UVC B;  1BR1 A;  3S4U A;  1MIW A;  3JC6 C;  3IEE A;  3KBU A;  3A8Y C;  3UU3 A;  3CQG B;  3SS1 A;  1H7C A;  4DR1 T;  4AKR B;  5DQV A;  4IDP A;  4ERR A;  1NAF A;  4PK4 A;  2XAG B;  4EYU A;  5AQN B;  4IDZ A;  1EZ3 A;  3CPZ A;  4UVA B;  2YDQ A;  4WW0 A;  3DP7 A;  3FBL A;  3UUM A;  3R6N A;  3SOL A;  3PUS A;  5DQW A;  4OK0 A;  5FXV A;  4JI5 T;  4NPP A;  5CA1 E;  4WYV A;  1IZN B;  2XUE A;  2GK9 A;  3KV4 A;  4X1I E;  2BVL A;  2YN6 A;  2LHR A;  3N9Q A;  4HN9 A;  5F5W A;  2E5V A;  2WP9 A;  3F57 A;  5FXZ A;  2QYW A;  3RYC E;  1J1J A;  4PFP A;  3N9M A;  3RGL A;  4FJO A;  2WM9 A;  3PUX F;  1VCT A;  4JBW F;  3P7I A;  3AEB A;  4JI7 T;  5JDF A;  2JMK A;  5LA6 E;  4UVB B;  2JRK A;  3Q5D A;  2BS3 A;  1HNX T;  5JVD E;  4ANJ A;  4HKA A;  4ZI7 E;  4GOU A;  5J2T E;  2MOZ A;  5JRC A;  1N32 T;  2L3L A;  2J4G A;  3B13 A;  4KMC A;  2CCQ A;  3AED A;  5ABH A;  4AQF C;  4IE5 A;  2B1E A;  3CVR A;  1KFY A;  5LHG B;  3TLU A;  3N9P A;  2XZE A;  5M4Y A;  5AQJ B;  2XM1 A;  2WCA A;  3HKC E;  5HXR A;  3F2E A;  3CX6 B;  4IE7 A;  4Q25 A;  2X9H A;  4EED A;  3LSV A;  2FUP A;  2VAS A;  1Z0P A;  3EDU A;  2WMN A;  3AE9 A;  3PUV F;  2VKH A;  3L8R A;  2NW9 A;  2WZI A;  4HFC A;  4IT4 A;  4LMK A;  2WB5 A;  3RRW A;  5CGM A;  3KDS E;  2WSS V;  3AE2 A;  1KK7 A;  2V26 A;  3ZT5 A;  3QOF A;  3Q5E A;  2WU2 A;  2LSY A;  4ZI3 D;  4EV6 A;  2W66 A;  3N5L A;  1WCR A;  3SFE A;  4IE0 A;  2XM2 A;  3I0O A;  3V5S A;  3EHZ A;  2X51 A;  5HEU A;  3BQL A;  4LFA T;  2HHH T;  5ETW A;  5C3J A;  2BDE A;  3M3Z B;  2A9U A;  2W67 A;  2BS2 A;  3RX6 A;  3RC3 A;  2XAQ B;  3NKZ A;  2CM0 A;  1MMN A;  3CQC B;  1KNZ A;  2JJ9 A;  5JH7 E;  3KV9 A;  2V5D A;  4QXC B;  3T1Y T;  3P50 A;  1D1B A;  1W0B A;  2VVS A;  2VB6 A;  2VUR A;  3K1S A;  3P4S A;  5E0O A;  4KI0 F;  1U5P A;  2OLT A;  4AQG A;  4LMJ A;  1IJ5 A;  3UUN A;  3MXZ A;  2FJA A;  2WWU A;  2XJ7 A;  1VRB A;  4OYK A;  3GMI A;  2VQE T;  2K5B B;  3C4Z A;  3RQU A;  4PAG A;  5FKY A;  4ZS3 A;  4EZ4 A;  3GA8 A;  3O1H A;  3UQ4 A;  3I9Y A;  1UUS A;  1LRZ A;  2JQK A;  2I59 A;  2BG9 C;  2XQ4 A;  2LSK A;  4YTM A;  4DO0 A;  1SA0 E;  4HGA A;  2W61 A;  4L5G A;  5ADX L;  2BG9 B;  5LBQ B;  3AA1 B;  2CMR A;  2D5U A;  2X0H A;  2A3D A;  3C98 B;  4ZI3 C;  4LFC T;  3HKE E;  4TX5 A;  1T8B A;  4YHH T;  4DR5 T;  1FJG T;  1VOM A;  2ZLY A;  4HFD A;  2CBI A;  4JI4 T;  3GN5 A;  2CXD A;  2VL8 A;  1QSD A;  1N34 T;  1S35 A;  3ANW A;  3RHW A;  3HI2 A;  1WFD A;  4QKN A;  4YJ2 E;  3C50 A;  4JUY A;  4P1N A;  3TLS A;  5LJM A;  2E9X A;  1MIY A;  4GIW A;  4TV9 E;  4L9I A;  3MAC A;  5C8Y E;  3NZP A;  5IUX A;  4WBO A;  3DJB A;  3T1H T;  1WR6 A;  1HF8 A;  3LK2 B;  3AE8 A;  5F8P A;  2ZM8 A;  5HCJ A;  2WDQ A;  1FEW A;  1GQE A;  3UQ7 A;  2LJL A;  3WAK A;  3FZH B;  4CQI A;  2IDO B;  2YEV C;  4IE4 A;  5JRC B;  3AE4 A;  3P4R A;  2E5L T;  2CLY B;  4DID B;  3RLF F;  3E0Z A;  2UU9 T;  5JR9 A;  1SE7 A;  1IBK T;  1UX4 A;  3KVA A;  5J1G A;  5LYJ E;  3RIF A;  4NXN T;  5AQS B;  3JAF A;  1I94 T;  3N2G E;  5KX5 E;  1O3X A;  4ISS A;  2RP4 A;  3RYF E;  2BBH A;  4UR9 A;  3PDY A;  4H63 V; 
#chains in the Genus database with same CATH homology
 3OJA A;  5GON E;  3LBX A;  3UUM A;  3ZMU B;  5LOV E;  3ZN1 B;  2Y48 B;  2X9W A;  4KUM B;  3R6N A;  3SOL A;  2WBL A;  4KBM B;  2CWY A;  4PJJ A;  3VHL A;  4CXY A;  3PUS A;  5DQW A;  4OK0 A;  2Q9Q D;  5FXV A;  4JEU B;  5LHI B;  3PUA A;  3O1J A;  2PG8 A;  3FBZ A;  3RRC A;  5CA1 E;  3OKQ A;  2P9B A;  2H7O A;  2NW7 A;  1IZN B;  2XUE A;  2GK9 A;  3ESL A;  3KV4 A;  3RC8 A;  4YLH A;  3ZEF B;  5EK4 A;  4X1I E;  4H9Q C;  5HXC A;  2BVL A;  2C5K T;  2LHR A;  3N9Q A;  4HN9 A;  3IF8 B;  2CXL A;  4C91 A;  3LBX B;  4F6R C;  1WYC A;  2EHO A;  3OYX A;  3D0T A;  1WRD A;  2KWH A;  2LOP A;  2OA5 A;  3EVY A;  3F57 A;  3ZJ1 A;  5FXZ A;  1X79 A;  3RYC E;  2D0U A;  2H7V C;  4H9O C;  4V1A v;  4IST A;  3CQX C;  4PFP A;  1US7 B;  2QGS A;  4NUU A;  3N9M A;  2NP9 A;  4FJO A;  5L2L A;  2HPJ A;  2WM9 A;  3I0Q A;  2V1D B;  3L09 A;  2DHR A;  3HL6 A;  2EHO C;  3AAA B;  5LXT E;  2LT3 A;  3J9X 1;  2JPF A;  4EZH A;  3P7I A;  4CXX A;  3U78 A;  1Y64 B;  5HXH A;  2N9D A;  2LEH A;  4C90 A;  1NWM X;  3QK6 A;  4U72 A;  4HFV A;  1D0Z A;  2JMK A;  2Z6E A;  2H3R A;  3I1A A;  2EHO B;  5JDF A;  5LA6 E;  1E1H B;  4O2A E;  4ASK A;  1D1A A;  5BMV E;  2PBI A;  2JRK A;  4UVB B;  4MAL A;  5FP3 A;  4DBQ A;  2XHE B;  3KV6 A;  3AAE B;  4OFZ A;  2IC6 A;  3E22 E;  3KV5 A;  4E7S A;  1UX5 A;  1IJ6 A;  5JVD E;  2NOX A;  4ANJ A;  4HKA A;  3Q5X A;  4ZI7 E;  3A5X A;  2XAH B;  2DWK A;  3AVR A;  4GOU A;  5HXE A;  4DND A;  4AQF A;  1FIO A;  1QUU A;  5J2T E;  2Y6X A;  2MOZ A;  3ONX A;  5JRC A;  2KMF A;  2L3L A;  1YKE B;  2K24 A;  2JMH A;  4GYS A;  4H9N C;  1ZHC A;  3B13 A;  5LNK A;  5FXX A;  4KMC A;  5DAB A;  5L3F B;  4H9R C;  4YHJ A;  4DMW A;  2CCQ A;  2ODU A;  5AFU L;  4XZC A;  4IIJ E;  2XTL A;  3C64 A;  4AQF C;  4ILU A;  4IE5 A;  1YW0 A;  2B1E A;  3H37 A;  3CVR A;  2KND A;  5LHG B;  2NTY A;  3K3O A;  4PJL A;  2CLY C;  3FXE B;  2XAJ B;  3FB2 A;  5FMN A;  5HAX A;  1V9D A;  3N9P A;  3K3Q C;  5A1L A;  3Q2M A;  5L3G B;  5M4Y A;  5LP6 E;  2ZM0 A;  2WMO A;  4EAH A;  4ZI2 D;  1AJ3 A;  5H6Q B;  3VKG A;  2J1D G;  2DCF A;  3ZMZ B;  3CX8 B;  2CWO A;  3R84 B;  3V5U A;  3ZYK A;  3KBT A;  3MA9 A;  2XAF B;  1HG5 A;  4UIG A;  3HKC E;  5JDH A;  4AKL A;  5HWY A;  5HXR A;  3F2E A;  4MFR A;  4HEA A;  1BR0 A;  3CX6 B;  4IE7 A;  2X9H A;  3OYZ A;  3RYH E;  2LM9 A;  1MMD A;  3ZMT B;  2VAS A;  3N9O A;  4MLK A;  4P0B A;  1Z0P A;  3EDU A;  3UUL A;  2WMN A;  3AA7 B;  3HKB E;  4AKH A;  3UUX B;  2VKH A;  2NW8 A;  2NW9 A;  3K8P C;  3C51 A;  2W62 A;  3PUR A;  4KP3 C;  2Q9Q A;  5FXW A;  2L8K A;  3AAI A;  3RRW A;  5JRE A;  5HWX A;  3KDS E;  1WLX A;  2WSS V;  2LHN A;  5JDL A;  1HX8 A;  3ZPO A;  1KK7 A;  4UV8 B;  2V26 A;  3MZK B;  3Q9D A;  4UXN B;  4WBN E;  4I50 E;  3LK4 2;  2LSY A;  5H6R B;  3TKL B;  4ZI3 D;  4MBQ A;  2VKJ A;  5F3J A;  3AA6 B;  2YK0 A;  3N5L A;  2WAU A;  3UFE A;  4UV9 B;  1MMG A;  2Q9Q C;  5JDN A;  5KDM C;  2KZ7 B;  4IE0 A;  3BQI A;  3AB3 B;  5EZY E;  4QWN B;  4QHO A;  2Q9Q B;  4EOZ B;  3I0O A;  4YFS A;  2LOS A;  2C0S A;  4JLE A;  3V5S A;  2X51 A;  3I9W A;  3MK7 C;  4YJ3 E;  3NZQ A;  1LVK A;  3ZYM A;  5EK3 A;  3H3A A;  1MNE A;  3BQL A;  3SRZ A;  5ETW A;  1G73 A;  2V7M A;  5L3E B;  2BDE A;  2UXN B;  4I43 B;  2D0T A;  5LCY A;  4H63 H;  4O8S A;  4O4J E;  3RX6 A;  3RC3 A;  2XAQ B;  3Q5W A;  3LK3 B;  3MJX A;  2X9Y A;  2D2S A;  2CM0 A;  1MMN A;  3UTK A;  2X66 A;  3CQC B;  1FMW A;  3PTR B;  1D0X A;  4NUV A;  1WYB A;  1KNZ A;  2JJ9 A;  4UEL A;  4QX7 B;  3ZYL A;  2LSI A;  5JH7 E;  4FI5 A;  4ZHQ E;  3KV9 A;  4I4T E;  3SWH A;  4QX8 B;  4QXC B;  4B6X A;  2HH7 A;  3U3I A;  4I55 E;  2ODV A;  4X1K E;  3RH3 A;  3KFW X;  3ZCI A;  4QXH B;  3L3P A;  1D1B A;  2VB6 A;  5FY7 A;  2X68 A;  3T8O A;  5JDG A;  2KT9 A;  2VKO A;  2N2N A;  2KWI B;  3NRX A;  1MIV A;  3CKD A;  2NWB A;  5E0O A;  1U5P A;  1YKH B;  1FMV A;  3ZJ2 A;  3FHN A;  4JEH B;  5CA0 E;  2VKD A;  2E9X D;  3OBV E;  4P09 A;  4AQG A;  3ZMV B;  4QXB B;  3K3N A;  2IC9 A;  3O4X E;  3B57 A;  3KVB A;  1IJ5 A;  3UUN A;  3WAJ A;  4H9S E;  5LG4 A;  3MXZ A;  2L9Q A;  2NTX A;  3RKO A;  3CWZ B;  2DNX A;  2SPC A;  2XAS B;  2BZB A;  3N2K E;  2WWU A;  4G2A A;  2MBG A;  3WI3 A;  3ETV A;  1VRB A;  2E9X B;  2V7K A;  4OYK A;  4CI2 B;  3JC6 D;  4CI3 B;  4K0U A;  3GMI A;  4GK0 E;  5KMG P;  2PFV A;  4OYJ A;  4ZI2 C;  2UXX B;  5LGU B;  3PUG A;  2K5B B;  3C4Z A;  3ZC1 A;  5LGT B;  2M67 A;  4Z8X A;  4PAG A;  3UT5 E;  3ETU A;  4ZS3 A;  3HR0 A;  2LSJ A;  4TV8 E;  3GA8 A;  4EZ4 A;  5LGN B;  1YD8 G;  3O1H A;  3EUH A;  1UCU A;  5JDQ A;  2QA7 A;  4HTE A;  2Y8D A;  4M1P A;  3I9Y A;  3LFM A;  3C4W A;  4BAY B;  4ZOL E;  1LRZ A;  2MYS A;  2I59 A;  4DVD A;  2DI4 A;  4AI6 A;  3MKD A;  3N2O A;  3PE0 A;  3W15 B;  2LSK A;  2PJQ A;  3NRY A;  4DO0 A;  1SA0 E;  4HGA A;  3CX7 B;  4UEM A;  2W61 A;  4DMV A;  2CEA A;  4L5G A;  4BJN A;  5ADX L;  2W0G A;  5JDM A;  4P0A A;  1D1C A;  3AA1 B;  3BQK A;  5LBQ B;  5JQG E;  4PJM A;  3VKH A;  2CA5 A;  2CMR A;  3O1I A;  3RPU A;  3ZLI A;  3O9X A;  5FYM A;  2D5U A;  4O4L E;  1HCI A;  5HXS A;  2A3D A;  1ZEE A;  1IAP A;  5JR9 C;  2XQY A;  4AKG A;  4XAX B;  1HG2 A;  3ZN0 B;  4AKI A;  3C98 B;  4J2C A;  4ZI3 C;  4AXP A;  5JR9 B;  2E8I A;  2YU1 A;  3NBX X;  4IE6 A;  3HKE E;  4O4I E;  4TX5 A;  1VOM A;  4PW8 A;  3QC9 A;  4PFO A;  5LHH B;  4EXT A;  3HKD E;  2C5I T;  4X1Y E;  3BK9 A;  5TAO A;  3QUJ A;  2C5J A;  2MTQ A;  3PDY A;  5DJQ C;  2V7L A;  1MMA A;  2K48 A;  2X0L B;  5CB4 E;  4ADZ A;  4TUY E;  2KLQ A;  2ZLY A;  2LE8 A;  4XBF B;  3P8C D;  3ZCJ A;  4IGU A;  2G0U A;  5LBM A;  4EB6 E;  3GN5 A;  3IHR A;  2ACX A;  2A2F X;  2BVM A;  2DLR A;  3DTO A;  2CXD A;  1BR4 A;  2HPL A;  1QSD A;  2VL8 A;  3C4X A;  3M65 A;  4PK6 A;  3VU7 H;  3J7Y q;  1LVF A;  2EHO D;  3AA0 B;  3CML A;  4O2B E;  4H9P C;  2V7I A;  1S35 A;  3ANW A;  2CE7 A;  3HI2 A;  2W63 A;  4QKN A;  2DWG A;  4TN7 B;  2RA1 A;  1B7T A;  3N9L A;  4PJN A;  5FY0 A;  3N9N A;  4YJ2 E;  1ZV4 X;  5L3B B;  4BA9 A;  4CI1 B;  2CXF A;  4CXW A;  3LG7 A;  3C50 A;  5LJN A;  4JUY A;  1BR2 A;  5LJM A;  3GN5 B;  2E9X A;  2X9X A;  1ZKE A;  5EK2 A;  4O4H E;  3PUQ A;  1MIY A;  4GIW A;  4X20 E;  1U4Q A;  4OHF A;  3E08 A;  4HE8 A;  3GWH A;  4TV9 E;  2YIN A;  4U74 A;  1SHZ C;  5IHY A;  2V7J A;  4L9I A;  1OWA A;  3ANW B;  3MAC A;  4GK5 E;  2W00 A;  4PNI A;  5C8Y E;  5HYA A;  2KIN B;  3NZP A;  3KIN B;  3PU3 A;  3AVS A;  2JQQ A;  4EIW A;  4WBO A;  3DJB A;  2E9X C;  5L3C B;  2X67 A;  4E7Z A;  4EYY R;  1WR6 A;  3ZC0 A;  5IYZ E;  1HF8 A;  3LK2 B;  2KXP B;  5F8P A;  2YU2 A;  4A56 A;  5FNV E;  4UF0 A;  4WNK A;  2VWA A;  1LKX A;  4UVC B;  2ZM8 A;  4TZ4 C;  1BR1 A;  3S4U A;  2N1G A;  1FEW A;  4G63 A;  2IAK A;  2LJL A;  4GYR A;  1MIW A;  3WAK A;  3JC6 C;  4CQI A;  4PK5 A;  1S94 A;  3RYI E;  2YEV C;  1HTJ F;  3IEE A;  1HFA A;  4IE4 A;  4BJM A;  3KBU A;  5JRC B;  4DBR A;  4CZZ B;  3CQG B;  3LJC A;  3SS1 A;  1H7C A;  5J2U E;  2CLY B;  3F31 A;  4AKR B;  5DQV A;  5L3D B;  1T98 A;  1MND A;  4ZS2 A;  4ERR A;  2VK9 A;  3E0Z A;  5FY1 A;  1NAF A;  4UF0 B;  4PK4 A;  1G8X A;  2ZMA A;  4IHJ E;  4MHC A;  5JR9 A;  3PU8 A;  4N78 D;  2XAG B;  1UX4 A;  3KVA A;  1HS7 A;  3HA4 A;  5J1G A;  4EYU A;  1D0Y A;  5LYJ E;  3ZMS B;  4IDZ A;  1EZ3 A;  3CPZ A;  4L0R A;  2ZM2 A;  3N2G E;  5KX5 E;  4UVA B;  1O3X A;  4ISS A;  4WW0 A;  1OXZ A;  2LSG A;  3DP7 A;  2IW5 B;  2RP4 A;  3FXD B;  3EDV A;  3RYF E;  2A72 A;  3IBP A;  1CUN A;  2K9A A;  2ES0 A;  3FBL A;  4H63 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...