2LSKA

C-terminal domain of human rev1 in complex with dna-polymerase h (eta)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
95
Chain Sequence
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/protein binding
molecule keywords DNA repair protein REV1
publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lskA00
2LSKA 2N1GA 4GK5E 3VU7H 4BA9A 2LSJA 2LSYA 4GK0E 2LSIA 2LSGA 4EXTA 4FJOA
chains in the Genus database with same CATH superfamily
2LRKA 1IAPA 1O3XA 4KP3C 2WS3A 3NVOA 1IJ6A 2XAGB 2JRKA 3CPZA 3ESLA 3HKBE 4I0UA 2LT3A 1QSDA 4YJ3E 4QH4A 2LKHA 4AKIA 2NP9A 5AQMB 4G63A 3JCFA 5TAOA 1FMWA 4U31A 4YTPA 4NXMT 3FXDB 2K5BB 1VRBA 5AQHB 1WLXA 4YSYA 2ZLYA 3RIUC 5JDHA 4KI0F 2M6IA 1BR0A 3KBUA 2VURA 2X67A 3I9WA 3NRYA 2V7MA 3CWZB 2YN6A 3TKLB 2G0UA 3N2KE 4E7ZA 3ZYLA 5BR8T 3ZC0A 3PJAA 1YKHB 1MMDA 3QB5K 2ACZA 3ZJ2A 2F4VT 4TUYE 4F8HA 4NXNT 4YTNA 3PUXF 3FZKB 4X1IE 2VB6A 1J1JA 3DP7A 3RLFF 2E9XA 2IC6A 4KBMB 1MNEA 2NTYA 2OV9A 1S35A 3P4QA 3X1DA 4B3RT 5IWAT 5HXHA 3UU5A 4V1Av 3ZN1B 2D0UA 4GIWA 5FY1A 3E22E 3GN5A 2ZM0A 2HN2A 2MTQA 5L3FB 3OYZA 1S94A 3LSVA 4UIGA 1AJ3A 5HEJA 5LGUB 4JI0T 4P09A 2CBJA 2V7JA 2YKSA 5AQKB 5J2TE 2IDOB 4FJOA 2PTFA 2CLYB 3RPUA 2MYSA 2JIWA 3N2OA 2YDRA 4CN4A 5AQJB 1KEYA 2WU2A 2DLRA 5IUXA 3RF1A 4ADZA 2X9XA 2BDEA 4H9RC 2CXDA 1YD8G 4EZHA 3C50A 3KV6A 3L8RA 3H3MA 2WP9A 3OBVE 5L2LA 2PFVA 3LBXA 4O4JE 4O2AE 3RX6A 3UU6A 4CXYA 1HF8A 2QRXA 4YTMA 4Q25A 4JI7T 2KXPB 1LRZA 3Q2MA 4O2BE 2JMKA 3HKEE 4YXDA 5HEHA 5FXXA 4XAXB 5M4YA 3Q5WA 3RYCE 3C4WA 4U33A 3UUXB 2CWOA 4B3ST 5BMVE 3CMLA 4G2AA 4HWDA 2XQ7A 3V5UA 4UXNB 4DV5T 4HFHA 2XQ8A 3OVUA 3AE1A 2XQ9A 1LVKA 3W15B 1WFDA 2J1DG 2LSGA 3NZPA 4TZ4C 3UU3A 5CA0E 4U7IA 3VHLA 3ZSTA 4QHOA 4JUYA 5LGNB 4PW8A 5LJMA 4Z90A 4EGWA 5AQLB 2YDSA 5L3DB 1FIOA 1T7SA 3EHZA 3L09A 4EIWA 2CRBA 2LOSA 1E1HB 3AE2A 4H63V 4AKLA 1LKXA 4GK0E 2WZHA 3AE7A 2NR4A 2XHEB 2HHHT 2ZM6T 3LK42 3CX8B 3PDYA 2KWHA 3SFEA 5ABFA 4IT4A 3RC8A 5AQNB 3OTOT 5CGMA 5LHGB 3PV0F 4JI2T 1VCTA 1D1AA 2HPJA 3UT5E 3JC6C 1M62A 1WYCA 4ZXLA 3ONJA 3VR9A 5HXSA 1DU2A 3ZKRA 4TWHA 4IE6A 4DIDB 5LGTB 3VU7H 4CXWA 3AVSA 2JJ9A 4F6RC 3OKQA 3AE6A 5L3GB 4PK5A 1MNDA 2KMFA 1XMOT 1HX1B 3UQ7A 2Q9QB 4CQIA 5HEGA 2I59A 5HWXA 3Q5DA 4PAGA 2WB5A 4QWNB 5DABA 4COFA 2XUEA 5LBQB 4KMCA 2HN1A 4DV3T 3ZMSB 2E9XC 5LA6E 3PE0A 2NOXA 3ZC1A 1IBMT 2C0SA 4EB6E 5JDGA 3P4WA 2XAHB 4TX5A 3K3NA 2K24A 3N9OA 3HR0A 2MPKA 2B76A 2JMHA 2XJ7A 4OK0A 3D0TA 2BG9B 4C91A 2V8SV 1KNRA 2YINA 4IE0A 5LHIB 3S4UA 2V6YB 4GOUA 4AKRB 2VKDA 2CHOA 5LB7B 4HFIA 3Q5XA 3N9LA 5HEUA 2Q9QD 1N36T 1D0ZA 4U72A 4KX6A 2MOZA 3BQLA 2BS3A 4ZEYA 2JQ9A 2WMOA 5JRCB 4HFBA 4GKKT 4P1NA 2BKNA 3AE5A 5J1GA 5FXWA 1OEDB 3FB2A 5JR9A 5C2TA 3E0ZA 2XAQB 3AE3A 3PU8A 3U3IA 4PK6A 4KUMB 1V9DA 2DHRA 3ANWB 2X0LB 3O1JA 4LMKA 3FXEB 4JI4T 1U5PA 5JVDE 3NZQA 3UUMA 4Z91A 4UR9A 3ZMVB 5JDQA 2W66A 5CJ5A 2RPAA 2VVSA 4O8SA 1U4QA 5ADXL 5C3JA 1IJ5A 3K3QC 1X79A 1T72A 5J0ZA 4ZI3C 4YHHT 3NRXA 5FKYA 4UV9B 3KV9A 2WU5A 3BQIA 4LF8T 2LOPA 3RC3A 5HYAA 2V6XA 3KFWX 1G8XA 2W62A 4OYKA 5DQWA 3EDUA 4ZS2A 1SHZC 3EAMA 2E2AA 3I9YA 4IDOA 4ZI7E 5FXVA 2UUBT 1ZHCA 4AXPA 2L3LA 2X51A 3RHWA 2D0TA 5C8YE 3AXJB 2Q9QA 4UVAB 2W2UA 5LCYA 2FJAA 4HWIB 3AE8A 2I0MA 2VVNA 4CXXA 1UX4A 2ES0A 3DTOA 5KDMC 2EHOA 4DR1T 5FY7A 3RQWA 4P0AA 2BBJA 3JADA 3RYFE 1HG5A 2LM9A 3FBLA 5FMNA 2UUAT 3O1HA 2ODVA 3CK6A 5L4HA 4AQGA 2LSIA 4A56A 4EEDA 2LLYA 2BVLA 5F5WA 5HCMA 2B1EA 5JRCA 1WYBA 3ZLIA 4U2ZA 1UURA 4NUUA 4X5TA 2UUCT 1N33T 1W0AA 3MXZA 2Y8DA 4LF4T 3FZMB 2UXDT 3MACA 1HNXT 2OLTA 4DV6T 2DI4A 1ZOYA 5FL0A 1J5ET 3G06A 4UELA 3AB3B 2WQYA 5HEOA 2XQ6A 5HCJA 3LK2B 2JQHA 2XASB 2BKPA 4DUYT 4JI8T 1HG2A 5AFUL 2NTXA 4PJLA 3U78A 4A97A 5ABEA 3IF8B 2SPCA 4AKHA 2I6HA 5JR9C 4L0RA 2X0HA 1UK5A 4JI6T 2WDQA 2IUBA 4EXTA 3ZN0B 3ZSSA 2VKOA 3RIAA 1YQ3A 2CMRA 4AISA 1J5WA 1LVFA 4IDPA 2D9DA 5F8PA 4YSZA 3WI3A 2E8IA 4UF0B 2J4GA 2CM0A 2E5VA 5AQSB 4OFZA 1BR2A 2H88A 2K9AA 4PJJA 2FBWA 2VKJA 1QLBA 5JDLA 4YHJA 2UXBT 5LOVE 1W9RA 2C5IT 4LFCT 2A3DA 3RGLA 4HWFA 2CXLA 3UULA 4OHFA 4WZXA 1VCSA 3ONXA 2W67A 3O4XE 2CA5A 4ISSA 2XAJB 5FXZA 1HX8A 3RKOA 3AA6B 4TNWA 2WZIA 3T8OA 3ZYKA 3UU4A 3P50A 2W4XA 3H3AA 4ZZCA 4ZHQE 3HI2A 4IREA 1Z8UA 2LHNA 4H9OC 3CVRA 3T1YT 3LK3B 2KT9A 5JREA 1CHUA 2NWBA 4JEHB 2VL8A 3AAAB 3AA7B 1KFYA 2EHOC 3NKZA 4GKJT 3ZCJA 4ILAA 4EZ4A 4LF5T 4HFDA 4N78D 2V1DB 4XBFB 3N9QA 1CUNA 2VWAA 2IW5B 4L9IA 4H9PC 2V26A 3GA8A 4I4TE 3UTKA 3HL6A 1NWMX 5DJQC 3ZJ1A 2VL0A 2RP4A 2YDQA 3ZYMA 1MMAA 4TNVA 3KV4A 4TWDA 4M1PA 2CPTA 1JNRA 2CXFA 5HAXA 3AA0B 1HR0T 1MIYA 2X66A 3SFDA 4YSXA 5LMNT 4JV5T 3UQ4A 1YQ4A 3AVRA 4QKNA 2QYWA 4LF9T 4ZOLE 5FYMA 3F57A 2VASA 1MMGA 2YU2A 3RIFA 2WWVA 2QGSA 2WSSV 2WBLA 4A5XA 1HTJF 2KZ7B 3WAJA 5F3JA 3HA4A 4DO0A 5A1LA 1N34T 2BS2A 3M3ZB 5DQVA 4MALA 1US7B 3KVAA 3RRCA 1UX5A 1E2AA 3PJAJ 4EAHA 1D1CA 4BJNA 2NW8A 1UGOA 3QUJA 5H6QB 4DBQA 4HFVA 4UVCB 5EZYE 3ONLC 5HXRA 2WDRA 2FUPA 3O9XA 4DNDA 4J2CA 2R6GF 4X1YE 2IHR1 3J9X1 2XM1A 3KINB 4HN9A 2LKGA 2VQFT 4ISTA 1NAFA 3SRZA 5ABGA 4TV9E 4Z8XA 4X20E 2GK9A 4JLEA 3E08A 5EK2A 2XSBA 3ZPOA 1D1BA 3QK6A 2A72A 4PJNA 2CBIA 2LHRA 4YJ2E 1B7TA 1FJGT 3A7MA 1D0YA 2ZM2A 2LSJA 3AEEA 1NEKA 2UXCT 4WBNE 4O4LE 3MKDA 4U3CA 4LFBT 3O1IA 4CI1B 3PURA 4MFRA 4KHPT 4ASKA 1MIVA 1UUSA 3VRBA 3I0QA 2DWKA 4H9SE 3ABVA 3QB5A 2OA5A 5JQGE 4IE4A 2LSYA 2WCAA 2NW7A 3Q5EA 4IDQA 1WCRA 2H3RA 2CE7A 2DWGA 1XDOA 4DV2T 3HKCE 3VKHA 3KDSE 2Y48B 1SE7A 2X9WA 2RA1A 3TLTA 4YLHA 3MA9A 4IDZA 3LDQB 1IZNB 4PJMA 3AEAA 3Q9DA 3T1HT 3ZEFB 4IL4A 4ZI2C 1FMVA 1KK7A 2C5JA 2HPLA 4I55E 3N9NA 3P8CD 4IE5A 1Z0PA 3M65A 3H37A 2W61A 3CX6B 2WAUA 3LFMA 5IYZE 3C4ZA 4HTEA 2QVAA 4DVDA 4ILCA 2BZBA 5AQQB 2X0YA 1Y01A 3ZMUB 3GN5B 3JC6D 4MBQA 4OYJA 3I0OA 3RRWA 2LM2A 1IBKT 1HFAA 4QXHB 4TN7B 1X9BA 1OWAA 3CKDA 3P4RA 3AEGA 1E7PA 1XWMA 5KMGP 3N2GE 2FJBA 4UEMA 1KNPA 4X66T 3R84B 3PUAA 4LF6T 5LHHB 4HKAA 5FP3A 2PBIA 3F31A 3B13A 3N9MA 4DMWA 2XAFB 2E9XD 3AECA 2XQ5A 5FL1A 2AXDS 3AE4A 3DJBA 2X9HA 2BG9A 3UUBA 3QNUA 3C64A 2V6YA 3KBTA 3PUSA 1N32T 3JAFA 3RQUA 2H7OA 2CHNA 2CLYC 5FNVE 5LBMA 4PK4A 4A98A 1KF6A 2LSKA 2W0GA 2CEAA 3AE9A 4XZCA 5L47A 3RH3A 4QX8B 5KX5E 3PU3A 3L39A 3IBPA 4DUZT 2BG9E 4PFPA 4EYUA 5L3EB 1OEDA 2FJDA 4U7YA 3FZLB 5HWYA 3J7Yq 1HNWT 3FZFB 5FY0A 4GK5E 3ANWA 3UFGA 2A2FX 2VK9A 3PUWF 4JBWF 5EK4A 3VR8A 1EZ3A 1M7KA 3OPCA 2BKOA 4CI2B 1KNZA 4QH1A 4IL9A 1OEDE 3CQCB 1D0XA 2N1GA 4QX7B 5IHYA 3UFEA 4ERRA 1XZYA 1T8BA 1HCIA 3VRAA 2C5KT 4ANJA 3FZHB 1IBLT 3AAEB 4K0UA 3QOFA 5AQGB 4X62T 1XNQT 4ZI3D 2JPFA 5ABFB 4GYSA 3K8PC 4IHJE 1YW0A 5ETWA 2V7KA 4ZI2D 1UCUA 4U74A 3CX7B 4QH5A 1XDPA 3C4XA 5L3CB 3KV5A 4UV8B 3RYHE 2WWUA 4GYRA 4E7SA 1SA0E 4P0BA 3AXJA 4ILBA 1HS7A 2QA7A 1ZKEA 2ZMAA 4ZZBA 1ZP0A 2FJEA 4U2YA 4AKGA 3ZT5A 4EYYR 4C90A 4BA9A 3VKGA 2YK0A 3CQXC 3EABA 2V5CA 2D2SA 3P4SA 3BQKA 4O4HE 4IGUA 2V7IA 4LMJA 5CA1E 4TV8E 2JQQA 2XQ4A 4EOZB 2A9UA 4YFSA 2XQYA 4DR7T 4BJMA 2XTLA 3AA1B 4EEBA 2M6BA 3AEBA 3KVBA 2Q9QC 1QUUA 4UVBB 2WDVA 3TLWA 4CN1A 4HWCA 3MK7C 5AQRB 4X65T 1YKEB 2BS4A 4X1KE 5L4EA 2DNXA 5AQVB 4JI1T 1L0VA 5JDFA 4JI5T 4DBRA 4AQFA 4WNKA 1H7CA 4IDNA 1XNRT 3FHNA 2WY2A 2L9QA 3JAEA 5LG4A 2M67A 1VOMA 3EUHA 4CI3B 3N9PA 2H89A 2K3WA 2BG9C 2XZEA 4PFOA 1I6ZA 4DV4T 3WAKA 4DR2T 5JR9B 2X9YA 2DCFA 1W09A 3RKGA 4NUVA 4NIQA 3NBXX 4DMVA 2LEHA 2JQKA 4LF7T 4ILUA 3UU8A 5LYJE 5H6RB 2KWIB 1BR4A 4WYVA 3PUGA 3PUYF 3K3OA 3AEDA 3NWIA 3C51A 4TWFA 4FI5A 1Y64B 4HFCA 2J62A 3R6NA 5AQUB 1MMNA 3ZT7A 4HEAA 1GQEA 1OEDC 2WM9A 3SWHA 3CQGB 3LJCA 4NPPA 2MBGA 5FVLA 5ABHA 4QXCB 4HWHA 3HKDE 3B5MA 5HXCA 3RI5A 3F2EA 2HH7A 1NENA 2XQAA 3V5SA 1I94T 3QC9A 4JI3T 4UF0A 3PUVF 5AQOB 4DV7T 3CIRA 2KSRA 2BBHA 3MZKB 3I1AA 2UXNB 1WRDA 4OX9T 5JDMA 3C98B 3ZT6A 2W00A 5CFBA 2MAWA 5AQTB 4AIUA 2XM2A 5CB4E 5GONE 3FBZA 3OYXA 2XQ3A 2YEVC 1WR0A 4IIJE 3IHRA 3EDVA 3K1SA 2ACXA 3GMIA 2IAKA 2ZM8A 2LRLA 2CCQA 3TLVA 4DV0T 3A8YC 4DR6T 1SUMB 4YY3T 4B3TT 3EVYA 2KNDA 2EHOB 2YU1A 3RIUA 5LMUT 4DV1T 3ZMZB 2XPKA 4L5GA 3TLUA 4AQYT 4BAYB 1ZEEA 3IA3A 4IE7A 5J2UE 4O4IE 5JTGA 2D5UA 3LG7A 2LE8A 1MIWA 3P4PA 4I50E 4WW0A 5E0OA 4LFAT 1OXZA 5AQPB 1JNZA 1YXRA 3B57A 3L3PA 4WBOA 4X64T 2ODUA 4DR3T 3P7IA 5LNKA 3PTRB 5LP6E 1XMQT 1HNZT 3ETVA 3MJXA 2E5LT 4I43B 2EHOD 2K48A 4H63H 4H9NC 5EK3A 2AE9A 4EV6A 2IIUA 3UUNA 2W63A 4YT0A 2VKHA 3ZCIA 2VQET 2YOEA 1BR1A 2V7LA 5FVKA 4AQFC 5L3BB 4DR5T 3BK9A 2XSAA 5HXEA 2J47A 3N5LA 1T98A 3ZMTB 2KINB 1ZV4X 4HGAA 2N9DA 4PNIA 3OJAA 5AQFB 4B3MT 4MLKA 4ZS3A 2E9XB 3SS1A 2LJLA 4LMLA 3RYIE 2WMNA 4B6XA 2IMLA 3SOLA 2NW9A 4K0KT 4H9QC 3PUQA 1W0BA 2V5DA 5JDNA 5KXJA 2IC9A 3PUZF 2Y6XA 2L8KA 4CZZB 5JH7E 2UU9T 4JYAT 2PG8A 2XY8B 3AAIA 4JEUB 4HFEA 3IEEA 2DL1A 3A5XA 4AI6A 4KHZF 2Z6EA 3TLSA 4DR4T 3GWHA 1G73A 4HE8A 3AEFA 1R8IA 3EI0A 2X68A 4QXBB 5LXTE 5AQIB 2UXXB 2N2NA 2P9BA 2BVMA 1WR6A 4CN6A 2PJQA 2KLQA 2CWYA 1FEWA 3LBXB 5LJNA 4MHCA 2H7VC 3ETUA 5LG3A
chains in the Genus database with same CATH topology
4AKGA 4PK6A 1IAPA 4KUMB 3AVRA 1O3XA 4QKNA 4EYYR 4C90A 1V9DA 2DHRA 4KP3C 3ANWB 4ZOLE 5FYMA 2X0LB 4BA9A 3O1JA 3VKGA 1IJ6A 3CPZA 2JRKA 2XAGB 2YK0A 2VASA 3CQXC 1MMGA 3ESLA 2YU2A 3F57A 3HKBE 2QGSA 3FXEB 2WSSV 2WBLA 2LT3A 1U5PA 5JVDE 1QSDA 3NZQA 2D2SA 4YJ3E 3UUMA 1HTJF 2KZ7B 3BQKA 3WAJA 5F3JA 3HA4A 4O4HE 3ZMVB 4IGUA 5JDQA 4AKIA 4DO0A 2V7IA 5A1LA 2NP9A 4G63A 4O8SA 5CA1E 1U4QA 4TV8E 5ADXL 5TAOA 1FMWA 2JQQA 1IJ5A 4EOZB 3K3QC 1X79A 4YFSA 5DQVA 4MALA 3FXDB 1US7B 3KVAA 3RRCA 2K5BB 1VRBA 2XQYA 4BJMA 1UX5A 4ZI3C 4EAHA 2XTLA 1D1CA 1WLXA 4BJNA 2NW8A 2ZLYA 3NRXA 3QUJA 3AA1B 5H6QB 4DBQA 4UV9B 4HFVA 3KV9A 3KVBA 2Q9QC 5JDHA 1QUUA 4UVCB 5EZYE 5HXRA 3BQIA 4UVBB 1BR0A 3KBUA 3MK7C 2LOPA 2X67A 3I9WA 3NRYA 1YKEB 3RC3A 5HYAA 3KFWX 2V7MA 3CWZB 1G8XA 4X1KE 2DNXA 2W62A 2G0UA 3TKLB 4OYKA 5DQWA 3N2KE 4E7ZA 5JDFA 3O9XA 3ZYLA 4DNDA 3ZC0A 4J2CA 3EDUA 4ZS2A 4DBRA 4X1YE 4AQFA 1YKHB 4WNKA 1H7CA 1MMDA 3J9X1 3FHNA 3KINB 1SHZC 4HN9A 3I9YA 2L9QA 4ISTA 5LG4A 4ZI7E 1NAFA 3SRZA 5FXVA 2M67A 3ZJ2A 1VOMA 4TV9E 4TUYE 3EUHA 4CI3B 3N9PA 1ZHCA 4AXPA 2L3LA 2X51A 4Z8XA 4X20E 2GK9A 4X1IE 4JLEA 3E08A 5EK2A 2VB6A 3ZPOA 4PFOA 2D0TA 1D1BA 3QK6A 3WAKA 5C8YE 3DP7A 5JR9B 2A72A 2X9YA 2Q9QA 4PJNA 2DCFA 4UVAB 2LHRA 4NUVA 4YJ2E 5LCYA 1B7TA 3NBXX 2E9XA 4DMVA 2LEHA 2IC6A 1D0YA 4KBMB 1MNEA 4ILUA 2ZM2A 2LSJA 2NTYA 1S35A 5LYJE 5H6RB 2KWIB 1BR4A 3PUGA 5HXHA 4V1Av 4CXXA 4WBNE 1UX4A 3K3OA 3ZN1B 2D0UA 4GIWA 5FY1A 3E22E 3GN5A 3C51A 2ZM0A 2MTQA 4O4LE 3MKDA 4FI5A 2ES0A 3DTOA 5L3FB 1Y64B 3OYZA 2EHOA 5KDMC 3R6NA 5FY7A 1S94A 3O1IA 4P0AA 4CI1B 4UIGA 3PURA 1MMNA 4MFRA 1AJ3A 5LGUB 3RYFE 1HG5A 4HEAA 4ASKA 4P09A 1MIVA 2LM9A 3FBLA 5FMNA 2V7JA 2WM9A 3SWHA 3CQGB 3I0QA 5J2TE 2DWKA 4H9SE 3LJCA 2MBGA 2OA5A 4FJOA 5JQGE 4QXCB 3O1HA 2CLYB 2ODVA 4IE4A 2LSYA 2NW7A 3RPUA 2MYSA 3HKDE 2H3RA 2CE7A 5HXCA 2DWGA 3N2OA 3F2EA 2HH7A 4AQGA 3V5SA 2LSIA 4A56A 3QC9A 2DLRA 4UF0A 2BVLA 4ADZA 2X9XA 2BDEA 4H9RC 3HKCE 2B1EA 5JRCA 1WYBA 3VKHA 3ZLIA 3KDSE 2CXDA 2Y48B 3MZKB 3I1AA 1YD8G 2UXNB 4EZHA 1WRDA 4NUUA 3C50A 2X9WA 2RA1A 5JDMA 3KV6A 3C98B 4YLHA 3MA9A 4IDZA 2W00A 1IZNB 3MXZA 3OBVE 4PJMA 3Q9DA 5L2LA 2Y8DA 2PFVA 3ZEFB 3LBXA 4O4JE 3MACA 4O2AE 5CB4E 3RX6A 5GONE 4ZI2C 3FBZA 4CXYA 1FMVA 1KK7A 2C5JA 1HF8A 2HPLA 3OYXA 3N9NA 3P8CD 4I55E 2YEVC 4IE5A 2KXPB 1LRZA 1Z0PA 3M65A 3Q2MA 4O2BE 4IIJE 2JMKA 3HKEE 3IHRA 3H37A 5FXXA 4XAXB 3EDVA 2DI4A 5M4YA 3Q5WA 3RYCE 3C4WA 2W61A 3CX6B 3UUXB 2WAUA 2CWOA 2ACXA 3GMIA 3LFMA 5IYZE 4UELA 5BMVE 2IAKA 3CMLA 2ZM8A 4G2AA 3C4ZA 4HTEA 3V5UA 3AB3B 4UXNB 4DVDA 2BZBA 2CCQA 3ZMUB 3LK2B 3GN5B 3JC6D 4MBQA 4OYJA 2XASB 3I0OA 3RRWA 1LVKA 3W15B 1HG2A 3EVYA 2KNDA 5AFUL 2EHOB 2NTXA 2YU1A 2J1DG 4PJLA 2LSGA 1HFAA 3NZPA 4TZ4C 3U78A 3IF8B 5CA0E 3ZMZB 4QXHB 4L5GA 4TN7B 4BAYB 3CKDA 1OWAA 3VHLA 1ZEEA 4QHOA 4JUYA 2SPCA 4IE7A 5J2UE 4O4IE 4AKHA 5JR9C 4L0RA 2D5UA 5LGNB 5KMGP 3LG7A 2LE8A 3N2GE 1MIWA 4PW8A 4UEMA 4I50E 5LJMA 4WW0A 4EXTA 3R84B 3ZN0B 5E0OA 3PUAA 1OXZA 2VKOA 5LHHB 5L3DB 2CMRA 1FIOA 4HKAA 3L09A 1LVFA 3B57A 4EIWA 3L3PA 5FP3A 2PBIA 4WBOA 2LOSA 1E1HB 2ODUA 3F31A 5F8PA 3B13A 3N9MA 4H63V 4AKLA 4DMWA 3P7IA 2XAFB 2E9XD 3WI3A 2E8IA 5LNKA 1LKXA 4GK0E 4UF0B 3PTRB 2CM0A 5LP6E 3DJBA 2X9HA 4OFZA 1BR2A 2XHEB 3C64A 3ETVA 2K9AA 3KBTA 3MJXA 3PUSA 3LK42 3CX8B 4I43B 3PDYA 4PJJA 2KWHA 2EHOD 2VKJA 2K48A 3RC8A 2H7OA 5LBMA 2CLYC 5FNVE 5JDLA 4H63H 4PK4A 4YHJA 5LHGB 5LOVE 4H9NC 5EK3A 2LSKA 3UUNA 2C5IT 2W0GA 2W63A 2CEAA 1D1AA 2HPJA 3UT5E 4XZCA 2VKHA 3ZCIA 2A3DA 3RH3A 3JC6C 4QX8B 1BR1A 2V7LA 5KX5E 3PU3A 1WYCA 5HXSA 3IBPA 4IE6A 5LGTB 2CXLA 4PFPA 3UULA 4OHFA 4EYUA 4AQFC 5L3BB 3BK9A 5L3EB 3VU7H 3ONXA 4CXWA 5HXEA 3O4XE 3AVSA 2JJ9A 2CA5A 4ISSA 4F6RC 3N5LA 1T98A 3OKQA 3ZMTB 2XAJB 5FXZA 1HX8A 2KINB 3AA6B 1ZV4X 4HGAA 5HWYA 3RKOA 5L3GB 3J7Yq 2N9DA 4PK5A 4PNIA 1MNDA 2KMFA 3OJAA 5FY0A 4GK5E 3T8OA 3ZYKA 2Q9QB 4CQIA 3ANWA 2I59A 5HWXA 4MLKA 2A2FX 2VK9A 4PAGA 4ZS3A 4QWNB 5DABA 2E9XB 5EK4A 1EZ3A 2LJLA 3H3AA 3SS1A 2XUEA 4ZHQE 5LBQB 3HI2A 4KMCA 3RYIE 2LHNA 3ZMSB 4CI2B 2E9XC 2WMNA 1KNZA 5LA6E 4B6XA 4H9OC 3PE0A 2NOXA 3ZC1A 3CVRA 3SOLA 2C0SA 4EB6E 2NW9A 5JDGA 2XAHB 4H9QC 3LK3B 4TX5A 2KT9A 3CQCB 3PUQA 5JREA 1D0XA 3K3NA 2N1GA 2NWBA 2K24A 3N9OA 4JEHB 5JDNA 3HR0A 2IC9A 2VL8A 4QX7B 5IHYA 2JMHA 3AAAB 3AA7B 2EHOC 3UFEA 4ERRA 3ZCJA 4OK0A 3D0TA 2Y6XA 4C91A 2YINA 2L8KA 4IE0A 5LHIB 1HCIA 3S4UA 4EZ4A 2C5KT 4CZZB 5JH7E 4GOUA 4AKRB 4ANJA 3AAEB 4K0UA 2VKDA 4N78D 2V1DB 4XBFB 4ZI3D 2JPFA 3Q5XA 3N9QA 4GYSA 3K8PC 3N9LA 2PG8A 1CUNA 3AAIA 4IHJE 1YW0A 2VWAA 2IW5B 2Q9QD 4JEUB 4H9PC 4L9IA 5ETWA 3IEEA 2V7KA 4ZI2D 2V26A 3GA8A 1D0ZA 1UCUA 4U72A 3A5XA 2MOZA 3BQLA 4I4TE 4U74A 3UTKA 3HL6A 4AI6A 3CX7B 2WMOA 2Z6EA 5JRCB 1NWMX 3C4XA 5L3CB 3KV5A 4UV8B 5DJQC 3GWHA 1G73A 3RYHE 4HE8A 3ZJ1A 2RP4A 2X68A 4QXBB 5LXTE 2WWUA 4GYRA 2UXXB 2N2NA 3ZYMA 2P9BA 1MMAA 2BVMA 4E7SA 1WR6A 1SA0E 3KV4A 4M1PA 4P0BA 5J1GA 5FXWA 5JR9A 3FB2A 2PJQA 2KLQA 2CXFA 1HS7A 2CWYA 5HAXA 1FEWA 1ZKEA 2QA7A 3AA0B 3LBXB 3E0ZA 2ZMAA 2XAQB 5LJNA 1MIYA 2X66A 4MHCA 2H7VC 3ETUA 3PU8A 3U3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSK A;  2N1G A;  4GK5 E;  3VU7 H;  4BA9 A;  2LSJ A;  2LSY A;  4GK0 E;  2LSI A;  2LSG A;  4EXT A;  4FJO A; 
#chains in the Genus database with same CATH topology
 2LRK A;  1IAP A;  1O3X A;  4KP3 C;  2WS3 A;  3NVO A;  1IJ6 A;  2XAG B;  2JRK A;  3CPZ A;  3ESL A;  3HKB E;  4I0U A;  2LT3 A;  1QSD A;  4YJ3 E;  4QH4 A;  2LKH A;  4AKI A;  2NP9 A;  5AQM B;  4G63 A;  3JCF A;  5TAO A;  1FMW A;  4U31 A;  4YTP A;  4NXM T;  3FXD B;  2K5B B;  1VRB A;  5AQH B;  1WLX A;  4YSY A;  2ZLY A;  3RIU C;  5JDH A;  4KI0 F;  2M6I A;  1BR0 A;  3KBU A;  2VUR A;  2X67 A;  3I9W A;  3NRY A;  2V7M A;  3CWZ B;  2YN6 A;  3TKL B;  2G0U A;  3N2K E;  4E7Z A;  3ZYL A;  5BR8 T;  3ZC0 A;  3PJA A;  1YKH B;  1MMD A;  3QB5 K;  2ACZ A;  3ZJ2 A;  2F4V T;  4TUY E;  4F8H A;  4NXN T;  4YTN A;  3PUX F;  3FZK B;  4X1I E;  2VB6 A;  1J1J A;  3DP7 A;  3RLF F;  2E9X A;  2IC6 A;  4KBM B;  1MNE A;  2NTY A;  2OV9 A;  1S35 A;  3P4Q A;  3X1D A;  4B3R T;  5IWA T;  5HXH A;  3UU5 A;  4V1A v;  3ZN1 B;  2D0U A;  4GIW A;  5FY1 A;  3E22 E;  3GN5 A;  2ZM0 A;  2HN2 A;  2MTQ A;  5L3F B;  3OYZ A;  1S94 A;  3LSV A;  4UIG A;  1AJ3 A;  5HEJ A;  5LGU B;  4JI0 T;  4P09 A;  2CBJ A;  2V7J A;  2YKS A;  5AQK B;  5J2T E;  2IDO B;  4FJO A;  2PTF A;  2CLY B;  3RPU A;  2MYS A;  2JIW A;  3N2O A;  2YDR A;  4CN4 A;  5AQJ B;  1KEY A;  2WU2 A;  2DLR A;  5IUX A;  3RF1 A;  4ADZ A;  2X9X A;  2BDE A;  4H9R C;  2CXD A;  1YD8 G;  4EZH A;  3C50 A;  3KV6 A;  3L8R A;  3H3M A;  2WP9 A;  3OBV E;  5L2L A;  2PFV A;  3LBX A;  4O4J E;  4O2A E;  3RX6 A;  3UU6 A;  4CXY A;  1HF8 A;  2QRX A;  4YTM A;  4Q25 A;  4JI7 T;  2KXP B;  1LRZ A;  3Q2M A;  4O2B E;  2JMK A;  3HKE E;  4YXD A;  5HEH A;  5FXX A;  4XAX B;  5M4Y A;  3Q5W A;  3RYC E;  3C4W A;  4U33 A;  3UUX B;  2CWO A;  4B3S T;  5BMV E;  3CML A;  4G2A A;  4HWD A;  2XQ7 A;  3V5U A;  4UXN B;  4DV5 T;  4HFH A;  2XQ8 A;  3OVU A;  3AE1 A;  2XQ9 A;  1LVK A;  3W15 B;  1WFD A;  2J1D G;  2LSG A;  3NZP A;  4TZ4 C;  3UU3 A;  5CA0 E;  4U7I A;  3VHL A;  3ZST A;  4QHO A;  4JUY A;  5LGN B;  4PW8 A;  5LJM A;  4Z90 A;  4EGW A;  5AQL B;  2YDS A;  5L3D B;  1FIO A;  1T7S A;  3EHZ A;  3L09 A;  4EIW A;  2CRB A;  2LOS A;  1E1H B;  3AE2 A;  4H63 V;  4AKL A;  1LKX A;  4GK0 E;  2WZH A;  3AE7 A;  2NR4 A;  2XHE B;  2HHH T;  2ZM6 T;  3LK4 2;  3CX8 B;  3PDY A;  2KWH A;  3SFE A;  5ABF A;  4IT4 A;  3RC8 A;  5AQN B;  3OTO T;  5CGM A;  5LHG B;  3PV0 F;  4JI2 T;  1VCT A;  1D1A A;  2HPJ A;  3UT5 E;  3JC6 C;  1M62 A;  1WYC A;  4ZXL A;  3ONJ A;  3VR9 A;  5HXS A;  1DU2 A;  3ZKR A;  4TWH A;  4IE6 A;  4DID B;  5LGT B;  3VU7 H;  4CXW A;  3AVS A;  2JJ9 A;  4F6R C;  3OKQ A;  3AE6 A;  5L3G B;  4PK5 A;  1MND A;  2KMF A;  1XMO T;  1HX1 B;  3UQ7 A;  2Q9Q B;  4CQI A;  5HEG A;  2I59 A;  5HWX A;  3Q5D A;  4PAG A;  2WB5 A;  4QWN B;  5DAB A;  4COF A;  2XUE A;  5LBQ B;  4KMC A;  2HN1 A;  4DV3 T;  3ZMS B;  2E9X C;  5LA6 E;  3PE0 A;  2NOX A;  3ZC1 A;  1IBM T;  2C0S A;  4EB6 E;  5JDG A;  3P4W A;  2XAH B;  4TX5 A;  3K3N A;  2K24 A;  3N9O A;  3HR0 A;  2MPK A;  2B76 A;  2JMH A;  2XJ7 A;  4OK0 A;  3D0T A;  2BG9 B;  4C91 A;  2V8S V;  1KNR A;  2YIN A;  4IE0 A;  5LHI B;  3S4U A;  2V6Y B;  4GOU A;  4AKR B;  2VKD A;  2CHO A;  5LB7 B;  4HFI A;  3Q5X A;  3N9L A;  5HEU A;  2Q9Q D;  1N36 T;  1D0Z A;  4U72 A;  4KX6 A;  2MOZ A;  3BQL A;  2BS3 A;  4ZEY A;  2JQ9 A;  2WMO A;  5JRC B;  4HFB A;  4GKK T;  4P1N A;  2BKN A;  3AE5 A;  5J1G A;  5FXW A;  1OED B;  3FB2 A;  5JR9 A;  5C2T A;  3E0Z A;  2XAQ B;  3AE3 A;  3PU8 A;  3U3I A;  4PK6 A;  4KUM B;  1V9D A;  2DHR A;  3ANW B;  2X0L B;  3O1J A;  4LMK A;  3FXE B;  4JI4 T;  1U5P A;  5JVD E;  3NZQ A;  3UUM A;  4Z91 A;  4UR9 A;  3ZMV B;  5JDQ A;  2W66 A;  5CJ5 A;  2RPA A;  2VVS A;  4O8S A;  1U4Q A;  5ADX L;  5C3J A;  1IJ5 A;  3K3Q C;  1X79 A;  1T72 A;  5J0Z A;  4ZI3 C;  4YHH T;  3NRX A;  5FKY A;  4UV9 B;  3KV9 A;  2WU5 A;  3BQI A;  4LF8 T;  2LOP A;  3RC3 A;  5HYA A;  2V6X A;  3KFW X;  1G8X A;  2W62 A;  4OYK A;  5DQW A;  3EDU A;  4ZS2 A;  1SHZ C;  3EAM A;  2E2A A;  3I9Y A;  4IDO A;  4ZI7 E;  5FXV A;  2UUB T;  1ZHC A;  4AXP A;  2L3L A;  2X51 A;  3RHW A;  2D0T A;  5C8Y E;  3AXJ B;  2Q9Q A;  4UVA B;  2W2U A;  5LCY A;  2FJA A;  4HWI B;  3AE8 A;  2I0M A;  2VVN A;  4CXX A;  1UX4 A;  2ES0 A;  3DTO A;  5KDM C;  2EHO A;  4DR1 T;  5FY7 A;  3RQW A;  4P0A A;  2BBJ A;  3JAD A;  3RYF E;  1HG5 A;  2LM9 A;  3FBL A;  5FMN A;  2UUA T;  3O1H A;  2ODV A;  3CK6 A;  5L4H A;  4AQG A;  2LSI A;  4A56 A;  4EED A;  2LLY A;  2BVL A;  5F5W A;  5HCM A;  2B1E A;  5JRC A;  1WYB A;  3ZLI A;  4U2Z A;  1UUR A;  4NUU A;  4X5T A;  2UUC T;  1N33 T;  1W0A A;  3MXZ A;  2Y8D A;  4LF4 T;  3FZM B;  2UXD T;  3MAC A;  1HNX T;  2OLT A;  4DV6 T;  2DI4 A;  1ZOY A;  5FL0 A;  1J5E T;  3G06 A;  4UEL A;  3AB3 B;  2WQY A;  5HEO A;  2XQ6 A;  5HCJ A;  3LK2 B;  2JQH A;  2XAS B;  2BKP A;  4DUY T;  4JI8 T;  1HG2 A;  5AFU L;  2NTX A;  4PJL A;  3U78 A;  4A97 A;  5ABE A;  3IF8 B;  2SPC A;  4AKH A;  2I6H A;  5JR9 C;  4L0R A;  2X0H A;  1UK5 A;  4JI6 T;  2WDQ A;  2IUB A;  4EXT A;  3ZN0 B;  3ZSS A;  2VKO A;  3RIA A;  1YQ3 A;  2CMR A;  4AIS A;  1J5W A;  1LVF A;  4IDP A;  2D9D A;  5F8P A;  4YSZ A;  3WI3 A;  2E8I A;  4UF0 B;  2J4G A;  2CM0 A;  2E5V A;  5AQS B;  4OFZ A;  1BR2 A;  2H88 A;  2K9A A;  4PJJ A;  2FBW A;  2VKJ A;  1QLB A;  5JDL A;  4YHJ A;  2UXB T;  5LOV E;  1W9R A;  2C5I T;  4LFC T;  2A3D A;  3RGL A;  4HWF A;  2CXL A;  3UUL A;  4OHF A;  4WZX A;  1VCS A;  3ONX A;  2W67 A;  3O4X E;  2CA5 A;  4ISS A;  2XAJ B;  5FXZ A;  1HX8 A;  3RKO A;  3AA6 B;  4TNW A;  2WZI A;  3T8O A;  3ZYK A;  3UU4 A;  3P50 A;  2W4X A;  3H3A A;  4ZZC A;  4ZHQ E;  3HI2 A;  4IRE A;  1Z8U A;  2LHN A;  4H9O C;  3CVR A;  3T1Y T;  3LK3 B;  2KT9 A;  5JRE A;  1CHU A;  2NWB A;  4JEH B;  2VL8 A;  3AAA B;  3AA7 B;  1KFY A;  2EHO C;  3NKZ A;  4GKJ T;  3ZCJ A;  4ILA A;  4EZ4 A;  4LF5 T;  4HFD A;  4N78 D;  2V1D B;  4XBF B;  3N9Q A;  1CUN A;  2VWA A;  2IW5 B;  4L9I A;  4H9P C;  2V26 A;  3GA8 A;  4I4T E;  3UTK A;  3HL6 A;  1NWM X;  5DJQ C;  3ZJ1 A;  2VL0 A;  2RP4 A;  2YDQ A;  3ZYM A;  1MMA A;  4TNV A;  3KV4 A;  4TWD A;  4M1P A;  2CPT A;  1JNR A;  2CXF A;  5HAX A;  3AA0 B;  1HR0 T;  1MIY A;  2X66 A;  3SFD A;  4YSX A;  5LMN T;  4JV5 T;  3UQ4 A;  1YQ4 A;  3AVR A;  4QKN A;  2QYW A;  4LF9 T;  4ZOL E;  5FYM A;  3F57 A;  2VAS A;  1MMG A;  2YU2 A;  3RIF A;  2WWV A;  2QGS A;  2WSS V;  2WBL A;  4A5X A;  1HTJ F;  2KZ7 B;  3WAJ A;  5F3J A;  3HA4 A;  4DO0 A;  5A1L A;  1N34 T;  2BS2 A;  3M3Z B;  5DQV A;  4MAL A;  1US7 B;  3KVA A;  3RRC A;  1UX5 A;  1E2A A;  3PJA J;  4EAH A;  1D1C A;  4BJN A;  2NW8 A;  1UGO A;  3QUJ A;  5H6Q B;  4DBQ A;  4HFV A;  4UVC B;  5EZY E;  3ONL C;  5HXR A;  2WDR A;  2FUP A;  3O9X A;  4DND A;  4J2C A;  2R6G F;  4X1Y E;  2IHR 1;  3J9X 1;  2XM1 A;  3KIN B;  4HN9 A;  2LKG A;  2VQF T;  4IST A;  1NAF A;  3SRZ A;  5ABG A;  4TV9 E;  4Z8X A;  4X20 E;  2GK9 A;  4JLE A;  3E08 A;  5EK2 A;  2XSB A;  3ZPO A;  1D1B A;  3QK6 A;  2A72 A;  4PJN A;  2CBI A;  2LHR A;  4YJ2 E;  1B7T A;  1FJG T;  3A7M A;  1D0Y A;  2ZM2 A;  2LSJ A;  3AEE A;  1NEK A;  2UXC T;  4WBN E;  4O4L E;  3MKD A;  4U3C A;  4LFB T;  3O1I A;  4CI1 B;  3PUR A;  4MFR A;  4KHP T;  4ASK A;  1MIV A;  1UUS A;  3VRB A;  3I0Q A;  2DWK A;  4H9S E;  3ABV A;  3QB5 A;  2OA5 A;  5JQG E;  4IE4 A;  2LSY A;  2WCA A;  2NW7 A;  3Q5E A;  4IDQ A;  1WCR A;  2H3R A;  2CE7 A;  2DWG A;  1XDO A;  4DV2 T;  3HKC E;  3VKH A;  3KDS E;  2Y48 B;  1SE7 A;  2X9W A;  2RA1 A;  3TLT A;  4YLH A;  3MA9 A;  4IDZ A;  3LDQ B;  1IZN B;  4PJM A;  3AEA A;  3Q9D A;  3T1H T;  3ZEF B;  4IL4 A;  4ZI2 C;  1FMV A;  1KK7 A;  2C5J A;  2HPL A;  4I55 E;  3N9N A;  3P8C D;  4IE5 A;  1Z0P A;  3M65 A;  3H37 A;  2W61 A;  3CX6 B;  2WAU A;  3LFM A;  5IYZ E;  3C4Z A;  4HTE A;  2QVA A;  4DVD A;  4ILC A;  2BZB A;  5AQQ B;  2X0Y A;  1Y01 A;  3ZMU B;  3GN5 B;  3JC6 D;  4MBQ A;  4OYJ A;  3I0O A;  3RRW A;  2LM2 A;  1IBK T;  1HFA A;  4QXH B;  4TN7 B;  1X9B A;  1OWA A;  3CKD A;  3P4R A;  3AEG A;  1E7P A;  1XWM A;  5KMG P;  3N2G E;  2FJB A;  4UEM A;  1KNP A;  4X66 T;  3R84 B;  3PUA A;  4LF6 T;  5LHH B;  4HKA A;  5FP3 A;  2PBI A;  3F31 A;  3B13 A;  3N9M A;  4DMW A;  2XAF B;  2E9X D;  3AEC A;  2XQ5 A;  5FL1 A;  2AXD S;  3AE4 A;  3DJB A;  2X9H A;  2BG9 A;  3UUB A;  3QNU A;  3C64 A;  2V6Y A;  3KBT A;  3PUS A;  1N32 T;  3JAF A;  3RQU A;  2H7O A;  2CHN A;  2CLY C;  5FNV E;  5LBM A;  4PK4 A;  4A98 A;  1KF6 A;  2LSK A;  2W0G A;  2CEA A;  3AE9 A;  4XZC A;  5L47 A;  3RH3 A;  4QX8 B;  5KX5 E;  3PU3 A;  3L39 A;  3IBP A;  4DUZ T;  2BG9 E;  4PFP A;  4EYU A;  5L3E B;  1OED A;  2FJD A;  4U7Y A;  3FZL B;  5HWY A;  3J7Y q;  1HNW T;  3FZF B;  5FY0 A;  4GK5 E;  3ANW A;  3UFG A;  2A2F X;  2VK9 A;  3PUW F;  4JBW F;  5EK4 A;  3VR8 A;  1EZ3 A;  1M7K A;  3OPC A;  2BKO A;  4CI2 B;  1KNZ A;  4QH1 A;  4IL9 A;  1OED E;  3CQC B;  1D0X A;  2N1G A;  4QX7 B;  5IHY A;  3UFE A;  4ERR A;  1XZY A;  1T8B A;  1HCI A;  3VRA A;  2C5K T;  4ANJ A;  3FZH B;  1IBL T;  3AAE B;  4K0U A;  3QOF A;  5AQG B;  4X62 T;  1XNQ T;  4ZI3 D;  2JPF A;  5ABF B;  4GYS A;  3K8P C;  4IHJ E;  1YW0 A;  5ETW A;  2V7K A;  4ZI2 D;  1UCU A;  4U74 A;  3CX7 B;  4QH5 A;  1XDP A;  3C4X A;  5L3C B;  3KV5 A;  4UV8 B;  3RYH E;  2WWU A;  4GYR A;  4E7S A;  1SA0 E;  4P0B A;  3AXJ A;  4ILB A;  1HS7 A;  2QA7 A;  1ZKE A;  2ZMA A;  4ZZB A;  1ZP0 A;  2FJE A;  4U2Y A;  4AKG A;  3ZT5 A;  4EYY R;  4C90 A;  4BA9 A;  3VKG A;  2YK0 A;  3CQX C;  3EAB A;  2V5C A;  2D2S A;  3P4S A;  3BQK A;  4O4H E;  4IGU A;  2V7I A;  4LMJ A;  5CA1 E;  4TV8 E;  2JQQ A;  2XQ4 A;  4EOZ B;  2A9U A;  4YFS A;  2XQY A;  4DR7 T;  4BJM A;  2XTL A;  3AA1 B;  4EEB A;  2M6B A;  3AEB A;  3KVB A;  2Q9Q C;  1QUU A;  4UVB B;  2WDV A;  3TLW A;  4CN1 A;  4HWC A;  3MK7 C;  5AQR B;  4X65 T;  1YKE B;  2BS4 A;  4X1K E;  5L4E A;  2DNX A;  5AQV B;  4JI1 T;  1L0V A;  5JDF A;  4JI5 T;  4DBR A;  4AQF A;  4WNK A;  1H7C A;  4IDN A;  1XNR T;  3FHN A;  2WY2 A;  2L9Q A;  3JAE A;  5LG4 A;  2M67 A;  1VOM A;  3EUH A;  4CI3 B;  3N9P A;  2H89 A;  2K3W A;  2BG9 C;  2XZE A;  4PFO A;  1I6Z A;  4DV4 T;  3WAK A;  4DR2 T;  5JR9 B;  2X9Y A;  2DCF A;  1W09 A;  3RKG A;  4NUV A;  4NIQ A;  3NBX X;  4DMV A;  2LEH A;  2JQK A;  4LF7 T;  4ILU A;  3UU8 A;  5LYJ E;  5H6R B;  2KWI B;  1BR4 A;  4WYV A;  3PUG A;  3PUY F;  3K3O A;  3AED A;  3NWI A;  3C51 A;  4TWF A;  4FI5 A;  1Y64 B;  4HFC A;  2J62 A;  3R6N A;  5AQU B;  1MMN A;  3ZT7 A;  4HEA A;  1GQE A;  1OED C;  2WM9 A;  3SWH A;  3CQG B;  3LJC A;  4NPP A;  2MBG A;  5FVL A;  5ABH A;  4QXC B;  4HWH A;  3HKD E;  3B5M A;  5HXC A;  3RI5 A;  3F2E A;  2HH7 A;  1NEN A;  2XQA A;  3V5S A;  1I94 T;  3QC9 A;  4JI3 T;  4UF0 A;  3PUV F;  5AQO B;  4DV7 T;  3CIR A;  2KSR A;  2BBH A;  3MZK B;  3I1A A;  2UXN B;  1WRD A;  4OX9 T;  5JDM A;  3C98 B;  3ZT6 A;  2W00 A;  5CFB A;  2MAW A;  5AQT B;  4AIU A;  2XM2 A;  5CB4 E;  5GON E;  3FBZ A;  3OYX A;  2XQ3 A;  2YEV C;  1WR0 A;  4IIJ E;  3IHR A;  3EDV A;  3K1S A;  2ACX A;  3GMI A;  2IAK A;  2ZM8 A;  2LRL A;  2CCQ A;  3TLV A;  4DV0 T;  3A8Y C;  4DR6 T;  1SUM B;  4YY3 T;  4B3T T;  3EVY A;  2KND A;  2EHO B;  2YU1 A;  3RIU A;  5LMU T;  4DV1 T;  3ZMZ B;  2XPK A;  4L5G A;  3TLU A;  4AQY T;  4BAY B;  1ZEE A;  3IA3 A;  4IE7 A;  5J2U E;  4O4I E;  5JTG A;  2D5U A;  3LG7 A;  2LE8 A;  1MIW A;  3P4P A;  4I50 E;  4WW0 A;  5E0O A;  4LFA T;  1OXZ A;  5AQP B;  1JNZ A;  1YXR A;  3B57 A;  3L3P A;  4WBO A;  4X64 T;  2ODU A;  4DR3 T;  3P7I A;  5LNK A;  3PTR B;  5LP6 E;  1XMQ T;  1HNZ T;  3ETV A;  3MJX A;  2E5L T;  4I43 B;  2EHO D;  2K48 A;  4H63 H;  4H9N C;  5EK3 A;  2AE9 A;  4EV6 A;  2IIU A;  3UUN A;  2W63 A;  4YT0 A;  2VKH A;  3ZCI A;  2VQE T;  2YOE A;  1BR1 A;  2V7L A;  5FVK A;  4AQF C;  5L3B B;  4DR5 T;  3BK9 A;  2XSA A;  5HXE A;  2J47 A;  3N5L A;  1T98 A;  3ZMT B;  2KIN B;  1ZV4 X;  4HGA A;  2N9D A;  4PNI A;  3OJA A;  5AQF B;  4B3M T;  4MLK A;  4ZS3 A;  2E9X B;  3SS1 A;  2LJL A;  4LML A;  3RYI E;  2WMN A;  4B6X A;  2IML A;  3SOL A;  2NW9 A;  4K0K T;  4H9Q C;  3PUQ A;  1W0B A;  2V5D A;  5JDN A;  5KXJ A;  2IC9 A;  3PUZ F;  2Y6X A;  2L8K A;  4CZZ B;  5JH7 E;  2UU9 T;  4JYA T;  2PG8 A;  2XY8 B;  3AAI A;  4JEU B;  4HFE A;  3IEE A;  2DL1 A;  3A5X A;  4AI6 A;  4KHZ F;  2Z6E A;  3TLS A;  4DR4 T;  3GWH A;  1G73 A;  4HE8 A;  3AEF A;  1R8I A;  3EI0 A;  2X68 A;  4QXB B;  5LXT E;  5AQI B;  2UXX B;  2N2N A;  2P9B A;  2BVM A;  1WR6 A;  4CN6 A;  2PJQ A;  2KLQ A;  2CWY A;  1FEW A;  3LBX B;  5LJN A;  4MHC A;  2H7V C;  3ETU A;  5LG3 A; 
#chains in the Genus database with same CATH homology
 4AKG A;  4PK6 A;  1IAP A;  4KUM B;  3AVR A;  1O3X A;  4QKN A;  4EYY R;  4C90 A;  1V9D A;  2DHR A;  4KP3 C;  3ANW B;  4ZOL E;  5FYM A;  2X0L B;  4BA9 A;  3O1J A;  3VKG A;  1IJ6 A;  3CPZ A;  2JRK A;  2XAG B;  2YK0 A;  2VAS A;  3CQX C;  1MMG A;  3ESL A;  2YU2 A;  3F57 A;  3HKB E;  2QGS A;  3FXE B;  2WSS V;  2WBL A;  2LT3 A;  1U5P A;  5JVD E;  1QSD A;  3NZQ A;  2D2S A;  4YJ3 E;  3UUM A;  1HTJ F;  2KZ7 B;  3BQK A;  3WAJ A;  5F3J A;  3HA4 A;  4O4H E;  3ZMV B;  4IGU A;  5JDQ A;  4AKI A;  4DO0 A;  2V7I A;  5A1L A;  2NP9 A;  4G63 A;  4O8S A;  5CA1 E;  1U4Q A;  4TV8 E;  5ADX L;  5TAO A;  1FMW A;  2JQQ A;  1IJ5 A;  4EOZ B;  3K3Q C;  1X79 A;  4YFS A;  5DQV A;  4MAL A;  3FXD B;  1US7 B;  3KVA A;  3RRC A;  2K5B B;  1VRB A;  2XQY A;  4BJM A;  1UX5 A;  4ZI3 C;  4EAH A;  2XTL A;  1D1C A;  1WLX A;  4BJN A;  2NW8 A;  2ZLY A;  3NRX A;  3QUJ A;  3AA1 B;  5H6Q B;  4DBQ A;  4UV9 B;  4HFV A;  3KV9 A;  3KVB A;  2Q9Q C;  5JDH A;  1QUU A;  4UVC B;  5EZY E;  5HXR A;  3BQI A;  4UVB B;  1BR0 A;  3KBU A;  3MK7 C;  2LOP A;  2X67 A;  3I9W A;  3NRY A;  1YKE B;  3RC3 A;  5HYA A;  3KFW X;  2V7M A;  3CWZ B;  1G8X A;  4X1K E;  2DNX A;  2W62 A;  2G0U A;  3TKL B;  4OYK A;  5DQW A;  3N2K E;  4E7Z A;  5JDF A;  3O9X A;  3ZYL A;  4DND A;  3ZC0 A;  4J2C A;  3EDU A;  4ZS2 A;  4DBR A;  4X1Y E;  4AQF A;  1YKH B;  4WNK A;  1H7C A;  1MMD A;  3J9X 1;  3FHN A;  3KIN B;  1SHZ C;  4HN9 A;  3I9Y A;  2L9Q A;  4IST A;  5LG4 A;  4ZI7 E;  1NAF A;  3SRZ A;  5FXV A;  2M67 A;  3ZJ2 A;  1VOM A;  4TV9 E;  4TUY E;  3EUH A;  4CI3 B;  3N9P A;  1ZHC A;  4AXP A;  2L3L A;  2X51 A;  4Z8X A;  4X20 E;  2GK9 A;  4X1I E;  4JLE A;  3E08 A;  5EK2 A;  2VB6 A;  3ZPO A;  4PFO A;  2D0T A;  1D1B A;  3QK6 A;  3WAK A;  5C8Y E;  3DP7 A;  5JR9 B;  2A72 A;  2X9Y A;  2Q9Q A;  4PJN A;  2DCF A;  4UVA B;  2LHR A;  4NUV A;  4YJ2 E;  5LCY A;  1B7T A;  3NBX X;  2E9X A;  4DMV A;  2LEH A;  2IC6 A;  1D0Y A;  4KBM B;  1MNE A;  4ILU A;  2ZM2 A;  2LSJ A;  2NTY A;  1S35 A;  5LYJ E;  5H6R B;  2KWI B;  1BR4 A;  3PUG A;  5HXH A;  4V1A v;  4CXX A;  4WBN E;  1UX4 A;  3K3O A;  3ZN1 B;  2D0U A;  4GIW A;  5FY1 A;  3E22 E;  3GN5 A;  3C51 A;  2ZM0 A;  2MTQ A;  4O4L E;  3MKD A;  4FI5 A;  2ES0 A;  3DTO A;  5L3F B;  1Y64 B;  3OYZ A;  2EHO A;  5KDM C;  3R6N A;  5FY7 A;  1S94 A;  3O1I A;  4P0A A;  4CI1 B;  4UIG A;  3PUR A;  1MMN A;  4MFR A;  1AJ3 A;  5LGU B;  3RYF E;  1HG5 A;  4HEA A;  4ASK A;  4P09 A;  1MIV A;  2LM9 A;  3FBL A;  5FMN A;  2V7J A;  2WM9 A;  3SWH A;  3CQG B;  3I0Q A;  5J2T E;  2DWK A;  4H9S E;  3LJC A;  2MBG A;  2OA5 A;  4FJO A;  5JQG E;  4QXC B;  3O1H A;  2CLY B;  2ODV A;  4IE4 A;  2LSY A;  2NW7 A;  3RPU A;  2MYS A;  3HKD E;  2H3R A;  2CE7 A;  5HXC A;  2DWG A;  3N2O A;  3F2E A;  2HH7 A;  4AQG A;  3V5S A;  2LSI A;  4A56 A;  3QC9 A;  2DLR A;  4UF0 A;  2BVL A;  4ADZ A;  2X9X A;  2BDE A;  4H9R C;  3HKC E;  2B1E A;  5JRC A;  1WYB A;  3VKH A;  3ZLI A;  3KDS E;  2CXD A;  2Y48 B;  3MZK B;  3I1A A;  1YD8 G;  2UXN B;  4EZH A;  1WRD A;  4NUU A;  3C50 A;  2X9W A;  2RA1 A;  5JDM A;  3KV6 A;  3C98 B;  4YLH A;  3MA9 A;  4IDZ A;  2W00 A;  1IZN B;  3MXZ A;  3OBV E;  4PJM A;  3Q9D A;  5L2L A;  2Y8D A;  2PFV A;  3ZEF B;  3LBX A;  4O4J E;  3MAC A;  4O2A E;  5CB4 E;  3RX6 A;  5GON E;  4ZI2 C;  3FBZ A;  4CXY A;  1FMV A;  1KK7 A;  2C5J A;  1HF8 A;  2HPL A;  3OYX A;  3N9N A;  3P8C D;  4I55 E;  2YEV C;  4IE5 A;  2KXP B;  1LRZ A;  1Z0P A;  3M65 A;  3Q2M A;  4O2B E;  4IIJ E;  2JMK A;  3HKE E;  3IHR A;  3H37 A;  5FXX A;  4XAX B;  3EDV A;  2DI4 A;  5M4Y A;  3Q5W A;  3RYC E;  3C4W A;  2W61 A;  3CX6 B;  3UUX B;  2WAU A;  2CWO A;  2ACX A;  3GMI A;  3LFM A;  5IYZ E;  4UEL A;  5BMV E;  2IAK A;  3CML A;  2ZM8 A;  4G2A A;  3C4Z A;  4HTE A;  3V5U A;  3AB3 B;  4UXN B;  4DVD A;  2BZB A;  2CCQ A;  3ZMU B;  3LK2 B;  3GN5 B;  3JC6 D;  4MBQ A;  4OYJ A;  2XAS B;  3I0O A;  3RRW A;  1LVK A;  3W15 B;  1HG2 A;  3EVY A;  2KND A;  5AFU L;  2EHO B;  2NTX A;  2YU1 A;  2J1D G;  4PJL A;  2LSG A;  1HFA A;  3NZP A;  4TZ4 C;  3U78 A;  3IF8 B;  5CA0 E;  3ZMZ B;  4QXH B;  4L5G A;  4TN7 B;  4BAY B;  3CKD A;  1OWA A;  3VHL A;  1ZEE A;  4QHO A;  4JUY A;  2SPC A;  4IE7 A;  5J2U E;  4O4I E;  4AKH A;  5JR9 C;  4L0R A;  2D5U A;  5LGN B;  5KMG P;  3LG7 A;  2LE8 A;  3N2G E;  1MIW A;  4PW8 A;  4UEM A;  4I50 E;  5LJM A;  4WW0 A;  4EXT A;  3R84 B;  3ZN0 B;  5E0O A;  3PUA A;  1OXZ A;  2VKO A;  5LHH B;  5L3D B;  2CMR A;  1FIO A;  4HKA A;  3L09 A;  1LVF A;  3B57 A;  4EIW A;  3L3P A;  5FP3 A;  2PBI A;  4WBO A;  2LOS A;  1E1H B;  2ODU A;  3F31 A;  5F8P A;  3B13 A;  3N9M A;  4H63 V;  4AKL A;  4DMW A;  3P7I A;  2XAF B;  2E9X D;  3WI3 A;  2E8I A;  5LNK A;  1LKX A;  4GK0 E;  4UF0 B;  3PTR B;  2CM0 A;  5LP6 E;  3DJB A;  2X9H A;  4OFZ A;  1BR2 A;  2XHE B;  3C64 A;  3ETV A;  2K9A A;  3KBT A;  3MJX A;  3PUS A;  3LK4 2;  3CX8 B;  4I43 B;  3PDY A;  4PJJ A;  2KWH A;  2EHO D;  2VKJ A;  2K48 A;  3RC8 A;  2H7O A;  5LBM A;  2CLY C;  5FNV E;  5JDL A;  4H63 H;  4PK4 A;  4YHJ A;  5LHG B;  5LOV E;  4H9N C;  5EK3 A;  2LSK A;  3UUN A;  2C5I T;  2W0G A;  2W63 A;  2CEA A;  1D1A A;  2HPJ A;  3UT5 E;  4XZC A;  2VKH A;  3ZCI A;  2A3D A;  3RH3 A;  3JC6 C;  4QX8 B;  1BR1 A;  2V7L A;  5KX5 E;  3PU3 A;  1WYC A;  5HXS A;  3IBP A;  4IE6 A;  5LGT B;  2CXL A;  4PFP A;  3UUL A;  4OHF A;  4EYU A;  4AQF C;  5L3B B;  3BK9 A;  5L3E B;  3VU7 H;  3ONX A;  4CXW A;  5HXE A;  3O4X E;  3AVS A;  2JJ9 A;  2CA5 A;  4ISS A;  4F6R C;  3N5L A;  1T98 A;  3OKQ A;  3ZMT B;  2XAJ B;  5FXZ A;  1HX8 A;  2KIN B;  3AA6 B;  1ZV4 X;  4HGA A;  5HWY A;  3RKO A;  5L3G B;  3J7Y q;  2N9D A;  4PK5 A;  4PNI A;  1MND A;  2KMF A;  3OJA A;  5FY0 A;  4GK5 E;  3T8O A;  3ZYK A;  2Q9Q B;  4CQI A;  3ANW A;  2I59 A;  5HWX A;  4MLK A;  2A2F X;  2VK9 A;  4PAG A;  4ZS3 A;  4QWN B;  5DAB A;  2E9X B;  5EK4 A;  1EZ3 A;  2LJL A;  3H3A A;  3SS1 A;  2XUE A;  4ZHQ E;  5LBQ B;  3HI2 A;  4KMC A;  3RYI E;  2LHN A;  3ZMS B;  4CI2 B;  2E9X C;  2WMN A;  1KNZ A;  5LA6 E;  4B6X A;  4H9O C;  3PE0 A;  2NOX A;  3ZC1 A;  3CVR A;  3SOL A;  2C0S A;  4EB6 E;  2NW9 A;  5JDG A;  2XAH B;  4H9Q C;  3LK3 B;  4TX5 A;  2KT9 A;  3CQC B;  3PUQ A;  5JRE A;  1D0X A;  3K3N A;  2N1G A;  2NWB A;  2K24 A;  3N9O A;  4JEH B;  5JDN A;  3HR0 A;  2IC9 A;  2VL8 A;  4QX7 B;  5IHY A;  2JMH A;  3AAA B;  3AA7 B;  2EHO C;  3UFE A;  4ERR A;  3ZCJ A;  4OK0 A;  3D0T A;  2Y6X A;  4C91 A;  2YIN A;  2L8K A;  4IE0 A;  5LHI B;  1HCI A;  3S4U A;  4EZ4 A;  2C5K T;  4CZZ B;  5JH7 E;  4GOU A;  4AKR B;  4ANJ A;  3AAE B;  4K0U A;  2VKD A;  4N78 D;  2V1D B;  4XBF B;  4ZI3 D;  2JPF A;  3Q5X A;  3N9Q A;  4GYS A;  3K8P C;  3N9L A;  2PG8 A;  1CUN A;  3AAI A;  4IHJ E;  1YW0 A;  2VWA A;  2IW5 B;  2Q9Q D;  4JEU B;  4H9P C;  4L9I A;  5ETW A;  3IEE A;  2V7K A;  4ZI2 D;  2V26 A;  3GA8 A;  1D0Z A;  1UCU A;  4U72 A;  3A5X A;  2MOZ A;  3BQL A;  4I4T E;  4U74 A;  3UTK A;  3HL6 A;  4AI6 A;  3CX7 B;  2WMO A;  2Z6E A;  5JRC B;  1NWM X;  3C4X A;  5L3C B;  3KV5 A;  4UV8 B;  5DJQ C;  3GWH A;  1G73 A;  3RYH E;  4HE8 A;  3ZJ1 A;  2RP4 A;  2X68 A;  4QXB B;  5LXT E;  2WWU A;  4GYR A;  2UXX B;  2N2N A;  3ZYM A;  2P9B A;  1MMA A;  2BVM A;  4E7S A;  1WR6 A;  1SA0 E;  3KV4 A;  4M1P A;  4P0B A;  5J1G A;  5FXW A;  5JR9 A;  3FB2 A;  2PJQ A;  2KLQ A;  2CXF A;  1HS7 A;  2CWY A;  5HAX A;  1FEW A;  1ZKE A;  2QA7 A;  3AA0 B;  3LBX B;  3E0Z A;  2ZMA A;  2XAQ B;  5LJN A;  1MIY A;  2X66 A;  4MHC A;  2H7V C;  3ETU A;  3PU8 A;  3U3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...