2LSKA

C-terminal domain of human rev1 in complex with dna-polymerase h (eta)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
95
Chain Sequence
b'GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/protein binding
total genus 30
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lskA00
4GK0E 2LSYA 2LSIA 2LSJA 3VU7H 2LSKA 2N1GA 2LSGA 4EXTA 4FJOA 4GK5E 4BA9A
chains in the Genus database with same CATH superfamily
2VQET 2IAKA 1XNRT 2OV9A 3AAIA 4LF9T 3FXDB 1S35A 4TN7B 3CKDA 1IBMT 2X9YA 3UTKA 4IE0A 3RIAA 1X9BA 3UFGA 2VK9A 3O9XA 1HNWT 5L4HA 3RPUA 3B57A 1U5PA 2BS4A 3NZQA 5JR9B 2EHOB 2Q9QB 2H88A 1W09A 5ADXL 5A1LA 2XAGB 1U4QA 3AVRA 2W00A 2VB6A 4DMWA 5HYAA 5FY0A 3D0TA 4BA9A 5AQMB 5L3DB 5BR8T 3AEEA 3ESLA 3RQWA 2BG9B 3RYIE 2XUEA 2X9WA 4YT0A 2QA7A 4I0UA 3TLWA 2V7LA 2PJQA 1UX4A 4KX6A 3O4XE 2OA5A 1NEKA 3RYFE 4KI0F 5EK4A 3AE6A 2BG9E 3FZHB 4HFCA 2AXDS 3RIFA 2V6YA 3KV4A 2WBLA 3IEEA 2JQ9A 4X66T 4I50E 5JTGA 2ZM6T 4OFZA 5F8PA 3KV6A 5EK3A 4COFA 3KBUA 4QX7B 3AE3A 2IC9A 1WRDA 3L3PA 2QYWA 1D1CA 3V5SA 1WYCA 2X68A 2FUPA 4YSXA 4YSYA 3G06A 3SS1A 3UQ4A 4GIWA 2LSJA 5JH7E 3AEBA 2VVNA 3N9QA 4LF8T 1IZNB 4DUZT 4TWHA 1D1AA 4JBWF 2XASB 1XMQT 3ZJ1A 2B76A 4A56A 5IYZE 1OWAA 1MMNA 4LMLA 2BVMA 2LJLA 4CI3B 4DBRA 2V8SV 1YQ3A 3GN5A 5AQLB 3WAKA 3QNUA 3PV0F 2HHHT 3FXEB 3JAEA 5AQNB 5TAOA 3MZKB 1MIYA 4PFOA 4YJ3E 5AQSB 1OEDA 3P4SA 3OBVE 4AI6A 3PURA 2B1EA 4GK5E 5JDLA 4HKAA 5DJQC 4MFRA 5IHYA 3AE9A 3PDYA 1E2AA 3RX6A 3HKDE 3H37A 3E08A 3CQCB 4DR4T 1OXZA 2LT3A 4HWCA 3FZFB 3O1JA 5J1GA 3AA6B 4G2AA 4OYKA 4CN4A 3FHNA 1R8IA 3TLTA 4U7IA 5AQVB 2HN2A 2Z6EA 2CHNA 1ZV4X 5AQGB 4ZI7E 4ZEYA 2FJBA 2LSIA 2V1DB 2VL0A 3EI0A 5C8YE 2KMFA 5LHGB 3RH3A 1YQ4A 4U31A 4ILAA 4WNKA 4I55E 1UX5A 4GK0E 2E9XA 2CMRA 5AQJB 4DV5T 2CBJA 2XAFB 3VRBA 1Z8UA 5LJMA 3NVOA 3C98B 1QSDA 5JDGA 5CA0E 2I0MA 3RC8A 2NW8A 2CLYB 5LYJE 3J9X1 4DR1T 3HKEE 3ZSSA 5FXWA 4JI8T 3DP7A 4NUUA 1YKHB 4F8HA 2JRKA 2DLRA 3AA1B 2DNXA 2WZIA 1SUMB 4HFDA 4ZOLE 2NTYA 2RPAA 1LVKA 5LGTB 4DIDB 4IE5A 4YTNA 4X5TA 5L3EB 5ABHA 2XM2A 5L3BB 2WMNA 5HEUA 4B6XA 3N9NA 5LOVE 1UCUA 5CB4E 1MMAA 3PJAA 1O3XA 2WWUA 2HN1A 2A9UA 1KK7A 1HS7A 5HXEA 3N2OA 3PUSA 4AQFC 2LOPA 3A7MA 2NTXA 3ONLC 4QH4A 5KXJA 5FL1A 1T98A 1NENA 3LSVA 4U7YA 2F4VT 5H6RB 3HKCE 3RRWA 1XWMA 2J1DG 2PFVA 2LHRA 4IT4A 4DBQA 3F2EA 3AE5A 3GA8A 2UXBT 2WAUA 2XQ8A 3K3NA 3QB5A 4WYVA 5LG4A 4DR7T 4DV4T 1BR2A 2J47A 2SPCA 2XSAA 4IDOA 2ODVA 4LF5T 2X51A 3I0QA 3DJBA 4HFBA 1FJGT 4UF0A 2VWAA 2E8IA 3C4WA 3ABVA 4AISA 2XSBA 3A5XA 3LK42 4HEAA 1IJ6A 2IW5B 4XAXB 4LFAT 4OYJA 1WLXA 3ETUA 4PFPA 4TWFA 1IAPA 3AEDA 2LOSA 2YK0A 3RIUA 3PUVF 4X64T 2C5KT 2JQHA 4Z90A 4KHPT 5AQRB 4I43B 1BR1A 3VRAA 4H63H 1VCSA 1N34T 3NZPA 3AEAA 3N2KE 4WZXA 2K9AA 3SOLA 3AE7A 1VOMA 2YEVC 2LHNA 3RC3A 3ZN1B 2NWBA 2D5UA 4O4HE 1MIVA 2BS3A 3Q5DA 5ABEA 1UUSA 2Y48B 5ABFA 3L8RA 4I4TE 2Y8DA 4YTMA 3N9LA 2V7KA 1E7PA 3PU3A 1T8BA 1LKXA 3FBZA 4DVDA 2L9QA 2FBWA 3UU8A 2C5JA 2YKSA 3OPCA 5C2TA 3ZCIA 5LMNT 3PTRB 4O4JE 2C0SA 4ILBA 2V6XA 2G0UA 4EAHA 5FKYA 3AE1A 1D0YA 2K5BB 4YTPA 4IREA 3ZLIA 4TNWA 3J7Yq 3AXJA 5AQQB 4KUMB 1LRZA 4X62T 3ANWA 3M3ZB 2M6BA 4AKRB 1GQEA 2XTLA 3E0ZA 4DNDA 2J4GA 2L8KA 5LCYA 5AQIB 1M62A 1MIWA 3C51A 2W2UA 4X20E 5HXSA 4FI5A 4MALA 2WDVA 2WZHA 5FNVE 4N78D 3N2GE 1D0XA 3KV9A 4IL4A 3SRZA 1W0AA 3P4RA 5LHIB 2XQAA 1US7B 3RGLA 3PUZF 4B3ST 4P0AA 1M7KA 5EK2A 1SHZC 4Q25A 2J62A 4U33A 3NWIA 3SFEA 3P8CD 4HFHA 4OK0A 3RRCA 1HTJF 4EZ4A 2WS3A 4YHJA 1X79A 3T8OA 2LRLA 4DMVA 4HE8A 2JQKA 3VU7H 2BDEA 5LP6E 4EOZB 2BZBA 1KF6A 2BBHA 2YDQA 3OYXA 3FZKB 4JEUB 4PAGA 3ZN0B 3M65A 1IBLT 3PUQA 2CXLA 2BKPA 4ZZCA 3P50A 1FIOA 3UULA 2BKNA 1HG5A 2KWIB 3NRYA 3PUYF 5CFBA 5KX5E 2KSRA 2XQ6A 3ZEFB 1D1BA 4CN1A 4ISTA 4X1YE 2E5LT 1HCIA 4KBMB 1OEDC 2A2FX 1YW0A 5KMGP 2W4XA 2WP9A 3AE4A 4B3RT 4UF0B 4O4LE 4MHCA 4QXHB 5JDQA 4YFSA 5DQWA 2VKDA 3ZMSB 2YOEA 3T1YT 4U2YA 1XNQT 5L2LA 2M67A 3Q9DA 5KDMC 5JDFA 2BKOA 3IHRA 2CPTA 5IUXA 4OHFA 2UUCT 1Y64B 4TV8E 5CGMA 5JREA 3IA3A 3QUJA 2CM0A 3LK2B 4UVCB 3T1HT 5CA1E 3V5UA 2E9XC 5L3CB 4WW0A 4O4IE 2ACXA 2D0UA 2X0LB 2E9XD 3HL6A 4PK5A 2YU2A 4HWFA 5AQFB 3BQIA 5HXHA 2PTFA 4HWDA 4NXNT 3P7IA 4LMKA 1IBKT 4JI1T 2VQFT 1N32T 3FZLB 3BK9A 5HEJA 1T72A 3CMLA 2CEAA 3ONJA 1IJ5A 2X0YA 4JEHB 3RYCE 1J1JA 4YXDA 5FXVA 2WCAA 3O1HA 3H3MA 3GWHA 4IE7A 4AKGA 4UELA 3AB3B 3QB5K 3I9YA 3F31A 4DV0T 1DU2A 4O2BE 2P9BA 2IMLA 1FMVA 4GOUA 4LMJA 4TV9E 3AVSA 1S94A 4CZZB 1E1HB 3UUNA 3RYHE 5HCMA 2H7VC 4TX5A 2YU1A 5JVDE 3AXJB 5LBQB 3K1SA 2NOXA 4JYAT 3ANWB 1J5WA 3F57A 2WB5A 2CA5A 3PUXF 4UXNB 5FMNA 2X0HA 1WYBA 2WU2A 1UK5A 1ZP0A 2H3RA 3RF1A 4A97A 4MLKA 3QK6A 2UU9T 3C64A 4PJMA 3UU3A 1HX1B 3ZYLA 5AQKB 3C50A 3H3AA 2YDRA 2LSKA 3AAEB 4NPPA 2KLQA 3KBTA 4HFEA 5BMVE 3B5MA 2CCQA 2WMOA 3PUWF 1BR0A 4JI6T 3TLUA 5JDHA 5LJNA 3RHWA 5F5WA 2WU5A 3OYZA 2W0GA 3KDSE 4BJNA 4EIWA 4TNVA 3K8PC 4ZZBA 2A72A 3VHLA 4QHOA 4AKHA 2XQ4A 4H9QC 2WQYA 2KZ7B 2X9HA 4H9SE 3I0OA 5E0OA 3RIUC 1HNXT 4IL9A 2LSGA 2QRXA 4IE4A 1XDOA 2EHOA 2Q9QA 2DCFA 2PG8A 3PUGA 2XQ7A 4U3CA 3OTOT 4OX9T 3ONXA 2UXCT 4X1KE 3NBXX 3OKQA 4ZI2C 4CI1B 2V7JA 4G63A 2DWKA 2V6YB 1CHUA 4EXTA 4ZI2D 3VKGA 2CHOA 2W62A 2BBJA 2ZM2A 1MMGA 4DV3T 3CX7B 3QOFA 5AQOB 5L3FB 1YD8G 4ERRA 4MBQA 1NWMX 2BG9A 5GONE 3P4PA 1HFAA 5HWXA 2VKJA 3ZYKA 5FL0A 2LLYA 1SE7A 1HNZT 3UU6A 3MK7C 4L5GA 3UUMA 3FBLA 2ZM8A 3L09A 4JLEA 4U72A 2WWVA 2XAHB 2XQ9A 2XJ7A 4DR6T 2LRKA 5J2UE 2XHEB 5EZYE 2CXDA 2CXFA 2X66A 4UVAB 5FVLA 5CJ5A 2D9DA 4O8SA 2A3DA 3GN5B 2FJEA 2VKHA 3ZCJA 3U78A 5FY7A 2HPLA 5LB7B 2W66A 5AQUB 1OEDB 5LNKA 3AE8A 4ISSA 2JQQA 2H7OA 2XQ3A 2YDSA 2WY2A 3ZMVB 4X1IE 4GKJT 2AE9A 5FY1A 2IIUA 3LDQB 5AFUL 2XM1A 2GK9A 3TLSA 4DV2T 3ZKRA 2LEHA 2WDQA 5HXCA 4ZHQE 4IE6A 1H7CA 4AXPA 1J5ET 3HR0A 1NAFA 3R84B 3ZT5A 3RKGA 3AEFA 3FZMB 2E9XB 4WBNE 3K3OA 4H9NC 4F6RC 3JADA 1XZYA 3LBXA 3UQ7A 4JI3T 4JI2T 4LF6T 2DI4A 4QXCB 2D2SA 2UXXB 1KNRA 2FJAA 4PJLA 4CN6A 1ZOYA 2CRBA 3L39A 5LXTE 5HEOA 4CXXA 2W61A 3KVBA 3MACA 3ZMTB 4DV6T 2LSYA 1WR6A 4H9OC 1HR0T 1MNDA 1KNPA 2LKGA 4DUYT 4LFCT 2MOZA 3ZMUB 2RA1A 1FMWA 4WBOA 4UV9B 4PNIA 4YSZA 2ZLYA 3CIRA 2I59A 3KVAA 4IIJE 3LJCA 3PJAJ 3VR9A 2XQYA 2V5CA 3IBPA 2X67A 1ZEEA 2UUBT 2IC6A 4XZCA 2KNDA 2JMHA 1I6ZA 4JUYA 4DR5T 3EDUA 4HWHA 5JQGE 4Z91A 4J2CA 2N9DA 5C3JA 4JI4T 3JC6C 4YY3T 4AKLA 1MMDA 3N5LA 3BQKA 3CX6B 3JC6D 4ILUA 4L9IA 4ZS3A 2CE7A 5HAXA 5JRCA 5L47A 4EYYR 3C4XA 4ASKA 3AA7B 2VKOA 2CWOA 1V9DA 1AJ3A 4ADZA 2KXPB 5M4YA 4DR2T 1B7TA 3KFWX 3AECA 2LM9A 3HKBE 5ABGA 5L4EA 2XAJB 2K3WA 5ETWA 3CWZB 3FB2A 3ZYMA 2YINA 2NW9A 1XMOT 4KP3C 4EB6E 1SA0E 3DTOA 2XAQB 4CXYA 2Y6XA 5DQVA 4EEDA 2CBIA 3Q5XA 3CX8B 1YKEB 4DV7T 4IDQA 4X65T 3E22E 4QX8B 2V7IA 4LF7T 5FP3A 5FXZA 4V1Av 2E2AA 4KMCA 3TKLB 3MKDA 4AKIA 5IWAT 1MNEA 4NIQA 4HFIA 1WCRA 3Q5WA 4B3MT 3TLVA 4UR9A 3P4QA 2VURA 1LVFA 2LE8A 5LGNB 4P09A 4TZ4C 4P0BA 1UURA 4YLHA 2E5VA 1G8XA 3AA0B 1JNRA 1CUNA 3RLFF 2UUAT 4LF4T 5ABFB 4EGWA 1W9RA 3I9WA 4K0KT 2XQ5A 2XPKA 2IUBA 2R6GF 4EV6A 3UFEA 5FXXA 4EYUA 2IDOB 4E7ZA 4JI7T 2K24A 3SFDA 4Z8XA 4PJNA 3X1DA 2WM9A 2MPKA 4ZI3C 5FYMA 4ZI3D 3LBXB 4CI2B 3ZJ2A 2N2NA 2K48A 2HH7A 3KV5A 5L3GB 2ACZA 4GYRA 2KWHA 3RI5A 3EHZA 2C5IT 4H63V 1VCTA 2XY8B 4GKKT 3UUXB 2MTQA 4IDPA 4QKNA 1WFDA 2D0TA 1QUUA 4TWDA 1KFYA 2ODUA 4QXBB 3EVYA 2W63A 5JR9C 1HF8A 2EHOC 5HCJA 4HN9A 2WSSV 2Q9QC 2VASA 2KT9A 4CQIA 3ETVA 2EHOD 2V26A 4A5XA 2Q9QD 2H89A 4M1PA 2NW7A 3QC9A 3W15B 1KEYA 5FVKA 2ES0A 5JDNA 2UXDT 2BS2A 5H6QB 5AQPB 2V7MA 3PE0A 4H9RC 3LK3B 2DWGA 2L3LA 3IF8B 1XDPA 2BG9C 5LA6E 3HA4A 1KNZA 2I6HA 1Z0PA 3ZT7A 3ZC0A 2JPFA 1QLBA 2ZM0A 5J0ZA 3ZPOA 5JDMA 4JI0T 4LFBT 3EAMA 4XBFB 4UIGA 5DABA 5LHHB 3CQGB 2IHR1 2BVLA 2LM2A 4L0RA 1D0ZA 5JRCB 4GYSA 1BR4A 3AEGA 3O1IA 2PBIA 4ZXLA 5F3JA 4UVBB 4NUVA 3ZMZB 4ANJA 2KINB 3UU5A 1FEWA 1N33T 1HG2A 4HTEA 3KINB 5JR9A 4AIUA 2M6IA 2QGSA 3NRXA 2DL1A 4PK6A 4YHHT 4IDZA 4NXMT 3UU4A 3JAFA 3P4WA 3BQLA 2LKHA 4EEBA 5AQTB 3A8YC 4HGAA 3N9PA 1UGOA 1VRBA 3Q5EA 2MAWA 3NKZA 4PJJA 3VKHA 1N36T 2NP9A 3CK6A 4UV8B 1WR0A 2V5DA 4UEMA 5HXRA 4IHJE 3R6NA 4YJ2E 3LFMA 4AQGA 3WI3A 1ZHCA 3CVRA 4A98A 3UT5E 3EDVA 5LBMA 3GMIA 5AQHB 5HWYA 4DO0A 1YXRA 2W67A 3AE2A 2ZMAA 3ZC1A 2N1GA 5LG3A 5J2TE 4C91A 3OVUA 2QVAA 4K0UA 4E7SA 1ZKEA 4DR3T 5HEGA 2UXNB 1I94T 3C4ZA 3LG7A 2HPJA 4O2AE 1G73A 2JJ9A 2X9XA 2OLTA 3N9MA 5LGUB 4CXWA 4U2ZA 4BJMA 3RQUA 5LMUT 4AQFA 3U3IA 4DV1T 1HX8A 4KHZF 2CWYA 4HFVA 3S4UA 4HWIB 4H9PC 3MA9A 4U74A 1L0VA 3EABA 4JV5T 1T7SA 4P1NA 2WDRA 2VL8A 1OEDE 2JMKA 4BAYB 2VVSA 2MYSA 2CLYC 2RP4A 3CPZA 4QH1A 2XZEA 3SWHA 2NR4A 4IDNA 3WAJA 4C90A 4TUYE 4AQYT 5HEHA 3MJXA 3B13A 3K3QC 4EZHA 3ZSTA 3EUHA 2JIWA 3N9OA 3RKOA 4QWNB 3MXZA 2FJDA 2DHRA 4FJOA 4IGUA 3AAAB 3Q2MA 3VR8A 2MBGA 3PUAA 4ZS2A 1Y01A 4QH5A 1W0BA 1EZ3A 1JNZA 4PW8A 4JI5T 3JCFA 3PU8A 4PK4A 4B3TT 3CQXC 3UUBA 2YN6A 4ILCA 3OJAA 3HI2A 3I1AA 3ZT6A
chains in the Genus database with same CATH topology
2IAKA 1IJ6A 2CCQA 2WMOA 2IW5B 3Q5WA 4XAXB 3AAIA 4OYJA 1WLXA 3ETUA 1BR0A 4PFPA 1IAPA 3FXDB 1S35A 1LVFA 5JDHA 5LJNA 2LOSA 2YK0A 2LE8A 4TN7B 3CKDA 5LGNB 4P09A 4TZ4C 4P0BA 2X9YA 4YLHA 1G8XA 2C5KT 3UTKA 3OYZA 2W0GA 4IE0A 3KDSE 3AA0B 1CUNA 4BJNA 4EIWA 2VK9A 3O9XA 3K8PC 4I43B 1BR1A 2A72A 4H63H 3RPUA 3VHLA 4QHOA 4AKHA 3NZPA 3B57A 1U5PA 3I9WA 4H9QC 2KZ7B 2X9HA 3N2KE 3NZQA 2K9AA 4H9SE 5JR9B 3I0OA 2EHOB 3SOLA 1VOMA 5E0OA 2Q9QB 2LHNA 2YEVC 3RC3A 3ZN1B 2NWBA 5ADXL 2D5UA 5A1LA 4O4HE 2XAGB 1MIVA 3UFEA 5FXXA 4EYUA 1U4QA 2Y48B 3AVRA 2W00A 4E7ZA 2VB6A 2K24A 4DMWA 5HYAA 5FY0A 4I4TE 4Z8XA 2LSGA 4PJNA 3D0TA 2Y8DA 4BA9A 2WM9A 3N9LA 4IE4A 2V7KA 3PU3A 4ZI3C 5FYMA 2EHOA 1LKXA 3FBZA 2Q9QA 2DCFA 4ZI3D 2PG8A 5L3DB 3LBXB 3PUGA 4DVDA 4CI2B 3ZJ2A 2L9QA 2N2NA 3ESLA 2K48A 3ONXA 2HH7A 4X1KE 3KV5A 3NBXX 5L3GB 3OKQA 3RYIE 4GYRA 4ZI2C 2C5JA 2KWHA 4CI1B 2V7JA 2XUEA 4G63A 2DWKA 2X9WA 3ZCIA 2C5IT 2QA7A 4H63V 4EXTA 4ZI2D 3VKGA 3PTRB 2W62A 4O4JE 2C0SA 2V7LA 2PJQA 1UX4A 3UUXB 3O4XE 2MTQA 2ZM2A 2OA5A 2G0UA 4EAHA 1MMGA 4QKNA 2D0TA 3RYFE 1QUUA 5EK4A 1D0YA 2K5BB 3CX7B 5L3FB 1YD8G 4ERRA 2ODUA 4QXBB 4MBQA 3ZLIA 1NWMX 3EVYA 5GONE 2W63A 5JR9C 1HF8A 3J7Yq 2EHOC 1HFAA 4HN9A 2WSSV 5HWXA 2Q9QC 2VKJA 4KUMB 2VASA 2KT9A 4CQIA 1LRZA 3ZYKA 3KV4A 2WBLA 3ANWA 3ETVA 2EHOD 2V26A 2Q9QD 4AKRB 3IEEA 4M1PA 4I50E 3MK7C 4OFZA 4L5GA 5F8PA 3KV6A 3UUMA 5EK3A 2NW7A 3QC9A 3W15B 3KBUA 3FBLA 2XTLA 3E0ZA 2ES0A 4QX7B 2ZM8A 2IC9A 4DNDA 5JDNA 2L8KA 3L09A 5H6QB 4JLEA 4U72A 1WRDA 3L3PA 2V7MA 3PE0A 5LCYA 1D1CA 4H9RC 2XAHB 3V5SA 1WYCA 1MIWA 2X68A 3C51A 3LK3B 4X20E 5HXSA 4FI5A 5J2UE 4MALA 2DWGA 2L3LA 2XHEB 3IF8B 5EZYE 2CXDA 5FNVE 4N78D 3SS1A 2CXFA 3N2GE 4GIWA 5LA6E 2X66A 1D0XA 3HA4A 3KV9A 4UVAB 1KNZA 1Z0PA 2LSJA 4O8SA 5JH7E 3SRZA 5LHIB 3ZC0A 2JPFA 2ZM0A 1US7B 3ZPOA 2A3DA 3N9QA 3GN5B 1IZNB 5JDMA 1D1AA 2VKHA 3ZCJA 2XASB 3U78A 4P0AA 5FY7A 2HPLA 5EK2A 3ZJ1A 1SHZC 4A56A 5IYZE 4XBFB 4UIGA 1OWAA 5DABA 5LHHB 3P8CD 5LNKA 3CQGB 1MMNA 2BVLA 4OK0A 4ISSA 2JQQA 3RRCA 1HTJF 2BVMA 2LJLA 4EZ4A 4CI3B 4L0RA 4DBRA 2H7OA 3GN5A 1D0ZA 1X79A 4YHJA 3T8OA 3WAKA 5JRCB 4DMVA 4GYSA 1BR4A 3O1IA 2PBIA 4HE8A 3ZMVB 3FXEB 3VU7H 5F3JA 5TAOA 2BDEA 3MZKB 4NUVA 4UVBB 3ZMZB 1MIYA 4X1IE 4ANJA 4EOZB 5LP6E 2BZBA 4PFOA 2KINB 1FEWA 4YJ3E 5FY1A 1HG2A 5AFUL 3OBVE 2GK9A 4HTEA 4AI6A 3PURA 2B1EA 4GK5E 3KINB 3OYXA 2LEHA 5JR9A 5JDLA 4HKAA 5DJQC 4MFRA 5HXCA 5IHYA 4JEUB 4ZHQE 4IE6A 2QGSA 3NRXA 3PDYA 1H7CA 4PAGA 4AXPA 3HR0A 3ZN0B 3RX6A 1NAFA 4PK6A 3M65A 3R84B 3HKDE 4IDZA 3H37A 3E08A 3CQCB 1OXZA 2LT3A 3PUQA 2CXLA 1FIOA 3O1JA 3UULA 1HG5A 5J1GA 3BQLA 2KWIB 3AA6B 3NRYA 4G2AA 4OYKA 5KX5E 2E9XB 4WBNE 3FHNA 3ZEFB 1D1BA 3K3OA 4ISTA 4X1YE 2Z6EA 4HGAA 4H9NC 4F6RC 3N9PA 1ZV4X 3LBXA 1VRBA 1HCIA 4ZI7E 4KBMB 4PJJA 2LSIA 2A2FX 2DI4A 2V1DB 3VKHA 1YW0A 4QXCB 5KMGP 2D2SA 5C8YE 2NP9A 2UXXB 2KMFA 5LHGB 4UV8B 3RH3A 4WNKA 4UEMA 4PJLA 4UF0B 5HXRA 4I55E 1UX5A 4GK0E 4O4LE 4IHJE 3R6NA 5LXTE 3LFMA 4AQGA 2E9XA 2CMRA 4MHCA 3WI3A 1ZHCA 4CXXA 4YJ2E 2W61A 4QXHB 3CVRA 5JDQA 3KVBA 4YFSA 3MACA 3UT5E 3ZMTB 5DQWA 2VKDA 3EDVA 2XAFB 3ZMSB 5LJMA 5LBMA 3GMIA 3C98B 2LSYA 5HWYA 1QSDA 4DO0A 1WR6A 4H9OC 5JDGA 5L2LA 2M67A 3Q9DA 5CA0E 5JDFA 5KDMC 1MNDA 2ZMAA 3IHRA 3RC8A 3ZC1A 2N1GA 2NW8A 2CLYB 5LYJE 4OHFA 1Y64B 4TV8E 5J2TE 3J9X1 4C91A 4K0UA 5JREA 2MOZA 3ZMUB 2RA1A 3QUJA 4E7SA 1FMWA 4WBOA 3HKEE 5FXWA 1ZKEA 2UXNB 3C4ZA 3DP7A 3LG7A 4NUUA 4UV9B 2CM0A 2HPJA 3LK2B 4O2AE 1G73A 4PNIA 4UVCB 1YKHB 2ZLYA 2I59A 5CA1E 3KVAA 2E9XC 3LJCA 4IIJE 4WW0A 3V5UA 5L3CB 4O4IE 2ACXA 2JRKA 2JJ9A 2XQYA 2D0UA 2X0LB 2DLRA 2E9XD 2X9XA 3IBPA 3AA1B 3HL6A 2X67A 2DNXA 4PK5A 3N9MA 5LGUB 4CXWA 1ZEEA 4BJMA 2YU2A 3BQIA 4ZOLE 2NTYA 4AQFA 3U3IA 5HXHA 2IC6A 4XZCA 1HX8A 3P7IA 1LVKA 5LGTB 2KNDA 2CWYA 2JMHA 4HFVA 3BK9A 3S4UA 4JUYA 4IE5A 3CMLA 3EDUA 2CEAA 4H9PC 3MA9A 5JQGE 4U74A 5L3EB 4J2CA 1IJ5A 4JEHB 3RYCE 5L3BB 5FXVA 2N9DA 2WMNA 3O1HA 4B6XA 3N9NA 2VL8A 3JC6C 2JMKA 5LOVE 1UCUA 5CB4E 4AKLA 1MMDA 3N5LA 4BAYB 3BQKA 1MMAA 2MYSA 3CX6B 3GWHA 3JC6D 4ILUA 4IE7A 4AKGA 1O3XA 2CLYC 4UELA 2RP4A 4L9IA 4ZS3A 3AB3B 2WWUA 3CPZA 3I9YA 2CE7A 1KK7A 1HS7A 5HAXA 3F31A 3N2OA 5HXEA 5JRCA 4O2BE 2P9BA 3PUSA 4AQFC 1FMVA 2LOPA 4EYYR 3C4XA 4GOUA 2NTXA 4ASKA 3SWHA 3AA7B 4TV9E 2VKOA 2CWOA 3AVSA 1S94A 4CZZB 1V9DA 1E1HB 3WAJA 1AJ3A 4ADZA 4C90A 4TUYE 3UUNA 1T98A 3MJXA 3B13A 3RYHE 3K3QC 2H7VC 2KXPB 4TX5A 5H6RB 3HKCE 4EZHA 5M4YA 3EUHA 3RRWA 1B7TA 3KFWX 2YU1A 2LM9A 2J1DG 5JVDE 3HKBE 2PFVA 2LHRA 5LBQB 3N9OA 2NOXA 2XAJB 3RKOA 3ANWB 5ETWA 3CWZB 3FB2A 3ZYMA 2YINA 3F57A 4QWNB 2NW9A 3MXZA 2DHRA 4DBQA 2CA5A 3F2EA 4KP3C 4UXNB 5FMNA 3GA8A 4FJOA 4EB6E 4IGUA 3AAAB 1SA0E 3Q2MA 2WAUA 3DTOA 1WYBA 3K3NA 2XAQB 2MBGA 4CXYA 3PUAA 5LG4A 2Y6XA 1BR2A 4ZS2A 2H3RA 2SPCA 5DQVA 3Q5XA 3CX8B 1YKEB 1EZ3A 4MLKA 4PW8A 2ODVA 3QK6A 2X51A 3I0QA 3E22E 3DJBA 3C64A 4PJMA 4QX8B 3PU8A 4PK4A 2V7IA 3ZYLA 5FP3A 4UF0A 2VWAA 3C50A 5FXZA 3CQXC 4V1Av 3H3AA 4KMCA 3TKLB 2LSKA 3MKDA 3AAEB 2E8IA 3C4WA 4AKIA 3OJAA 2KLQA 3A5XA 3KBTA 1MNEA 3LK42 3HI2A 5BMVE 3I1AA 4HEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GK0 E;  2LSY A;  2LSI A;  2LSJ A;  3VU7 H;  2LSK A;  2N1G A;  2LSG A;  4EXT A;  4FJO A;  4GK5 E;  4BA9 A; 
#chains in the Genus database with same CATH topology
 2VQE T;  2IAK A;  1XNR T;  2OV9 A;  3AAI A;  4LF9 T;  3FXD B;  1S35 A;  4TN7 B;  3CKD A;  1IBM T;  2X9Y A;  3UTK A;  4IE0 A;  3RIA A;  1X9B A;  3UFG A;  2VK9 A;  3O9X A;  1HNW T;  5L4H A;  3RPU A;  3B57 A;  1U5P A;  2BS4 A;  3NZQ A;  5JR9 B;  2EHO B;  2Q9Q B;  2H88 A;  1W09 A;  5ADX L;  5A1L A;  2XAG B;  1U4Q A;  3AVR A;  2W00 A;  2VB6 A;  4DMW A;  5HYA A;  5FY0 A;  3D0T A;  4BA9 A;  5AQM B;  5L3D B;  5BR8 T;  3AEE A;  3ESL A;  3RQW A;  2BG9 B;  3RYI E;  2XUE A;  2X9W A;  4YT0 A;  2QA7 A;  4I0U A;  3TLW A;  2V7L A;  2PJQ A;  1UX4 A;  4KX6 A;  3O4X E;  2OA5 A;  1NEK A;  3RYF E;  4KI0 F;  5EK4 A;  3AE6 A;  2BG9 E;  3FZH B;  4HFC A;  2AXD S;  3RIF A;  2V6Y A;  3KV4 A;  2WBL A;  3IEE A;  2JQ9 A;  4X66 T;  4I50 E;  5JTG A;  2ZM6 T;  4OFZ A;  5F8P A;  3KV6 A;  5EK3 A;  4COF A;  3KBU A;  4QX7 B;  3AE3 A;  2IC9 A;  1WRD A;  3L3P A;  2QYW A;  1D1C A;  3V5S A;  1WYC A;  2X68 A;  2FUP A;  4YSX A;  4YSY A;  3G06 A;  3SS1 A;  3UQ4 A;  4GIW A;  2LSJ A;  5JH7 E;  3AEB A;  2VVN A;  3N9Q A;  4LF8 T;  1IZN B;  4DUZ T;  4TWH A;  1D1A A;  4JBW F;  2XAS B;  1XMQ T;  3ZJ1 A;  2B76 A;  4A56 A;  5IYZ E;  1OWA A;  1MMN A;  4LML A;  2BVM A;  2LJL A;  4CI3 B;  4DBR A;  2V8S V;  1YQ3 A;  3GN5 A;  5AQL B;  3WAK A;  3QNU A;  3PV0 F;  2HHH T;  3FXE B;  3JAE A;  5AQN B;  5TAO A;  3MZK B;  1MIY A;  4PFO A;  4YJ3 E;  5AQS B;  1OED A;  3P4S A;  3OBV E;  4AI6 A;  3PUR A;  2B1E A;  4GK5 E;  5JDL A;  4HKA A;  5DJQ C;  4MFR A;  5IHY A;  3AE9 A;  3PDY A;  1E2A A;  3RX6 A;  3HKD E;  3H37 A;  3E08 A;  3CQC B;  4DR4 T;  1OXZ A;  2LT3 A;  4HWC A;  3FZF B;  3O1J A;  5J1G A;  3AA6 B;  4G2A A;  4OYK A;  4CN4 A;  3FHN A;  1R8I A;  3TLT A;  4U7I A;  5AQV B;  2HN2 A;  2Z6E A;  2CHN A;  1ZV4 X;  5AQG B;  4ZI7 E;  4ZEY A;  2FJB A;  2LSI A;  2V1D B;  2VL0 A;  3EI0 A;  5C8Y E;  2KMF A;  5LHG B;  3RH3 A;  1YQ4 A;  4U31 A;  4ILA A;  4WNK A;  4I55 E;  1UX5 A;  4GK0 E;  2E9X A;  2CMR A;  5AQJ B;  4DV5 T;  2CBJ A;  2XAF B;  3VRB A;  1Z8U A;  5LJM A;  3NVO A;  3C98 B;  1QSD A;  5JDG A;  5CA0 E;  2I0M A;  3RC8 A;  2NW8 A;  2CLY B;  5LYJ E;  3J9X 1;  4DR1 T;  3HKE E;  3ZSS A;  5FXW A;  4JI8 T;  3DP7 A;  4NUU A;  1YKH B;  4F8H A;  2JRK A;  2DLR A;  3AA1 B;  2DNX A;  2WZI A;  1SUM B;  4HFD A;  4ZOL E;  2NTY A;  2RPA A;  1LVK A;  5LGT B;  4DID B;  4IE5 A;  4YTN A;  4X5T A;  5L3E B;  5ABH A;  2XM2 A;  5L3B B;  2WMN A;  5HEU A;  4B6X A;  3N9N A;  5LOV E;  1UCU A;  5CB4 E;  1MMA A;  3PJA A;  1O3X A;  2WWU A;  2HN1 A;  2A9U A;  1KK7 A;  1HS7 A;  5HXE A;  3N2O A;  3PUS A;  4AQF C;  2LOP A;  3A7M A;  2NTX A;  3ONL C;  4QH4 A;  5KXJ A;  5FL1 A;  1T98 A;  1NEN A;  3LSV A;  4U7Y A;  2F4V T;  5H6R B;  3HKC E;  3RRW A;  1XWM A;  2J1D G;  2PFV A;  2LHR A;  4IT4 A;  4DBQ A;  3F2E A;  3AE5 A;  3GA8 A;  2UXB T;  2WAU A;  2XQ8 A;  3K3N A;  3QB5 A;  4WYV A;  5LG4 A;  4DR7 T;  4DV4 T;  1BR2 A;  2J47 A;  2SPC A;  2XSA A;  4IDO A;  2ODV A;  4LF5 T;  2X51 A;  3I0Q A;  3DJB A;  4HFB A;  1FJG T;  4UF0 A;  2VWA A;  2E8I A;  3C4W A;  3ABV A;  4AIS A;  2XSB A;  3A5X A;  3LK4 2;  4HEA A;  1IJ6 A;  2IW5 B;  4XAX B;  4LFA T;  4OYJ A;  1WLX A;  3ETU A;  4PFP A;  4TWF A;  1IAP A;  3AED A;  2LOS A;  2YK0 A;  3RIU A;  3PUV F;  4X64 T;  2C5K T;  2JQH A;  4Z90 A;  4KHP T;  5AQR B;  4I43 B;  1BR1 A;  3VRA A;  4H63 H;  1VCS A;  1N34 T;  3NZP A;  3AEA A;  3N2K E;  4WZX A;  2K9A A;  3SOL A;  3AE7 A;  1VOM A;  2YEV C;  2LHN A;  3RC3 A;  3ZN1 B;  2NWB A;  2D5U A;  4O4H E;  1MIV A;  2BS3 A;  3Q5D A;  5ABE A;  1UUS A;  2Y48 B;  5ABF A;  3L8R A;  4I4T E;  2Y8D A;  4YTM A;  3N9L A;  2V7K A;  1E7P A;  3PU3 A;  1T8B A;  1LKX A;  3FBZ A;  4DVD A;  2L9Q A;  2FBW A;  3UU8 A;  2C5J A;  2YKS A;  3OPC A;  5C2T A;  3ZCI A;  5LMN T;  3PTR B;  4O4J E;  2C0S A;  4ILB A;  2V6X A;  2G0U A;  4EAH A;  5FKY A;  3AE1 A;  1D0Y A;  2K5B B;  4YTP A;  4IRE A;  3ZLI A;  4TNW A;  3J7Y q;  3AXJ A;  5AQQ B;  4KUM B;  1LRZ A;  4X62 T;  3ANW A;  3M3Z B;  2M6B A;  4AKR B;  1GQE A;  2XTL A;  3E0Z A;  4DND A;  2J4G A;  2L8K A;  5LCY A;  5AQI B;  1M62 A;  1MIW A;  3C51 A;  2W2U A;  4X20 E;  5HXS A;  4FI5 A;  4MAL A;  2WDV A;  2WZH A;  5FNV E;  4N78 D;  3N2G E;  1D0X A;  3KV9 A;  4IL4 A;  3SRZ A;  1W0A A;  3P4R A;  5LHI B;  2XQA A;  1US7 B;  3RGL A;  3PUZ F;  4B3S T;  4P0A A;  1M7K A;  5EK2 A;  1SHZ C;  4Q25 A;  2J62 A;  4U33 A;  3NWI A;  3SFE A;  3P8C D;  4HFH A;  4OK0 A;  3RRC A;  1HTJ F;  4EZ4 A;  2WS3 A;  4YHJ A;  1X79 A;  3T8O A;  2LRL A;  4DMV A;  4HE8 A;  2JQK A;  3VU7 H;  2BDE A;  5LP6 E;  4EOZ B;  2BZB A;  1KF6 A;  2BBH A;  2YDQ A;  3OYX A;  3FZK B;  4JEU B;  4PAG A;  3ZN0 B;  3M65 A;  1IBL T;  3PUQ A;  2CXL A;  2BKP A;  4ZZC A;  3P50 A;  1FIO A;  3UUL A;  2BKN A;  1HG5 A;  2KWI B;  3NRY A;  3PUY F;  5CFB A;  5KX5 E;  2KSR A;  2XQ6 A;  3ZEF B;  1D1B A;  4CN1 A;  4IST A;  4X1Y E;  2E5L T;  1HCI A;  4KBM B;  1OED C;  2A2F X;  1YW0 A;  5KMG P;  2W4X A;  2WP9 A;  3AE4 A;  4B3R T;  4UF0 B;  4O4L E;  4MHC A;  4QXH B;  5JDQ A;  4YFS A;  5DQW A;  2VKD A;  3ZMS B;  2YOE A;  3T1Y T;  4U2Y A;  1XNQ T;  5L2L A;  2M67 A;  3Q9D A;  5KDM C;  5JDF A;  2BKO A;  3IHR A;  2CPT A;  5IUX A;  4OHF A;  2UUC T;  1Y64 B;  4TV8 E;  5CGM A;  5JRE A;  3IA3 A;  3QUJ A;  2CM0 A;  3LK2 B;  4UVC B;  3T1H T;  5CA1 E;  3V5U A;  2E9X C;  5L3C B;  4WW0 A;  4O4I E;  2ACX A;  2D0U A;  2X0L B;  2E9X D;  3HL6 A;  4PK5 A;  2YU2 A;  4HWF A;  5AQF B;  3BQI A;  5HXH A;  2PTF A;  4HWD A;  4NXN T;  3P7I A;  4LMK A;  1IBK T;  4JI1 T;  2VQF T;  1N32 T;  3FZL B;  3BK9 A;  5HEJ A;  1T72 A;  3CML A;  2CEA A;  3ONJ A;  1IJ5 A;  2X0Y A;  4JEH B;  3RYC E;  1J1J A;  4YXD A;  5FXV A;  2WCA A;  3O1H A;  3H3M A;  3GWH A;  4IE7 A;  4AKG A;  4UEL A;  3AB3 B;  3QB5 K;  3I9Y A;  3F31 A;  4DV0 T;  1DU2 A;  4O2B E;  2P9B A;  2IML A;  1FMV A;  4GOU A;  4LMJ A;  4TV9 E;  3AVS A;  1S94 A;  4CZZ B;  1E1H B;  3UUN A;  3RYH E;  5HCM A;  2H7V C;  4TX5 A;  2YU1 A;  5JVD E;  3AXJ B;  5LBQ B;  3K1S A;  2NOX A;  4JYA T;  3ANW B;  1J5W A;  3F57 A;  2WB5 A;  2CA5 A;  3PUX F;  4UXN B;  5FMN A;  2X0H A;  1WYB A;  2WU2 A;  1UK5 A;  1ZP0 A;  2H3R A;  3RF1 A;  4A97 A;  4MLK A;  3QK6 A;  2UU9 T;  3C64 A;  4PJM A;  3UU3 A;  1HX1 B;  3ZYL A;  5AQK B;  3C50 A;  3H3A A;  2YDR A;  2LSK A;  3AAE B;  4NPP A;  2KLQ A;  3KBT A;  4HFE A;  5BMV E;  3B5M A;  2CCQ A;  2WMO A;  3PUW F;  1BR0 A;  4JI6 T;  3TLU A;  5JDH A;  5LJN A;  3RHW A;  5F5W A;  2WU5 A;  3OYZ A;  2W0G A;  3KDS E;  4BJN A;  4EIW A;  4TNV A;  3K8P C;  4ZZB A;  2A72 A;  3VHL A;  4QHO A;  4AKH A;  2XQ4 A;  4H9Q C;  2WQY A;  2KZ7 B;  2X9H A;  4H9S E;  3I0O A;  5E0O A;  3RIU C;  1HNX T;  4IL9 A;  2LSG A;  2QRX A;  4IE4 A;  1XDO A;  2EHO A;  2Q9Q A;  2DCF A;  2PG8 A;  3PUG A;  2XQ7 A;  4U3C A;  3OTO T;  4OX9 T;  3ONX A;  2UXC T;  4X1K E;  3NBX X;  3OKQ A;  4ZI2 C;  4CI1 B;  2V7J A;  4G63 A;  2DWK A;  2V6Y B;  1CHU A;  4EXT A;  4ZI2 D;  3VKG A;  2CHO A;  2W62 A;  2BBJ A;  2ZM2 A;  1MMG A;  4DV3 T;  3CX7 B;  3QOF A;  5AQO B;  5L3F B;  1YD8 G;  4ERR A;  4MBQ A;  1NWM X;  2BG9 A;  5GON E;  3P4P A;  1HFA A;  5HWX A;  2VKJ A;  3ZYK A;  5FL0 A;  2LLY A;  1SE7 A;  1HNZ T;  3UU6 A;  3MK7 C;  4L5G A;  3UUM A;  3FBL A;  2ZM8 A;  3L09 A;  4JLE A;  4U72 A;  2WWV A;  2XAH B;  2XQ9 A;  2XJ7 A;  4DR6 T;  2LRK A;  5J2U E;  2XHE B;  5EZY E;  2CXD A;  2CXF A;  2X66 A;  4UVA B;  5FVL A;  5CJ5 A;  2D9D A;  4O8S A;  2A3D A;  3GN5 B;  2FJE A;  2VKH A;  3ZCJ A;  3U78 A;  5FY7 A;  2HPL A;  5LB7 B;  2W66 A;  5AQU B;  1OED B;  5LNK A;  3AE8 A;  4ISS A;  2JQQ A;  2H7O A;  2XQ3 A;  2YDS A;  2WY2 A;  3ZMV B;  4X1I E;  4GKJ T;  2AE9 A;  5FY1 A;  2IIU A;  3LDQ B;  5AFU L;  2XM1 A;  2GK9 A;  3TLS A;  4DV2 T;  3ZKR A;  2LEH A;  2WDQ A;  5HXC A;  4ZHQ E;  4IE6 A;  1H7C A;  4AXP A;  1J5E T;  3HR0 A;  1NAF A;  3R84 B;  3ZT5 A;  3RKG A;  3AEF A;  3FZM B;  2E9X B;  4WBN E;  3K3O A;  4H9N C;  4F6R C;  3JAD A;  1XZY A;  3LBX A;  3UQ7 A;  4JI3 T;  4JI2 T;  4LF6 T;  2DI4 A;  4QXC B;  2D2S A;  2UXX B;  1KNR A;  2FJA A;  4PJL A;  4CN6 A;  1ZOY A;  2CRB A;  3L39 A;  5LXT E;  5HEO A;  4CXX A;  2W61 A;  3KVB A;  3MAC A;  3ZMT B;  4DV6 T;  2LSY A;  1WR6 A;  4H9O C;  1HR0 T;  1MND A;  1KNP A;  2LKG A;  4DUY T;  4LFC T;  2MOZ A;  3ZMU B;  2RA1 A;  1FMW A;  4WBO A;  4UV9 B;  4PNI A;  4YSZ A;  2ZLY A;  3CIR A;  2I59 A;  3KVA A;  4IIJ E;  3LJC A;  3PJA J;  3VR9 A;  2XQY A;  2V5C A;  3IBP A;  2X67 A;  1ZEE A;  2UUB T;  2IC6 A;  4XZC A;  2KND A;  2JMH A;  1I6Z A;  4JUY A;  4DR5 T;  3EDU A;  4HWH A;  5JQG E;  4Z91 A;  4J2C A;  2N9D A;  5C3J A;  4JI4 T;  3JC6 C;  4YY3 T;  4AKL A;  1MMD A;  3N5L A;  3BQK A;  3CX6 B;  3JC6 D;  4ILU A;  4L9I A;  4ZS3 A;  2CE7 A;  5HAX A;  5JRC A;  5L47 A;  4EYY R;  3C4X A;  4ASK A;  3AA7 B;  2VKO A;  2CWO A;  1V9D A;  1AJ3 A;  4ADZ A;  2KXP B;  5M4Y A;  4DR2 T;  1B7T A;  3KFW X;  3AEC A;  2LM9 A;  3HKB E;  5ABG A;  5L4E A;  2XAJ B;  2K3W A;  5ETW A;  3CWZ B;  3FB2 A;  3ZYM A;  2YIN A;  2NW9 A;  1XMO T;  4KP3 C;  4EB6 E;  1SA0 E;  3DTO A;  2XAQ B;  4CXY A;  2Y6X A;  5DQV A;  4EED A;  2CBI A;  3Q5X A;  3CX8 B;  1YKE B;  4DV7 T;  4IDQ A;  4X65 T;  3E22 E;  4QX8 B;  2V7I A;  4LF7 T;  5FP3 A;  5FXZ A;  4V1A v;  2E2A A;  4KMC A;  3TKL B;  3MKD A;  4AKI A;  5IWA T;  1MNE A;  4NIQ A;  4HFI A;  1WCR A;  3Q5W A;  4B3M T;  3TLV A;  4UR9 A;  3P4Q A;  2VUR A;  1LVF A;  2LE8 A;  5LGN B;  4P09 A;  4TZ4 C;  4P0B A;  1UUR A;  4YLH A;  2E5V A;  1G8X A;  3AA0 B;  1JNR A;  1CUN A;  3RLF F;  2UUA T;  4LF4 T;  5ABF B;  4EGW A;  1W9R A;  3I9W A;  4K0K T;  2XQ5 A;  2XPK A;  2IUB A;  2R6G F;  4EV6 A;  3UFE A;  5FXX A;  4EYU A;  2IDO B;  4E7Z A;  4JI7 T;  2K24 A;  3SFD A;  4Z8X A;  4PJN A;  3X1D A;  2WM9 A;  2MPK A;  4ZI3 C;  5FYM A;  4ZI3 D;  3LBX B;  4CI2 B;  3ZJ2 A;  2N2N A;  2K48 A;  2HH7 A;  3KV5 A;  5L3G B;  2ACZ A;  4GYR A;  2KWH A;  3RI5 A;  3EHZ A;  2C5I T;  4H63 V;  1VCT A;  2XY8 B;  4GKK T;  3UUX B;  2MTQ A;  4IDP A;  4QKN A;  1WFD A;  2D0T A;  1QUU A;  4TWD A;  1KFY A;  2ODU A;  4QXB B;  3EVY A;  2W63 A;  5JR9 C;  1HF8 A;  2EHO C;  5HCJ A;  4HN9 A;  2WSS V;  2Q9Q C;  2VAS A;  2KT9 A;  4CQI A;  3ETV A;  2EHO D;  2V26 A;  4A5X A;  2Q9Q D;  2H89 A;  4M1P A;  2NW7 A;  3QC9 A;  3W15 B;  1KEY A;  5FVK A;  2ES0 A;  5JDN A;  2UXD T;  2BS2 A;  5H6Q B;  5AQP B;  2V7M A;  3PE0 A;  4H9R C;  3LK3 B;  2DWG A;  2L3L A;  3IF8 B;  1XDP A;  2BG9 C;  5LA6 E;  3HA4 A;  1KNZ A;  2I6H A;  1Z0P A;  3ZT7 A;  3ZC0 A;  2JPF A;  1QLB A;  2ZM0 A;  5J0Z A;  3ZPO A;  5JDM A;  4JI0 T;  4LFB T;  3EAM A;  4XBF B;  4UIG A;  5DAB A;  5LHH B;  3CQG B;  2IHR 1;  2BVL A;  2LM2 A;  4L0R A;  1D0Z A;  5JRC B;  4GYS A;  1BR4 A;  3AEG A;  3O1I A;  2PBI A;  4ZXL A;  5F3J A;  4UVB B;  4NUV A;  3ZMZ B;  4ANJ A;  2KIN B;  3UU5 A;  1FEW A;  1N33 T;  1HG2 A;  4HTE A;  3KIN B;  5JR9 A;  4AIU A;  2M6I A;  2QGS A;  3NRX A;  2DL1 A;  4PK6 A;  4YHH T;  4IDZ A;  4NXM T;  3UU4 A;  3JAF A;  3P4W A;  3BQL A;  2LKH A;  4EEB A;  5AQT B;  3A8Y C;  4HGA A;  3N9P A;  1UGO A;  1VRB A;  3Q5E A;  2MAW A;  3NKZ A;  4PJJ A;  3VKH A;  1N36 T;  2NP9 A;  3CK6 A;  4UV8 B;  1WR0 A;  2V5D A;  4UEM A;  5HXR A;  4IHJ E;  3R6N A;  4YJ2 E;  3LFM A;  4AQG A;  3WI3 A;  1ZHC A;  3CVR A;  4A98 A;  3UT5 E;  3EDV A;  5LBM A;  3GMI A;  5AQH B;  5HWY A;  4DO0 A;  1YXR A;  2W67 A;  3AE2 A;  2ZMA A;  3ZC1 A;  2N1G A;  5LG3 A;  5J2T E;  4C91 A;  3OVU A;  2QVA A;  4K0U A;  4E7S A;  1ZKE A;  4DR3 T;  5HEG A;  2UXN B;  1I94 T;  3C4Z A;  3LG7 A;  2HPJ A;  4O2A E;  1G73 A;  2JJ9 A;  2X9X A;  2OLT A;  3N9M A;  5LGU B;  4CXW A;  4U2Z A;  4BJM A;  3RQU A;  5LMU T;  4AQF A;  3U3I A;  4DV1 T;  1HX8 A;  4KHZ F;  2CWY A;  4HFV A;  3S4U A;  4HWI B;  4H9P C;  3MA9 A;  4U74 A;  1L0V A;  3EAB A;  4JV5 T;  1T7S A;  4P1N A;  2WDR A;  2VL8 A;  1OED E;  2JMK A;  4BAY B;  2VVS A;  2MYS A;  2CLY C;  2RP4 A;  3CPZ A;  4QH1 A;  2XZE A;  3SWH A;  2NR4 A;  4IDN A;  3WAJ A;  4C90 A;  4TUY E;  4AQY T;  5HEH A;  3MJX A;  3B13 A;  3K3Q C;  4EZH A;  3ZST A;  3EUH A;  2JIW A;  3N9O A;  3RKO A;  4QWN B;  3MXZ A;  2FJD A;  2DHR A;  4FJO A;  4IGU A;  3AAA B;  3Q2M A;  3VR8 A;  2MBG A;  3PUA A;  4ZS2 A;  1Y01 A;  4QH5 A;  1W0B A;  1EZ3 A;  1JNZ A;  4PW8 A;  4JI5 T;  3JCF A;  3PU8 A;  4PK4 A;  4B3T T;  3CQX C;  3UUB A;  2YN6 A;  4ILC A;  3OJA A;  3HI2 A;  3I1A A;  3ZT6 A; 
#chains in the Genus database with same CATH homology
 2IAK A;  1IJ6 A;  2CCQ A;  2WMO A;  2IW5 B;  3Q5W A;  4XAX B;  3AAI A;  4OYJ A;  1WLX A;  3ETU A;  1BR0 A;  4PFP A;  1IAP A;  3FXD B;  1S35 A;  1LVF A;  5JDH A;  5LJN A;  2LOS A;  2YK0 A;  2LE8 A;  4TN7 B;  3CKD A;  5LGN B;  4P09 A;  4TZ4 C;  4P0B A;  2X9Y A;  4YLH A;  1G8X A;  2C5K T;  3UTK A;  3OYZ A;  2W0G A;  4IE0 A;  3KDS E;  3AA0 B;  1CUN A;  4BJN A;  4EIW A;  2VK9 A;  3O9X A;  3K8P C;  4I43 B;  1BR1 A;  2A72 A;  4H63 H;  3RPU A;  3VHL A;  4QHO A;  4AKH A;  3NZP A;  3B57 A;  1U5P A;  3I9W A;  4H9Q C;  2KZ7 B;  2X9H A;  3N2K E;  3NZQ A;  2K9A A;  4H9S E;  5JR9 B;  3I0O A;  2EHO B;  3SOL A;  1VOM A;  5E0O A;  2Q9Q B;  2LHN A;  2YEV C;  3RC3 A;  3ZN1 B;  2NWB A;  5ADX L;  2D5U A;  5A1L A;  4O4H E;  2XAG B;  1MIV A;  3UFE A;  5FXX A;  4EYU A;  1U4Q A;  2Y48 B;  3AVR A;  2W00 A;  4E7Z A;  2VB6 A;  2K24 A;  4DMW A;  5HYA A;  5FY0 A;  4I4T E;  4Z8X A;  2LSG A;  4PJN A;  3D0T A;  2Y8D A;  4BA9 A;  2WM9 A;  3N9L A;  4IE4 A;  2V7K A;  3PU3 A;  4ZI3 C;  5FYM A;  2EHO A;  1LKX A;  3FBZ A;  2Q9Q A;  2DCF A;  4ZI3 D;  2PG8 A;  5L3D B;  3LBX B;  3PUG A;  4DVD A;  4CI2 B;  3ZJ2 A;  2L9Q A;  2N2N A;  3ESL A;  2K48 A;  3ONX A;  2HH7 A;  4X1K E;  3KV5 A;  3NBX X;  5L3G B;  3OKQ A;  3RYI E;  4GYR A;  4ZI2 C;  2C5J A;  2KWH A;  4CI1 B;  2V7J A;  2XUE A;  4G63 A;  2DWK A;  2X9W A;  3ZCI A;  2C5I T;  2QA7 A;  4H63 V;  4EXT A;  4ZI2 D;  3VKG A;  3PTR B;  2W62 A;  4O4J E;  2C0S A;  2V7L A;  2PJQ A;  1UX4 A;  3UUX B;  3O4X E;  2MTQ A;  2ZM2 A;  2OA5 A;  2G0U A;  4EAH A;  1MMG A;  4QKN A;  2D0T A;  3RYF E;  1QUU A;  5EK4 A;  1D0Y A;  2K5B B;  3CX7 B;  5L3F B;  1YD8 G;  4ERR A;  2ODU A;  4QXB B;  4MBQ A;  3ZLI A;  1NWM X;  3EVY A;  5GON E;  2W63 A;  5JR9 C;  1HF8 A;  3J7Y q;  2EHO C;  1HFA A;  4HN9 A;  2WSS V;  5HWX A;  2Q9Q C;  2VKJ A;  4KUM B;  2VAS A;  2KT9 A;  4CQI A;  1LRZ A;  3ZYK A;  3KV4 A;  2WBL A;  3ANW A;  3ETV A;  2EHO D;  2V26 A;  2Q9Q D;  4AKR B;  3IEE A;  4M1P A;  4I50 E;  3MK7 C;  4OFZ A;  4L5G A;  5F8P A;  3KV6 A;  3UUM A;  5EK3 A;  2NW7 A;  3QC9 A;  3W15 B;  3KBU A;  3FBL A;  2XTL A;  3E0Z A;  2ES0 A;  4QX7 B;  2ZM8 A;  2IC9 A;  4DND A;  5JDN A;  2L8K A;  3L09 A;  5H6Q B;  4JLE A;  4U72 A;  1WRD A;  3L3P A;  2V7M A;  3PE0 A;  5LCY A;  1D1C A;  4H9R C;  2XAH B;  3V5S A;  1WYC A;  1MIW A;  2X68 A;  3C51 A;  3LK3 B;  4X20 E;  5HXS A;  4FI5 A;  5J2U E;  4MAL A;  2DWG A;  2L3L A;  2XHE B;  3IF8 B;  5EZY E;  2CXD A;  5FNV E;  4N78 D;  3SS1 A;  2CXF A;  3N2G E;  4GIW A;  5LA6 E;  2X66 A;  1D0X A;  3HA4 A;  3KV9 A;  4UVA B;  1KNZ A;  1Z0P A;  2LSJ A;  4O8S A;  5JH7 E;  3SRZ A;  5LHI B;  3ZC0 A;  2JPF A;  2ZM0 A;  1US7 B;  3ZPO A;  2A3D A;  3N9Q A;  3GN5 B;  1IZN B;  5JDM A;  1D1A A;  2VKH A;  3ZCJ A;  2XAS B;  3U78 A;  4P0A A;  5FY7 A;  2HPL A;  5EK2 A;  3ZJ1 A;  1SHZ C;  4A56 A;  5IYZ E;  4XBF B;  4UIG A;  1OWA A;  5DAB A;  5LHH B;  3P8C D;  5LNK A;  3CQG B;  1MMN A;  2BVL A;  4OK0 A;  4ISS A;  2JQQ A;  3RRC A;  1HTJ F;  2BVM A;  2LJL A;  4EZ4 A;  4CI3 B;  4L0R A;  4DBR A;  2H7O A;  3GN5 A;  1D0Z A;  1X79 A;  4YHJ A;  3T8O A;  3WAK A;  5JRC B;  4DMV A;  4GYS A;  1BR4 A;  3O1I A;  2PBI A;  4HE8 A;  3ZMV B;  3FXE B;  3VU7 H;  5F3J A;  5TAO A;  2BDE A;  3MZK B;  4NUV A;  4UVB B;  3ZMZ B;  1MIY A;  4X1I E;  4ANJ A;  4EOZ B;  5LP6 E;  2BZB A;  4PFO A;  2KIN B;  1FEW A;  4YJ3 E;  5FY1 A;  1HG2 A;  5AFU L;  3OBV E;  2GK9 A;  4HTE A;  4AI6 A;  3PUR A;  2B1E A;  4GK5 E;  3KIN B;  3OYX A;  2LEH A;  5JR9 A;  5JDL A;  4HKA A;  5DJQ C;  4MFR A;  5HXC A;  5IHY A;  4JEU B;  4ZHQ E;  4IE6 A;  2QGS A;  3NRX A;  3PDY A;  1H7C A;  4PAG A;  4AXP A;  3HR0 A;  3ZN0 B;  3RX6 A;  1NAF A;  4PK6 A;  3M65 A;  3R84 B;  3HKD E;  4IDZ A;  3H37 A;  3E08 A;  3CQC B;  1OXZ A;  2LT3 A;  3PUQ A;  2CXL A;  1FIO A;  3O1J A;  3UUL A;  1HG5 A;  5J1G A;  3BQL A;  2KWI B;  3AA6 B;  3NRY A;  4G2A A;  4OYK A;  5KX5 E;  2E9X B;  4WBN E;  3FHN A;  3ZEF B;  1D1B A;  3K3O A;  4IST A;  4X1Y E;  2Z6E A;  4HGA A;  4H9N C;  4F6R C;  3N9P A;  1ZV4 X;  3LBX A;  1VRB A;  1HCI A;  4ZI7 E;  4KBM B;  4PJJ A;  2LSI A;  2A2F X;  2DI4 A;  2V1D B;  3VKH A;  1YW0 A;  4QXC B;  5KMG P;  2D2S A;  5C8Y E;  2NP9 A;  2UXX B;  2KMF A;  5LHG B;  4UV8 B;  3RH3 A;  4WNK A;  4UEM A;  4PJL A;  4UF0 B;  5HXR A;  4I55 E;  1UX5 A;  4GK0 E;  4O4L E;  4IHJ E;  3R6N A;  5LXT E;  3LFM A;  4AQG A;  2E9X A;  2CMR A;  4MHC A;  3WI3 A;  1ZHC A;  4CXX A;  4YJ2 E;  2W61 A;  4QXH B;  3CVR A;  5JDQ A;  3KVB A;  4YFS A;  3MAC A;  3UT5 E;  3ZMT B;  5DQW A;  2VKD A;  3EDV A;  2XAF B;  3ZMS B;  5LJM A;  5LBM A;  3GMI A;  3C98 B;  2LSY A;  5HWY A;  1QSD A;  4DO0 A;  1WR6 A;  4H9O C;  5JDG A;  5L2L A;  2M67 A;  3Q9D A;  5CA0 E;  5JDF A;  5KDM C;  1MND A;  2ZMA A;  3IHR A;  3RC8 A;  3ZC1 A;  2N1G A;  2NW8 A;  2CLY B;  5LYJ E;  4OHF A;  1Y64 B;  4TV8 E;  5J2T E;  3J9X 1;  4C91 A;  4K0U A;  5JRE A;  2MOZ A;  3ZMU B;  2RA1 A;  3QUJ A;  4E7S A;  1FMW A;  4WBO A;  3HKE E;  5FXW A;  1ZKE A;  2UXN B;  3C4Z A;  3DP7 A;  3LG7 A;  4NUU A;  4UV9 B;  2CM0 A;  2HPJ A;  3LK2 B;  4O2A E;  1G73 A;  4PNI A;  4UVC B;  1YKH B;  2ZLY A;  2I59 A;  5CA1 E;  3KVA A;  2E9X C;  3LJC A;  4IIJ E;  4WW0 A;  3V5U A;  5L3C B;  4O4I E;  2ACX A;  2JRK A;  2JJ9 A;  2XQY A;  2D0U A;  2X0L B;  2DLR A;  2E9X D;  2X9X A;  3IBP A;  3AA1 B;  3HL6 A;  2X67 A;  2DNX A;  4PK5 A;  3N9M A;  5LGU B;  4CXW A;  1ZEE A;  4BJM A;  2YU2 A;  3BQI A;  4ZOL E;  2NTY A;  4AQF A;  3U3I A;  5HXH A;  2IC6 A;  4XZC A;  1HX8 A;  3P7I A;  1LVK A;  5LGT B;  2KND A;  2CWY A;  2JMH A;  4HFV A;  3BK9 A;  3S4U A;  4JUY A;  4IE5 A;  3CML A;  3EDU A;  2CEA A;  4H9P C;  3MA9 A;  5JQG E;  4U74 A;  5L3E B;  4J2C A;  1IJ5 A;  4JEH B;  3RYC E;  5L3B B;  5FXV A;  2N9D A;  2WMN A;  3O1H A;  4B6X A;  3N9N A;  2VL8 A;  3JC6 C;  2JMK A;  5LOV E;  1UCU A;  5CB4 E;  4AKL A;  1MMD A;  3N5L A;  4BAY B;  3BQK A;  1MMA A;  2MYS A;  3CX6 B;  3GWH A;  3JC6 D;  4ILU A;  4IE7 A;  4AKG A;  1O3X A;  2CLY C;  4UEL A;  2RP4 A;  4L9I A;  4ZS3 A;  3AB3 B;  2WWU A;  3CPZ A;  3I9Y A;  2CE7 A;  1KK7 A;  1HS7 A;  5HAX A;  3F31 A;  3N2O A;  5HXE A;  5JRC A;  4O2B E;  2P9B A;  3PUS A;  4AQF C;  1FMV A;  2LOP A;  4EYY R;  3C4X A;  4GOU A;  2NTX A;  4ASK A;  3SWH A;  3AA7 B;  4TV9 E;  2VKO A;  2CWO A;  3AVS A;  1S94 A;  4CZZ B;  1V9D A;  1E1H B;  3WAJ A;  1AJ3 A;  4ADZ A;  4C90 A;  4TUY E;  3UUN A;  1T98 A;  3MJX A;  3B13 A;  3RYH E;  3K3Q C;  2H7V C;  2KXP B;  4TX5 A;  5H6R B;  3HKC E;  4EZH A;  5M4Y A;  3EUH A;  3RRW A;  1B7T A;  3KFW X;  2YU1 A;  2LM9 A;  2J1D G;  5JVD E;  3HKB E;  2PFV A;  2LHR A;  5LBQ B;  3N9O A;  2NOX A;  2XAJ B;  3RKO A;  3ANW B;  5ETW A;  3CWZ B;  3FB2 A;  3ZYM A;  2YIN A;  3F57 A;  4QWN B;  2NW9 A;  3MXZ A;  2DHR A;  4DBQ A;  2CA5 A;  3F2E A;  4KP3 C;  4UXN B;  5FMN A;  3GA8 A;  4FJO A;  4EB6 E;  4IGU A;  3AAA B;  1SA0 E;  3Q2M A;  2WAU A;  3DTO A;  1WYB A;  3K3N A;  2XAQ B;  2MBG A;  4CXY A;  3PUA A;  5LG4 A;  2Y6X A;  1BR2 A;  4ZS2 A;  2H3R A;  2SPC A;  5DQV A;  3Q5X A;  3CX8 B;  1YKE B;  1EZ3 A;  4MLK A;  4PW8 A;  2ODV A;  3QK6 A;  2X51 A;  3I0Q A;  3E22 E;  3DJB A;  3C64 A;  4PJM A;  4QX8 B;  3PU8 A;  4PK4 A;  2V7I A;  3ZYL A;  5FP3 A;  4UF0 A;  2VWA A;  3C50 A;  5FXZ A;  3CQX C;  4V1A v;  3H3A A;  4KMC A;  3TKL B;  2LSK A;  3MKD A;  3AAE B;  2E8I A;  3C4W A;  4AKI A;  3OJA A;  2KLQ A;  3A5X A;  3KBT A;  1MNE A;  3LK4 2;  3HI2 A;  5BMV E;  3I1A A;  4HEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...