3EDVA

Crystal structure of repeats 14-16 of beta2-spectrin
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
322
structure length
322
Chain Sequence
b'SHMRHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spectrin beta chain, brain 1
publication title Localization and Structure of the Ankyrin-binding Site on beta2-Spectrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 156
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA01
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA02
3F57A 3EDUA 3LBXB 2ODVA 5J1GA 1HCIA 2ODUA 3FB2A 3KBUA 2SPCA 3PDYA 3R6NA 1U4QA 2IAKA 1QUUA 3UULA 3UUNA 1AJ3A 3KBTA 1OWAA 3PE0A 1U5PA 3EDVA 3LBXA 3UUMA 1S35A 3F31A 1G8XA 1WLXA 1CUNA
chains in the Genus database with same CATH superfamily
4KHPT 5LG3A 1T72A 4DR7T 1FMWA 3GMIA 4AI6A 3KV5A 1HFAA 1HTJF 4O2AE 2VKOA 3KV6A 3I9YA 1M7KA 3AE6A 2V7JA 3TLVA 4CI3B 2CWOA 4PJMA 2LHRA 4JI0T 2IDOB 4DBRA 1O3XA 4NXNT 3TLSA 1KNRA 4KHZF 2WAUA 5FY7A 2PBIA 3AAAB 2HPJA 2XQ7A 3AA7B 5EK2A 3C4XA 1YW0A 5DQWA 3AEDA 4TV8E 3ZMUB 2V7MA 5EK4A 3EDUA 4QXCB 5AQNB 4QH5A 5HWYA 3GA8A 1FJGT 3UULA 3K3OA 2Q9QA 3UUXB 3PTRB 2D2SA 4TV9E 3KFWX 5KXJA 2CWYA 4JUYA 4IDZA 2WS3A 2DHRA 2EHOC 3PU8A 3PDYA 4IIJE 4DO0A 2CBJA 1IJ5A 3HKCE 3OKQA 4HFBA 1VCTA 3H37A 1BR1A 3CIRA 2QYWA 1MIYA 4EAHA 3PUGA 1CUNA 3RIFA 2X9WA 2BG9C 3AA6B 1YXRA 2BBJA 4JI4T 4DNDA 2CHOA 2DWKA 2H89A 1U4QA 4GYSA 5CB4E 2CXFA 5LP6E 4QKNA 4LMKA 2J4GA 2QA7A 3UUMA 3F31A 5J2TE 3FBLA 4A97A 5FY1A 4QXHB 2DNXA 4UIGA 4I43B 3U78A 4LF6T 5ABEA 2XAJB 3OPCA 4V1Av 3QC9A 3K1SA 3RHWA 1ZV4X 2WMOA 4HN9A 4HWFA 4BJNA 4KUMB 5HAXA 2CCQA 5HCMA 1S35A 3HL6A 4KI0F 1XMQT 5CFBA 1L0VA 2PG8A 4TUYE 2LJLA 2V7KA 2XJ7A 1D0YA 5FVKA 2A2FX 3UU6A 4WZXA 2MOZA 4PK4A 4AKGA 4X1YE 1G73A 5ADXL 2V7LA 2RP4A 4DR1T 1XDOA 1OEDB 5JTGA 4H63H 2LSGA 3SS1A 4KMCA 1HNWT 2YU2A 4ISSA 5DABA 4C90A 2K3WA 4O8SA 2E5LT 4EZHA 3FBZA 2V6YB 1UURA 2X68A 3A7MA 3ONLC 3T8OA 1US7B 3AA1B 4L5GA 3FHNA 1MMGA 3VKHA 4A98A 3P4PA 5FXVA 4OYKA 2N2NA 4TZ4C 2K9AA 2WDRA 3MZKB 4QXBB 3TLUA 3EABA 5HXEA 1VOMA 2BKNA 4FJOA 3IBPA 4JLEA 3SFEA 1IAPA 2PJQA 4QH4A 1GQEA 2B76A 4LF7T 1UX5A 4ILUA 5JDGA 2VQET 3RLFF 3A5XA 1I6ZA 2BS4A 2LLYA 3VRAA 3DTOA 2KINB 3S4UA 2BDEA 1OEDA 2XAQB 2J62A 4NUUA 4PAGA 4DV1T 3AE7A 3R6NA 5L2LA 4DR2T 4NIQA 5FY0A 1IZNB 4ZZBA 4JBWF 3H3MA 2XQYA 2V6YA 2IC9A 3K8PC 2DLRA 2ZM0A 4MALA 4QX7B 3PUSA 3H3AA 2VKDA 3AEAA 1YKEB 3E08A 1ZKEA 2N1GA 3L39A 1AJ3A 1ZHCA 4XBFB 3JADA 2MPKA 3RF1A 4U2ZA 2IMLA 3RH3A 2LM2A 1G8XA 5LMNT 1J5ET 4NXMT 4B3ST 3JAFA 4HFEA 1BR4A 3HKEE 3OTOT 5C8YE 4HWIB 2F4VT 3EAMA 2XSAA 4WW0A 3MACA 3UUNA 4DV3T 2LSYA 3KINB 3PURA 4PNIA 3ZYMA 2XQ4A 4PK5A 4AISA 2FUPA 3RI5A 4QHOA 2ODVA 4K0UA 2YKSA 2E9XD 3D0TA 5FNVE 2XQ8A 2CLYC 2EHOB 2LHNA 5L3BB 3AXJB 3N9QA 3UU8A 2VKJA 4I0UA 4XAXB 4CN6A 3CMLA 3PV0F 4IDNA 3CX6B 1XWMA 3PJAJ 2WWVA 3MKDA 3UQ7A 2W62A 5L3GB 3I1AA 3ZT5A 3CQCB 4ZI7E 4CQIA 3I0QA 2YN6A 1UCUA 3OBVE 3PU3A 2AXDS 4LMLA 4DIDB 5CGMA 2XUEA 5LOVE 3AEEA 3G06A 4BAYB 1NAFA 4PFPA 3N9OA 2DCFA 3P7IA 5JH7E 2NW7A 4HFCA 5C2TA 4ISTA 4U31A 1WRDA 1UGOA 2XQAA 2W66A 5M4YA 5HXRA 3U3IA 3P4RA 2EHOA 1YKHB 3HR0A 4JI5T 3AXJA 1SE7A 3WAKA 2NTXA 1N36T 2YU1A 3Q9DA 1MIWA 3SWHA 2HPLA 3J7Yq 3O1JA 4EEBA 1MNDA 2D9DA 1FMVA 2WP9A 5JDLA 3NVOA 1KNZA 4EIWA 5HEOA 4OHFA 4X65T 3NZPA 3P8CD 3M3ZB 4H9QC 2M6IA 3IF8B 4HWHA 1KFYA 2J1DG 5FL1A 2X66A 5AQGB 2NR4A 4A56A 3P4WA 3BK9A 3CQXC 2UUCT 1WCRA 2V7IA 4TNWA 1E1HB 5IYZE 1JNZA 1WFDA 2DWGA 5JQGE 3O1IA 2NTYA 4HFHA 2CXDA 4G2AA 2Q9QD 4EEDA 2AE9A 2V26A 3ZN0B 4DV2T 2BS2A 3QUJA 3NZQA 3F57A 4X64T 5FYMA 3UUBA 1CHUA 4CXWA 3Q5DA 2D5UA 4JI8T 2IAKA 5AQKB 1LVFA 3NRYA 2C5KT 3RKGA 3X1DA 5AQUB 3AE1A 5HWXA 3C4ZA 2CEAA 3FZMB 4H9OC 4UV9B 3T1YT 2LEHA 4LFBT 3C51A 2JIWA 5AQQB 3QB5A 1W9RA 5LNKA 2ES0A 3TLTA 5LGTB 3ONJA 3WAJA 1XZYA 3EDVA 5AQMB 3WI3A 3PUWF 2CM0A 3MK7C 3PUXF 4F6RC 4OFZA 2X9XA 3O4XE 1HNXT 4QH1A 3ZC0A 3RRWA 4OX9T 3ZJ1A 4O4HE 4U7IA 1ZOYA 4DR6T 1M62A 4YTNA 5LHGB 3EVYA 2BS3A 3ZMZB 4U2YA 2V6XA 3C50A 2VASA 4IGUA 1VRBA 2VKHA 4KP3C 4O4IE 4IE4A 4JI6T 1R8IA 4EOZB 4UF0B 3ZKRA 2JQKA 3ETVA 4HFIA 5C3JA 3CWZB 4IHJE 3GN5B 3ZT7A 4AKRB 3JC6D 2DI4A 3N2GE 3PJAA 5KDMC 5LHIB 1XNQT 2V8SV 2UXCT 3RKOA 4YLHA 5HXCA 3UU5A 3ZLIA 2LRKA 2Y48B 3ZCJA 1W0BA 5AQOB 3LG7A 3LDQB 2UUAT 4DBQA 2CLYB 4H9SE 2Y6XA 1WR6A 3K3QC 3SFDA 5TAOA 2V1DB 1B7TA 2JMHA 5H6RB 2I6HA 3N2KE 2ACZA 2E9XC 1NENA 1XMOT 5AQIB 3FZKB 1SUMB 5LBMA 3CX7B 2BBHA 4UF0A 4ZI3C 5L3DB 5FXZA 2UU9T 5HEHA 3GN5A 4ZI2D 4YTMA 4H9RC 2QVAA 3C64A 2WCAA 2ZM2A 3A8YC 4I4TE 5ABHA 4Z8XA 3ZC1A 2YDSA 5IHYA 4E7ZA 3FXDB 3HKDE 5JDFA 4GOUA 2BZBA 2IHR1 4GKKT 5LG4A 4PJNA 3TLWA 3EI0A 4DV0T 3OYXA 1HF8A 2HN2A 2VQFT 3N9LA 5KX5E 5EZYE 4GK5E 1V9DA 1HNZT 5AQHB 2PTFA 4UELA 3PUVF 2VL8A 3QB5K 2KXPB 4GIWA 4CI2B 2JMKA 4M1PA 4TWFA 4O4JE 4L0RA 2FJDA 3L8RA 3PUAA 4GKJT 4DUZT 5HEJA 2A9UA 3DP7A 1WYCA 2V5DA 3OYZA 4DV6T 2JPFA 2B1EA 4BA9A 2XQ3A 3N5LA 2D0UA 3DJBA 3EUHA 3N9PA 4JEUB 3CVRA 4X66T 2X0YA 5CJ5A 4YXDA 4HFVA 5AQJB 4AQFA 2H88A 2OA5A 2Z6EA 1YD8G 5IUXA 5LYJE 3I0OA 5AQPB 4P09A 4I50E 1KF6A 3C4WA 1KNPA 4AXPA 2XAFB 2XSBA 3AE4A 3QK6A 4TX5A 3B5MA 3RQUA 4UR9A 4JI3T 3AAEB 2X67A 5E0OA 4Q25A 2X0HA 2ZM8A 4YY3T 1D0ZA 4N78D 4HTEA 4LF4T 3VU7H 5FP3A 3Q2MA 5A1LA 4CZZB 3F2EA 1IJ6A 3LK42 1I94T 1MMDA 1QLBA 1NEKA 2LT3A 3OVUA 4H9PC 4LF8T 5HEUA 4IE7A 2JRKA 3VHLA 2JJ9A 2C5JA 3MA9A 3ETUA 2XQ6A 4JYAT 4IE6A 4U33A 4YFSA 4PJJA 2UXXB 2I59A 2W0GA 2WB5A 4LF5T 1WLXA 1HX8A 1Z0PA 1T8BA 5JR9C 3ZT6A 4U72A 4IE5A 2VK9A 1D0XA 4NPPA 3ZCIA 2LSJA 4JI2T 1WYBA 1EZ3A 4H9NC 3RX6A 5AQLB 2WWUA 5FL0A 2W63A 4IDOA 3JC6C 4ZS2A 5FXWA 5L3EB 4MHCA 4NUVA 4WBNE 4ZEYA 5J2UE 5LJNA 2LOSA 2KT9A 2LOPA 1MMAA 4HGAA 2BG9E 3J9X1 3R84B 3RPUA 3W15B 3AA0B 4U74A 2QGSA 1D1BA 2W61A 5DJQC 3AE9A 1IBMT 4ZXLA 2FBWA 2E9XB 2WZIA 2WBLA 2YINA 4TNVA 2XM1A 4A5XA 3JCFA 1S94A 4EXTA 3KVAA 3Q5EA 2BVMA 4UEMA 4PFOA 4YJ3E 5AQFB 2KZ7B 3KBUA 4AQFC 3P4SA 2IC6A 3CK6A 5FXXA 3VR9A 4QWNB 5L3FB 2KSRA 4Z91A 4HKAA 2XZEA 5LHHB 2WM9A 3LK3B 4ILAA 4C91A 3AB3B 3UTKA 4ZS3A 1T7SA 1LRZA 1N34T 2OLTA 5ETWA 2WU5A 2W2UA 3LSVA 1LVKA 1QUUA 3UU4A 4IE0A 5LA6E 3CQGB 3UFGA 3P4QA 2H3RA 2H7VC 3ESLA 1U5PA 2GK9A 1MNEA 3QNUA 3NBXX 3RGLA 4P1NA 2E9XA 1W0AA 4DR3T 4HE8A 4CN4A 1D1CA 2E8IA 3HA4A 2NW8A 5H6QB 3ZMVB 5IWAT 4K0KT 4DMVA 4DV4T 5FMNA 3UT5E 3RIUC 2E2AA 4JI7T 2DL1A 2Y8DA 4DV5T 4YT0A 2ZM6T 4LF9T 2XAHB 2KWIB 3QOFA 4HFDA 4ERRA 1OWAA 3B13A 2CHNA 3K3NA 3PUQA 4E7SA 1UUSA 2HH7A 2LSIA 3CPZA 3VRBA 5HCJA 4P0BA 3KV4A 4EYYR 3FZLB 5LGNB 2LSKA 4B3MT 2HN1A 2X9HA 1MIVA 4AKHA 5HXSA 2LM9A 1Y64B 5AFUL 2WDVA 3LFMA 5ABGA 2VWAA 4L9IA 2HHHT 5AQRB 2CPTA 4YSZA 4AKIA 1IBKT 3ZJ2A 1KK7A 3ANWB 3V5UA 4JI1T 1LKXA 4YSXA 4QX8B 2I0MA 4DV7T 1Y01A 4KBMB 4G63A 4ANJA 3HI2A 3AEGA 2YDRA 4YTPA 3RC3A 2KWHA 2LRLA 3VKGA 4EGWA 1T98A 3ZPOA 3BQIA 3MJXA 3L3PA 5L4EA 2CMRA 2C0SA 3LK2B 5J0ZA 2X51A 2RA1A 2K48A 5JR9B 3AEFA 5F8PA 5AQSB 4ILBA 1FIOA 1OXZA 1YQ4A 1X79A 2G0UA 4GK0E 4COFA 3ANWA 1W09A 5LGUB 5F3JA 4B3RT 2XPKA 3EHZA 3LBXB 3Q5WA 3Q5XA 3SOLA 5FKYA 3AECA 5JDQA 5L3CB 1BR2A 2CXLA 2A3DA 3RRCA 3ZYLA 4OYJA 3ONXA 3FXEB 1VCSA 2WZHA 3UQ4A 5DQVA 5BMVE 2VL0A 3KVBA 5LB7B 2D0TA 4DR5T 3BQKA 1JNRA 2CE7A 4MLKA 2J47A 5JVDE 2XM2A 4CN1A 2ZLYA 5JR9A 2FJAA 1J5WA 5LCYA 3ZSSA 2WU2A 3ZN1B 1X9BA 3ABVA 4P0AA 4TWHA 2LKGA 3OJAA 2FJBA 1XNRT 3N9MA 5LXTE 3AE2A 4ZZCA 1DU2A 3LBXA 2YDQA 2LE8A 1J1JA 2A72A 4OK0A 2VURA 1E7PA 2KNDA 4JV5T 1HX1B 4B6XA 3KBTA 3IHRA 3NRXA 4KX6A 4UVCB 5AQTB 4F8HA 3BQLA 4PW8A 4IDPA 1OEDE 1N33T 3MXZA 3RYIE 2SPCA 4HWDA 3PUZF 4AIUA 3UFEA 3C98B 2CA5A 3RYFE 2MYSA 1NWMX 4YJ2E 4Z90A 3RYHE 2L8KA 3AE3A 2CBIA 3N2OA 3M65A 4AQGA 1YQ3A 2XASB 4PJLA 4X62T 3L09A 5F5WA 3AE8A 4HWCA 2OV9A 2WDQA 3ZMTB 4ILCA 2M6BA 5JDHA 2Q9QC 2XHEB 4XZCA 4CXXA 4PK6A 2JQHA 2ZMAA 4FI5A 2XTLA 2WQYA 4YHHT 3RIAA 2JQ9A 3FB2A 5JDNA 2RPAA 4IT4A 2XQ9A 2XY8B 2YOEA 3PE0A 5JDMA 4YSYA 4X5TA 4YHJA 1KEYA 4UVBB 2IW5B 1IBLT 4ZOLE 2X0LB 3HKBE 4O4LE 3FZHB 2KMFA 3JAEA 1UX4A 3AE5A 4X20E 3IEEA 2VVSA 3RIUA 4TN7B 3O9XA 4EYUA 2NOXA 2EHOD 3VR8A 2X9YA 5EK3A 3AAIA 3GWHA 1UK5A 3AVSA 4X1IE 1D1AA 3FZFB 4IREA 3SRZA 2YK0A 2M67A 3B57A 4EV6A 2UXNB 2NWBA 3KDSE 3KV9A 2R6GF 5BR8T 4DUYT 4UVAB 3N9NA 2IUBA 3O1HA 1ZP0A 2VVNA 4UV8B 2K24A 2WSSV 4X1KE 2BVLA 4U7YA 4IL9A 1HG5A 3LJCA 3ZYKA 4ZHQE 2PFVA 4JEHB 3V5SA 2N9DA 3AEBA 4U3CA 4EB6E 2V5CA 4ZI3D 5JREA 4WBOA 2BKOA 4H63V 2K5BB 4CXYA 4ADZA 4DMWA 2UXBT 5LMUT 1SA0E 1XDPA 2BG9B 1Z8UA 3TKLB 3CKDA 1FEWA 3RC8A 1H7CA 5ABFB 5KMGP 4BJMA 5HXHA 3I9WA 4AKLA 2NW9A 1E2AA 2CRBA 3ZSTA 2UXDT 2NP9A 1HS7A 4IL4A 2W67A 2FJEA 1QSDA 4I55E 3RQWA 4ASKA 5GONE 2UUBT 3NKZA 3UU3A 4ZI2C 3IA3A 1HG2A 2BKPA 2VB6A 4DR4T 2P9BA 5L4HA 4UXNB 4MBQA 1WR0A 2E5VA 1HCIA 4EZ4A 2ODUA 3PUYF 5LJMA 5FVLA 5JRCB 2XAGB 2W4XA 5CA0E 1MMNA 3P50A 2QRXA 2BG9A 2KLQA 4GYRA 4WNKA 4IDQA 2YEVC 5J1GA 2C5IT 5ABFA 1OEDC 4TWDA 2ACXA 2LKHA 1N32T 4LMJA 5HYAA 2WY2A 5CA1E 4AQYT 1ZEEA 3ZMSB 4O2BE 1HR0T 2MTQA 4LFCT 2MAWA 2L9QA 2H7OA 4WYVA 1SHZC 4LFAT 1BR0A 4DVDA 3ZEFB 4MFRA 3E0ZA 3T1HT 5AQVB 4B3TT 5LBQB 5JRCA 3AVRA 4HEAA 2XQ5A 3E22E 2JQQA 2L3LA 5HEGA 3RYCE 2W00A 3CX8B 5L47A 4J2CA 3NWIA 4CI1B 2MBGA 2IIUA 2Q9QB 2WMNA
chains in the Genus database with same CATH topology
3ZYLA 4OYJA 3ONXA 3FXEB 3QK6A 4TX5A 2XUEA 1FMWA 3AAEB 3GMIA 5LOVE 4AI6A 3KV5A 1HFAA 2X67A 5E0OA 1HTJF 5DQVA 4BAYB 4O2AE 1NAFA 2ZM8A 5BMVE 4PFPA 2VKOA 2DCFA 3KVBA 3N9OA 3KV6A 3P7IA 5JH7E 3I9YA 2NW7A 2D0TA 3BQKA 1D0ZA 2V7JA 4N78D 4HTEA 4ISTA 4CI3B 2CE7A 4MLKA 1WRDA 5JVDE 3VU7H 2CWOA 5FP3A 2ZLYA 5JR9A 3Q2MA 4PJMA 5A1LA 4CZZB 5M4YA 5HXRA 5LCYA 2LHRA 3U3IA 2EHOA 1YKHB 3ZN1B 4DBRA 3F2EA 1IJ6A 4P0AA 3LK42 1O3XA 3HR0A 1MMDA 2LT3A 4H9PC 3WAKA 3OJAA 2NTXA 2YU1A 3Q9DA 2WAUA 1MIWA 5FY7A 4IE7A 3SWHA 2PBIA 3AAAB 2HPJA 3AA7B 5EK2A 3N9MA 2JRKA 5LXTE 3C4XA 2HPLA 3VHLA 1YW0A 3LBXA 5DQWA 4TV8E 2JJ9A 2C5JA 3ZMUB 3MA9A 2LE8A 2A72A 2V7MA 3O1JA 3ETUA 3J7Yq 4OK0A 1MNDA 5EK4A 1FMVA 2KNDA 3EDUA 5JDLA 4QXCB 1KNZA 4EIWA 5HWYA 3GA8A 4OHFA 4IE6A 3NZPA 3UULA 3P8CD 4B6XA 3K3OA 3KBTA 2Q9QA 3UUXB 3IHRA 3NRXA 4YFSA 3PTRB 2D2SA 4TV9E 3KFWX 4H9QC 4PJJA 2UXXB 2I59A 2CWYA 4JUYA 2W0GA 3IF8B 4UVCB 4IDZA 2J1DG 1WLXA 3BQLA 2X66A 1HX8A 1Z0PA 4PW8A 2DHRA 5JR9C 3MXZA 4A56A 3RYIE 4U72A 3BK9A 3CQXC 2EHOC 3PU8A 2SPCA 4IE5A 2VK9A 2V7IA 3PDYA 4IIJE 1E1HB 4DO0A 3UFEA 5IYZE 3C98B 2CA5A 2DWGA 5JQGE 3RYFE 2MYSA 1NWMX 3O1IA 1IJ5A 2NTYA 3HKCE 4YJ2E 1D0XA 2CXDA 3OKQA 4G2AA 3RYHE 2Q9QD 3ZCIA 2L8KA 3H37A 2V26A 3ZN0B 1BR1A 2LSJA 1WYBA 1MIYA 1EZ3A 4EAHA 3N2OA 4H9NC 3RX6A 3PUGA 3M65A 4AQGA 3QUJA 1CUNA 3NZQA 2WWUA 2X9WA 3F57A 2XASB 5FYMA 2W63A 4PJLA 3AA6B 4CXWA 2D5UA 3JC6C 4DNDA 4ZS2A 5FXWA 3L09A 2DWKA 1U4QA 2IAKA 5L3EB 4GYSA 4MHCA 1LVFA 3NRYA 4NUVA 5CB4E 3ZMTB 2C5KT 2CXFA 5LP6E 4QKNA 5JDHA 2Q9QC 2XHEB 4WBNE 5J2UE 4XZCA 5LJNA 4CXXA 2LOSA 2QA7A 2KT9A 4PK6A 3UUMA 2LOPA 3F31A 1MMAA 2ZMAA 4HGAA 3J9X1 5HWXA 4FI5A 5J2TE 2XTLA 3R84B 3C4ZA 3RPUA 3W15B 3AA0B 2CEAA 4U74A 3FBLA 4H9OC 2QGSA 3FB2A 5FY1A 4QXHB 4UV9B 5JDNA 1D1BA 2DNXA 2W61A 5DJQC 2LEHA 2E9XB 4UIGA 3C51A 4I43B 3U78A 5LNKA 3PE0A 2ES0A 2XAJB 2WBLA 2YINA 5JDMA 5LGTB 4V1Av 3WAJA 1S94A 3QC9A 3EDVA 4EXTA 3KVAA 1ZV4X 4YHJA 4UVBB 2BVMA 2WMOA 4UEMA 4PFOA 4YJ3E 2IW5B 4ZOLE 3WI3A 2KZ7B 3KBUA 2CM0A 3MK7C 4HN9A 4AQFC 4F6RC 2X0LB 3HKBE 2IC6A 4O4LE 4OFZA 5FXXA 2KMFA 4QWNB 5L3FB 4HKAA 4BJNA 1UX4A 2X9XA 4KUMB 3O4XE 5HAXA 5LHHB 4X20E 3IEEA 2CCQA 3ZC0A 2WM9A 3LK3B 3RRWA 4TN7B 4C91A 1S35A 3HL6A 3ZJ1A 3O9XA 3AB3B 3UTKA 4O4HE 4EYUA 4ZS3A 1LRZA 2NOXA 2PG8A 4TUYE 2LJLA 3EVYA 2V7KA 5LHGB 5ETWA 2EHOD 1LVKA 3ZMZB 2X9YA 3C50A 1QUUA 2VASA 5EK3A 3AAIA 1VRBA 4IGUA 4IE0A 3GWHA 3AVSA 5LA6E 2VKHA 4KP3C 4O4IE 3CQGB 4IE4A 4X1IE 1D0YA 1D1AA 2H3RA 2H7VC 3ESLA 2A2FX 1U5PA 3SRZA 2YK0A 2M67A 4EOZB 2GK9A 3B57A 1MNEA 2NWBA 2UXNB 3KDSE 4UF0B 3KV9A 3NBXX 3ETVA 2E9XA 3CWZB 4IHJE 3GN5B 2MOZA 4PK4A 4AKRB 4HE8A 4AKGA 3JC6D 4UVAB 4X1YE 1G73A 2DI4A 2V7LA 3N2GE 3N9NA 5ADXL 2RP4A 1D1CA 3O1HA 2E8IA 3HA4A 2NW8A 5H6QB 4H63H 3ZMVB 2LSGA 3SS1A 4KMCA 5KDMC 5LHIB 4UV8B 2YU2A 4DMVA 2K24A 4ISSA 5DABA 3RKOA 2WSSV 4X1KE 4C90A 5FMNA 3UT5E 4YLHA 5HXCA 4O8SA 4EZHA 3FBZA 2BVLA 2Y8DA 3ZLIA 1HG5A 2X68A 3LJCA 3ZYKA 4ZHQE 2Y48B 3ZCJA 2PFVA 2XAHB 3T8OA 2KWIB 4JEHB 3V5SA 1US7B 3AA1B 3LG7A 4L5GA 2N9DA 4ERRA 3FHNA 1MMGA 4EB6E 2CLYB 4H9SE 1OWAA 3B13A 4DBQA 3VKHA 2Y6XA 1WR6A 4OYKA 3K3QC 5FXVA 2N2NA 4TZ4C 4ZI3D 2K9AA 5TAOA 3MZKB 2V1DB 5JREA 4WBOA 3K3NA 3PUQA 4QXBB 4H63V 4E7SA 2K5BB 5HXEA 1B7TA 4ADZA 4DMWA 1VOMA 2JMHA 4CXYA 1SA0E 5H6RB 4FJOA 2HH7A 2LSIA 3IBPA 3CPZA 3N2KE 4JLEA 1IAPA 2PJQA 2E9XC 3TKLB 3CKDA 1FEWA 1UX5A 4ILUA 3RC8A 1H7CA 5KMGP 5LBMA 3CX7B 5JDGA 4P0BA 3KV4A 4BJMA 4UF0A 4EYYR 5HXHA 4ZI3C 5L3DB 3I9WA 4AKLA 5FXZA 3A5XA 5LGNB 2LSKA 3GN5A 4ZI2D 2NW9A 2X9HA 1MIVA 3DTOA 2KINB 4H9RC 3S4UA 3C64A 2BDEA 4AKHA 2NP9A 5HXSA 2XAQB 2LM9A 1Y64B 2ZM2A 5AFUL 4I4TE 1HS7A 4NUUA 4PAGA 3LFMA 4Z8XA 3R6NA 3ZC1A 5L2LA 2VWAA 1QSDA 4I55E 5IHYA 4L9IA 4ASKA 5FY0A 4E7ZA 1IZNB 5GONE 3FXDB 3HKDE 5JDFA 2XQYA 2IC9A 3K8PC 2DLRA 2ZM0A 4ZI2C 4MALA 4AKIA 4GOUA 1HG2A 2BZBA 2VB6A 4QX7B 2P9BA 4UXNB 3PUSA 3ZJ2A 1KK7A 4MBQA 3ANWB 3H3AA 1HCIA 4EZ4A 2ODUA 5LJMA 2VKDA 5LG4A 3V5UA 4PJNA 5JRCB 1YKEB 3E08A 2XAGB 1LKXA 1ZKEA 2N1GA 4QX8B 1AJ3A 1ZHCA 3OYXA 4XBFB 1HF8A 3N9LA 5CA0E 5KX5E 1MMNA 3RH3A 4KBMB 5EZYE 4GK5E 1G8XA 4G63A 4ANJA 3HI2A 2KLQA 4GYRA 4WNKA 1V9DA 1BR4A 3HKEE 2YEVC 5J1GA 2C5IT 4UELA 3RC3A 2KWHA 5C8YE 2VL8A 3VKGA 2ACXA 2KXPB 4WW0A 3MACA 5HYAA 4GIWA 5CA1E 3UUNA 4CI2B 1T98A 2JMKA 3ZPOA 3BQIA 4M1PA 4O4JE 2LSYA 4L0RA 3KINB 3MJXA 3L3PA 3PURA 4PNIA 3ZYMA 3PUAA 2CMRA 2C0SA 1ZEEA 3DP7A 3LK2B 4PK5A 1WYCA 4QHOA 3ZMSB 4O2BE 3OYZA 2ODVA 2MTQA 2JPFA 2B1EA 2X51A 2RA1A 2K48A 4K0UA 5JR9B 4BA9A 2E9XD 3D0TA 5F8PA 5FNVE 3N5LA 1FIOA 2L9QA 2CLYC 2D0UA 1OXZA 2EHOB 2H7OA 3DJBA 1X79A 3EUHA 1SHZC 3N9PA 3CVRA 4JEUB 1BR0A 4DVDA 2LHNA 3ZEFB 4MFRA 3E0ZA 5L3BB 3N9QA 2G0UA 2VKJA 4XAXB 4GK0E 3CMLA 3ANWA 5LBQB 5LGUB 5F3JA 4HFVA 3CX6B 4AQFA 5JRCA 3AVRA 3LBXB 4HEAA 3Q5WA 3MKDA 3Q5XA 3SOLA 2OA5A 2Z6EA 2W62A 5L3GB 3I1AA 1YD8G 3E22E 5LYJE 3CQCB 4ZI7E 5JDQA 2JQQA 2L3LA 3I0OA 5L3CB 4CQIA 3RYCE 2W00A 3CX8B 1BR2A 3I0QA 2CXLA 4J2CA 4P09A 1UCUA 3OBVE 3PU3A 4I50E 4CI1B 2MBGA 3C4WA 2A3DA 2Q9QB 2WMNA 3RRCA 4AXPA 2XAFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F57 A;  3EDU A;  3LBX B;  2ODV A;  5J1G A;  1HCI A;  2ODU A;  3FB2 A;  3KBU A;  2SPC A;  3PDY A;  3R6N A;  1U4Q A;  2IAK A;  1QUU A;  3UUL A;  3UUN A;  1AJ3 A;  3KBT A;  1OWA A;  3PE0 A;  1U5P A;  3EDV A;  3LBX A;  3UUM A;  1S35 A;  3F31 A;  1G8X A;  1WLX A;  1CUN A; 
#chains in the Genus database with same CATH topology
 4KHP T;  5LG3 A;  1T72 A;  4DR7 T;  1FMW A;  3GMI A;  4AI6 A;  3KV5 A;  1HFA A;  1HTJ F;  4O2A E;  2VKO A;  3KV6 A;  3I9Y A;  1M7K A;  3AE6 A;  2V7J A;  3TLV A;  4CI3 B;  2CWO A;  4PJM A;  2LHR A;  4JI0 T;  2IDO B;  4DBR A;  1O3X A;  4NXN T;  3TLS A;  1KNR A;  4KHZ F;  2WAU A;  5FY7 A;  2PBI A;  3AAA B;  2HPJ A;  2XQ7 A;  3AA7 B;  5EK2 A;  3C4X A;  1YW0 A;  5DQW A;  3AED A;  4TV8 E;  3ZMU B;  2V7M A;  5EK4 A;  3EDU A;  4QXC B;  5AQN B;  4QH5 A;  5HWY A;  3GA8 A;  1FJG T;  3UUL A;  3K3O A;  2Q9Q A;  3UUX B;  3PTR B;  2D2S A;  4TV9 E;  3KFW X;  5KXJ A;  2CWY A;  4JUY A;  4IDZ A;  2WS3 A;  2DHR A;  2EHO C;  3PU8 A;  3PDY A;  4IIJ E;  4DO0 A;  2CBJ A;  1IJ5 A;  3HKC E;  3OKQ A;  4HFB A;  1VCT A;  3H37 A;  1BR1 A;  3CIR A;  2QYW A;  1MIY A;  4EAH A;  3PUG A;  1CUN A;  3RIF A;  2X9W A;  2BG9 C;  3AA6 B;  1YXR A;  2BBJ A;  4JI4 T;  4DND A;  2CHO A;  2DWK A;  2H89 A;  1U4Q A;  4GYS A;  5CB4 E;  2CXF A;  5LP6 E;  4QKN A;  4LMK A;  2J4G A;  2QA7 A;  3UUM A;  3F31 A;  5J2T E;  3FBL A;  4A97 A;  5FY1 A;  4QXH B;  2DNX A;  4UIG A;  4I43 B;  3U78 A;  4LF6 T;  5ABE A;  2XAJ B;  3OPC A;  4V1A v;  3QC9 A;  3K1S A;  3RHW A;  1ZV4 X;  2WMO A;  4HN9 A;  4HWF A;  4BJN A;  4KUM B;  5HAX A;  2CCQ A;  5HCM A;  1S35 A;  3HL6 A;  4KI0 F;  1XMQ T;  5CFB A;  1L0V A;  2PG8 A;  4TUY E;  2LJL A;  2V7K A;  2XJ7 A;  1D0Y A;  5FVK A;  2A2F X;  3UU6 A;  4WZX A;  2MOZ A;  4PK4 A;  4AKG A;  4X1Y E;  1G73 A;  5ADX L;  2V7L A;  2RP4 A;  4DR1 T;  1XDO A;  1OED B;  5JTG A;  4H63 H;  2LSG A;  3SS1 A;  4KMC A;  1HNW T;  2YU2 A;  4ISS A;  5DAB A;  4C90 A;  2K3W A;  4O8S A;  2E5L T;  4EZH A;  3FBZ A;  2V6Y B;  1UUR A;  2X68 A;  3A7M A;  3ONL C;  3T8O A;  1US7 B;  3AA1 B;  4L5G A;  3FHN A;  1MMG A;  3VKH A;  4A98 A;  3P4P A;  5FXV A;  4OYK A;  2N2N A;  4TZ4 C;  2K9A A;  2WDR A;  3MZK B;  4QXB B;  3TLU A;  3EAB A;  5HXE A;  1VOM A;  2BKN A;  4FJO A;  3IBP A;  4JLE A;  3SFE A;  1IAP A;  2PJQ A;  4QH4 A;  1GQE A;  2B76 A;  4LF7 T;  1UX5 A;  4ILU A;  5JDG A;  2VQE T;  3RLF F;  3A5X A;  1I6Z A;  2BS4 A;  2LLY A;  3VRA A;  3DTO A;  2KIN B;  3S4U A;  2BDE A;  1OED A;  2XAQ B;  2J62 A;  4NUU A;  4PAG A;  4DV1 T;  3AE7 A;  3R6N A;  5L2L A;  4DR2 T;  4NIQ A;  5FY0 A;  1IZN B;  4ZZB A;  4JBW F;  3H3M A;  2XQY A;  2V6Y A;  2IC9 A;  3K8P C;  2DLR A;  2ZM0 A;  4MAL A;  4QX7 B;  3PUS A;  3H3A A;  2VKD A;  3AEA A;  1YKE B;  3E08 A;  1ZKE A;  2N1G A;  3L39 A;  1AJ3 A;  1ZHC A;  4XBF B;  3JAD A;  2MPK A;  3RF1 A;  4U2Z A;  2IML A;  3RH3 A;  2LM2 A;  1G8X A;  5LMN T;  1J5E T;  4NXM T;  4B3S T;  3JAF A;  4HFE A;  1BR4 A;  3HKE E;  3OTO T;  5C8Y E;  4HWI B;  2F4V T;  3EAM A;  2XSA A;  4WW0 A;  3MAC A;  3UUN A;  4DV3 T;  2LSY A;  3KIN B;  3PUR A;  4PNI A;  3ZYM A;  2XQ4 A;  4PK5 A;  4AIS A;  2FUP A;  3RI5 A;  4QHO A;  2ODV A;  4K0U A;  2YKS A;  2E9X D;  3D0T A;  5FNV E;  2XQ8 A;  2CLY C;  2EHO B;  2LHN A;  5L3B B;  3AXJ B;  3N9Q A;  3UU8 A;  2VKJ A;  4I0U A;  4XAX B;  4CN6 A;  3CML A;  3PV0 F;  4IDN A;  3CX6 B;  1XWM A;  3PJA J;  2WWV A;  3MKD A;  3UQ7 A;  2W62 A;  5L3G B;  3I1A A;  3ZT5 A;  3CQC B;  4ZI7 E;  4CQI A;  3I0Q A;  2YN6 A;  1UCU A;  3OBV E;  3PU3 A;  2AXD S;  4LML A;  4DID B;  5CGM A;  2XUE A;  5LOV E;  3AEE A;  3G06 A;  4BAY B;  1NAF A;  4PFP A;  3N9O A;  2DCF A;  3P7I A;  5JH7 E;  2NW7 A;  4HFC A;  5C2T A;  4IST A;  4U31 A;  1WRD A;  1UGO A;  2XQA A;  2W66 A;  5M4Y A;  5HXR A;  3U3I A;  3P4R A;  2EHO A;  1YKH B;  3HR0 A;  4JI5 T;  3AXJ A;  1SE7 A;  3WAK A;  2NTX A;  1N36 T;  2YU1 A;  3Q9D A;  1MIW A;  3SWH A;  2HPL A;  3J7Y q;  3O1J A;  4EEB A;  1MND A;  2D9D A;  1FMV A;  2WP9 A;  5JDL A;  3NVO A;  1KNZ A;  4EIW A;  5HEO A;  4OHF A;  4X65 T;  3NZP A;  3P8C D;  3M3Z B;  4H9Q C;  2M6I A;  3IF8 B;  4HWH A;  1KFY A;  2J1D G;  5FL1 A;  2X66 A;  5AQG B;  2NR4 A;  4A56 A;  3P4W A;  3BK9 A;  3CQX C;  2UUC T;  1WCR A;  2V7I A;  4TNW A;  1E1H B;  5IYZ E;  1JNZ A;  1WFD A;  2DWG A;  5JQG E;  3O1I A;  2NTY A;  4HFH A;  2CXD A;  4G2A A;  2Q9Q D;  4EED A;  2AE9 A;  2V26 A;  3ZN0 B;  4DV2 T;  2BS2 A;  3QUJ A;  3NZQ A;  3F57 A;  4X64 T;  5FYM A;  3UUB A;  1CHU A;  4CXW A;  3Q5D A;  2D5U A;  4JI8 T;  2IAK A;  5AQK B;  1LVF A;  3NRY A;  2C5K T;  3RKG A;  3X1D A;  5AQU B;  3AE1 A;  5HWX A;  3C4Z A;  2CEA A;  3FZM B;  4H9O C;  4UV9 B;  3T1Y T;  2LEH A;  4LFB T;  3C51 A;  2JIW A;  5AQQ B;  3QB5 A;  1W9R A;  5LNK A;  2ES0 A;  3TLT A;  5LGT B;  3ONJ A;  3WAJ A;  1XZY A;  3EDV A;  5AQM B;  3WI3 A;  3PUW F;  2CM0 A;  3MK7 C;  3PUX F;  4F6R C;  4OFZ A;  2X9X A;  3O4X E;  1HNX T;  4QH1 A;  3ZC0 A;  3RRW A;  4OX9 T;  3ZJ1 A;  4O4H E;  4U7I A;  1ZOY A;  4DR6 T;  1M62 A;  4YTN A;  5LHG B;  3EVY A;  2BS3 A;  3ZMZ B;  4U2Y A;  2V6X A;  3C50 A;  2VAS A;  4IGU A;  1VRB A;  2VKH A;  4KP3 C;  4O4I E;  4IE4 A;  4JI6 T;  1R8I A;  4EOZ B;  4UF0 B;  3ZKR A;  2JQK A;  3ETV A;  4HFI A;  5C3J A;  3CWZ B;  4IHJ E;  3GN5 B;  3ZT7 A;  4AKR B;  3JC6 D;  2DI4 A;  3N2G E;  3PJA A;  5KDM C;  5LHI B;  1XNQ T;  2V8S V;  2UXC T;  3RKO A;  4YLH A;  5HXC A;  3UU5 A;  3ZLI A;  2LRK A;  2Y48 B;  3ZCJ A;  1W0B A;  5AQO B;  3LG7 A;  3LDQ B;  2UUA T;  4DBQ A;  2CLY B;  4H9S E;  2Y6X A;  1WR6 A;  3K3Q C;  3SFD A;  5TAO A;  2V1D B;  1B7T A;  2JMH A;  5H6R B;  2I6H A;  3N2K E;  2ACZ A;  2E9X C;  1NEN A;  1XMO T;  5AQI B;  3FZK B;  1SUM B;  5LBM A;  3CX7 B;  2BBH A;  4UF0 A;  4ZI3 C;  5L3D B;  5FXZ A;  2UU9 T;  5HEH A;  3GN5 A;  4ZI2 D;  4YTM A;  4H9R C;  2QVA A;  3C64 A;  2WCA A;  2ZM2 A;  3A8Y C;  4I4T E;  5ABH A;  4Z8X A;  3ZC1 A;  2YDS A;  5IHY A;  4E7Z A;  3FXD B;  3HKD E;  5JDF A;  4GOU A;  2BZB A;  2IHR 1;  4GKK T;  5LG4 A;  4PJN A;  3TLW A;  3EI0 A;  4DV0 T;  3OYX A;  1HF8 A;  2HN2 A;  2VQF T;  3N9L A;  5KX5 E;  5EZY E;  4GK5 E;  1V9D A;  1HNZ T;  5AQH B;  2PTF A;  4UEL A;  3PUV F;  2VL8 A;  3QB5 K;  2KXP B;  4GIW A;  4CI2 B;  2JMK A;  4M1P A;  4TWF A;  4O4J E;  4L0R A;  2FJD A;  3L8R A;  3PUA A;  4GKJ T;  4DUZ T;  5HEJ A;  2A9U A;  3DP7 A;  1WYC A;  2V5D A;  3OYZ A;  4DV6 T;  2JPF A;  2B1E A;  4BA9 A;  2XQ3 A;  3N5L A;  2D0U A;  3DJB A;  3EUH A;  3N9P A;  4JEU B;  3CVR A;  4X66 T;  2X0Y A;  5CJ5 A;  4YXD A;  4HFV A;  5AQJ B;  4AQF A;  2H88 A;  2OA5 A;  2Z6E A;  1YD8 G;  5IUX A;  5LYJ E;  3I0O A;  5AQP B;  4P09 A;  4I50 E;  1KF6 A;  3C4W A;  1KNP A;  4AXP A;  2XAF B;  2XSB A;  3AE4 A;  3QK6 A;  4TX5 A;  3B5M A;  3RQU A;  4UR9 A;  4JI3 T;  3AAE B;  2X67 A;  5E0O A;  4Q25 A;  2X0H A;  2ZM8 A;  4YY3 T;  1D0Z A;  4N78 D;  4HTE A;  4LF4 T;  3VU7 H;  5FP3 A;  3Q2M A;  5A1L A;  4CZZ B;  3F2E A;  1IJ6 A;  3LK4 2;  1I94 T;  1MMD A;  1QLB A;  1NEK A;  2LT3 A;  3OVU A;  4H9P C;  4LF8 T;  5HEU A;  4IE7 A;  2JRK A;  3VHL A;  2JJ9 A;  2C5J A;  3MA9 A;  3ETU A;  2XQ6 A;  4JYA T;  4IE6 A;  4U33 A;  4YFS A;  4PJJ A;  2UXX B;  2I59 A;  2W0G A;  2WB5 A;  4LF5 T;  1WLX A;  1HX8 A;  1Z0P A;  1T8B A;  5JR9 C;  3ZT6 A;  4U72 A;  4IE5 A;  2VK9 A;  1D0X A;  4NPP A;  3ZCI A;  2LSJ A;  4JI2 T;  1WYB A;  1EZ3 A;  4H9N C;  3RX6 A;  5AQL B;  2WWU A;  5FL0 A;  2W63 A;  4IDO A;  3JC6 C;  4ZS2 A;  5FXW A;  5L3E B;  4MHC A;  4NUV A;  4WBN E;  4ZEY A;  5J2U E;  5LJN A;  2LOS A;  2KT9 A;  2LOP A;  1MMA A;  4HGA A;  2BG9 E;  3J9X 1;  3R84 B;  3RPU A;  3W15 B;  3AA0 B;  4U74 A;  2QGS A;  1D1B A;  2W61 A;  5DJQ C;  3AE9 A;  1IBM T;  4ZXL A;  2FBW A;  2E9X B;  2WZI A;  2WBL A;  2YIN A;  4TNV A;  2XM1 A;  4A5X A;  3JCF A;  1S94 A;  4EXT A;  3KVA A;  3Q5E A;  2BVM A;  4UEM A;  4PFO A;  4YJ3 E;  5AQF B;  2KZ7 B;  3KBU A;  4AQF C;  3P4S A;  2IC6 A;  3CK6 A;  5FXX A;  3VR9 A;  4QWN B;  5L3F B;  2KSR A;  4Z91 A;  4HKA A;  2XZE A;  5LHH B;  2WM9 A;  3LK3 B;  4ILA A;  4C91 A;  3AB3 B;  3UTK A;  4ZS3 A;  1T7S A;  1LRZ A;  1N34 T;  2OLT A;  5ETW A;  2WU5 A;  2W2U A;  3LSV A;  1LVK A;  1QUU A;  3UU4 A;  4IE0 A;  5LA6 E;  3CQG B;  3UFG A;  3P4Q A;  2H3R A;  2H7V C;  3ESL A;  1U5P A;  2GK9 A;  1MNE A;  3QNU A;  3NBX X;  3RGL A;  4P1N A;  2E9X A;  1W0A A;  4DR3 T;  4HE8 A;  4CN4 A;  1D1C A;  2E8I A;  3HA4 A;  2NW8 A;  5H6Q B;  3ZMV B;  5IWA T;  4K0K T;  4DMV A;  4DV4 T;  5FMN A;  3UT5 E;  3RIU C;  2E2A A;  4JI7 T;  2DL1 A;  2Y8D A;  4DV5 T;  4YT0 A;  2ZM6 T;  4LF9 T;  2XAH B;  2KWI B;  3QOF A;  4HFD A;  4ERR A;  1OWA A;  3B13 A;  2CHN A;  3K3N A;  3PUQ A;  4E7S A;  1UUS A;  2HH7 A;  2LSI A;  3CPZ A;  3VRB A;  5HCJ A;  4P0B A;  3KV4 A;  4EYY R;  3FZL B;  5LGN B;  2LSK A;  4B3M T;  2HN1 A;  2X9H A;  1MIV A;  4AKH A;  5HXS A;  2LM9 A;  1Y64 B;  5AFU L;  2WDV A;  3LFM A;  5ABG A;  2VWA A;  4L9I A;  2HHH T;  5AQR B;  2CPT A;  4YSZ A;  4AKI A;  1IBK T;  3ZJ2 A;  1KK7 A;  3ANW B;  3V5U A;  4JI1 T;  1LKX A;  4YSX A;  4QX8 B;  2I0M A;  4DV7 T;  1Y01 A;  4KBM B;  4G63 A;  4ANJ A;  3HI2 A;  3AEG A;  2YDR A;  4YTP A;  3RC3 A;  2KWH A;  2LRL A;  3VKG A;  4EGW A;  1T98 A;  3ZPO A;  3BQI A;  3MJX A;  3L3P A;  5L4E A;  2CMR A;  2C0S A;  3LK2 B;  5J0Z A;  2X51 A;  2RA1 A;  2K48 A;  5JR9 B;  3AEF A;  5F8P A;  5AQS B;  4ILB A;  1FIO A;  1OXZ A;  1YQ4 A;  1X79 A;  2G0U A;  4GK0 E;  4COF A;  3ANW A;  1W09 A;  5LGU B;  5F3J A;  4B3R T;  2XPK A;  3EHZ A;  3LBX B;  3Q5W A;  3Q5X A;  3SOL A;  5FKY A;  3AEC A;  5JDQ A;  5L3C B;  1BR2 A;  2CXL A;  2A3D A;  3RRC A;  3ZYL A;  4OYJ A;  3ONX A;  3FXE B;  1VCS A;  2WZH A;  3UQ4 A;  5DQV A;  5BMV E;  2VL0 A;  3KVB A;  5LB7 B;  2D0T A;  4DR5 T;  3BQK A;  1JNR A;  2CE7 A;  4MLK A;  2J47 A;  5JVD E;  2XM2 A;  4CN1 A;  2ZLY A;  5JR9 A;  2FJA A;  1J5W A;  5LCY A;  3ZSS A;  2WU2 A;  3ZN1 B;  1X9B A;  3ABV A;  4P0A A;  4TWH A;  2LKG A;  3OJA A;  2FJB A;  1XNR T;  3N9M A;  5LXT E;  3AE2 A;  4ZZC A;  1DU2 A;  3LBX A;  2YDQ A;  2LE8 A;  1J1J A;  2A72 A;  4OK0 A;  2VUR A;  1E7P A;  2KND A;  4JV5 T;  1HX1 B;  4B6X A;  3KBT A;  3IHR A;  3NRX A;  4KX6 A;  4UVC B;  5AQT B;  4F8H A;  3BQL A;  4PW8 A;  4IDP A;  1OED E;  1N33 T;  3MXZ A;  3RYI E;  2SPC A;  4HWD A;  3PUZ F;  4AIU A;  3UFE A;  3C98 B;  2CA5 A;  3RYF E;  2MYS A;  1NWM X;  4YJ2 E;  4Z90 A;  3RYH E;  2L8K A;  3AE3 A;  2CBI A;  3N2O A;  3M65 A;  4AQG A;  1YQ3 A;  2XAS B;  4PJL A;  4X62 T;  3L09 A;  5F5W A;  3AE8 A;  4HWC A;  2OV9 A;  2WDQ A;  3ZMT B;  4ILC A;  2M6B A;  5JDH A;  2Q9Q C;  2XHE B;  4XZC A;  4CXX A;  4PK6 A;  2JQH A;  2ZMA A;  4FI5 A;  2XTL A;  2WQY A;  4YHH T;  3RIA A;  2JQ9 A;  3FB2 A;  5JDN A;  2RPA A;  4IT4 A;  2XQ9 A;  2XY8 B;  2YOE A;  3PE0 A;  5JDM A;  4YSY A;  4X5T A;  4YHJ A;  1KEY A;  4UVB B;  2IW5 B;  1IBL T;  4ZOL E;  2X0L B;  3HKB E;  4O4L E;  3FZH B;  2KMF A;  3JAE A;  1UX4 A;  3AE5 A;  4X20 E;  3IEE A;  2VVS A;  3RIU A;  4TN7 B;  3O9X A;  4EYU A;  2NOX A;  2EHO D;  3VR8 A;  2X9Y A;  5EK3 A;  3AAI A;  3GWH A;  1UK5 A;  3AVS A;  4X1I E;  1D1A A;  3FZF B;  4IRE A;  3SRZ A;  2YK0 A;  2M67 A;  3B57 A;  4EV6 A;  2UXN B;  2NWB A;  3KDS E;  3KV9 A;  2R6G F;  5BR8 T;  4DUY T;  4UVA B;  3N9N A;  2IUB A;  3O1H A;  1ZP0 A;  2VVN A;  4UV8 B;  2K24 A;  2WSS V;  4X1K E;  2BVL A;  4U7Y A;  4IL9 A;  1HG5 A;  3LJC A;  3ZYK A;  4ZHQ E;  2PFV A;  4JEH B;  3V5S A;  2N9D A;  3AEB A;  4U3C A;  4EB6 E;  2V5C A;  4ZI3 D;  5JRE A;  4WBO A;  2BKO A;  4H63 V;  2K5B B;  4CXY A;  4ADZ A;  4DMW A;  2UXB T;  5LMU T;  1SA0 E;  1XDP A;  2BG9 B;  1Z8U A;  3TKL B;  3CKD A;  1FEW A;  3RC8 A;  1H7C A;  5ABF B;  5KMG P;  4BJM A;  5HXH A;  3I9W A;  4AKL A;  2NW9 A;  1E2A A;  2CRB A;  3ZST A;  2UXD T;  2NP9 A;  1HS7 A;  4IL4 A;  2W67 A;  2FJE A;  1QSD A;  4I55 E;  3RQW A;  4ASK A;  5GON E;  2UUB T;  3NKZ A;  3UU3 A;  4ZI2 C;  3IA3 A;  1HG2 A;  2BKP A;  2VB6 A;  4DR4 T;  2P9B A;  5L4H A;  4UXN B;  4MBQ A;  1WR0 A;  2E5V A;  1HCI A;  4EZ4 A;  2ODU A;  3PUY F;  5LJM A;  5FVL A;  5JRC B;  2XAG B;  2W4X A;  5CA0 E;  1MMN A;  3P50 A;  2QRX A;  2BG9 A;  2KLQ A;  4GYR A;  4WNK A;  4IDQ A;  2YEV C;  5J1G A;  2C5I T;  5ABF A;  1OED C;  4TWD A;  2ACX A;  2LKH A;  1N32 T;  4LMJ A;  5HYA A;  2WY2 A;  5CA1 E;  4AQY T;  1ZEE A;  3ZMS B;  4O2B E;  1HR0 T;  2MTQ A;  4LFC T;  2MAW A;  2L9Q A;  2H7O A;  4WYV A;  1SHZ C;  4LFA T;  1BR0 A;  4DVD A;  3ZEF B;  4MFR A;  3E0Z A;  3T1H T;  5AQV B;  4B3T T;  5LBQ B;  5JRC A;  3AVR A;  4HEA A;  2XQ5 A;  3E22 E;  2JQQ A;  2L3L A;  5HEG A;  3RYC E;  2W00 A;  3CX8 B;  5L47 A;  4J2C A;  3NWI A;  4CI1 B;  2MBG A;  2IIU A;  2Q9Q B;  2WMN A; 
#chains in the Genus database with same CATH homology
 3ZYL A;  4OYJ A;  3ONX A;  3FXE B;  3QK6 A;  4TX5 A;  2XUE A;  1FMW A;  3AAE B;  3GMI A;  5LOV E;  4AI6 A;  3KV5 A;  1HFA A;  2X67 A;  5E0O A;  1HTJ F;  5DQV A;  4BAY B;  4O2A E;  1NAF A;  2ZM8 A;  5BMV E;  4PFP A;  2VKO A;  2DCF A;  3KVB A;  3N9O A;  3KV6 A;  3P7I A;  5JH7 E;  3I9Y A;  2NW7 A;  2D0T A;  3BQK A;  1D0Z A;  2V7J A;  4N78 D;  4HTE A;  4IST A;  4CI3 B;  2CE7 A;  4MLK A;  1WRD A;  5JVD E;  3VU7 H;  2CWO A;  5FP3 A;  2ZLY A;  5JR9 A;  3Q2M A;  4PJM A;  5A1L A;  4CZZ B;  5M4Y A;  5HXR A;  5LCY A;  2LHR A;  3U3I A;  2EHO A;  1YKH B;  3ZN1 B;  4DBR A;  3F2E A;  1IJ6 A;  4P0A A;  3LK4 2;  1O3X A;  3HR0 A;  1MMD A;  2LT3 A;  4H9P C;  3WAK A;  3OJA A;  2NTX A;  2YU1 A;  3Q9D A;  2WAU A;  1MIW A;  5FY7 A;  4IE7 A;  3SWH A;  2PBI A;  3AAA B;  2HPJ A;  3AA7 B;  5EK2 A;  3N9M A;  2JRK A;  5LXT E;  3C4X A;  2HPL A;  3VHL A;  1YW0 A;  3LBX A;  5DQW A;  4TV8 E;  2JJ9 A;  2C5J A;  3ZMU B;  3MA9 A;  2LE8 A;  2A72 A;  2V7M A;  3O1J A;  3ETU A;  3J7Y q;  4OK0 A;  1MND A;  5EK4 A;  1FMV A;  2KND A;  3EDU A;  5JDL A;  4QXC B;  1KNZ A;  4EIW A;  5HWY A;  3GA8 A;  4OHF A;  4IE6 A;  3NZP A;  3UUL A;  3P8C D;  4B6X A;  3K3O A;  3KBT A;  2Q9Q A;  3UUX B;  3IHR A;  3NRX A;  4YFS A;  3PTR B;  2D2S A;  4TV9 E;  3KFW X;  4H9Q C;  4PJJ A;  2UXX B;  2I59 A;  2CWY A;  4JUY A;  2W0G A;  3IF8 B;  4UVC B;  4IDZ A;  2J1D G;  1WLX A;  3BQL A;  2X66 A;  1HX8 A;  1Z0P A;  4PW8 A;  2DHR A;  5JR9 C;  3MXZ A;  4A56 A;  3RYI E;  4U72 A;  3BK9 A;  3CQX C;  2EHO C;  3PU8 A;  2SPC A;  4IE5 A;  2VK9 A;  2V7I A;  3PDY A;  4IIJ E;  1E1H B;  4DO0 A;  3UFE A;  5IYZ E;  3C98 B;  2CA5 A;  2DWG A;  5JQG E;  3RYF E;  2MYS A;  1NWM X;  3O1I A;  1IJ5 A;  2NTY A;  3HKC E;  4YJ2 E;  1D0X A;  2CXD A;  3OKQ A;  4G2A A;  3RYH E;  2Q9Q D;  3ZCI A;  2L8K A;  3H37 A;  2V26 A;  3ZN0 B;  1BR1 A;  2LSJ A;  1WYB A;  1MIY A;  1EZ3 A;  4EAH A;  3N2O A;  4H9N C;  3RX6 A;  3PUG A;  3M65 A;  4AQG A;  3QUJ A;  1CUN A;  3NZQ A;  2WWU A;  2X9W A;  3F57 A;  2XAS B;  5FYM A;  2W63 A;  4PJL A;  3AA6 B;  4CXW A;  2D5U A;  3JC6 C;  4DND A;  4ZS2 A;  5FXW A;  3L09 A;  2DWK A;  1U4Q A;  2IAK A;  5L3E B;  4GYS A;  4MHC A;  1LVF A;  3NRY A;  4NUV A;  5CB4 E;  3ZMT B;  2C5K T;  2CXF A;  5LP6 E;  4QKN A;  5JDH A;  2Q9Q C;  2XHE B;  4WBN E;  5J2U E;  4XZC A;  5LJN A;  4CXX A;  2LOS A;  2QA7 A;  2KT9 A;  4PK6 A;  3UUM A;  2LOP A;  3F31 A;  1MMA A;  2ZMA A;  4HGA A;  3J9X 1;  5HWX A;  4FI5 A;  5J2T E;  2XTL A;  3R84 B;  3C4Z A;  3RPU A;  3W15 B;  3AA0 B;  2CEA A;  4U74 A;  3FBL A;  4H9O C;  2QGS A;  3FB2 A;  5FY1 A;  4QXH B;  4UV9 B;  5JDN A;  1D1B A;  2DNX A;  2W61 A;  5DJQ C;  2LEH A;  2E9X B;  4UIG A;  3C51 A;  4I43 B;  3U78 A;  5LNK A;  3PE0 A;  2ES0 A;  2XAJ B;  2WBL A;  2YIN A;  5JDM A;  5LGT B;  4V1A v;  3WAJ A;  1S94 A;  3QC9 A;  3EDV A;  4EXT A;  3KVA A;  1ZV4 X;  4YHJ A;  4UVB B;  2BVM A;  2WMO A;  4UEM A;  4PFO A;  4YJ3 E;  2IW5 B;  4ZOL E;  3WI3 A;  2KZ7 B;  3KBU A;  2CM0 A;  3MK7 C;  4HN9 A;  4AQF C;  4F6R C;  2X0L B;  3HKB E;  2IC6 A;  4O4L E;  4OFZ A;  5FXX A;  2KMF A;  4QWN B;  5L3F B;  4HKA A;  4BJN A;  1UX4 A;  2X9X A;  4KUM B;  3O4X E;  5HAX A;  5LHH B;  4X20 E;  3IEE A;  2CCQ A;  3ZC0 A;  2WM9 A;  3LK3 B;  3RRW A;  4TN7 B;  4C91 A;  1S35 A;  3HL6 A;  3ZJ1 A;  3O9X A;  3AB3 B;  3UTK A;  4O4H E;  4EYU A;  4ZS3 A;  1LRZ A;  2NOX A;  2PG8 A;  4TUY E;  2LJL A;  3EVY A;  2V7K A;  5LHG B;  5ETW A;  2EHO D;  1LVK A;  3ZMZ B;  2X9Y A;  3C50 A;  1QUU A;  2VAS A;  5EK3 A;  3AAI A;  1VRB A;  4IGU A;  4IE0 A;  3GWH A;  3AVS A;  5LA6 E;  2VKH A;  4KP3 C;  4O4I E;  3CQG B;  4IE4 A;  4X1I E;  1D0Y A;  1D1A A;  2H3R A;  2H7V C;  3ESL A;  2A2F X;  1U5P A;  3SRZ A;  2YK0 A;  2M67 A;  4EOZ B;  2GK9 A;  3B57 A;  1MNE A;  2NWB A;  2UXN B;  3KDS E;  4UF0 B;  3KV9 A;  3NBX X;  3ETV A;  2E9X A;  3CWZ B;  4IHJ E;  3GN5 B;  2MOZ A;  4PK4 A;  4AKR B;  4HE8 A;  4AKG A;  3JC6 D;  4UVA B;  4X1Y E;  1G73 A;  2DI4 A;  2V7L A;  3N2G E;  3N9N A;  5ADX L;  2RP4 A;  1D1C A;  3O1H A;  2E8I A;  3HA4 A;  2NW8 A;  5H6Q B;  4H63 H;  3ZMV B;  2LSG A;  3SS1 A;  4KMC A;  5KDM C;  5LHI B;  4UV8 B;  2YU2 A;  4DMV A;  2K24 A;  4ISS A;  5DAB A;  3RKO A;  2WSS V;  4X1K E;  4C90 A;  5FMN A;  3UT5 E;  4YLH A;  5HXC A;  4O8S A;  4EZH A;  3FBZ A;  2BVL A;  2Y8D A;  3ZLI A;  1HG5 A;  2X68 A;  3LJC A;  3ZYK A;  4ZHQ E;  2Y48 B;  3ZCJ A;  2PFV A;  2XAH B;  3T8O A;  2KWI B;  4JEH B;  3V5S A;  1US7 B;  3AA1 B;  3LG7 A;  4L5G A;  2N9D A;  4ERR A;  3FHN A;  1MMG A;  4EB6 E;  2CLY B;  4H9S E;  1OWA A;  3B13 A;  4DBQ A;  3VKH A;  2Y6X A;  1WR6 A;  4OYK A;  3K3Q C;  5FXV A;  2N2N A;  4TZ4 C;  4ZI3 D;  2K9A A;  5TAO A;  3MZK B;  2V1D B;  5JRE A;  4WBO A;  3K3N A;  3PUQ A;  4QXB B;  4H63 V;  4E7S A;  2K5B B;  5HXE A;  1B7T A;  4ADZ A;  4DMW A;  1VOM A;  2JMH A;  4CXY A;  1SA0 E;  5H6R B;  4FJO A;  2HH7 A;  2LSI A;  3IBP A;  3CPZ A;  3N2K E;  4JLE A;  1IAP A;  2PJQ A;  2E9X C;  3TKL B;  3CKD A;  1FEW A;  1UX5 A;  4ILU A;  3RC8 A;  1H7C A;  5KMG P;  5LBM A;  3CX7 B;  5JDG A;  4P0B A;  3KV4 A;  4BJM A;  4UF0 A;  4EYY R;  5HXH A;  4ZI3 C;  5L3D B;  3I9W A;  4AKL A;  5FXZ A;  3A5X A;  5LGN B;  2LSK A;  3GN5 A;  4ZI2 D;  2NW9 A;  2X9H A;  1MIV A;  3DTO A;  2KIN B;  4H9R C;  3S4U A;  3C64 A;  2BDE A;  4AKH A;  2NP9 A;  5HXS A;  2XAQ B;  2LM9 A;  1Y64 B;  2ZM2 A;  5AFU L;  4I4T E;  1HS7 A;  4NUU A;  4PAG A;  3LFM A;  4Z8X A;  3R6N A;  3ZC1 A;  5L2L A;  2VWA A;  1QSD A;  4I55 E;  5IHY A;  4L9I A;  4ASK A;  5FY0 A;  4E7Z A;  1IZN B;  5GON E;  3FXD B;  3HKD E;  5JDF A;  2XQY A;  2IC9 A;  3K8P C;  2DLR A;  2ZM0 A;  4ZI2 C;  4MAL A;  4AKI A;  4GOU A;  1HG2 A;  2BZB A;  2VB6 A;  4QX7 B;  2P9B A;  4UXN B;  3PUS A;  3ZJ2 A;  1KK7 A;  4MBQ A;  3ANW B;  3H3A A;  1HCI A;  4EZ4 A;  2ODU A;  5LJM A;  2VKD A;  5LG4 A;  3V5U A;  4PJN A;  5JRC B;  1YKE B;  3E08 A;  2XAG B;  1LKX A;  1ZKE A;  2N1G A;  4QX8 B;  1AJ3 A;  1ZHC A;  3OYX A;  4XBF B;  1HF8 A;  3N9L A;  5CA0 E;  5KX5 E;  1MMN A;  3RH3 A;  4KBM B;  5EZY E;  4GK5 E;  1G8X A;  4G63 A;  4ANJ A;  3HI2 A;  2KLQ A;  4GYR A;  4WNK A;  1V9D A;  1BR4 A;  3HKE E;  2YEV C;  5J1G A;  2C5I T;  4UEL A;  3RC3 A;  2KWH A;  5C8Y E;  2VL8 A;  3VKG A;  2ACX A;  2KXP B;  4WW0 A;  3MAC A;  5HYA A;  4GIW A;  5CA1 E;  3UUN A;  4CI2 B;  1T98 A;  2JMK A;  3ZPO A;  3BQI A;  4M1P A;  4O4J E;  2LSY A;  4L0R A;  3KIN B;  3MJX A;  3L3P A;  3PUR A;  4PNI A;  3ZYM A;  3PUA A;  2CMR A;  2C0S A;  1ZEE A;  3DP7 A;  3LK2 B;  4PK5 A;  1WYC A;  4QHO A;  3ZMS B;  4O2B E;  3OYZ A;  2ODV A;  2MTQ A;  2JPF A;  2B1E A;  2X51 A;  2RA1 A;  2K48 A;  4K0U A;  5JR9 B;  4BA9 A;  2E9X D;  3D0T A;  5F8P A;  5FNV E;  3N5L A;  1FIO A;  2L9Q A;  2CLY C;  2D0U A;  1OXZ A;  2EHO B;  2H7O A;  3DJB A;  1X79 A;  3EUH A;  1SHZ C;  3N9P A;  3CVR A;  4JEU B;  1BR0 A;  4DVD A;  2LHN A;  3ZEF B;  4MFR A;  3E0Z A;  5L3B B;  3N9Q A;  2G0U A;  2VKJ A;  4XAX B;  4GK0 E;  3CML A;  3ANW A;  5LBQ B;  5LGU B;  5F3J A;  4HFV A;  3CX6 B;  4AQF A;  5JRC A;  3AVR A;  3LBX B;  4HEA A;  3Q5W A;  3MKD A;  3Q5X A;  3SOL A;  2OA5 A;  2Z6E A;  2W62 A;  5L3G B;  3I1A A;  1YD8 G;  3E22 E;  5LYJ E;  3CQC B;  4ZI7 E;  5JDQ A;  2JQQ A;  2L3L A;  3I0O A;  5L3C B;  4CQI A;  3RYC E;  2W00 A;  3CX8 B;  1BR2 A;  3I0Q A;  2CXL A;  4J2C A;  4P09 A;  1UCU A;  3OBV E;  3PU3 A;  4I50 E;  4CI1 B;  2MBG A;  3C4W A;  2A3D A;  2Q9Q B;  2WMN A;  3RRC A;  4AXP A;  2XAF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...