3EDVA

Crystal structure of repeats 14-16 of beta2-spectrin
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
322
structure length
322
Chain Sequence
SHMRHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Localization and Structure of the Ankyrin-binding Site on beta2-Spectrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Spectrin beta chain, brain 1
total genus 156
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA01
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA02
3LBXA 3R6NA 1U5PA 3EDVA 1G8XA 2ODUA 3UUMA 2SPCA 3F31A 5J1GA 2ODVA 3LBXB 3KBUA 3FB2A 2IAKA 1HCIA 1CUNA 1S35A 1QUUA 3EDUA 3PE0A 3KBTA 1OWAA 3UULA 3PDYA 1WLXA 3F57A 3UUNA 1U4QA 1AJ3A
chains in the Genus database with same CATH superfamily
1IAPA 3P4QA 2ZM0A 5HEJA 2ACXA 4DR3T 1HG5A 3Q9DA 2BG9A 5FVLA 1T72A 2E9XC 2FJDA 4P09A 2MBGA 4CZZB 4LMLA 4JI1T 2NW8A 5EK3A 4CI2B 1KNRA 3SRZA 4DR1T 2ODVA 3AB3B 4AIUA 3QK6A 4O4IE 4YHHT 3ZN1B 4Z8XA 2WP9A 3QB5A 3C64A 4OK0A 2IC6A 2KXPB 2RPAA 4AQFC 5L3FB 1SA0E 4HFBA 3NZPA 4OFZA 3CVRA 2BS2A 3VRBA 4JV5T 3CQGB 4ANJA 4YSZA 4K0KT 3VR8A 3KV6A 1Z8UA 2WDQA 3LJCA 4GYSA 4LMJA 1E2AA 4U33A 3KV9A 5LB7B 3SOLA 2Q9QD 2KZ7B 2M6IA 3MJXA 4ADZA 5L4HA 4COFA 2UUCT 4JI8T 3IBPA 1ZHCA 1NWMX 3D0TA 3EVYA 3KINB 3J9X1 1MMGA 3LG7A 3RPUA 5LYJE 1N32T 3OYXA 2LSJA 2CXDA 4U7YA 3PU3A 3UUMA 4CXYA 4HE8A 3RX6A 3ZYMA 2PFVA 2VKDA 3PUQA 1W09A 2CXFA 1UX4A 3N9LA 1KEYA 3CX7B 3TKLB 4LF6T 3AXJA 5LHGB 3J7Yq 5JRCB 4H9PC 1HTJF 2XAQB 4AISA 2KNDA 2ZM8A 4HGAA 3VRAA 1IBKT 3ONLC 4Z91A 2YKSA 3C51A 2ZLYA 5AQKB 4WNKA 5HCMA 3FZLB 2LRLA 4H63H 4QHOA 2E9XD 2BDEA 4HWDA 2Y6XA 5FXXA 3UQ7A 4HTEA 4IREA 4TZ4C 1LVFA 1N34T 1B7TA 2DHRA 4CI1B 4I4TE 4JBWF 2NR4A 3CPZA 2DWGA 1XMQT 3CQCB 2X9YA 3O9XA 2FUPA 5LBQB 4EGWA 2L8KA 2Y48B 2LOSA 4TN7B 3GWHA 5LBMA 1IJ5A 4HFDA 5FL1A 4A98A 4O4LE 2C0SA 3NKZA 4JI5T 3ANWB 3AVSA 2H88A 3VU7H 2LSGA 2K3WA 2CHNA 4IT4A 4JEUB 1HNZT 2VKOA 2J62A 3HR0A 1N33T 4AQGA 3E22E 3IEEA 4B6XA 2NW7A 2WQYA 4UF0A 4X64T 3ZSSA 3RQWA 3ZC1A 1WRDA 4YY3T 5FMNA 4KUMB 4EAHA 4QH4A 5F3JA 3UU8A 3LK42 3ZJ2A 4ERRA 3I0QA 4LF4T 1J5WA 4U2ZA 4MALA 4X66T 3ANWA 5AQSB 2LRKA 4NPPA 5LJMA 4LFBT 4AKRB 5AQFB 3AE8A 1KNZA 4QWNB 5LA6E 4H9QC 5HCJA 4IDQA 3JAEA 4B3RT 2BS3A 4U72A 4B3ST 2YDSA 1WLXA 1UGOA 2YDQA 2W67A 3Q5EA 3C4WA 3RIFA 5HEGA 3ZYLA 5A1LA 3T1YT 3CX8B 2W62A 4IDPA 1SUMB 1HF8A 4IDZA 1O3XA 2NOXA 4TX5A 2BG9E 3OYZA 2C5IT 4WBOA 3JADA 3O4XE 5CA0E 5LMUT 4U3CA 2JIWA 5CB4E 4G2AA 5JDHA 4QXHB 4TV9E 3RKOA 1XNRT 4A56A 2WB5A 5AQQB 2FBWA 1BR1A 4TWFA 5H6RB 2V6YA 2JQHA 5AQRB 5L3DB 3IHRA 5DQVA 4QX7B 1E1HB 4ZI3D 1OWAA 1YKHB 4KHPT 4XZCA 1HX8A 4B3TT 2LSYA 4NXNT 2CBJA 2CBIA 3ZCJA 1J5ET 2ZMAA 4DNDA 3AECA 4IE4A 4HFVA 3F57A 2X9WA 4ILUA 3HL6A 3NVOA 5HXCA 3SFDA 2UUBT 1MMNA 3AEGA 4CN1A 5LNKA 3AEFA 3ZC0A 2XHEB 3GN5B 3K8PC 4PJNA 4HFIA 1UURA 2JQ9A 4IE5A 5HAXA 2LHNA 2DWKA 2J47A 2V6YB 3N9NA 4LMKA 3EABA 1MNDA 2LM9A 3RC8A 2BKOA 2VVSA 3JC6C 3L09A 5C3JA 1HR0T 2XAFB 2E9XB 2LSKA 1J1JA 1GQEA 3AXJB 4IIJE 2X9HA 4JI0T 4EEBA 1E7PA 3DP7A 3N2OA 5JRCA 1QLBA 1OEDB 1XDPA 4GYRA 3AVRA 5FP3A 2WU5A 3RRCA 4ZI2C 1D1CA 5ABFB 2XAGB 1D1AA 2P9BA 4YTMA 3H37A 3UTKA 5IWAT 3LFMA 4C90A 3P50A 2KWHA 2BVMA 3M65A 3S4UA 2HN1A 3MA9A 5HYAA 2AXDS 3VKGA 3HA4A 2WU2A 3ABVA 4HEAA 3E08A 4M1PA 4X1IE 2WZIA 5JTGA 2VQFT 3FZKB 2A72A 2WMOA 4UV9B 3U3IA 2UUAT 3BQKA 4O2BE 2LE8A 5JREA 4NXMT 5FXVA 2WAUA 2HN2A 4YT0A 1OEDE 4DBRA 4H9RC 4DV3T 2WBLA 3RYCE 2UXDT 5AQOB 5FKYA 3DTOA 1V9DA 4DV1T 5C2TA 3UT5E 4UF0B 4U31A 5AQJB 3AAAB 5ABFA 1IBLT 4X65T 1YW0A 1ZV4X 4TNVA 2XQ9A 1G73A 2PTFA 5EZYE 1CHUA 1IJ6A 3AA7B 5HEHA 4C91A 3FZMB 3UU4A 5BR8T 4XBFB 2KINB 2V7KA 5AQUB 5LMNT 1I94T 4DV2T 4LF8T 5H6QB 5ABGA 2H89A 2NP9A 3AEDA 4H63V 3ZYKA 3V5SA 5JQGE 2Q9QC 1MNEA 2KT9A 3GN5A 2V5CA 3OKQA 4N78D 4B3MT 2K24A 2LEHA 2V26A 3CMLA 3GMIA 3MACA 3O1HA 2WMNA 3PURA 3R6NA 4EB6E 5LG4A 1ZKEA 1OEDC 3UU6A 1OEDA 4QXCB 3AEAA 4YJ3E 5EK4A 4AQYT 4YLHA 3AE4A 5AQMB 3PU8A 2K48A 2XUEA 4Q25A 5AQVB 5TAOA 2E8IA 3WI3A 4DV7T 3FZHB 2AE9A 3AAEB 3RIAA 2D0UA 1ZEEA 3AEBA 3QNUA 2VVNA 4PFOA 4BJMA 2X0HA 2CCQA 3PJAA 2LLYA 3ZMSB 3OBVE 3KVAA 2UU9T 2MTQA 3FXDB 1HS7A 4AKGA 5KXJA 5JDQA 3UQ4A 4ILAA 5L2LA 4PJLA 4PK4A 3ZCIA 2BBHA 3PUSA 4OYJA 1HX1B 2FJAA 4UELA 3VKHA 2MAWA 4UIGA 2G0UA 2D5UA 5HEUA 4ASKA 3ETUA 3ZKRA 4J2CA 5FYMA 2V5DA 2I6HA 1N36T 3PUAA 3ZT6A 2CA5A 5BMVE 3AA6B 4Z90A 3EDVA 2JJ9A 2L9QA 4E7ZA 4DUZT 2NWBA 2DL1A 4ILBA 1ZOYA 2N1GA 2XQ5A 4EXTA 2YEVC 5LP6E 5IHYA 2JMHA 2FJEA 2K9AA 5FXZA 1XNQT 2IAKA 3PTRB 4KX6A 3ZPOA 4JYAT 4AQFA 4XAXB 2CLYC 1Z0PA 3CKDA 3RLFF 1KNPA 3O1JA 4TWDA 2D2SA 3M3ZB 3VHLA 3X1DA 4ZZCA 4DR7T 3P4RA 1WYBA 4I43B 1FIOA 2UXBT 4AKIA 2JRKA 3PUGA 2QA7A 2YOEA 2KMFA 3RH3A 4YHJA 1S94A 5LG3A 1WR6A 2BBJA 2DNXA 2WWUA 4MLKA 4NUVA 3UUXB 4HFEA 2LKGA 4AKHA 5KDMC 5FY0A 5JDMA 1YKEB 1MMDA 1AJ3A 5JR9B 2KLQA 1D0ZA 1XWMA 1NAFA 2XAHB 2XQ8A 3EI0A 5LCYA 3P7IA 4ZXLA 2F4VT 2XQ7A 2YK0A 3AA0B 2I59A 3C50A 3HI2A 3PUZF 4O2AE 4YTPA 3EHZA 4UVAB 4DV6T 3HKCE 2WS3A 2BS4A 1YQ3A 2LM2A 2V6XA 2XM1A 3ZSTA 3T8OA 5J1GA 4X62T 2L3LA 3LBXB 4AXPA 3FB2A 3O1IA 2LKHA 3ESLA 3IA3A 3LK2B 4UVBB 2QYWA 3QC9A 2HPJA 3A7MA 5JH7E 1MMAA 1QSDA 2FJBA 2QVAA 4KP3C 2A9UA 3TLVA 2W66A 2VB6A 4IE0A 2LSIA 4UV8B 4LF9T 4LFAT 5CGMA 4WYVA 2CM0A 5AQLB 2XM2A 3K3QC 3CWZB 5LHHB 4ZI7E 2CPTA 2Q9QA 2IDOB 4DV0T 2J1DG 2LHRA 1M62A 5FY1A 1LVKA 3LBXA 2CRBA 2N9DA 3NWIA 4G63A 3QB5K 4MBQA 1UCUA 4UEMA 2CLYB 4PAGA 3ZN0B 1JNZA 2V7IA 2EHOB 2JMKA 3KDSE 3KVBA 1HNWT 3H3AA 4I55E 3ZT5A 5FXWA 5LGTB 2RP4A 3PUYF 3AA1B 2YN6A 3RYHE 4HWFA 4EV6A 3L8RA 5DJQC 2EHOD 3ZMTB 1JNRA 2Z6EA 2K5BB 5HXRA 2PG8A 4ISSA 4QH5A 2BKPA 1CUNA 3AE5A 2EHOC 1WCRA 2J4GA 2CMRA 2DLRA 3JC6D 3MXZA 3OPCA 4GOUA 2XY8B 1YQ4A 4YFSA 3JCFA 5FY7A 2I0MA 4CN4A 4YJ2E 1UX5A 2MYSA 3CX6B 4EOZB 3FXEB 4UVCB 2OA5A 5DABA 3NRYA 4NIQA 2XQ4A 2NW9A 5E0OA 3UU3A 2MPKA 3V5UA 5JDNA 1BR2A 1HNXT 3HKDE 5HEOA 3TLTA 3N9QA 5L3BB 5L3EB 1VCTA 3K3NA 3RGLA 3W15B 5LGNB 2ZM6T 3QOFA 2V1DB 1U4QA 2E9XA 3ONJA 3UU5A 4YXDA 5J2TE 1W0BA 4IL9A 3B57A 3BK9A 3C4XA 3CK6A 1G8XA 3UUBA 4O4HE 2E2AA 4JLEA 4BAYB 2YU2A 3PJAJ 4ZS2A 1IBMT 2JPFA 1VOMA 5KX5E 5L3GB 2M67A 2HH7A 2XQ3A 5F8PA 5FVKA 4U74A 5C8YE 4EIWA 4JI4T 4QKNA 3NBXX 3ZMUB 3OVUA 3KFWX 4A5XA 2D9DA 4H9SE 2IW5B 5CFBA 4AI6A 3RIUA 5GONE 2E5LT 3FZFB 4DR5T 3P4SA 4TUYE 4IHJE 4JI3T 5HWYA 2A3DA 3N9PA 3I9WA 3KBTA 3PE0A 4DO0A 5HXEA 2YINA 3UULA 2H3RA 2RA1A 2X66A 5ABEA 3P4WA 2CWYA 4JUYA 4YSYA 4DR6T 3L3PA 5ETWA 3AAIA 1MIWA 5IYZE 4OX9T 1IZNB 3N9MA 2M6BA 4WW0A 3AE7A 4HFCA 2VL8A 1FMVA 4FJOA 1D1BA 3MK7C 3MKDA 4IE6A 2VKJA 2CHOA 3A8YC 4CQIA 4YTNA 4DV5T 3VR9A 1M7KA 2UXNB 3SS1A 4EZHA 4JEHB 4PNIA 3HKBE 4BJNA 1Y64B 4MFRA 2V7LA 2X67A 4ZOLE 5F5WA 4HWCA 3I9YA 4EZ4A 2DI4A 2X9XA 2XZEA 4EYYR 2ACZA 4O8SA 2XQAA 3Q2MA 3RHWA 2ZM2A 2WWVA 2QRXA 2YDRA 4MHCA 4TV8E 3MZKB 5JVDE 4ZHQE 3DJBA 4I50E 5IUXA 1I6ZA 2W00A 2JQKA 3RIUC 2UXCT 1QUUA 2W61A 2XTLA 2ES0A 2N2NA 2V7MA 5AQTB 2B76A 2OLTA 1SE7A 1YXRA 2C5KT 3N2KE 4IDOA 4WZXA 4DBQA 2CWOA 5LJNA 3Q5XA 3UFGA 3LK3B 1MIVA 3OTOT 2H7VC 5AQHB 4LF7T 4GKKT 2IUBA 2WDRA 3HKEE 2CEAA 4UR9A 3RQUA 2GK9A 3PDYA 3I0OA 3PUWF 2W4XA 3A5XA 4X1KE 3KV4A 4DMVA 2BKNA 3TLWA 3WAKA 3ZJ1A 2OV9A 2YU1A 2XQ6A 1EZ3A 2Y8DA 1U5PA 2R6GF 4BA9A 3K3OA 3SFEA 5ABHA 1FJGT 2KWIB 4HN9A 4PJJA 2HHHT 3FBZA 1Y01A 2MOZA 2BVLA 2JQQA 1UK5A 3EAMA 1DU2A 3RYIE 4HWIB 1LRZA 3IF8B 4PFPA 2IMLA 3ZLIA 2QGSA 2XAJB 4GK5E 3RYFE 5HWXA 2VK9A 4GK0E 3ZMVB 4PK5A 5JDGA 5L3CB 4QH1A 1YD8G 2VASA 4L5GA 2W63A 4H9NC 4IL4A 5LXTE 3B5MA 5JR9C 4X1YE 4JI7T 2CE7A 2W2UA 2IHR1 5CJ5A 3OJAA 4DIDB 2V7JA 3Q5DA 4KI0F 4ILCA 3N2GE 4U7IA 3L39A 1X79A 2Q9QB 3AE2A 4UXNB 5KMGP 4ZZBA 3AEEA 4DUYT 2LOPA 2B1EA 1R8IA 1MIYA 4GKJT 1H7CA 1FMWA 4A97A 2ODUA 3BQIA 2XASB 2UXXB 1NENA 1D0YA 2VURA 2WM9A 4DV4T 5L47A 2A2FX 2H7OA 1NEKA 3QUJA 1T8BA 4HWHA 3KV5A 4CXWA 2XSBA 5EK2A 3AE6A 1XZYA 2DCFA 2WSSV 4IE7A 3AE1A 3PV0F 2PJQA 1OXZA 3ZMZB 4WBNE 3EUHA 4L9IA 5DQWA 4P1NA 4DR2T 3R84B 5ADXL 5JR9A 5M4YA 2BZBA 4IGUA 3CIRA 1T7SA 2NTXA 5HXHA 2NTYA 1HFAA 1VCSA 4K0UA 3PUXF 4HFHA 5AQIB 1L0VA 3FHNA 5L4EA 3T1HT 5LHIB 5JDFA 4H9OC 3RKGA 4DVDA 4ZEYA 3PUVF 3AE9A 2D0TA 1XMOT 4IDNA 2E5VA 2X0YA 2PBIA 1W0AA 5FNVE 3UUNA 4KMCA 3RI5A 1XDOA 4CN6A 3N9OA 4F8HA 2VKHA 3H3MA 4L0RA 3BQLA 4ZS3A 4JI6T 1FEWA 2SPCA 3ONXA 4X5TA 3TLSA 3FBLA 4QX8B 3ETVA 5CA1E 1KK7A 4I0UA 4DMWA 2VWAA 4QXBB 4E7SA 4EYUA 4ZI2D 2IIUA 2WDVA 3WAJA 4OYKA 4LF5T 5HXSA 2XQYA 3C4ZA 4P0AA 2X68A 3NZQA 1S35A 2X0LB 2WY2A 4U2YA 5AQPB 4O4JE 5AQGB 2EHOA 2WCAA 3G06A 1WFDA 4HKAA 4YSXA 4AKLA 4GIWA 3SWHA 4PJMA 1VRBA 4DR4T 3B13A 3CQXC 1UUSA 2XSAA 5AFUL 4PW8A 1WYCA 1W9RA 4JI2T 4EEDA 5LOVE 5J0ZA 2IC9A 1ZP0A 2HPLA 3KBUA 2WZHA 4NUUA 4FI5A 3TLUA 4TWHA 5FL0A 3U78A 1BR0A 2BG9C 1BR4A 5AQNB 5JDLA 2VQET 3F31A 1US7B 4LFCT 2W0GA 1D0XA 4P0BA 4ISTA 3ZT7A 3ZEFB 1KFYA 1WR0A 3I1AA 2CXLA 1HG2A 1HCIA 3F2EA 4OHFA 2XJ7A 4CXXA 2BG9B 2LJLA 3P4PA 3GA8A 1T98A 3AE3A 4V1Av 2KSRA 3RRWA 3UFEA 1X9BA 3EDUA 2LT3A 3Q5WA 3NRXA 2C5JA 3LSVA 3RF1A 1LKXA 4PK6A 1KF6A 4KBMB 4CI3B 5LGUB 4X20E 4F6RC 5J2UE 2V8SV 3LDQB 4ZI3C 1SHZC 2XPKA 3C98B 3K1SA 3E0ZA 2VL0A 3P8CD 4TNWA 3RC3A 3JAFA 4KHZF 2X51A 3N5LA
chains in the Genus database with same CATH topology
1IAPA 2ZM0A 2ACXA 1HG5A 3Q9DA 2E9XC 4P09A 2MBGA 4CZZB 2NW8A 5EK3A 4CI2B 3SRZA 2ODVA 3AB3B 3QK6A 4O4IE 3ZN1B 4Z8XA 3C64A 4OK0A 2IC6A 2KXPB 4AQFC 5L3FB 1SA0E 3NZPA 4OFZA 3CVRA 3CQGB 4ANJA 3KV6A 4GYSA 3LJCA 4CI3B 3SOLA 4ADZA 3KV9A 2Q9QD 2KZ7B 3MJXA 3IBPA 1ZHCA 1NWMX 3EVYA 3D0TA 3KINB 3J9X1 1MMGA 3LG7A 3RPUA 5LYJE 3OYXA 2LSJA 2CXDA 3PU3A 3UUMA 4CXYA 4HE8A 3RX6A 3ZYMA 2PFVA 2VKDA 3PUQA 2CXFA 1UX4A 3N9LA 3CX7B 3TKLB 5JRCB 5LHGB 3J7Yq 4H9PC 1HTJF 2XAQB 2KNDA 2ZM8A 4HGAA 3C51A 2ZLYA 4WNKA 4H63H 4QHOA 2E9XD 2BDEA 5FXXA 2Y6XA 4HTEA 4TZ4C 1LVFA 1B7TA 2DHRA 4CI1B 4I4TE 3CPZA 2DWGA 3CQCB 2X9YA 3O9XA 5LBQB 2L8KA 2Y48B 2LOSA 4TN7B 3GWHA 5LBMA 1IJ5A 4O4LE 2C0SA 3ANWB 3AVSA 3VU7H 2LSGA 4JEUB 2VKOA 3HR0A 4AQGA 3E22E 3IEEA 4B6XA 2NW7A 4UF0A 3ZC1A 1WRDA 5FMNA 4KUMB 4EAHA 5F3JA 3LK42 3ZJ2A 4ERRA 3I0QA 4MALA 3ANWA 5LJMA 4AKRB 1KNZA 4QWNB 5LA6E 4H9QC 4U72A 1WLXA 3C4WA 3ZYLA 5A1LA 3CX8B 2W62A 1HF8A 4IDZA 1O3XA 2NOXA 4TX5A 3OYZA 2C5IT 4WBOA 3O4XE 5CA0E 5CB4E 4G2AA 5JDHA 4QXHB 4TV9E 3RKOA 4A56A 1BR1A 5H6RB 5L3DB 3IHRA 5DQVA 4QX7B 1E1HB 4ZI3D 1OWAA 1YKHB 4XZCA 1HX8A 2LSYA 3ZCJA 2ZMAA 4DNDA 4IE4A 4HFVA 5HXCA 2X9WA 4ILUA 3HL6A 1MMNA 5LNKA 3ZC0A 2XHEB 3GN5B 3K8PC 4PJNA 4IE5A 5HAXA 2LHNA 2DWKA 3N9NA 1MNDA 2LM9A 3RC8A 3JC6C 3L09A 2XAFB 2E9XB 2LSKA 5JRCA 4IIJE 2X9HA 3N2OA 3DP7A 5FP3A 4GYRA 4ZI2C 3AVRA 3RRCA 1D1CA 2XAGB 1D1AA 2P9BA 3UTKA 3H37A 3LFMA 4C90A 2KWHA 2BVMA 3M65A 3S4UA 3MA9A 5HYAA 3HA4A 4HEAA 3E08A 4M1PA 4X1IE 2A72A 2WMOA 4UV9B 3U3IA 3BQKA 4O2BE 2LE8A 5JREA 5FXVA 2WAUA 4DBRA 4H9RC 2WBLA 3RYCE 3DTOA 1V9DA 3UT5E 4UF0B 3AAAB 1YW0A 1ZV4X 1G73A 5EZYE 1IJ6A 3AA7B 4C91A 4XBFB 2KINB 2V7KA 5H6QB 2NP9A 3ZYKA 4H63V 3V5SA 5JQGE 1MNEA 2KT9A 2Q9QC 3GN5A 4N78D 3OKQA 2K24A 2LEHA 2V26A 3CMLA 3GMIA 3MACA 3O1HA 2WMNA 3PURA 3R6NA 4EB6E 5LG4A 1ZKEA 4QXCB 4YJ3E 5EK4A 4YLHA 3PU8A 2K48A 2XUEA 2E8IA 3WI3A 3AAEB 2D0UA 1ZEEA 2X51A 4PFOA 4BJMA 2CCQA 3ZMSB 3OBVE 3KVAA 1HS7A 2MTQA 3FXDB 4AKGA 5L2LA 4PJLA 4PK4A 3ZCIA 4OYJA 3PUSA 4UELA 3VKHA 4UIGA 2G0UA 2D5UA 4ASKA 3ETUA 4J2CA 5FYMA 3PUAA 5BMVE 2CA5A 3AA6B 3EDVA 2JJ9A 2L9QA 4E7ZA 2NWBA 2N1GA 4EXTA 2YEVC 5LP6E 5IHYA 2JMHA 2K9AA 5FXZA 2IAKA 3PTRB 3ZPOA 4AQFA 4XAXB 2CLYC 1Z0PA 3CKDA 3O1JA 2D2SA 3VHLA 1WYBA 4I43B 1FIOA 4AKIA 2JRKA 3PUGA 2QA7A 3RH3A 2KMFA 4YHJA 1S94A 1WR6A 4MLKA 2DNXA 2WWUA 4NUVA 3UUXB 4AKHA 5KDMC 5FY0A 5JDMA 1YKEB 1MMDA 1AJ3A 5JR9B 2KLQA 1D0ZA 2XAHB 1NAFA 5LCYA 3P7IA 3AA0B 2YK0A 3C50A 2I59A 4O2AE 3HI2A 4UVAB 3HKCE 3T8OA 5J1GA 2L3LA 3LBXB 4AXPA 3FB2A 3O1IA 3LK2B 3ESLA 4UVBB 5JDQA 3QC9A 2HPJA 5JH7E 1MMAA 1QSDA 4KP3C 2VB6A 4IE0A 2LSIA 4UV8B 2CM0A 3K3QC 3CWZB 5LHHB 4ZI7E 2Q9QA 2J1DG 2LHRA 1LVKA 3LBXA 4G63A 2N9DA 4MBQA 4UEMA 5TAOA 1UCUA 3ZN0B 2CLYB 4PAGA 2V7IA 2EHOB 2JMKA 3KDSE 3KVBA 3H3AA 4I55E 5FXWA 5LGTB 2RP4A 3RYHE 3AA1B 5DJQC 2EHOD 3ZMTB 2Z6EA 2K5BB 5HXRA 2PG8A 4ISSA 1CUNA 2EHOC 3JC6D 4GOUA 2CMRA 2DLRA 5FY7A 3MXZA 4YFSA 4YJ2E 5M4YA 3VKGA 1UX5A 2MYSA 3CX6B 4EOZB 3FXEB 4UVCB 2OA5A 5DABA 3NRYA 2NW9A 3V5UA 5JDNA 5E0OA 1BR2A 3HKDE 3N9QA 5L3BB 5L3EB 3K3NA 3W15B 5LGNB 2V1DB 1U4QA 2E9XA 5J2TE 3B57A 3BK9A 3C4XA 1G8XA 4O4HE 4JLEA 4BAYB 2YU2A 4ZS2A 2JPFA 1VOMA 5KX5E 5L3GB 2M67A 2HH7A 5C8YE 5F8PA 4U74A 4EIWA 4QKNA 3NBXX 3ZMUB 3KFWX 4H9SE 4AI6A 2IW5B 5GONE 4TUYE 4IHJE 5HWYA 2A3DA 3N9PA 3I9WA 3KBTA 3PE0A 4DO0A 5HXEA 2YINA 3UULA 2H3RA 2RA1A 2X66A 2CWYA 4JUYA 3L3PA 5ETWA 3AAIA 1MIWA 5IYZE 1IZNB 3N9MA 4WW0A 2VL8A 1FMVA 4FJOA 1D1BA 3MK7C 3MKDA 4IE6A 2VKJA 4CQIA 4WBNE 2UXNB 3SS1A 4EZHA 4JEHB 4PNIA 3HKBE 4BJNA 1Y64B 4MFRA 2V7LA 2X67A 4ZOLE 4EZ4A 3I9YA 2DI4A 2X9XA 4EYYR 4O8SA 3Q2MA 2ZM2A 4MHCA 4TV8E 3MZKB 5JVDE 4ZHQE 3DJBA 4I50E 2W00A 1QUUA 2W61A 2XTLA 2ES0A 2N2NA 2V7MA 5FY1A 2C5KT 3N2KE 4DBQA 2CWOA 3Q5XA 3LK3B 1MIVA 2H7VC 3HKEE 2CEAA 2GK9A 3PDYA 3I0OA 4DMVA 3A5XA 4X1KE 3KV4A 3WAKA 3ZJ1A 2YU1A 1EZ3A 2Y8DA 1U5PA 4BA9A 3K3OA 2KWIB 4HN9A 4PJJA 3FBZA 2MOZA 2BVLA 2JQQA 3RYIE 4PFPA 1LRZA 3IF8B 3ZLIA 2QGSA 2XAJB 4GK5E 3RYFE 5HWXA 2VK9A 4GK0E 3ZMVB 4PK5A 5JDGA 5L3CB 1YD8G 2VASA 4L5GA 2W63A 4H9NC 5LXTE 5JR9C 4X1YE 2CE7A 3OJAA 2V7JA 3N2GE 1X79A 2Q9QB 5KMGP 4UXNB 2LOPA 2B1EA 1MIYA 1H7CA 1FMWA 2ODUA 3BQIA 2XASB 2UXXB 1D0YA 2WM9A 2A2FX 2H7OA 3QUJA 3KV5A 4CXWA 5EK2A 2DCFA 2WSSV 4IE7A 2PJQA 1OXZA 3ZMZB 3EUHA 4L9IA 5DQWA 3R84B 5ADXL 5JR9A 2BZBA 4IGUA 2NTXA 5HXHA 2NTYA 1HFAA 4K0UA 3FHNA 5LHIB 5JDFA 4H9OC 4DVDA 2D0TA 5FNVE 2PBIA 3UUNA 4KMCA 3N9OA 2VKHA 4L0RA 4ZS3A 3BQLA 1FEWA 2SPCA 3ONXA 5CA1E 3FBLA 4QX8B 3ETVA 1KK7A 4DMWA 2VWAA 4QXBB 4E7SA 4EYUA 4ZI2D 3WAJA 4OYKA 5HXSA 2XQYA 3C4ZA 4P0AA 2X68A 3NZQA 1S35A 2X0LB 4O4JE 2EHOA 4HKAA 4AKLA 4GIWA 3SWHA 4PJMA 1VRBA 3B13A 3CQXC 5AFUL 4PW8A 1WYCA 5LOVE 2IC9A 3KBUA 2HPLA 4NUUA 3U78A 1BR0A 4FI5A 1BR4A 5JDLA 3F31A 1US7B 2W0GA 1D0XA 4P0BA 4ISTA 3ZEFB 3I1AA 2CXLA 1HG2A 1HCIA 3F2EA 4OHFA 4CXXA 2LJLA 3GA8A 1T98A 4V1Av 3UFEA 3RRWA 3EDUA 2LT3A 3Q5WA 3NRXA 2C5JA 1LKXA 4PK6A 4KBMB 5LGUB 4X20E 4F6RC 5J2UE 4ZI3C 1SHZC 3C98B 3P8CD 3RC3A 3E0ZA 5LJNA 3F57A 3N5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LBX A;  3R6N A;  1U5P A;  3EDV A;  1G8X A;  2ODU A;  3UUM A;  2SPC A;  3F31 A;  5J1G A;  2ODV A;  3LBX B;  3KBU A;  3FB2 A;  2IAK A;  1HCI A;  1CUN A;  1S35 A;  1QUU A;  3EDU A;  3PE0 A;  3KBT A;  1OWA A;  3UUL A;  3PDY A;  1WLX A;  3F57 A;  3UUN A;  1U4Q A;  1AJ3 A; 
#chains in the Genus database with same CATH topology
 1IAP A;  3P4Q A;  2ZM0 A;  5HEJ A;  2ACX A;  4DR3 T;  1HG5 A;  3Q9D A;  2BG9 A;  5FVL A;  1T72 A;  2E9X C;  2FJD A;  4P09 A;  2MBG A;  4CZZ B;  4LML A;  4JI1 T;  2NW8 A;  5EK3 A;  4CI2 B;  1KNR A;  3SRZ A;  4DR1 T;  2ODV A;  3AB3 B;  4AIU A;  3QK6 A;  4O4I E;  4YHH T;  3ZN1 B;  4Z8X A;  2WP9 A;  3QB5 A;  3C64 A;  4OK0 A;  2IC6 A;  2KXP B;  2RPA A;  4AQF C;  5L3F B;  1SA0 E;  4HFB A;  3NZP A;  4OFZ A;  3CVR A;  2BS2 A;  3VRB A;  4JV5 T;  3CQG B;  4ANJ A;  4YSZ A;  4K0K T;  3VR8 A;  3KV6 A;  1Z8U A;  2WDQ A;  3LJC A;  4GYS A;  4LMJ A;  1E2A A;  4U33 A;  3KV9 A;  5LB7 B;  3SOL A;  2Q9Q D;  2KZ7 B;  2M6I A;  3MJX A;  4ADZ A;  5L4H A;  4COF A;  2UUC T;  4JI8 T;  3IBP A;  1ZHC A;  1NWM X;  3D0T A;  3EVY A;  3KIN B;  3J9X 1;  1MMG A;  3LG7 A;  3RPU A;  5LYJ E;  1N32 T;  3OYX A;  2LSJ A;  2CXD A;  4U7Y A;  3PU3 A;  3UUM A;  4CXY A;  4HE8 A;  3RX6 A;  3ZYM A;  2PFV A;  2VKD A;  3PUQ A;  1W09 A;  2CXF A;  1UX4 A;  3N9L A;  1KEY A;  3CX7 B;  3TKL B;  4LF6 T;  3AXJ A;  5LHG B;  3J7Y q;  5JRC B;  4H9P C;  1HTJ F;  2XAQ B;  4AIS A;  2KND A;  2ZM8 A;  4HGA A;  3VRA A;  1IBK T;  3ONL C;  4Z91 A;  2YKS A;  3C51 A;  2ZLY A;  5AQK B;  4WNK A;  5HCM A;  3FZL B;  2LRL A;  4H63 H;  4QHO A;  2E9X D;  2BDE A;  4HWD A;  2Y6X A;  5FXX A;  3UQ7 A;  4HTE A;  4IRE A;  4TZ4 C;  1LVF A;  1N34 T;  1B7T A;  2DHR A;  4CI1 B;  4I4T E;  4JBW F;  2NR4 A;  3CPZ A;  2DWG A;  1XMQ T;  3CQC B;  2X9Y A;  3O9X A;  2FUP A;  5LBQ B;  4EGW A;  2L8K A;  2Y48 B;  2LOS A;  4TN7 B;  3GWH A;  5LBM A;  1IJ5 A;  4HFD A;  5FL1 A;  4A98 A;  4O4L E;  2C0S A;  3NKZ A;  4JI5 T;  3ANW B;  3AVS A;  2H88 A;  3VU7 H;  2LSG A;  2K3W A;  2CHN A;  4IT4 A;  4JEU B;  1HNZ T;  2VKO A;  2J62 A;  3HR0 A;  1N33 T;  4AQG A;  3E22 E;  3IEE A;  4B6X A;  2NW7 A;  2WQY A;  4UF0 A;  4X64 T;  3ZSS A;  3RQW A;  3ZC1 A;  1WRD A;  4YY3 T;  5FMN A;  4KUM B;  4EAH A;  4QH4 A;  5F3J A;  3UU8 A;  3LK4 2;  3ZJ2 A;  4ERR A;  3I0Q A;  4LF4 T;  1J5W A;  4U2Z A;  4MAL A;  4X66 T;  3ANW A;  5AQS B;  2LRK A;  4NPP A;  5LJM A;  4LFB T;  4AKR B;  5AQF B;  3AE8 A;  1KNZ A;  4QWN B;  5LA6 E;  4H9Q C;  5HCJ A;  4IDQ A;  3JAE A;  4B3R T;  2BS3 A;  4U72 A;  4B3S T;  2YDS A;  1WLX A;  1UGO A;  2YDQ A;  2W67 A;  3Q5E A;  3C4W A;  3RIF A;  5HEG A;  3ZYL A;  5A1L A;  3T1Y T;  3CX8 B;  2W62 A;  4IDP A;  1SUM B;  1HF8 A;  4IDZ A;  1O3X A;  2NOX A;  4TX5 A;  2BG9 E;  3OYZ A;  2C5I T;  4WBO A;  3JAD A;  3O4X E;  5CA0 E;  5LMU T;  4U3C A;  2JIW A;  5CB4 E;  4G2A A;  5JDH A;  4QXH B;  4TV9 E;  3RKO A;  1XNR T;  4A56 A;  2WB5 A;  5AQQ B;  2FBW A;  1BR1 A;  4TWF A;  5H6R B;  2V6Y A;  2JQH A;  5AQR B;  5L3D B;  3IHR A;  5DQV A;  4QX7 B;  1E1H B;  4ZI3 D;  1OWA A;  1YKH B;  4KHP T;  4XZC A;  1HX8 A;  4B3T T;  2LSY A;  4NXN T;  2CBJ A;  2CBI A;  3ZCJ A;  1J5E T;  2ZMA A;  4DND A;  3AEC A;  4IE4 A;  4HFV A;  3F57 A;  2X9W A;  4ILU A;  3HL6 A;  3NVO A;  5HXC A;  3SFD A;  2UUB T;  1MMN A;  3AEG A;  4CN1 A;  5LNK A;  3AEF A;  3ZC0 A;  2XHE B;  3GN5 B;  3K8P C;  4PJN A;  4HFI A;  1UUR A;  2JQ9 A;  4IE5 A;  5HAX A;  2LHN A;  2DWK A;  2J47 A;  2V6Y B;  3N9N A;  4LMK A;  3EAB A;  1MND A;  2LM9 A;  3RC8 A;  2BKO A;  2VVS A;  3JC6 C;  3L09 A;  5C3J A;  1HR0 T;  2XAF B;  2E9X B;  2LSK A;  1J1J A;  1GQE A;  3AXJ B;  4IIJ E;  2X9H A;  4JI0 T;  4EEB A;  1E7P A;  3DP7 A;  3N2O A;  5JRC A;  1QLB A;  1OED B;  1XDP A;  4GYR A;  3AVR A;  5FP3 A;  2WU5 A;  3RRC A;  4ZI2 C;  1D1C A;  5ABF B;  2XAG B;  1D1A A;  2P9B A;  4YTM A;  3H37 A;  3UTK A;  5IWA T;  3LFM A;  4C90 A;  3P50 A;  2KWH A;  2BVM A;  3M65 A;  3S4U A;  2HN1 A;  3MA9 A;  5HYA A;  2AXD S;  3VKG A;  3HA4 A;  2WU2 A;  3ABV A;  4HEA A;  3E08 A;  4M1P A;  4X1I E;  2WZI A;  5JTG A;  2VQF T;  3FZK B;  2A72 A;  2WMO A;  4UV9 B;  3U3I A;  2UUA T;  3BQK A;  4O2B E;  2LE8 A;  5JRE A;  4NXM T;  5FXV A;  2WAU A;  2HN2 A;  4YT0 A;  1OED E;  4DBR A;  4H9R C;  4DV3 T;  2WBL A;  3RYC E;  2UXD T;  5AQO B;  5FKY A;  3DTO A;  1V9D A;  4DV1 T;  5C2T A;  3UT5 E;  4UF0 B;  4U31 A;  5AQJ B;  3AAA B;  5ABF A;  1IBL T;  4X65 T;  1YW0 A;  1ZV4 X;  4TNV A;  2XQ9 A;  1G73 A;  2PTF A;  5EZY E;  1CHU A;  1IJ6 A;  3AA7 B;  5HEH A;  4C91 A;  3FZM B;  3UU4 A;  5BR8 T;  4XBF B;  2KIN B;  2V7K A;  5AQU B;  5LMN T;  1I94 T;  4DV2 T;  4LF8 T;  5H6Q B;  5ABG A;  2H89 A;  2NP9 A;  3AED A;  4H63 V;  3ZYK A;  3V5S A;  5JQG E;  2Q9Q C;  1MNE A;  2KT9 A;  3GN5 A;  2V5C A;  3OKQ A;  4N78 D;  4B3M T;  2K24 A;  2LEH A;  2V26 A;  3CML A;  3GMI A;  3MAC A;  3O1H A;  2WMN A;  3PUR A;  3R6N A;  4EB6 E;  5LG4 A;  1ZKE A;  1OED C;  3UU6 A;  1OED A;  4QXC B;  3AEA A;  4YJ3 E;  5EK4 A;  4AQY T;  4YLH A;  3AE4 A;  5AQM B;  3PU8 A;  2K48 A;  2XUE A;  4Q25 A;  5AQV B;  5TAO A;  2E8I A;  3WI3 A;  4DV7 T;  3FZH B;  2AE9 A;  3AAE B;  3RIA A;  2D0U A;  1ZEE A;  3AEB A;  3QNU A;  2VVN A;  4PFO A;  4BJM A;  2X0H A;  2CCQ A;  3PJA A;  2LLY A;  3ZMS B;  3OBV E;  3KVA A;  2UU9 T;  2MTQ A;  3FXD B;  1HS7 A;  4AKG A;  5KXJ A;  5JDQ A;  3UQ4 A;  4ILA A;  5L2L A;  4PJL A;  4PK4 A;  3ZCI A;  2BBH A;  3PUS A;  4OYJ A;  1HX1 B;  2FJA A;  4UEL A;  3VKH A;  2MAW A;  4UIG A;  2G0U A;  2D5U A;  5HEU A;  4ASK A;  3ETU A;  3ZKR A;  4J2C A;  5FYM A;  2V5D A;  2I6H A;  1N36 T;  3PUA A;  3ZT6 A;  2CA5 A;  5BMV E;  3AA6 B;  4Z90 A;  3EDV A;  2JJ9 A;  2L9Q A;  4E7Z A;  4DUZ T;  2NWB A;  2DL1 A;  4ILB A;  1ZOY A;  2N1G A;  2XQ5 A;  4EXT A;  2YEV C;  5LP6 E;  5IHY A;  2JMH A;  2FJE A;  2K9A A;  5FXZ A;  1XNQ T;  2IAK A;  3PTR B;  4KX6 A;  3ZPO A;  4JYA T;  4AQF A;  4XAX B;  2CLY C;  1Z0P A;  3CKD A;  3RLF F;  1KNP A;  3O1J A;  4TWD A;  2D2S A;  3M3Z B;  3VHL A;  3X1D A;  4ZZC A;  4DR7 T;  3P4R A;  1WYB A;  4I43 B;  1FIO A;  2UXB T;  4AKI A;  2JRK A;  3PUG A;  2QA7 A;  2YOE A;  2KMF A;  3RH3 A;  4YHJ A;  1S94 A;  5LG3 A;  1WR6 A;  2BBJ A;  2DNX A;  2WWU A;  4MLK A;  4NUV A;  3UUX B;  4HFE A;  2LKG A;  4AKH A;  5KDM C;  5FY0 A;  5JDM A;  1YKE B;  1MMD A;  1AJ3 A;  5JR9 B;  2KLQ A;  1D0Z A;  1XWM A;  1NAF A;  2XAH B;  2XQ8 A;  3EI0 A;  5LCY A;  3P7I A;  4ZXL A;  2F4V T;  2XQ7 A;  2YK0 A;  3AA0 B;  2I59 A;  3C50 A;  3HI2 A;  3PUZ F;  4O2A E;  4YTP A;  3EHZ A;  4UVA B;  4DV6 T;  3HKC E;  2WS3 A;  2BS4 A;  1YQ3 A;  2LM2 A;  2V6X A;  2XM1 A;  3ZST A;  3T8O A;  5J1G A;  4X62 T;  2L3L A;  3LBX B;  4AXP A;  3FB2 A;  3O1I A;  2LKH A;  3ESL A;  3IA3 A;  3LK2 B;  4UVB B;  2QYW A;  3QC9 A;  2HPJ A;  3A7M A;  5JH7 E;  1MMA A;  1QSD A;  2FJB A;  2QVA A;  4KP3 C;  2A9U A;  3TLV A;  2W66 A;  2VB6 A;  4IE0 A;  2LSI A;  4UV8 B;  4LF9 T;  4LFA T;  5CGM A;  4WYV A;  2CM0 A;  5AQL B;  2XM2 A;  3K3Q C;  3CWZ B;  5LHH B;  4ZI7 E;  2CPT A;  2Q9Q A;  2IDO B;  4DV0 T;  2J1D G;  2LHR A;  1M62 A;  5FY1 A;  1LVK A;  3LBX A;  2CRB A;  2N9D A;  3NWI A;  4G63 A;  3QB5 K;  4MBQ A;  1UCU A;  4UEM A;  2CLY B;  4PAG A;  3ZN0 B;  1JNZ A;  2V7I A;  2EHO B;  2JMK A;  3KDS E;  3KVB A;  1HNW T;  3H3A A;  4I55 E;  3ZT5 A;  5FXW A;  5LGT B;  2RP4 A;  3PUY F;  3AA1 B;  2YN6 A;  3RYH E;  4HWF A;  4EV6 A;  3L8R A;  5DJQ C;  2EHO D;  3ZMT B;  1JNR A;  2Z6E A;  2K5B B;  5HXR A;  2PG8 A;  4ISS A;  4QH5 A;  2BKP A;  1CUN A;  3AE5 A;  2EHO C;  1WCR A;  2J4G A;  2CMR A;  2DLR A;  3JC6 D;  3MXZ A;  3OPC A;  4GOU A;  2XY8 B;  1YQ4 A;  4YFS A;  3JCF A;  5FY7 A;  2I0M A;  4CN4 A;  4YJ2 E;  1UX5 A;  2MYS A;  3CX6 B;  4EOZ B;  3FXE B;  4UVC B;  2OA5 A;  5DAB A;  3NRY A;  4NIQ A;  2XQ4 A;  2NW9 A;  5E0O A;  3UU3 A;  2MPK A;  3V5U A;  5JDN A;  1BR2 A;  1HNX T;  3HKD E;  5HEO A;  3TLT A;  3N9Q A;  5L3B B;  5L3E B;  1VCT A;  3K3N A;  3RGL A;  3W15 B;  5LGN B;  2ZM6 T;  3QOF A;  2V1D B;  1U4Q A;  2E9X A;  3ONJ A;  3UU5 A;  4YXD A;  5J2T E;  1W0B A;  4IL9 A;  3B57 A;  3BK9 A;  3C4X A;  3CK6 A;  1G8X A;  3UUB A;  4O4H E;  2E2A A;  4JLE A;  4BAY B;  2YU2 A;  3PJA J;  4ZS2 A;  1IBM T;  2JPF A;  1VOM A;  5KX5 E;  5L3G B;  2M67 A;  2HH7 A;  2XQ3 A;  5F8P A;  5FVK A;  4U74 A;  5C8Y E;  4EIW A;  4JI4 T;  4QKN A;  3NBX X;  3ZMU B;  3OVU A;  3KFW X;  4A5X A;  2D9D A;  4H9S E;  2IW5 B;  5CFB A;  4AI6 A;  3RIU A;  5GON E;  2E5L T;  3FZF B;  4DR5 T;  3P4S A;  4TUY E;  4IHJ E;  4JI3 T;  5HWY A;  2A3D A;  3N9P A;  3I9W A;  3KBT A;  3PE0 A;  4DO0 A;  5HXE A;  2YIN A;  3UUL A;  2H3R A;  2RA1 A;  2X66 A;  5ABE A;  3P4W A;  2CWY A;  4JUY A;  4YSY A;  4DR6 T;  3L3P A;  5ETW A;  3AAI A;  1MIW A;  5IYZ E;  4OX9 T;  1IZN B;  3N9M A;  2M6B A;  4WW0 A;  3AE7 A;  4HFC A;  2VL8 A;  1FMV A;  4FJO A;  1D1B A;  3MK7 C;  3MKD A;  4IE6 A;  2VKJ A;  2CHO A;  3A8Y C;  4CQI A;  4YTN A;  4DV5 T;  3VR9 A;  1M7K A;  2UXN B;  3SS1 A;  4EZH A;  4JEH B;  4PNI A;  3HKB E;  4BJN A;  1Y64 B;  4MFR A;  2V7L A;  2X67 A;  4ZOL E;  5F5W A;  4HWC A;  3I9Y A;  4EZ4 A;  2DI4 A;  2X9X A;  2XZE A;  4EYY R;  2ACZ A;  4O8S A;  2XQA A;  3Q2M A;  3RHW A;  2ZM2 A;  2WWV A;  2QRX A;  2YDR A;  4MHC A;  4TV8 E;  3MZK B;  5JVD E;  4ZHQ E;  3DJB A;  4I50 E;  5IUX A;  1I6Z A;  2W00 A;  2JQK A;  3RIU C;  2UXC T;  1QUU A;  2W61 A;  2XTL A;  2ES0 A;  2N2N A;  2V7M A;  5AQT B;  2B76 A;  2OLT A;  1SE7 A;  1YXR A;  2C5K T;  3N2K E;  4IDO A;  4WZX A;  4DBQ A;  2CWO A;  5LJN A;  3Q5X A;  3UFG A;  3LK3 B;  1MIV A;  3OTO T;  2H7V C;  5AQH B;  4LF7 T;  4GKK T;  2IUB A;  2WDR A;  3HKE E;  2CEA A;  4UR9 A;  3RQU A;  2GK9 A;  3PDY A;  3I0O A;  3PUW F;  2W4X A;  3A5X A;  4X1K E;  3KV4 A;  4DMV A;  2BKN A;  3TLW A;  3WAK A;  3ZJ1 A;  2OV9 A;  2YU1 A;  2XQ6 A;  1EZ3 A;  2Y8D A;  1U5P A;  2R6G F;  4BA9 A;  3K3O A;  3SFE A;  5ABH A;  1FJG T;  2KWI B;  4HN9 A;  4PJJ A;  2HHH T;  3FBZ A;  1Y01 A;  2MOZ A;  2BVL A;  2JQQ A;  1UK5 A;  3EAM A;  1DU2 A;  3RYI E;  4HWI B;  1LRZ A;  3IF8 B;  4PFP A;  2IML A;  3ZLI A;  2QGS A;  2XAJ B;  4GK5 E;  3RYF E;  5HWX A;  2VK9 A;  4GK0 E;  3ZMV B;  4PK5 A;  5JDG A;  5L3C B;  4QH1 A;  1YD8 G;  2VAS A;  4L5G A;  2W63 A;  4H9N C;  4IL4 A;  5LXT E;  3B5M A;  5JR9 C;  4X1Y E;  4JI7 T;  2CE7 A;  2W2U A;  2IHR 1;  5CJ5 A;  3OJA A;  4DID B;  2V7J A;  3Q5D A;  4KI0 F;  4ILC A;  3N2G E;  4U7I A;  3L39 A;  1X79 A;  2Q9Q B;  3AE2 A;  4UXN B;  5KMG P;  4ZZB A;  3AEE A;  4DUY T;  2LOP A;  2B1E A;  1R8I A;  1MIY A;  4GKJ T;  1H7C A;  1FMW A;  4A97 A;  2ODU A;  3BQI A;  2XAS B;  2UXX B;  1NEN A;  1D0Y A;  2VUR A;  2WM9 A;  4DV4 T;  5L47 A;  2A2F X;  2H7O A;  1NEK A;  3QUJ A;  1T8B A;  4HWH A;  3KV5 A;  4CXW A;  2XSB A;  5EK2 A;  3AE6 A;  1XZY A;  2DCF A;  2WSS V;  4IE7 A;  3AE1 A;  3PV0 F;  2PJQ A;  1OXZ A;  3ZMZ B;  4WBN E;  3EUH A;  4L9I A;  5DQW A;  4P1N A;  4DR2 T;  3R84 B;  5ADX L;  5JR9 A;  5M4Y A;  2BZB A;  4IGU A;  3CIR A;  1T7S A;  2NTX A;  5HXH A;  2NTY A;  1HFA A;  1VCS A;  4K0U A;  3PUX F;  4HFH A;  5AQI B;  1L0V A;  3FHN A;  5L4E A;  3T1H T;  5LHI B;  5JDF A;  4H9O C;  3RKG A;  4DVD A;  4ZEY A;  3PUV F;  3AE9 A;  2D0T A;  1XMO T;  4IDN A;  2E5V A;  2X0Y A;  2PBI A;  1W0A A;  5FNV E;  3UUN A;  4KMC A;  3RI5 A;  1XDO A;  4CN6 A;  3N9O A;  4F8H A;  2VKH A;  3H3M A;  4L0R A;  3BQL A;  4ZS3 A;  4JI6 T;  1FEW A;  2SPC A;  3ONX A;  4X5T A;  3TLS A;  3FBL A;  4QX8 B;  3ETV A;  5CA1 E;  1KK7 A;  4I0U A;  4DMW A;  2VWA A;  4QXB B;  4E7S A;  4EYU A;  4ZI2 D;  2IIU A;  2WDV A;  3WAJ A;  4OYK A;  4LF5 T;  5HXS A;  2XQY A;  3C4Z A;  4P0A A;  2X68 A;  3NZQ A;  1S35 A;  2X0L B;  2WY2 A;  4U2Y A;  5AQP B;  4O4J E;  5AQG B;  2EHO A;  2WCA A;  3G06 A;  1WFD A;  4HKA A;  4YSX A;  4AKL A;  4GIW A;  3SWH A;  4PJM A;  1VRB A;  4DR4 T;  3B13 A;  3CQX C;  1UUS A;  2XSA A;  5AFU L;  4PW8 A;  1WYC A;  1W9R A;  4JI2 T;  4EED A;  5LOV E;  5J0Z A;  2IC9 A;  1ZP0 A;  2HPL A;  3KBU A;  2WZH A;  4NUU A;  4FI5 A;  3TLU A;  4TWH A;  5FL0 A;  3U78 A;  1BR0 A;  2BG9 C;  1BR4 A;  5AQN B;  5JDL A;  2VQE T;  3F31 A;  1US7 B;  4LFC T;  2W0G A;  1D0X A;  4P0B A;  4IST A;  3ZT7 A;  3ZEF B;  1KFY A;  1WR0 A;  3I1A A;  2CXL A;  1HG2 A;  1HCI A;  3F2E A;  4OHF A;  2XJ7 A;  4CXX A;  2BG9 B;  2LJL A;  3P4P A;  3GA8 A;  1T98 A;  3AE3 A;  4V1A v;  2KSR A;  3RRW A;  3UFE A;  1X9B A;  3EDU A;  2LT3 A;  3Q5W A;  3NRX A;  2C5J A;  3LSV A;  3RF1 A;  1LKX A;  4PK6 A;  1KF6 A;  4KBM B;  4CI3 B;  5LGU B;  4X20 E;  4F6R C;  5J2U E;  2V8S V;  3LDQ B;  4ZI3 C;  1SHZ C;  2XPK A;  3C98 B;  3K1S A;  3E0Z A;  2VL0 A;  3P8C D;  4TNW A;  3RC3 A;  3JAF A;  4KHZ F;  2X51 A;  3N5L A; 
#chains in the Genus database with same CATH homology
 1IAP A;  2ZM0 A;  2ACX A;  1HG5 A;  3Q9D A;  2E9X C;  4P09 A;  2MBG A;  4CZZ B;  2NW8 A;  5EK3 A;  4CI2 B;  3SRZ A;  2ODV A;  3AB3 B;  3QK6 A;  4O4I E;  3ZN1 B;  4Z8X A;  3C64 A;  4OK0 A;  2IC6 A;  2KXP B;  4AQF C;  5L3F B;  1SA0 E;  3NZP A;  4OFZ A;  3CVR A;  3CQG B;  4ANJ A;  3KV6 A;  4GYS A;  3LJC A;  4CI3 B;  3SOL A;  4ADZ A;  3KV9 A;  2Q9Q D;  2KZ7 B;  3MJX A;  3IBP A;  1ZHC A;  1NWM X;  3EVY A;  3D0T A;  3KIN B;  3J9X 1;  1MMG A;  3LG7 A;  3RPU A;  5LYJ E;  3OYX A;  2LSJ A;  2CXD A;  3PU3 A;  3UUM A;  4CXY A;  4HE8 A;  3RX6 A;  3ZYM A;  2PFV A;  2VKD A;  3PUQ A;  2CXF A;  1UX4 A;  3N9L A;  3CX7 B;  3TKL B;  5JRC B;  5LHG B;  3J7Y q;  4H9P C;  1HTJ F;  2XAQ B;  2KND A;  2ZM8 A;  4HGA A;  3C51 A;  2ZLY A;  4WNK A;  4H63 H;  4QHO A;  2E9X D;  2BDE A;  5FXX A;  2Y6X A;  4HTE A;  4TZ4 C;  1LVF A;  1B7T A;  2DHR A;  4CI1 B;  4I4T E;  3CPZ A;  2DWG A;  3CQC B;  2X9Y A;  3O9X A;  5LBQ B;  2L8K A;  2Y48 B;  2LOS A;  4TN7 B;  3GWH A;  5LBM A;  1IJ5 A;  4O4L E;  2C0S A;  3ANW B;  3AVS A;  3VU7 H;  2LSG A;  4JEU B;  2VKO A;  3HR0 A;  4AQG A;  3E22 E;  3IEE A;  4B6X A;  2NW7 A;  4UF0 A;  3ZC1 A;  1WRD A;  5FMN A;  4KUM B;  4EAH A;  5F3J A;  3LK4 2;  3ZJ2 A;  4ERR A;  3I0Q A;  4MAL A;  3ANW A;  5LJM A;  4AKR B;  1KNZ A;  4QWN B;  5LA6 E;  4H9Q C;  4U72 A;  1WLX A;  3C4W A;  3ZYL A;  5A1L A;  3CX8 B;  2W62 A;  1HF8 A;  4IDZ A;  1O3X A;  2NOX A;  4TX5 A;  3OYZ A;  2C5I T;  4WBO A;  3O4X E;  5CA0 E;  5CB4 E;  4G2A A;  5JDH A;  4QXH B;  4TV9 E;  3RKO A;  4A56 A;  1BR1 A;  5H6R B;  5L3D B;  3IHR A;  5DQV A;  4QX7 B;  1E1H B;  4ZI3 D;  1OWA A;  1YKH B;  4XZC A;  1HX8 A;  2LSY A;  3ZCJ A;  2ZMA A;  4DND A;  4IE4 A;  4HFV A;  5HXC A;  2X9W A;  4ILU A;  3HL6 A;  1MMN A;  5LNK A;  3ZC0 A;  2XHE B;  3GN5 B;  3K8P C;  4PJN A;  4IE5 A;  5HAX A;  2LHN A;  2DWK A;  3N9N A;  1MND A;  2LM9 A;  3RC8 A;  3JC6 C;  3L09 A;  2XAF B;  2E9X B;  2LSK A;  5JRC A;  4IIJ E;  2X9H A;  3N2O A;  3DP7 A;  5FP3 A;  4GYR A;  4ZI2 C;  3AVR A;  3RRC A;  1D1C A;  2XAG B;  1D1A A;  2P9B A;  3UTK A;  3H37 A;  3LFM A;  4C90 A;  2KWH A;  2BVM A;  3M65 A;  3S4U A;  3MA9 A;  5HYA A;  3HA4 A;  4HEA A;  3E08 A;  4M1P A;  4X1I E;  2A72 A;  2WMO A;  4UV9 B;  3U3I A;  3BQK A;  4O2B E;  2LE8 A;  5JRE A;  5FXV A;  2WAU A;  4DBR A;  4H9R C;  2WBL A;  3RYC E;  3DTO A;  1V9D A;  3UT5 E;  4UF0 B;  3AAA B;  1YW0 A;  1ZV4 X;  1G73 A;  5EZY E;  1IJ6 A;  3AA7 B;  4C91 A;  4XBF B;  2KIN B;  2V7K A;  5H6Q B;  2NP9 A;  3ZYK A;  4H63 V;  3V5S A;  5JQG E;  1MNE A;  2KT9 A;  2Q9Q C;  3GN5 A;  4N78 D;  3OKQ A;  2K24 A;  2LEH A;  2V26 A;  3CML A;  3GMI A;  3MAC A;  3O1H A;  2WMN A;  3PUR A;  3R6N A;  4EB6 E;  5LG4 A;  1ZKE A;  4QXC B;  4YJ3 E;  5EK4 A;  4YLH A;  3PU8 A;  2K48 A;  2XUE A;  2E8I A;  3WI3 A;  3AAE B;  2D0U A;  1ZEE A;  2X51 A;  4PFO A;  4BJM A;  2CCQ A;  3ZMS B;  3OBV E;  3KVA A;  1HS7 A;  2MTQ A;  3FXD B;  4AKG A;  5L2L A;  4PJL A;  4PK4 A;  3ZCI A;  4OYJ A;  3PUS A;  4UEL A;  3VKH A;  4UIG A;  2G0U A;  2D5U A;  4ASK A;  3ETU A;  4J2C A;  5FYM A;  3PUA A;  5BMV E;  2CA5 A;  3AA6 B;  3EDV A;  2JJ9 A;  2L9Q A;  4E7Z A;  2NWB A;  2N1G A;  4EXT A;  2YEV C;  5LP6 E;  5IHY A;  2JMH A;  2K9A A;  5FXZ A;  2IAK A;  3PTR B;  3ZPO A;  4AQF A;  4XAX B;  2CLY C;  1Z0P A;  3CKD A;  3O1J A;  2D2S A;  3VHL A;  1WYB A;  4I43 B;  1FIO A;  4AKI A;  2JRK A;  3PUG A;  2QA7 A;  3RH3 A;  2KMF A;  4YHJ A;  1S94 A;  1WR6 A;  4MLK A;  2DNX A;  2WWU A;  4NUV A;  3UUX B;  4AKH A;  5KDM C;  5FY0 A;  5JDM A;  1YKE B;  1MMD A;  1AJ3 A;  5JR9 B;  2KLQ A;  1D0Z A;  2XAH B;  1NAF A;  5LCY A;  3P7I A;  3AA0 B;  2YK0 A;  3C50 A;  2I59 A;  4O2A E;  3HI2 A;  4UVA B;  3HKC E;  3T8O A;  5J1G A;  2L3L A;  3LBX B;  4AXP A;  3FB2 A;  3O1I A;  3LK2 B;  3ESL A;  4UVB B;  5JDQ A;  3QC9 A;  2HPJ A;  5JH7 E;  1MMA A;  1QSD A;  4KP3 C;  2VB6 A;  4IE0 A;  2LSI A;  4UV8 B;  2CM0 A;  3K3Q C;  3CWZ B;  5LHH B;  4ZI7 E;  2Q9Q A;  2J1D G;  2LHR A;  1LVK A;  3LBX A;  4G63 A;  2N9D A;  4MBQ A;  4UEM A;  5TAO A;  1UCU A;  3ZN0 B;  2CLY B;  4PAG A;  2V7I A;  2EHO B;  2JMK A;  3KDS E;  3KVB A;  3H3A A;  4I55 E;  5FXW A;  5LGT B;  2RP4 A;  3RYH E;  3AA1 B;  5DJQ C;  2EHO D;  3ZMT B;  2Z6E A;  2K5B B;  5HXR A;  2PG8 A;  4ISS A;  1CUN A;  2EHO C;  3JC6 D;  4GOU A;  2CMR A;  2DLR A;  5FY7 A;  3MXZ A;  4YFS A;  4YJ2 E;  5M4Y A;  3VKG A;  1UX5 A;  2MYS A;  3CX6 B;  4EOZ B;  3FXE B;  4UVC B;  2OA5 A;  5DAB A;  3NRY A;  2NW9 A;  3V5U A;  5JDN A;  5E0O A;  1BR2 A;  3HKD E;  3N9Q A;  5L3B B;  5L3E B;  3K3N A;  3W15 B;  5LGN B;  2V1D B;  1U4Q A;  2E9X A;  5J2T E;  3B57 A;  3BK9 A;  3C4X A;  1G8X A;  4O4H E;  4JLE A;  4BAY B;  2YU2 A;  4ZS2 A;  2JPF A;  1VOM A;  5KX5 E;  5L3G B;  2M67 A;  2HH7 A;  5C8Y E;  5F8P A;  4U74 A;  4EIW A;  4QKN A;  3NBX X;  3ZMU B;  3KFW X;  4H9S E;  4AI6 A;  2IW5 B;  5GON E;  4TUY E;  4IHJ E;  5HWY A;  2A3D A;  3N9P A;  3I9W A;  3KBT A;  3PE0 A;  4DO0 A;  5HXE A;  2YIN A;  3UUL A;  2H3R A;  2RA1 A;  2X66 A;  2CWY A;  4JUY A;  3L3P A;  5ETW A;  3AAI A;  1MIW A;  5IYZ E;  1IZN B;  3N9M A;  4WW0 A;  2VL8 A;  1FMV A;  4FJO A;  1D1B A;  3MK7 C;  3MKD A;  4IE6 A;  2VKJ A;  4CQI A;  4WBN E;  2UXN B;  3SS1 A;  4EZH A;  4JEH B;  4PNI A;  3HKB E;  4BJN A;  1Y64 B;  4MFR A;  2V7L A;  2X67 A;  4ZOL E;  4EZ4 A;  3I9Y A;  2DI4 A;  2X9X A;  4EYY R;  4O8S A;  3Q2M A;  2ZM2 A;  4MHC A;  4TV8 E;  3MZK B;  5JVD E;  4ZHQ E;  3DJB A;  4I50 E;  2W00 A;  1QUU A;  2W61 A;  2XTL A;  2ES0 A;  2N2N A;  2V7M A;  5FY1 A;  2C5K T;  3N2K E;  4DBQ A;  2CWO A;  3Q5X A;  3LK3 B;  1MIV A;  2H7V C;  3HKE E;  2CEA A;  2GK9 A;  3PDY A;  3I0O A;  4DMV A;  3A5X A;  4X1K E;  3KV4 A;  3WAK A;  3ZJ1 A;  2YU1 A;  1EZ3 A;  2Y8D A;  1U5P A;  4BA9 A;  3K3O A;  2KWI B;  4HN9 A;  4PJJ A;  3FBZ A;  2MOZ A;  2BVL A;  2JQQ A;  3RYI E;  4PFP A;  1LRZ A;  3IF8 B;  3ZLI A;  2QGS A;  2XAJ B;  4GK5 E;  3RYF E;  5HWX A;  2VK9 A;  4GK0 E;  3ZMV B;  4PK5 A;  5JDG A;  5L3C B;  1YD8 G;  2VAS A;  4L5G A;  2W63 A;  4H9N C;  5LXT E;  5JR9 C;  4X1Y E;  2CE7 A;  3OJA A;  2V7J A;  3N2G E;  1X79 A;  2Q9Q B;  5KMG P;  4UXN B;  2LOP A;  2B1E A;  1MIY A;  1H7C A;  1FMW A;  2ODU A;  3BQI A;  2XAS B;  2UXX B;  1D0Y A;  2WM9 A;  2A2F X;  2H7O A;  3QUJ A;  3KV5 A;  4CXW A;  5EK2 A;  2DCF A;  2WSS V;  4IE7 A;  2PJQ A;  1OXZ A;  3ZMZ B;  3EUH A;  4L9I A;  5DQW A;  3R84 B;  5ADX L;  5JR9 A;  2BZB A;  4IGU A;  2NTX A;  5HXH A;  2NTY A;  1HFA A;  4K0U A;  3FHN A;  5LHI B;  5JDF A;  4H9O C;  4DVD A;  2D0T A;  5FNV E;  2PBI A;  3UUN A;  4KMC A;  3N9O A;  2VKH A;  4L0R A;  4ZS3 A;  3BQL A;  1FEW A;  2SPC A;  3ONX A;  5CA1 E;  3FBL A;  4QX8 B;  3ETV A;  1KK7 A;  4DMW A;  2VWA A;  4QXB B;  4E7S A;  4EYU A;  4ZI2 D;  3WAJ A;  4OYK A;  5HXS A;  2XQY A;  3C4Z A;  4P0A A;  2X68 A;  3NZQ A;  1S35 A;  2X0L B;  4O4J E;  2EHO A;  4HKA A;  4AKL A;  4GIW A;  3SWH A;  4PJM A;  1VRB A;  3B13 A;  3CQX C;  5AFU L;  4PW8 A;  1WYC A;  5LOV E;  2IC9 A;  3KBU A;  2HPL A;  4NUU A;  3U78 A;  1BR0 A;  4FI5 A;  1BR4 A;  5JDL A;  3F31 A;  1US7 B;  2W0G A;  1D0X A;  4P0B A;  4IST A;  3ZEF B;  3I1A A;  2CXL A;  1HG2 A;  1HCI A;  3F2E A;  4OHF A;  4CXX A;  2LJL A;  3GA8 A;  1T98 A;  4V1A v;  3UFE A;  3RRW A;  3EDU A;  2LT3 A;  3Q5W A;  3NRX A;  2C5J A;  1LKX A;  4PK6 A;  4KBM B;  5LGU B;  4X20 E;  4F6R C;  5J2U E;  4ZI3 C;  1SHZ C;  3C98 B;  3P8C D;  3RC3 A;  3E0Z A;  5LJN A;  3F57 A;  3N5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...