3EDVA

Crystal structure of repeats 14-16 of beta2-spectrin
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
322
structure length
322
Chain Sequence
SHMRHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spectrin beta chain, brain 1
publication title Localization and Structure of the Ankyrin-binding Site on beta2-Spectrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 156
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA01
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA02
1U5PA 5J1GA 1S35A 3F57A 3LBXA 2SPCA 1QUUA 2ODUA 3EDUA 1OWAA 2ODVA 3F31A 2IAKA 3UUNA 3R6NA 3UUMA 3LBXB 1G8XA 3PDYA 3FB2A 3UULA 1HCIA 1CUNA 3PE0A 3KBTA 3KBUA 3EDVA 1AJ3A 1WLXA 1U4QA
chains in the Genus database with same CATH superfamily
3ANWA 4F6RC 2XASB 2C5JA 4EAHA 2UXDT 5JDMA 3L09A 1D1BA 4ILAA 1J5ET 3C4ZA 3ZYMA 1YD8G 2XQ4A 4JI0T 1YW0A 4P0BA 3PDYA 2M6BA 3CMLA 2X0HA 1YXRA 2UU9T 5JRCB 2QVAA 4DR2T 4FI5A 4ZI3D 3ZMTB 5EK2A 2I59A 3AA0B 1HG5A 5LMNT 4DV5T 4B3TT 3N9QA 1UGOA 2VQFT 4AI6A 1N36T 2LRLA 2Q9QA 3PUQA 4H63V 3RIFA 5HCMA 3UT5E 4P0AA 2WB5A 1X9BA 4EEDA 3NKZA 2ZM6T 1IAPA 5L3GB 4DBQA 3CX6B 3GN5A 2IC9A 2IC6A 2OLTA 4LF8T 4G63A 3PJAA 5FY7A 4COFA 1S35A 5L3DB 4UVBB 4KMCA 5JTGA 2CMRA 2VL8A 4L0RA 1D0XA 2VKJA 4U2ZA 2W63A 4O4HE 2BKNA 3P7IA 1V9DA 5LNKA 4TWFA 5J2TE 2DLRA 4HFIA 5AQJB 4UEMA 5HXHA 3KV4A 4IE4A 2N2NA 1WYBA 2X68A 2J1DG 4PNIA 4X20E 4YTNA 2XQ6A 2MPKA 2VKHA 1WCRA 2ODVA 4AQGA 4HWDA 3AE9A 3AE5A 5LG4A 2L9QA 3UUMA 4NUUA 4CI3B 2W0GA 4PFOA 4DV1T 2ZMAA 4U33A 2KNDA 2B76A 2CBIA 4JI2T 5HXCA 2XAGB 4AKLA 3P4QA 2LSIA 4JBWF 5FXWA 4IE6A 2IW5B 4QX7B 4ZEYA 5HXEA 2DWGA 4OYKA 4AKIA 2UXCT 3AECA 1OEDA 4KHPT 5JREA 4CZZB 4E7ZA 1HF8A 1LVKA 4DV3T 3KV6A 4PJMA 3N2OA 3F31A 3IEEA 3W15B 1R8IA 1UCUA 3FZLB 5JVDE 4TV8E 2JMHA 5IYZE 2D0UA 2WS3A 4DR1T 5HEHA 4HFCA 4G2AA 3IF8B 3JC6D 2W61A 3AAAB 4KP3C 2HPLA 3SWHA 4X64T 3C51A 3DP7A 2PTFA 3AA7B 3SRZA 1J5WA 4JEUB 3HI2A 4PK4A 3R6NA 3UUXB 4EZHA 4YSXA 3SFEA 3AE6A 4DR5T 2QGSA 4JI7T 4YFSA 2V5DA 2WZHA 3LK3B 4MBQA 2LHNA 2X0LB 4BA9A 1L0VA 5F3JA 4X62T 3QK6A 4AXPA 3ZT7A 4AKRB 3UU3A 2E2AA 4HFEA 2BS3A 4WZXA 1KNPA 3WI3A 2LOPA 2XAJB 3HKDE 2WY2A 2H7VC 2Q9QC 3RPUA 2W00A 3ZMUB 3KVBA 2Q9QB 4YXDA 4JUYA 1B7TA 4KI0F 4ANJA 2R6GF 2XQ9A 1LKXA 3AE3A 3P4SA 4H9NC 1CHUA 2YOEA 2CXDA 2IIUA 2V6XA 2NR4A 2W4XA 4PFPA 2UXXB 1WRDA 4X66T 1NENA 5HWYA 3PTRB 1MMDA 1ZV4X 5L3CB 2KXPB 3MJXA 2L8KA 5FXVA 2X51A 2LE8A 5IWAT 3RLFF 2XHEB 4UVCB 3P4PA 5LOVE 1N34T 4CI1B 3MXZA 4X65T 4LFAT 4WYVA 4JEHB 2J47A 4GYSA 2J4GA 3BQKA 5KXJA 3CQCB 2N1GA 2VKOA 2LM9A 4BJNA 1XDOA 3NWIA 3GMIA 3C4WA 4WBOA 3PUAA 4IL9A 2NWBA 3PV0F 5AFUL 3I1AA 3LK42 4TX5A 3T8OA 4ILBA 4DV2T 4IDZA 4YY3T 1E7PA 1KFYA 5HXRA 2UUBT 2WWVA 3PUXF 3FXDB 3B13A 4UV8B 3J9X1 5BR8T 3A8YC 4O4JE 4LFCT 4IL4A 5AQMB 3HA4A 3CQGB 2WCAA 4X1KE 2LLYA 4GK5E 1D0YA 4IE0A 1T98A 4ZXLA 5LBQB 4IE7A 5HEJA 5DQWA 4UVAB 5AQRB 2FJEA 5DQVA 3H3AA 4HFVA 4CXXA 2LSYA 1SE7A 1H7CA 3OTOT 5JDHA 2E9XC 2BVLA 3ONJA 3MZKB 3X1DA 4DV7T 4IREA 4V1Av 4X1IE 1ZP0A 1ZOYA 5CB4E 4O4LE 1MMGA 4WW0A 5DABA 3CKDA 2XQ8A 2K9AA 4CI2B 2V7KA 3EI0A 4K0KT 3N9OA 4P1NA 2JRKA 1VRBA 4CQIA 4YTMA 2J62A 3CIRA 4DNDA 2KMFA 3OYZA 4HWFA 2OA5A 1WYCA 2N9DA 3V5SA 2HPJA 1HX8A 5F8PA 4NPPA 2KWHA 3IBPA 2VVNA 3VU7H 1ZKEA 2BVMA 3ZEFB 3TLWA 4EIWA 2YU2A 4EXTA 3FZHB 1BR4A 3RYFE 1T8BA 2LSGA 2EHOC 3M65A 2A72A 2XAFB 4H9QC 3VKGA 2EHOB 2LKGA 2WDQA 1N33T 2VB6A 3AE1A 4CN1A 3SFDA 3CX7B 3QNUA 4TWDA 2X9XA 5AQLB 2Y8DA 3KV9A 3Q5EA 2C5KT 3OPCA 2GK9A 4E7SA 3LFMA 2PBIA 2CLYC 3ZC0A 4CN4A 4J2CA 2CLYB 4OFZA 4QXBB 3O4XE 2XAHB 4PW8A 2V7JA 3SOLA 1KK7A 2YDRA 1Z0PA 3FXEB 4C91A 1FJGT 3N2GE 3AE7A 3HKBE 1IZNB 3RC3A 2AXDS 3KBTA 1DU2A 2D0TA 2CHOA 3N9LA 2D2SA 5BMVE 5EK3A 4DMVA 2V26A 4WNKA 4EYUA 2F4VT 2LT3A 3M3ZB 2VWAA 3UU6A 1HNXT 2V7IA 2Z6EA 1YQ3A 2UUCT 5JDLA 4EV6A 5JDNA 2IDOB 3FBZA 2LHRA 4TZ4C 5AQOB 4IIJE 1EZ3A 4CXYA 2XSAA 2Y48B 3UTKA 4AKHA 2UXNB 3G06A 3AEAA 1KF6A 2VL0A 3HL6A 2BS4A 2YINA 3ZT6A 5ABHA 4IDNA 4QH5A 3DTOA 1HNZT 3QC9A 4HE8A 2I0MA 4Z90A 5L4EA 4LMKA 4GKKT 2WBLA 2H88A 2PG8A 3AEGA 3B57A 3ONXA 2M6IA 2ZM8A 4H63H 3PUZF 2OV9A 2V8SV 4PJJA 5C8YE 2QA7A 3ZMSB 1KNZA 3I9WA 1VCTA 1Y64B 1X79A 2WU5A 1OWAA 3ZKRA 4LFBT 1HR0T 4F8HA 4DV0T 4IT4A 2V6YA 3FZKB 1M62A 3UQ4A 2I6HA 2YKSA 3V5UA 2NW9A 2LJLA 5HEUA 4PAGA 3K3NA 3LJCA 1HFAA 2X67A 3U3IA 3P8CD 3HKCE 5KDMC 1T72A 5LHHB 1US7B 3D0TA 4U31A 2ZM0A 4JI8T 3QOFA 5DJQC 4ZZBA 3Q9DA 1Y01A 5FMNA 2NOXA 4QH1A 4NXMT 1MNDA 3JAFA 2MTQA 3L39A 3HR0A 3VHLA 5JR9C 4A97A 3MKDA 4UF0B 5LGNB 3RI5A 5JR9B 2YEVC 5LGUB 5ABGA 3E22E 1FEWA 4JI1T 1IBMT 4EYYR 2XM1A 3AAIA 2KINB 1U5PA 5AQSB 3LSVA 3KINB 5JDGA 5L3BB 2MOZA 4MALA 4X5TA 3ZMVB 3NZQA 4DO0A 4L5GA 1MIWA 1XNRT 4EZ4A 1W09A 3A5XA 2LSKA 4XZCA 3T1HT 3KVAA 3JC6C 2E9XA 3EDUA 1D1AA 4I50E 3ZPOA 1IBLT 2WP9A 3WAKA 1G73A 2KWIB 2WU2A 4ZS2A 3AA6B 1UX5A 3ABVA 1XMQT 3NBXX 1YKEB 4ISTA 2BG9E 2LOSA 3ZSSA 4NXNT 3N2KE 5J0ZA 3F2EA 5AQPB 4OHFA 5F5WA 4I4TE 5H6QB 2L3LA 4ISSA 5ADXL 4JI5T 4AISA 2ACZA 1NEKA 2FJBA 3K3OA 4K0UA 2EHOA 4TWHA 2BS2A 3UQ7A 3RRCA 2AE9A 2H7OA 5LB7B 2K48A 4JV5T 1XWMA 4UELA 4X1YE 5HWXA 2JPFA 2SPCA 5CJ5A 4TV9E 3GWHA 3UU8A 3ZCJA 3Q5XA 3AAEB 5GONE 4QWNB 3ZT5A 3OVUA 2XQ7A 2Y6XA 1Z8UA 2PJQA 5LYJE 2G0UA 2ODUA 4IDQA 2Q9QD 3RKGA 3RIAA 4HN9A 3UFGA 3O1HA 4H9SE 1UURA 5E0OA 4DBRA 5CFBA 5J2UE 4NIQA 5LG3A 2CXFA 4YSYA 3H37A 5L4HA 2KT9A 5FVLA 2HH7A 4MHCA 4A98A 4ZI7E 3PE0A 2CE7A 3I0OA 4Q25A 3KFWX 5HYAA 3C64A 3FZFB 5HEGA 5LGTB 2DWKA 2W67A 2V6YB 4O2BE 2VQET 2YDQA 2IUBA 1W0BA 3LK2B 3SS1A 4KBMB 4QX8B 1E2AA 3T1YT 2M67A 2IAKA 2LM2A 2XJ7A 4UXNB 5AQFB 2K3WA 5FYMA 4QXHB 1XZYA 3PURA 4A5XA 2WDVA 4HEAA 4CXWA 2DCFA 5AQIB 4ZI2D 1OEDE 4HKAA 3ZJ2A 1W0AA 1SUMB 2IMLA 2VVSA 3AVSA 2XTLA 5CGMA 4IE5A 2K24A 5HXSA 2X0YA 2CWOA 3KDSE 1JNZA 5EZYE 3ZYKA 2QYWA 4LF6T 3AEDA 3AA1B 1WR6A 3NRYA 2XZEA 1XMOT 2WMNA 3LBXA 5ABEA 3LDQB 1KNRA 2YU1A 4QXCB 2HN1A 2WAUA 2E9XB 1CUNA 2PFVA 4UF0A 5JR9A 3IHRA 3VRBA 1HNWT 2KSRA 3CK6A 5CA1E 3EHZA 2LKHA 4C90A 3OBVE 2CA5A 3VR8A 2LSJA 3AB3B 4ERRA 4JLEA 4DV4T 3I0QA 4DR4T 1MMNA 3CWZB 4HFBA 3EDVA 3ONLC 5ETWA 1ZHCA 2B1EA 4IDPA 3QB5A 3PUWF 5FP3A 3AEEA 5FNVE 4LMLA 3RF1A 3K1SA 3R84B 4N78D 3F57A 3TLUA 2LEHA 2ZLYA 2RPAA 1VCSA 3LG7A 1LRZA 4QH4A 4FJOA 5FY1A 2WDRA 2ACXA 4H9PC 1I94T 3RQUA 3RGLA 3P4WA 2QRXA 5C2TA 2H3RA 3ZYLA 1IBKT 4DUYT 2XQAA 4OX9T 3FBLA 2E5VA 5AQKB 3PU8A 5AQVB 2ZM2A 3FB2A 4B6XA 5M4YA 4BAYB 1AJ3A 4PK6A 4GIWA 4XAXB 4ILCA 3VKHA 4ZI3C 4YT0A 5LJMA 3K8PC 2XAQB 4KUMB 2FUPA 4CN6A 3RX6A 2BKPA 3TLTA 4MLKA 2VK9A 1GQEA 2A2FX 1J1JA 4IDOA 4M1PA 2BG9A 1O3XA 3CPZA 3NVOA 1LVFA 3OYXA 1QSDA 4DV6T 3C50A 2A3DA 3AEBA 5AQHB 3VR9A 2NW7A 3DJBA 3J7Yq 3RIUC 2LRKA 3RC8A 5TAOA 3ZC1A 2VURA 2JQKA 1SHZC 5CA0E 3MA9A 2JIWA 2WWUA 4WBNE 2DHRA 5HCJA 5FXXA 1FIOA 3B5MA 2UXBT 2RP4A 2XQYA 3HKEE 3PUGA 3WAJA 5FL0A 3N9PA 4ILUA 2XSBA 4HWHA 2CXLA 1D1CA 4YTPA 2X9WA 1KEYA 2XPKA 2MBGA 3AXJA 1MIVA 4KHZF 3ZMZB 5JH7E 3QUJA 5KX5E 2V7LA 2D9DA 3C98B 4H9RC 3ETVA 5LJNA 2W66A 4HTEA 4DUZT 3I9YA 5ABFA 4GYRA 4HGAA 2NW8A 2RA1A 2CWYA 4HWIB 4EB6E 3LBXB 2C5IT 2H89A 2E5LT 3CQXC 4I55E 4LF7T 1YQ4A 4LF9T 1NWMX 3UU4A 5LHGB 1W9RA 5LCYA 3EAMA 3RH3A 4P09A 1G8XA 2CPTA 1NAFA 3Q2MA 1MNEA 5LP6E 2YN6A 4DMWA 3S4UA 3EABA 1T7SA 4TNVA 1SA0E 4PK5A 4QHOA 5EK4A 4YHJA 4DVDA 3RKOA 3AVRA 4YSZA 5LMUT 4TNWA 2BZBA 1UX4A 3KBUA 3L3PA 1WLXA 3TLVA 3RYHE 5H6RB 2HN2A 3FZMB 3O1IA 4EGWA 1IJ5A 4ADZA 3O1JA 2WQYA 2CCQA 3ZJ1A 1S94A 1JNRA 5A1LA 1BR2A 2CBJA 2VASA 2YK0A 5AQTB 4AQFC 1UUSA 3RRWA 3PUSA 1HS7A 2WM9A 2P9BA 4AQYT 3EUHA 4BJMA 2JQHA 4TN7B 4A56A 2V1DB 2BKOA 4O4IE 2V7MA 2CEAA 3Q5DA 4U72A 1WR0A 4HFHA 4UV9B 1I6ZA 4I0UA 2IHR1 2BDEA 4H9OC 3TKLB 2XUEA 3ANWB 2FBWA 4LF5T 3TLSA 3N5LA 5HAXA 1FMVA 3BQIA 3JAEA 3JCFA 5FKYA 3OJAA 3FHNA 3RQWA 2C0SA 3E0ZA 4DR7T 1QLBA 5L47A 2BG9C 1HX1B 4U7YA 5JDQA 2XQ5A 2HHHT 3QB5K 2VKDA 2BG9B 5C3JA 3VRAA 1HCIA 4Z8XA 5HEOA 2CHNA 2BBHA 4JI6T 4HFDA 5L2LA 1D0ZA 1MMAA 5FVKA 1M7KA 3CX8B 4GKJT 2DI4A 1E1HB 3NRXA 3UUBA 3U78A 2DL1A 5AQNB 2JJ9A 3C4XA 2ES0A 3RYIE 4JI4T 3N9NA 4PJLA 5AQQB 4OK0A 5IUXA 3GN5B 5LHIB 1VOMA 4YJ3E 2XY8B 1MIYA 3ESLA 3UUNA 4U2YA 3UULA 3ZCIA 4B3ST 1XNQT 3AXJB 3EVYA 3AEFA 4DIDB 5JRCA 4UIGA 5J1GA 3PUYF 3RIUA 2X66A 3RHWA 5AQGB 2W62A 3P4RA 2XQ3A 5ABFB 2MAWA 3K3QC 3UU5A 4XBFB 4EEBA 4MFRA 1U4QA 3H3MA 4ZI2C 2D5UA 3BQLA 4JI3T 3BK9A 2A9UA 5JDFA 2JQQA 4PJNA 1UK5A 4ZHQE 3O9XA 4O8SA 2V5CA 4B3MT 2K5BB 2CRBA 2JMKA 3ZN1B 2CM0A 3PUVF 4DR6T 1IJ6A 1ZEEA 5JQGE 2DNXA 4B3RT 2BBJA 3UFEA 4YHHT 4U3CA 3AE8A 4GK0E 4ZOLE 2MYSA 4LF4T 4IGUA 5FY0A 1OEDC 5LXTE 2NP9A 1OEDB 3AE2A 3RYCE 2WMOA 2UUAT 4KX6A 3P50A 4O2AE 5LA6E 2FJDA 3L8RA 5AQUB 1BR0A 3KV5A 5L3EB 1FMWA 4JYAT 1QUUA 2X9YA 4YJ2E 4AKGA 4OYJA 4Z91A 3MK7C 1HG2A 4EOZB 2E9XD 4LMJA 2WZIA 5IHYA 4DR3T 4ZZCA 5KMGP 3N9MA 1N32T 3Q5WA 3ZSTA 3PU3A 2X9HA 4YLHA 4ZS3A 3GA8A 4NUVA 3JADA 4I43B 4U74A 2NTYA 3CVRA 2WSSV 2NTXA 2W2UA 3IA3A 5FL1A 3ETUA 3E08A 4AIUA 2KLQA 4UR9A 1HTJF 3OKQA 3PJAJ 4QKNA 5L3FB 4AQFA 2XM2A 2E8IA 2KZ7B 2FJAA 2YDSA 3AE4A 4GOUA 3ZLIA 3ZN0B 1OXZA 4ASKA 4L9IA 3MACA 2EHOD 1YKHB 1BR1A 4TUYE 1XDPA 3A7MA 5LBMA 4IHJE 2JQ9A 4HWCA 3NZPA 4U7IA 5FXZA 1WFDA
chains in the Genus database with same CATH topology
2K48A 3ANWA 1NWMX 4F6RC 2XASB 2C5JA 3HA4A 3CQGB 5LHGB 4UELA 4EAHA 4X1YE 5JDMA 4X1KE 2JPFA 5HWXA 2SPCA 3L09A 5LCYA 4TV9E 3GWHA 1D1BA 3ZCJA 3Q5XA 3C4ZA 3AAEB 3ZYMA 4GK5E 3RH3A 1D0YA 4IE0A 1T98A 1YD8G 5GONE 4P09A 4QWNB 5LBQB 1YW0A 4P0BA 4IE7A 1G8XA 3PDYA 1NAFA 3Q2MA 3CMLA 5DQWA 4UVAB 1MNEA 5LP6E 2Y6XA 5DQVA 3H3AA 4DMWA 3S4UA 2PJQA 4HFVA 5LYJE 1SA0E 4CXXA 2LSYA 4PK5A 4QHOA 5EK4A 1H7CA 2G0UA 2ODUA 5JDHA 5JRCB 2E9XC 4FI5A 4YHJA 2BVLA 3RKOA 4DVDA 3ZMTB 4ZI3D 3AVRA 2Q9QD 5EK2A 2I59A 3MZKB 3AA0B 1HG5A 4HN9A 3O1HA 4V1Av 2BZBA 1UX4A 4X1IE 3KBUA 4H9SE 3L3PA 5CB4E 4O4LE 1WLXA 3N9QA 1MMGA 4WW0A 5DABA 5E0OA 3RYHE 4AI6A 2Q9QA 3PUQA 4H63V 5H6RB 4DBRA 3CKDA 2K9AA 4CI2B 5J2UE 3UT5E 4P0AA 2V7KA 3O1IA 1IJ5A 2CXFA 3N9OA 4ADZA 3O1JA 2CCQA 2JRKA 3H37A 1VRBA 2KT9A 1IAPA 2HH7A 5L3GB 4MHCA 4CQIA 3CX6B 4DBQA 3ZJ1A 3GN5A 4ZI7E 1S94A 2IC9A 2IC6A 5A1LA 1BR2A 4DNDA 3PE0A 2CE7A 2VASA 2YK0A 3I0OA 2KMFA 3OYZA 3KFWX 2OA5A 5HYAA 4AQFC 1WYCA 4G63A 5FY7A 3C64A 5LGTB 2N9DA 2DWKA 3V5SA 1S35A 2HPJA 4UVBB 3RRWA 4KMCA 3PUSA 4O2BE 5L3DB 2CMRA 2VL8A 1HX8A 1HS7A 4L0RA 5F8PA 1D0XA 2P9BA 2WM9A 2VKJA 2KWHA 3IBPA 2W63A 3EUHA 3VU7H 4O4HE 4BJMA 4TN7B 1ZKEA 2BVMA 3LK2B 3ZEFB 4A56A 3SS1A 2V1DB 4KBMB 4QX8B 4O4IE 4EIWA 2V7MA 2CEAA 3P7IA 1V9DA 2M67A 2YU2A 4U72A 2IAKA 4EXTA 5LNKA 5J2TE 2DLRA 1BR4A 3RYFE 4UXNB 2LSGA 2EHOC 3M65A 2A72A 2XAFB 4UV9B 4H9QC 5FYMA 3VKGA 2EHOB 4QXHB 4UEMA 2BDEA 2VB6A 4H9OC 3PURA 5HXHA 4HEAA 4CXWA 3TKLB 2DCFA 4ZI2D 3CX7B 2XUEA 3KV4A 4HKAA 3ANWB 3ZJ2A 2X9XA 2Y8DA 4IE4A 3KV9A 2N2NA 2C5KT 3N5LA 2GK9A 1WYBA 1FMVA 5HAXA 3AVSA 3BQIA 3LFMA 2PBIA 2CLYC 2XTLA 4E7SA 3ZC0A 3OJAA 2X68A 2J1DG 4J2CA 2CLYB 4OFZA 4IE5A 4PNIA 2K24A 4X20E 4QXBB 3O4XE 2XAHB 4PW8A 3FHNA 2C0SA 3E0ZA 5HXSA 2V7JA 3SOLA 1KK7A 2CWOA 3KDSE 1Z0PA 3FXEB 2VKHA 4C91A 3N2GE 5EZYE 3ZYKA 2ODVA 4AQGA 5JDQA 2VKDA 3HKBE 5LG4A 2L9QA 3UUMA 1IZNB 4NUUA 1HCIA 3RC3A 4CI3B 3KBTA 2W0GA 2D0TA 4Z8XA 3N9LA 3AA1B 2D2SA 4PFOA 5BMVE 5EK3A 4DMVA 2V26A 4WNKA 1WR6A 2ZMAA 3NRYA 4EYUA 2KNDA 5L2LA 1D0ZA 1MMAA 2WMNA 3LBXA 2LT3A 3CX8B 2DI4A 1E1HB 5HXCA 3NRXA 3U78A 2VWAA 2YU1A 2XAGB 4AKLA 4QXCB 2JJ9A 2LSIA 3C4XA 2V7IA 2ES0A 2WAUA 5FXWA 2Z6EA 3RYIE 2E9XB 5JDLA 1CUNA 4IE6A 3N9NA 4PJLA 5JDNA 2IW5B 4QX7B 5HXEA 2PFVA 2DWGA 4UF0A 4OYKA 5JR9A 4OK0A 3IHRA 4AKIA 3GN5B 3FBZA 5LHIB 2LHRA 4TZ4C 5CA1E 5JREA 4CZZB 4IIJE 1EZ3A 4CXYA 4E7ZA 1HF8A 4C90A 1LVKA 1VOMA 3OBVE 2Y48B 3KV6A 3UTKA 4PJMA 3N2OA 2CA5A 4YJ3E 4AKHA 2LSJA 3AB3B 1MIYA 4JLEA 4ERRA 3F31A 3IEEA 3W15B 2UXNB 3ESLA 3UUNA 3I0QA 3ZCIA 3UULA 1MMNA 1UCUA 3CWZB 3EVYA 3EDVA 3HL6A 2YINA 5JRCA 4UIGA 5J1GA 5JVDE 3DTOA 4TV8E 5ETWA 2JMHA 1ZHCA 3QC9A 5IYZE 2B1EA 4HE8A 2D0UA 2X66A 2WBLA 4G2AA 2W62A 3IF8B 3JC6D 2PG8A 5FP3A 2W61A 3AAAB 3B57A 3ONXA 4KP3C 5FNVE 3K3QC 2ZM8A 4XBFB 2HPLA 3SWHA 4H63H 3C51A 4MFRA 4PJJA 1U4QA 4ZI2C 5C8YE 2QA7A 2D5UA 3BQLA 4N78D 3R84B 3DP7A 3F57A 3ZMSB 3AA7B 3I9WA 3SRZA 1KNZA 2LEHA 3BK9A 5JDFA 2ZLYA 1Y64B 3LG7A 4JEUB 1LRZA 1X79A 3HI2A 4FJOA 5FY1A 4PK4A 1OWAA 2ACXA 2JQQA 4H9PC 4PJNA 4ZHQE 3O9XA 4O8SA 3R6NA 3UUXB 4EZHA 2K5BB 3V5UA 2QGSA 2NW9A 2LJLA 4YFSA 2JMKA 3ZN1B 3LK3B 4PAGA 4MBQA 2CM0A 2LHNA 3K3NA 2H3RA 3ZYLA 3LJCA 1HFAA 2X0LB 2X67A 4BA9A 1IJ6A 5F3JA 3U3IA 3QK6A 4AXPA 3P8CD 1ZEEA 5JQGE 2DNXA 3FBLA 3HKCE 5KDMC 4AKRB 3UFEA 5LHHB 3PU8A 1US7B 3D0TA 2ZM0A 2ZM2A 3FB2A 4B6XA 5DJQC 5M4YA 3Q9DA 4BAYB 1AJ3A 4PK6A 4GIWA 3WI3A 5FMNA 2NOXA 2LOPA 4GK0E 4ZOLE 4XAXB 2XAJB 1MNDA 2MTQA 3VHLA 3HKDE 2MYSA 3HR0A 5JR9C 3VKHA 4ZI3C 5LJMA 3MKDA 2H7VC 2Q9QC 4IGUA 4UF0B 3K8PC 5FY0A 3RPUA 2XAQB 5JR9B 5LGNB 2YEVC 2W00A 4KUMB 5LGUB 3ZMUB 3KVBA 2Q9QB 5LXTE 2NP9A 3E22E 3RX6A 1FEWA 3RYCE 2WMOA 4JUYA 1B7TA 4MLKA 2VK9A 4O2AE 5LA6E 4ANJA 2A2FX 4EYYR 4M1PA 1LKXA 3AAIA 2KINB 1U5PA 3KINB 1BR0A 3KV5A 4H9NC 5L3EB 1FMWA 1O3XA 3CPZA 1LVFA 5JDGA 5L3BB 3OYXA 1QUUA 2X9YA 2MOZA 1QSDA 2CXDA 4YJ2E 4MALA 3C50A 4AKGA 4OYJA 2A3DA 3MK7C 3ZMVB 2NW7A 3DJBA 1HG2A 3NZQA 4PFPA 3J7Yq 2UXXB 4DO0A 1WRDA 5HWYA 3RC8A 3PTRB 4L5GA 4EOZB 5TAOA 2E9XD 1MIWA 3ZC1A 1MMDA 1ZV4X 4EZ4A 5IHYA 5L3CB 2KXPB 3MJXA 1SHZC 2L8KA 5CA0E 3A5XA 3N9MA 5KMGP 3Q5WA 3MA9A 2LSKA 4XZCA 3PU3A 5FXVA 3KVAA 2X51A 2WWUA 2LE8A 2X9HA 4WBNE 2DHRA 4YLHA 3JC6C 4ZS3A 2XHEB 3GA8A 2E9XA 4UVCB 5FXXA 4NUVA 1FIOA 2RP4A 2XQYA 3EDUA 4I43B 4U74A 5LOVE 1D1AA 2NTYA 4CI1B 3MXZA 4I50E 3HKEE 3ZPOA 3CVRA 2WSSV 4JEHB 2NTXA 3WAKA 3PUGA 1G73A 3WAJA 3N9PA 4ILUA 2KWIB 4GYSA 3ETUA 3E08A 4ZS2A 3AA6B 3BQKA 3CQCB 1UX5A 2N1GA 2CXLA 1D1CA 2KLQA 2X9WA 2VKOA 3NBXX 2LM9A 4BJNA 1HTJF 2MBGA 1YKEB 4ISTA 3GMIA 1MIVA 3C4WA 2LOSA 3ZMZB 4WBOA 3PUAA 3OKQA 5JH7E 4QKNA 3QUJA 5KX5E 5L3FB 2V7LA 2NWBA 3C98B 3N2KE 4AQFA 5AFUL 4H9RC 2E8IA 3F2EA 2KZ7B 3I1AA 4OHFA 4GOUA 4I4TE 3ETVA 3LK42 5H6QB 4TX5A 3ZLIA 2L3LA 3ZN0B 4ISSA 1OXZA 4ASKA 4L9IA 5LJNA 5ADXL 3MACA 2EHOD 4HTEA 1YKHB 1BR1A 3I9YA 4TUYE 3T8OA 4GYRA 4HGAA 2NW8A 4IDZA 5LBMA 2RA1A 2CWYA 3K3OA 5HXRA 4IHJE 4EB6E 4K0UA 2EHOA 3FXDB 3NZPA 3B13A 3LBXB 4UV8B 3J9X1 2C5IT 3RRCA 5FXZA 4O4JE 3CQXC 4I55E 2H7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5P A;  5J1G A;  1S35 A;  3F57 A;  3LBX A;  2SPC A;  1QUU A;  2ODU A;  3EDU A;  1OWA A;  2ODV A;  3F31 A;  2IAK A;  3UUN A;  3R6N A;  3UUM A;  3LBX B;  1G8X A;  3PDY A;  3FB2 A;  3UUL A;  1HCI A;  1CUN A;  3PE0 A;  3KBT A;  3KBU A;  3EDV A;  1AJ3 A;  1WLX A;  1U4Q A; 
#chains in the Genus database with same CATH topology
 3ANW A;  4F6R C;  2XAS B;  2C5J A;  4EAH A;  2UXD T;  5JDM A;  3L09 A;  1D1B A;  4ILA A;  1J5E T;  3C4Z A;  3ZYM A;  1YD8 G;  2XQ4 A;  4JI0 T;  1YW0 A;  4P0B A;  3PDY A;  2M6B A;  3CML A;  2X0H A;  1YXR A;  2UU9 T;  5JRC B;  2QVA A;  4DR2 T;  4FI5 A;  4ZI3 D;  3ZMT B;  5EK2 A;  2I59 A;  3AA0 B;  1HG5 A;  5LMN T;  4DV5 T;  4B3T T;  3N9Q A;  1UGO A;  2VQF T;  4AI6 A;  1N36 T;  2LRL A;  2Q9Q A;  3PUQ A;  4H63 V;  3RIF A;  5HCM A;  3UT5 E;  4P0A A;  2WB5 A;  1X9B A;  4EED A;  3NKZ A;  2ZM6 T;  1IAP A;  5L3G B;  4DBQ A;  3CX6 B;  3GN5 A;  2IC9 A;  2IC6 A;  2OLT A;  4LF8 T;  4G63 A;  3PJA A;  5FY7 A;  4COF A;  1S35 A;  5L3D B;  4UVB B;  4KMC A;  5JTG A;  2CMR A;  2VL8 A;  4L0R A;  1D0X A;  2VKJ A;  4U2Z A;  2W63 A;  4O4H E;  2BKN A;  3P7I A;  1V9D A;  5LNK A;  4TWF A;  5J2T E;  2DLR A;  4HFI A;  5AQJ B;  4UEM A;  5HXH A;  3KV4 A;  4IE4 A;  2N2N A;  1WYB A;  2X68 A;  2J1D G;  4PNI A;  4X20 E;  4YTN A;  2XQ6 A;  2MPK A;  2VKH A;  1WCR A;  2ODV A;  4AQG A;  4HWD A;  3AE9 A;  3AE5 A;  5LG4 A;  2L9Q A;  3UUM A;  4NUU A;  4CI3 B;  2W0G A;  4PFO A;  4DV1 T;  2ZMA A;  4U33 A;  2KND A;  2B76 A;  2CBI A;  4JI2 T;  5HXC A;  2XAG B;  4AKL A;  3P4Q A;  2LSI A;  4JBW F;  5FXW A;  4IE6 A;  2IW5 B;  4QX7 B;  4ZEY A;  5HXE A;  2DWG A;  4OYK A;  4AKI A;  2UXC T;  3AEC A;  1OED A;  4KHP T;  5JRE A;  4CZZ B;  4E7Z A;  1HF8 A;  1LVK A;  4DV3 T;  3KV6 A;  4PJM A;  3N2O A;  3F31 A;  3IEE A;  3W15 B;  1R8I A;  1UCU A;  3FZL B;  5JVD E;  4TV8 E;  2JMH A;  5IYZ E;  2D0U A;  2WS3 A;  4DR1 T;  5HEH A;  4HFC A;  4G2A A;  3IF8 B;  3JC6 D;  2W61 A;  3AAA B;  4KP3 C;  2HPL A;  3SWH A;  4X64 T;  3C51 A;  3DP7 A;  2PTF A;  3AA7 B;  3SRZ A;  1J5W A;  4JEU B;  3HI2 A;  4PK4 A;  3R6N A;  3UUX B;  4EZH A;  4YSX A;  3SFE A;  3AE6 A;  4DR5 T;  2QGS A;  4JI7 T;  4YFS A;  2V5D A;  2WZH A;  3LK3 B;  4MBQ A;  2LHN A;  2X0L B;  4BA9 A;  1L0V A;  5F3J A;  4X62 T;  3QK6 A;  4AXP A;  3ZT7 A;  4AKR B;  3UU3 A;  2E2A A;  4HFE A;  2BS3 A;  4WZX A;  1KNP A;  3WI3 A;  2LOP A;  2XAJ B;  3HKD E;  2WY2 A;  2H7V C;  2Q9Q C;  3RPU A;  2W00 A;  3ZMU B;  3KVB A;  2Q9Q B;  4YXD A;  4JUY A;  1B7T A;  4KI0 F;  4ANJ A;  2R6G F;  2XQ9 A;  1LKX A;  3AE3 A;  3P4S A;  4H9N C;  1CHU A;  2YOE A;  2CXD A;  2IIU A;  2V6X A;  2NR4 A;  2W4X A;  4PFP A;  2UXX B;  1WRD A;  4X66 T;  1NEN A;  5HWY A;  3PTR B;  1MMD A;  1ZV4 X;  5L3C B;  2KXP B;  3MJX A;  2L8K A;  5FXV A;  2X51 A;  2LE8 A;  5IWA T;  3RLF F;  2XHE B;  4UVC B;  3P4P A;  5LOV E;  1N34 T;  4CI1 B;  3MXZ A;  4X65 T;  4LFA T;  4WYV A;  4JEH B;  2J47 A;  4GYS A;  2J4G A;  3BQK A;  5KXJ A;  3CQC B;  2N1G A;  2VKO A;  2LM9 A;  4BJN A;  1XDO A;  3NWI A;  3GMI A;  3C4W A;  4WBO A;  3PUA A;  4IL9 A;  2NWB A;  3PV0 F;  5AFU L;  3I1A A;  3LK4 2;  4TX5 A;  3T8O A;  4ILB A;  4DV2 T;  4IDZ A;  4YY3 T;  1E7P A;  1KFY A;  5HXR A;  2UUB T;  2WWV A;  3PUX F;  3FXD B;  3B13 A;  4UV8 B;  3J9X 1;  5BR8 T;  3A8Y C;  4O4J E;  4LFC T;  4IL4 A;  5AQM B;  3HA4 A;  3CQG B;  2WCA A;  4X1K E;  2LLY A;  4GK5 E;  1D0Y A;  4IE0 A;  1T98 A;  4ZXL A;  5LBQ B;  4IE7 A;  5HEJ A;  5DQW A;  4UVA B;  5AQR B;  2FJE A;  5DQV A;  3H3A A;  4HFV A;  4CXX A;  2LSY A;  1SE7 A;  1H7C A;  3OTO T;  5JDH A;  2E9X C;  2BVL A;  3ONJ A;  3MZK B;  3X1D A;  4DV7 T;  4IRE A;  4V1A v;  4X1I E;  1ZP0 A;  1ZOY A;  5CB4 E;  4O4L E;  1MMG A;  4WW0 A;  5DAB A;  3CKD A;  2XQ8 A;  2K9A A;  4CI2 B;  2V7K A;  3EI0 A;  4K0K T;  3N9O A;  4P1N A;  2JRK A;  1VRB A;  4CQI A;  4YTM A;  2J62 A;  3CIR A;  4DND A;  2KMF A;  3OYZ A;  4HWF A;  2OA5 A;  1WYC A;  2N9D A;  3V5S A;  2HPJ A;  1HX8 A;  5F8P A;  4NPP A;  2KWH A;  3IBP A;  2VVN A;  3VU7 H;  1ZKE A;  2BVM A;  3ZEF B;  3TLW A;  4EIW A;  2YU2 A;  4EXT A;  3FZH B;  1BR4 A;  3RYF E;  1T8B A;  2LSG A;  2EHO C;  3M65 A;  2A72 A;  2XAF B;  4H9Q C;  3VKG A;  2EHO B;  2LKG A;  2WDQ A;  1N33 T;  2VB6 A;  3AE1 A;  4CN1 A;  3SFD A;  3CX7 B;  3QNU A;  4TWD A;  2X9X A;  5AQL B;  2Y8D A;  3KV9 A;  3Q5E A;  2C5K T;  3OPC A;  2GK9 A;  4E7S A;  3LFM A;  2PBI A;  2CLY C;  3ZC0 A;  4CN4 A;  4J2C A;  2CLY B;  4OFZ A;  4QXB B;  3O4X E;  2XAH B;  4PW8 A;  2V7J A;  3SOL A;  1KK7 A;  2YDR A;  1Z0P A;  3FXE B;  4C91 A;  1FJG T;  3N2G E;  3AE7 A;  3HKB E;  1IZN B;  3RC3 A;  2AXD S;  3KBT A;  1DU2 A;  2D0T A;  2CHO A;  3N9L A;  2D2S A;  5BMV E;  5EK3 A;  4DMV A;  2V26 A;  4WNK A;  4EYU A;  2F4V T;  2LT3 A;  3M3Z B;  2VWA A;  3UU6 A;  1HNX T;  2V7I A;  2Z6E A;  1YQ3 A;  2UUC T;  5JDL A;  4EV6 A;  5JDN A;  2IDO B;  3FBZ A;  2LHR A;  4TZ4 C;  5AQO B;  4IIJ E;  1EZ3 A;  4CXY A;  2XSA A;  2Y48 B;  3UTK A;  4AKH A;  2UXN B;  3G06 A;  3AEA A;  1KF6 A;  2VL0 A;  3HL6 A;  2BS4 A;  2YIN A;  3ZT6 A;  5ABH A;  4IDN A;  4QH5 A;  3DTO A;  1HNZ T;  3QC9 A;  4HE8 A;  2I0M A;  4Z90 A;  5L4E A;  4LMK A;  4GKK T;  2WBL A;  2H88 A;  2PG8 A;  3AEG A;  3B57 A;  3ONX A;  2M6I A;  2ZM8 A;  4H63 H;  3PUZ F;  2OV9 A;  2V8S V;  4PJJ A;  5C8Y E;  2QA7 A;  3ZMS B;  1KNZ A;  3I9W A;  1VCT A;  1Y64 B;  1X79 A;  2WU5 A;  1OWA A;  3ZKR A;  4LFB T;  1HR0 T;  4F8H A;  4DV0 T;  4IT4 A;  2V6Y A;  3FZK B;  1M62 A;  3UQ4 A;  2I6H A;  2YKS A;  3V5U A;  2NW9 A;  2LJL A;  5HEU A;  4PAG A;  3K3N A;  3LJC A;  1HFA A;  2X67 A;  3U3I A;  3P8C D;  3HKC E;  5KDM C;  1T72 A;  5LHH B;  1US7 B;  3D0T A;  4U31 A;  2ZM0 A;  4JI8 T;  3QOF A;  5DJQ C;  4ZZB A;  3Q9D A;  1Y01 A;  5FMN A;  2NOX A;  4QH1 A;  4NXM T;  1MND A;  3JAF A;  2MTQ A;  3L39 A;  3HR0 A;  3VHL A;  5JR9 C;  4A97 A;  3MKD A;  4UF0 B;  5LGN B;  3RI5 A;  5JR9 B;  2YEV C;  5LGU B;  5ABG A;  3E22 E;  1FEW A;  4JI1 T;  1IBM T;  4EYY R;  2XM1 A;  3AAI A;  2KIN B;  1U5P A;  5AQS B;  3LSV A;  3KIN B;  5JDG A;  5L3B B;  2MOZ A;  4MAL A;  4X5T A;  3ZMV B;  3NZQ A;  4DO0 A;  4L5G A;  1MIW A;  1XNR T;  4EZ4 A;  1W09 A;  3A5X A;  2LSK A;  4XZC A;  3T1H T;  3KVA A;  3JC6 C;  2E9X A;  3EDU A;  1D1A A;  4I50 E;  3ZPO A;  1IBL T;  2WP9 A;  3WAK A;  1G73 A;  2KWI B;  2WU2 A;  4ZS2 A;  3AA6 B;  1UX5 A;  3ABV A;  1XMQ T;  3NBX X;  1YKE B;  4IST A;  2BG9 E;  2LOS A;  3ZSS A;  4NXN T;  3N2K E;  5J0Z A;  3F2E A;  5AQP B;  4OHF A;  5F5W A;  4I4T E;  5H6Q B;  2L3L A;  4ISS A;  5ADX L;  4JI5 T;  4AIS A;  2ACZ A;  1NEK A;  2FJB A;  3K3O A;  4K0U A;  2EHO A;  4TWH A;  2BS2 A;  3UQ7 A;  3RRC A;  2AE9 A;  2H7O A;  5LB7 B;  2K48 A;  4JV5 T;  1XWM A;  4UEL A;  4X1Y E;  5HWX A;  2JPF A;  2SPC A;  5CJ5 A;  4TV9 E;  3GWH A;  3UU8 A;  3ZCJ A;  3Q5X A;  3AAE B;  5GON E;  4QWN B;  3ZT5 A;  3OVU A;  2XQ7 A;  2Y6X A;  1Z8U A;  2PJQ A;  5LYJ E;  2G0U A;  2ODU A;  4IDQ A;  2Q9Q D;  3RKG A;  3RIA A;  4HN9 A;  3UFG A;  3O1H A;  4H9S E;  1UUR A;  5E0O A;  4DBR A;  5CFB A;  5J2U E;  4NIQ A;  5LG3 A;  2CXF A;  4YSY A;  3H37 A;  5L4H A;  2KT9 A;  5FVL A;  2HH7 A;  4MHC A;  4A98 A;  4ZI7 E;  3PE0 A;  2CE7 A;  3I0O A;  4Q25 A;  3KFW X;  5HYA A;  3C64 A;  3FZF B;  5HEG A;  5LGT B;  2DWK A;  2W67 A;  2V6Y B;  4O2B E;  2VQE T;  2YDQ A;  2IUB A;  1W0B A;  3LK2 B;  3SS1 A;  4KBM B;  4QX8 B;  1E2A A;  3T1Y T;  2M67 A;  2IAK A;  2LM2 A;  2XJ7 A;  4UXN B;  5AQF B;  2K3W A;  5FYM A;  4QXH B;  1XZY A;  3PUR A;  4A5X A;  2WDV A;  4HEA A;  4CXW A;  2DCF A;  5AQI B;  4ZI2 D;  1OED E;  4HKA A;  3ZJ2 A;  1W0A A;  1SUM B;  2IML A;  2VVS A;  3AVS A;  2XTL A;  5CGM A;  4IE5 A;  2K24 A;  5HXS A;  2X0Y A;  2CWO A;  3KDS E;  1JNZ A;  5EZY E;  3ZYK A;  2QYW A;  4LF6 T;  3AED A;  3AA1 B;  1WR6 A;  3NRY A;  2XZE A;  1XMO T;  2WMN A;  3LBX A;  5ABE A;  3LDQ B;  1KNR A;  2YU1 A;  4QXC B;  2HN1 A;  2WAU A;  2E9X B;  1CUN A;  2PFV A;  4UF0 A;  5JR9 A;  3IHR A;  3VRB A;  1HNW T;  2KSR A;  3CK6 A;  5CA1 E;  3EHZ A;  2LKH A;  4C90 A;  3OBV E;  2CA5 A;  3VR8 A;  2LSJ A;  3AB3 B;  4ERR A;  4JLE A;  4DV4 T;  3I0Q A;  4DR4 T;  1MMN A;  3CWZ B;  4HFB A;  3EDV A;  3ONL C;  5ETW A;  1ZHC A;  2B1E A;  4IDP A;  3QB5 A;  3PUW F;  5FP3 A;  3AEE A;  5FNV E;  4LML A;  3RF1 A;  3K1S A;  3R84 B;  4N78 D;  3F57 A;  3TLU A;  2LEH A;  2ZLY A;  2RPA A;  1VCS A;  3LG7 A;  1LRZ A;  4QH4 A;  4FJO A;  5FY1 A;  2WDR A;  2ACX A;  4H9P C;  1I94 T;  3RQU A;  3RGL A;  3P4W A;  2QRX A;  5C2T A;  2H3R A;  3ZYL A;  1IBK T;  4DUY T;  2XQA A;  4OX9 T;  3FBL A;  2E5V A;  5AQK B;  3PU8 A;  5AQV B;  2ZM2 A;  3FB2 A;  4B6X A;  5M4Y A;  4BAY B;  1AJ3 A;  4PK6 A;  4GIW A;  4XAX B;  4ILC A;  3VKH A;  4ZI3 C;  4YT0 A;  5LJM A;  3K8P C;  2XAQ B;  4KUM B;  2FUP A;  4CN6 A;  3RX6 A;  2BKP A;  3TLT A;  4MLK A;  2VK9 A;  1GQE A;  2A2F X;  1J1J A;  4IDO A;  4M1P A;  2BG9 A;  1O3X A;  3CPZ A;  3NVO A;  1LVF A;  3OYX A;  1QSD A;  4DV6 T;  3C50 A;  2A3D A;  3AEB A;  5AQH B;  3VR9 A;  2NW7 A;  3DJB A;  3J7Y q;  3RIU C;  2LRK A;  3RC8 A;  5TAO A;  3ZC1 A;  2VUR A;  2JQK A;  1SHZ C;  5CA0 E;  3MA9 A;  2JIW A;  2WWU A;  4WBN E;  2DHR A;  5HCJ A;  5FXX A;  1FIO A;  3B5M A;  2UXB T;  2RP4 A;  2XQY A;  3HKE E;  3PUG A;  3WAJ A;  5FL0 A;  3N9P A;  4ILU A;  2XSB A;  4HWH A;  2CXL A;  1D1C A;  4YTP A;  2X9W A;  1KEY A;  2XPK A;  2MBG A;  3AXJ A;  1MIV A;  4KHZ F;  3ZMZ B;  5JH7 E;  3QUJ A;  5KX5 E;  2V7L A;  2D9D A;  3C98 B;  4H9R C;  3ETV A;  5LJN A;  2W66 A;  4HTE A;  4DUZ T;  3I9Y A;  5ABF A;  4GYR A;  4HGA A;  2NW8 A;  2RA1 A;  2CWY A;  4HWI B;  4EB6 E;  3LBX B;  2C5I T;  2H89 A;  2E5L T;  3CQX C;  4I55 E;  4LF7 T;  1YQ4 A;  4LF9 T;  1NWM X;  3UU4 A;  5LHG B;  1W9R A;  5LCY A;  3EAM A;  3RH3 A;  4P09 A;  1G8X A;  2CPT A;  1NAF A;  3Q2M A;  1MNE A;  5LP6 E;  2YN6 A;  4DMW A;  3S4U A;  3EAB A;  1T7S A;  4TNV A;  1SA0 E;  4PK5 A;  4QHO A;  5EK4 A;  4YHJ A;  4DVD A;  3RKO A;  3AVR A;  4YSZ A;  5LMU T;  4TNW A;  2BZB A;  1UX4 A;  3KBU A;  3L3P A;  1WLX A;  3TLV A;  3RYH E;  5H6R B;  2HN2 A;  3FZM B;  3O1I A;  4EGW A;  1IJ5 A;  4ADZ A;  3O1J A;  2WQY A;  2CCQ A;  3ZJ1 A;  1S94 A;  1JNR A;  5A1L A;  1BR2 A;  2CBJ A;  2VAS A;  2YK0 A;  5AQT B;  4AQF C;  1UUS A;  3RRW A;  3PUS A;  1HS7 A;  2WM9 A;  2P9B A;  4AQY T;  3EUH A;  4BJM A;  2JQH A;  4TN7 B;  4A56 A;  2V1D B;  2BKO A;  4O4I E;  2V7M A;  2CEA A;  3Q5D A;  4U72 A;  1WR0 A;  4HFH A;  4UV9 B;  1I6Z A;  4I0U A;  2IHR 1;  2BDE A;  4H9O C;  3TKL B;  2XUE A;  3ANW B;  2FBW A;  4LF5 T;  3TLS A;  3N5L A;  5HAX A;  1FMV A;  3BQI A;  3JAE A;  3JCF A;  5FKY A;  3OJA A;  3FHN A;  3RQW A;  2C0S A;  3E0Z A;  4DR7 T;  1QLB A;  5L47 A;  2BG9 C;  1HX1 B;  4U7Y A;  5JDQ A;  2XQ5 A;  2HHH T;  3QB5 K;  2VKD A;  2BG9 B;  5C3J A;  3VRA A;  1HCI A;  4Z8X A;  5HEO A;  2CHN A;  2BBH A;  4JI6 T;  4HFD A;  5L2L A;  1D0Z A;  1MMA A;  5FVK A;  1M7K A;  3CX8 B;  4GKJ T;  2DI4 A;  1E1H B;  3NRX A;  3UUB A;  3U78 A;  2DL1 A;  5AQN B;  2JJ9 A;  3C4X A;  2ES0 A;  3RYI E;  4JI4 T;  3N9N A;  4PJL A;  5AQQ B;  4OK0 A;  5IUX A;  3GN5 B;  5LHI B;  1VOM A;  4YJ3 E;  2XY8 B;  1MIY A;  3ESL A;  3UUN A;  4U2Y A;  3UUL A;  3ZCI A;  4B3S T;  1XNQ T;  3AXJ B;  3EVY A;  3AEF A;  4DID B;  5JRC A;  4UIG A;  5J1G A;  3PUY F;  3RIU A;  2X66 A;  3RHW A;  5AQG B;  2W62 A;  3P4R A;  2XQ3 A;  5ABF B;  2MAW A;  3K3Q C;  3UU5 A;  4XBF B;  4EEB A;  4MFR A;  1U4Q A;  3H3M A;  4ZI2 C;  2D5U A;  3BQL A;  4JI3 T;  3BK9 A;  2A9U A;  5JDF A;  2JQQ A;  4PJN A;  1UK5 A;  4ZHQ E;  3O9X A;  4O8S A;  2V5C A;  4B3M T;  2K5B B;  2CRB A;  2JMK A;  3ZN1 B;  2CM0 A;  3PUV F;  4DR6 T;  1IJ6 A;  1ZEE A;  5JQG E;  2DNX A;  4B3R T;  2BBJ A;  3UFE A;  4YHH T;  4U3C A;  3AE8 A;  4GK0 E;  4ZOL E;  2MYS A;  4LF4 T;  4IGU A;  5FY0 A;  1OED C;  5LXT E;  2NP9 A;  1OED B;  3AE2 A;  3RYC E;  2WMO A;  2UUA T;  4KX6 A;  3P50 A;  4O2A E;  5LA6 E;  2FJD A;  3L8R A;  5AQU B;  1BR0 A;  3KV5 A;  5L3E B;  1FMW A;  4JYA T;  1QUU A;  2X9Y A;  4YJ2 E;  4AKG A;  4OYJ A;  4Z91 A;  3MK7 C;  1HG2 A;  4EOZ B;  2E9X D;  4LMJ A;  2WZI A;  5IHY A;  4DR3 T;  4ZZC A;  5KMG P;  3N9M A;  1N32 T;  3Q5W A;  3ZST A;  3PU3 A;  2X9H A;  4YLH A;  4ZS3 A;  3GA8 A;  4NUV A;  3JAD A;  4I43 B;  4U74 A;  2NTY A;  3CVR A;  2WSS V;  2NTX A;  2W2U A;  3IA3 A;  5FL1 A;  3ETU A;  3E08 A;  4AIU A;  2KLQ A;  4UR9 A;  1HTJ F;  3OKQ A;  3PJA J;  4QKN A;  5L3F B;  4AQF A;  2XM2 A;  2E8I A;  2KZ7 B;  2FJA A;  2YDS A;  3AE4 A;  4GOU A;  3ZLI A;  3ZN0 B;  1OXZ A;  4ASK A;  4L9I A;  3MAC A;  2EHO D;  1YKH B;  1BR1 A;  4TUY E;  1XDP A;  3A7M A;  5LBM A;  4IHJ E;  2JQ9 A;  4HWC A;  3NZP A;  4U7I A;  5FXZ A;  1WFD A; 
#chains in the Genus database with same CATH homology
 2K48 A;  3ANW A;  1NWM X;  4F6R C;  2XAS B;  2C5J A;  3HA4 A;  3CQG B;  5LHG B;  4UEL A;  4EAH A;  4X1Y E;  5JDM A;  4X1K E;  2JPF A;  5HWX A;  2SPC A;  3L09 A;  5LCY A;  4TV9 E;  3GWH A;  1D1B A;  3ZCJ A;  3Q5X A;  3C4Z A;  3AAE B;  3ZYM A;  4GK5 E;  3RH3 A;  1D0Y A;  4IE0 A;  1T98 A;  1YD8 G;  5GON E;  4P09 A;  4QWN B;  5LBQ B;  1YW0 A;  4P0B A;  4IE7 A;  1G8X A;  3PDY A;  1NAF A;  3Q2M A;  3CML A;  5DQW A;  4UVA B;  1MNE A;  5LP6 E;  2Y6X A;  5DQV A;  3H3A A;  4DMW A;  3S4U A;  2PJQ A;  4HFV A;  5LYJ E;  1SA0 E;  4CXX A;  2LSY A;  4PK5 A;  4QHO A;  5EK4 A;  1H7C A;  2G0U A;  2ODU A;  5JDH A;  5JRC B;  2E9X C;  4FI5 A;  4YHJ A;  2BVL A;  3RKO A;  4DVD A;  3ZMT B;  4ZI3 D;  3AVR A;  2Q9Q D;  5EK2 A;  2I59 A;  3MZK B;  3AA0 B;  1HG5 A;  4HN9 A;  3O1H A;  4V1A v;  2BZB A;  1UX4 A;  4X1I E;  3KBU A;  4H9S E;  3L3P A;  5CB4 E;  4O4L E;  1WLX A;  3N9Q A;  1MMG A;  4WW0 A;  5DAB A;  5E0O A;  3RYH E;  4AI6 A;  2Q9Q A;  3PUQ A;  4H63 V;  5H6R B;  4DBR A;  3CKD A;  2K9A A;  4CI2 B;  5J2U E;  3UT5 E;  4P0A A;  2V7K A;  3O1I A;  1IJ5 A;  2CXF A;  3N9O A;  4ADZ A;  3O1J A;  2CCQ A;  2JRK A;  3H37 A;  1VRB A;  2KT9 A;  1IAP A;  2HH7 A;  5L3G B;  4MHC A;  4CQI A;  3CX6 B;  4DBQ A;  3ZJ1 A;  3GN5 A;  4ZI7 E;  1S94 A;  2IC9 A;  2IC6 A;  5A1L A;  1BR2 A;  4DND A;  3PE0 A;  2CE7 A;  2VAS A;  2YK0 A;  3I0O A;  2KMF A;  3OYZ A;  3KFW X;  2OA5 A;  5HYA A;  4AQF C;  1WYC A;  4G63 A;  5FY7 A;  3C64 A;  5LGT B;  2N9D A;  2DWK A;  3V5S A;  1S35 A;  2HPJ A;  4UVB B;  3RRW A;  4KMC A;  3PUS A;  4O2B E;  5L3D B;  2CMR A;  2VL8 A;  1HX8 A;  1HS7 A;  4L0R A;  5F8P A;  1D0X A;  2P9B A;  2WM9 A;  2VKJ A;  2KWH A;  3IBP A;  2W63 A;  3EUH A;  3VU7 H;  4O4H E;  4BJM A;  4TN7 B;  1ZKE A;  2BVM A;  3LK2 B;  3ZEF B;  4A56 A;  3SS1 A;  2V1D B;  4KBM B;  4QX8 B;  4O4I E;  4EIW A;  2V7M A;  2CEA A;  3P7I A;  1V9D A;  2M67 A;  2YU2 A;  4U72 A;  2IAK A;  4EXT A;  5LNK A;  5J2T E;  2DLR A;  1BR4 A;  3RYF E;  4UXN B;  2LSG A;  2EHO C;  3M65 A;  2A72 A;  2XAF B;  4UV9 B;  4H9Q C;  5FYM A;  3VKG A;  2EHO B;  4QXH B;  4UEM A;  2BDE A;  2VB6 A;  4H9O C;  3PUR A;  5HXH A;  4HEA A;  4CXW A;  3TKL B;  2DCF A;  4ZI2 D;  3CX7 B;  2XUE A;  3KV4 A;  4HKA A;  3ANW B;  3ZJ2 A;  2X9X A;  2Y8D A;  4IE4 A;  3KV9 A;  2N2N A;  2C5K T;  3N5L A;  2GK9 A;  1WYB A;  1FMV A;  5HAX A;  3AVS A;  3BQI A;  3LFM A;  2PBI A;  2CLY C;  2XTL A;  4E7S A;  3ZC0 A;  3OJA A;  2X68 A;  2J1D G;  4J2C A;  2CLY B;  4OFZ A;  4IE5 A;  4PNI A;  2K24 A;  4X20 E;  4QXB B;  3O4X E;  2XAH B;  4PW8 A;  3FHN A;  2C0S A;  3E0Z A;  5HXS A;  2V7J A;  3SOL A;  1KK7 A;  2CWO A;  3KDS E;  1Z0P A;  3FXE B;  2VKH A;  4C91 A;  3N2G E;  5EZY E;  3ZYK A;  2ODV A;  4AQG A;  5JDQ A;  2VKD A;  3HKB E;  5LG4 A;  2L9Q A;  3UUM A;  1IZN B;  4NUU A;  1HCI A;  3RC3 A;  4CI3 B;  3KBT A;  2W0G A;  2D0T A;  4Z8X A;  3N9L A;  3AA1 B;  2D2S A;  4PFO A;  5BMV E;  5EK3 A;  4DMV A;  2V26 A;  4WNK A;  1WR6 A;  2ZMA A;  3NRY A;  4EYU A;  2KND A;  5L2L A;  1D0Z A;  1MMA A;  2WMN A;  3LBX A;  2LT3 A;  3CX8 B;  2DI4 A;  1E1H B;  5HXC A;  3NRX A;  3U78 A;  2VWA A;  2YU1 A;  2XAG B;  4AKL A;  4QXC B;  2JJ9 A;  2LSI A;  3C4X A;  2V7I A;  2ES0 A;  2WAU A;  5FXW A;  2Z6E A;  3RYI E;  2E9X B;  5JDL A;  1CUN A;  4IE6 A;  3N9N A;  4PJL A;  5JDN A;  2IW5 B;  4QX7 B;  5HXE A;  2PFV A;  2DWG A;  4UF0 A;  4OYK A;  5JR9 A;  4OK0 A;  3IHR A;  4AKI A;  3GN5 B;  3FBZ A;  5LHI B;  2LHR A;  4TZ4 C;  5CA1 E;  5JRE A;  4CZZ B;  4IIJ E;  1EZ3 A;  4CXY A;  4E7Z A;  1HF8 A;  4C90 A;  1LVK A;  1VOM A;  3OBV E;  2Y48 B;  3KV6 A;  3UTK A;  4PJM A;  3N2O A;  2CA5 A;  4YJ3 E;  4AKH A;  2LSJ A;  3AB3 B;  1MIY A;  4JLE A;  4ERR A;  3F31 A;  3IEE A;  3W15 B;  2UXN B;  3ESL A;  3UUN A;  3I0Q A;  3ZCI A;  3UUL A;  1MMN A;  1UCU A;  3CWZ B;  3EVY A;  3EDV A;  3HL6 A;  2YIN A;  5JRC A;  4UIG A;  5J1G A;  5JVD E;  3DTO A;  4TV8 E;  5ETW A;  2JMH A;  1ZHC A;  3QC9 A;  5IYZ E;  2B1E A;  4HE8 A;  2D0U A;  2X66 A;  2WBL A;  4G2A A;  2W62 A;  3IF8 B;  3JC6 D;  2PG8 A;  5FP3 A;  2W61 A;  3AAA B;  3B57 A;  3ONX A;  4KP3 C;  5FNV E;  3K3Q C;  2ZM8 A;  4XBF B;  2HPL A;  3SWH A;  4H63 H;  3C51 A;  4MFR A;  4PJJ A;  1U4Q A;  4ZI2 C;  5C8Y E;  2QA7 A;  2D5U A;  3BQL A;  4N78 D;  3R84 B;  3DP7 A;  3F57 A;  3ZMS B;  3AA7 B;  3I9W A;  3SRZ A;  1KNZ A;  2LEH A;  3BK9 A;  5JDF A;  2ZLY A;  1Y64 B;  3LG7 A;  4JEU B;  1LRZ A;  1X79 A;  3HI2 A;  4FJO A;  5FY1 A;  4PK4 A;  1OWA A;  2ACX A;  2JQQ A;  4H9P C;  4PJN A;  4ZHQ E;  3O9X A;  4O8S A;  3R6N A;  3UUX B;  4EZH A;  2K5B B;  3V5U A;  2QGS A;  2NW9 A;  2LJL A;  4YFS A;  2JMK A;  3ZN1 B;  3LK3 B;  4PAG A;  4MBQ A;  2CM0 A;  2LHN A;  3K3N A;  2H3R A;  3ZYL A;  3LJC A;  1HFA A;  2X0L B;  2X67 A;  4BA9 A;  1IJ6 A;  5F3J A;  3U3I A;  3QK6 A;  4AXP A;  3P8C D;  1ZEE A;  5JQG E;  2DNX A;  3FBL A;  3HKC E;  5KDM C;  4AKR B;  3UFE A;  5LHH B;  3PU8 A;  1US7 B;  3D0T A;  2ZM0 A;  2ZM2 A;  3FB2 A;  4B6X A;  5DJQ C;  5M4Y A;  3Q9D A;  4BAY B;  1AJ3 A;  4PK6 A;  4GIW A;  3WI3 A;  5FMN A;  2NOX A;  2LOP A;  4GK0 E;  4ZOL E;  4XAX B;  2XAJ B;  1MND A;  2MTQ A;  3VHL A;  3HKD E;  2MYS A;  3HR0 A;  5JR9 C;  3VKH A;  4ZI3 C;  5LJM A;  3MKD A;  2H7V C;  2Q9Q C;  4IGU A;  4UF0 B;  3K8P C;  5FY0 A;  3RPU A;  2XAQ B;  5JR9 B;  5LGN B;  2YEV C;  2W00 A;  4KUM B;  5LGU B;  3ZMU B;  3KVB A;  2Q9Q B;  5LXT E;  2NP9 A;  3E22 E;  3RX6 A;  1FEW A;  3RYC E;  2WMO A;  4JUY A;  1B7T A;  4MLK A;  2VK9 A;  4O2A E;  5LA6 E;  4ANJ A;  2A2F X;  4EYY R;  4M1P A;  1LKX A;  3AAI A;  2KIN B;  1U5P A;  3KIN B;  1BR0 A;  3KV5 A;  4H9N C;  5L3E B;  1FMW A;  1O3X A;  3CPZ A;  1LVF A;  5JDG A;  5L3B B;  3OYX A;  1QUU A;  2X9Y A;  2MOZ A;  1QSD A;  2CXD A;  4YJ2 E;  4MAL A;  3C50 A;  4AKG A;  4OYJ A;  2A3D A;  3MK7 C;  3ZMV B;  2NW7 A;  3DJB A;  1HG2 A;  3NZQ A;  4PFP A;  3J7Y q;  2UXX B;  4DO0 A;  1WRD A;  5HWY A;  3RC8 A;  3PTR B;  4L5G A;  4EOZ B;  5TAO A;  2E9X D;  1MIW A;  3ZC1 A;  1MMD A;  1ZV4 X;  4EZ4 A;  5IHY A;  5L3C B;  2KXP B;  3MJX A;  1SHZ C;  2L8K A;  5CA0 E;  3A5X A;  3N9M A;  5KMG P;  3Q5W A;  3MA9 A;  2LSK A;  4XZC A;  3PU3 A;  5FXV A;  3KVA A;  2X51 A;  2WWU A;  2LE8 A;  2X9H A;  4WBN E;  2DHR A;  4YLH A;  3JC6 C;  4ZS3 A;  2XHE B;  3GA8 A;  2E9X A;  4UVC B;  5FXX A;  4NUV A;  1FIO A;  2RP4 A;  2XQY A;  3EDU A;  4I43 B;  4U74 A;  5LOV E;  1D1A A;  2NTY A;  4CI1 B;  3MXZ A;  4I50 E;  3HKE E;  3ZPO A;  3CVR A;  2WSS V;  4JEH B;  2NTX A;  3WAK A;  3PUG A;  1G73 A;  3WAJ A;  3N9P A;  4ILU A;  2KWI B;  4GYS A;  3ETU A;  3E08 A;  4ZS2 A;  3AA6 B;  3BQK A;  3CQC B;  1UX5 A;  2N1G A;  2CXL A;  1D1C A;  2KLQ A;  2X9W A;  2VKO A;  3NBX X;  2LM9 A;  4BJN A;  1HTJ F;  2MBG A;  1YKE B;  4IST A;  3GMI A;  1MIV A;  3C4W A;  2LOS A;  3ZMZ B;  4WBO A;  3PUA A;  3OKQ A;  5JH7 E;  4QKN A;  3QUJ A;  5KX5 E;  5L3F B;  2V7L A;  2NWB A;  3C98 B;  3N2K E;  4AQF A;  5AFU L;  4H9R C;  2E8I A;  3F2E A;  2KZ7 B;  3I1A A;  4OHF A;  4GOU A;  4I4T E;  3ETV A;  3LK4 2;  5H6Q B;  4TX5 A;  3ZLI A;  2L3L A;  3ZN0 B;  4ISS A;  1OXZ A;  4ASK A;  4L9I A;  5LJN A;  5ADX L;  3MAC A;  2EHO D;  4HTE A;  1YKH B;  1BR1 A;  3I9Y A;  4TUY E;  3T8O A;  4GYR A;  4HGA A;  2NW8 A;  4IDZ A;  5LBM A;  2RA1 A;  2CWY A;  3K3O A;  5HXR A;  4IHJ E;  4EB6 E;  4K0U A;  2EHO A;  3FXD B;  3NZP A;  3B13 A;  3LBX B;  4UV8 B;  3J9X 1;  2C5I T;  3RRC A;  5FXZ A;  4O4J E;  3CQX C;  4I55 E;  2H7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...