3EDVA

Crystal structure of repeats 14-16 of beta2-spectrin
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
322
structure length
322
Chain Sequence
SHMRHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spectrin beta chain, brain 1
publication title Localization and Structure of the Ankyrin-binding Site on beta2-Spectrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 156
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA01
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA02
1WLXA 3EDVA 1HCIA 5J1GA 1QUUA 3PE0A 3UUMA 1OWAA 1S35A 3FB2A 3LBXB 2ODUA 3UULA 1U4QA 1AJ3A 1G8XA 3PDYA 1U5PA 3R6NA 3KBTA 3F31A 3UUNA 3EDUA 2IAKA 3F57A 3LBXA 3KBUA 2ODVA 2SPCA 1CUNA
chains in the Genus database with same CATH superfamily
4YTPA 2LSYA 3O9XA 4AQFA 3LK2B 3JC6D 1YXRA 4ISSA 4ILAA 5LHGB 4ZXLA 2X0YA 3LBXA 4O4HE 5FL0A 3AAAB 3HKEE 2WQYA 4DR1T 5IHYA 4ZEYA 4O2AE 3ETUA 2J1DG 4EYUA 5TAOA 4ZI7E 4TN7B 5DABA 5FMNA 2WDRA 4YJ3E 4ILBA 1XZYA 1D0XA 4DMVA 4PK6A 2DWKA 5JDHA 4YFSA 3I9WA 4AKIA 2Q9QC 3PUSA 3O1HA 3JCFA 3N9PA 3ZPOA 3VHLA 3UT5E 4YTNA 4NPPA 2CXDA 5FY0A 1B7TA 5JREA 3I0QA 4DR6T 1YQ3A 4U33A 3ZKRA 4DV4T 3AEBA 3D0TA 1IBKT 4PFPA 2LHRA 2LRKA 4O4LE 3ZLIA 4I50E 4CI3B 3L09A 4H9OC 2HH7A 5HCJA 1SE7A 4UR9A 4QHOA 1NENA 2CM0A 5HEJA 1N33T 2WWUA 1US7B 4DUYT 2C5IT 3ZJ1A 5JDMA 5LHHB 4JI5T 4UEMA 3O1IA 4MHCA 4TV8E 1HX1B 2CWYA 2FJDA 2XAGB 3OYZA 4HFIA 1T7SA 4I55E 2ACZA 4DMWA 1MNDA 2DLRA 5EZYE 3HI2A 3UFEA 5FL1A 1N36T 2KWIB 3FZKB 1FMVA 5LGTB 4I0UA 4EZ4A 4O4JE 3AEEA 4IREA 1HCIA 1IBMT 4C91A 4LF9T 2GK9A 3KFWX 1ZV4X 3N2OA 5AQTB 4JI2T 2Q9QD 3ABVA 3ZSTA 4DBRA 2KINB 3UU3A 4GKKT 3ZSSA 2UXBT 4QXHB 2CCQA 5BR8T 1WRDA 1D1AA 4KUMB 2V5CA 3CPZA 3A7MA 3TKLB 2DL1A 4YSZA 4G63A 4WNKA 2YDQA 5LB7B 3C4ZA 2XQ7A 3FZMB 3KBUA 2V8SV 5JDNA 5L3GB 4QH1A 5AQRB 4PK4A 2ES0A 4BAYB 2IDOB 3QB5K 3I0OA 3UU5A 4H9NC 2JPFA 3U78A 2NW7A 2BVMA 2L3LA 2D9DA 4UV8B 4WBNE 1Z0PA 5AQMB 3RGLA 4LF4T 2V26A 1M7KA 4YTMA 2XQYA 3V5UA 3IHRA 3KINB 4PK5A 4DV2T 4LFCT 5L4EA 3L39A 2MAWA 3NBXX 4HE8A 3GWHA 4YHJA 4H63V 1XNRT 1XWMA 4BJNA 1J5WA 4LFBT 3FXEB 2BBHA 4UF0A 2ZM0A 4G2AA 2BVLA 4ZI3C 2HPLA 4CXXA 2CLYC 2WWVA 5LMNT 2W00A 4EYYR 1D1CA 2LT3A 3CIRA 2HPJA 1GQEA 3BQKA 2XSAA 2YKSA 4X65T 2LKHA 2CPTA 5JQGE 5CB4E 2VURA 3AE1A 4TNWA 5EK4A 1UURA 3WAJA 3AE5A 4QXCB 2XQ8A 4WZXA 4GKJT 1VCTA 4B3ST 2XQ5A 3OTOT 3OYXA 5C2TA 3NRXA 3MA9A 4UV9B 3PV0F 3QOFA 5HEGA 3TLUA 3CVRA 3AEFA 4ZZBA 3VR8A 2NWBA 4AKRB 1OWAA 4L0RA 4AIUA 2WU5A 5JR9A 3QB5A 3FHNA 1OEDC 2BKPA 4IE0A 4HKAA 4XAXB 2LOPA 5FY1A 4FJOA 4IDNA 2XSBA 1BR1A 5EK2A 4KHPT 1W0BA 3H37A 4U2YA 2LLYA 5IYZE 3PJAJ 2FJBA 2H7VC 3P50A 3AECA 1X79A 3UUMA 3FB2A 4U7YA 3KVBA 1SUMB 4NUVA 2FJEA 3CQGB 1O3XA 3MKDA 4ZI3D 2PJQA 3ZN0B 4IE7A 4UELA 2LKGA 1YKHB 3LDQB 5LGNB 3N2KE 5FXZA 4JLEA 5L3FB 3AEDA 3UU4A 2CE7A 3PTRB 5F8PA 4DV0T 4B3MT 1G8XA 3AE3A 4YXDA 2PFVA 3IA3A 4U31A 3CKDA 3B5MA 2LEHA 5LMUT 4LF8T 4YHHT 2E9XA 1WYCA 4TWFA 1Y64B 1XMQT 3UUXB 4GK0E 2CLYB 5L47A 4A97A 5LJMA 3F57A 3PJAA 3RYCE 4A5XA 1M62A 3EDVA 5HXSA 4HEAA 3KV6A 2W0GA 1NAFA 5J2TE 2X68A 3PUZF 3HA4A 3RYFE 3VRBA 5LHIB 2V7MA 1WFDA 4IL4A 2K9AA 4UF0B 2HHHT 3WI3A 5JRCA 4DR2T 5LYJE 4AXPA 2KMFA 5DQWA 2E8IA 4ZI2C 2J62A 3K3OA 5LXTE 3P7IA 3C50A 3FZHB 5HXHA 1XMOT 3P4PA 3M3ZB 3RIUC 5HWXA 2WDQA 1OEDB 4EB6E 3CWZB 1I6ZA 1ZOYA 2VWAA 3HL6A 1JNRA 4JI6T 4HWCA 5C3JA 2YEVC 3EHZA 4OHFA 2Y48B 3VRAA 4AISA 3LFMA 2W2UA 2XQ6A 4CQIA 1ZP0A 4ZZCA 3RYIE 3A8YC 2CBJA 1D0YA 3RI5A 3RIFA 4KHZF 4QKNA 4B3TT 5HXCA 3C98B 2LSIA 4U2ZA 2UU9T 3M65A 2H3RA 5LOVE 5L3BB 3AAEB 3AXJB 3H3MA 4GYSA 3CX8B 2KXPB 2PG8A 5CJ5A 2UXCT 4HN9A 3SOLA 3LSVA 1KEYA 4LF7T 3O1JA 4TZ4C 4PAGA 4GK5E 2MTQA 1D1BA 5FNVE 4FI5A 4ASKA 4JI4T 2BZBA 2KZ7B 3VR9A 2MBGA 4EIWA 2KNDA 2JMKA 4ZI2D 1FJGT 4HGAA 2XAFB 3LK3B 5AQUB 2H7OA 2CEAA 1N34T 1ZHCA 2VL0A 2XQ9A 2XJ7A 3J7Yq 2WBLA 4AQFC 1ZEEA 3ZMZB 4KMCA 2LOSA 2A3DA 3ZMVB 3AA7B 4JUYA 2UXDT 4EEDA 3R6NA 2BG9A 2E9XB 4KX6A 2X66A 3UQ4A 1WR6A 5AQFB 3HKBE 1HS7A 5L2LA 3PU3A 1IBLT 5L3CB 5AQSB 3HR0A 3PUWF 3QC9A 3OVUA 1XNQT 5AQIB 5KMGP 1J5ET 4P1NA 2B1EA 2CXFA 4IT4A 3IF8B 2W67A 2IC6A 2NR4A 4HFHA 4N78D 2W66A 4NUUA 1FEWA 4IDPA 3IEEA 3W15B 2HN2A 5F3JA 4IDQA 4IHJE 3PURA 2I0MA 1HF8A 3E08A 3C4WA 3FXDB 5ETWA 3C64A 4YSXA 2VVSA 3V5SA 1WCRA 3PUQA 2LHNA 5JRCB 2C0SA 2M6BA 4H9SE 3OPCA 2RA1A 2DNXA 4TWHA 2DI4A 2V5DA 4P0AA 2QVAA 2LSGA 4BJMA 2XTLA 4UVAB 3F2EA 2EHOA 1E2AA 5AQLB 3F31A 3N9MA 2OA5A 2BKNA 2WS3A 1MMAA 5IWAT 4WBOA 3FZLB 4XBFB 2V1DB 1I94T 4EXTA 2B76A 1NEKA 3EUHA 3JADA 1IAPA 1YQ4A 2X9XA 2NP9A 3JAEA 4O2BE 3GA8A 5LBQB 4PW8A 1EZ3A 3A5XA 3ZC1A 5CGMA 2YN6A 2KWHA 2VKDA 5FXVA 1ZKEA 1FIOA 5A1LA 2XQ3A 4PNIA 4B3RT 5ABFA 4LMKA 3AA0B 2V7IA 4JYAT 5IUXA 3MZKB 3T8OA 1R8IA 4MALA 3LBXB 1IJ6A 2YK0A 4TWDA 4AI6A 4ILCA 2W62A 5AQQB 1OXZA 2WZHA 4ANJA 4QX7B 3FBLA 4CXYA 3QK6A 4TV9E 2KSRA 3ONJA 1HFAA 4X1IE 1UUSA 2YU2A 2D5UA 5JDQA 3NVOA 4NIQA 1KNRA 3CX6B 3ZYLA 3J9X1 2JMHA 2C5JA 5LG3A 4I4TE 1N32T 1WLXA 2VQFT 2BG9B 4ERRA 4HFBA 3ZT6A 4A56A 1U4QA 4P09A 3MJXA 1J1JA 2XM2A 4EZHA 4DVDA 5HXEA 4F6RC 1YD8G 3DJBA 3ZYKA 3UQ7A 2QGSA 3P8CD 2AXDS 3C51A 4MBQA 2QRXA 4EEBA 3BQIA 4CN4A 3B13A 3N9NA 1MMDA 2X51A 5AQHB 3Q9DA 5EK3A 4JI1T 1CHUA 2Z6EA 4YSYA 3N2GE 3UU6A 4QXBB 3KV4A 2QYWA 2XASB 2XAHB 2XHEB 2A2FX 4YJ2E 2NTYA 2XAJB 1UGOA 3EABA 2EHOB 3L8RA 3N9OA 2NTXA 4JI3T 4U74A 1UX4A 4UXNB 2LM2A 2C5KT 1SHZC 2CHOA 3IBPA 5DQVA 2ZM6T 4NXNT 1G73A 5LNKA 2YDRA 2XM1A 2ZMAA 2JQQA 5FXXA 4AKHA 4ZHQE 3ZCIA 3PUAA 2LSJA 3UU8A 3Q5DA 1W0AA 5LBMA 2CA5A 3K1SA 1MMNA 3CQCB 4JV5T 1VOMA 4OK0A 3ANWA 3QNUA 1DU2A 2V6YA 4YY3T 2XAQB 5J0ZA 5JR9C 5LGUB 2UXXB 4IE4A 5AQJB 4BA9A 5ABFB 2H89A 5HEOA 4QH5A 4AKGA 1YW0A 2XY8B 3EI0A 2E5VA 3N9QA 2ZM2A 4JI0T 4AQYT 2NW9A 4UVCB 2V7KA 4V1Av 1KNPA 2X9YA 2VKJA 1QLBA 4F8HA 4PFOA 3OKQA 5ADXL 2IW5B 5L3DB 3KVAA 3P4SA 2NOXA 2ACXA 4PJMA 2BS2A 3KV9A 3P4WA 1H7CA 4YLHA 2J4GA 2R6GF 4P0BA 1WR0A 4PJNA 2XUEA 3RKOA 1LRZA 2FUPA 4OYKA 2JIWA 2XQAA 3P4QA 4E7SA 2VKHA 3RRWA 3ESLA 1QSDA 4HWHA 2X0LB 3EDUA 4HTEA 2CHNA 5M4YA 2E9XC 2X67A 3MACA 2CXLA 3P4RA 4IGUA 2V7JA 3QUJA 3CX7B 2LSKA 1LKXA 4DNDA 3AB3B 2MOZA 4WYVA 3FZFB 5AQKB 4J2CA 3AA1B 4KP3C 3PUGA 3RC3A 1MIYA 3ZEFB 2X0HA 1HNWT 4DR7T 3TLVA 3LK42 2L8KA 5HYAA 2L9QA 2PTFA 3OJAA 2UUCT 4JBWF 2XZEA 4K0KT 2A9UA 4DO0A 1E1HB 4DR5T 3Q2MA 4HWIB 1MNEA 3RKGA 2A72A 2VK9A 2WM9A 5HEUA 2QA7A 5JR9B 4ADZA 3O4XE 2UXNB 3DTOA 4OFZA 4KI0F 3EAMA 3TLSA 4EAHA 3GMIA 4LF6T 3PU8A 4COFA 5FXWA 2MPKA 4YT0A 2XQ4A 3AEAA 3EVYA 1W09A 4EOZB 2OV9A 4IE6A 3S4UA 2DCFA 2SPCA 2E9XD 1JNZA 4K0UA 4DIDB 2W61A 3K3NA 3ONLC 3ANWB 5KX5E 3Q5WA 3RH3A 2V6YB 2Q9QA 3ZMTB 2VL8A 4OX9T 1T72A 2RPAA 4EV6A 1L0VA 2WMOA 4TX5A 2ODVA 5L3EB 3PUVF 3RYHE 2I59A 3LG7A 3H3AA 2H88A 1YKEB 2Y6XA 4H9QC 4DR3T 2ODUA 1BR2A 2E5LT 4ZOLE 1HX8A 3KV5A 2J47A 4B6XA 4Z90A 2V6XA 1HG2A 1T98A 5ABGA 4LFAT 4NXMT 1OEDE 3N5LA 5ABEA 4WW0A 5H6RB 4X5TA 2YU1A 5F5WA 3TLWA 2VQET 1HG5A 2BG9C 3TLTA 3AVRA 3JAFA 5FVLA 5KXJA 2AE9A 2VB6A 2JQHA 5LP6E 1HNZT 2N9DA 3MK7C 3HKDE 1MIVA 4LMJA 1HNXT 4HFEA 3T1YT 1NWMX 2YDSA 3ZMSB 4HWFA 5JTGA 4MFRA 5LG4A 3ZMUB 2CMRA 2WDVA 2YOEA 3N9LA 3PE0A 3T1HT 3AE4A 3VKGA 4Z91A 2X9WA 1VCSA 5CA1E 2D0UA 1VRBA 2MYSA 1Z8UA 1IZNB 3PUYF 1IJ5A 4XZCA 4X62T 2KT9A 2KLQA 3GN5A 4IDOA 3I9YA 5CFBA 5ABHA 3VU7H 1LVKA 3NWIA 4L9IA 1UCUA 2EHOC 3L3PA 2DWGA 1KK7A 4CZZB 1BR4A 2V7LA 5J2UE 3I1AA 3RC8A 3BQLA 4HFDA 4IIJE 4ZS2A 4QH4A 1E7PA 4TUYE 5FKYA 5AQNB 4A98A 2UUBT 4KBMB 4M1PA 2K48A 2Q9QB 2IAKA 3K3QC 3B57A 2G0UA 3BK9A 4ISTA 2I6HA 3X1DA 5HCMA 1W9RA 3PUXF 2CWOA 5JDLA 3RIAA 3Q5EA 3VKHA 5FY7A 5LA6E 5GONE 4L5GA 2FBWA 3U3IA 3LJCA 3ZC0A 3WAKA 5HEHA 4X1YE 5E0OA 4HWDA 4DV6T 4OYJA 2BS3A 1HTJF 5FVKA 4IDZA 5FYMA 5JDGA 4JEHB 2WAUA 5HWYA 2WY2A 3AVSA 4X66T 2WU2A 4X64T 3DP7A 2IMLA 3ZN1B 4E7ZA 1FMWA 2EHOD 2FJAA 4UIGA 2WSSV 1XDOA 2HN1A 4CI1B 2UUAT 3SRZA 3AE8A 4GIWA 3FBZA 4IE5A 2CRBA 1T8BA 5AQGB 4AKLA 2X9HA 1V9DA 4CN1A 4MLKA 1CUNA 2JQ9A 1HR0T 3ZT5A 3HKCE 4DUZT 2PBIA 3Q5XA 5AFUL 3UULA 4U72A 2K3WA 3ZCJA 3KBTA 3UTKA 1OEDA 4ILUA 5BMVE 4H9PC 3MXZA 2CBIA 2WCAA 1BR0A 2BS4A 4JEUB 1QUUA 4LF5T 4UVBB 1UX5A 4O4IE 3SFDA 1D0ZA 4X1KE 3NZPA 5L4HA 1AJ3A 2P9BA 2IHR1 2LE8A 2D0TA 5FP3A 4DV3T 3NRYA 4HFCA 4PJJA 3CQXC 2M6IA 2VKOA 2RP4A 4I43B 5H6QB 3GN5B 4C90A 3AXJA 5JH7E 1S94A 2WB5A 3SFEA 2N1GA 4H63H 3SWHA 4AQGA 3ZYMA 4DV1T 4QX8B 3RX6A 3SS1A 3AE6A 1KFYA 1MMGA 5HXRA 4X20E 3RPUA 2K24A 3E22E 3G06A 4DBQA 2BG9E 3AEGA 5LCYA 1LVFA 1KNZA 2F4VT 5JVDE 3E0ZA 3R84B 4EGWA 3RHWA 5CA0E 5J1GA 1S35A 2W4XA 4Z8XA 1MIWA 2JJ9A 4IL9A 3RQUA 1UK5A 3PDYA 4LMLA 4CI2B 3OBVE 2BDEA 2IIUA 3ONXA 4JI7T 2WMNA 4DV7T 3RQWA 4GOUA 3K8PC 5JDFA 4CXWA 2Y8DA 4HFVA 1WYBA 5AQVB 4DV5T 3CK6A 2ZLYA 4Q25A 2VASA 2JRKA 5DJQC 4CN6A 3RIUA 2LRLA 3AAIA 2BKOA 3JC6C 3AE2A 2M67A 2D2SA 4H9RC 3RRCA 4O8SA 2E2AA 2WZIA 2BBJA 4DR4T 2LJLA 4TNVA 2W63A 2YINA 5LJNA 1XDPA 3ZJ2A 4JI8T 2K5BB 2N2NA 2LM9A 2WP9A 3KDSE 3AE9A 1Y01A 3C4XA 3NZQA 4U7IA 1SA0E 5AQOB 3UFGA 5KDMC 4ZS3A 3CMLA 5C8YE 2NW8A 3ETVA 3RF1A 1X9BA 4GYRA 2IC9A 5HAXA 4U3CA 2DHRA 4QWNB 2OLTA 3AE7A 3NKZA 2XPKA 4PJLA 3RLFF 1U5PA 2ZM8A 3UUNA 3UUBA 2JQKA 3ZT7A 5AQPB 1KF6A 2VVNA 3AA6B 2IUBA
chains in the Genus database with same CATH topology
1YD8G 3DJBA 3ZYKA 2QGSA 3N9LA 3P8CD 3C51A 4MBQA 2LSYA 3PE0A 3O9XA 2E9XA 1WYCA 3BQIA 3VKGA 2X9WA 4AQFA 3LK2B 5CA1E 3B13A 2D0UA 3JC6D 1Y64B 3N9NA 1MMDA 2X51A 3Q9DA 5EK3A 3UUXB 1VRBA 2MYSA 4ISSA 1IZNB 5LHGB 1IJ5A 4XZCA 4GK0E 2CLYB 2KT9A 2KLQA 5LJMA 3F57A 3GN5A 3LBXA 4O4HE 2Z6EA 3AAAB 3N2GE 3HKEE 3I9YA 3RYCE 5IHYA 4QXBB 3VU7H 3EDVA 3KV4A 4O2AE 5HXSA 1LVKA 3ETUA 2J1DG 4HEAA 4EYUA 4L9IA 1UCUA 2EHOC 3L3PA 2DWGA 1KK7A 5TAOA 3KV6A 2W0GA 1NAFA 2XASB 4ZI7E 2XAHB 2CMRA 5J2TE 4TN7B 5DABA 4CZZB 2X68A 5FMNA 3HA4A 3RYFE 1BR4A 2XHEB 2A2FX 2V7LA 4YJ2E 2NTYA 5LHIB 2V7MA 2XAJB 4YJ3E 5J2UE 3I1AA 3RC8A 3BQLA 1D0XA 4IIJE 4DMVA 2EHOB 2K9AA 2DWKA 4PK6A 4ZS2A 4UF0B 3N9OA 5JDHA 2NTXA 4YFSA 3I9WA 4AKIA 2Q9QC 3WI3A 3PUSA 3O1HA 4U74A 1UX4A 4UXNB 3N9PA 5JRCA 4TUYE 3ZPOA 5LYJE 3VHLA 3UT5E 2C5KT 1SHZC 4AXPA 2KMFA 3IBPA 5DQVA 5DQWA 2E8IA 4ZI2C 1G73A 3K3OA 4KBMB 5LNKA 4M1PA 3P7IA 2CXDA 5LXTE 5FY0A 2K48A 2Q9QB 1B7TA 2IAKA 5JREA 2ZMAA 2JQQA 3C50A 3B57A 3I0QA 3K3QC 5FXXA 2G0UA 5HXHA 4AKHA 3BK9A 4ZHQE 3ZCIA 3PUAA 4ISTA 2LSJA 3D0TA 5HWXA 4PFPA 2CWOA 2LHRA 4EB6E 4O4LE 3ZLIA 5LBMA 3CWZB 4I50E 5JDLA 4CI3B 3L09A 4H9OC 3VKHA 2CA5A 2HH7A 5FY7A 5LA6E 1MMNA 3CQCB 3HL6A 2VWAA 5GONE 4L5GA 4QHOA 2YEVC 4OHFA 2CM0A 1VOMA 2WWUA 2Y48B 4OK0A 1US7B 3U3IA 3ANWA 2C5IT 3ZJ1A 5JDMA 5LHHB 3LFMA 4CQIA 3LJCA 4UEMA 3ZC0A 3O1IA 2XAQB 4MHCA 3WAKA 5JR9C 4TV8E 2CWYA 2XAGB 3OYZA 3RYIE 4I55E 4DMWA 4X1YE 5E0OA 5LGUB 2UXXB 1D0YA 1MNDA 4IE4A 2DLRA 4OYJA 4QKNA 5EZYE 4BA9A 5HXCA 1HTJF 3C98B 2LSIA 4IDZA 3HI2A 4AKGA 1YW0A 5FYMA 3UFEA 3M65A 2H3RA 3N9QA 5JDGA 5LOVE 4JEHB 2WAUA 5L3BB 2KWIB 5HWYA 3AVSA 2ZM2A 3AAEB 1FMVA 4GYSA 2NW9A 3CX8B 2KXPB 2V7KA 3DP7A 4UVCB 4V1Av 3ZN1B 5LGTB 2X9YA 4E7ZA 2PG8A 1FMWA 4EZ4A 2VKJA 2EHOD 4O4JE 4PFOA 3OKQA 4UIGA 4HN9A 1HCIA 5ADXL 2IW5B 2WSSV 4C91A 5L3DB 3SOLA 3KVAA 4CI1B 2GK9A 2NOXA 3SRZA 2ACXA 4PJMA 3O1JA 4GIWA 3FBZA 4IE5A 4TZ4C 3KV9A 1H7CA 4AKLA 3KFWX 4YLHA 1ZV4X 4P0BA 4PAGA 3N2OA 4GK5E 2X9HA 2MTQA 1V9DA 4MLKA 1D1BA 1CUNA 2XUEA 4PJNA 5FNVE 3RKOA 2Q9QD 4FI5A 4ASKA 4DBRA 3HKCE 2KINB 1LRZA 2PBIA 4OYKA 2BZBA 2KZ7B 3Q5XA 4EIWA 2MBGA 5AFUL 4E7SA 2KNDA 2JMKA 4QXHB 3UULA 2VKHA 2CCQA 4HGAA 2XAFB 4U72A 3RRWA 3ESLA 3LK3B 3ZCJA 1WRDA 1QSDA 1D1AA 3KBTA 2X0LB 4KUMB 3UTKA 3EDUA 4HTEA 4ILUA 5BMVE 4H9PC 2H7OA 5M4YA 2CEAA 1ZHCA 3MXZA 3J7Yq 2E9XC 2WBLA 2X67A 3CPZA 3MACA 1BR0A 2CXLA 3TKLB 4AQFC 4IGUA 2V7JA 4JEUB 3QUJA 1QUUA 1ZEEA 3CX7B 4G63A 3ZMZB 4KMCA 4UVBB 1UX5A 2LOSA 2A3DA 4O4IE 2LSKA 1LKXA 3AA7B 1D0ZA 4WNKA 3ZMVB 4X1KE 4DNDA 4JUYA 3AB3B 2MOZA 3NZPA 1AJ3A 2P9BA 3C4ZA 3R6NA 2LE8A 2E9XB 2D0TA 5FP3A 3NRYA 2X66A 4J2CA 1WR6A 3AA1B 3KBUA 3HKBE 1HS7A 5L2LA 4PJJA 3CQXC 5JDNA 3PU3A 5L3GB 5L3CB 2VKOA 2RP4A 3HR0A 4KP3C 3PUGA 4PK4A 3QC9A 3RC3A 4I43B 5H6QB 3GN5B 2ES0A 4C90A 4BAYB 1MIYA 3ZEFB 3I0OA 5KMGP 5JH7E 1S94A 4H9NC 2B1EA 2JPFA 3LK42 2N1GA 2CXFA 2L8KA 4H63H 3IF8B 3U78A 2IC6A 2NW7A 5HYAA 3SWHA 4N78D 4NUUA 2BVMA 1FEWA 2L9QA 4AQGA 3ZYMA 3OJAA 3IEEA 3W15B 5F3JA 2L3LA 4UV8B 4QX8B 3RX6A 4WBNE 1Z0PA 3SS1A 4IHJE 1MMGA 5HXRA 4DO0A 3PURA 1E1HB 1HF8A 3E08A 3C4WA 3FXDB 4X20E 5ETWA 3RPUA 3C64A 2V26A 2K24A 3Q2MA 3E22E 4DBQA 3V5SA 3PUQA 2LHNA 1MNEA 5LCYA 1LVFA 2A72A 2XQYA 2VK9A 1KNZA 2C0SA 5JRCB 2WM9A 3V5UA 5JVDE 2QA7A 3IHRA 3KINB 5JR9B 4PK5A 3E0ZA 2UXNB 3O4XE 3DTOA 4H9SE 4ADZA 4OFZA 2RA1A 2DNXA 3R84B 2DI4A 4EAHA 3GMIA 5CA0E 4P0AA 5J1GA 3NBXX 2LSGA 3PU8A 4HE8A 1S35A 4BJMA 2XTLA 5FXWA 4Z8XA 4UVAB 1MIWA 3GWHA 4YHJA 2JJ9A 4H63V 4BJNA 3F2EA 2EHOA 3FXEB 4UF0A 3PDYA 2ZM0A 4G2AA 2BVLA 3EVYA 3F31A 4EOZB 4IE6A 4ZI3C 4CI2B 3N9MA 2HPLA 3S4UA 2DCFA 2OA5A 2E9XD 2SPCA 3OBVE 1MMAA 4K0UA 4CXXA 2CLYC 2W61A 4WBOA 2BDEA 3K3NA 3ONXA 3ANWB 2W00A 4XBFB 5KX5E 2WMNA 2V1DB 3Q5WA 3RH3A 4GOUA 4EYYR 3K8PC 1D1CA 4EXTA 2LT3A 2Q9QA 3ZMTB 2VL8A 5JDFA 4CXWA 2Y8DA 3EUHA 2HPJA 1IAPA 4HFVA 1WYBA 3BQKA 2X9XA 2WMOA 4TX5A 2ODVA 2NP9A 4O2BE 5JQGE 3GA8A 5CB4E 5LBQB 4PW8A 1EZ3A 5EK4A 5L3EB 2ZLYA 3A5XA 3RYHE 2I59A 3WAJA 2VASA 3LG7A 3H3AA 2JRKA 4QXCB 5DJQC 3ZC1A 1YKEB 2Y6XA 2KWHA 2VKDA 3AAIA 4H9QC 5FXVA 2ODUA 1ZKEA 1FIOA 1BR2A 3JC6C 3OYXA 3NRXA 4ZOLE 3MA9A 2M67A 5A1LA 2D2SA 1HX8A 4H9RC 3KV5A 4PNIA 4UV9B 4B6XA 3RRCA 4O8SA 3AA0B 2V7IA 3CVRA 4ZI2D 3MZKB 2NWBA 3T8OA 1HG2A 4AKRB 4MALA 1T98A 1OWAA 3LBXB 4L0RA 2LJLA 2W63A 5JR9A 2YINA 1IJ6A 2YK0A 3FHNA 5LJNA 4IE0A 4HKAA 4XAXB 2LOPA 5FY1A 4FJOA 4AI6A 3N5LA 3ZJ2A 2K5BB 2N2NA 2W62A 1OXZA 1BR1A 4WW0A 4ANJA 5EK2A 4QX7B 3FBLA 5H6RB 4CXYA 2LM9A 3QK6A 4TV9E 2YU1A 3H37A 3KDSE 5IYZE 1HFAA 4X1IE 2H7VC 1HG5A 3C4XA 3NZQA 1X79A 3UUMA 3FB2A 1SA0E 5KDMC 2YU2A 2D5UA 4ZS3A 5JDQA 3CMLA 3KVBA 5C8YE 4NUVA 3CQGB 2NW8A 1O3XA 3AVRA 3MKDA 3CX6B 3ETVA 3ZYLA 3J9X1 4ZI3D 2JMHA 2PJQA 2C5JA 2VB6A 5LP6E 3ZN0B 4GYRA 4IE7A 4UELA 1YKHB 2N9DA 4I4TE 1WLXA 3MK7C 5LGNB 2IC9A 3HKDE 3N2KE 1MIVA 5FXZA 4ERRA 4JLEA 5HAXA 5L3FB 2DHRA 4QWNB 2CE7A 3PTRB 5F8PA 4A56A 4PJLA 1NWMX 1U4QA 4P09A 1G8XA 3MJXA 3ZMSB 1U5PA 2ZM8A 3UUNA 4EZHA 2PFVA 4DVDA 5HXEA 3AA6B 3CKDA 4MFRA 4F6RC 5LG4A 3ZMUB 2LEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLX A;  3EDV A;  1HCI A;  5J1G A;  1QUU A;  3PE0 A;  3UUM A;  1OWA A;  1S35 A;  3FB2 A;  3LBX B;  2ODU A;  3UUL A;  1U4Q A;  1AJ3 A;  1G8X A;  3PDY A;  1U5P A;  3R6N A;  3KBT A;  3F31 A;  3UUN A;  3EDU A;  2IAK A;  3F57 A;  3LBX A;  3KBU A;  2ODV A;  2SPC A;  1CUN A; 
#chains in the Genus database with same CATH topology
 4YTP A;  2LSY A;  3O9X A;  4AQF A;  3LK2 B;  3JC6 D;  1YXR A;  4ISS A;  4ILA A;  5LHG B;  4ZXL A;  2X0Y A;  3LBX A;  4O4H E;  5FL0 A;  3AAA B;  3HKE E;  2WQY A;  4DR1 T;  5IHY A;  4ZEY A;  4O2A E;  3ETU A;  2J1D G;  4EYU A;  5TAO A;  4ZI7 E;  4TN7 B;  5DAB A;  5FMN A;  2WDR A;  4YJ3 E;  4ILB A;  1XZY A;  1D0X A;  4DMV A;  4PK6 A;  2DWK A;  5JDH A;  4YFS A;  3I9W A;  4AKI A;  2Q9Q C;  3PUS A;  3O1H A;  3JCF A;  3N9P A;  3ZPO A;  3VHL A;  3UT5 E;  4YTN A;  4NPP A;  2CXD A;  5FY0 A;  1B7T A;  5JRE A;  3I0Q A;  4DR6 T;  1YQ3 A;  4U33 A;  3ZKR A;  4DV4 T;  3AEB A;  3D0T A;  1IBK T;  4PFP A;  2LHR A;  2LRK A;  4O4L E;  3ZLI A;  4I50 E;  4CI3 B;  3L09 A;  4H9O C;  2HH7 A;  5HCJ A;  1SE7 A;  4UR9 A;  4QHO A;  1NEN A;  2CM0 A;  5HEJ A;  1N33 T;  2WWU A;  1US7 B;  4DUY T;  2C5I T;  3ZJ1 A;  5JDM A;  5LHH B;  4JI5 T;  4UEM A;  3O1I A;  4MHC A;  4TV8 E;  1HX1 B;  2CWY A;  2FJD A;  2XAG B;  3OYZ A;  4HFI A;  1T7S A;  4I55 E;  2ACZ A;  4DMW A;  1MND A;  2DLR A;  5EZY E;  3HI2 A;  3UFE A;  5FL1 A;  1N36 T;  2KWI B;  3FZK B;  1FMV A;  5LGT B;  4I0U A;  4EZ4 A;  4O4J E;  3AEE A;  4IRE A;  1HCI A;  1IBM T;  4C91 A;  4LF9 T;  2GK9 A;  3KFW X;  1ZV4 X;  3N2O A;  5AQT B;  4JI2 T;  2Q9Q D;  3ABV A;  3ZST A;  4DBR A;  2KIN B;  3UU3 A;  4GKK T;  3ZSS A;  2UXB T;  4QXH B;  2CCQ A;  5BR8 T;  1WRD A;  1D1A A;  4KUM B;  2V5C A;  3CPZ A;  3A7M A;  3TKL B;  2DL1 A;  4YSZ A;  4G63 A;  4WNK A;  2YDQ A;  5LB7 B;  3C4Z A;  2XQ7 A;  3FZM B;  3KBU A;  2V8S V;  5JDN A;  5L3G B;  4QH1 A;  5AQR B;  4PK4 A;  2ES0 A;  4BAY B;  2IDO B;  3QB5 K;  3I0O A;  3UU5 A;  4H9N C;  2JPF A;  3U78 A;  2NW7 A;  2BVM A;  2L3L A;  2D9D A;  4UV8 B;  4WBN E;  1Z0P A;  5AQM B;  3RGL A;  4LF4 T;  2V26 A;  1M7K A;  4YTM A;  2XQY A;  3V5U A;  3IHR A;  3KIN B;  4PK5 A;  4DV2 T;  4LFC T;  5L4E A;  3L39 A;  2MAW A;  3NBX X;  4HE8 A;  3GWH A;  4YHJ A;  4H63 V;  1XNR T;  1XWM A;  4BJN A;  1J5W A;  4LFB T;  3FXE B;  2BBH A;  4UF0 A;  2ZM0 A;  4G2A A;  2BVL A;  4ZI3 C;  2HPL A;  4CXX A;  2CLY C;  2WWV A;  5LMN T;  2W00 A;  4EYY R;  1D1C A;  2LT3 A;  3CIR A;  2HPJ A;  1GQE A;  3BQK A;  2XSA A;  2YKS A;  4X65 T;  2LKH A;  2CPT A;  5JQG E;  5CB4 E;  2VUR A;  3AE1 A;  4TNW A;  5EK4 A;  1UUR A;  3WAJ A;  3AE5 A;  4QXC B;  2XQ8 A;  4WZX A;  4GKJ T;  1VCT A;  4B3S T;  2XQ5 A;  3OTO T;  3OYX A;  5C2T A;  3NRX A;  3MA9 A;  4UV9 B;  3PV0 F;  3QOF A;  5HEG A;  3TLU A;  3CVR A;  3AEF A;  4ZZB A;  3VR8 A;  2NWB A;  4AKR B;  1OWA A;  4L0R A;  4AIU A;  2WU5 A;  5JR9 A;  3QB5 A;  3FHN A;  1OED C;  2BKP A;  4IE0 A;  4HKA A;  4XAX B;  2LOP A;  5FY1 A;  4FJO A;  4IDN A;  2XSB A;  1BR1 A;  5EK2 A;  4KHP T;  1W0B A;  3H37 A;  4U2Y A;  2LLY A;  5IYZ E;  3PJA J;  2FJB A;  2H7V C;  3P50 A;  3AEC A;  1X79 A;  3UUM A;  3FB2 A;  4U7Y A;  3KVB A;  1SUM B;  4NUV A;  2FJE A;  3CQG B;  1O3X A;  3MKD A;  4ZI3 D;  2PJQ A;  3ZN0 B;  4IE7 A;  4UEL A;  2LKG A;  1YKH B;  3LDQ B;  5LGN B;  3N2K E;  5FXZ A;  4JLE A;  5L3F B;  3AED A;  3UU4 A;  2CE7 A;  3PTR B;  5F8P A;  4DV0 T;  4B3M T;  1G8X A;  3AE3 A;  4YXD A;  2PFV A;  3IA3 A;  4U31 A;  3CKD A;  3B5M A;  2LEH A;  5LMU T;  4LF8 T;  4YHH T;  2E9X A;  1WYC A;  4TWF A;  1Y64 B;  1XMQ T;  3UUX B;  4GK0 E;  2CLY B;  5L47 A;  4A97 A;  5LJM A;  3F57 A;  3PJA A;  3RYC E;  4A5X A;  1M62 A;  3EDV A;  5HXS A;  4HEA A;  3KV6 A;  2W0G A;  1NAF A;  5J2T E;  2X68 A;  3PUZ F;  3HA4 A;  3RYF E;  3VRB A;  5LHI B;  2V7M A;  1WFD A;  4IL4 A;  2K9A A;  4UF0 B;  2HHH T;  3WI3 A;  5JRC A;  4DR2 T;  5LYJ E;  4AXP A;  2KMF A;  5DQW A;  2E8I A;  4ZI2 C;  2J62 A;  3K3O A;  5LXT E;  3P7I A;  3C50 A;  3FZH B;  5HXH A;  1XMO T;  3P4P A;  3M3Z B;  3RIU C;  5HWX A;  2WDQ A;  1OED B;  4EB6 E;  3CWZ B;  1I6Z A;  1ZOY A;  2VWA A;  3HL6 A;  1JNR A;  4JI6 T;  4HWC A;  5C3J A;  2YEV C;  3EHZ A;  4OHF A;  2Y48 B;  3VRA A;  4AIS A;  3LFM A;  2W2U A;  2XQ6 A;  4CQI A;  1ZP0 A;  4ZZC A;  3RYI E;  3A8Y C;  2CBJ A;  1D0Y A;  3RI5 A;  3RIF A;  4KHZ F;  4QKN A;  4B3T T;  5HXC A;  3C98 B;  2LSI A;  4U2Z A;  2UU9 T;  3M65 A;  2H3R A;  5LOV E;  5L3B B;  3AAE B;  3AXJ B;  3H3M A;  4GYS A;  3CX8 B;  2KXP B;  2PG8 A;  5CJ5 A;  2UXC T;  4HN9 A;  3SOL A;  3LSV A;  1KEY A;  4LF7 T;  3O1J A;  4TZ4 C;  4PAG A;  4GK5 E;  2MTQ A;  1D1B A;  5FNV E;  4FI5 A;  4ASK A;  4JI4 T;  2BZB A;  2KZ7 B;  3VR9 A;  2MBG A;  4EIW A;  2KND A;  2JMK A;  4ZI2 D;  1FJG T;  4HGA A;  2XAF B;  3LK3 B;  5AQU B;  2H7O A;  2CEA A;  1N34 T;  1ZHC A;  2VL0 A;  2XQ9 A;  2XJ7 A;  3J7Y q;  2WBL A;  4AQF C;  1ZEE A;  3ZMZ B;  4KMC A;  2LOS A;  2A3D A;  3ZMV B;  3AA7 B;  4JUY A;  2UXD T;  4EED A;  3R6N A;  2BG9 A;  2E9X B;  4KX6 A;  2X66 A;  3UQ4 A;  1WR6 A;  5AQF B;  3HKB E;  1HS7 A;  5L2L A;  3PU3 A;  1IBL T;  5L3C B;  5AQS B;  3HR0 A;  3PUW F;  3QC9 A;  3OVU A;  1XNQ T;  5AQI B;  5KMG P;  1J5E T;  4P1N A;  2B1E A;  2CXF A;  4IT4 A;  3IF8 B;  2W67 A;  2IC6 A;  2NR4 A;  4HFH A;  4N78 D;  2W66 A;  4NUU A;  1FEW A;  4IDP A;  3IEE A;  3W15 B;  2HN2 A;  5F3J A;  4IDQ A;  4IHJ E;  3PUR A;  2I0M A;  1HF8 A;  3E08 A;  3C4W A;  3FXD B;  5ETW A;  3C64 A;  4YSX A;  2VVS A;  3V5S A;  1WCR A;  3PUQ A;  2LHN A;  5JRC B;  2C0S A;  2M6B A;  4H9S E;  3OPC A;  2RA1 A;  2DNX A;  4TWH A;  2DI4 A;  2V5D A;  4P0A A;  2QVA A;  2LSG A;  4BJM A;  2XTL A;  4UVA B;  3F2E A;  2EHO A;  1E2A A;  5AQL B;  3F31 A;  3N9M A;  2OA5 A;  2BKN A;  2WS3 A;  1MMA A;  5IWA T;  4WBO A;  3FZL B;  4XBF B;  2V1D B;  1I94 T;  4EXT A;  2B76 A;  1NEK A;  3EUH A;  3JAD A;  1IAP A;  1YQ4 A;  2X9X A;  2NP9 A;  3JAE A;  4O2B E;  3GA8 A;  5LBQ B;  4PW8 A;  1EZ3 A;  3A5X A;  3ZC1 A;  5CGM A;  2YN6 A;  2KWH A;  2VKD A;  5FXV A;  1ZKE A;  1FIO A;  5A1L A;  2XQ3 A;  4PNI A;  4B3R T;  5ABF A;  4LMK A;  3AA0 B;  2V7I A;  4JYA T;  5IUX A;  3MZK B;  3T8O A;  1R8I A;  4MAL A;  3LBX B;  1IJ6 A;  2YK0 A;  4TWD A;  4AI6 A;  4ILC A;  2W62 A;  5AQQ B;  1OXZ A;  2WZH A;  4ANJ A;  4QX7 B;  3FBL A;  4CXY A;  3QK6 A;  4TV9 E;  2KSR A;  3ONJ A;  1HFA A;  4X1I E;  1UUS A;  2YU2 A;  2D5U A;  5JDQ A;  3NVO A;  4NIQ A;  1KNR A;  3CX6 B;  3ZYL A;  3J9X 1;  2JMH A;  2C5J A;  5LG3 A;  4I4T E;  1N32 T;  1WLX A;  2VQF T;  2BG9 B;  4ERR A;  4HFB A;  3ZT6 A;  4A56 A;  1U4Q A;  4P09 A;  3MJX A;  1J1J A;  2XM2 A;  4EZH A;  4DVD A;  5HXE A;  4F6R C;  1YD8 G;  3DJB A;  3ZYK A;  3UQ7 A;  2QGS A;  3P8C D;  2AXD S;  3C51 A;  4MBQ A;  2QRX A;  4EEB A;  3BQI A;  4CN4 A;  3B13 A;  3N9N A;  1MMD A;  2X51 A;  5AQH B;  3Q9D A;  5EK3 A;  4JI1 T;  1CHU A;  2Z6E A;  4YSY A;  3N2G E;  3UU6 A;  4QXB B;  3KV4 A;  2QYW A;  2XAS B;  2XAH B;  2XHE B;  2A2F X;  4YJ2 E;  2NTY A;  2XAJ B;  1UGO A;  3EAB A;  2EHO B;  3L8R A;  3N9O A;  2NTX A;  4JI3 T;  4U74 A;  1UX4 A;  4UXN B;  2LM2 A;  2C5K T;  1SHZ C;  2CHO A;  3IBP A;  5DQV A;  2ZM6 T;  4NXN T;  1G73 A;  5LNK A;  2YDR A;  2XM1 A;  2ZMA A;  2JQQ A;  5FXX A;  4AKH A;  4ZHQ E;  3ZCI A;  3PUA A;  2LSJ A;  3UU8 A;  3Q5D A;  1W0A A;  5LBM A;  2CA5 A;  3K1S A;  1MMN A;  3CQC B;  4JV5 T;  1VOM A;  4OK0 A;  3ANW A;  3QNU A;  1DU2 A;  2V6Y A;  4YY3 T;  2XAQ B;  5J0Z A;  5JR9 C;  5LGU B;  2UXX B;  4IE4 A;  5AQJ B;  4BA9 A;  5ABF B;  2H89 A;  5HEO A;  4QH5 A;  4AKG A;  1YW0 A;  2XY8 B;  3EI0 A;  2E5V A;  3N9Q A;  2ZM2 A;  4JI0 T;  4AQY T;  2NW9 A;  4UVC B;  2V7K A;  4V1A v;  1KNP A;  2X9Y A;  2VKJ A;  1QLB A;  4F8H A;  4PFO A;  3OKQ A;  5ADX L;  2IW5 B;  5L3D B;  3KVA A;  3P4S A;  2NOX A;  2ACX A;  4PJM A;  2BS2 A;  3KV9 A;  3P4W A;  1H7C A;  4YLH A;  2J4G A;  2R6G F;  4P0B A;  1WR0 A;  4PJN A;  2XUE A;  3RKO A;  1LRZ A;  2FUP A;  4OYK A;  2JIW A;  2XQA A;  3P4Q A;  4E7S A;  2VKH A;  3RRW A;  3ESL A;  1QSD A;  4HWH A;  2X0L B;  3EDU A;  4HTE A;  2CHN A;  5M4Y A;  2E9X C;  2X67 A;  3MAC A;  2CXL A;  3P4R A;  4IGU A;  2V7J A;  3QUJ A;  3CX7 B;  2LSK A;  1LKX A;  4DND A;  3AB3 B;  2MOZ A;  4WYV A;  3FZF B;  5AQK B;  4J2C A;  3AA1 B;  4KP3 C;  3PUG A;  3RC3 A;  1MIY A;  3ZEF B;  2X0H A;  1HNW T;  4DR7 T;  3TLV A;  3LK4 2;  2L8K A;  5HYA A;  2L9Q A;  2PTF A;  3OJA A;  2UUC T;  4JBW F;  2XZE A;  4K0K T;  2A9U A;  4DO0 A;  1E1H B;  4DR5 T;  3Q2M A;  4HWI B;  1MNE A;  3RKG A;  2A72 A;  2VK9 A;  2WM9 A;  5HEU A;  2QA7 A;  5JR9 B;  4ADZ A;  3O4X E;  2UXN B;  3DTO A;  4OFZ A;  4KI0 F;  3EAM A;  3TLS A;  4EAH A;  3GMI A;  4LF6 T;  3PU8 A;  4COF A;  5FXW A;  2MPK A;  4YT0 A;  2XQ4 A;  3AEA A;  3EVY A;  1W09 A;  4EOZ B;  2OV9 A;  4IE6 A;  3S4U A;  2DCF A;  2SPC A;  2E9X D;  1JNZ A;  4K0U A;  4DID B;  2W61 A;  3K3N A;  3ONL C;  3ANW B;  5KX5 E;  3Q5W A;  3RH3 A;  2V6Y B;  2Q9Q A;  3ZMT B;  2VL8 A;  4OX9 T;  1T72 A;  2RPA A;  4EV6 A;  1L0V A;  2WMO A;  4TX5 A;  2ODV A;  5L3E B;  3PUV F;  3RYH E;  2I59 A;  3LG7 A;  3H3A A;  2H88 A;  1YKE B;  2Y6X A;  4H9Q C;  4DR3 T;  2ODU A;  1BR2 A;  2E5L T;  4ZOL E;  1HX8 A;  3KV5 A;  2J47 A;  4B6X A;  4Z90 A;  2V6X A;  1HG2 A;  1T98 A;  5ABG A;  4LFA T;  4NXM T;  1OED E;  3N5L A;  5ABE A;  4WW0 A;  5H6R B;  4X5T A;  2YU1 A;  5F5W A;  3TLW A;  2VQE T;  1HG5 A;  2BG9 C;  3TLT A;  3AVR A;  3JAF A;  5FVL A;  5KXJ A;  2AE9 A;  2VB6 A;  2JQH A;  5LP6 E;  1HNZ T;  2N9D A;  3MK7 C;  3HKD E;  1MIV A;  4LMJ A;  1HNX T;  4HFE A;  3T1Y T;  1NWM X;  2YDS A;  3ZMS B;  4HWF A;  5JTG A;  4MFR A;  5LG4 A;  3ZMU B;  2CMR A;  2WDV A;  2YOE A;  3N9L A;  3PE0 A;  3T1H T;  3AE4 A;  3VKG A;  4Z91 A;  2X9W A;  1VCS A;  5CA1 E;  2D0U A;  1VRB A;  2MYS A;  1Z8U A;  1IZN B;  3PUY F;  1IJ5 A;  4XZC A;  4X62 T;  2KT9 A;  2KLQ A;  3GN5 A;  4IDO A;  3I9Y A;  5CFB A;  5ABH A;  3VU7 H;  1LVK A;  3NWI A;  4L9I A;  1UCU A;  2EHO C;  3L3P A;  2DWG A;  1KK7 A;  4CZZ B;  1BR4 A;  2V7L A;  5J2U E;  3I1A A;  3RC8 A;  3BQL A;  4HFD A;  4IIJ E;  4ZS2 A;  4QH4 A;  1E7P A;  4TUY E;  5FKY A;  5AQN B;  4A98 A;  2UUB T;  4KBM B;  4M1P A;  2K48 A;  2Q9Q B;  2IAK A;  3K3Q C;  3B57 A;  2G0U A;  3BK9 A;  4IST A;  2I6H A;  3X1D A;  5HCM A;  1W9R A;  3PUX F;  2CWO A;  5JDL A;  3RIA A;  3Q5E A;  3VKH A;  5FY7 A;  5LA6 E;  5GON E;  4L5G A;  2FBW A;  3U3I A;  3LJC A;  3ZC0 A;  3WAK A;  5HEH A;  4X1Y E;  5E0O A;  4HWD A;  4DV6 T;  4OYJ A;  2BS3 A;  1HTJ F;  5FVK A;  4IDZ A;  5FYM A;  5JDG A;  4JEH B;  2WAU A;  5HWY A;  2WY2 A;  3AVS A;  4X66 T;  2WU2 A;  4X64 T;  3DP7 A;  2IML A;  3ZN1 B;  4E7Z A;  1FMW A;  2EHO D;  2FJA A;  4UIG A;  2WSS V;  1XDO A;  2HN1 A;  4CI1 B;  2UUA T;  3SRZ A;  3AE8 A;  4GIW A;  3FBZ A;  4IE5 A;  2CRB A;  1T8B A;  5AQG B;  4AKL A;  2X9H A;  1V9D A;  4CN1 A;  4MLK A;  1CUN A;  2JQ9 A;  1HR0 T;  3ZT5 A;  3HKC E;  4DUZ T;  2PBI A;  3Q5X A;  5AFU L;  3UUL A;  4U72 A;  2K3W A;  3ZCJ A;  3KBT A;  3UTK A;  1OED A;  4ILU A;  5BMV E;  4H9P C;  3MXZ A;  2CBI A;  2WCA A;  1BR0 A;  2BS4 A;  4JEU B;  1QUU A;  4LF5 T;  4UVB B;  1UX5 A;  4O4I E;  3SFD A;  1D0Z A;  4X1K E;  3NZP A;  5L4H A;  1AJ3 A;  2P9B A;  2IHR 1;  2LE8 A;  2D0T A;  5FP3 A;  4DV3 T;  3NRY A;  4HFC A;  4PJJ A;  3CQX C;  2M6I A;  2VKO A;  2RP4 A;  4I43 B;  5H6Q B;  3GN5 B;  4C90 A;  3AXJ A;  5JH7 E;  1S94 A;  2WB5 A;  3SFE A;  2N1G A;  4H63 H;  3SWH A;  4AQG A;  3ZYM A;  4DV1 T;  4QX8 B;  3RX6 A;  3SS1 A;  3AE6 A;  1KFY A;  1MMG A;  5HXR A;  4X20 E;  3RPU A;  2K24 A;  3E22 E;  3G06 A;  4DBQ A;  2BG9 E;  3AEG A;  5LCY A;  1LVF A;  1KNZ A;  2F4V T;  5JVD E;  3E0Z A;  3R84 B;  4EGW A;  3RHW A;  5CA0 E;  5J1G A;  1S35 A;  2W4X A;  4Z8X A;  1MIW A;  2JJ9 A;  4IL9 A;  3RQU A;  1UK5 A;  3PDY A;  4LML A;  4CI2 B;  3OBV E;  2BDE A;  2IIU A;  3ONX A;  4JI7 T;  2WMN A;  4DV7 T;  3RQW A;  4GOU A;  3K8P C;  5JDF A;  4CXW A;  2Y8D A;  4HFV A;  1WYB A;  5AQV B;  4DV5 T;  3CK6 A;  2ZLY A;  4Q25 A;  2VAS A;  2JRK A;  5DJQ C;  4CN6 A;  3RIU A;  2LRL A;  3AAI A;  2BKO A;  3JC6 C;  3AE2 A;  2M67 A;  2D2S A;  4H9R C;  3RRC A;  4O8S A;  2E2A A;  2WZI A;  2BBJ A;  4DR4 T;  2LJL A;  4TNV A;  2W63 A;  2YIN A;  5LJN A;  1XDP A;  3ZJ2 A;  4JI8 T;  2K5B B;  2N2N A;  2LM9 A;  2WP9 A;  3KDS E;  3AE9 A;  1Y01 A;  3C4X A;  3NZQ A;  4U7I A;  1SA0 E;  5AQO B;  3UFG A;  5KDM C;  4ZS3 A;  3CML A;  5C8Y E;  2NW8 A;  3ETV A;  3RF1 A;  1X9B A;  4GYR A;  2IC9 A;  5HAX A;  4U3C A;  2DHR A;  4QWN B;  2OLT A;  3AE7 A;  3NKZ A;  2XPK A;  4PJL A;  3RLF F;  1U5P A;  2ZM8 A;  3UUN A;  3UUB A;  2JQK A;  3ZT7 A;  5AQP B;  1KF6 A;  2VVN A;  3AA6 B;  2IUB A; 
#chains in the Genus database with same CATH homology
 1YD8 G;  3DJB A;  3ZYK A;  2QGS A;  3N9L A;  3P8C D;  3C51 A;  4MBQ A;  2LSY A;  3PE0 A;  3O9X A;  2E9X A;  1WYC A;  3BQI A;  3VKG A;  2X9W A;  4AQF A;  3LK2 B;  5CA1 E;  3B13 A;  2D0U A;  3JC6 D;  1Y64 B;  3N9N A;  1MMD A;  2X51 A;  3Q9D A;  5EK3 A;  3UUX B;  1VRB A;  2MYS A;  4ISS A;  1IZN B;  5LHG B;  1IJ5 A;  4XZC A;  4GK0 E;  2CLY B;  2KT9 A;  2KLQ A;  5LJM A;  3F57 A;  3GN5 A;  3LBX A;  4O4H E;  2Z6E A;  3AAA B;  3N2G E;  3HKE E;  3I9Y A;  3RYC E;  5IHY A;  4QXB B;  3VU7 H;  3EDV A;  3KV4 A;  4O2A E;  5HXS A;  1LVK A;  3ETU A;  2J1D G;  4HEA A;  4EYU A;  4L9I A;  1UCU A;  2EHO C;  3L3P A;  2DWG A;  1KK7 A;  5TAO A;  3KV6 A;  2W0G A;  1NAF A;  2XAS B;  4ZI7 E;  2XAH B;  2CMR A;  5J2T E;  4TN7 B;  5DAB A;  4CZZ B;  2X68 A;  5FMN A;  3HA4 A;  3RYF E;  1BR4 A;  2XHE B;  2A2F X;  2V7L A;  4YJ2 E;  2NTY A;  5LHI B;  2V7M A;  2XAJ B;  4YJ3 E;  5J2U E;  3I1A A;  3RC8 A;  3BQL A;  1D0X A;  4IIJ E;  4DMV A;  2EHO B;  2K9A A;  2DWK A;  4PK6 A;  4ZS2 A;  4UF0 B;  3N9O A;  5JDH A;  2NTX A;  4YFS A;  3I9W A;  4AKI A;  2Q9Q C;  3WI3 A;  3PUS A;  3O1H A;  4U74 A;  1UX4 A;  4UXN B;  3N9P A;  5JRC A;  4TUY E;  3ZPO A;  5LYJ E;  3VHL A;  3UT5 E;  2C5K T;  1SHZ C;  4AXP A;  2KMF A;  3IBP A;  5DQV A;  5DQW A;  2E8I A;  4ZI2 C;  1G73 A;  3K3O A;  4KBM B;  5LNK A;  4M1P A;  3P7I A;  2CXD A;  5LXT E;  5FY0 A;  2K48 A;  2Q9Q B;  1B7T A;  2IAK A;  5JRE A;  2ZMA A;  2JQQ A;  3C50 A;  3B57 A;  3I0Q A;  3K3Q C;  5FXX A;  2G0U A;  5HXH A;  4AKH A;  3BK9 A;  4ZHQ E;  3ZCI A;  3PUA A;  4IST A;  2LSJ A;  3D0T A;  5HWX A;  4PFP A;  2CWO A;  2LHR A;  4EB6 E;  4O4L E;  3ZLI A;  5LBM A;  3CWZ B;  4I50 E;  5JDL A;  4CI3 B;  3L09 A;  4H9O C;  3VKH A;  2CA5 A;  2HH7 A;  5FY7 A;  5LA6 E;  1MMN A;  3CQC B;  3HL6 A;  2VWA A;  5GON E;  4L5G A;  4QHO A;  2YEV C;  4OHF A;  2CM0 A;  1VOM A;  2WWU A;  2Y48 B;  4OK0 A;  1US7 B;  3U3I A;  3ANW A;  2C5I T;  3ZJ1 A;  5JDM A;  5LHH B;  3LFM A;  4CQI A;  3LJC A;  4UEM A;  3ZC0 A;  3O1I A;  2XAQ B;  4MHC A;  3WAK A;  5JR9 C;  4TV8 E;  2CWY A;  2XAG B;  3OYZ A;  3RYI E;  4I55 E;  4DMW A;  4X1Y E;  5E0O A;  5LGU B;  2UXX B;  1D0Y A;  1MND A;  4IE4 A;  2DLR A;  4OYJ A;  4QKN A;  5EZY E;  4BA9 A;  5HXC A;  1HTJ F;  3C98 B;  2LSI A;  4IDZ A;  3HI2 A;  4AKG A;  1YW0 A;  5FYM A;  3UFE A;  3M65 A;  2H3R A;  3N9Q A;  5JDG A;  5LOV E;  4JEH B;  2WAU A;  5L3B B;  2KWI B;  5HWY A;  3AVS A;  2ZM2 A;  3AAE B;  1FMV A;  4GYS A;  2NW9 A;  3CX8 B;  2KXP B;  2V7K A;  3DP7 A;  4UVC B;  4V1A v;  3ZN1 B;  5LGT B;  2X9Y A;  4E7Z A;  2PG8 A;  1FMW A;  4EZ4 A;  2VKJ A;  2EHO D;  4O4J E;  4PFO A;  3OKQ A;  4UIG A;  4HN9 A;  1HCI A;  5ADX L;  2IW5 B;  2WSS V;  4C91 A;  5L3D B;  3SOL A;  3KVA A;  4CI1 B;  2GK9 A;  2NOX A;  3SRZ A;  2ACX A;  4PJM A;  3O1J A;  4GIW A;  3FBZ A;  4IE5 A;  4TZ4 C;  3KV9 A;  1H7C A;  4AKL A;  3KFW X;  4YLH A;  1ZV4 X;  4P0B A;  4PAG A;  3N2O A;  4GK5 E;  2X9H A;  2MTQ A;  1V9D A;  4MLK A;  1D1B A;  1CUN A;  2XUE A;  4PJN A;  5FNV E;  3RKO A;  2Q9Q D;  4FI5 A;  4ASK A;  4DBR A;  3HKC E;  2KIN B;  1LRZ A;  2PBI A;  4OYK A;  2BZB A;  2KZ7 B;  3Q5X A;  4EIW A;  2MBG A;  5AFU L;  4E7S A;  2KND A;  2JMK A;  4QXH B;  3UUL A;  2VKH A;  2CCQ A;  4HGA A;  2XAF B;  4U72 A;  3RRW A;  3ESL A;  3LK3 B;  3ZCJ A;  1WRD A;  1QSD A;  1D1A A;  3KBT A;  2X0L B;  4KUM B;  3UTK A;  3EDU A;  4HTE A;  4ILU A;  5BMV E;  4H9P C;  2H7O A;  5M4Y A;  2CEA A;  1ZHC A;  3MXZ A;  3J7Y q;  2E9X C;  2WBL A;  2X67 A;  3CPZ A;  3MAC A;  1BR0 A;  2CXL A;  3TKL B;  4AQF C;  4IGU A;  2V7J A;  4JEU B;  3QUJ A;  1QUU A;  1ZEE A;  3CX7 B;  4G63 A;  3ZMZ B;  4KMC A;  4UVB B;  1UX5 A;  2LOS A;  2A3D A;  4O4I E;  2LSK A;  1LKX A;  3AA7 B;  1D0Z A;  4WNK A;  3ZMV B;  4X1K E;  4DND A;  4JUY A;  3AB3 B;  2MOZ A;  3NZP A;  1AJ3 A;  2P9B A;  3C4Z A;  3R6N A;  2LE8 A;  2E9X B;  2D0T A;  5FP3 A;  3NRY A;  2X66 A;  4J2C A;  1WR6 A;  3AA1 B;  3KBU A;  3HKB E;  1HS7 A;  5L2L A;  4PJJ A;  3CQX C;  5JDN A;  3PU3 A;  5L3G B;  5L3C B;  2VKO A;  2RP4 A;  3HR0 A;  4KP3 C;  3PUG A;  4PK4 A;  3QC9 A;  3RC3 A;  4I43 B;  5H6Q B;  3GN5 B;  2ES0 A;  4C90 A;  4BAY B;  1MIY A;  3ZEF B;  3I0O A;  5KMG P;  5JH7 E;  1S94 A;  4H9N C;  2B1E A;  2JPF A;  3LK4 2;  2N1G A;  2CXF A;  2L8K A;  4H63 H;  3IF8 B;  3U78 A;  2IC6 A;  2NW7 A;  5HYA A;  3SWH A;  4N78 D;  4NUU A;  2BVM A;  1FEW A;  2L9Q A;  4AQG A;  3ZYM A;  3OJA A;  3IEE A;  3W15 B;  5F3J A;  2L3L A;  4UV8 B;  4QX8 B;  3RX6 A;  4WBN E;  1Z0P A;  3SS1 A;  4IHJ E;  1MMG A;  5HXR A;  4DO0 A;  3PUR A;  1E1H B;  1HF8 A;  3E08 A;  3C4W A;  3FXD B;  4X20 E;  5ETW A;  3RPU A;  3C64 A;  2V26 A;  2K24 A;  3Q2M A;  3E22 E;  4DBQ A;  3V5S A;  3PUQ A;  2LHN A;  1MNE A;  5LCY A;  1LVF A;  2A72 A;  2XQY A;  2VK9 A;  1KNZ A;  2C0S A;  5JRC B;  2WM9 A;  3V5U A;  5JVD E;  2QA7 A;  3IHR A;  3KIN B;  5JR9 B;  4PK5 A;  3E0Z A;  2UXN B;  3O4X E;  3DTO A;  4H9S E;  4ADZ A;  4OFZ A;  2RA1 A;  2DNX A;  3R84 B;  2DI4 A;  4EAH A;  3GMI A;  5CA0 E;  4P0A A;  5J1G A;  3NBX X;  2LSG A;  3PU8 A;  4HE8 A;  1S35 A;  4BJM A;  2XTL A;  5FXW A;  4Z8X A;  4UVA B;  1MIW A;  3GWH A;  4YHJ A;  2JJ9 A;  4H63 V;  4BJN A;  3F2E A;  2EHO A;  3FXE B;  4UF0 A;  3PDY A;  2ZM0 A;  4G2A A;  2BVL A;  3EVY A;  3F31 A;  4EOZ B;  4IE6 A;  4ZI3 C;  4CI2 B;  3N9M A;  2HPL A;  3S4U A;  2DCF A;  2OA5 A;  2E9X D;  2SPC A;  3OBV E;  1MMA A;  4K0U A;  4CXX A;  2CLY C;  2W61 A;  4WBO A;  2BDE A;  3K3N A;  3ONX A;  3ANW B;  2W00 A;  4XBF B;  5KX5 E;  2WMN A;  2V1D B;  3Q5W A;  3RH3 A;  4GOU A;  4EYY R;  3K8P C;  1D1C A;  4EXT A;  2LT3 A;  2Q9Q A;  3ZMT B;  2VL8 A;  5JDF A;  4CXW A;  2Y8D A;  3EUH A;  2HPJ A;  1IAP A;  4HFV A;  1WYB A;  3BQK A;  2X9X A;  2WMO A;  4TX5 A;  2ODV A;  2NP9 A;  4O2B E;  5JQG E;  3GA8 A;  5CB4 E;  5LBQ B;  4PW8 A;  1EZ3 A;  5EK4 A;  5L3E B;  2ZLY A;  3A5X A;  3RYH E;  2I59 A;  3WAJ A;  2VAS A;  3LG7 A;  3H3A A;  2JRK A;  4QXC B;  5DJQ C;  3ZC1 A;  1YKE B;  2Y6X A;  2KWH A;  2VKD A;  3AAI A;  4H9Q C;  5FXV A;  2ODU A;  1ZKE A;  1FIO A;  1BR2 A;  3JC6 C;  3OYX A;  3NRX A;  4ZOL E;  3MA9 A;  2M67 A;  5A1L A;  2D2S A;  1HX8 A;  4H9R C;  3KV5 A;  4PNI A;  4UV9 B;  4B6X A;  3RRC A;  4O8S A;  3AA0 B;  2V7I A;  3CVR A;  4ZI2 D;  3MZK B;  2NWB A;  3T8O A;  1HG2 A;  4AKR B;  4MAL A;  1T98 A;  1OWA A;  3LBX B;  4L0R A;  2LJL A;  2W63 A;  5JR9 A;  2YIN A;  1IJ6 A;  2YK0 A;  3FHN A;  5LJN A;  4IE0 A;  4HKA A;  4XAX B;  2LOP A;  5FY1 A;  4FJO A;  4AI6 A;  3N5L A;  3ZJ2 A;  2K5B B;  2N2N A;  2W62 A;  1OXZ A;  1BR1 A;  4WW0 A;  4ANJ A;  5EK2 A;  4QX7 B;  3FBL A;  5H6R B;  4CXY A;  2LM9 A;  3QK6 A;  4TV9 E;  2YU1 A;  3H37 A;  3KDS E;  5IYZ E;  1HFA A;  4X1I E;  2H7V C;  1HG5 A;  3C4X A;  3NZQ A;  1X79 A;  3UUM A;  3FB2 A;  1SA0 E;  5KDM C;  2YU2 A;  2D5U A;  4ZS3 A;  5JDQ A;  3CML A;  3KVB A;  5C8Y E;  4NUV A;  3CQG B;  2NW8 A;  1O3X A;  3AVR A;  3MKD A;  3CX6 B;  3ETV A;  3ZYL A;  3J9X 1;  4ZI3 D;  2JMH A;  2PJQ A;  2C5J A;  2VB6 A;  5LP6 E;  3ZN0 B;  4GYR A;  4IE7 A;  4UEL A;  1YKH B;  2N9D A;  4I4T E;  1WLX A;  3MK7 C;  5LGN B;  2IC9 A;  3HKD E;  3N2K E;  1MIV A;  5FXZ A;  4ERR A;  4JLE A;  5HAX A;  5L3F B;  2DHR A;  4QWN B;  2CE7 A;  3PTR B;  5F8P A;  4A56 A;  4PJL A;  1NWM X;  1U4Q A;  4P09 A;  1G8X A;  3MJX A;  3ZMS B;  1U5P A;  2ZM8 A;  3UUN A;  4EZH A;  2PFV A;  4DVD A;  5HXE A;  3AA6 B;  3CKD A;  4MFR A;  4F6R C;  5LG4 A;  3ZMU B;  2LEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...