3EDVA

Crystal structure of repeats 14-16 of beta2-spectrin
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
322
structure length
322
Chain Sequence
SHMRHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Localization and Structure of the Ankyrin-binding Site on beta2-Spectrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Spectrin beta chain, brain 1
total genus 156
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA01
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA02
3F57A 3PE0A 2IAKA 2ODUA 3KBTA 3EDUA 3UUNA 3UUMA 3KBUA 1HCIA 1OWAA 3F31A 3LBXB 2ODVA 1G8XA 3R6NA 3EDVA 1AJ3A 1S35A 1WLXA 3PDYA 2SPCA 1U5PA 1U4QA 3UULA 3FB2A 5J1GA 3LBXA 1CUNA 1QUUA
chains in the Genus database with same CATH superfamily
2ACXA 2WM9A 3BQIA 3NWIA 4TV8E 3WAJA 4JYAT 4HKAA 3W15B 2LSGA 1UCUA 4U2YA 4U2ZA 3RPUA 1KFYA 3AE1A 2E8IA 2LSYA 2V7JA 3CQCB 3AXJA 4YTPA 1YKEB 3M65A 3AEEA 1XDOA 3KBUA 3QK6A 4PJLA 1HCIA 1BR1A 5CFBA 2H7OA 2E9XB 3P7IA 3VKHA 1YQ3A 2A72A 1T98A 3R84B 4H9OC 4NUUA 3ZPOA 3PUQA 4LMLA 1ZHCA 3FBZA 4X62T 2XM2A 4WYVA 1E7PA 3ETUA 4UELA 3VU7H 1S35A 4DV1T 2Q9QB 2V5DA 3UU6A 2CLYC 2LHNA 1W9RA 3ONLC 5LXTE 5AQMB 2ES0A 4JV5T 2XUEA 4HFHA 3OKQA 4EEBA 3UT5E 1QLBA 5L3GB 4DV6T 4AKGA 2X0LB 2B76A 5ABFB 4DV7T 3C64A 3AE8A 4UF0A 3FHNA 2L8KA 3ZJ2A 1NWMX 3CMLA 4HWCA 3OTOT 3EHZA 4BAYB 1NENA 2ZM8A 4DBRA 3PUWF 3SWHA 4HWDA 2CWYA 5L3DB 4NXMT 3GWHA 5IHYA 2JMHA 4H63H 3H3MA 1KEYA 3K3NA 5LOVE 3ETVA 4P0AA 3LK3B 3QNUA 4IL9A 4ZI2C 3CVRA 2NOXA 2AXDS 4K0UA 4N78D 3K3QC 1ZP0A 4HFBA 3KV4A 4GK0E 2LSIA 1WR0A 4YSYA 2XAQB 5GONE 4AKLA 1D1BA 2NP9A 4NXNT 1AJ3A 5JR9A 3FXEB 3Q5EA 3PJAA 1FIOA 1GQEA 4Q25A 4EYYR 5J2UE 5L3FB 4AQYT 4JI3T 2NTYA 4DMVA 1E2AA 2D5UA 3AEBA 3FZMB 2FJDA 4JI7T 4P09A 3FXDB 4KMCA 3N9PA 4B3TT 5FL1A 2DI4A 3LSVA 4ZS2A 2BG9C 3F57A 2C5KT 3RIFA 2I59A 2LM9A 3BQKA 2LLYA 2BBHA 2W0GA 2WS3A 2X68A 2ZMAA 3IA3A 4H63V 2ODUA 4WNKA 4H9QC 2WSSV 4YXDA 4FJOA 5H6QB 4X1IE 2VURA 5AFUL 5JDMA 4QKNA 4HWIB 2DCFA 3N2KE 3AXJB 3QB5K 5KDMC 1Z0PA 1G8XA 1FEWA 2EHOC 2W67A 2Q9QD 2XQ4A 2HPLA 4U7IA 2LOSA 2NTXA 5E0OA 4PK4A 2X0HA 2OA5A 2XPKA 3PU3A 4KUMB 4E7ZA 5EK2A 5ABEA 3T1YT 3NRXA 4I55E 3AEAA 5A1LA 4EAHA 3EAMA 5LNKA 2CXLA 1U4QA 2LRKA 2V6XA 5AQUB 2VK9A 4YSXA 5HAXA 5JQGE 2UXCT 1SHZC 2H3RA 3UU4A 3CX8B 2LRLA 2WY2A 1D0ZA 2CBJA 4DIDB 4JI0T 4GIWA 1HX1B 2LE8A 1SE7A 4A98A 1QSDA 1J1JA 2IAKA 2CHOA 2WU5A 3LJCA 2N9DA 3PUYF 4IE6A 3JC6C 4PK5A 2LEHA 3E08A 1VCTA 4KI0F 4YFSA 3X1DA 4AQGA 3LG7A 2QYWA 2W4XA 5DJQC 3S4UA 2P9BA 1UX5A 2RP4A 4YTNA 1XMOT 1HG2A 4X66T 4QXCB 2DWKA 3FZFB 3DJBA 4GYSA 4I4TE 4MBQA 4PK6A 3RRWA 3SRZA 2JRKA 3C98B 1KNPA 2MYSA 4KBMB 3TLWA 3AVSA 3ZT7A 4KHPT 5FNVE 2XZEA 3NBXX 1SUMB 3MXZA 4WBOA 3ZSSA 4LFBT 2NW7A 2YOEA 2R6GF 2FBWA 2XQ5A 2XY8B 3VRAA 4DV2T 2WP9A 3O9XA 1YW0A 3JAFA 4KHZF 4PJJA 4ZHQE 4O4LE 4HE8A 4YHHT 4O8SA 2YDQA 5HCMA 3PUSA 1ZV4X 4WW0A 3VR8A 5LGTB 1HTJF 3NZQA 2J47A 2WDQA 2X9HA 3ONXA 3MKDA 4IHJE 2KMFA 3DTOA 3HKBE 3ZMTB 2IC9A 4DV4T 5CJ5A 4CI2B 2Z6EA 5JDNA 2NWBA 2FUPA 3EABA 3JAEA 3AEDA 5J0ZA 4TUYE 4ZEYA 2A2FX 5FL0A 1UUSA 5JDLA 3P50A 2UXNB 1YKHB 2RA1A 3NZPA 4O2AE 2L3LA 3BQLA 1MMGA 5F3JA 3F31A 5JH7E 2OLTA 3AA1B 3MK7C 1WR6A 4AXPA 2WU2A 3N2OA 4ISTA 4HFEA 1MNEA 5H6RB 2CBIA 3PTRB 5JDQA 1ZEEA 2KINB 3AEGA 4TNWA 5LHIB 5LHGB 4EEDA 4LF6T 3AVRA 3QOFA 2IW5B 4PFOA 4ZI3C 1J5ET 4DUYT 1HNWT 2H89A 2V7MA 1E1HB 1D0YA 2HN1A 3K1SA 3L39A 2CHNA 3D0TA 4MHCA 2GK9A 5TAOA 3SS1A 3PUZF 2M6BA 1SA0E 1N36T 2DWGA 2E9XA 2EHOA 2E2AA 2JMKA 5LCYA 4UVAB 4GK5E 2G0UA 4PJNA 5HWYA 3VKGA 4AQFC 4L0RA 4I43B 2JQQA 4DUZT 1YD8G 4ZI2D 1W0AA 5JTGA 3ABVA 3N9QA 2JPFA 2W63A 2LKHA 3IF8B 3NKZA 5HEGA 5EK3A 3GN5A 2J62A 3O1JA 4FI5A 3UQ4A 2FJBA 2V5CA 3V5UA 2WDVA 1T72A 1D1CA 5AQRB 3ZLIA 1R8IA 2M6IA 4LMKA 5DQWA 2VB6A 3ZMZB 5C2TA 5LB7B 4Z91A 3HL6A 5FXZA 2C5JA 3F2EA 3AA6B 3C4XA 4HTEA 4JUYA 3AB3B 1KF6A 3I9YA 4IE4A 2XHEB 1U5PA 2XAGB 2XQ3A 2X9XA 3DP7A 1XZYA 2NW9A 5AQPB 2I6HA 2VKDA 3HKDE 3PUGA 1J5WA 2V7IA 4JLEA 4YJ2E 4DV3T 2VVSA 4AKHA 1OEDA 3OYXA 3RYFE 4X64T 2XQ9A 1NEKA 2M67A 3LK2B 4DR4T 4U74A 3P4PA 3ZYKA 4DR3T 4B3ST 3SFEA 3Q5DA 5JRCA 1KK7A 2N1GA 5L2LA 1Z8UA 3RGLA 2KZ7B 4UVCB 4QHOA 3CX6B 4IL4A 2UUBT 3HR0A 3AE5A 5AQGB 3QUJA 4X1YE 2VASA 4TX5A 1N32T 5AQVB 1NAFA 2KLQA 2WMOA 1IAPA 4YY3T 1OEDC 2XAHB 5AQQB 2DHRA 4JBWF 1WFDA 5ABGA 3MZKB 2ACZA 4H9RC 2WB5A 3JC6D 1BR4A 3I0QA 2A9UA 2JJ9A 3PUAA 2KSRA 2XQ7A 3FB2A 4TN7B 5HEUA 2BKPA 1LRZA 2VQET 2UUAT 4Z90A 2L9QA 2E5VA 4JI6T 1FMVA 4U3CA 2VKJA 2AE9A 4U72A 4ERRA 4YT0A 4A5XA 4B3RT 2X9YA 3HI2A 2CXDA 2PTFA 3RYIE 3J9X1 2PFVA 2WDRA 4IREA 3ANWB 2IHR1 4LF7T 2DLRA 2XQAA 3RRCA 2XASB 5LA6E 2CE7A 3SOLA 5CA0E 2MPKA 2XM1A 1XWMA 2D9DA 1JNZA 4X20E 4YHJA 5HEHA 3U78A 2FJEA 4AKRB 2WCAA 3I0OA 3ZCJA 2CXFA 3LK42 2BVMA 1S94A 4TWDA 1G73A 2BZBA 4CQIA 3UU3A 4QH1A 5FXXA 3OPCA 3UQ7A 5AQHB 2V26A 2CLYB 3ZT6A 1US7B 3RIAA 4CXYA 3UU8A 5JVDE 1CUNA 1BR0A 1CHUA 2IUBA 3ZYMA 3RIUA 4AISA 3ZEFB 3CX7B 1HS7A 3TLVA 1IJ6A 2WZHA 2XAFB 2V6YA 4QX8B 5AQKB 5ADXL 4IE5A 2K3WA 1I6ZA 2UXBT 1T8BA 2CA5A 4UEMA 4HWHA 4H9NC 4PJMA 3CKDA 4ISSA 1VCSA 2Y6XA 3UFEA 3RYCE 4UR9A 4Z8XA 3T8OA 2BKOA 4LF9T 2ZM6T 4JI1T 4OK0A 4LF5T 1WRDA 2XQ8A 5FXVA 3IBPA 5CB4E 1HFAA 2YDRA 4KX6A 3CK6A 3QC9A 4LMJA 3AE4A 3L09A 3R6NA 2KWIB 4HFCA 2E5LT 2QGSA 1BR2A 3RKOA 1MMAA 1Y64B 1IJ5A 2BVLA 2J4GA 3AAEB 4I0UA 2CEAA 1FJGT 5L3BB 4HN9A 1LVKA 3N9NA 4P0BA 4UVBB 5LJNA 3WAKA 4IDQA 2D0UA 2D0TA 3PU8A 5ETWA 4ADZA 2J1DG 4V1Av 3KFWX 3J7Yq 4LFCT 5FY0A 4AKIA 2OV9A 5HWXA 2JQHA 2YU1A 5AQTB 4UXNB 5FXWA 4F8HA 5DABA 3ZJ1A 4ZI3D 5FVKA 2VKHA 4G63A 2FJAA 1HR0T 5EZYE 1MNDA 3N9OA 5LMUT 3KVBA 3OJAA 3NVOA 3SFDA 3PV0F 3A8YC 4ANJA 2MAWA 4HGAA 4ZZBA 2WAUA 4CI1B 2YN6A 3LBXB 1DU2A 1UURA 1OEDB 3I1AA 2ZM0A 2CWOA 2CRBA 4IGUA 2EHOB 4IDNA 2WWUA 3CWZB 4TWHA 4EXTA 5FP3A 4U33A 4YLHA 4EGWA 3ZMVB 2VVNA 1IBKT 4XBFB 1XDPA 3MJXA 5J1GA 3UULA 1D1AA 4TV9E 4CI3B 2DL1A 4QXHB 3P4QA 4YJ3E 4HWFA 2LOPA 3GA8A 2KXPB 3E0ZA 1QUUA 4E7SA 2V1DB 2LHRA 4OFZA 3ZC0A 2PBIA 3AAAB 3LDQB 5L4EA 4CN1A 4YSZA 4COFA 2HPJA 2W66A 3FBLA 4GYRA 1VRBA 3OVUA 4L9IA 5JR9C 4AI6A 5EK4A 3FZHB 2F4VT 2WQYA 4C91A 4PAGA 4ZXLA 4H9PC 3EVYA 2IMLA 4I50E 3ZMUB 1V9DA 1W09A 2IDOB 4TZ4C 4B6XA 1MIWA 2ODVA 2YDSA 3ZN0B 3L3PA 5FY7A 2JQ9A 3GMIA 3K3OA 5FKYA 1WLXA 4X65T 2BG9A 3KINB 4NIQA 3P4SA 5LBQB 3ZMSB 1HNXT 1JNRA 1IBMT 1EZ3A 2V6YB 3E22E 1D0XA 4H9SE 4PW8A 4DR5T 3GN5B 3FZLB 2CCQA 1HG5A 4HFVA 3RKGA 4ASKA 4CZZB 4CXXA 5HXSA 4LFAT 4JI2T 2Y48B 3LBXA 3P4WA 4XZCA 2EHOD 4OX9T 4DNDA 2XSBA 2XQYA 4U31A 5J2TE 1N34T 2CMRA 2XSAA 2WMNA 4L5GA 3KBTA 4ILCA 3RX6A 5AQFB 4DVDA 4EYUA 2BS3A 4O4HE 5F5WA 3AE6A 4XAXB 4EIWA 2NR4A 3B57A 5ABFA 1ZKEA 3TLTA 3VHLA 4JI4T 3UUXB 2B1EA 3O1IA 2LT3A 2BDEA 1MMDA 1OXZA 3ZT5A 2C0SA 5C8YE 3AEFA 3U3IA 5CGMA 4OHFA 3EDVA 3HA4A 2QVAA 3B13A 2WBLA 2SPCA 4DR2T 3P8CD 3IHRA 5ABHA 3ZKRA 4O4IE 2X66A 4G2AA 4QWNB 5LGNB 5LBMA 3AE7A 3VRBA 1VOMA 3TLSA 2VL0A 3JCFA 2V7KA 5L3EB 5HXCA 2LSKA 1XMQT 4IE0A 2XAJB 2K9AA 5LJMA 5HEJA 5AQJB 3B5MA 2ZM2A 1FMWA 3KV6A 3Q2MA 3TLUA 2YK0A 1MIVA 3C50A 4ILBA 3N2GE 4YTMA 2W2UA 3EDUA 1L0VA 4JI5T 3RYHE 3UUNA 3C4ZA 3LFMA 1ZOYA 2QRXA 2RPAA 3L8RA 4ZS3A 1KNZA 3AE2A 3ZC1A 1X79A 4AIUA 1X9BA 2WZIA 2H88A 5LGUB 2BKNA 3AA0B 4ILAA 2Q9QA 3H3AA 3ONJA 2MBGA 4CN6A 3N5LA 3UFGA 4DR1T 3KV9A 1WCRA 3CQXC 5L4HA 2UXXB 2LSJA 3P4RA 4O2BE 5JDFA 3PJAJ 5M4YA 4LF8T 1IBLT 3RC3A 1O3XA 4ILUA 3BK9A 4P1NA 4DMWA 4F6RC 1UK5A 5CA1E 2MOZA 5LG4A 1Y01A 1WYBA 3Q5WA 3QB5A 3T1HT 3N9LA 2XTLA 2C5IT 1I94T 1H7CA 2V8SV 5AQLB 2VKOA 4IT4A 4IDOA 5L47A 3CQGB 5LYJE 3Q9DA 1MMNA 4U7YA 4TNVA 4JI8T 2K5BB 3V5SA 2A3DA 3PUXF 3PE0A 4HEAA 4QXBB 3Q5XA 4HFDA 4MALA 3O1HA 4OYJA 4QX7B 1B7TA 3C4WA 4UV9B 5LHHB 4DR6T 4GKKT 4HFIA 2BBJA 2CPTA 3MACA 4O4JE 4JEHB 5IWAT 3AE9A 3NRYA 4EZ4A 5HXEA 5L3CB 4A97A 4CN4A 3CIRA 3RH3A 3RQWA 1YQ4A 1XNRT 4MLKA 2QA7A 2W61A 2KWHA 3FZKB 2H7VC 5HXHA 4DV5T 2PJQA 2E9XC 2XJ7A 3RHWA 2CM0A 3RI5A 4GKJT 4TWFA 3HKEE 3CPZA 2X51A 5IYZE 2ZLYA 3TKLB 3ZN1B 4AQFA 4EOZB 1M62A 2UUCT 3KVAA 5JREA 2UXDT 3KV5A 4IDZA 2X67A 1HX8A 5HXRA 2W00A 1MIYA 4IDPA 1W0BA 2YKSA 5HEOA 5JR9B 2X9WA 4C90A 4GOUA 3IEEA 2YEVC 2N2NA 5FVLA 2Y8DA 3WI3A 2PG8A 3KDSE 2VL8A 3C51A 3UUMA 1LKXA 4A56A 3RLFF 4K0KT 3G06A 3UUBA 4BA9A 2I0MA 3HKCE 1OWAA 5BR8T 2HH7A 4NUVA 5KMGP 2DNXA 5C3JA 2JQKA 2LKGA 3OBVE 5AQIB 5FMNA 4BJNA 2YU2A 3ANWA 4CXWA 3OYZA 5HCJA 4WBNE 5JDGA 1WYCA 3AA7B 3A5XA 2IC6A 1M7KA 3ZSTA 4J2CA 2JIWA 5AQOB 3RF1A 3O4XE 2HHHT 4LF4T 3RC8A 3N9MA 2D2SA 2K24A 2YINA 2E9XD 3JADA 4OYKA 2Q9QC 3A7MA 3RQUA 3H37A 2K48A 1UGOA 2W62A 3VR9A 3PUVF 4EV6A 1N33T 1XNQT 3AECA 4MFRA 5JDHA 2LJLA 2LM2A 2HN2A 3EUHA 4PNIA 3ZCIA 2V7LA 5JRCB 4M1PA 4WZXA 2VQFT 5FY1A 3K8PC 4UF0B 2KNDA 3AE3A 2BG9B 4B3MT 4DV0T 2XQ6A 1KNRA 4NPPA 5KX5E 1LVFA 3AAIA 3ESLA 4IIJE 5HYAA 5LMNT 1HNZT 4PFPA 4DO0A 1YXRA 5AQNB 4DBQA 5BMVE 5IUXA 3PURA 4QH5A 4UIGA 4UV8B 2BG9E 4X5TA 4EZHA 3RIUC 2VWAA 1UX4A 3I9WA 4ZOLE 5DQVA 1T7SA 4IE7A 4X1KE 2WWVA 4ZI7E 2BS2A 5KXJA 5LP6E 2UU9T 3M3ZB 2X0YA 4EB6E 3UTKA 3PDYA 4DR7T 2MTQA 2KT9A 5LG3A 3ZYLA 2NW8A 4BJMA 1HF8A 1OEDE 5AQSB 5F8PA 3MA9A 2IIUA 4JEUB 4ZZCA 1IZNB 2BS4A 4QH4A 4KP3C 3UU5A 5FYMA 3EI0A
chains in the Genus database with same CATH topology
2ACXA 2WM9A 3BQIA 4TV8E 3WAJA 4HKAA 3W15B 2LSGA 1UCUA 3RPUA 4ZI2D 3J7Yq 2E8IA 2LSYA 2V7JA 3CQCB 1YKEB 3M65A 3KBUA 3QK6A 4PJLA 1HCIA 1BR1A 2H7OA 2E9XB 3P7IA 3VKHA 2A72A 1T98A 3R84B 4H9OC 4NUUA 3ZPOA 3PUQA 1ZHCA 3FBZA 3ETUA 4UELA 3VU7H 1S35A 2Q9QB 2CLYC 2LHNA 5LXTE 2ES0A 2XUEA 3OKQA 5L3GB 3UT5E 4AKGA 2X0LB 3C64A 4UF0A 3FHNA 2L8KA 1NWMX 3CMLA 4BAYB 2ZM8A 4DBRA 3SWHA 2CWYA 3GWHA 5IHYA 2JMHA 4H63H 5LOVE 3K3NA 4P0AA 3ETVA 3LK3B 4ZI2C 3CVRA 2NOXA 4N78D 4K0UA 3ZCIA 3K3QC 3KV4A 4GK0E 2LSIA 2XAQB 5GONE 1D1BA 2NP9A 1AJ3A 5JR9A 3FXEB 1FIOA 4EYYR 5J2UE 5L3FB 2NTYA 4DMVA 2D5UA 4P09A 3FXDB 4KMCA 3N9PA 2DI4A 4ZS2A 3F57A 4EXTA 2C5KT 2I59A 2LM9A 3BQKA 2X68A 4H63V 2W0GA 2MBGA 2ZMAA 4WNKA 2ODUA 4H9QC 2WSSV 4FJOA 5H6QB 4X1IE 5AFUL 5JDMA 4QKNA 2DCFA 3N2KE 5KDMC 1Z0PA 1G8XA 1FEWA 2EHOC 2Q9QD 2HPLA 5E0OA 2LOSA 2NTXA 5EK2A 4PK4A 2OA5A 3PU3A 4KUMB 4E7ZA 3NRXA 4I55E 5A1LA 4EAHA 5LNKA 2CXLA 1U4QA 5JQGE 2VK9A 5HAXA 1SHZC 2H3RA 3CX8B 1D0ZA 4GIWA 2LE8A 1QSDA 2IAKA 4IE6A 3LJCA 4QXHB 4ADZA 2N9DA 4YFSA 4PK5A 3JC6C 4AKLA 2LEHA 3E08A 4AQGA 3LG7A 5DJQC 3S4UA 2P9BA 1UX5A 2RP4A 1HG2A 4QXCB 2DWKA 4GYSA 3DJBA 4I4TE 4PK6A 4MBQA 3RRWA 3SRZA 3ZJ2A 2JRKA 3C98B 2MYSA 4KBMB 5L3DB 3AVSA 5FNVE 3NBXX 3MXZA 4WBOA 2NW7A 3O9XA 1YW0A 4PJJA 4ZHQE 4O4LE 4HE8A 4O8SA 3PUSA 1ZV4X 4WW0A 5LGTB 1HTJF 3NZQA 4IHJE 2X9HA 3ONXA 3ZMTB 3MKDA 3DTOA 2KMFA 3HKBE 2IC9A 4CI2B 2Z6EA 5JDNA 2NWBA 4TUYE 2A2FX 5JDLA 1YKHB 2UXNB 2RA1A 3NZPA 4O2AE 2L3LA 3BQLA 1MMGA 5F3JA 3F31A 5JH7E 3AA1B 3MK7C 1WR6A 4AXPA 3N2OA 4ISTA 5H6RB 1MNEA 5JDQA 5LHIB 3PTRB 5LHGB 1ZEEA 2KINB 3AVRA 2IW5B 4PFOA 4ZI3C 2V7MA 4I43B 1E1HB 1D0YA 5TAOA 3D0TA 4MHCA 2GK9A 3SS1A 1SA0E 2DWGA 2E9XA 2EHOA 2JMKA 5LCYA 4UVAB 4GK5E 2G0UA 4PJNA 5HWYA 3VKGA 4AQFC 4L0RA 2JQQA 1YD8G 3N9QA 2JPFA 2W63A 3IF8B 5EK3A 3GN5A 3O1JA 4FI5A 3V5UA 1D1CA 3ZLIA 5DQWA 2VB6A 3ZMZB 3HL6A 5FXZA 2C5JA 3F2EA 3AA6B 3C4XA 4HTEA 4JUYA 3AB3B 3I9YA 4IE4A 2XHEB 1U5PA 2XAGB 2X9XA 3DP7A 2NW9A 2VKDA 3HKDE 3PUGA 2V7IA 4JLEA 4YJ2E 4AKHA 3OYXA 3RYFE 3LK2B 2M67A 4U74A 3ZYKA 5JRCA 1KK7A 2N1GA 5L2LA 2KZ7B 4UVCB 4QHOA 3CX6B 3HR0A 3QUJA 4X1YE 2VASA 4TX5A 1NAFA 2KLQA 2WMOA 1IAPA 2XAHB 2DHRA 3MZKB 4H9RC 3PUAA 3JC6D 1BR4A 3I0QA 2JJ9A 3FB2A 4TN7B 1LRZA 2L9QA 1FMVA 2VKJA 4U72A 4ERRA 2X9YA 3HI2A 2CXDA 3RYIE 3J9X1 2PFVA 3ANWB 2DLRA 3RRCA 2XASB 5LA6E 2CE7A 3SOLA 5CA0E 4X20E 4YHJA 3U78A 4AKRB 3I0OA 3ZCJA 2CXFA 3LK42 2BVMA 1S94A 1G73A 2BZBA 4CQIA 5FXXA 2V26A 2CLYB 1US7B 4CXYA 5JVDE 1CUNA 1BR0A 3ZEFB 3ZYMA 1HS7A 3CX7B 1IJ6A 2XAFB 4QX8B 5ADXL 4IE5A 2CA5A 4UEMA 4H9NC 4PJMA 3CKDA 4ISSA 2Y6XA 3UFEA 3RYCE 4Z8XA 3T8OA 4OK0A 1WRDA 5FXVA 3IBPA 5CB4E 1HFAA 3R6NA 3QC9A 3L09A 2KWIB 2QGSA 1BR2A 3RKOA 1MMAA 1Y64B 1IJ5A 2BVLA 3AAEB 2CEAA 5L3BB 4HN9A 1LVKA 3N9NA 4P0BA 4UVBB 5LJNA 3WAKA 2D0UA 2D0TA 3PU8A 5ETWA 4AKIA 2J1DG 4V1Av 3KFWX 5FY0A 5HWXA 2YU1A 5FXWA 4UXNB 5DABA 3ZJ1A 4ZI3D 2VKHA 4G63A 5EZYE 1MNDA 3N9OA 3KVBA 3OJAA 4ANJA 4HGAA 4CI1B 2WAUA 3LBXB 3I1AA 2ZM0A 2CWOA 4IGUA 2EHOB 2WWUA 3CWZB 5FP3A 4XBFB 4YLHA 3ZMVB 3MJXA 5J1GA 3UULA 1D1AA 4TV9E 4CI3B 4YJ3E 2LOPA 3GA8A 2KXPB 3E0ZA 1QUUA 4E7SA 2V1DB 2LHRA 4OFZA 3ZC0A 2PBIA 3AAAB 2HPJA 3FBLA 4GYRA 4AI6A 1VRBA 4L9IA 5JR9C 5EK4A 4C91A 4PAGA 4H9PC 3EVYA 4I50E 3ZMUB 1V9DA 4TZ4C 4B6XA 1MIWA 2ODVA 3ZN0B 3L3PA 5FY7A 3GMIA 3K3OA 1WLXA 3KINB 3ZMSB 5LBQB 1EZ3A 3E22E 4PW8A 1D0XA 4H9SE 3GN5B 4ASKA 2CCQA 1HG5A 4HFVA 4CZZB 4CXXA 5HXSA 2Y48B 3LBXA 4XZCA 2EHOD 4DNDA 2XQYA 5J2TE 2CMRA 2WMNA 4L5GA 3KBTA 3RX6A 4DVDA 4EYUA 4O4HE 4XAXB 4EIWA 3B57A 1ZKEA 3VHLA 3UUXB 2B1EA 3O1IA 2BDEA 2LT3A 1MMDA 1OXZA 5C8YE 2C0SA 3U3IA 4OHFA 3EDVA 3HA4A 3B13A 2WBLA 2SPCA 3P8CD 3IHRA 4O4IE 2X66A 4G2AA 4QWNB 5LGNB 5LBMA 1VOMA 2V7KA 5L3EB 5HXCA 2LSKA 4IE0A 2XAJB 2K9AA 5LJMA 2ZM2A 1FMWA 3KV6A 3Q2MA 2YK0A 1MIVA 3C50A 3N2GE 3EDUA 3RYHE 3UUNA 3C4ZA 3LFMA 4ZS3A 1KNZA 3ZC1A 1X79A 5LGUB 3AA0B 2Q9QA 3H3AA 3N5LA 3KV9A 3CQXC 5M4YA 2LSJA 2UXXB 4O2BE 5JDFA 3RC3A 1O3XA 4ILUA 3BK9A 4F6RC 4DMWA 5CA1E 2MOZA 5LG4A 1WYBA 3Q5WA 3N9LA 2XTLA 2C5IT 1H7CA 2VKOA 5LYJE 3CQGB 3Q9DA 1MMNA 2K5BB 3V5SA 2A3DA 4HEAA 3PE0A 4QXBB 3Q5XA 4MALA 4OYJA 3O1HA 4QX7B 4UV9B 1B7TA 3C4WA 5LHHB 3MACA 4O4JE 4JEHB 3NRYA 4EZ4A 5HXEA 5L3CB 3RH3A 4MLKA 2QA7A 2W61A 2KWHA 5HXHA 2H7VC 2PJQA 2E9XC 2CM0A 3HKEE 3CPZA 2X51A 5IYZE 2ZLYA 3TKLB 3ZN1B 4AQFA 4EOZB 3KVAA 5JREA 3KV5A 4IDZA 2X67A 1HX8A 5HXRA 2W00A 1MIYA 5JR9B 2X9WA 4C90A 4GOUA 3IEEA 2YEVC 2N2NA 2Y8DA 3WI3A 2PG8A 3KDSE 2VL8A 3C51A 3UUMA 1LKXA 4A56A 4BA9A 3HKCE 1OWAA 2HH7A 4NUVA 5KMGP 2DNXA 3OBVE 4BJNA 5FMNA 4CXWA 2YU2A 3ANWA 3OYZA 4WBNE 5JDGA 1WYCA 3AA7B 3A5XA 2IC6A 3RC8A 4J2CA 3O4XE 3N9MA 2D2SA 2K24A 2YINA 2E9XD 4OYKA 2Q9QC 3H37A 2K48A 2W62A 4MFRA 5JDHA 2LJLA 3EUHA 4PNIA 5JRCB 2V7LA 4M1PA 5FY1A 3K8PC 4UF0B 2KNDA 5KX5E 1LVFA 3AAIA 3ESLA 4IIJE 5HYAA 4PFPA 4DO0A 5BMVE 4DBQA 3PURA 4UIGA 4UV8B 4EZHA 2VWAA 1UX4A 3I9WA 4ZOLE 5DQVA 4IE7A 4X1KE 4ZI7E 5LP6E 4EB6E 3UTKA 3PDYA 2MTQA 2KT9A 3ZYLA 2NW8A 4BJMA 1HF8A 5F8PA 3MA9A 4JEUB 1IZNB 4KP3C 5FYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F57 A;  3PE0 A;  2IAK A;  2ODU A;  3KBT A;  3EDU A;  3UUN A;  3UUM A;  3KBU A;  1HCI A;  1OWA A;  3F31 A;  3LBX B;  2ODV A;  1G8X A;  3R6N A;  3EDV A;  1AJ3 A;  1S35 A;  1WLX A;  3PDY A;  2SPC A;  1U5P A;  1U4Q A;  3UUL A;  3FB2 A;  5J1G A;  3LBX A;  1CUN A;  1QUU A; 
#chains in the Genus database with same CATH topology
 2ACX A;  2WM9 A;  3BQI A;  3NWI A;  4TV8 E;  3WAJ A;  4JYA T;  4HKA A;  3W15 B;  2LSG A;  1UCU A;  4U2Y A;  4U2Z A;  3RPU A;  1KFY A;  3AE1 A;  2E8I A;  2LSY A;  2V7J A;  3CQC B;  3AXJ A;  4YTP A;  1YKE B;  3M65 A;  3AEE A;  1XDO A;  3KBU A;  3QK6 A;  4PJL A;  1HCI A;  1BR1 A;  5CFB A;  2H7O A;  2E9X B;  3P7I A;  3VKH A;  1YQ3 A;  2A72 A;  1T98 A;  3R84 B;  4H9O C;  4NUU A;  3ZPO A;  3PUQ A;  4LML A;  1ZHC A;  3FBZ A;  4X62 T;  2XM2 A;  4WYV A;  1E7P A;  3ETU A;  4UEL A;  3VU7 H;  1S35 A;  4DV1 T;  2Q9Q B;  2V5D A;  3UU6 A;  2CLY C;  2LHN A;  1W9R A;  3ONL C;  5LXT E;  5AQM B;  2ES0 A;  4JV5 T;  2XUE A;  4HFH A;  3OKQ A;  4EEB A;  3UT5 E;  1QLB A;  5L3G B;  4DV6 T;  4AKG A;  2X0L B;  2B76 A;  5ABF B;  4DV7 T;  3C64 A;  3AE8 A;  4UF0 A;  3FHN A;  2L8K A;  3ZJ2 A;  1NWM X;  3CML A;  4HWC A;  3OTO T;  3EHZ A;  4BAY B;  1NEN A;  2ZM8 A;  4DBR A;  3PUW F;  3SWH A;  4HWD A;  2CWY A;  5L3D B;  4NXM T;  3GWH A;  5IHY A;  2JMH A;  4H63 H;  3H3M A;  1KEY A;  3K3N A;  5LOV E;  3ETV A;  4P0A A;  3LK3 B;  3QNU A;  4IL9 A;  4ZI2 C;  3CVR A;  2NOX A;  2AXD S;  4K0U A;  4N78 D;  3K3Q C;  1ZP0 A;  4HFB A;  3KV4 A;  4GK0 E;  2LSI A;  1WR0 A;  4YSY A;  2XAQ B;  5GON E;  4AKL A;  1D1B A;  2NP9 A;  4NXN T;  1AJ3 A;  5JR9 A;  3FXE B;  3Q5E A;  3PJA A;  1FIO A;  1GQE A;  4Q25 A;  4EYY R;  5J2U E;  5L3F B;  4AQY T;  4JI3 T;  2NTY A;  4DMV A;  1E2A A;  2D5U A;  3AEB A;  3FZM B;  2FJD A;  4JI7 T;  4P09 A;  3FXD B;  4KMC A;  3N9P A;  4B3T T;  5FL1 A;  2DI4 A;  3LSV A;  4ZS2 A;  2BG9 C;  3F57 A;  2C5K T;  3RIF A;  2I59 A;  2LM9 A;  3BQK A;  2LLY A;  2BBH A;  2W0G A;  2WS3 A;  2X68 A;  2ZMA A;  3IA3 A;  4H63 V;  2ODU A;  4WNK A;  4H9Q C;  2WSS V;  4YXD A;  4FJO A;  5H6Q B;  4X1I E;  2VUR A;  5AFU L;  5JDM A;  4QKN A;  4HWI B;  2DCF A;  3N2K E;  3AXJ B;  3QB5 K;  5KDM C;  1Z0P A;  1G8X A;  1FEW A;  2EHO C;  2W67 A;  2Q9Q D;  2XQ4 A;  2HPL A;  4U7I A;  2LOS A;  2NTX A;  5E0O A;  4PK4 A;  2X0H A;  2OA5 A;  2XPK A;  3PU3 A;  4KUM B;  4E7Z A;  5EK2 A;  5ABE A;  3T1Y T;  3NRX A;  4I55 E;  3AEA A;  5A1L A;  4EAH A;  3EAM A;  5LNK A;  2CXL A;  1U4Q A;  2LRK A;  2V6X A;  5AQU B;  2VK9 A;  4YSX A;  5HAX A;  5JQG E;  2UXC T;  1SHZ C;  2H3R A;  3UU4 A;  3CX8 B;  2LRL A;  2WY2 A;  1D0Z A;  2CBJ A;  4DID B;  4JI0 T;  4GIW A;  1HX1 B;  2LE8 A;  1SE7 A;  4A98 A;  1QSD A;  1J1J A;  2IAK A;  2CHO A;  2WU5 A;  3LJC A;  2N9D A;  3PUY F;  4IE6 A;  3JC6 C;  4PK5 A;  2LEH A;  3E08 A;  1VCT A;  4KI0 F;  4YFS A;  3X1D A;  4AQG A;  3LG7 A;  2QYW A;  2W4X A;  5DJQ C;  3S4U A;  2P9B A;  1UX5 A;  2RP4 A;  4YTN A;  1XMO T;  1HG2 A;  4X66 T;  4QXC B;  2DWK A;  3FZF B;  3DJB A;  4GYS A;  4I4T E;  4MBQ A;  4PK6 A;  3RRW A;  3SRZ A;  2JRK A;  3C98 B;  1KNP A;  2MYS A;  4KBM B;  3TLW A;  3AVS A;  3ZT7 A;  4KHP T;  5FNV E;  2XZE A;  3NBX X;  1SUM B;  3MXZ A;  4WBO A;  3ZSS A;  4LFB T;  2NW7 A;  2YOE A;  2R6G F;  2FBW A;  2XQ5 A;  2XY8 B;  3VRA A;  4DV2 T;  2WP9 A;  3O9X A;  1YW0 A;  3JAF A;  4KHZ F;  4PJJ A;  4ZHQ E;  4O4L E;  4HE8 A;  4YHH T;  4O8S A;  2YDQ A;  5HCM A;  3PUS A;  1ZV4 X;  4WW0 A;  3VR8 A;  5LGT B;  1HTJ F;  3NZQ A;  2J47 A;  2WDQ A;  2X9H A;  3ONX A;  3MKD A;  4IHJ E;  2KMF A;  3DTO A;  3HKB E;  3ZMT B;  2IC9 A;  4DV4 T;  5CJ5 A;  4CI2 B;  2Z6E A;  5JDN A;  2NWB A;  2FUP A;  3EAB A;  3JAE A;  3AED A;  5J0Z A;  4TUY E;  4ZEY A;  2A2F X;  5FL0 A;  1UUS A;  5JDL A;  3P50 A;  2UXN B;  1YKH B;  2RA1 A;  3NZP A;  4O2A E;  2L3L A;  3BQL A;  1MMG A;  5F3J A;  3F31 A;  5JH7 E;  2OLT A;  3AA1 B;  3MK7 C;  1WR6 A;  4AXP A;  2WU2 A;  3N2O A;  4IST A;  4HFE A;  1MNE A;  5H6R B;  2CBI A;  3PTR B;  5JDQ A;  1ZEE A;  2KIN B;  3AEG A;  4TNW A;  5LHI B;  5LHG B;  4EED A;  4LF6 T;  3AVR A;  3QOF A;  2IW5 B;  4PFO A;  4ZI3 C;  1J5E T;  4DUY T;  1HNW T;  2H89 A;  2V7M A;  1E1H B;  1D0Y A;  2HN1 A;  3K1S A;  3L39 A;  2CHN A;  3D0T A;  4MHC A;  2GK9 A;  5TAO A;  3SS1 A;  3PUZ F;  2M6B A;  1SA0 E;  1N36 T;  2DWG A;  2E9X A;  2EHO A;  2E2A A;  2JMK A;  5LCY A;  4UVA B;  4GK5 E;  2G0U A;  4PJN A;  5HWY A;  3VKG A;  4AQF C;  4L0R A;  4I43 B;  2JQQ A;  4DUZ T;  1YD8 G;  4ZI2 D;  1W0A A;  5JTG A;  3ABV A;  3N9Q A;  2JPF A;  2W63 A;  2LKH A;  3IF8 B;  3NKZ A;  5HEG A;  5EK3 A;  3GN5 A;  2J62 A;  3O1J A;  4FI5 A;  3UQ4 A;  2FJB A;  2V5C A;  3V5U A;  2WDV A;  1T72 A;  1D1C A;  5AQR B;  3ZLI A;  1R8I A;  2M6I A;  4LMK A;  5DQW A;  2VB6 A;  3ZMZ B;  5C2T A;  5LB7 B;  4Z91 A;  3HL6 A;  5FXZ A;  2C5J A;  3F2E A;  3AA6 B;  3C4X A;  4HTE A;  4JUY A;  3AB3 B;  1KF6 A;  3I9Y A;  4IE4 A;  2XHE B;  1U5P A;  2XAG B;  2XQ3 A;  2X9X A;  3DP7 A;  1XZY A;  2NW9 A;  5AQP B;  2I6H A;  2VKD A;  3HKD E;  3PUG A;  1J5W A;  2V7I A;  4JLE A;  4YJ2 E;  4DV3 T;  2VVS A;  4AKH A;  1OED A;  3OYX A;  3RYF E;  4X64 T;  2XQ9 A;  1NEK A;  2M67 A;  3LK2 B;  4DR4 T;  4U74 A;  3P4P A;  3ZYK A;  4DR3 T;  4B3S T;  3SFE A;  3Q5D A;  5JRC A;  1KK7 A;  2N1G A;  5L2L A;  1Z8U A;  3RGL A;  2KZ7 B;  4UVC B;  4QHO A;  3CX6 B;  4IL4 A;  2UUB T;  3HR0 A;  3AE5 A;  5AQG B;  3QUJ A;  4X1Y E;  2VAS A;  4TX5 A;  1N32 T;  5AQV B;  1NAF A;  2KLQ A;  2WMO A;  1IAP A;  4YY3 T;  1OED C;  2XAH B;  5AQQ B;  2DHR A;  4JBW F;  1WFD A;  5ABG A;  3MZK B;  2ACZ A;  4H9R C;  2WB5 A;  3JC6 D;  1BR4 A;  3I0Q A;  2A9U A;  2JJ9 A;  3PUA A;  2KSR A;  2XQ7 A;  3FB2 A;  4TN7 B;  5HEU A;  2BKP A;  1LRZ A;  2VQE T;  2UUA T;  4Z90 A;  2L9Q A;  2E5V A;  4JI6 T;  1FMV A;  4U3C A;  2VKJ A;  2AE9 A;  4U72 A;  4ERR A;  4YT0 A;  4A5X A;  4B3R T;  2X9Y A;  3HI2 A;  2CXD A;  2PTF A;  3RYI E;  3J9X 1;  2PFV A;  2WDR A;  4IRE A;  3ANW B;  2IHR 1;  4LF7 T;  2DLR A;  2XQA A;  3RRC A;  2XAS B;  5LA6 E;  2CE7 A;  3SOL A;  5CA0 E;  2MPK A;  2XM1 A;  1XWM A;  2D9D A;  1JNZ A;  4X20 E;  4YHJ A;  5HEH A;  3U78 A;  2FJE A;  4AKR B;  2WCA A;  3I0O A;  3ZCJ A;  2CXF A;  3LK4 2;  2BVM A;  1S94 A;  4TWD A;  1G73 A;  2BZB A;  4CQI A;  3UU3 A;  4QH1 A;  5FXX A;  3OPC A;  3UQ7 A;  5AQH B;  2V26 A;  2CLY B;  3ZT6 A;  1US7 B;  3RIA A;  4CXY A;  3UU8 A;  5JVD E;  1CUN A;  1BR0 A;  1CHU A;  2IUB A;  3ZYM A;  3RIU A;  4AIS A;  3ZEF B;  3CX7 B;  1HS7 A;  3TLV A;  1IJ6 A;  2WZH A;  2XAF B;  2V6Y A;  4QX8 B;  5AQK B;  5ADX L;  4IE5 A;  2K3W A;  1I6Z A;  2UXB T;  1T8B A;  2CA5 A;  4UEM A;  4HWH A;  4H9N C;  4PJM A;  3CKD A;  4ISS A;  1VCS A;  2Y6X A;  3UFE A;  3RYC E;  4UR9 A;  4Z8X A;  3T8O A;  2BKO A;  4LF9 T;  2ZM6 T;  4JI1 T;  4OK0 A;  4LF5 T;  1WRD A;  2XQ8 A;  5FXV A;  3IBP A;  5CB4 E;  1HFA A;  2YDR A;  4KX6 A;  3CK6 A;  3QC9 A;  4LMJ A;  3AE4 A;  3L09 A;  3R6N A;  2KWI B;  4HFC A;  2E5L T;  2QGS A;  1BR2 A;  3RKO A;  1MMA A;  1Y64 B;  1IJ5 A;  2BVL A;  2J4G A;  3AAE B;  4I0U A;  2CEA A;  1FJG T;  5L3B B;  4HN9 A;  1LVK A;  3N9N A;  4P0B A;  4UVB B;  5LJN A;  3WAK A;  4IDQ A;  2D0U A;  2D0T A;  3PU8 A;  5ETW A;  4ADZ A;  2J1D G;  4V1A v;  3KFW X;  3J7Y q;  4LFC T;  5FY0 A;  4AKI A;  2OV9 A;  5HWX A;  2JQH A;  2YU1 A;  5AQT B;  4UXN B;  5FXW A;  4F8H A;  5DAB A;  3ZJ1 A;  4ZI3 D;  5FVK A;  2VKH A;  4G63 A;  2FJA A;  1HR0 T;  5EZY E;  1MND A;  3N9O A;  5LMU T;  3KVB A;  3OJA A;  3NVO A;  3SFD A;  3PV0 F;  3A8Y C;  4ANJ A;  2MAW A;  4HGA A;  4ZZB A;  2WAU A;  4CI1 B;  2YN6 A;  3LBX B;  1DU2 A;  1UUR A;  1OED B;  3I1A A;  2ZM0 A;  2CWO A;  2CRB A;  4IGU A;  2EHO B;  4IDN A;  2WWU A;  3CWZ B;  4TWH A;  4EXT A;  5FP3 A;  4U33 A;  4YLH A;  4EGW A;  3ZMV B;  2VVN A;  1IBK T;  4XBF B;  1XDP A;  3MJX A;  5J1G A;  3UUL A;  1D1A A;  4TV9 E;  4CI3 B;  2DL1 A;  4QXH B;  3P4Q A;  4YJ3 E;  4HWF A;  2LOP A;  3GA8 A;  2KXP B;  3E0Z A;  1QUU A;  4E7S A;  2V1D B;  2LHR A;  4OFZ A;  3ZC0 A;  2PBI A;  3AAA B;  3LDQ B;  5L4E A;  4CN1 A;  4YSZ A;  4COF A;  2HPJ A;  2W66 A;  3FBL A;  4GYR A;  1VRB A;  3OVU A;  4L9I A;  5JR9 C;  4AI6 A;  5EK4 A;  3FZH B;  2F4V T;  2WQY A;  4C91 A;  4PAG A;  4ZXL A;  4H9P C;  3EVY A;  2IML A;  4I50 E;  3ZMU B;  1V9D A;  1W09 A;  2IDO B;  4TZ4 C;  4B6X A;  1MIW A;  2ODV A;  2YDS A;  3ZN0 B;  3L3P A;  5FY7 A;  2JQ9 A;  3GMI A;  3K3O A;  5FKY A;  1WLX A;  4X65 T;  2BG9 A;  3KIN B;  4NIQ A;  3P4S A;  5LBQ B;  3ZMS B;  1HNX T;  1JNR A;  1IBM T;  1EZ3 A;  2V6Y B;  3E22 E;  1D0X A;  4H9S E;  4PW8 A;  4DR5 T;  3GN5 B;  3FZL B;  2CCQ A;  1HG5 A;  4HFV A;  3RKG A;  4ASK A;  4CZZ B;  4CXX A;  5HXS A;  4LFA T;  4JI2 T;  2Y48 B;  3LBX A;  3P4W A;  4XZC A;  2EHO D;  4OX9 T;  4DND A;  2XSB A;  2XQY A;  4U31 A;  5J2T E;  1N34 T;  2CMR A;  2XSA A;  2WMN A;  4L5G A;  3KBT A;  4ILC A;  3RX6 A;  5AQF B;  4DVD A;  4EYU A;  2BS3 A;  4O4H E;  5F5W A;  3AE6 A;  4XAX B;  4EIW A;  2NR4 A;  3B57 A;  5ABF A;  1ZKE A;  3TLT A;  3VHL A;  4JI4 T;  3UUX B;  2B1E A;  3O1I A;  2LT3 A;  2BDE A;  1MMD A;  1OXZ A;  3ZT5 A;  2C0S A;  5C8Y E;  3AEF A;  3U3I A;  5CGM A;  4OHF A;  3EDV A;  3HA4 A;  2QVA A;  3B13 A;  2WBL A;  2SPC A;  4DR2 T;  3P8C D;  3IHR A;  5ABH A;  3ZKR A;  4O4I E;  2X66 A;  4G2A A;  4QWN B;  5LGN B;  5LBM A;  3AE7 A;  3VRB A;  1VOM A;  3TLS A;  2VL0 A;  3JCF A;  2V7K A;  5L3E B;  5HXC A;  2LSK A;  1XMQ T;  4IE0 A;  2XAJ B;  2K9A A;  5LJM A;  5HEJ A;  5AQJ B;  3B5M A;  2ZM2 A;  1FMW A;  3KV6 A;  3Q2M A;  3TLU A;  2YK0 A;  1MIV A;  3C50 A;  4ILB A;  3N2G E;  4YTM A;  2W2U A;  3EDU A;  1L0V A;  4JI5 T;  3RYH E;  3UUN A;  3C4Z A;  3LFM A;  1ZOY A;  2QRX A;  2RPA A;  3L8R A;  4ZS3 A;  1KNZ A;  3AE2 A;  3ZC1 A;  1X79 A;  4AIU A;  1X9B A;  2WZI A;  2H88 A;  5LGU B;  2BKN A;  3AA0 B;  4ILA A;  2Q9Q A;  3H3A A;  3ONJ A;  2MBG A;  4CN6 A;  3N5L A;  3UFG A;  4DR1 T;  3KV9 A;  1WCR A;  3CQX C;  5L4H A;  2UXX B;  2LSJ A;  3P4R A;  4O2B E;  5JDF A;  3PJA J;  5M4Y A;  4LF8 T;  1IBL T;  3RC3 A;  1O3X A;  4ILU A;  3BK9 A;  4P1N A;  4DMW A;  4F6R C;  1UK5 A;  5CA1 E;  2MOZ A;  5LG4 A;  1Y01 A;  1WYB A;  3Q5W A;  3QB5 A;  3T1H T;  3N9L A;  2XTL A;  2C5I T;  1I94 T;  1H7C A;  2V8S V;  5AQL B;  2VKO A;  4IT4 A;  4IDO A;  5L47 A;  3CQG B;  5LYJ E;  3Q9D A;  1MMN A;  4U7Y A;  4TNV A;  4JI8 T;  2K5B B;  3V5S A;  2A3D A;  3PUX F;  3PE0 A;  4HEA A;  4QXB B;  3Q5X A;  4HFD A;  4MAL A;  3O1H A;  4OYJ A;  4QX7 B;  1B7T A;  3C4W A;  4UV9 B;  5LHH B;  4DR6 T;  4GKK T;  4HFI A;  2BBJ A;  2CPT A;  3MAC A;  4O4J E;  4JEH B;  5IWA T;  3AE9 A;  3NRY A;  4EZ4 A;  5HXE A;  5L3C B;  4A97 A;  4CN4 A;  3CIR A;  3RH3 A;  3RQW A;  1YQ4 A;  1XNR T;  4MLK A;  2QA7 A;  2W61 A;  2KWH A;  3FZK B;  2H7V C;  5HXH A;  4DV5 T;  2PJQ A;  2E9X C;  2XJ7 A;  3RHW A;  2CM0 A;  3RI5 A;  4GKJ T;  4TWF A;  3HKE E;  3CPZ A;  2X51 A;  5IYZ E;  2ZLY A;  3TKL B;  3ZN1 B;  4AQF A;  4EOZ B;  1M62 A;  2UUC T;  3KVA A;  5JRE A;  2UXD T;  3KV5 A;  4IDZ A;  2X67 A;  1HX8 A;  5HXR A;  2W00 A;  1MIY A;  4IDP A;  1W0B A;  2YKS A;  5HEO A;  5JR9 B;  2X9W A;  4C90 A;  4GOU A;  3IEE A;  2YEV C;  2N2N A;  5FVL A;  2Y8D A;  3WI3 A;  2PG8 A;  3KDS E;  2VL8 A;  3C51 A;  3UUM A;  1LKX A;  4A56 A;  3RLF F;  4K0K T;  3G06 A;  3UUB A;  4BA9 A;  2I0M A;  3HKC E;  1OWA A;  5BR8 T;  2HH7 A;  4NUV A;  5KMG P;  2DNX A;  5C3J A;  2JQK A;  2LKG A;  3OBV E;  5AQI B;  5FMN A;  4BJN A;  2YU2 A;  3ANW A;  4CXW A;  3OYZ A;  5HCJ A;  4WBN E;  5JDG A;  1WYC A;  3AA7 B;  3A5X A;  2IC6 A;  1M7K A;  3ZST A;  4J2C A;  2JIW A;  5AQO B;  3RF1 A;  3O4X E;  2HHH T;  4LF4 T;  3RC8 A;  3N9M A;  2D2S A;  2K24 A;  2YIN A;  2E9X D;  3JAD A;  4OYK A;  2Q9Q C;  3A7M A;  3RQU A;  3H37 A;  2K48 A;  1UGO A;  2W62 A;  3VR9 A;  3PUV F;  4EV6 A;  1N33 T;  1XNQ T;  3AEC A;  4MFR A;  5JDH A;  2LJL A;  2LM2 A;  2HN2 A;  3EUH A;  4PNI A;  3ZCI A;  2V7L A;  5JRC B;  4M1P A;  4WZX A;  2VQF T;  5FY1 A;  3K8P C;  4UF0 B;  2KND A;  3AE3 A;  2BG9 B;  4B3M T;  4DV0 T;  2XQ6 A;  1KNR A;  4NPP A;  5KX5 E;  1LVF A;  3AAI A;  3ESL A;  4IIJ E;  5HYA A;  5LMN T;  1HNZ T;  4PFP A;  4DO0 A;  1YXR A;  5AQN B;  4DBQ A;  5BMV E;  5IUX A;  3PUR A;  4QH5 A;  4UIG A;  4UV8 B;  2BG9 E;  4X5T A;  4EZH A;  3RIU C;  2VWA A;  1UX4 A;  3I9W A;  4ZOL E;  5DQV A;  1T7S A;  4IE7 A;  4X1K E;  2WWV A;  4ZI7 E;  2BS2 A;  5KXJ A;  5LP6 E;  2UU9 T;  3M3Z B;  2X0Y A;  4EB6 E;  3UTK A;  3PDY A;  4DR7 T;  2MTQ A;  2KT9 A;  5LG3 A;  3ZYL A;  2NW8 A;  4BJM A;  1HF8 A;  1OED E;  5AQS B;  5F8P A;  3MA9 A;  2IIU A;  4JEU B;  4ZZC A;  1IZN B;  2BS4 A;  4QH4 A;  4KP3 C;  3UU5 A;  5FYM A;  3EI0 A; 
#chains in the Genus database with same CATH homology
 2ACX A;  2WM9 A;  3BQI A;  4TV8 E;  3WAJ A;  4HKA A;  3W15 B;  2LSG A;  1UCU A;  3RPU A;  4ZI2 D;  3J7Y q;  2E8I A;  2LSY A;  2V7J A;  3CQC B;  1YKE B;  3M65 A;  3KBU A;  3QK6 A;  4PJL A;  1HCI A;  1BR1 A;  2H7O A;  2E9X B;  3P7I A;  3VKH A;  2A72 A;  1T98 A;  3R84 B;  4H9O C;  4NUU A;  3ZPO A;  3PUQ A;  1ZHC A;  3FBZ A;  3ETU A;  4UEL A;  3VU7 H;  1S35 A;  2Q9Q B;  2CLY C;  2LHN A;  5LXT E;  2ES0 A;  2XUE A;  3OKQ A;  5L3G B;  3UT5 E;  4AKG A;  2X0L B;  3C64 A;  4UF0 A;  3FHN A;  2L8K A;  1NWM X;  3CML A;  4BAY B;  2ZM8 A;  4DBR A;  3SWH A;  2CWY A;  3GWH A;  5IHY A;  2JMH A;  4H63 H;  5LOV E;  3K3N A;  4P0A A;  3ETV A;  3LK3 B;  4ZI2 C;  3CVR A;  2NOX A;  4N78 D;  4K0U A;  3ZCI A;  3K3Q C;  3KV4 A;  4GK0 E;  2LSI A;  2XAQ B;  5GON E;  1D1B A;  2NP9 A;  1AJ3 A;  5JR9 A;  3FXE B;  1FIO A;  4EYY R;  5J2U E;  5L3F B;  2NTY A;  4DMV A;  2D5U A;  4P09 A;  3FXD B;  4KMC A;  3N9P A;  2DI4 A;  4ZS2 A;  3F57 A;  4EXT A;  2C5K T;  2I59 A;  2LM9 A;  3BQK A;  2X68 A;  4H63 V;  2W0G A;  2MBG A;  2ZMA A;  4WNK A;  2ODU A;  4H9Q C;  2WSS V;  4FJO A;  5H6Q B;  4X1I E;  5AFU L;  5JDM A;  4QKN A;  2DCF A;  3N2K E;  5KDM C;  1Z0P A;  1G8X A;  1FEW A;  2EHO C;  2Q9Q D;  2HPL A;  5E0O A;  2LOS A;  2NTX A;  5EK2 A;  4PK4 A;  2OA5 A;  3PU3 A;  4KUM B;  4E7Z A;  3NRX A;  4I55 E;  5A1L A;  4EAH A;  5LNK A;  2CXL A;  1U4Q A;  5JQG E;  2VK9 A;  5HAX A;  1SHZ C;  2H3R A;  3CX8 B;  1D0Z A;  4GIW A;  2LE8 A;  1QSD A;  2IAK A;  4IE6 A;  3LJC A;  4QXH B;  4ADZ A;  2N9D A;  4YFS A;  4PK5 A;  3JC6 C;  4AKL A;  2LEH A;  3E08 A;  4AQG A;  3LG7 A;  5DJQ C;  3S4U A;  2P9B A;  1UX5 A;  2RP4 A;  1HG2 A;  4QXC B;  2DWK A;  4GYS A;  3DJB A;  4I4T E;  4PK6 A;  4MBQ A;  3RRW A;  3SRZ A;  3ZJ2 A;  2JRK A;  3C98 B;  2MYS A;  4KBM B;  5L3D B;  3AVS A;  5FNV E;  3NBX X;  3MXZ A;  4WBO A;  2NW7 A;  3O9X A;  1YW0 A;  4PJJ A;  4ZHQ E;  4O4L E;  4HE8 A;  4O8S A;  3PUS A;  1ZV4 X;  4WW0 A;  5LGT B;  1HTJ F;  3NZQ A;  4IHJ E;  2X9H A;  3ONX A;  3ZMT B;  3MKD A;  3DTO A;  2KMF A;  3HKB E;  2IC9 A;  4CI2 B;  2Z6E A;  5JDN A;  2NWB A;  4TUY E;  2A2F X;  5JDL A;  1YKH B;  2UXN B;  2RA1 A;  3NZP A;  4O2A E;  2L3L A;  3BQL A;  1MMG A;  5F3J A;  3F31 A;  5JH7 E;  3AA1 B;  3MK7 C;  1WR6 A;  4AXP A;  3N2O A;  4IST A;  5H6R B;  1MNE A;  5JDQ A;  5LHI B;  3PTR B;  5LHG B;  1ZEE A;  2KIN B;  3AVR A;  2IW5 B;  4PFO A;  4ZI3 C;  2V7M A;  4I43 B;  1E1H B;  1D0Y A;  5TAO A;  3D0T A;  4MHC A;  2GK9 A;  3SS1 A;  1SA0 E;  2DWG A;  2E9X A;  2EHO A;  2JMK A;  5LCY A;  4UVA B;  4GK5 E;  2G0U A;  4PJN A;  5HWY A;  3VKG A;  4AQF C;  4L0R A;  2JQQ A;  1YD8 G;  3N9Q A;  2JPF A;  2W63 A;  3IF8 B;  5EK3 A;  3GN5 A;  3O1J A;  4FI5 A;  3V5U A;  1D1C A;  3ZLI A;  5DQW A;  2VB6 A;  3ZMZ B;  3HL6 A;  5FXZ A;  2C5J A;  3F2E A;  3AA6 B;  3C4X A;  4HTE A;  4JUY A;  3AB3 B;  3I9Y A;  4IE4 A;  2XHE B;  1U5P A;  2XAG B;  2X9X A;  3DP7 A;  2NW9 A;  2VKD A;  3HKD E;  3PUG A;  2V7I A;  4JLE A;  4YJ2 E;  4AKH A;  3OYX A;  3RYF E;  3LK2 B;  2M67 A;  4U74 A;  3ZYK A;  5JRC A;  1KK7 A;  2N1G A;  5L2L A;  2KZ7 B;  4UVC B;  4QHO A;  3CX6 B;  3HR0 A;  3QUJ A;  4X1Y E;  2VAS A;  4TX5 A;  1NAF A;  2KLQ A;  2WMO A;  1IAP A;  2XAH B;  2DHR A;  3MZK B;  4H9R C;  3PUA A;  3JC6 D;  1BR4 A;  3I0Q A;  2JJ9 A;  3FB2 A;  4TN7 B;  1LRZ A;  2L9Q A;  1FMV A;  2VKJ A;  4U72 A;  4ERR A;  2X9Y A;  3HI2 A;  2CXD A;  3RYI E;  3J9X 1;  2PFV A;  3ANW B;  2DLR A;  3RRC A;  2XAS B;  5LA6 E;  2CE7 A;  3SOL A;  5CA0 E;  4X20 E;  4YHJ A;  3U78 A;  4AKR B;  3I0O A;  3ZCJ A;  2CXF A;  3LK4 2;  2BVM A;  1S94 A;  1G73 A;  2BZB A;  4CQI A;  5FXX A;  2V26 A;  2CLY B;  1US7 B;  4CXY A;  5JVD E;  1CUN A;  1BR0 A;  3ZEF B;  3ZYM A;  1HS7 A;  3CX7 B;  1IJ6 A;  2XAF B;  4QX8 B;  5ADX L;  4IE5 A;  2CA5 A;  4UEM A;  4H9N C;  4PJM A;  3CKD A;  4ISS A;  2Y6X A;  3UFE A;  3RYC E;  4Z8X A;  3T8O A;  4OK0 A;  1WRD A;  5FXV A;  3IBP A;  5CB4 E;  1HFA A;  3R6N A;  3QC9 A;  3L09 A;  2KWI B;  2QGS A;  1BR2 A;  3RKO A;  1MMA A;  1Y64 B;  1IJ5 A;  2BVL A;  3AAE B;  2CEA A;  5L3B B;  4HN9 A;  1LVK A;  3N9N A;  4P0B A;  4UVB B;  5LJN A;  3WAK A;  2D0U A;  2D0T A;  3PU8 A;  5ETW A;  4AKI A;  2J1D G;  4V1A v;  3KFW X;  5FY0 A;  5HWX A;  2YU1 A;  5FXW A;  4UXN B;  5DAB A;  3ZJ1 A;  4ZI3 D;  2VKH A;  4G63 A;  5EZY E;  1MND A;  3N9O A;  3KVB A;  3OJA A;  4ANJ A;  4HGA A;  4CI1 B;  2WAU A;  3LBX B;  3I1A A;  2ZM0 A;  2CWO A;  4IGU A;  2EHO B;  2WWU A;  3CWZ B;  5FP3 A;  4XBF B;  4YLH A;  3ZMV B;  3MJX A;  5J1G A;  3UUL A;  1D1A A;  4TV9 E;  4CI3 B;  4YJ3 E;  2LOP A;  3GA8 A;  2KXP B;  3E0Z A;  1QUU A;  4E7S A;  2V1D B;  2LHR A;  4OFZ A;  3ZC0 A;  2PBI A;  3AAA B;  2HPJ A;  3FBL A;  4GYR A;  4AI6 A;  1VRB A;  4L9I A;  5JR9 C;  5EK4 A;  4C91 A;  4PAG A;  4H9P C;  3EVY A;  4I50 E;  3ZMU B;  1V9D A;  4TZ4 C;  4B6X A;  1MIW A;  2ODV A;  3ZN0 B;  3L3P A;  5FY7 A;  3GMI A;  3K3O A;  1WLX A;  3KIN B;  3ZMS B;  5LBQ B;  1EZ3 A;  3E22 E;  4PW8 A;  1D0X A;  4H9S E;  3GN5 B;  4ASK A;  2CCQ A;  1HG5 A;  4HFV A;  4CZZ B;  4CXX A;  5HXS A;  2Y48 B;  3LBX A;  4XZC A;  2EHO D;  4DND A;  2XQY A;  5J2T E;  2CMR A;  2WMN A;  4L5G A;  3KBT A;  3RX6 A;  4DVD A;  4EYU A;  4O4H E;  4XAX B;  4EIW A;  3B57 A;  1ZKE A;  3VHL A;  3UUX B;  2B1E A;  3O1I A;  2BDE A;  2LT3 A;  1MMD A;  1OXZ A;  5C8Y E;  2C0S A;  3U3I A;  4OHF A;  3EDV A;  3HA4 A;  3B13 A;  2WBL A;  2SPC A;  3P8C D;  3IHR A;  4O4I E;  2X66 A;  4G2A A;  4QWN B;  5LGN B;  5LBM A;  1VOM A;  2V7K A;  5L3E B;  5HXC A;  2LSK A;  4IE0 A;  2XAJ B;  2K9A A;  5LJM A;  2ZM2 A;  1FMW A;  3KV6 A;  3Q2M A;  2YK0 A;  1MIV A;  3C50 A;  3N2G E;  3EDU A;  3RYH E;  3UUN A;  3C4Z A;  3LFM A;  4ZS3 A;  1KNZ A;  3ZC1 A;  1X79 A;  5LGU B;  3AA0 B;  2Q9Q A;  3H3A A;  3N5L A;  3KV9 A;  3CQX C;  5M4Y A;  2LSJ A;  2UXX B;  4O2B E;  5JDF A;  3RC3 A;  1O3X A;  4ILU A;  3BK9 A;  4F6R C;  4DMW A;  5CA1 E;  2MOZ A;  5LG4 A;  1WYB A;  3Q5W A;  3N9L A;  2XTL A;  2C5I T;  1H7C A;  2VKO A;  5LYJ E;  3CQG B;  3Q9D A;  1MMN A;  2K5B B;  3V5S A;  2A3D A;  4HEA A;  3PE0 A;  4QXB B;  3Q5X A;  4MAL A;  4OYJ A;  3O1H A;  4QX7 B;  4UV9 B;  1B7T A;  3C4W A;  5LHH B;  3MAC A;  4O4J E;  4JEH B;  3NRY A;  4EZ4 A;  5HXE A;  5L3C B;  3RH3 A;  4MLK A;  2QA7 A;  2W61 A;  2KWH A;  5HXH A;  2H7V C;  2PJQ A;  2E9X C;  2CM0 A;  3HKE E;  3CPZ A;  2X51 A;  5IYZ E;  2ZLY A;  3TKL B;  3ZN1 B;  4AQF A;  4EOZ B;  3KVA A;  5JRE A;  3KV5 A;  4IDZ A;  2X67 A;  1HX8 A;  5HXR A;  2W00 A;  1MIY A;  5JR9 B;  2X9W A;  4C90 A;  4GOU A;  3IEE A;  2YEV C;  2N2N A;  2Y8D A;  3WI3 A;  2PG8 A;  3KDS E;  2VL8 A;  3C51 A;  3UUM A;  1LKX A;  4A56 A;  4BA9 A;  3HKC E;  1OWA A;  2HH7 A;  4NUV A;  5KMG P;  2DNX A;  3OBV E;  4BJN A;  5FMN A;  4CXW A;  2YU2 A;  3ANW A;  3OYZ A;  4WBN E;  5JDG A;  1WYC A;  3AA7 B;  3A5X A;  2IC6 A;  3RC8 A;  4J2C A;  3O4X E;  3N9M A;  2D2S A;  2K24 A;  2YIN A;  2E9X D;  4OYK A;  2Q9Q C;  3H37 A;  2K48 A;  2W62 A;  4MFR A;  5JDH A;  2LJL A;  3EUH A;  4PNI A;  5JRC B;  2V7L A;  4M1P A;  5FY1 A;  3K8P C;  4UF0 B;  2KND A;  5KX5 E;  1LVF A;  3AAI A;  3ESL A;  4IIJ E;  5HYA A;  4PFP A;  4DO0 A;  5BMV E;  4DBQ A;  3PUR A;  4UIG A;  4UV8 B;  4EZH A;  2VWA A;  1UX4 A;  3I9W A;  4ZOL E;  5DQV A;  4IE7 A;  4X1K E;  4ZI7 E;  5LP6 E;  4EB6 E;  3UTK A;  3PDY A;  2MTQ A;  2KT9 A;  3ZYL A;  2NW8 A;  4BJM A;  1HF8 A;  5F8P A;  3MA9 A;  4JEU B;  1IZN B;  4KP3 C;  5FYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...