3EDVA

Crystal structure of repeats 14-16 of beta2-spectrin
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
322
structure length
322
Chain Sequence
SHMRHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Spectrin beta chain, brain 1
publication title Localization and Structure of the Ankyrin-binding Site on beta2-Spectrin
pubmed doi rcsb
source organism Homo sapiens
total genus 156
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA01
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3edvA02
3R6NA 1HCIA 3KBTA 1U4QA 3F31A 2SPCA 5J1GA 3PDYA 1WLXA 2ODUA 1AJ3A 3LBXB 1CUNA 3LBXA 2ODVA 1U5PA 3EDVA 2IAKA 3PE0A 1S35A 3UULA 3KBUA 3F57A 3EDUA 1OWAA 3FB2A 3UUNA 1G8XA 3UUMA 1QUUA
chains in the Genus database with same CATH superfamily
2KSRA 5HXHA 3UTKA 4CI2B 2XPKA 5HCJA 3RYIE 5HXCA 2JMHA 2CBIA 2L8KA 2DWGA 4IIJE 2WM9A 2X0YA 3SFEA 1X79A 3AEAA 2XM2A 3MK7C 4X64T 5HXRA 3PU3A 3P7IA 3LDQB 2P9BA 2NW9A 2CWOA 2H89A 4EYUA 3N2OA 4HEAA 5HAXA 3UULA 3AEFA 1I6ZA 4AI6A 3MA9A 1UX4A 2X9HA 4H9OC 3RGLA 2UU9T 3PU8A 2B76A 2NW7A 1L0VA 2LSKA 2Q9QC 3KBTA 5AQKB 1KK7A 3F2EA 3PUAA 2UUBT 1SA0E 1IZNB 3VRAA 2HPJA 3AECA 3QB5K 3PJAJ 3EVYA 2QVAA 3PUXF 4J2CA 2KZ7B 2BG9E 4P09A 3ZMUB 1SUMB 2NWBA 2OV9A 3O1IA 2KWIB 2UXNB 3Q5XA 4LF4T 4I43B 3I9YA 3RH3A 2VKHA 3UFGA 4GKJT 1Y64B 3NRYA 3FHNA 5J2UE 1KNZA 3PE0A 3UUMA 1SHZC 5JREA 2K9AA 2ZM0A 5FY7A 3PUYF 4DO0A 1HNWT 2NTXA 4YHHT 3B57A 2J62A 4EXTA 4X1IE 4KX6A 4N78D 4EZHA 5IUXA 3KVAA 2XTLA 5IWAT 4U74A 3HKCE 2BS4A 2CM0A 2D2SA 4CN4A 2SPCA 2R6GF 5DQWA 1X9BA 3IEEA 2Z6EA 4JI5T 2ZM2A 4TX5A 4JI3T 1Z8UA 4IDPA 3BQLA 3IA3A 3QUJA 3CQGB 3ZSTA 4YY3T 4UVAB 4ZZCA 3KV6A 5JR9A 3NBXX 3CX6B 3L3PA 3RIUC 1YD8G 4K0KT 4ANJA 2JIWA 5JQGE 2D9DA 3UU4A 1J1JA 2V7KA 3A7MA 4QX7B 3ZJ1A 3IHRA 5AQFB 4JEUB 3RC3A 4UV8B 2W61A 3NVOA 4MFRA 1XMOT 5M4YA 3RF1A 3ZYKA 4E7SA 4A98A 2AE9A 4H9SE 3GMIA 4G2AA 3HI2A 4E7ZA 4HFIA 4BAYB 5ABHA 3H3AA 1D1BA 1G8XA 4IREA 3RPUA 3TLUA 2XQ9A 2V6YA 2H7OA 2E2AA 3OTOT 4QX8B 1MIWA 4L9IA 3WI3A 4COFA 2HN2A 4HE8A 1KF6A 3TLSA 1WR6A 2OA5A 4AQFC 2DWKA 4L0RA 2H3RA 4HWHA 3CMLA 5HWXA 4KMCA 2JPFA 3J7Yq 4P1NA 1T8BA 3UUXB 3TLWA 5CB4E 2ODVA 4X20E 2KMFA 2FUPA 2HHHT 2BDEA 3FZLB 4JYAT 4GYSA 4NXMT 2VKOA 3FZFB 3ZMZB 1B7TA 2MBGA 3K8PC 4AQGA 3KV9A 3P4RA 4G63A 2LT3A 2BKPA 3I1AA 5J0ZA 2WB5A 1N33T 2BG9A 5CFBA 4TWFA 4KUMB 1T7SA 4PW8A 4EGWA 2FJEA 3AA7B 5L4EA 3ABVA 3DP7A 4O4IE 4BJNA 2YEVC 5BMVE 3MJXA 2K3WA 4TNVA 5AQQB 3CKDA 4X1YE 2XQ8A 1YW0A 2VVSA 3G06A 1G73A 4HGAA 1IAPA 3NZPA 2BKOA 1WR0A 4TV8E 2X66A 1HS7A 2V5DA 1IJ5A 3RLFF 3KVBA 5LHIB 1E7PA 4WZXA 4H63H 4HWCA 5CGMA 2CA5A 5FXWA 1H7CA 2C5IT 4YSXA 2WWUA 3LK2B 3ZYMA 1WYCA 1ZKEA 5LGTB 3FXEB 5FP3A 5AQIB 4V1Av 1M7KA 2V6YB 4IE6A 2JRKA 1JNRA 3AE8A 3OJAA 3ZCJA 4JV5T 2A3DA 3N9NA 4EYYR 2UUAT 2NOXA 5HCMA 4KI0F 3P4WA 3UQ7A 4B3MT 2YDSA 3WAJA 4EB6E 2Y6XA 4UELA 2XY8B 4MALA 4DV5T 4EV6A 2IMLA 4OYKA 2XASB 1KFYA 4LFBT 1ZP0A 5LJNA 4HFCA 2X9YA 3W15B 4CI1B 4U31A 2LSIA 3RYFE 2WU5A 2BG9B 1OEDC 3OKQA 3HL6A 2IW5B 1QUUA 1XMQT 1Z0PA 3CX7B 1W9RA 2ES0A 3AAAB 1HX1B 5LNKA 2YDQA 5L4HA 2CWYA 2IHR1 3ZT6A 3HKEE 5JDNA 2CHOA 3E0ZA 4DV6T 2OLTA 4EEBA 2M67A 4H9NC 4MBQA 1LRZA 4X5TA 4WBNE 4LMKA 5IYZE 4YLHA 1KNRA 4A97A 1LKXA 3UT5E 1MMGA 5LJMA 2WCAA 5ADXL 4UR9A 3MACA 1BR2A 2FJDA 4YTMA 2EHOA 5FVLA 2W2UA 4JEHB 1ZV4X 3EDUA 2C5JA 2W0GA 3P50A 2VQET 2MPKA 2W00A 2BVLA 2CXFA 4ISTA 1ZEEA 2BKNA 5DJQC 2W62A 1XNQT 2WQYA 2ZMAA 4QXHB 4UF0A 3I9WA 2F4VT 3PV0F 4FI5A 5JDMA 3ZT7A 2JQQA 4O2BE 4ILBA 1D0ZA 2Q9QD 3LK42 5F5WA 3AEEA 3V5SA 3AA1B 5JH7E 3Q2MA 4ZS3A 4IE4A 4M1PA 4IT4A 2LSGA 1VCTA 3O4XE 2CEAA 5AQSB 3JC6C 4DR3T 3P4PA 5ABFA 4Z91A 2D0UA 3JAFA 1W0AA 1HF8A 4TNWA 3HKDE 2DL1A 4ZOLE 1D1AA 4EEDA 2NW8A 3O1HA 4X1KE 1ZOYA 5AQGB 2LRLA 2YINA 4CI3B 3EAMA 3RKGA 5JDQA 2XAHB 2KLQA 3AE2A 1KNPA 4YSYA 3AE4A 2HPLA 1MIVA 4XZCA 2JQ9A 4HFHA 3FBZA 1HG5A 4L5GA 5FNVE 5EK2A 3AVRA 3PUQA 5JDLA 4F8HA 5DQVA 5KXJA 4TZ4C 2X9XA 1T98A 2Y48B 1WLXA 2HN1A 4JLEA 2C0SA 2L9QA 2IC6A 2BG9C 5JVDE 3I0OA 1MMNA 3ETUA 2VL8A 3E08A 3Q9DA 3LSVA 3ZMVB 4JI1T 3C98B 3EHZA 4FJOA 5L2LA 4WNKA 2EHOB 3BQKA 1US7B 4DUZT 3T1HT 5AQNB 5FKYA 3OBVE 2E5LT 4DV7T 3EABA 3ANWA 3ZPOA 4IE0A 3C50A 3UQ4A 3RHWA 1MNEA 3A5XA 2IIUA 2CLYB 2V7IA 2BBJA 2UXCT 1KEYA 3RKOA 4XBFB 2W63A 5A1LA 4X65T 5LBMA 4UF0B 4HWIB 5F8PA 5KDMC 4ZHQE 1LVFA 4B3RT 3PUGA 2JQHA 3GA8A 2C5KT 5AQHB 1D0YA 3SOLA 4JI8T 2N1GA 3FZKB 4H9RC 5H6QB 5KX5E 2WDRA 2WMNA 4DUYT 2E9XA 4YHJA 2CHNA 2CE7A 2WP9A 5FY0A 4PJLA 1YQ4A 2XQ5A 4O8SA 5ABFB 2MYSA 4AQYT 4WBOA 3N9OA 4I0UA 3Q5DA 5L47A 4Z8XA 1GQEA 4ADZA 4LF8T 3ZJ2A 1FJGT 2YDRA 4ZS2A 2M6BA 2YU2A 3CVRA 5C3JA 4U7IA 4I55E 3B13A 3P4QA 2LSJA 3RRWA 2VVNA 1BR0A 2UXXB 1UGOA 4I4TE 4AISA 2XZEA 3LK3B 3ZLIA 3AAIA 4TUYE 2VQFT 1NWMX 3KDSE 3AEBA 2UXDT 3UU5A 4AKRB 1BR1A 3UUNA 4CN1A 4ZI3C 3ZC1A 2KXPB 3QC9A 4EOZB 4C90A 5LG3A 4YJ2E 3SFDA 4EAHA 2WDQA 2X67A 2UXBT 2X0HA 3AE7A 3SS1A 3OPCA 2K24A 2PFVA 4LMLA 4U7YA 5L3EB 4DR6T 2ACXA 2DHRA 2GK9A 3JADA 4YT0A 1YKHB 4YSZA 3ANWB 3S4UA 1XNRT 3EDVA 1QLBA 3F57A 2FJBA 4CQIA 5ETWA 3CQCB 4ILAA 2EHOC 5AQMB 5KMGP 4A56A 1V9DA 5AQTB 3AE1A 2K48A 5FXVA 4CZZB 5LP6E 1NENA 4DMVA 2J47A 2ZM6T 5HEJA 3ZKRA 3DTOA 2E9XB 4PK6A 5FXZA 4KHZF 4C91A 2QA7A 3ZCIA 1UUSA 5L3BB 2LE8A 2L3LA 2WAUA 2E8IA 3U78A 2DI4A 2K5BB 5JR9B 3EI0A 2LLYA 5F3JA 4EIWA 4B3TT 2CXDA 5LGNB 3HKBE 3U3IA 4OFZA 3C51A 5HWYA 2LEHA 1J5ET 4PJMA 3N2GE 2LKHA 5JDGA 2X9WA 1E2AA 2XSBA 3RIAA 3EUHA 2V7LA 3KBUA 4QH1A 3AEGA 4JI4T 3Q5WA 3AAEB 2XQYA 5AFUL 4HTEA 5L3GB 4ZI7E 5L3FB 3VU7H 5EK3A 1XDOA 3WAKA 3ZT5A 4JI6T 2E5VA 4IHJE 4PAGA 1U5PA 5L3DB 3C4WA 4O2AE 4GOUA 3PURA 5J1GA 4PFPA 4U72A 1HR0T 4U2ZA 2WSSV 1DU2A 4HFBA 3PTRB 1ZHCA 3N9QA 4YFSA 5LB7B 2LOPA 2XAGB 3A8YC 1MNDA 5FMNA 3T8OA 2VKJA 3N2KE 1WRDA 2MAWA 4GYRA 3ZN0B 2LKGA 4UV9B 4OK0A 3QB5A 3AE3A 3VR9A 4DIDB 2H88A 2XAQB 1HCIA 3CWZB 4DV0T 4DBRA 4Z90A 3JCFA 5LOVE 4TV9E 1XWMA 5CJ5A 2A9UA 4UIGA 4IL4A 4NIQA 4ZI2C 3M3ZB 2YN6A 4ILUA 3FBLA 4YXDA 3K1SA 5LYJE 4QH4A 4JI7T 2XQ6A 2W4XA 3C64A 5AQUB 2ZM8A 3VKGA 2MOZA 2VK9A 2VASA 4DR2T 3L09A 2V8SV 4CN6A 4PK5A 1MMAA 1CHUA 3ZEFB 5C8YE 1UCUA 2CRBA 3JC6D 4NUUA 2V7JA 4U2YA 2NP9A 2KINB 1OEDE 1OXZA 2E9XC 5AQRB 4UXNB 2W66A 4O4LE 1UURA 2KWHA 1IJ6A 3PUWF 4K0UA 3SWHA 3RRCA 2N9DA 2WS3A 3N5LA 4UVBB 2VURA 5JR9C 2FBWA 2LRKA 1OWAA 5HXSA 3VRBA 2LM2A 3PJAA 2XAJB 2NR4A 2XJ7A 3I0QA 3FZMB 3P8CD 1U4QA 2UUCT 4BJMA 1IBLT 1N36T 2RP4A 3JAEA 2XQ7A 3NWIA 3C4ZA 2XHEB 1WFDA 3AE9A 5ABEA 2CPTA 1JNZA 1S94A 5JDFA 5CA1E 3FZHB 2PG8A 3RX6A 3RQWA 4UEMA 3TLVA 4HFEA 3BK9A 5FVKA 2XM1A 4GIWA 4DVDA 2Y8DA 5JDHA 4DR5T 2KT9A 3NRXA 3RQUA 1LVKA 2B1EA 4JI2T 5JRCA 3RI5A 1YKEB 3L39A 4JUYA 3R6NA 2QGSA 4IDOA 2CCQA 3OYZA 2N2NA 3IBPA 3LBXA 3IF8B 2V26A 5HEUA 1O3XA 1MIYA 3P4SA 3ESLA 4GK0E 4B3ST 1FMWA 3TLTA 1XZYA 4DR4T 3J9X1 2DNXA 2YKSA 3SRZA 2WMOA 3CPZA 2WDVA 2LOSA 4F6RC 1S35A 3VKHA 4H9QC 4YJ3E 4AKGA 4ILCA 3MZKB 2X51A 4P0AA 3ZN1B 1HNZT 4DMWA 1UX5A 5LHHB 3HA4A 1BR4A 1IBKT 4LF6T 2WBLA 4GKKT 4OHFA 5LHGB 5LGUB 4LF7T 1UK5A 2QRXA 2KNDA 2VL0A 4XAXB 2IDOB 3AXJA 5DABA 5HXEA 3ZMSB 2W67A 4U3CA 3UU8A 2BZBA 4O4JE 2HH7A 4HKAA 3CK6A 3O9XA 4AXPA 4CXXA 4KP3C 2FJAA 4ZI3D 5LXTE 1QSDA 1M62A 4QWNB 5LMNT 4JI0T 3ZC0A 1OEDA 2JJ9A 3FXDB 4DR1T 3DJBA 4P0BA 4PJJA 4O4HE 3KFWX 4ZZBA 2XAFB 2WWVA 5E0OA 4ZXLA 3RIFA 3H37A 3KINB 2YK0A 3ZSSA 2V5CA 5FYMA 2D0TA 5L3CB 1HFAA 3QK6A 1IBMT 3C4XA 1T72A 5TAOA 4DV1T 4CXYA 4PJNA 5JRCB 5J2TE 3O1JA 1EZ3A 4BA9A 5ABGA 3PDYA 4IDNA 2EHOD 4DNDA 4QHOA 2ODUA 2JMKA 3LBXB 4HFDA 3L8RA 2WU2A 1D0XA 3E22E 2M6IA 3AVSA 3N9LA 2XSAA 2J1DG 4NUVA 2H7VC 5GONE 3Q5EA 4DV2T 2A72A 2WZIA 2XQ4A 2VWAA 4PFOA 2RPAA 1FEWA 2XQAA 5LCYA 2VKDA 1N34T 2CMRA 1VRBA 1FIOA 3AB3B 3LFMA 3T1YT 3ONXA 3M65A 5LG4A 3X1DA 3AA0B 2ZLYA 2DCFA 4HWFA 1HTJF 3MXZA 2G0UA 5AQVB 3PUZF 3VHLA 3H3MA 2YU1A 4X66T 4AKHA 4DR7T 3AXJB 5LBQB 2JQKA 3D0TA 1YXRA 2WY2A 3LJCA 3ONJA 4Q25A 4QXBB 3VR8A 4WYVA 3GN5A 2PJQA 3UU6A 2CBJA 1WCRA 5HEGA 5AQPB 5AQLB 3ONLC 1FMVA 1OEDB 3RYCE 2CLYC 3KV5A 2V7MA 4MLKA 3NKZA 2PBIA 3N9PA 2Q9QA 3PUVF 5EK4A 1N32T 1NEKA 1WYBA 4ISSA 3LG7A 3MKDA 2BS3A 1XDPA 2IAKA 3B5MA 2I6HA 4AKLA 4LMJA 4QKNA 1R8IA 5AQOB 5HEHA 3AEDA 4PNIA 4HN9A 3GWHA 2BVMA 3CIRA 4NXNT 3RYHE 2V6XA 2X68A 4IE5A 1YQ3A 4IGUA 3N9MA 1AJ3A 2J4GA 4ZI2D 1HNXT 3NZQA 4H63V 4X62T 3ZYLA 1J5WA 4DV3T 4KBMB 4DV4T 4OYJA 1W0BA 4OX9T 4U33A 2I0MA 2LJLA 4HFVA 3RC8A 4AKIA 5LA6E 3AE5A 2LHNA 2PTFA 4LFCT 1CUNA 2NTYA 4LFAT 3BQIA 2VB6A 4IDZA 5FL1A 4EZ4A 1HG2A 4PK4A 3KV4A 4CXWA 2E9XD 3CQXC 3UFEA 1VCSA 3UU3A 5H6RB 3AA6B 2X0LB 1I94T 3OVUA 4ERRA 5AQJB 2V1DB 4YTNA 5HEOA 4NPPA 3UUBA 2MTQA 2I59A 4GK5E 4HWDA 3RIUA 4ASKA 3ZMTB 4H9PC 4A5XA 4DBQA 1MMDA 5C2TA 4I50E 3GN5B 3R84B 5IHYA 3HR0A 2IC9A 3K3OA 1HX8A 3QOFA 3PUSA 4TWHA 4IE7A 2IUBA 5BR8T 3TKLB 3FB2A 2LHRA 4QH5A 5FY1A 2Q9QB 3F31A 5FL0A 3V5UA 1W09A 3K3QC 2YOEA 5HYAA 3K3NA 1D1CA 4QXCB 2LM9A 2LSYA 5JTGA 2A2FX 2BBHA 4LF9T 4MHCA 2BS2A 4AQFA 2XQ3A 4AIUA 5LMUT 2ACZA 3QNUA 2D5UA 1NAFA 1SE7A 3ETVA 4TN7B 2QYWA 5FXXA 3AE6A 3OYXA 2WZHA 2DLRA 4IL9A 5EZYE 2XUEA 2AXDS 4JBWF 4KHPT 2CXLA 4WW0A 4LF5T 4YTPA 1VOMA 4B6XA 5CA0E 1Y01A 2RA1A 1E1HB 4TWDA 4IDQA 3CX8B 4UVCB 4ZEYA
chains in the Genus database with same CATH topology
4CQIA 5ETWA 5HXHA 3ZC0A 3CQCB 3UTKA 2JJ9A 3FXDB 4CI2B 3DJBA 4P0BA 3WAJA 4EB6E 2Y6XA 4UELA 3RYIE 2EHOC 5HXCA 4PJJA 2JMHA 5KMGP 4A56A 1V9DA 2L8KA 4O4HE 4MALA 3KFWX 2DWGA 2K48A 2XAFB 5FXVA 4OYKA 4IIJE 5E0OA 3H37A 4CZZB 5LP6E 2WM9A 3KINB 2YK0A 4DMVA 2XASB 1X79A 5FYMA 2D0TA 5L3CB 1HFAA 3QK6A 3DTOA 3MK7C 2E9XB 4PK6A 5HXRA 3C4XA 3PU3A 5FXZA 5LJNA 5TAOA 3P7IA 4C91A 2QA7A 2X9YA 4CXYA 3W15B 3ZCIA 4CI1B 5L3BB 4PJNA 2P9BA 2NW9A 2LE8A 2CWOA 2L3LA 5JRCB 2WAUA 4EYUA 2E8IA 2LSIA 3N2OA 3RYFE 3U78A 4HEAA 5J2TE 3OKQA 5HAXA 3UULA 2DI4A 3O1JA 2K5BB 3HL6A 4AI6A 2IW5B 5JR9B 3MA9A 1QUUA 1EZ3A 5F3JA 1Z0PA 4BA9A 4EIWA 3CX7B 1UX4A 2X9HA 4H9OC 2ES0A 3AAAB 3PDYA 2CXDA 5LNKA 2EHOD 4DNDA 4QHOA 3PU8A 3HKBE 3U3IA 5LGNB 2CWYA 2ODUA 4OFZA 2NW7A 2JMKA 3C51A 2LEHA 3LBXB 3HKEE 4PJMA 5HWYA 3N2GE 5JDNA 5JDGA 3E0ZA 2X9WA 1D0XA 3EUHA 2V7LA 3E22E 2LSKA 3AVSA 3N9LA 3KBUA 2M67A 4H9NC 2J1DG 4NUVA 4MBQA 2H7VC 1LRZA 5GONE 2Q9QC 2A72A 3KBTA 4WBNE 1KK7A 5IYZE 3Q5WA 3AAEB 4YLHA 3F2EA 1LKXA 2XQYA 3PUAA 5AFUL 4HTEA 1MMGA 1SA0E 2VWAA 3UT5E 1IZNB 4PFOA 4ZI7E 5L3GB 5L3FB 1FEWA 3VU7H 2HPJA 5LJMA 5EK3A 5LCYA 3WAKA 5ADXL 2VKDA 2CMRA 1BR2A 1VRBA 3EVYA 3MACA 1FIOA 4IHJE 4PAGA 3AB3B 3LFMA 4J2CA 2EHOA 1U5PA 5L3DB 2KZ7B 4JEHB 4P09A 3ZMUB 1ZV4X 3ONXA 3M65A 3EDUA 5LG4A 2C5JA 2W0GA 3C4WA 4O2AE 3AA0B 2NWBA 3O1IA 4GOUA 3PURA 5J1GA 2ZLYA 2DCFA 2KWIB 2W00A 2UXNB 3Q5XA 2BVLA 2CXFA 4ISTA 1ZEEA 1HTJF 3MXZA 2G0UA 4PFPA 4I43B 3I9YA 3RH3A 4U72A 5DJQC 2W62A 2VKHA 2WSSV 2ZMAA 3PTRB 1ZHCA 4QXHB 3VHLA 1Y64B 2YU1A 4UF0A 3I9WA 3FHNA 3NRYA 5J2UE 3N9QA 4YFSA 4FI5A 5JDMA 4AKHA 1KNZA 3PE0A 2JQQA 4O2BE 5LBQB 1D0ZA 2Q9QD 3D0TA 3LK42 2LOPA 2XAGB 3LJCA 3UUMA 1SHZC 5JREA 1MNDA 2K9AA 4QXBB 2ZM0A 5FMNA 5FY7A 3T8OA 3V5SA 4DO0A 2VKJA 3N2KE 1WRDA 2NTXA 4GYRA 3AA1B 3GN5A 3B57A 3ZN0B 2PJQA 5JH7E 3Q2MA 4EXTA 4X1IE 4N78D 4UV9B 4EZHA 4ZS3A 4IE4A 4OK0A 4M1PA 2LSGA 3KVAA 3O4XE 2XTLA 4U74A 2CEAA 2XAQB 1FMVA 3JC6C 3HKCE 3RYCE 2CM0A 2CLYC 3KV5A 1HCIA 3CWZB 2D2SA 2V7MA 2D0UA 4MLKA 2SPCA 4DBRA 5DQWA 3IEEA 5LOVE 1HF8A 2PBIA 2Z6EA 3N9PA 2ZM2A 2Q9QA 4TV9E 4TX5A 5EK4A 4UIGA 3HKDE 1WYBA 4ZI2C 4ISSA 3LG7A 3MKDA 4ILUA 3BQLA 3FBLA 3QUJA 4ZOLE 3CQGB 2IAKA 1D1AA 5LYJE 2NW8A 3O1HA 4AKLA 3C64A 4UVAB 2ZM8A 3VKGA 2MOZA 3KV6A 2VK9A 4X1KE 5JR9A 3NBXX 2VASA 3CX6B 3L3PA 4QKNA 3L09A 2YINA 4PK5A 4CI3B 1YD8G 1MMAA 4PNIA 4ANJA 3ZEFB 4HN9A 5JDQA 2XAHB 2KLQA 5JQGE 5C8YE 2HPLA 1MIVA 3GWHA 4XZCA 2V7KA 1UCUA 4QX7B 3FBZA 3JC6D 1HG5A 2V7JA 2BVMA 4L5GA 4NUUA 5FNVE 3ZJ1A 3AVRA 2NP9A 5EK2A 3IHRA 3PUQA 5JDLA 2KINB 4JEUB 3RC3A 1OXZA 2E9XC 5DQVA 4UV8B 3RYHE 2W61A 4UXNB 4TZ4C 2X9XA 2X68A 4MFRA 1T98A 5M4YA 2Y48B 4IE5A 3ZYKA 4E7SA 4O4LE 4IGUA 1WLXA 3N9MA 4H9SE 1AJ3A 4JLEA 2C0SA 4ZI2D 3GMIA 2L9QA 2IC6A 4G2AA 3NZQA 4H63V 2KWHA 1IJ6A 4K0UA 3SWHA 5JVDE 3HI2A 3RRCA 2N9DA 1MMNA 3I0OA 3ZYLA 3N5LA 4E7ZA 4UVBB 4KBMB 5JR9C 4BAYB 3ETUA 4OYJA 2VL8A 1OWAA 3H3AA 1D1BA 3E08A 1G8XA 2LJLA 3Q9DA 5HXSA 4HFVA 3ZMVB 3RC8A 3RPUA 3C98B 4AKIA 5LA6E 4FJOA 5L2LA 2H7OA 2LHNA 4WNKA 2XAJB 4QX8B 1CUNA 2EHOB 3BQKA 1MIWA 1US7B 2NTYA 3BQIA 4L9IA 2VB6A 4IDZA 4EZ4A 3WI3A 3OBVE 1HG2A 3I0QA 4PK4A 3KV4A 4CXWA 2E9XD 3CQXC 3UFEA 3ANWA 3ZPOA 4IE0A 3P8CD 3C50A 4HE8A 5H6RB 3AA6B 3A5XA 2X0LB 1MNEA 1WR6A 1U4QA 2OA5A 4AQFC 2CLYB 2V7IA 4ERRA 2V1DB 4BJMA 2DWKA 4L0RA 3RKOA 4XBFB 2W63A 5A1LA 2H3RA 2RP4A 3CMLA 5LBMA 5HWXA 2MTQA 4KMCA 2JPFA 3J7Yq 2I59A 4GK5E 4UF0B 3C4ZA 2XHEB 5F8PA 5KDMC 3UUXB 4ZHQE 1LVFA 3PUGA 1S94A 5CB4E 4ASKA 5JDFA 5CA1E 2ODVA 4H9PC 3ZMTB 3GA8A 4DBQA 2C5KT 4X20E 2PG8A 1D0YA 2KMFA 3SOLA 1MMDA 3RX6A 4UEMA 4I50E 2N1GA 2BDEA 4H9RC 5H6QB 5KX5E 3BK9A 3GN5B 4GYSA 4GIWA 3R84B 5IHYA 2WMNA 3HR0A 2IC9A 2E9XA 4DVDA 3K3OA 4YHJA 1HX8A 2VKOA 2CE7A 2Y8DA 3PUSA 3ZMZB 1B7TA 2MBGA 5JDHA 3K8PC 4AQGA 3KV9A 2KT9A 3NRXA 1LVKA 5FY0A 4G63A 4PJLA 4IE7A 2B1EA 2LT3A 5JRCA 3TKLB 4O8SA 3I1AA 3FB2A 2LHRA 2MYSA 1YKEB 4WBOA 4JUYA 3R6NA 3N9OA 4KUMB 5FY1A 2Q9QB 3F31A 4PW8A 4Z8XA 4ADZA 3V5UA 2QGSA 3AA7B 3DP7A 4O4IE 4BJNA 2CCQA 3ZJ2A 2YEVC 3OYZA 5BMVE 2N2NA 3K3QC 3IBPA 3MJXA 3LBXA 5HYAA 3IF8B 4ZS2A 2V26A 3K3NA 2YU2A 1D1CA 4QXCB 2LM9A 3CVRA 3CKDA 4X1YE 4I55E 1YW0A 1O3XA 2LSYA 3B13A 1MIYA 1G73A 2A2FX 2LSJA 4HGAA 1IAPA 3RRWA 3ESLA 3NZPA 4GK0E 2UXXB 1BR0A 4I4TE 1FMWA 4MHCA 4TV8E 2X66A 3LK3B 3ZLIA 4AQFA 3AAIA 3J9X1 2DNXA 4TUYE 1HS7A 1NWMX 3KDSE 3SRZA 2WMOA 3CPZA 4AKRB 2LOSA 4F6RC 1S35A 3VKHA 4H9QC 4YJ3E 1BR1A 3UUNA 2D5UA 1NAFA 4ZI3C 1IJ5A 3ETVA 3ZC1A 4AKGA 3KVBA 5LHIB 3MZKB 2X51A 4TN7B 4P0AA 3ZN1B 4H63H 5FXXA 4DMWA 2CA5A 1UX5A 2KXPB 3OYXA 3HA4A 3QC9A 1BR4A 5FXWA 5LHHB 4EOZB 2DLRA 1H7CA 4C90A 2C5IT 2WBLA 5EZYE 2XUEA 4YJ2E 2WWUA 4OHFA 4EAHA 3LK2B 5LHGB 3ZYMA 5LGUB 2X67A 1WYCA 1ZKEA 2KNDA 3SS1A 4XAXB 2CXLA 2K24A 2PFVA 3FXEB 4WW0A 5LGTB 5FP3A 5DABA 5L3EB 4V1Av 5HXEA 3ZMSB 1VOMA 2ACXA 4B6XA 2DHRA 2GK9A 4IE6A 2JRKA 5CA0E 2BZBA 2RA1A 4O4JE 2HH7A 1E1HB 3OJAA 4HKAA 1YKHB 3O9XA 3ZCJA 4AXPA 4CXXA 3ANWB 3S4UA 3CX8B 3EDVA 4KP3C 4UVCB 3F57A 2A3DA 3N9NA 4EYYR 4ZI3D 5LXTE 2NOXA 1QSDA 4QWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6N A;  1HCI A;  3KBT A;  1U4Q A;  3F31 A;  2SPC A;  5J1G A;  3PDY A;  1WLX A;  2ODU A;  1AJ3 A;  3LBX B;  1CUN A;  3LBX A;  2ODV A;  1U5P A;  3EDV A;  2IAK A;  3PE0 A;  1S35 A;  3UUL A;  3KBU A;  3F57 A;  3EDU A;  1OWA A;  3FB2 A;  3UUN A;  1G8X A;  3UUM A;  1QUU A; 
#chains in the Genus database with same CATH topology
 2KSR A;  5HXH A;  3UTK A;  4CI2 B;  2XPK A;  5HCJ A;  3RYI E;  5HXC A;  2JMH A;  2CBI A;  2L8K A;  2DWG A;  4IIJ E;  2WM9 A;  2X0Y A;  3SFE A;  1X79 A;  3AEA A;  2XM2 A;  3MK7 C;  4X64 T;  5HXR A;  3PU3 A;  3P7I A;  3LDQ B;  2P9B A;  2NW9 A;  2CWO A;  2H89 A;  4EYU A;  3N2O A;  4HEA A;  5HAX A;  3UUL A;  3AEF A;  1I6Z A;  4AI6 A;  3MA9 A;  1UX4 A;  2X9H A;  4H9O C;  3RGL A;  2UU9 T;  3PU8 A;  2B76 A;  2NW7 A;  1L0V A;  2LSK A;  2Q9Q C;  3KBT A;  5AQK B;  1KK7 A;  3F2E A;  3PUA A;  2UUB T;  1SA0 E;  1IZN B;  3VRA A;  2HPJ A;  3AEC A;  3QB5 K;  3PJA J;  3EVY A;  2QVA A;  3PUX F;  4J2C A;  2KZ7 B;  2BG9 E;  4P09 A;  3ZMU B;  1SUM B;  2NWB A;  2OV9 A;  3O1I A;  2KWI B;  2UXN B;  3Q5X A;  4LF4 T;  4I43 B;  3I9Y A;  3RH3 A;  2VKH A;  3UFG A;  4GKJ T;  1Y64 B;  3NRY A;  3FHN A;  5J2U E;  1KNZ A;  3PE0 A;  3UUM A;  1SHZ C;  5JRE A;  2K9A A;  2ZM0 A;  5FY7 A;  3PUY F;  4DO0 A;  1HNW T;  2NTX A;  4YHH T;  3B57 A;  2J62 A;  4EXT A;  4X1I E;  4KX6 A;  4N78 D;  4EZH A;  5IUX A;  3KVA A;  2XTL A;  5IWA T;  4U74 A;  3HKC E;  2BS4 A;  2CM0 A;  2D2S A;  4CN4 A;  2SPC A;  2R6G F;  5DQW A;  1X9B A;  3IEE A;  2Z6E A;  4JI5 T;  2ZM2 A;  4TX5 A;  4JI3 T;  1Z8U A;  4IDP A;  3BQL A;  3IA3 A;  3QUJ A;  3CQG B;  3ZST A;  4YY3 T;  4UVA B;  4ZZC A;  3KV6 A;  5JR9 A;  3NBX X;  3CX6 B;  3L3P A;  3RIU C;  1YD8 G;  4K0K T;  4ANJ A;  2JIW A;  5JQG E;  2D9D A;  3UU4 A;  1J1J A;  2V7K A;  3A7M A;  4QX7 B;  3ZJ1 A;  3IHR A;  5AQF B;  4JEU B;  3RC3 A;  4UV8 B;  2W61 A;  3NVO A;  4MFR A;  1XMO T;  5M4Y A;  3RF1 A;  3ZYK A;  4E7S A;  4A98 A;  2AE9 A;  4H9S E;  3GMI A;  4G2A A;  3HI2 A;  4E7Z A;  4HFI A;  4BAY B;  5ABH A;  3H3A A;  1D1B A;  1G8X A;  4IRE A;  3RPU A;  3TLU A;  2XQ9 A;  2V6Y A;  2H7O A;  2E2A A;  3OTO T;  4QX8 B;  1MIW A;  4L9I A;  3WI3 A;  4COF A;  2HN2 A;  4HE8 A;  1KF6 A;  3TLS A;  1WR6 A;  2OA5 A;  4AQF C;  2DWK A;  4L0R A;  2H3R A;  4HWH A;  3CML A;  5HWX A;  4KMC A;  2JPF A;  3J7Y q;  4P1N A;  1T8B A;  3UUX B;  3TLW A;  5CB4 E;  2ODV A;  4X20 E;  2KMF A;  2FUP A;  2HHH T;  2BDE A;  3FZL B;  4JYA T;  4GYS A;  4NXM T;  2VKO A;  3FZF B;  3ZMZ B;  1B7T A;  2MBG A;  3K8P C;  4AQG A;  3KV9 A;  3P4R A;  4G63 A;  2LT3 A;  2BKP A;  3I1A A;  5J0Z A;  2WB5 A;  1N33 T;  2BG9 A;  5CFB A;  4TWF A;  4KUM B;  1T7S A;  4PW8 A;  4EGW A;  2FJE A;  3AA7 B;  5L4E A;  3ABV A;  3DP7 A;  4O4I E;  4BJN A;  2YEV C;  5BMV E;  3MJX A;  2K3W A;  4TNV A;  5AQQ B;  3CKD A;  4X1Y E;  2XQ8 A;  1YW0 A;  2VVS A;  3G06 A;  1G73 A;  4HGA A;  1IAP A;  3NZP A;  2BKO A;  1WR0 A;  4TV8 E;  2X66 A;  1HS7 A;  2V5D A;  1IJ5 A;  3RLF F;  3KVB A;  5LHI B;  1E7P A;  4WZX A;  4H63 H;  4HWC A;  5CGM A;  2CA5 A;  5FXW A;  1H7C A;  2C5I T;  4YSX A;  2WWU A;  3LK2 B;  3ZYM A;  1WYC A;  1ZKE A;  5LGT B;  3FXE B;  5FP3 A;  5AQI B;  4V1A v;  1M7K A;  2V6Y B;  4IE6 A;  2JRK A;  1JNR A;  3AE8 A;  3OJA A;  3ZCJ A;  4JV5 T;  2A3D A;  3N9N A;  4EYY R;  2UUA T;  2NOX A;  5HCM A;  4KI0 F;  3P4W A;  3UQ7 A;  4B3M T;  2YDS A;  3WAJ A;  4EB6 E;  2Y6X A;  4UEL A;  2XY8 B;  4MAL A;  4DV5 T;  4EV6 A;  2IML A;  4OYK A;  2XAS B;  1KFY A;  4LFB T;  1ZP0 A;  5LJN A;  4HFC A;  2X9Y A;  3W15 B;  4CI1 B;  4U31 A;  2LSI A;  3RYF E;  2WU5 A;  2BG9 B;  1OED C;  3OKQ A;  3HL6 A;  2IW5 B;  1QUU A;  1XMQ T;  1Z0P A;  3CX7 B;  1W9R A;  2ES0 A;  3AAA B;  1HX1 B;  5LNK A;  2YDQ A;  5L4H A;  2CWY A;  2IHR 1;  3ZT6 A;  3HKE E;  5JDN A;  2CHO A;  3E0Z A;  4DV6 T;  2OLT A;  4EEB A;  2M67 A;  4H9N C;  4MBQ A;  1LRZ A;  4X5T A;  4WBN E;  4LMK A;  5IYZ E;  4YLH A;  1KNR A;  4A97 A;  1LKX A;  3UT5 E;  1MMG A;  5LJM A;  2WCA A;  5ADX L;  4UR9 A;  3MAC A;  1BR2 A;  2FJD A;  4YTM A;  2EHO A;  5FVL A;  2W2U A;  4JEH B;  1ZV4 X;  3EDU A;  2C5J A;  2W0G A;  3P50 A;  2VQE T;  2MPK A;  2W00 A;  2BVL A;  2CXF A;  4IST A;  1ZEE A;  2BKN A;  5DJQ C;  2W62 A;  1XNQ T;  2WQY A;  2ZMA A;  4QXH B;  4UF0 A;  3I9W A;  2F4V T;  3PV0 F;  4FI5 A;  5JDM A;  3ZT7 A;  2JQQ A;  4O2B E;  4ILB A;  1D0Z A;  2Q9Q D;  3LK4 2;  5F5W A;  3AEE A;  3V5S A;  3AA1 B;  5JH7 E;  3Q2M A;  4ZS3 A;  4IE4 A;  4M1P A;  4IT4 A;  2LSG A;  1VCT A;  3O4X E;  2CEA A;  5AQS B;  3JC6 C;  4DR3 T;  3P4P A;  5ABF A;  4Z91 A;  2D0U A;  3JAF A;  1W0A A;  1HF8 A;  4TNW A;  3HKD E;  2DL1 A;  4ZOL E;  1D1A A;  4EED A;  2NW8 A;  3O1H A;  4X1K E;  1ZOY A;  5AQG B;  2LRL A;  2YIN A;  4CI3 B;  3EAM A;  3RKG A;  5JDQ A;  2XAH B;  2KLQ A;  3AE2 A;  1KNP A;  4YSY A;  3AE4 A;  2HPL A;  1MIV A;  4XZC A;  2JQ9 A;  4HFH A;  3FBZ A;  1HG5 A;  4L5G A;  5FNV E;  5EK2 A;  3AVR A;  3PUQ A;  5JDL A;  4F8H A;  5DQV A;  5KXJ A;  4TZ4 C;  2X9X A;  1T98 A;  2Y48 B;  1WLX A;  2HN1 A;  4JLE A;  2C0S A;  2L9Q A;  2IC6 A;  2BG9 C;  5JVD E;  3I0O A;  1MMN A;  3ETU A;  2VL8 A;  3E08 A;  3Q9D A;  3LSV A;  3ZMV B;  4JI1 T;  3C98 B;  3EHZ A;  4FJO A;  5L2L A;  4WNK A;  2EHO B;  3BQK A;  1US7 B;  4DUZ T;  3T1H T;  5AQN B;  5FKY A;  3OBV E;  2E5L T;  4DV7 T;  3EAB A;  3ANW A;  3ZPO A;  4IE0 A;  3C50 A;  3UQ4 A;  3RHW A;  1MNE A;  3A5X A;  2IIU A;  2CLY B;  2V7I A;  2BBJ A;  2UXC T;  1KEY A;  3RKO A;  4XBF B;  2W63 A;  5A1L A;  4X65 T;  5LBM A;  4UF0 B;  4HWI B;  5F8P A;  5KDM C;  4ZHQ E;  1LVF A;  4B3R T;  3PUG A;  2JQH A;  3GA8 A;  2C5K T;  5AQH B;  1D0Y A;  3SOL A;  4JI8 T;  2N1G A;  3FZK B;  4H9R C;  5H6Q B;  5KX5 E;  2WDR A;  2WMN A;  4DUY T;  2E9X A;  4YHJ A;  2CHN A;  2CE7 A;  2WP9 A;  5FY0 A;  4PJL A;  1YQ4 A;  2XQ5 A;  4O8S A;  5ABF B;  2MYS A;  4AQY T;  4WBO A;  3N9O A;  4I0U A;  3Q5D A;  5L47 A;  4Z8X A;  1GQE A;  4ADZ A;  4LF8 T;  3ZJ2 A;  1FJG T;  2YDR A;  4ZS2 A;  2M6B A;  2YU2 A;  3CVR A;  5C3J A;  4U7I A;  4I55 E;  3B13 A;  3P4Q A;  2LSJ A;  3RRW A;  2VVN A;  1BR0 A;  2UXX B;  1UGO A;  4I4T E;  4AIS A;  2XZE A;  3LK3 B;  3ZLI A;  3AAI A;  4TUY E;  2VQF T;  1NWM X;  3KDS E;  3AEB A;  2UXD T;  3UU5 A;  4AKR B;  1BR1 A;  3UUN A;  4CN1 A;  4ZI3 C;  3ZC1 A;  2KXP B;  3QC9 A;  4EOZ B;  4C90 A;  5LG3 A;  4YJ2 E;  3SFD A;  4EAH A;  2WDQ A;  2X67 A;  2UXB T;  2X0H A;  3AE7 A;  3SS1 A;  3OPC A;  2K24 A;  2PFV A;  4LML A;  4U7Y A;  5L3E B;  4DR6 T;  2ACX A;  2DHR A;  2GK9 A;  3JAD A;  4YT0 A;  1YKH B;  4YSZ A;  3ANW B;  3S4U A;  1XNR T;  3EDV A;  1QLB A;  3F57 A;  2FJB A;  4CQI A;  5ETW A;  3CQC B;  4ILA A;  2EHO C;  5AQM B;  5KMG P;  4A56 A;  1V9D A;  5AQT B;  3AE1 A;  2K48 A;  5FXV A;  4CZZ B;  5LP6 E;  1NEN A;  4DMV A;  2J47 A;  2ZM6 T;  5HEJ A;  3ZKR A;  3DTO A;  2E9X B;  4PK6 A;  5FXZ A;  4KHZ F;  4C91 A;  2QA7 A;  3ZCI A;  1UUS A;  5L3B B;  2LE8 A;  2L3L A;  2WAU A;  2E8I A;  3U78 A;  2DI4 A;  2K5B B;  5JR9 B;  3EI0 A;  2LLY A;  5F3J A;  4EIW A;  4B3T T;  2CXD A;  5LGN B;  3HKB E;  3U3I A;  4OFZ A;  3C51 A;  5HWY A;  2LEH A;  1J5E T;  4PJM A;  3N2G E;  2LKH A;  5JDG A;  2X9W A;  1E2A A;  2XSB A;  3RIA A;  3EUH A;  2V7L A;  3KBU A;  4QH1 A;  3AEG A;  4JI4 T;  3Q5W A;  3AAE B;  2XQY A;  5AFU L;  4HTE A;  5L3G B;  4ZI7 E;  5L3F B;  3VU7 H;  5EK3 A;  1XDO A;  3WAK A;  3ZT5 A;  4JI6 T;  2E5V A;  4IHJ E;  4PAG A;  1U5P A;  5L3D B;  3C4W A;  4O2A E;  4GOU A;  3PUR A;  5J1G A;  4PFP A;  4U72 A;  1HR0 T;  4U2Z A;  2WSS V;  1DU2 A;  4HFB A;  3PTR B;  1ZHC A;  3N9Q A;  4YFS A;  5LB7 B;  2LOP A;  2XAG B;  3A8Y C;  1MND A;  5FMN A;  3T8O A;  2VKJ A;  3N2K E;  1WRD A;  2MAW A;  4GYR A;  3ZN0 B;  2LKG A;  4UV9 B;  4OK0 A;  3QB5 A;  3AE3 A;  3VR9 A;  4DID B;  2H88 A;  2XAQ B;  1HCI A;  3CWZ B;  4DV0 T;  4DBR A;  4Z90 A;  3JCF A;  5LOV E;  4TV9 E;  1XWM A;  5CJ5 A;  2A9U A;  4UIG A;  4IL4 A;  4NIQ A;  4ZI2 C;  3M3Z B;  2YN6 A;  4ILU A;  3FBL A;  4YXD A;  3K1S A;  5LYJ E;  4QH4 A;  4JI7 T;  2XQ6 A;  2W4X A;  3C64 A;  5AQU B;  2ZM8 A;  3VKG A;  2MOZ A;  2VK9 A;  2VAS A;  4DR2 T;  3L09 A;  2V8S V;  4CN6 A;  4PK5 A;  1MMA A;  1CHU A;  3ZEF B;  5C8Y E;  1UCU A;  2CRB A;  3JC6 D;  4NUU A;  2V7J A;  4U2Y A;  2NP9 A;  2KIN B;  1OED E;  1OXZ A;  2E9X C;  5AQR B;  4UXN B;  2W66 A;  4O4L E;  1UUR A;  2KWH A;  1IJ6 A;  3PUW F;  4K0U A;  3SWH A;  3RRC A;  2N9D A;  2WS3 A;  3N5L A;  4UVB B;  2VUR A;  5JR9 C;  2FBW A;  2LRK A;  1OWA A;  5HXS A;  3VRB A;  2LM2 A;  3PJA A;  2XAJ B;  2NR4 A;  2XJ7 A;  3I0Q A;  3FZM B;  3P8C D;  1U4Q A;  2UUC T;  4BJM A;  1IBL T;  1N36 T;  2RP4 A;  3JAE A;  2XQ7 A;  3NWI A;  3C4Z A;  2XHE B;  1WFD A;  3AE9 A;  5ABE A;  2CPT A;  1JNZ A;  1S94 A;  5JDF A;  5CA1 E;  3FZH B;  2PG8 A;  3RX6 A;  3RQW A;  4UEM A;  3TLV A;  4HFE A;  3BK9 A;  5FVK A;  2XM1 A;  4GIW A;  4DVD A;  2Y8D A;  5JDH A;  4DR5 T;  2KT9 A;  3NRX A;  3RQU A;  1LVK A;  2B1E A;  4JI2 T;  5JRC A;  3RI5 A;  1YKE B;  3L39 A;  4JUY A;  3R6N A;  2QGS A;  4IDO A;  2CCQ A;  3OYZ A;  2N2N A;  3IBP A;  3LBX A;  3IF8 B;  2V26 A;  5HEU A;  1O3X A;  1MIY A;  3P4S A;  3ESL A;  4GK0 E;  4B3S T;  1FMW A;  3TLT A;  1XZY A;  4DR4 T;  3J9X 1;  2DNX A;  2YKS A;  3SRZ A;  2WMO A;  3CPZ A;  2WDV A;  2LOS A;  4F6R C;  1S35 A;  3VKH A;  4H9Q C;  4YJ3 E;  4AKG A;  4ILC A;  3MZK B;  2X51 A;  4P0A A;  3ZN1 B;  1HNZ T;  4DMW A;  1UX5 A;  5LHH B;  3HA4 A;  1BR4 A;  1IBK T;  4LF6 T;  2WBL A;  4GKK T;  4OHF A;  5LHG B;  5LGU B;  4LF7 T;  1UK5 A;  2QRX A;  2KND A;  2VL0 A;  4XAX B;  2IDO B;  3AXJ A;  5DAB A;  5HXE A;  3ZMS B;  2W67 A;  4U3C A;  3UU8 A;  2BZB A;  4O4J E;  2HH7 A;  4HKA A;  3CK6 A;  3O9X A;  4AXP A;  4CXX A;  4KP3 C;  2FJA A;  4ZI3 D;  5LXT E;  1QSD A;  1M62 A;  4QWN B;  5LMN T;  4JI0 T;  3ZC0 A;  1OED A;  2JJ9 A;  3FXD B;  4DR1 T;  3DJB A;  4P0B A;  4PJJ A;  4O4H E;  3KFW X;  4ZZB A;  2XAF B;  2WWV A;  5E0O A;  4ZXL A;  3RIF A;  3H37 A;  3KIN B;  2YK0 A;  3ZSS A;  2V5C A;  5FYM A;  2D0T A;  5L3C B;  1HFA A;  3QK6 A;  1IBM T;  3C4X A;  1T72 A;  5TAO A;  4DV1 T;  4CXY A;  4PJN A;  5JRC B;  5J2T E;  3O1J A;  1EZ3 A;  4BA9 A;  5ABG A;  3PDY A;  4IDN A;  2EHO D;  4DND A;  4QHO A;  2ODU A;  2JMK A;  3LBX B;  4HFD A;  3L8R A;  2WU2 A;  1D0X A;  3E22 E;  2M6I A;  3AVS A;  3N9L A;  2XSA A;  2J1D G;  4NUV A;  2H7V C;  5GON E;  3Q5E A;  4DV2 T;  2A72 A;  2WZI A;  2XQ4 A;  2VWA A;  4PFO A;  2RPA A;  1FEW A;  2XQA A;  5LCY A;  2VKD A;  1N34 T;  2CMR A;  1VRB A;  1FIO A;  3AB3 B;  3LFM A;  3T1Y T;  3ONX A;  3M65 A;  5LG4 A;  3X1D A;  3AA0 B;  2ZLY A;  2DCF A;  4HWF A;  1HTJ F;  3MXZ A;  2G0U A;  5AQV B;  3PUZ F;  3VHL A;  3H3M A;  2YU1 A;  4X66 T;  4AKH A;  4DR7 T;  3AXJ B;  5LBQ B;  2JQK A;  3D0T A;  1YXR A;  2WY2 A;  3LJC A;  3ONJ A;  4Q25 A;  4QXB B;  3VR8 A;  4WYV A;  3GN5 A;  2PJQ A;  3UU6 A;  2CBJ A;  1WCR A;  5HEG A;  5AQP B;  5AQL B;  3ONL C;  1FMV A;  1OED B;  3RYC E;  2CLY C;  3KV5 A;  2V7M A;  4MLK A;  3NKZ A;  2PBI A;  3N9P A;  2Q9Q A;  3PUV F;  5EK4 A;  1N32 T;  1NEK A;  1WYB A;  4ISS A;  3LG7 A;  3MKD A;  2BS3 A;  1XDP A;  2IAK A;  3B5M A;  2I6H A;  4AKL A;  4LMJ A;  4QKN A;  1R8I A;  5AQO B;  5HEH A;  3AED A;  4PNI A;  4HN9 A;  3GWH A;  2BVM A;  3CIR A;  4NXN T;  3RYH E;  2V6X A;  2X68 A;  4IE5 A;  1YQ3 A;  4IGU A;  3N9M A;  1AJ3 A;  2J4G A;  4ZI2 D;  1HNX T;  3NZQ A;  4H63 V;  4X62 T;  3ZYL A;  1J5W A;  4DV3 T;  4KBM B;  4DV4 T;  4OYJ A;  1W0B A;  4OX9 T;  4U33 A;  2I0M A;  2LJL A;  4HFV A;  3RC8 A;  4AKI A;  5LA6 E;  3AE5 A;  2LHN A;  2PTF A;  4LFC T;  1CUN A;  2NTY A;  4LFA T;  3BQI A;  2VB6 A;  4IDZ A;  5FL1 A;  4EZ4 A;  1HG2 A;  4PK4 A;  3KV4 A;  4CXW A;  2E9X D;  3CQX C;  3UFE A;  1VCS A;  3UU3 A;  5H6R B;  3AA6 B;  2X0L B;  1I94 T;  3OVU A;  4ERR A;  5AQJ B;  2V1D B;  4YTN A;  5HEO A;  4NPP A;  3UUB A;  2MTQ A;  2I59 A;  4GK5 E;  4HWD A;  3RIU A;  4ASK A;  3ZMT B;  4H9P C;  4A5X A;  4DBQ A;  1MMD A;  5C2T A;  4I50 E;  3GN5 B;  3R84 B;  5IHY A;  3HR0 A;  2IC9 A;  3K3O A;  1HX8 A;  3QOF A;  3PUS A;  4TWH A;  4IE7 A;  2IUB A;  5BR8 T;  3TKL B;  3FB2 A;  2LHR A;  4QH5 A;  5FY1 A;  2Q9Q B;  3F31 A;  5FL0 A;  3V5U A;  1W09 A;  3K3Q C;  2YOE A;  5HYA A;  3K3N A;  1D1C A;  4QXC B;  2LM9 A;  2LSY A;  5JTG A;  2A2F X;  2BBH A;  4LF9 T;  4MHC A;  2BS2 A;  4AQF A;  2XQ3 A;  4AIU A;  5LMU T;  2ACZ A;  3QNU A;  2D5U A;  1NAF A;  1SE7 A;  3ETV A;  4TN7 B;  2QYW A;  5FXX A;  3AE6 A;  3OYX A;  2WZH A;  2DLR A;  4IL9 A;  5EZY E;  2XUE A;  2AXD S;  4JBW F;  4KHP T;  2CXL A;  4WW0 A;  4LF5 T;  4YTP A;  1VOM A;  4B6X A;  5CA0 E;  1Y01 A;  2RA1 A;  1E1H B;  4TWD A;  4IDQ A;  3CX8 B;  4UVC B;  4ZEY A; 
#chains in the Genus database with same CATH homology
 4CQI A;  5ETW A;  5HXH A;  3ZC0 A;  3CQC B;  3UTK A;  2JJ9 A;  3FXD B;  4CI2 B;  3DJB A;  4P0B A;  3WAJ A;  4EB6 E;  2Y6X A;  4UEL A;  3RYI E;  2EHO C;  5HXC A;  4PJJ A;  2JMH A;  5KMG P;  4A56 A;  1V9D A;  2L8K A;  4O4H E;  4MAL A;  3KFW X;  2DWG A;  2K48 A;  2XAF B;  5FXV A;  4OYK A;  4IIJ E;  5E0O A;  3H37 A;  4CZZ B;  5LP6 E;  2WM9 A;  3KIN B;  2YK0 A;  4DMV A;  2XAS B;  1X79 A;  5FYM A;  2D0T A;  5L3C B;  1HFA A;  3QK6 A;  3DTO A;  3MK7 C;  2E9X B;  4PK6 A;  5HXR A;  3C4X A;  3PU3 A;  5FXZ A;  5LJN A;  5TAO A;  3P7I A;  4C91 A;  2QA7 A;  2X9Y A;  4CXY A;  3W15 B;  3ZCI A;  4CI1 B;  5L3B B;  4PJN A;  2P9B A;  2NW9 A;  2LE8 A;  2CWO A;  2L3L A;  5JRC B;  2WAU A;  4EYU A;  2E8I A;  2LSI A;  3N2O A;  3RYF E;  3U78 A;  4HEA A;  5J2T E;  3OKQ A;  5HAX A;  3UUL A;  2DI4 A;  3O1J A;  2K5B B;  3HL6 A;  4AI6 A;  2IW5 B;  5JR9 B;  3MA9 A;  1QUU A;  1EZ3 A;  5F3J A;  1Z0P A;  4BA9 A;  4EIW A;  3CX7 B;  1UX4 A;  2X9H A;  4H9O C;  2ES0 A;  3AAA B;  3PDY A;  2CXD A;  5LNK A;  2EHO D;  4DND A;  4QHO A;  3PU8 A;  3HKB E;  3U3I A;  5LGN B;  2CWY A;  2ODU A;  4OFZ A;  2NW7 A;  2JMK A;  3C51 A;  2LEH A;  3LBX B;  3HKE E;  4PJM A;  5HWY A;  3N2G E;  5JDN A;  5JDG A;  3E0Z A;  2X9W A;  1D0X A;  3EUH A;  2V7L A;  3E22 E;  2LSK A;  3AVS A;  3N9L A;  3KBU A;  2M67 A;  4H9N C;  2J1D G;  4NUV A;  4MBQ A;  2H7V C;  1LRZ A;  5GON E;  2Q9Q C;  2A72 A;  3KBT A;  4WBN E;  1KK7 A;  5IYZ E;  3Q5W A;  3AAE B;  4YLH A;  3F2E A;  1LKX A;  2XQY A;  3PUA A;  5AFU L;  4HTE A;  1MMG A;  1SA0 E;  2VWA A;  3UT5 E;  1IZN B;  4PFO A;  4ZI7 E;  5L3G B;  5L3F B;  1FEW A;  3VU7 H;  2HPJ A;  5LJM A;  5EK3 A;  5LCY A;  3WAK A;  5ADX L;  2VKD A;  2CMR A;  1BR2 A;  1VRB A;  3EVY A;  3MAC A;  1FIO A;  4IHJ E;  4PAG A;  3AB3 B;  3LFM A;  4J2C A;  2EHO A;  1U5P A;  5L3D B;  2KZ7 B;  4JEH B;  4P09 A;  3ZMU B;  1ZV4 X;  3ONX A;  3M65 A;  3EDU A;  5LG4 A;  2C5J A;  2W0G A;  3C4W A;  4O2A E;  3AA0 B;  2NWB A;  3O1I A;  4GOU A;  3PUR A;  5J1G A;  2ZLY A;  2DCF A;  2KWI B;  2W00 A;  2UXN B;  3Q5X A;  2BVL A;  2CXF A;  4IST A;  1ZEE A;  1HTJ F;  3MXZ A;  2G0U A;  4PFP A;  4I43 B;  3I9Y A;  3RH3 A;  4U72 A;  5DJQ C;  2W62 A;  2VKH A;  2WSS V;  2ZMA A;  3PTR B;  1ZHC A;  4QXH B;  3VHL A;  1Y64 B;  2YU1 A;  4UF0 A;  3I9W A;  3FHN A;  3NRY A;  5J2U E;  3N9Q A;  4YFS A;  4FI5 A;  5JDM A;  4AKH A;  1KNZ A;  3PE0 A;  2JQQ A;  4O2B E;  5LBQ B;  1D0Z A;  2Q9Q D;  3D0T A;  3LK4 2;  2LOP A;  2XAG B;  3LJC A;  3UUM A;  1SHZ C;  5JRE A;  1MND A;  2K9A A;  4QXB B;  2ZM0 A;  5FMN A;  5FY7 A;  3T8O A;  3V5S A;  4DO0 A;  2VKJ A;  3N2K E;  1WRD A;  2NTX A;  4GYR A;  3AA1 B;  3GN5 A;  3B57 A;  3ZN0 B;  2PJQ A;  5JH7 E;  3Q2M A;  4EXT A;  4X1I E;  4N78 D;  4UV9 B;  4EZH A;  4ZS3 A;  4IE4 A;  4OK0 A;  4M1P A;  2LSG A;  3KVA A;  3O4X E;  2XTL A;  4U74 A;  2CEA A;  2XAQ B;  1FMV A;  3JC6 C;  3HKC E;  3RYC E;  2CM0 A;  2CLY C;  3KV5 A;  1HCI A;  3CWZ B;  2D2S A;  2V7M A;  2D0U A;  4MLK A;  2SPC A;  4DBR A;  5DQW A;  3IEE A;  5LOV E;  1HF8 A;  2PBI A;  2Z6E A;  3N9P A;  2ZM2 A;  2Q9Q A;  4TV9 E;  4TX5 A;  5EK4 A;  4UIG A;  3HKD E;  1WYB A;  4ZI2 C;  4ISS A;  3LG7 A;  3MKD A;  4ILU A;  3BQL A;  3FBL A;  3QUJ A;  4ZOL E;  3CQG B;  2IAK A;  1D1A A;  5LYJ E;  2NW8 A;  3O1H A;  4AKL A;  3C64 A;  4UVA B;  2ZM8 A;  3VKG A;  2MOZ A;  3KV6 A;  2VK9 A;  4X1K E;  5JR9 A;  3NBX X;  2VAS A;  3CX6 B;  3L3P A;  4QKN A;  3L09 A;  2YIN A;  4PK5 A;  4CI3 B;  1YD8 G;  1MMA A;  4PNI A;  4ANJ A;  3ZEF B;  4HN9 A;  5JDQ A;  2XAH B;  2KLQ A;  5JQG E;  5C8Y E;  2HPL A;  1MIV A;  3GWH A;  4XZC A;  2V7K A;  1UCU A;  4QX7 B;  3FBZ A;  3JC6 D;  1HG5 A;  2V7J A;  2BVM A;  4L5G A;  4NUU A;  5FNV E;  3ZJ1 A;  3AVR A;  2NP9 A;  5EK2 A;  3IHR A;  3PUQ A;  5JDL A;  2KIN B;  4JEU B;  3RC3 A;  1OXZ A;  2E9X C;  5DQV A;  4UV8 B;  3RYH E;  2W61 A;  4UXN B;  4TZ4 C;  2X9X A;  2X68 A;  4MFR A;  1T98 A;  5M4Y A;  2Y48 B;  4IE5 A;  3ZYK A;  4E7S A;  4O4L E;  4IGU A;  1WLX A;  3N9M A;  4H9S E;  1AJ3 A;  4JLE A;  2C0S A;  4ZI2 D;  3GMI A;  2L9Q A;  2IC6 A;  4G2A A;  3NZQ A;  4H63 V;  2KWH A;  1IJ6 A;  4K0U A;  3SWH A;  5JVD E;  3HI2 A;  3RRC A;  2N9D A;  1MMN A;  3I0O A;  3ZYL A;  3N5L A;  4E7Z A;  4UVB B;  4KBM B;  5JR9 C;  4BAY B;  3ETU A;  4OYJ A;  2VL8 A;  1OWA A;  3H3A A;  1D1B A;  3E08 A;  1G8X A;  2LJL A;  3Q9D A;  5HXS A;  4HFV A;  3ZMV B;  3RC8 A;  3RPU A;  3C98 B;  4AKI A;  5LA6 E;  4FJO A;  5L2L A;  2H7O A;  2LHN A;  4WNK A;  2XAJ B;  4QX8 B;  1CUN A;  2EHO B;  3BQK A;  1MIW A;  1US7 B;  2NTY A;  3BQI A;  4L9I A;  2VB6 A;  4IDZ A;  4EZ4 A;  3WI3 A;  3OBV E;  1HG2 A;  3I0Q A;  4PK4 A;  3KV4 A;  4CXW A;  2E9X D;  3CQX C;  3UFE A;  3ANW A;  3ZPO A;  4IE0 A;  3P8C D;  3C50 A;  4HE8 A;  5H6R B;  3AA6 B;  3A5X A;  2X0L B;  1MNE A;  1WR6 A;  1U4Q A;  2OA5 A;  4AQF C;  2CLY B;  2V7I A;  4ERR A;  2V1D B;  4BJM A;  2DWK A;  4L0R A;  3RKO A;  4XBF B;  2W63 A;  5A1L A;  2H3R A;  2RP4 A;  3CML A;  5LBM A;  5HWX A;  2MTQ A;  4KMC A;  2JPF A;  3J7Y q;  2I59 A;  4GK5 E;  4UF0 B;  3C4Z A;  2XHE B;  5F8P A;  5KDM C;  3UUX B;  4ZHQ E;  1LVF A;  3PUG A;  1S94 A;  5CB4 E;  4ASK A;  5JDF A;  5CA1 E;  2ODV A;  4H9P C;  3ZMT B;  3GA8 A;  4DBQ A;  2C5K T;  4X20 E;  2PG8 A;  1D0Y A;  2KMF A;  3SOL A;  1MMD A;  3RX6 A;  4UEM A;  4I50 E;  2N1G A;  2BDE A;  4H9R C;  5H6Q B;  5KX5 E;  3BK9 A;  3GN5 B;  4GYS A;  4GIW A;  3R84 B;  5IHY A;  2WMN A;  3HR0 A;  2IC9 A;  2E9X A;  4DVD A;  3K3O A;  4YHJ A;  1HX8 A;  2VKO A;  2CE7 A;  2Y8D A;  3PUS A;  3ZMZ B;  1B7T A;  2MBG A;  5JDH A;  3K8P C;  4AQG A;  3KV9 A;  2KT9 A;  3NRX A;  1LVK A;  5FY0 A;  4G63 A;  4PJL A;  4IE7 A;  2B1E A;  2LT3 A;  5JRC A;  3TKL B;  4O8S A;  3I1A A;  3FB2 A;  2LHR A;  2MYS A;  1YKE B;  4WBO A;  4JUY A;  3R6N A;  3N9O A;  4KUM B;  5FY1 A;  2Q9Q B;  3F31 A;  4PW8 A;  4Z8X A;  4ADZ A;  3V5U A;  2QGS A;  3AA7 B;  3DP7 A;  4O4I E;  4BJN A;  2CCQ A;  3ZJ2 A;  2YEV C;  3OYZ A;  5BMV E;  2N2N A;  3K3Q C;  3IBP A;  3MJX A;  3LBX A;  5HYA A;  3IF8 B;  4ZS2 A;  2V26 A;  3K3N A;  2YU2 A;  1D1C A;  4QXC B;  2LM9 A;  3CVR A;  3CKD A;  4X1Y E;  4I55 E;  1YW0 A;  1O3X A;  2LSY A;  3B13 A;  1MIY A;  1G73 A;  2A2F X;  2LSJ A;  4HGA A;  1IAP A;  3RRW A;  3ESL A;  3NZP A;  4GK0 E;  2UXX B;  1BR0 A;  4I4T E;  1FMW A;  4MHC A;  4TV8 E;  2X66 A;  3LK3 B;  3ZLI A;  4AQF A;  3AAI A;  3J9X 1;  2DNX A;  4TUY E;  1HS7 A;  1NWM X;  3KDS E;  3SRZ A;  2WMO A;  3CPZ A;  4AKR B;  2LOS A;  4F6R C;  1S35 A;  3VKH A;  4H9Q C;  4YJ3 E;  1BR1 A;  3UUN A;  2D5U A;  1NAF A;  4ZI3 C;  1IJ5 A;  3ETV A;  3ZC1 A;  4AKG A;  3KVB A;  5LHI B;  3MZK B;  2X51 A;  4TN7 B;  4P0A A;  3ZN1 B;  4H63 H;  5FXX A;  4DMW A;  2CA5 A;  1UX5 A;  2KXP B;  3OYX A;  3HA4 A;  3QC9 A;  1BR4 A;  5FXW A;  5LHH B;  4EOZ B;  2DLR A;  1H7C A;  4C90 A;  2C5I T;  2WBL A;  5EZY E;  2XUE A;  4YJ2 E;  2WWU A;  4OHF A;  4EAH A;  3LK2 B;  5LHG B;  3ZYM A;  5LGU B;  2X67 A;  1WYC A;  1ZKE A;  2KND A;  3SS1 A;  4XAX B;  2CXL A;  2K24 A;  2PFV A;  3FXE B;  4WW0 A;  5LGT B;  5FP3 A;  5DAB A;  5L3E B;  4V1A v;  5HXE A;  3ZMS B;  1VOM A;  2ACX A;  4B6X A;  2DHR A;  2GK9 A;  4IE6 A;  2JRK A;  5CA0 E;  2BZB A;  2RA1 A;  4O4J E;  2HH7 A;  1E1H B;  3OJA A;  4HKA A;  1YKH B;  3O9X A;  3ZCJ A;  4AXP A;  4CXX A;  3ANW B;  3S4U A;  3CX8 B;  3EDV A;  4KP3 C;  4UVC B;  3F57 A;  2A3D A;  3N9N A;  4EYY R;  4ZI3 D;  5LXT E;  2NOX A;  1QSD A;  4QWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...