5IWAT

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
103
structure length
103
Chain Sequence
KKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 34
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5iwaT00
2UXBT 1IBKT 1HNZT 4NXMT 4DR3T 1I94T 1IBMT 1XNQT 4B3ST 2VQFT 4DR1T 4DV6T 4DV0T 4LFBT 5LMNT 1HNXT 1HR0T 5IWAT 4AQYT 4NXNT 4K0KT 1N32T 4DV4T 4DR4T 4DUZT 4DR6T 4GKKT 3T1YT 2VQET 4DV7T 4JI1T 4YHHT 4DUYT 4LF6T 4DV2T 4DV3T 4OX9T 1IBLT 4JI0T 2E5LT 4LF8T 2UXDT 1FJGT 2ZM6T 4LF5T 4DR7T 1XMQT 4JI2T 4X65T 1N33T 4LF9T 1XNRT 4DR5T 4LFAT 4DR2T 1N36T 1XMOT 4JYAT 1J5ET 5BR8T 2UUCT 4B3MT 4JI8T 2F4VT 4GKJT 4LFCT 4JI6T 2UUAT 2UXCT 1N34T 4YY3T 4DV1T 4JI5T 1HNWT 2UUBT 3T1HT 2UU9T 4JI7T 3OTOT 5LMUT 4LF7T 4JV5T 4B3RT 4X64T 4KHPT 4X62T 4JI3T 4B3TT 4LF4T 4JI4T 4DV5T 4X66T 2HHHT
chains in the Genus database with same CATH superfamily
2XASB 2CBIA 2BS2A 3EVYA 2I59A 2FUPA 2H7OA 2FJBA 3FZLB 3LK3B 4WYVA 3AE8A 3AE2A 5F3JA 1IBKT 3PJAA 1I94T 1KFYA 1XNQT 3UU8A 5H6QB 3OPCA 3A5XA 3RQUA 4DBRA 1BR0A 1US7B 4OYKA 3CK6A 3UU5A 4ANJA 3FB2A 2CCQA 2W67A 3G06A 3M65A 3TLTA 2KINB 3AE6A 5J0ZA 5FL1A 2YK0A 4M1PA 3QB5K 2OA5A 3UQ7A 5FL0A 2ZMAA 3EHZA 4KX6A 4LFBT 5C3JA 4ZXLA 3QNUA 3NZPA 4EEDA 1HR0T 4WW0A 3WI3A 3AECA 5AQSB 3IHRA 3P8CD 1H7CA 2LLYA 4PW8A 1LKXA 3AXJB 4I50E 5ABFA 4HFBA 4QX8B 4IE6A 4LMJA 4AQYT 2ODVA 3PUXF 2JIWA 3SS1A 3TLSA 3C4XA 1Y01A 2MTQA 4HFIA 4JUYA 5LOVE 4YTPA 4QXBB 3KV6A 4B6XA 2JQQA 3JC6D 5JR9A 4BAYB 3CMLA 2SPCA 2LM9A 5GONE 1HG5A 5HYAA 4PNIA 2M67A 1OEDA 2WWUA 1E7PA 3LFMA 4CN4A 4KMCA 4IE4A 5LBQB 3ABVA 3C50A 3JADA 5ADXL 5ABGA 5CJ5A 2XPKA 3VHLA 1Y64B 4ILAA 4AI6A 4AKRB 2YKSA 2OLTA 4I0UA 2K3WA 4DR6T 3ZMTB 3CPZA 4HWDA 4EEBA 3CVRA 3FBZA 2VQET 2MOZA 3OVUA 3ZMZB 2CMRA 5AQLB 2A3DA 3JAFA 3RYHE 2VL8A 4JI1T 3PUAA 5F8PA 3U78A 3AA7B 4UELA 3VRBA 5DQWA 1T98A 2IIUA 5EK3A 4EYYR 5C2TA 1OEDE 2VKHA 4TZ4C 4AKHA 5HEUA 3BK9A 2XUEA 4C91A 4CI1B 3UULA 2LRKA 1YQ3A 1HX8A 1YKEB 1XMQT 3I9YA 3R6NA 3RX6A 5CA0E 4DR7T 4NUVA 4IL4A 4JEUB 5LNKA 5KX5E 3CX8B 5LGTB 2X9XA 4AQFA 3CX7B 4AXPA 4O2AE 3ONLC 2VKDA 2ZM8A 4HN9A 4WBOA 2NOXA 3MXZA 2W00A 1W09A 3P4QA 4X65T 4A97A 4LF9T 2WMOA 5KMGP 2IW5B 1AJ3A 3RC3A 1XZYA 2RPAA 1VCTA 3GN5A 2KZ7B 2FJEA 5FNVE 2V8SV 4YXDA 2K24A 1X79A 3VRAA 3VR8A 1OWAA 5BR8T 2UUCT 1M62A 1NAFA 2EHOD 4U31A 3RHWA 3ZSTA 2F4VT 3FBLA 4XBFB 4QH5A 4P1NA 5AQGB 4EAHA 3N9LA 5JREA 3KVBA 3PDYA 3N9PA 3RRCA 3MK7C 3PUYF 1VRBA 3AEAA 4ZS3A 5L3FB 3OJAA 2V7JA 4OYJA 4JI6T 1VOMA 4YJ2E 1LRZA 4O4JE 5AQFB 2BG9A 3AAAB 3HR0A 4UV8B 2BG9E 2P9BA 1YD8G 4DV1T 1UCUA 2VK9A 1VCSA 5HEGA 3HKDE 2LSIA 3N5LA 4JI5T 2PFVA 4HWIB 3OKQA 2MBGA 3ZMVB 2HHHT 3H37A 4PAGA 4UIGA 4TWHA 5AQHB 4HKAA 1D1AA 4HFCA 5HXRA 2V7IA 4YLHA 2NP9A 1YKHB 2YINA 2QRXA 3RYIE 5FY0A 5LMUT 5DQVA 3JC6C 2YDRA 4COFA 5AQPB 1LVKA 2KNDA 3RH3A 4JV5T 2NTYA 4X64T 2BS3A 4MHCA 3LG7A 3P7IA 5H6RB 4XZCA 2W2UA 2ZM2A 1WR0A 2AE9A 4QH1A 3J9X1 4DVDA 5J2TE 1GQEA 2VVSA 3KV9A 2D9DA 4BA9A 1U5PA 1MNEA 5JQGE 4CN6A 2E2AA 2LSKA 4IHJE 2ES0A 1HNZT 4TNVA 4NXMT 4ERRA 1D0YA 2X9WA 3PUGA 4YSZA 1IBMT 5FYMA 4OHFA 2VWAA 5HAXA 1HF8A 2LHRA 3I0OA 3ZMUB 2CRBA 3EAMA 3NBXX 1Z0PA 2LSYA 4B3ST 4FI5A 4IE0A 4A5XA 1EZ3A 3KBTA 4A98A 4ZI7E 4TUYE 4WZXA 3AE3A 5KXJA 2D5UA 2WSSV 2XJ7A 2KWIB 1WLXA 2B1EA 2CWYA 3EI0A 3ZPOA 2W4XA 5AFUL 2XZEA 1Z8UA 3N2GE 3NRYA 5L4HA 3RRWA 5LMNT 3I9WA 1ZOYA 4MLKA 4EZHA 2E9XD 2PTFA 2PG8A 3H3AA 3PUVF 4BJMA 5IWAT 2YEVC 4ILCA 5FXWA 4TV9E 2ACXA 2CXFA 2DNXA 2NW8A 5LJMA 1ZV4X 1MMDA 1V9DA 1O3XA 2BBHA 3CQGB 2ZLYA 3Q5EA 4PJNA 2M6IA 2NW9A 2XQ5A 4NXNT 1D0XA 4J2CA 5L2LA 2NTXA 2Y8DA 3AE9A 1XDPA 3B57A 1SHZC 2WY2A 2MYSA 2IAKA 2UXNB 1KNPA 2VKOA 2YDSA 3E22E 3LK42 3PJAJ 4UVAB 3ZT6A 4QX7B 2XAFB 5LG3A 4DV4T 4EV6A 4DR4T 4JEHB 2A9UA 2VL0A 3IA3A 2WDVA 4U7IA 2BVLA 2HH7A 2Y6XA 2LSJA 4PJMA 5FY1A 3L09A 3RGLA 3RKGA 4AIUA 5JDGA 4ASKA 2LT3A 4BJNA 2EHOA 4GOUA 4IREA 2BKNA 4GK0E 3RIFA 5J1GA 4AKLA 3T1YT 5DABA 4ADZA 1OEDC 1UGOA 1MMAA 2BZBA 2VURA 2WU2A 3AAEB 5FP3A 5LHHB 3I0QA 3TKLB 5LHGB 3AAIA 2CA5A 4DV3T 4EYUA 2W61A 5HEOA 4H63V 1HS7A 2XAGB 5JRCB 1LVFA 2LKGA 3FHNA 1FJGT 3LSVA 3QB5A 2DWKA 2QYWA 3KDSE 5AQQB 4ZHQE 5CFBA 2ZM6T 5HXHA 4I43B 2JRKA 2XSAA 3OBVE 4G63A 5TAOA 5AQOB 3ZCJA 4JLEA 3ZT5A 3P4PA 4TWFA 1I6ZA 2H88A 2XTLA 2XQ8A 3A7MA 3GMIA 4NUUA 1HG2A 1WRDA 2OV9A 4U2YA 4JI2T 3SFEA 2CPTA 3N9OA 3QUJA 5JDHA 4MBQA 1XNRT 2WDQA 1M7KA 4CXXA 2WU5A 2I6HA 4JBWF 3ZJ1A 2C5JA 5L3EB 2BBJA 1UK5A 3AE1A 1OEDB 3DJBA 4V1Av 5JDQA 5LHIB 1IJ5A 2QVAA 1XWMA 4GIWA 4ILUA 2X51A 2V7KA 3TLVA 4LF8T 3ZJ2A 4AKGA 3K8PC 3W15B 4GK5E 4LFCT 5AQTB 3HKCE 4GYSA 4HFDA 5FXVA 2XM2A 5EZYE 3ZEFB 3AEBA 3PUSA 2K48A 1L0VA 1J5WA 1D1BA 4OK0A 3N2KE 2LKHA 2YDQA 3IF8B 5FXXA 1S94A 3ESLA 1N34T 4KUMB 4WBNE 4KI0F 2EHOB 1MNDA 4YTNA 5HXSA 1UX5A 4X66T 3GN5B 3AVRA 2XM1A 3RYFE 2DLRA 3RF1A 2V6YB 3TLWA 4CN1A 4UV9B 1DU2A 5LBMA 1J1JA 4AKIA 2WZIA 3KFWX 2XY8B 2ACZA 1R8IA 5L3CB 2HN1A 2UU9T 3L39A 3PE0A 5LG4A 3M3ZB 4IE7A 3OTOT 2A2FX 2BKOA 2KLQA 2I0MA 3PV0F 4LF7T 2JJ9A 4H9SE 2DHRA 3AEFA 5HWYA 4B3RT 3WAJA 2PJQA 4KHPT 4NPPA 4U7YA 2CM0A 4YHJA 3Q5XA 4X62T 4P0AA 3ZC0A 3UU4A 4B3TT 1CUNA 2IHR1 3K3QC 2VASA 3R84B 5FVLA 5FXZA 4CQIA 3D0TA 4U3CA 3RI5A 3ZSSA 3E0ZA 3AE5A 2JMHA 2UXBT 2IDOB 1SUMB 1E1HB 1X9BA 1FMWA 4UR9A 4QWNB 2XQYA 4O4IE 1SA0E 2CEAA 1ZKEA 2J62A 2MPKA 3FZKB 3JAEA 3NWIA 3OYXA 4IL9A 4Z90A 4AISA 4DBQA 5KDMC 2E5VA 2WMNA 3UFEA 2E9XC 2Q9QB 3MJXA 4IIJE 4QH4A 5CB4E 4HGAA 2JQ9A 4DV6T 3AA6B 2WQYA 3KINB 4ZZCA 2L9QA 3ANWA 1E2AA 2J47A 2R6GF 4DV0T 4YFSA 1OXZA 4X5TA 1HNXT 2DWGA 2D0UA 2Y48B 3Q5WA 1NENA 4HTEA 3H3MA 5ABHA 2JQHA 3HKBE 1UUSA 3ZN0B 4WNKA 1NWMX 4ZZBA 5ABEA 5JDMA 4N78D 2CBJA 1BR4A 5HEJA 3SRZA 4LMLA 2YOEA 3TLUA 4KP3C 3AXJA 5JDFA 5ABFB 3UT5E 1FEWA 5HXCA 1WR6A 5LB7B 2DCFA 1W0BA 2Q9QD 4ISSA 4DNDA 2WWVA 1N32T 2W63A 3BQKA 1IAPA 2AXDS 2X9YA 4DIDB 5LXTE 2W62A 2L8KA 2NR4A 2YU1A 4HFEA 4QXCB 5IUXA 3UUMA 3MA9A 2H7VC 1KF6A 5FVKA 2V6XA 3BQLA 1ZEEA 1T7SA 4HFHA 4GKKT 3SOLA 3UUBA 3EDUA 2LSGA 5AQKB 3P50A 4CZZB 2RA1A 4GYRA 1QLBA 3AA1B 4H9QC 4TNWA 3RIUC 1ZHCA 2J4GA 2KMFA 3HI2A 3PU3A 2BG9B 3PU8A 4AQFC 2KXPB 4LF6T 1XDOA 4HWCA 4DV2T 5L4EA 4OX9T 3VKGA 4QXHB 3V5SA 3FZMB 3AB3B 3C51A 1HTJF 3ONJA 2VKJA 3FXDB 4O4HE 4H9NC 4PFPA 2X9HA 4IDOA 3QC9A 4U74A 2EHOC 2XAQB 5AQRB 4LF5T 1JNRA 4I4TE 3AEEA 3Q2MA 4F6RC 4H9PC 5LJNA 3J7Yq 4IT4A 4O8SA 5CA1E 2Q9QA 3MKDA 3PUZF 4QKNA 5C8YE 4IDPA 4U72A 1BR1A 4G2AA 4KHZF 5F5WA 5AQMB 1BR2A 4PFOA 3X1DA 5JH7E 3O1HA 2BKPA 1N33T 4YT0A 2UXDT 3LDQB 4L5GA 1MIVA 4UF0B 2WB5A 4UVBB 4X1KE 4CXYA 5ETWA 4DR5T 4YSXA 3NZQA 3LBXA 5BMVE 3IEEA 3Q9DA 1JNZA 3ZYLA 4CXWA 2BG9C 4UF0A 3V5UA 3MZKB 2JMKA 2Q9QC 3QOFA 1T72A 4EGWA 3C64A 5LGNB 1XMOT 4E7ZA 1KNZA 3RC8A 4B3MT 2GK9A 3P4RA 2A72A 4EIWA 2E9XB 5E0OA 4IDQA 2LEHA 2WP9A 2JPFA 1W9RA 3PUWF 4O4LE 3SFDA 1G8XA 2XQ4A 1KNRA 4EZ4A 4TV8E 3OYZA 1KEYA 2UXCT 3AE7A 2FJAA 5JVDE 4YY3T 4MALA 3ZC1A 5LYJE 5EK4A 3CKDA 1HCIA 1UURA 3NVOA 1HNWT 3T8OA 2WM9A 2X0YA 2LOPA 2UUBT 3I1AA 3N9MA 4TN7B 2YN6A 2ZM0A 2QA7A 3ETUA 4ZS2A 4P0BA 1MMNA 3A8YC 3L8RA 3P4SA 3VKHA 2V6YA 2XQ7A 3P4WA 5EK2A 4UEMA 5JRCA 4XAXB 2LHNA 1D1CA 3HKEE 3K1SA 4FJOA 1YW0A 3Q5DA 2JQKA 4A56A 5A1LA 4U2ZA 1CHUA 2NWBA 3UUXB 3ETVA 2V5CA 2XSBA 5HEHA 1U4QA 4IE5A 3C4WA 3RLFF 2MAWA 3ZMSB 3ZYKA 5J2UE 2E8IA 4X1YE 2WBLA 4ZI3C 5CGMA 2CE7A 4YSYA 3N9QA 3UUNA 4JI4T 4HE8A 4DV5T 2LE8A 2E9XA 5LP6E 2XQAA 2Z6EA 2C5KT 3CWZB 4HWFA 3PURA 2RP4A 2BVMA 4YTMA 2X67A 2BDEA 2D0TA 1G73A 2V7LA 3ZKRA 2XQ3A 4TWDA 1IJ6A 4DR3T 3DTOA 2HN2A 5JDLA 3UQ4A 5L3BB 2N1GA 2V7MA 4HWHA 4ZI2C 4PJJA 1UX4A 3ZT7A 2VQFT 1WFDA 4DR1T 2FBWA 5LGUB 5AQNB 2VB6A 4H63H 2N2NA 2LJLA 3KV4A 5L3DB 4H9OC 1W0AA 2V26A 4PK6A 3RIAA 4DMVA 4PK4A 1HFAA 2YU2A 3LK2B 3UU3A 1QSDA 3E08A 3F57A 2XAJB 1KK7A 2IMLA 2DI4A 4U33A 4LMKA 3FZHB 3N2OA 3NRXA 3UU6A 2N9DA 3JCFA 2CLYC 2NW7A 4YJ3E 2X0LB 2XQ6A 5JTGA 2DL1A 3VU7H 3K3NA 2W0GA 3N9NA 1NEKA 3ZYMA 1MMGA 4X1IE 5AQJB 4EXTA 5JR9B 1S35A 2HPLA 3AA0B 3EABA 4ZI3D 5M4YA 2V5DA 3AE4A 2CXDA 4K0KT 4PJLA 4HEAA 3GWHA 3O1JA 2FJDA 2IC9A 3NKZA 5FY7A 3ZN1B 2LRLA 3RIUA 1B7TA 2WCAA 4H9RC 4I55E 3KBUA 4ISTA 5HCMA 4JI3T 1QUUA 2K9AA 4KBMB 2QGSA 4ZI2D 4DUZT 2W66A 4E7SA 5L3GB 2G0UA 1YQ4A 1D0ZA 4EOZB 2KWHA 2V1DB 2D2SA 4L0RA 3B13A 5AQIB 4ZEYA 5JR9C 3AEGA 4F8HA 5DJQC 4DV7T 3GA8A 1FIOA 4YHHT 4Z91A 4IDNA 4DUYT 4PK5A 2KT9A 4IDZA 1IBLT 4JI0T 2E5LT 1IZNB 3CX6B 2M6BA 3KV5A 2XQ9A 3PUQA 4AQGA 5AQUB 2XHEB 3F31A 4L9IA 3K3OA 3C98B 3QK6A 2H89A 1T8BA 3C4ZA 3MACA 3S4UA 3CIRA 2BS4A 3ZCIA 4UVCB 4DMWA 5AQVB 2K5BB 2IUBA 2IC6A 3ANWB 4CI2B 3O1IA 3LBXB 2WS3A 3B5MA 3LJCA 3F2EA 4LFAT 2WDRA 3AVSA 3L3PA 1WYCA 2LM2A 3CQXC 2UXXB 3O9XA 4DR2T 3PTRB 1MIWA 2X68A 3RQWA 1N36T 3UTKA 1J5ET 3EDVA 4JYAT 3IBPA 4JI8T 1FMVA 4TX5A 1ZP0A 3AEDA 5HCJA 4GKJT 1WYBA 4O2BE 3HL6A 5IHYA 2C0SA 4OFZA 2H3RA 2XAHB 3FXEB 2ODUA 4Q25A 5LCYA 3VR9A 4EB6E 4NIQA 5HWXA 5L47A 2CXLA 2UUAT 3RPUA 3DP7A 2CHOA 2X0HA 1HX1B 2PBIA 2X66A 2WZHA 2C5IT 2CHNA 4Z8XA 4CI3B 2L3LA 3CQCB 4K0UA 3ONXA 5LA6E 2KSRA 5FKYA 3T1HT 2LOSA 3FZFB 4QHOA 4X20E 3KVAA 3RYCE 4DO0A 2CLYB 4JI7T 2WAUA 1YXRA 2CWOA 1MIYA 2B76A 2HPJA 3RKOA 5HXEA 3SWHA 4IGUA 4ZOLE 5IYZE 3UFGA 3WAKA 4HFVA 2J1DG 3ZLIA 3BQIA 5JDNA 5FMNA 3O4XE 3HA4A 2VVNA 4LF4T 4UXNB 4MFRA 4P09A 3U3IA 3EUHA 4ILBA 1SE7A 4C90A 1WCRA
chains in the Genus database with same CATH topology
2UXBT 1IBKT 1HNZT 4NXMT 4DR3T 1I94T 1IBMT 1XNQT 4B3ST 2VQFT 4DR1T 4DV6T 4DV0T 4LFBT 5LMNT 1HNXT 1HR0T 5IWAT 4AQYT 4NXNT 4K0KT 1N32T 4DV4T 4DR4T 4DUZT 4DR6T 4GKKT 3T1YT 2VQET 4DV7T 4JI1T 4YHHT 4DUYT 4LF6T 4DV2T 4DV3T 4OX9T 1IBLT 4JI0T 2E5LT 4LF8T 2UXDT 1FJGT 2ZM6T 4LF5T 4DR7T 1XMQT 4JI2T 4X65T 1N33T 4LF9T 1XNRT 4DR5T 4LFAT 4DR2T 1N36T 1XMOT 4JYAT 1J5ET 5BR8T 2UUCT 4B3MT 4JI8T 2F4VT 4GKJT 4LFCT 4JI6T 2UUAT 2UXCT 1N34T 4YY3T 4DV1T 4JI5T 1HNWT 2UUBT 3T1HT 2UU9T 4JI7T 3OTOT 5LMUT 4LF7T 4JV5T 4B3RT 4X64T 4KHPT 4X62T 4JI3T 4B3TT 4LF4T 4JI4T 4DV5T 4X66T 2HHHT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB T;  1IBK T;  1HNZ T;  4NXM T;  4DR3 T;  1I94 T;  1IBM T;  1XNQ T;  4B3S T;  2VQF T;  4DR1 T;  4DV6 T;  4DV0 T;  4LFB T;  5LMN T;  1HNX T;  1HR0 T;  5IWA T;  4AQY T;  4NXN T;  4K0K T;  1N32 T;  4DV4 T;  4DR4 T;  4DUZ T;  4DR6 T;  4GKK T;  3T1Y T;  2VQE T;  4DV7 T;  4JI1 T;  4YHH T;  4DUY T;  4LF6 T;  4DV2 T;  4DV3 T;  4OX9 T;  1IBL T;  4JI0 T;  2E5L T;  4LF8 T;  2UXD T;  1FJG T;  2ZM6 T;  4LF5 T;  4DR7 T;  1XMQ T;  4JI2 T;  4X65 T;  1N33 T;  4LF9 T;  1XNR T;  4DR5 T;  4LFA T;  4DR2 T;  1N36 T;  1XMO T;  4JYA T;  1J5E T;  5BR8 T;  2UUC T;  4B3M T;  4JI8 T;  2F4V T;  4GKJ T;  4LFC T;  4JI6 T;  2UUA T;  2UXC T;  1N34 T;  4YY3 T;  4DV1 T;  4JI5 T;  1HNW T;  2UUB T;  3T1H T;  2UU9 T;  4JI7 T;  3OTO T;  5LMU T;  4LF7 T;  4JV5 T;  4B3R T;  4X64 T;  4KHP T;  4X62 T;  4JI3 T;  4B3T T;  4LF4 T;  4JI4 T;  4DV5 T;  4X66 T;  2HHH T; 
#chains in the Genus database with same CATH topology
 2XAS B;  2CBI A;  2BS2 A;  3EVY A;  2I59 A;  2FUP A;  2H7O A;  2FJB A;  3FZL B;  3LK3 B;  4WYV A;  3AE8 A;  3AE2 A;  5F3J A;  1IBK T;  3PJA A;  1I94 T;  1KFY A;  1XNQ T;  3UU8 A;  5H6Q B;  3OPC A;  3A5X A;  3RQU A;  4DBR A;  1BR0 A;  1US7 B;  4OYK A;  3CK6 A;  3UU5 A;  4ANJ A;  3FB2 A;  2CCQ A;  2W67 A;  3G06 A;  3M65 A;  3TLT A;  2KIN B;  3AE6 A;  5J0Z A;  5FL1 A;  2YK0 A;  4M1P A;  3QB5 K;  2OA5 A;  3UQ7 A;  5FL0 A;  2ZMA A;  3EHZ A;  4KX6 A;  4LFB T;  5C3J A;  4ZXL A;  3QNU A;  3NZP A;  4EED A;  1HR0 T;  4WW0 A;  3WI3 A;  3AEC A;  5AQS B;  3IHR A;  3P8C D;  1H7C A;  2LLY A;  4PW8 A;  1LKX A;  3AXJ B;  4I50 E;  5ABF A;  4HFB A;  4QX8 B;  4IE6 A;  4LMJ A;  4AQY T;  2ODV A;  3PUX F;  2JIW A;  3SS1 A;  3TLS A;  3C4X A;  1Y01 A;  2MTQ A;  4HFI A;  4JUY A;  5LOV E;  4YTP A;  4QXB B;  3KV6 A;  4B6X A;  2JQQ A;  3JC6 D;  5JR9 A;  4BAY B;  3CML A;  2SPC A;  2LM9 A;  5GON E;  1HG5 A;  5HYA A;  4PNI A;  2M67 A;  1OED A;  2WWU A;  1E7P A;  3LFM A;  4CN4 A;  4KMC A;  4IE4 A;  5LBQ B;  3ABV A;  3C50 A;  3JAD A;  5ADX L;  5ABG A;  5CJ5 A;  2XPK A;  3VHL A;  1Y64 B;  4ILA A;  4AI6 A;  4AKR B;  2YKS A;  2OLT A;  4I0U A;  2K3W A;  4DR6 T;  3ZMT B;  3CPZ A;  4HWD A;  4EEB A;  3CVR A;  3FBZ A;  2VQE T;  2MOZ A;  3OVU A;  3ZMZ B;  2CMR A;  5AQL B;  2A3D A;  3JAF A;  3RYH E;  2VL8 A;  4JI1 T;  3PUA A;  5F8P A;  3U78 A;  3AA7 B;  4UEL A;  3VRB A;  5DQW A;  1T98 A;  2IIU A;  5EK3 A;  4EYY R;  5C2T A;  1OED E;  2VKH A;  4TZ4 C;  4AKH A;  5HEU A;  3BK9 A;  2XUE A;  4C91 A;  4CI1 B;  3UUL A;  2LRK A;  1YQ3 A;  1HX8 A;  1YKE B;  1XMQ T;  3I9Y A;  3R6N A;  3RX6 A;  5CA0 E;  4DR7 T;  4NUV A;  4IL4 A;  4JEU B;  5LNK A;  5KX5 E;  3CX8 B;  5LGT B;  2X9X A;  4AQF A;  3CX7 B;  4AXP A;  4O2A E;  3ONL C;  2VKD A;  2ZM8 A;  4HN9 A;  4WBO A;  2NOX A;  3MXZ A;  2W00 A;  1W09 A;  3P4Q A;  4X65 T;  4A97 A;  4LF9 T;  2WMO A;  5KMG P;  2IW5 B;  1AJ3 A;  3RC3 A;  1XZY A;  2RPA A;  1VCT A;  3GN5 A;  2KZ7 B;  2FJE A;  5FNV E;  2V8S V;  4YXD A;  2K24 A;  1X79 A;  3VRA A;  3VR8 A;  1OWA A;  5BR8 T;  2UUC T;  1M62 A;  1NAF A;  2EHO D;  4U31 A;  3RHW A;  3ZST A;  2F4V T;  3FBL A;  4XBF B;  4QH5 A;  4P1N A;  5AQG B;  4EAH A;  3N9L A;  5JRE A;  3KVB A;  3PDY A;  3N9P A;  3RRC A;  3MK7 C;  3PUY F;  1VRB A;  3AEA A;  4ZS3 A;  5L3F B;  3OJA A;  2V7J A;  4OYJ A;  4JI6 T;  1VOM A;  4YJ2 E;  1LRZ A;  4O4J E;  5AQF B;  2BG9 A;  3AAA B;  3HR0 A;  4UV8 B;  2BG9 E;  2P9B A;  1YD8 G;  4DV1 T;  1UCU A;  2VK9 A;  1VCS A;  5HEG A;  3HKD E;  2LSI A;  3N5L A;  4JI5 T;  2PFV A;  4HWI B;  3OKQ A;  2MBG A;  3ZMV B;  2HHH T;  3H37 A;  4PAG A;  4UIG A;  4TWH A;  5AQH B;  4HKA A;  1D1A A;  4HFC A;  5HXR A;  2V7I A;  4YLH A;  2NP9 A;  1YKH B;  2YIN A;  2QRX A;  3RYI E;  5FY0 A;  5LMU T;  5DQV A;  3JC6 C;  2YDR A;  4COF A;  5AQP B;  1LVK A;  2KND A;  3RH3 A;  4JV5 T;  2NTY A;  4X64 T;  2BS3 A;  4MHC A;  3LG7 A;  3P7I A;  5H6R B;  4XZC A;  2W2U A;  2ZM2 A;  1WR0 A;  2AE9 A;  4QH1 A;  3J9X 1;  4DVD A;  5J2T E;  1GQE A;  2VVS A;  3KV9 A;  2D9D A;  4BA9 A;  1U5P A;  1MNE A;  5JQG E;  4CN6 A;  2E2A A;  2LSK A;  4IHJ E;  2ES0 A;  1HNZ T;  4TNV A;  4NXM T;  4ERR A;  1D0Y A;  2X9W A;  3PUG A;  4YSZ A;  1IBM T;  5FYM A;  4OHF A;  2VWA A;  5HAX A;  1HF8 A;  2LHR A;  3I0O A;  3ZMU B;  2CRB A;  3EAM A;  3NBX X;  1Z0P A;  2LSY A;  4B3S T;  4FI5 A;  4IE0 A;  4A5X A;  1EZ3 A;  3KBT A;  4A98 A;  4ZI7 E;  4TUY E;  4WZX A;  3AE3 A;  5KXJ A;  2D5U A;  2WSS V;  2XJ7 A;  2KWI B;  1WLX A;  2B1E A;  2CWY A;  3EI0 A;  3ZPO A;  2W4X A;  5AFU L;  2XZE A;  1Z8U A;  3N2G E;  3NRY A;  5L4H A;  3RRW A;  5LMN T;  3I9W A;  1ZOY A;  4MLK A;  4EZH A;  2E9X D;  2PTF A;  2PG8 A;  3H3A A;  3PUV F;  4BJM A;  5IWA T;  2YEV C;  4ILC A;  5FXW A;  4TV9 E;  2ACX A;  2CXF A;  2DNX A;  2NW8 A;  5LJM A;  1ZV4 X;  1MMD A;  1V9D A;  1O3X A;  2BBH A;  3CQG B;  2ZLY A;  3Q5E A;  4PJN A;  2M6I A;  2NW9 A;  2XQ5 A;  4NXN T;  1D0X A;  4J2C A;  5L2L A;  2NTX A;  2Y8D A;  3AE9 A;  1XDP A;  3B57 A;  1SHZ C;  2WY2 A;  2MYS A;  2IAK A;  2UXN B;  1KNP A;  2VKO A;  2YDS A;  3E22 E;  3LK4 2;  3PJA J;  4UVA B;  3ZT6 A;  4QX7 B;  2XAF B;  5LG3 A;  4DV4 T;  4EV6 A;  4DR4 T;  4JEH B;  2A9U A;  2VL0 A;  3IA3 A;  2WDV A;  4U7I A;  2BVL A;  2HH7 A;  2Y6X A;  2LSJ A;  4PJM A;  5FY1 A;  3L09 A;  3RGL A;  3RKG A;  4AIU A;  5JDG A;  4ASK A;  2LT3 A;  4BJN A;  2EHO A;  4GOU A;  4IRE A;  2BKN A;  4GK0 E;  3RIF A;  5J1G A;  4AKL A;  3T1Y T;  5DAB A;  4ADZ A;  1OED C;  1UGO A;  1MMA A;  2BZB A;  2VUR A;  2WU2 A;  3AAE B;  5FP3 A;  5LHH B;  3I0Q A;  3TKL B;  5LHG B;  3AAI A;  2CA5 A;  4DV3 T;  4EYU A;  2W61 A;  5HEO A;  4H63 V;  1HS7 A;  2XAG B;  5JRC B;  1LVF A;  2LKG A;  3FHN A;  1FJG T;  3LSV A;  3QB5 A;  2DWK A;  2QYW A;  3KDS E;  5AQQ B;  4ZHQ E;  5CFB A;  2ZM6 T;  5HXH A;  4I43 B;  2JRK A;  2XSA A;  3OBV E;  4G63 A;  5TAO A;  5AQO B;  3ZCJ A;  4JLE A;  3ZT5 A;  3P4P A;  4TWF A;  1I6Z A;  2H88 A;  2XTL A;  2XQ8 A;  3A7M A;  3GMI A;  4NUU A;  1HG2 A;  1WRD A;  2OV9 A;  4U2Y A;  4JI2 T;  3SFE A;  2CPT A;  3N9O A;  3QUJ A;  5JDH A;  4MBQ A;  1XNR T;  2WDQ A;  1M7K A;  4CXX A;  2WU5 A;  2I6H A;  4JBW F;  3ZJ1 A;  2C5J A;  5L3E B;  2BBJ A;  1UK5 A;  3AE1 A;  1OED B;  3DJB A;  4V1A v;  5JDQ A;  5LHI B;  1IJ5 A;  2QVA A;  1XWM A;  4GIW A;  4ILU A;  2X51 A;  2V7K A;  3TLV A;  4LF8 T;  3ZJ2 A;  4AKG A;  3K8P C;  3W15 B;  4GK5 E;  4LFC T;  5AQT B;  3HKC E;  4GYS A;  4HFD A;  5FXV A;  2XM2 A;  5EZY E;  3ZEF B;  3AEB A;  3PUS A;  2K48 A;  1L0V A;  1J5W A;  1D1B A;  4OK0 A;  3N2K E;  2LKH A;  2YDQ A;  3IF8 B;  5FXX A;  1S94 A;  3ESL A;  1N34 T;  4KUM B;  4WBN E;  4KI0 F;  2EHO B;  1MND A;  4YTN A;  5HXS A;  1UX5 A;  4X66 T;  3GN5 B;  3AVR A;  2XM1 A;  3RYF E;  2DLR A;  3RF1 A;  2V6Y B;  3TLW A;  4CN1 A;  4UV9 B;  1DU2 A;  5LBM A;  1J1J A;  4AKI A;  2WZI A;  3KFW X;  2XY8 B;  2ACZ A;  1R8I A;  5L3C B;  2HN1 A;  2UU9 T;  3L39 A;  3PE0 A;  5LG4 A;  3M3Z B;  4IE7 A;  3OTO T;  2A2F X;  2BKO A;  2KLQ A;  2I0M A;  3PV0 F;  4LF7 T;  2JJ9 A;  4H9S E;  2DHR A;  3AEF A;  5HWY A;  4B3R T;  3WAJ A;  2PJQ A;  4KHP T;  4NPP A;  4U7Y A;  2CM0 A;  4YHJ A;  3Q5X A;  4X62 T;  4P0A A;  3ZC0 A;  3UU4 A;  4B3T T;  1CUN A;  2IHR 1;  3K3Q C;  2VAS A;  3R84 B;  5FVL A;  5FXZ A;  4CQI A;  3D0T A;  4U3C A;  3RI5 A;  3ZSS A;  3E0Z A;  3AE5 A;  2JMH A;  2UXB T;  2IDO B;  1SUM B;  1E1H B;  1X9B A;  1FMW A;  4UR9 A;  4QWN B;  2XQY A;  4O4I E;  1SA0 E;  2CEA A;  1ZKE A;  2J62 A;  2MPK A;  3FZK B;  3JAE A;  3NWI A;  3OYX A;  4IL9 A;  4Z90 A;  4AIS A;  4DBQ A;  5KDM C;  2E5V A;  2WMN A;  3UFE A;  2E9X C;  2Q9Q B;  3MJX A;  4IIJ E;  4QH4 A;  5CB4 E;  4HGA A;  2JQ9 A;  4DV6 T;  3AA6 B;  2WQY A;  3KIN B;  4ZZC A;  2L9Q A;  3ANW A;  1E2A A;  2J47 A;  2R6G F;  4DV0 T;  4YFS A;  1OXZ A;  4X5T A;  1HNX T;  2DWG A;  2D0U A;  2Y48 B;  3Q5W A;  1NEN A;  4HTE A;  3H3M A;  5ABH A;  2JQH A;  3HKB E;  1UUS A;  3ZN0 B;  4WNK A;  1NWM X;  4ZZB A;  5ABE A;  5JDM A;  4N78 D;  2CBJ A;  1BR4 A;  5HEJ A;  3SRZ A;  4LML A;  2YOE A;  3TLU A;  4KP3 C;  3AXJ A;  5JDF A;  5ABF B;  3UT5 E;  1FEW A;  5HXC A;  1WR6 A;  5LB7 B;  2DCF A;  1W0B A;  2Q9Q D;  4ISS A;  4DND A;  2WWV A;  1N32 T;  2W63 A;  3BQK A;  1IAP A;  2AXD S;  2X9Y A;  4DID B;  5LXT E;  2W62 A;  2L8K A;  2NR4 A;  2YU1 A;  4HFE A;  4QXC B;  5IUX A;  3UUM A;  3MA9 A;  2H7V C;  1KF6 A;  5FVK A;  2V6X A;  3BQL A;  1ZEE A;  1T7S A;  4HFH A;  4GKK T;  3SOL A;  3UUB A;  3EDU A;  2LSG A;  5AQK B;  3P50 A;  4CZZ B;  2RA1 A;  4GYR A;  1QLB A;  3AA1 B;  4H9Q C;  4TNW A;  3RIU C;  1ZHC A;  2J4G A;  2KMF A;  3HI2 A;  3PU3 A;  2BG9 B;  3PU8 A;  4AQF C;  2KXP B;  4LF6 T;  1XDO A;  4HWC A;  4DV2 T;  5L4E A;  4OX9 T;  3VKG A;  4QXH B;  3V5S A;  3FZM B;  3AB3 B;  3C51 A;  1HTJ F;  3ONJ A;  2VKJ A;  3FXD B;  4O4H E;  4H9N C;  4PFP A;  2X9H A;  4IDO A;  3QC9 A;  4U74 A;  2EHO C;  2XAQ B;  5AQR B;  4LF5 T;  1JNR A;  4I4T E;  3AEE A;  3Q2M A;  4F6R C;  4H9P C;  5LJN A;  3J7Y q;  4IT4 A;  4O8S A;  5CA1 E;  2Q9Q A;  3MKD A;  3PUZ F;  4QKN A;  5C8Y E;  4IDP A;  4U72 A;  1BR1 A;  4G2A A;  4KHZ F;  5F5W A;  5AQM B;  1BR2 A;  4PFO A;  3X1D A;  5JH7 E;  3O1H A;  2BKP A;  1N33 T;  4YT0 A;  2UXD T;  3LDQ B;  4L5G A;  1MIV A;  4UF0 B;  2WB5 A;  4UVB B;  4X1K E;  4CXY A;  5ETW A;  4DR5 T;  4YSX A;  3NZQ A;  3LBX A;  5BMV E;  3IEE A;  3Q9D A;  1JNZ A;  3ZYL A;  4CXW A;  2BG9 C;  4UF0 A;  3V5U A;  3MZK B;  2JMK A;  2Q9Q C;  3QOF A;  1T72 A;  4EGW A;  3C64 A;  5LGN B;  1XMO T;  4E7Z A;  1KNZ A;  3RC8 A;  4B3M T;  2GK9 A;  3P4R A;  2A72 A;  4EIW A;  2E9X B;  5E0O A;  4IDQ A;  2LEH A;  2WP9 A;  2JPF A;  1W9R A;  3PUW F;  4O4L E;  3SFD A;  1G8X A;  2XQ4 A;  1KNR A;  4EZ4 A;  4TV8 E;  3OYZ A;  1KEY A;  2UXC T;  3AE7 A;  2FJA A;  5JVD E;  4YY3 T;  4MAL A;  3ZC1 A;  5LYJ E;  5EK4 A;  3CKD A;  1HCI A;  1UUR A;  3NVO A;  1HNW T;  3T8O A;  2WM9 A;  2X0Y A;  2LOP A;  2UUB T;  3I1A A;  3N9M A;  4TN7 B;  2YN6 A;  2ZM0 A;  2QA7 A;  3ETU A;  4ZS2 A;  4P0B A;  1MMN A;  3A8Y C;  3L8R A;  3P4S A;  3VKH A;  2V6Y A;  2XQ7 A;  3P4W A;  5EK2 A;  4UEM A;  5JRC A;  4XAX B;  2LHN A;  1D1C A;  3HKE E;  3K1S A;  4FJO A;  1YW0 A;  3Q5D A;  2JQK A;  4A56 A;  5A1L A;  4U2Z A;  1CHU A;  2NWB A;  3UUX B;  3ETV A;  2V5C A;  2XSB A;  5HEH A;  1U4Q A;  4IE5 A;  3C4W A;  3RLF F;  2MAW A;  3ZMS B;  3ZYK A;  5J2U E;  2E8I A;  4X1Y E;  2WBL A;  4ZI3 C;  5CGM A;  2CE7 A;  4YSY A;  3N9Q A;  3UUN A;  4JI4 T;  4HE8 A;  4DV5 T;  2LE8 A;  2E9X A;  5LP6 E;  2XQA A;  2Z6E A;  2C5K T;  3CWZ B;  4HWF A;  3PUR A;  2RP4 A;  2BVM A;  4YTM A;  2X67 A;  2BDE A;  2D0T A;  1G73 A;  2V7L A;  3ZKR A;  2XQ3 A;  4TWD A;  1IJ6 A;  4DR3 T;  3DTO A;  2HN2 A;  5JDL A;  3UQ4 A;  5L3B B;  2N1G A;  2V7M A;  4HWH A;  4ZI2 C;  4PJJ A;  1UX4 A;  3ZT7 A;  2VQF T;  1WFD A;  4DR1 T;  2FBW A;  5LGU B;  5AQN B;  2VB6 A;  4H63 H;  2N2N A;  2LJL A;  3KV4 A;  5L3D B;  4H9O C;  1W0A A;  2V26 A;  4PK6 A;  3RIA A;  4DMV A;  4PK4 A;  1HFA A;  2YU2 A;  3LK2 B;  3UU3 A;  1QSD A;  3E08 A;  3F57 A;  2XAJ B;  1KK7 A;  2IML A;  2DI4 A;  4U33 A;  4LMK A;  3FZH B;  3N2O A;  3NRX A;  3UU6 A;  2N9D A;  3JCF A;  2CLY C;  2NW7 A;  4YJ3 E;  2X0L B;  2XQ6 A;  5JTG A;  2DL1 A;  3VU7 H;  3K3N A;  2W0G A;  3N9N A;  1NEK A;  3ZYM A;  1MMG A;  4X1I E;  5AQJ B;  4EXT A;  5JR9 B;  1S35 A;  2HPL A;  3AA0 B;  3EAB A;  4ZI3 D;  5M4Y A;  2V5D A;  3AE4 A;  2CXD A;  4K0K T;  4PJL A;  4HEA A;  3GWH A;  3O1J A;  2FJD A;  2IC9 A;  3NKZ A;  5FY7 A;  3ZN1 B;  2LRL A;  3RIU A;  1B7T A;  2WCA A;  4H9R C;  4I55 E;  3KBU A;  4IST A;  5HCM A;  4JI3 T;  1QUU A;  2K9A A;  4KBM B;  2QGS A;  4ZI2 D;  4DUZ T;  2W66 A;  4E7S A;  5L3G B;  2G0U A;  1YQ4 A;  1D0Z A;  4EOZ B;  2KWH A;  2V1D B;  2D2S A;  4L0R A;  3B13 A;  5AQI B;  4ZEY A;  5JR9 C;  3AEG A;  4F8H A;  5DJQ C;  4DV7 T;  3GA8 A;  1FIO A;  4YHH T;  4Z91 A;  4IDN A;  4DUY T;  4PK5 A;  2KT9 A;  4IDZ A;  1IBL T;  4JI0 T;  2E5L T;  1IZN B;  3CX6 B;  2M6B A;  3KV5 A;  2XQ9 A;  3PUQ A;  4AQG A;  5AQU B;  2XHE B;  3F31 A;  4L9I A;  3K3O A;  3C98 B;  3QK6 A;  2H89 A;  1T8B A;  3C4Z A;  3MAC A;  3S4U A;  3CIR A;  2BS4 A;  3ZCI A;  4UVC B;  4DMW A;  5AQV B;  2K5B B;  2IUB A;  2IC6 A;  3ANW B;  4CI2 B;  3O1I A;  3LBX B;  2WS3 A;  3B5M A;  3LJC A;  3F2E A;  4LFA T;  2WDR A;  3AVS A;  3L3P A;  1WYC A;  2LM2 A;  3CQX C;  2UXX B;  3O9X A;  4DR2 T;  3PTR B;  1MIW A;  2X68 A;  3RQW A;  1N36 T;  3UTK A;  1J5E T;  3EDV A;  4JYA T;  3IBP A;  4JI8 T;  1FMV A;  4TX5 A;  1ZP0 A;  3AED A;  5HCJ A;  4GKJ T;  1WYB A;  4O2B E;  3HL6 A;  5IHY A;  2C0S A;  4OFZ A;  2H3R A;  2XAH B;  3FXE B;  2ODU A;  4Q25 A;  5LCY A;  3VR9 A;  4EB6 E;  4NIQ A;  5HWX A;  5L47 A;  2CXL A;  2UUA T;  3RPU A;  3DP7 A;  2CHO A;  2X0H A;  1HX1 B;  2PBI A;  2X66 A;  2WZH A;  2C5I T;  2CHN A;  4Z8X A;  4CI3 B;  2L3L A;  3CQC B;  4K0U A;  3ONX A;  5LA6 E;  2KSR A;  5FKY A;  3T1H T;  2LOS A;  3FZF B;  4QHO A;  4X20 E;  3KVA A;  3RYC E;  4DO0 A;  2CLY B;  4JI7 T;  2WAU A;  1YXR A;  2CWO A;  1MIY A;  2B76 A;  2HPJ A;  3RKO A;  5HXE A;  3SWH A;  4IGU A;  4ZOL E;  5IYZ E;  3UFG A;  3WAK A;  4HFV A;  2J1D G;  3ZLI A;  3BQI A;  5JDN A;  5FMN A;  3O4X E;  3HA4 A;  2VVN A;  4LF4 T;  4UXN B;  4MFR A;  4P09 A;  3U3I A;  3EUH A;  4ILB A;  1SE7 A;  4C90 A;  1WCR A; 
#chains in the Genus database with same CATH homology
 2UXB T;  1IBK T;  1HNZ T;  4NXM T;  4DR3 T;  1I94 T;  1IBM T;  1XNQ T;  4B3S T;  2VQF T;  4DR1 T;  4DV6 T;  4DV0 T;  4LFB T;  5LMN T;  1HNX T;  1HR0 T;  5IWA T;  4AQY T;  4NXN T;  4K0K T;  1N32 T;  4DV4 T;  4DR4 T;  4DUZ T;  4DR6 T;  4GKK T;  3T1Y T;  2VQE T;  4DV7 T;  4JI1 T;  4YHH T;  4DUY T;  4LF6 T;  4DV2 T;  4DV3 T;  4OX9 T;  1IBL T;  4JI0 T;  2E5L T;  4LF8 T;  2UXD T;  1FJG T;  2ZM6 T;  4LF5 T;  4DR7 T;  1XMQ T;  4JI2 T;  4X65 T;  1N33 T;  4LF9 T;  1XNR T;  4DR5 T;  4LFA T;  4DR2 T;  1N36 T;  1XMO T;  4JYA T;  1J5E T;  5BR8 T;  2UUC T;  4B3M T;  4JI8 T;  2F4V T;  4GKJ T;  4LFC T;  4JI6 T;  2UUA T;  2UXC T;  1N34 T;  4YY3 T;  4DV1 T;  4JI5 T;  1HNW T;  2UUB T;  3T1H T;  2UU9 T;  4JI7 T;  3OTO T;  5LMU T;  4LF7 T;  4JV5 T;  4B3R T;  4X64 T;  4KHP T;  4X62 T;  4JI3 T;  4B3T T;  4LF4 T;  4JI4 T;  4DV5 T;  4X66 T;  2HHH T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...