5IWAT

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
103
structure length
103
Chain Sequence
KKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 34
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5iwaT00
4JV5T 4LF9T 1N32T 4K0KT 4LF5T 4NXMT 2HHHT 4DV6T 4JI7T 4JI5T 4JYAT 4JI2T 4KHPT 2VQET 4GKKT 4DUZT 4JI4T 2UXDT 4DV3T 1IBKT 1I94T 4DV5T 5LMUT 4DR7T 4JI0T 1J5ET 4LFAT 4JI3T 5LMNT 4AQYT 4DR3T 4NXNT 1N33T 2VQFT 1N34T 1HNXT 4JI6T 1XMOT 4B3TT 1XNRT 2UXBT 4JI1T 1FJGT 4B3MT 1HR0T 4LFBT 1HNZT 3OTOT 2E5LT 5BR8T 3T1YT 4B3ST 2F4VT 4LFCT 4DR5T 2UUBT 4DV7T 4JI8T 4DV4T 4GKJT 4YY3T 1HNWT 2ZM6T 4DV2T 1IBLT 2UUAT 4LF7T 4X65T 4B3RT 4DR4T 4LF4T 4DV1T 4X62T 2UU9T 3T1HT 1N36T 1XMQT 4X66T 4LF8T 4DR2T 1XNQT 4DUYT 4OX9T 2UXCT 5IWAT 4DR1T 4X64T 4LF6T 2UUCT 4YHHT 1IBMT 4DV0T 4DR6T
chains in the Genus database with same CATH superfamily
4U2YA 1J1JA 3UU5A 3AE1A 4JI7T 2YDSA 1VOMA 4CI2B 4TZ4C 4Z91A 5J2UE 3X1DA 3QC9A 3ETUA 5AQRB 4MHCA 2VL8A 3A5XA 2N9DA 3D0TA 5C2TA 1UK5A 2JIWA 4H9QC 4CQIA 3FB2A 1HCIA 5HXCA 1HNXT 3UQ4A 5DQWA 5CB4E 2DCFA 3MK7C 3U3IA 2HN1A 4ZEYA 2CHOA 2XTLA 1QSDA 2Q9QB 3SFEA 4H63H 4QX8B 5LBQB 2MBGA 3QB5A 2X9WA 2BG9C 4CXXA 3RGLA 4OYJA 1GQEA 2BVLA 3L09A 2LE8A 4ASKA 2WQYA 5TAOA 2HH7A 3VKHA 4IE7A 3S4UA 2EHOB 1OWAA 2NP9A 3ZKRA 5F5WA 4QXBB 2V7LA 4DV4T 3RC3A 2CRBA 1HNWT 4QWNB 4QHOA 4B3RT 4DR4T 4LF4T 3PUYF 3FZKB 2CHNA 4GK5E 2UXCT 2VKJA 2NTXA 4ZS3A 5IHYA 2WY2A 2QGSA 4AQFA 2HHHT 3C4XA 4WNKA 5EK4A 4ZI2C 3ZMSB 3I0QA 2V7IA 2JMKA 1Y64B 4IL4A 3JADA 3WI3A 1I94T 3AE9A 4Q25A 2CLYB 3Q9DA 5AQMB 4P0BA 1T7SA 1ZOYA 3NWIA 2BS3A 4ANJA 3N9LA 4BA9A 4H9PC 1LVFA 3OTOT 4XBFB 2WSSV 5FY7A 1XWMA 4HFVA 3F31A 4B3ST 4HFDA 2VASA 4AISA 3ONJA 2BKNA 3AEDA 5LNKA 5AQTB 3CVRA 3I1AA 2C5IT 3P4SA 3AE6A 4WW0A 2WU2A 4CI3B 2XAJB 4JUYA 3ZJ2A 1E1HB 2EHOC 3O1IA 4EYUA 2XQAA 3PUZF 4X62T 5ABHA 3HI2A 2CWOA 2MTQA 4H9RC 4A5XA 3TLUA 5C8YE 4DMWA 2Q9QA 2NOXA 3AEGA 4B6XA 3PUQA 1WFDA 3EI0A 4NXMT 5LJMA 3RC8A 4KUMB 4JYAT 4TN7B 2IC6A 1KF6A 2EHOA 2VQET 1UURA 2WP9A 4IIJE 4UVCB 2L8KA 5FNVE 4ZI3D 3PDYA 1W9RA 2JMHA 1EZ3A 4TWFA 1HX8A 2ES0A 1KFYA 1ZP0A 3K8PC 4A98A 5HEHA 1UCUA 4PJJA 2XM2A 3PUSA 4HWIB 5L2LA 4H63V 2VB6A 4FI5A 2CM0A 2N2NA 2MPKA 1JNZA 5L3BB 3C98B 2QVAA 4YJ3E 2D5UA 3Q5WA 2YK0A 2W67A 1W0AA 5HEJA 3E0ZA 5E0OA 2WMOA 3GA8A 3WAJA 4A97A 4UEMA 2XQ8A 1FEWA 4YHHT 3AE2A 4HFBA 3ZYLA 2LOPA 2X9XA 2HPLA 2JRKA 4O8SA 2XJ7A 3MZKB 5L3DB 2IIUA 3NRYA 4CXYA 4JEHB 2E9XB 3FXEB 5HEOA 5LMUT 4O4IE 3RF1A 5IUXA 3L39A 4IT4A 2E5VA 5JDMA 2CPTA 4JBWF 4P09A 4OYKA 1BR4A 3CQXC 5LP6E 2XZEA 1YKEB 4B3TT 3C64A 4IE5A 2BKPA 2RA1A 2QRXA 3L3PA 2L9QA 2E5LT 1HG5A 4IDNA 3RIAA 2AE9A 3JAEA 2LRLA 4HFHA 5AQIB 5LYJE 2X51A 4YSXA 2WDVA 2UUBT 2X0HA 4IHJE 2LM9A 4P1NA 5M4YA 1OEDE 2YINA 4H9OC 2JPFA 3EHZA 5AQHB 4F8HA 4HWDA 3CQCB 1WR6A 4WYVA 2D0TA 4GIWA 1KNZA 2DLRA 3P8CD 4UF0B 4LF6T 3FBLA 2YN6A 3RQUA 2FJEA 3ZMZB 3Q5DA 4BJNA 2J4GA 3O4XE 3P7IA 5HCMA 4N78D 4COFA 5FVKA 4KBMB 5AQLB 5EK2A 4IDPA 2XY8B 2XQ6A 4KHPT 1IZNB 4JEUB 4ERRA 3K3QC 4GYRA 3WAKA 2DI4A 3ABVA 4I0UA 4J2CA 3ONXA 4NXNT 1B7TA 3M65A 5FXVA 3CQGB 5KDMC 5AQUB 2LSGA 2H3RA 3ESLA 3RKGA 4E7ZA 3M3ZB 3UULA 3CKDA 5H6QB 3LK2B 2OV9A 1WLXA 1G8XA 5JDFA 2AXDS 3RLFF 1CUNA 2E9XA 4DV7T 2LRKA 4UV9B 4PJNA 3RYIE 2CMRA 5JR9B 4GYSA 2WCAA 5CGMA 2VURA 1S94A 3B13A 5AQPB 4JLEA 3AVRA 2LHRA 1BR2A 4LF8T 1T72A 2I59A 3AECA 3C4ZA 3KDSE 2D9DA 5DQVA 5L3CB 1MIVA 2V6YA 4L9IA 4H9NC 3E08A 3NBXX 3C51A 2KNDA 3RIFA 4ZOLE 5HXHA 2QYWA 3HKDE 2QA7A 5HYAA 5LXTE 2KT9A 3EABA 2FJDA 3AE7A 1S35A 3CX7B 3ZSTA 3ZYKA 5F8PA 1MMGA 4DMVA 4UVBB 4ADZA 4DVDA 3PJAA 3VU7H 2YKSA 2YDRA 1LKXA 2DHRA 4AQGA 2M67A 3AEEA 4TX5A 1LRZA 2H88A 3CMLA 4MALA 4UF0A 1YD8G 2ACZA 3NZQA 1W0BA 4PW8A 2YOEA 3UUXB 2FBWA 4I50E 3I9WA 2MAWA 3I0OA 2F4VT 2VK9A 3TLVA 2BBHA 3LDQB 2BG9E 2J62A 1LVKA 3SOLA 2FUPA 2KXPB 3FZLB 2LOSA 3PUGA 5J2TE 4YTMA 1J5WA 3PV0F 2UUAT 3VHLA 5KXJA 1XMQT 2WS3A 3AXJB 2JQKA 1XNQT 5JDNA 3ZPOA 4UVAB 4CN1A 4HGAA 4Z90A 5IWAT 4DR1T 4AQFC 2LKHA 4ZI2D 3E22E 5CFBA 3UQ7A 3AB3B 3N2GE 3AAEB 4TUYE 4IDQA 4YTPA 2MOZA 2LSKA 3QB5K 4BAYB 4ILCA 2X68A 4TWHA 1W09A 2XHEB 3G06A 2WWVA 4YLHA 3P50A 2BS4A 3O1HA 5GONE 4DR7T 5JR9A 3JAFA 1L0VA 3UU4A 5FL1A 3OVUA 5J0ZA 3CPZA 1QLBA 3CK6A 2VKHA 1G73A 3VRAA 4M1PA 1MMAA 2A72A 4CN6A 2CE7A 5EK3A 3RYCE 4JI1T 4EB6E 1AJ3A 2LSIA 2XM1A 4OFZA 1E7PA 1VCSA 1FMVA 4LFCT 2D0UA 3RX6A 4QX7B 2W66A 4UV8B 4FJOA 3C50A 2ZM0A 2XQ4A 2NW7A 3ETVA 2I0MA 3V5UA 2H7VC 5LBMA 3PUXF 5ABFB 4K0UA 3A8YC 1YQ4A 4U31A 1D1BA 1M62A 2Q9QC 2PJQA 1WYCA 2DNXA 4I4TE 5AFUL 1OXZA 3HKCE 5ABGA 4KX6A 1KK7A 4HFEA 2OLTA 4LF5T 3MJXA 5JTGA 1YW0A 3UUMA 4JI5T 1X79A 2ZMAA 4EAHA 5LJNA 1ZKEA 3ZMUB 1WCRA 4O4HE 2M6BA 3Q5XA 2V5CA 3N5LA 3CX6B 2K48A 3N9QA 2VVNA 3OYZA 2LSYA 1WRDA 3A7MA 1J5ET 5LCYA 4GK0E 3N9OA 4DR3T 2BKOA 5JVDE 3HL6A 4F6RC 5LG4A 3AXJA 4HTEA 2V6XA 4KMCA 3MA9A 1XNRT 4U3CA 3PUVF 2WZHA 2CCQA 4LFBT 2M6IA 5AQOB 1HG2A 5L4HA 5JDQA 2W2UA 3DP7A 1D0YA 4PJMA 4QXHB 1MMNA 4P0AA 4X1YE 2Y48B 2CLYC 4X5TA 4U2ZA 2XPKA 2WWUA 3FZMB 5ABEA 3AA6B 2WU5A 2Y8DA 5LB7B 2NW9A 4ILUA 4AXPA 2W00A 1YQ3A 1HX1B 3FZHB 2IMLA 4YHJA 3RRWA 2YU2A 3ZC1A 2XQ9A 4YJ2E 5ADXL 3KFWX 2JJ9A 1QUUA 3KVAA 5HXSA 4NUVA 3TKLB 3AE4A 4PK6A 1Y01A 3U78A 3KBTA 2ZM8A 1M7KA 4UELA 4ZI3C 1OEDB 5HEUA 2V7MA 3PJAJ 2V26A 3MXZA 2RPAA 3AEBA 3L8RA 5FXZA 4YSZA 4AQYT 5LHGB 3ZLIA 5ABFA 1N34T 2WBLA 1I6ZA 1H7CA 4C90A 4E7SA 1HNZT 3RKOA 4OK0A 3IF8B 5BR8T 5HWXA 5KMGP 4HWFA 3BK9A 5KX5E 3GN5A 3PURA 4DBQA 5LG3A 2W0GA 2V6YB 5JQGE 4ZXLA 4PFOA 3RIUA 4GKJT 4HE8A 2XSBA 4XAXB 2ZM6T 3JC6C 3AA0B 2B76A 2V5DA 3MKDA 2LSJA 1UUSA 3O9XA 5ETWA 1HF8A 5A1LA 2K3WA 2XAQB 4H9SE 4WZXA 1IAPA 1NAFA 3V5SA 2BBJA 3R84B 2ZM2A 1MIYA 3ZCIA 3OJAA 2WB5A 3RPUA 2A2FX 1ZV4X 4YXDA 1SHZC 4TWDA 2BS2A 1HS7A 4GKKT 4EGWA 4DV5T 3GWHA 4X20E 3UFEA 5AQKB 1NENA 3SWHA 3K3OA 5LHHB 3PUAA 3NVOA 1HTJF 5FY0A 2CA5A 1Z0PA 4ISTA 4KP3C 2UXXB 1HR0T 3AA1B 5JH7E 4LMLA 3J7Yq 4O2BE 5AQGB 4KHZF 4O4JE 3KV5A 5JDGA 2E9XC 5DJQC 2XASB 1ZEEA 3O1JA 3RI5A 3SS1A 3KV6A 4DBRA 5JDHA 3DTOA 2GK9A 3UTKA 5FXXA 3AAIA 3ZN1B 1OEDA 5AQJB 5H6RB 1IJ6A 4PNIA 4LF7T 2X9HA 5L3EB 3BQLA 3CX8B 1D0ZA 5HEGA 3AA7B 3ZN0B 4CXWA 4X66T 5AQNB 4CN4A 2G0UA 3OYXA 2JQ9A 4LMJA 4AKIA 2XAHB 4QH5A 4PJLA 3PTRB 3ZC0A 3FXDB 5CJ5A 3QK6A 3ZYMA 1O3XA 3TLTA 2BG9B 5JDLA 3FZFB 5FY1A 5FP3A 1BR1A 3VR8A 2XSAA 4I43B 4LFAT 4KI0F 1KNRA 1N33T 3K1SA 4QH4A 5JRCA 3F2EA 3ZT5A 1R8IA 2VKDA 3H37A 2VL0A 4QKNA 2UXNB 3PU8A 2LLYA 3P4WA 2KLQA 1V9DA 4U72A 2NTYA 3EDUA 3N2KE 3UFGA 4ZHQE 1E2AA 1X9BA 4DIDB 4V1Av 3QNUA 5LHIB 1MIWA 3EAMA 4DO0A 3AE3A 4DV2T 2C5KT 5L3GB 5J1GA 4DV1T 3I9YA 1D1AA 3UU8A 3PE0A 3ZCJA 4EEDA 2UUCT 2C0SA 4JV5T 2N1GA 5L47A 3DJBA 1MNEA 4YT0A 4UXNB 5FXWA 1U5PA 3AE8A 4EZHA 2LJLA 3AEFA 2KMFA 5JR9C 2XQ3A 3GMIA 5L4EA 3AVSA 3HA4A 2W61A 4IREA 5LOVE 2W62A 2Y6XA 3ANWB 4EIWA 4NPPA 3Q2MA 2WAUA 1FJGT 3ONLC 2XQ5A 3RHWA 3N9PA 4LMKA 3UUBA 2LM2A 1MNDA 3QOFA 5FVLA 2CXDA 1VCTA 3H3MA 4EOZB 5FKYA 2IDOB 2DWKA 5LGNB 2BG9A 2YEVC 3SRZA 3RYHE 5EZYE 2C5JA 3P4PA 4YY3T 3RRCA 2P9BA 3Q5EA 3BQKA 2Q9QD 2V8SV 2PBIA 4AIUA 2UU9T 1DU2A 2K9AA 4TV8E 3LSVA 4OX9T 1YXRA 5AQQB 4C91A 4X1IE 2EHOD 4L5GA 2NR4A 4XZCA 2PFVA 2XQ7A 3FHNA 4HFIA 4DR6T 4YFSA 3RH3A 5DABA 5LA6E 1N32T 4K0KT 3T8OA 3RYFE 1KEYA 2WMNA 4IE6A 4U7YA 4HEAA 4EV6A 2KSRA 4EXTA 3LJCA 2ODVA 4JI4T 4DV3T 3VKGA 1KNPA 3ZJ1A 2KWIB 3LFMA 2WZIA 2OA5A 2FJBA 3H3AA 3UU6A 3IA3A 2X66A 3LK42 2X9YA 3PUWF 3GN5B 4ZZCA 3K3NA 3QUJA 4IL9A 1XMOT 2W4XA 1VRBA 2CWYA 3KBUA 2RP4A 2R6GF 2CEAA 4B3MT 4PAGA 2B1EA 3ZMVB 3UT5E 4IDZA 4G63A 4U74A 2HN2A 4QH1A 4L0RA 2X0YA 2X0LB 3FBZA 4NUUA 4DR5T 5C3JA 3R6NA 2KWHA 2IAKA 4ILAA 1SA0E 2BZBA 3KV4A 4PFPA 3P4RA 4X65T 2V1DB 2IC9A 3T1HT 4EZ4A 2WDQA 3ANWA 3LBXB 4WBOA 1IJ5A 2DWGA 1XDPA 4X1KE 2LT3A 3PU3A 4HKAA 2X67A 3EVYA 5BMVE 3B5MA 4LF9T 4UR9A 4ZZBA 1WR0A 1JNRA 3ZEFB 4DV6T 2H7OA 1SUMB 4O2AE 4IGUA 2E8IA 4IE0A 4DUZT 4Z8XA 3SFDA 4EEBA 2WM9A 2YU1A 5AQVB 3ZMTB 4WBNE 3AE5A 5FL0A 1XDOA 4JI6T 4CZZB 2K24A 3ZSSA 2VWAA 5JREA 5HWYA 2VVSA 2KZ7B 2A3DA 2ODUA 2ACXA 2Z6EA 3UUNA 2XAFB 4EYYR 3JCFA 2KINB 3T1YT 4A56A 3P4QA 3HKBE 2VKOA 3RIUC 5AQSB 1HFAA 2W63A 3F57A 4G2AA 4HFCA 3N9NA 4JI8T 3JC6D 1MMDA 2NW8A 4AKHA 4O4LE 1NEKA 2DL1A 1IBLT 3IEEA 4U33A 4DUYT 5HXEA 2ZLYA 1D1CA 4X64T 4TNWA 2IHR1 1WYBA 3AEAA 3C4WA 5HXRA 2SPCA 2E2AA 3EUHA 1US7B 5CA0E 5HAXA 5FMNA 4AKLA 5HCJA 5L3FB 5JRCB 1FMWA 4ISSA 3N2OA 4AKRB 2PTFA 2CXLA 3UU3A 3KINB 5FYMA 4ZS2A 2J47A 2JQQA 5LMNT 3LG7A 1UX4A 4BJMA 3LBXA 1NWMX 3OBVE 5LGTB 4HN9A 2L3LA 2UXBT 3KVBA 1UGOA 2E9XD 3OPCA 1T8BA 4TV9E 3ZT6A 3BQIA 2CXFA 3AAAB 4I55E 1D0XA 2NWBA 3OKQA 4AI6A 1OEDC 3IBPA 2LKGA 4QXCB 3RQWA 3B57A 2CBIA 2JQHA 3MACA 4PK5A 2V7KA 3EDVA 1SE7A 3TLWA 4AKGA 2V7JA 2XQYA 2WDRA 4HWCA 4DR2T 3NZPA 1XZYA 2CBJA 4YSYA 1ZHCA 3ZT7A 2D2SA 1IBMT 2MYSA 3VRBA 2A9UA 4PK4A 5IYZE 1Z8UA 4JI2T 3KV9A 2UXDT 3CWZB 2IUBA 1IBKT 2BVMA 1FIOA 2XUEA 5CA1E 2XAGB 3HKEE 4JI0T 4JI3T 4HWHA 4IE4A 4MLKA 2VQFT 1YKHB 2H89A 2IW5B 5LGUB 3LK3B 4OHFA 4NIQA 2YDQA 4YTNA 1CHUA 3NRXA 2LEHA 3VR9A 1UX5A 3HR0A 4UIGA 2FJAA 3J9X1 1U4QA 2I6HA 4MBQA 2PG8A 4DNDA 1BR0A 3TLSA 4CI1B 5F3JA 4ZI7E 3W15B 4MFRA 1T98A 2K5BB 2J1DG 1N36T 3NKZA 2LHNA 5AQFB 3IHRA 4IDOA 2BDEA 4ILBA 4GOUA 4TNVA 3CIRA 3N9MA 2HPJA 4U7IA 4DV0T
chains in the Genus database with same CATH topology
4JV5T 4LF9T 1N32T 4K0KT 4LF5T 4NXMT 2HHHT 4DV6T 4JI7T 4JI5T 4JYAT 4JI2T 4KHPT 2VQET 4GKKT 4DUZT 4JI4T 2UXDT 4DV3T 1IBKT 1I94T 4DV5T 5LMUT 4DR7T 4JI0T 1J5ET 4LFAT 4JI3T 5LMNT 4AQYT 4DR3T 4NXNT 1N33T 2VQFT 1N34T 1HNXT 4JI6T 1XMOT 4B3TT 1XNRT 2UXBT 4JI1T 1FJGT 4B3MT 1HR0T 4LFBT 1HNZT 3OTOT 2E5LT 5BR8T 3T1YT 4B3ST 2F4VT 4LFCT 4DR5T 2UUBT 4DV7T 4JI8T 4DV4T 4GKJT 4YY3T 1HNWT 2ZM6T 4DV2T 1IBLT 2UUAT 4LF7T 4X65T 4B3RT 4DR4T 4LF4T 4DV1T 4X62T 2UU9T 3T1HT 1N36T 1XMQT 4X66T 4LF8T 4DR2T 1XNQT 4DUYT 4OX9T 2UXCT 5IWAT 4DR1T 4X64T 4LF6T 2UUCT 4YHHT 1IBMT 4DV0T 4DR6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 T;  4LF9 T;  1N32 T;  4K0K T;  4LF5 T;  4NXM T;  2HHH T;  4DV6 T;  4JI7 T;  4JI5 T;  4JYA T;  4JI2 T;  4KHP T;  2VQE T;  4GKK T;  4DUZ T;  4JI4 T;  2UXD T;  4DV3 T;  1IBK T;  1I94 T;  4DV5 T;  5LMU T;  4DR7 T;  4JI0 T;  1J5E T;  4LFA T;  4JI3 T;  5LMN T;  4AQY T;  4DR3 T;  4NXN T;  1N33 T;  2VQF T;  1N34 T;  1HNX T;  4JI6 T;  1XMO T;  4B3T T;  1XNR T;  2UXB T;  4JI1 T;  1FJG T;  4B3M T;  1HR0 T;  4LFB T;  1HNZ T;  3OTO T;  2E5L T;  5BR8 T;  3T1Y T;  4B3S T;  2F4V T;  4LFC T;  4DR5 T;  2UUB T;  4DV7 T;  4JI8 T;  4DV4 T;  4GKJ T;  4YY3 T;  1HNW T;  2ZM6 T;  4DV2 T;  1IBL T;  2UUA T;  4LF7 T;  4X65 T;  4B3R T;  4DR4 T;  4LF4 T;  4DV1 T;  4X62 T;  2UU9 T;  3T1H T;  1N36 T;  1XMQ T;  4X66 T;  4LF8 T;  4DR2 T;  1XNQ T;  4DUY T;  4OX9 T;  2UXC T;  5IWA T;  4DR1 T;  4X64 T;  4LF6 T;  2UUC T;  4YHH T;  1IBM T;  4DV0 T;  4DR6 T; 
#chains in the Genus database with same CATH topology
 4U2Y A;  1J1J A;  3UU5 A;  3AE1 A;  4JI7 T;  2YDS A;  1VOM A;  4CI2 B;  4TZ4 C;  4Z91 A;  5J2U E;  3X1D A;  3QC9 A;  3ETU A;  5AQR B;  4MHC A;  2VL8 A;  3A5X A;  2N9D A;  3D0T A;  5C2T A;  1UK5 A;  2JIW A;  4H9Q C;  4CQI A;  3FB2 A;  1HCI A;  5HXC A;  1HNX T;  3UQ4 A;  5DQW A;  5CB4 E;  2DCF A;  3MK7 C;  3U3I A;  2HN1 A;  4ZEY A;  2CHO A;  2XTL A;  1QSD A;  2Q9Q B;  3SFE A;  4H63 H;  4QX8 B;  5LBQ B;  2MBG A;  3QB5 A;  2X9W A;  2BG9 C;  4CXX A;  3RGL A;  4OYJ A;  1GQE A;  2BVL A;  3L09 A;  2LE8 A;  4ASK A;  2WQY A;  5TAO A;  2HH7 A;  3VKH A;  4IE7 A;  3S4U A;  2EHO B;  1OWA A;  2NP9 A;  3ZKR A;  5F5W A;  4QXB B;  2V7L A;  4DV4 T;  3RC3 A;  2CRB A;  1HNW T;  4QWN B;  4QHO A;  4B3R T;  4DR4 T;  4LF4 T;  3PUY F;  3FZK B;  2CHN A;  4GK5 E;  2UXC T;  2VKJ A;  2NTX A;  4ZS3 A;  5IHY A;  2WY2 A;  2QGS A;  4AQF A;  2HHH T;  3C4X A;  4WNK A;  5EK4 A;  4ZI2 C;  3ZMS B;  3I0Q A;  2V7I A;  2JMK A;  1Y64 B;  4IL4 A;  3JAD A;  3WI3 A;  1I94 T;  3AE9 A;  4Q25 A;  2CLY B;  3Q9D A;  5AQM B;  4P0B A;  1T7S A;  1ZOY A;  3NWI A;  2BS3 A;  4ANJ A;  3N9L A;  4BA9 A;  4H9P C;  1LVF A;  3OTO T;  4XBF B;  2WSS V;  5FY7 A;  1XWM A;  4HFV A;  3F31 A;  4B3S T;  4HFD A;  2VAS A;  4AIS A;  3ONJ A;  2BKN A;  3AED A;  5LNK A;  5AQT B;  3CVR A;  3I1A A;  2C5I T;  3P4S A;  3AE6 A;  4WW0 A;  2WU2 A;  4CI3 B;  2XAJ B;  4JUY A;  3ZJ2 A;  1E1H B;  2EHO C;  3O1I A;  4EYU A;  2XQA A;  3PUZ F;  4X62 T;  5ABH A;  3HI2 A;  2CWO A;  2MTQ A;  4H9R C;  4A5X A;  3TLU A;  5C8Y E;  4DMW A;  2Q9Q A;  2NOX A;  3AEG A;  4B6X A;  3PUQ A;  1WFD A;  3EI0 A;  4NXM T;  5LJM A;  3RC8 A;  4KUM B;  4JYA T;  4TN7 B;  2IC6 A;  1KF6 A;  2EHO A;  2VQE T;  1UUR A;  2WP9 A;  4IIJ E;  4UVC B;  2L8K A;  5FNV E;  4ZI3 D;  3PDY A;  1W9R A;  2JMH A;  1EZ3 A;  4TWF A;  1HX8 A;  2ES0 A;  1KFY A;  1ZP0 A;  3K8P C;  4A98 A;  5HEH A;  1UCU A;  4PJJ A;  2XM2 A;  3PUS A;  4HWI B;  5L2L A;  4H63 V;  2VB6 A;  4FI5 A;  2CM0 A;  2N2N A;  2MPK A;  1JNZ A;  5L3B B;  3C98 B;  2QVA A;  4YJ3 E;  2D5U A;  3Q5W A;  2YK0 A;  2W67 A;  1W0A A;  5HEJ A;  3E0Z A;  5E0O A;  2WMO A;  3GA8 A;  3WAJ A;  4A97 A;  4UEM A;  2XQ8 A;  1FEW A;  4YHH T;  3AE2 A;  4HFB A;  3ZYL A;  2LOP A;  2X9X A;  2HPL A;  2JRK A;  4O8S A;  2XJ7 A;  3MZK B;  5L3D B;  2IIU A;  3NRY A;  4CXY A;  4JEH B;  2E9X B;  3FXE B;  5HEO A;  5LMU T;  4O4I E;  3RF1 A;  5IUX A;  3L39 A;  4IT4 A;  2E5V A;  5JDM A;  2CPT A;  4JBW F;  4P09 A;  4OYK A;  1BR4 A;  3CQX C;  5LP6 E;  2XZE A;  1YKE B;  4B3T T;  3C64 A;  4IE5 A;  2BKP A;  2RA1 A;  2QRX A;  3L3P A;  2L9Q A;  2E5L T;  1HG5 A;  4IDN A;  3RIA A;  2AE9 A;  3JAE A;  2LRL A;  4HFH A;  5AQI B;  5LYJ E;  2X51 A;  4YSX A;  2WDV A;  2UUB T;  2X0H A;  4IHJ E;  2LM9 A;  4P1N A;  5M4Y A;  1OED E;  2YIN A;  4H9O C;  2JPF A;  3EHZ A;  5AQH B;  4F8H A;  4HWD A;  3CQC B;  1WR6 A;  4WYV A;  2D0T A;  4GIW A;  1KNZ A;  2DLR A;  3P8C D;  4UF0 B;  4LF6 T;  3FBL A;  2YN6 A;  3RQU A;  2FJE A;  3ZMZ B;  3Q5D A;  4BJN A;  2J4G A;  3O4X E;  3P7I A;  5HCM A;  4N78 D;  4COF A;  5FVK A;  4KBM B;  5AQL B;  5EK2 A;  4IDP A;  2XY8 B;  2XQ6 A;  4KHP T;  1IZN B;  4JEU B;  4ERR A;  3K3Q C;  4GYR A;  3WAK A;  2DI4 A;  3ABV A;  4I0U A;  4J2C A;  3ONX A;  4NXN T;  1B7T A;  3M65 A;  5FXV A;  3CQG B;  5KDM C;  5AQU B;  2LSG A;  2H3R A;  3ESL A;  3RKG A;  4E7Z A;  3M3Z B;  3UUL A;  3CKD A;  5H6Q B;  3LK2 B;  2OV9 A;  1WLX A;  1G8X A;  5JDF A;  2AXD S;  3RLF F;  1CUN A;  2E9X A;  4DV7 T;  2LRK A;  4UV9 B;  4PJN A;  3RYI E;  2CMR A;  5JR9 B;  4GYS A;  2WCA A;  5CGM A;  2VUR A;  1S94 A;  3B13 A;  5AQP B;  4JLE A;  3AVR A;  2LHR A;  1BR2 A;  4LF8 T;  1T72 A;  2I59 A;  3AEC A;  3C4Z A;  3KDS E;  2D9D A;  5DQV A;  5L3C B;  1MIV A;  2V6Y A;  4L9I A;  4H9N C;  3E08 A;  3NBX X;  3C51 A;  2KND A;  3RIF A;  4ZOL E;  5HXH A;  2QYW A;  3HKD E;  2QA7 A;  5HYA A;  5LXT E;  2KT9 A;  3EAB A;  2FJD A;  3AE7 A;  1S35 A;  3CX7 B;  3ZST A;  3ZYK A;  5F8P A;  1MMG A;  4DMV A;  4UVB B;  4ADZ A;  4DVD A;  3PJA A;  3VU7 H;  2YKS A;  2YDR A;  1LKX A;  2DHR A;  4AQG A;  2M67 A;  3AEE A;  4TX5 A;  1LRZ A;  2H88 A;  3CML A;  4MAL A;  4UF0 A;  1YD8 G;  2ACZ A;  3NZQ A;  1W0B A;  4PW8 A;  2YOE A;  3UUX B;  2FBW A;  4I50 E;  3I9W A;  2MAW A;  3I0O A;  2F4V T;  2VK9 A;  3TLV A;  2BBH A;  3LDQ B;  2BG9 E;  2J62 A;  1LVK A;  3SOL A;  2FUP A;  2KXP B;  3FZL B;  2LOS A;  3PUG A;  5J2T E;  4YTM A;  1J5W A;  3PV0 F;  2UUA T;  3VHL A;  5KXJ A;  1XMQ T;  2WS3 A;  3AXJ B;  2JQK A;  1XNQ T;  5JDN A;  3ZPO A;  4UVA B;  4CN1 A;  4HGA A;  4Z90 A;  5IWA T;  4DR1 T;  4AQF C;  2LKH A;  4ZI2 D;  3E22 E;  5CFB A;  3UQ7 A;  3AB3 B;  3N2G E;  3AAE B;  4TUY E;  4IDQ A;  4YTP A;  2MOZ A;  2LSK A;  3QB5 K;  4BAY B;  4ILC A;  2X68 A;  4TWH A;  1W09 A;  2XHE B;  3G06 A;  2WWV A;  4YLH A;  3P50 A;  2BS4 A;  3O1H A;  5GON E;  4DR7 T;  5JR9 A;  3JAF A;  1L0V A;  3UU4 A;  5FL1 A;  3OVU A;  5J0Z A;  3CPZ A;  1QLB A;  3CK6 A;  2VKH A;  1G73 A;  3VRA A;  4M1P A;  1MMA A;  2A72 A;  4CN6 A;  2CE7 A;  5EK3 A;  3RYC E;  4JI1 T;  4EB6 E;  1AJ3 A;  2LSI A;  2XM1 A;  4OFZ A;  1E7P A;  1VCS A;  1FMV A;  4LFC T;  2D0U A;  3RX6 A;  4QX7 B;  2W66 A;  4UV8 B;  4FJO A;  3C50 A;  2ZM0 A;  2XQ4 A;  2NW7 A;  3ETV A;  2I0M A;  3V5U A;  2H7V C;  5LBM A;  3PUX F;  5ABF B;  4K0U A;  3A8Y C;  1YQ4 A;  4U31 A;  1D1B A;  1M62 A;  2Q9Q C;  2PJQ A;  1WYC A;  2DNX A;  4I4T E;  5AFU L;  1OXZ A;  3HKC E;  5ABG A;  4KX6 A;  1KK7 A;  4HFE A;  2OLT A;  4LF5 T;  3MJX A;  5JTG A;  1YW0 A;  3UUM A;  4JI5 T;  1X79 A;  2ZMA A;  4EAH A;  5LJN A;  1ZKE A;  3ZMU B;  1WCR A;  4O4H E;  2M6B A;  3Q5X A;  2V5C A;  3N5L A;  3CX6 B;  2K48 A;  3N9Q A;  2VVN A;  3OYZ A;  2LSY A;  1WRD A;  3A7M A;  1J5E T;  5LCY A;  4GK0 E;  3N9O A;  4DR3 T;  2BKO A;  5JVD E;  3HL6 A;  4F6R C;  5LG4 A;  3AXJ A;  4HTE A;  2V6X A;  4KMC A;  3MA9 A;  1XNR T;  4U3C A;  3PUV F;  2WZH A;  2CCQ A;  4LFB T;  2M6I A;  5AQO B;  1HG2 A;  5L4H A;  5JDQ A;  2W2U A;  3DP7 A;  1D0Y A;  4PJM A;  4QXH B;  1MMN A;  4P0A A;  4X1Y E;  2Y48 B;  2CLY C;  4X5T A;  4U2Z A;  2XPK A;  2WWU A;  3FZM B;  5ABE A;  3AA6 B;  2WU5 A;  2Y8D A;  5LB7 B;  2NW9 A;  4ILU A;  4AXP A;  2W00 A;  1YQ3 A;  1HX1 B;  3FZH B;  2IML A;  4YHJ A;  3RRW A;  2YU2 A;  3ZC1 A;  2XQ9 A;  4YJ2 E;  5ADX L;  3KFW X;  2JJ9 A;  1QUU A;  3KVA A;  5HXS A;  4NUV A;  3TKL B;  3AE4 A;  4PK6 A;  1Y01 A;  3U78 A;  3KBT A;  2ZM8 A;  1M7K A;  4UEL A;  4ZI3 C;  1OED B;  5HEU A;  2V7M A;  3PJA J;  2V26 A;  3MXZ A;  2RPA A;  3AEB A;  3L8R A;  5FXZ A;  4YSZ A;  4AQY T;  5LHG B;  3ZLI A;  5ABF A;  1N34 T;  2WBL A;  1I6Z A;  1H7C A;  4C90 A;  4E7S A;  1HNZ T;  3RKO A;  4OK0 A;  3IF8 B;  5BR8 T;  5HWX A;  5KMG P;  4HWF A;  3BK9 A;  5KX5 E;  3GN5 A;  3PUR A;  4DBQ A;  5LG3 A;  2W0G A;  2V6Y B;  5JQG E;  4ZXL A;  4PFO A;  3RIU A;  4GKJ T;  4HE8 A;  2XSB A;  4XAX B;  2ZM6 T;  3JC6 C;  3AA0 B;  2B76 A;  2V5D A;  3MKD A;  2LSJ A;  1UUS A;  3O9X A;  5ETW A;  1HF8 A;  5A1L A;  2K3W A;  2XAQ B;  4H9S E;  4WZX A;  1IAP A;  1NAF A;  3V5S A;  2BBJ A;  3R84 B;  2ZM2 A;  1MIY A;  3ZCI A;  3OJA A;  2WB5 A;  3RPU A;  2A2F X;  1ZV4 X;  4YXD A;  1SHZ C;  4TWD A;  2BS2 A;  1HS7 A;  4GKK T;  4EGW A;  4DV5 T;  3GWH A;  4X20 E;  3UFE A;  5AQK B;  1NEN A;  3SWH A;  3K3O A;  5LHH B;  3PUA A;  3NVO A;  1HTJ F;  5FY0 A;  2CA5 A;  1Z0P A;  4IST A;  4KP3 C;  2UXX B;  1HR0 T;  3AA1 B;  5JH7 E;  4LML A;  3J7Y q;  4O2B E;  5AQG B;  4KHZ F;  4O4J E;  3KV5 A;  5JDG A;  2E9X C;  5DJQ C;  2XAS B;  1ZEE A;  3O1J A;  3RI5 A;  3SS1 A;  3KV6 A;  4DBR A;  5JDH A;  3DTO A;  2GK9 A;  3UTK A;  5FXX A;  3AAI A;  3ZN1 B;  1OED A;  5AQJ B;  5H6R B;  1IJ6 A;  4PNI A;  4LF7 T;  2X9H A;  5L3E B;  3BQL A;  3CX8 B;  1D0Z A;  5HEG A;  3AA7 B;  3ZN0 B;  4CXW A;  4X66 T;  5AQN B;  4CN4 A;  2G0U A;  3OYX A;  2JQ9 A;  4LMJ A;  4AKI A;  2XAH B;  4QH5 A;  4PJL A;  3PTR B;  3ZC0 A;  3FXD B;  5CJ5 A;  3QK6 A;  3ZYM A;  1O3X A;  3TLT A;  2BG9 B;  5JDL A;  3FZF B;  5FY1 A;  5FP3 A;  1BR1 A;  3VR8 A;  2XSA A;  4I43 B;  4LFA T;  4KI0 F;  1KNR A;  1N33 T;  3K1S A;  4QH4 A;  5JRC A;  3F2E A;  3ZT5 A;  1R8I A;  2VKD A;  3H37 A;  2VL0 A;  4QKN A;  2UXN B;  3PU8 A;  2LLY A;  3P4W A;  2KLQ A;  1V9D A;  4U72 A;  2NTY A;  3EDU A;  3N2K E;  3UFG A;  4ZHQ E;  1E2A A;  1X9B A;  4DID B;  4V1A v;  3QNU A;  5LHI B;  1MIW A;  3EAM A;  4DO0 A;  3AE3 A;  4DV2 T;  2C5K T;  5L3G B;  5J1G A;  4DV1 T;  3I9Y A;  1D1A A;  3UU8 A;  3PE0 A;  3ZCJ A;  4EED A;  2UUC T;  2C0S A;  4JV5 T;  2N1G A;  5L47 A;  3DJB A;  1MNE A;  4YT0 A;  4UXN B;  5FXW A;  1U5P A;  3AE8 A;  4EZH A;  2LJL A;  3AEF A;  2KMF A;  5JR9 C;  2XQ3 A;  3GMI A;  5L4E A;  3AVS A;  3HA4 A;  2W61 A;  4IRE A;  5LOV E;  2W62 A;  2Y6X A;  3ANW B;  4EIW A;  4NPP A;  3Q2M A;  2WAU A;  1FJG T;  3ONL C;  2XQ5 A;  3RHW A;  3N9P A;  4LMK A;  3UUB A;  2LM2 A;  1MND A;  3QOF A;  5FVL A;  2CXD A;  1VCT A;  3H3M A;  4EOZ B;  5FKY A;  2IDO B;  2DWK A;  5LGN B;  2BG9 A;  2YEV C;  3SRZ A;  3RYH E;  5EZY E;  2C5J A;  3P4P A;  4YY3 T;  3RRC A;  2P9B A;  3Q5E A;  3BQK A;  2Q9Q D;  2V8S V;  2PBI A;  4AIU A;  2UU9 T;  1DU2 A;  2K9A A;  4TV8 E;  3LSV A;  4OX9 T;  1YXR A;  5AQQ B;  4C91 A;  4X1I E;  2EHO D;  4L5G A;  2NR4 A;  4XZC A;  2PFV A;  2XQ7 A;  3FHN A;  4HFI A;  4DR6 T;  4YFS A;  3RH3 A;  5DAB A;  5LA6 E;  1N32 T;  4K0K T;  3T8O A;  3RYF E;  1KEY A;  2WMN A;  4IE6 A;  4U7Y A;  4HEA A;  4EV6 A;  2KSR A;  4EXT A;  3LJC A;  2ODV A;  4JI4 T;  4DV3 T;  3VKG A;  1KNP A;  3ZJ1 A;  2KWI B;  3LFM A;  2WZI A;  2OA5 A;  2FJB A;  3H3A A;  3UU6 A;  3IA3 A;  2X66 A;  3LK4 2;  2X9Y A;  3PUW F;  3GN5 B;  4ZZC A;  3K3N A;  3QUJ A;  4IL9 A;  1XMO T;  2W4X A;  1VRB A;  2CWY A;  3KBU A;  2RP4 A;  2R6G F;  2CEA A;  4B3M T;  4PAG A;  2B1E A;  3ZMV B;  3UT5 E;  4IDZ A;  4G63 A;  4U74 A;  2HN2 A;  4QH1 A;  4L0R A;  2X0Y A;  2X0L B;  3FBZ A;  4NUU A;  4DR5 T;  5C3J A;  3R6N A;  2KWH A;  2IAK A;  4ILA A;  1SA0 E;  2BZB A;  3KV4 A;  4PFP A;  3P4R A;  4X65 T;  2V1D B;  2IC9 A;  3T1H T;  4EZ4 A;  2WDQ A;  3ANW A;  3LBX B;  4WBO A;  1IJ5 A;  2DWG A;  1XDP A;  4X1K E;  2LT3 A;  3PU3 A;  4HKA A;  2X67 A;  3EVY A;  5BMV E;  3B5M A;  4LF9 T;  4UR9 A;  4ZZB A;  1WR0 A;  1JNR A;  3ZEF B;  4DV6 T;  2H7O A;  1SUM B;  4O2A E;  4IGU A;  2E8I A;  4IE0 A;  4DUZ T;  4Z8X A;  3SFD A;  4EEB A;  2WM9 A;  2YU1 A;  5AQV B;  3ZMT B;  4WBN E;  3AE5 A;  5FL0 A;  1XDO A;  4JI6 T;  4CZZ B;  2K24 A;  3ZSS A;  2VWA A;  5JRE A;  5HWY A;  2VVS A;  2KZ7 B;  2A3D A;  2ODU A;  2ACX A;  2Z6E A;  3UUN A;  2XAF B;  4EYY R;  3JCF A;  2KIN B;  3T1Y T;  4A56 A;  3P4Q A;  3HKB E;  2VKO A;  3RIU C;  5AQS B;  1HFA A;  2W63 A;  3F57 A;  4G2A A;  4HFC A;  3N9N A;  4JI8 T;  3JC6 D;  1MMD A;  2NW8 A;  4AKH A;  4O4L E;  1NEK A;  2DL1 A;  1IBL T;  3IEE A;  4U33 A;  4DUY T;  5HXE A;  2ZLY A;  1D1C A;  4X64 T;  4TNW A;  2IHR 1;  1WYB A;  3AEA A;  3C4W A;  5HXR A;  2SPC A;  2E2A A;  3EUH A;  1US7 B;  5CA0 E;  5HAX A;  5FMN A;  4AKL A;  5HCJ A;  5L3F B;  5JRC B;  1FMW A;  4ISS A;  3N2O A;  4AKR B;  2PTF A;  2CXL A;  3UU3 A;  3KIN B;  5FYM A;  4ZS2 A;  2J47 A;  2JQQ A;  5LMN T;  3LG7 A;  1UX4 A;  4BJM A;  3LBX A;  1NWM X;  3OBV E;  5LGT B;  4HN9 A;  2L3L A;  2UXB T;  3KVB A;  1UGO A;  2E9X D;  3OPC A;  1T8B A;  4TV9 E;  3ZT6 A;  3BQI A;  2CXF A;  3AAA B;  4I55 E;  1D0X A;  2NWB A;  3OKQ A;  4AI6 A;  1OED C;  3IBP A;  2LKG A;  4QXC B;  3RQW A;  3B57 A;  2CBI A;  2JQH A;  3MAC A;  4PK5 A;  2V7K A;  3EDV A;  1SE7 A;  3TLW A;  4AKG A;  2V7J A;  2XQY A;  2WDR A;  4HWC A;  4DR2 T;  3NZP A;  1XZY A;  2CBJ A;  4YSY A;  1ZHC A;  3ZT7 A;  2D2S A;  1IBM T;  2MYS A;  3VRB A;  2A9U A;  4PK4 A;  5IYZ E;  1Z8U A;  4JI2 T;  3KV9 A;  2UXD T;  3CWZ B;  2IUB A;  1IBK T;  2BVM A;  1FIO A;  2XUE A;  5CA1 E;  2XAG B;  3HKE E;  4JI0 T;  4JI3 T;  4HWH A;  4IE4 A;  4MLK A;  2VQF T;  1YKH B;  2H89 A;  2IW5 B;  5LGU B;  3LK3 B;  4OHF A;  4NIQ A;  2YDQ A;  4YTN A;  1CHU A;  3NRX A;  2LEH A;  3VR9 A;  1UX5 A;  3HR0 A;  4UIG A;  2FJA A;  3J9X 1;  1U4Q A;  2I6H A;  4MBQ A;  2PG8 A;  4DND A;  1BR0 A;  3TLS A;  4CI1 B;  5F3J A;  4ZI7 E;  3W15 B;  4MFR A;  1T98 A;  2K5B B;  2J1D G;  1N36 T;  3NKZ A;  2LHN A;  5AQF B;  3IHR A;  4IDO A;  2BDE A;  4ILB A;  4GOU A;  4TNV A;  3CIR A;  3N9M A;  2HPJ A;  4U7I A;  4DV0 T; 
#chains in the Genus database with same CATH homology
 4JV5 T;  4LF9 T;  1N32 T;  4K0K T;  4LF5 T;  4NXM T;  2HHH T;  4DV6 T;  4JI7 T;  4JI5 T;  4JYA T;  4JI2 T;  4KHP T;  2VQE T;  4GKK T;  4DUZ T;  4JI4 T;  2UXD T;  4DV3 T;  1IBK T;  1I94 T;  4DV5 T;  5LMU T;  4DR7 T;  4JI0 T;  1J5E T;  4LFA T;  4JI3 T;  5LMN T;  4AQY T;  4DR3 T;  4NXN T;  1N33 T;  2VQF T;  1N34 T;  1HNX T;  4JI6 T;  1XMO T;  4B3T T;  1XNR T;  2UXB T;  4JI1 T;  1FJG T;  4B3M T;  1HR0 T;  4LFB T;  1HNZ T;  3OTO T;  2E5L T;  5BR8 T;  3T1Y T;  4B3S T;  2F4V T;  4LFC T;  4DR5 T;  2UUB T;  4DV7 T;  4JI8 T;  4DV4 T;  4GKJ T;  4YY3 T;  1HNW T;  2ZM6 T;  4DV2 T;  1IBL T;  2UUA T;  4LF7 T;  4X65 T;  4B3R T;  4DR4 T;  4LF4 T;  4DV1 T;  4X62 T;  2UU9 T;  3T1H T;  1N36 T;  1XMQ T;  4X66 T;  4LF8 T;  4DR2 T;  1XNQ T;  4DUY T;  4OX9 T;  2UXC T;  5IWA T;  4DR1 T;  4X64 T;  4LF6 T;  2UUC T;  4YHH T;  1IBM T;  4DV0 T;  4DR6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...