5IWAT

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
103
structure length
103
Chain Sequence
KKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
total genus 34
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5iwaT00
4B3ST 1HNWT 1IBMT 1HNXT 2UUCT 4LF9T 1N32T 2F4VT 1IBKT 5BR8T 4DUYT 4JI2T 3T1HT 4DV5T 2VQET 4DUZT 4JYAT 4X65T 4OX9T 4KHPT 4YHHT 4DV1T 1I94T 2UUBT 1HR0T 2HHHT 4X66T 1N36T 4B3TT 1N34T 4LF4T 4YY3T 4LF7T 4DR5T 4X64T 4JI6T 4GKKT 2UXBT 4JV5T 1HNZT 4JI5T 1XMQT 4LFBT 4GKJT 1N33T 1XNQT 4DR6T 5LMNT 4NXMT 4DV6T 2E5LT 2UXDT 4NXNT 4DR3T 4LFCT 4JI0T 2ZM6T 4DR7T 4LF8T 4AQYT 4B3MT 4JI4T 5IWAT 4DV2T 4B3RT 4JI7T 3OTOT 5LMUT 2UUAT 1IBLT 4LF6T 4JI8T 4DV7T 4DV0T 1FJGT 4K0KT 1XNRT 4DR4T 2UXCT 1J5ET 4DV3T 1XMOT 4JI3T 2UU9T 4JI1T 4X62T 3T1YT 4DV4T 4DR2T 4LF5T 2VQFT 4LFAT 4DR1T
chains in the Genus database with same CATH superfamily
3C50A 2V26A 3RI5A 2IC6A 3ANWA 3OJAA 4V1Av 3VR9A 3K3OA 4LF4T 2K24A 2UXXB 5CA1E 2JJ9A 4MLKA 2BDEA 4AKIA 5LNKA 5AQJB 4YTNA 4YSYA 4PFOA 1WYBA 4H9RC 4L9IA 3VRAA 3PU8A 5EZYE 1MNEA 2XM1A 4F6RC 5GONE 3RYHE 4COFA 5L3CB 4ZS3A 4B3RT 2UUAT 4A97A 3AXJA 4WBOA 5AQHB 4CN6A 1M62A 5AQQB 5DQVA 4WW0A 4H63V 5CA0E 4L5GA 1NEKA 1WYCA 4JUYA 3I0QA 4JEHB 2MPKA 3WI3A 3MA9A 3E0ZA 2CBJA 2Q9QA 2W66A 3AA7B 4HWHA 2E8IA 1IJ6A 5A1LA 1T8BA 2IW5B 4IL9A 2LHRA 2KMFA 3ONJA 1MMNA 2OV9A 5FL1A 3UFGA 3L39A 2F4VT 3ABVA 4I43B 5ADXL 5LJNA 4U2ZA 3EABA 2VK9A 3PDYA 4CZZB 2LOPA 2PFVA 3EDVA 1KEYA 3B13A 3FZLB 5JQGE 4ADZA 2XHEB 4I0UA 1N33T 4EYUA 2QVAA 4LMKA 4QH4A 3QB5A 2IC9A 2KXPB 2NP9A 5LBMA 2LM9A 2WWUA 5HYAA 4TNWA 1Z0PA 3EDUA 4P09A 3UUMA 5FXXA 2NOXA 3F2EA 2WCAA 3O1JA 3RQWA 3A5XA 1IBLT 4HE8A 3AAEB 2UXNB 5FXZA 2ODVA 4TN7B 3M65A 5L3DB 2BKOA 4DMVA 1Y64B 3AA6B 2KSRA 1W9RA 1KNPA 3RYCE 1MIWA 2DWKA 5L3BB 3CX7B 3X1DA 4LF5T 3FHNA 2KT9A 1S35A 3GN5B 3UUBA 5HAXA 4EIWA 3AEGA 4X20E 4FJOA 2KINB 5HCJA 1IBMT 2DWGA 3I9YA 5JVDE 1FMWA 5CB4E 2GK9A 1Y01A 1IBKT 3ZMZB 1OEDC 4HGAA 1W0BA 3P4SA 2BS4A 2ZMAA 4H9SE 5KDMC 2YOEA 3C98B 5JDHA 4B6XA 4X66T 4UXNB 4DR5T 2X0HA 2CXFA 2HN2A 2W2UA 2RP4A 2NTXA 5AQUB 4CI3B 4ZHQE 2K3WA 3UQ4A 4E7SA 3NRYA 4U72A 2BG9C 2X51A 1VCSA 2QRXA 3C64A 2W67A 1D0YA 1NENA 2BVMA 4ZXLA 2M6IA 4NIQA 4WYVA 3VU7H 3NKZA 2XJ7A 1IJ5A 2Y6XA 1HX1B 2OA5A 4TWFA 1FIOA 2V7IA 5LMUT 2DI4A 2V5DA 4UF0A 4GK5E 4IIJE 5FKYA 4IE4A 3VKHA 4DR4T 2J1DG 4TWHA 1G8XA 1OEDB 3IEEA 3MZKB 3PUZF 3LK2B 3SOLA 5F5WA 2BBHA 3ZEFB 5KX5E 3T1YT 4DV4T 1HS7A 5CFBA 2I6HA 3AEAA 2A3DA 2BG9B 2N1GA 1MMDA 4DBRA 2D0UA 4PNIA 4AIUA 4BJMA 4LMJA 5JR9C 5HXCA 3EI0A 3FB2A 4GIWA 4HWFA 5HXSA 4EEBA 2V6YA 5LBQB 3RLFF 3N2KE 2BKNA 2J4GA 2X9XA 3ZJ2A 3AEEA 2W62A 2LRKA 5L3FB 2IDOB 5JRCA 3SRZA 2BZBA 3KFWX 3UT5E 2EHOB 4MHCA 3J7Yq 4OYKA 2YEVC 5ABFA 4ASKA 1BR4A 2YU1A 1T7SA 3HI2A 1SUMB 4HKAA 5EK2A 2WU5A 4BJNA 4DV7T 2DLRA 3AEBA 3MACA 2BS2A 5JR9B 5LJMA 4PFPA 3B5MA 5L47A 3PUWF 3D0TA 3AA1B 3CQCB 2XQ4A 3PUVF 3I9WA 1HNWT 2PJQA 2FJBA 2H3RA 1H7CA 2UUCT 2L9QA 3PTRB 2K9AA 2W00A 4NUVA 3NBXX 4TUYE 4ZZBA 3P4QA 1DU2A 3ZJ1A 3RRWA 5HXRA 1J1JA 1I94T 1HR0T 4KI0F 1WR0A 3UTKA 4JV5T 1MIVA 2DL1A 3RX6A 1XMQT 2YK0A 4DR6T 3RIFA 4U2YA 4NXNT 3C4ZA 4IREA 2VVSA 4UF0B 2ACZA 3N9LA 4DIDB 3RHWA 3H37A 4MFRA 4B3MT 3B57A 4AKLA 3TKLB 4YSXA 4PK5A 2YN6A 3ONLC 1WRDA 2HPLA 2P9BA 3OTOT 2XQ8A 3T8OA 3PJAA 1FEWA 4EXTA 4EV6A 3ESLA 2NW9A 2XQ7A 3HKCE 3KV4A 5FNVE 3ETUA 5LHIB 5E0OA 4AKGA 3GWHA 2VQFT 4UV8B 5KXJA 3FZKB 4GYSA 2XTLA 3O1HA 2CEAA 5AQGB 5FY7A 2HPJA 5FL0A 2D0TA 4IDPA 1U4QA 5HXEA 1N34T 4O4HE 4UVBB 5JDQA 3PU3A 4Z8XA 2V7JA 2UXBT 2MOZA 3GA8A 4U7YA 3E22E 2BBJA 3HKDE 2MAWA 5JREA 2VKOA 4ILAA 1YD8G 2ZM2A 5F3JA 3OYZA 5DJQC 2NW7A 2KWHA 3P8CD 2D9DA 4EZHA 1L0VA 3CK6A 2B76A 2LLYA 1NAFA 1XDPA 3ZCIA 3CPZA 2WDQA 1HF8A 2LSYA 3DTOA 3DP7A 3PUQA 2V7KA 2C5KT 3KV9A 2E9XD 4KP3C 2G0UA 3AE6A 2SPCA 4HFIA 5ABHA 5EK3A 2C5IT 4YTMA 1EZ3A 2Y48B 4JEUB 3K3QC 2XSBA 1ZHCA 3SFEA 4FI5A 3ZT7A 2XQ9A 4Z90A 1VRBA 3AE9A 3BK9A 4L0RA 2WSSV 4C90A 2VKDA 2LHNA 3P4RA 2CHOA 4CXWA 3FBZA 4JLEA 3T1HT 2X66A 2XSAA 4BAYB 4ISTA 1GQEA 3LJCA 3HR0A 2KWIB 4ZOLE 3IBPA 3AVRA 3N2OA 2M6BA 3Q2MA 2E9XC 5J2UE 5LG3A 4GKJT 3RIUC 3CWZB 5LHGB 3PUXF 3AE4A 3J9X1 2MBGA 2X9WA 3NVOA 4AQFA 2WB5A 2LKGA 3AE3A 4LFCT 4QHOA 4AXPA 4AQYT 4QWNB 1D1CA 3MKDA 3RPUA 4QKNA 4EEDA 3JAFA 3F57A 1YKEB 4H9OC 3AB3B 2VVNA 1LRZA 3LBXA 2WAUA 2X68A 4ISSA 3Q5DA 3UFEA 2Q9QD 2CHNA 2KZ7B 3P4WA 2LSJA 2H7VC 2A2FX 2BVLA 5HWXA 1W0AA 5HEHA 3A7MA 4IHJE 5IYZE 2H88A 3ZT6A 3RQUA 5AFUL 3A8YC 3CQXC 2E9XB 2JMHA 1HX8A 3PURA 3ZC1A 5FXVA 4DUYT 2FJAA 3I1AA 4P0AA 4ILBA 1VCTA 1UCUA 1IAPA 4OX9T 4ILCA 4HFCA 5JTGA 3ANWB 3KV6A 3JC6D 2X9HA 1KK7A 2CRBA 4HWIB 4I50E 2WU2A 3Q9DA 2Q9QC 3K1SA 5AQNB 4PJJA 1HNZT 4JI5T 4LFBT 3V5UA 1S94A 1XNQT 3UU6A 2CPTA 4H9NC 1D1AA 3AE7A 2YINA 5FY1A 3AEDA 2EHOD 3ZMVB 5LHHB 3NWIA 4ZI7E 5AQFB 5HWYA 4XZCA 5J2TE 1D0ZA 3QNUA 5IWAT 1ZEEA 3EUHA 4DV2T 1JNZA 3PE0A 1BR1A 3CIRA 4X1KE 4DBQA 3OYXA 3AXJB 3JC6C 3MK7C 4DV3T 2UU9T 1D1BA 5CJ5A 4X62T 1XDOA 3QC9A 2XAGB 5AQSB 2Q9QB 5HEGA 2K48A 3JADA 2IHR1 1U5PA 2V1DB 2EHOC 2VWAA 2XQ6A 4JI2T 5C8YE 2VQET 3CX6B 2LM2A 2W63A 4JYAT 4QH5A 2PTFA 4KHPT 4K0UA 5J1GA 2LOSA 2UUBT 3ZMTB 4HFEA 2DHRA 4B3TT 3HL6A 3ZKRA 4OK0A 4UVCB 5LG4A 4IDNA 1XWMA 4XAXB 1OEDE 4DV6T 1UURA 3LDQB 5EK4A 4O8SA 3ZMUB 2I59A 5FXWA 3U3IA 3LBXB 1ZP0A 3QOFA 4A56A 1YQ3A 3OPCA 5HEJA 4AI6A 4IE7A 2WZIA 4EB6E 4UR9A 2L3LA 3KVBA 4ZI2D 4LF6T 2LJLA 4UVAB 4JI8T 5LGTB 1Z8UA 4YTPA 4CI2B 5AQVB 4H9PC 3UU5A 4O4IE 1FMVA 2AE9A 1HG5A 4X5TA 2IMLA 5HEOA 2XPKA 3WAKA 4CN1A 2ACXA 3C4XA 4TWDA 2X0LB 2XAFB 3UQ7A 2V7LA 4UIGA 5FP3A 5L4HA 5LGNB 2V6XA 4DUZT 5DABA 2J62A 4ZI2C 3N9NA 4A98A 3CQGB 1HCIA 4DV1T 2HHHT 5AQTB 3LK3B 2LSGA 1LKXA 4I55E 2XM2A 3ETVA 2QGSA 3N9QA 5LA6E 3TLVA 1AJ3A 2CWYA 4NXMT 3P50A 2L8KA 3RRCA 3ZSSA 4KUMB 4TV8E 5F8PA 1ZV4X 3FZHB 5FYMA 5BMVE 2XASB 4LF8T 3P7IA 4KHZF 1B7TA 5JH7E 2E5VA 2VL0A 2HH7A 2WBLA 5L2LA 2CXDA 2FBWA 4IE0A 4UV9B 4H63H 4JI3T 3N5LA 1D0XA 3HA4A 3ZYMA 2J47A 3TLSA 3ZYLA 2XAJB 4U33A 1HTJF 2NTYA 3N9MA 3QB5K 2W4XA 3ZT5A 4IDOA 2FJEA 3BQLA 3ZN0B 2WMOA 5KMGP 3ZCJA 1KF6A 3S4UA 1YQ4A 4YHHT 5LCYA 3N9OA 4TV9E 3M3ZB 3SWHA 3KV5A 4I4TE 3RIAA 1ZOYA 2W0GA 3ZPOA 2V6YB 2AXDS 3QK6A 2V8SV 2V7MA 3CKDA 5JRCB 1M7KA 2JPFA 2YU2A 2CCQA 2UXDT 2R6GF 5AQOB 4DNDA 4NPPA 4BA9A 1YXRA 2MYSA 1T98A 3WAJA 2A9UA 2JMKA 1E1HB 4HFDA 2W61A 2XUEA 5ABFB 3KINB 2CLYB 5HXHA 5JDGA 2ODUA 2N2NA 3PUAA 4TNVA 2MTQA 1QSDA 2K5BB 4IGUA 2XAQB 3G06A 1UX5A 2VURA 4O4LE 2WP9A 2FJDA 1I6ZA 2CBIA 5DQWA 3RYFE 4AQGA 5AQMB 5TAOA 2N9DA 3IA3A 5JDNA 3O4XE 3GN5A 4JBWF 4TZ4C 5LGUB 3Q5XA 3PUGA 3ZYKA 1HG2A 3RF1A 3HKEE 5LOVE 4E7ZA 4QH1A 4IDZA 3RC3A 4P0BA 3AVSA 3NRXA 3EHZA 5AQLB 4U3CA 3VRBA 4DVDA 4DO0A 4N78D 2YKSA 3UU3A 4G2AA 4O2AE 1UX4A 2WDRA 2Z6EA 3K8PC 4QXHB 4LF7T 3VR8A 4YY3T 4F8HA 3KVAA 2ES0A 4X64T 3CX8B 5ETWA 1YW0A 4KX6A 1J5WA 1HFAA 3W15B 3FZFB 2PG8A 2CE7A 3AE2A 3R84B 4ZI3D 3OVUA 5C2TA 4YLHA 5FVLA 4JI0T 2ZM6T 2IIUA 4WNKA 3P4PA 1KNZA 1SE7A 4QXCB 4YFSA 1CHUA 2XQ5A 1OEDA 4HFVA 2UXCT 4KMCA 3RH3A 3FXEB 5FVKA 3RYIE 2RA1A 4OYJA 4QX8B 1BR2A 4IL4A 3CVRA 3RC8A 3Q5EA 1MMGA 4H9QC 3HKBE 2YDRA 3UUNA 2WS3A 4ZI3C 3FBLA 2KNDA 2BG9A 3RGLA 1V9DA 5LP6E 5JDFA 4AKRB 2BKPA 1WFDA 1US7B 1KFYA 2FUPA 3JCFA 5BR8T 1VOMA 5J0ZA 5FMNA 4GK0E 2IUBA 4PJNA 3NZPA 1UK5A 3R6NA 4HN9A 2LT3A 4TX5A 2EHOA 3LG7A 4HEAA 1YKHB 4P1NA 2CA5A 3UUXB 1UGOA 2JQ9A 4CXXA 4DR7T 3ZN1B 2OLTA 5H6QB 2QYWA 4WBNE 2XQYA 4ANJA 1IZNB 2CMRA 2NW8A 3O1IA 3C51A 3H3MA 4EOZB 5JR9A 2D5UA 3UULA 4K0KT 4OHFA 4YT0A 1MIYA 4X1YE 2XQAA 3ZC0A 1T72A 4X1IE 3AAAB 2E2AA 3TLTA 3FXDB 5H6RB 4AQFC 3AA0B 5ABEA 3IF8B 2CWOA 4O2BE 3SS1A 1JNRA 4JI6T 2LSIA 4PK4A 1HNXT 3NZQA 4GYRA 4OFZA 4PK6A 4Q25A 2BS3A 1MNDA 2H89A 1R8IA 3MXZA 2VB6A 2C5JA 3AE1A 1N36T 3KDSE 3PV0F 1WLXA 3K3NA 4HWCA 4GKKT 3LFMA 3CMLA 4GOUA 2WY2A 2B1EA 4ZEYA 4Z91A 4PW8A 1WR6A 3LSVA 3U78A 4LMLA 2ZM0A 1G73A 4CI1B 3ONXA 4IDQA 5HCMA 4IE5A 4HWDA 5CGMA 2VKHA 4JI4T 4JI7T 5ABGA 4MBQA 2WWVA 4CXYA 2X0YA 3UU4A 2ZLYA 4DV0T 3L3PA 1OWAA 3L8RA 3AEFA 3EAMA 1XNRT 1O3XA 3TLUA 4WZXA 3UU8A 4G63A 2JQHA 3ZMSB 3JAEA 4YXDA 3MJXA 5AQKB 4JI1T 2XAHB 2NR4A 4J2CA 2WQYA 2WM9A 4O4JE 4ZS2A 5HEUA 3PJAJ 3L09A 4DR2T 4CN4A 5JDLA 2KLQA 2X67A 4U31A 2BG9E 2A72A 2WMNA 4LFAT 4DMWA 2JIWA 4B3ST 1KNRA 4LF9T 3OBVE 5IHYA 4IT4A 4ZZCA 1SA0E 4EAHA 4AISA 4DV5T 4QX7B 4X65T 2JQKA 4HFBA 4ILUA 1WCRA 1E2AA 4CQIA 5LXTE 4UELA 2C0SA 2HN1A 3BQKA 3N9PA 2H7OA 4PAGA 3KBTA 5M4YA 3SFDA 1QLBA 4ERRA 5LMNT 3QUJA 3VKGA 5LB7B 2LEHA 4XBFB 2LSKA 4HTEA 1LVFA 4HFHA 4IE6A 2NWBA 2Y8DA 4YJ2E 1UUSA 5L3EB 2JRKA 4PJLA 2DCFA 5L3GB 1X9BA 2YDSA 3GMIA 2VKJA 5C3JA 3DJBA 4U74A 1J5ET 4M1PA 2WDVA 4PJMA 2XQ3A 3I0OA 5AQRB 4EYYR 3KBUA 1QUUA 3OKQA 2CM0A 3IHRA 3H3AA 2XZEA 3PUYF 2WZHA 4U7IA 5FY0A 4EZ4A 2DNXA 1E7PA 4AKHA 1N32T 3F31A 2PBIA 4YHJA 3PUSA 1LVKA 2VL8A 4EGWA 2YDQA 1ZKEA 3BQIA 4QXBB 2CLYC 5AQPB 2LRLA 2QA7A 4UEMA 3Q5WA 1X79A 2M67A 5LYJE 1SHZC 3FZMB 3ZSTA 1XZYA 4KBMB 4MALA 1NWMX 5JDMA 2E5LT 3AECA 2LE8A 2RPAA 4DR3T 2ZM8A 3AE5A 5L4EA 2XY8B 2IAKA 1OXZA 3LK42 2X9YA 3RKGA 2JQQA 3O9XA 3C4WA 2V5CA 3E08A 2CXLA 2D2SA 3V5SA 3ZLIA 4YJ3E 3AAIA 4YSZA 1FJGT 3N2GE 2VASA 3TLWA 4C91A 1XMOT 5IUXA 4NUUA 2LKHA 5AQIB 3RKOA 1W09A 1BR0A 3VHLA 2E9XA 4A5XA 1CUNA 3RIUA 2I0MA 3EVYA 3AE8A 1MMAA 4DR1T
chains in the Genus database with same CATH topology
4B3ST 1HNWT 1IBMT 1HNXT 2UUCT 4LF9T 1N32T 2F4VT 1IBKT 5BR8T 4DUYT 4JI2T 3T1HT 4DV5T 2VQET 4DUZT 4JYAT 4X65T 4OX9T 4KHPT 4YHHT 4DV1T 1I94T 2UUBT 1HR0T 2HHHT 4X66T 1N36T 4B3TT 1N34T 4LF4T 4YY3T 4LF7T 4DR5T 4X64T 4JI6T 4GKKT 2UXBT 4JV5T 1HNZT 4JI5T 1XMQT 4LFBT 4GKJT 1N33T 1XNQT 4DR6T 5LMNT 4NXMT 4DV6T 2E5LT 2UXDT 4NXNT 4DR3T 4LFCT 4JI0T 2ZM6T 4DR7T 4LF8T 4AQYT 4B3MT 4JI4T 5IWAT 4DV2T 4B3RT 4JI7T 3OTOT 5LMUT 2UUAT 1IBLT 4LF6T 4JI8T 4DV7T 4DV0T 1FJGT 4K0KT 1XNRT 4DR4T 2UXCT 1J5ET 4DV3T 1XMOT 4JI3T 2UU9T 4JI1T 4X62T 3T1YT 4DV4T 4DR2T 4LF5T 2VQFT 4LFAT 4DR1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S T;  1HNW T;  1IBM T;  1HNX T;  2UUC T;  4LF9 T;  1N32 T;  2F4V T;  1IBK T;  5BR8 T;  4DUY T;  4JI2 T;  3T1H T;  4DV5 T;  2VQE T;  4DUZ T;  4JYA T;  4X65 T;  4OX9 T;  4KHP T;  4YHH T;  4DV1 T;  1I94 T;  2UUB T;  1HR0 T;  2HHH T;  4X66 T;  1N36 T;  4B3T T;  1N34 T;  4LF4 T;  4YY3 T;  4LF7 T;  4DR5 T;  4X64 T;  4JI6 T;  4GKK T;  2UXB T;  4JV5 T;  1HNZ T;  4JI5 T;  1XMQ T;  4LFB T;  4GKJ T;  1N33 T;  1XNQ T;  4DR6 T;  5LMN T;  4NXM T;  4DV6 T;  2E5L T;  2UXD T;  4NXN T;  4DR3 T;  4LFC T;  4JI0 T;  2ZM6 T;  4DR7 T;  4LF8 T;  4AQY T;  4B3M T;  4JI4 T;  5IWA T;  4DV2 T;  4B3R T;  4JI7 T;  3OTO T;  5LMU T;  2UUA T;  1IBL T;  4LF6 T;  4JI8 T;  4DV7 T;  4DV0 T;  1FJG T;  4K0K T;  1XNR T;  4DR4 T;  2UXC T;  1J5E T;  4DV3 T;  1XMO T;  4JI3 T;  2UU9 T;  4JI1 T;  4X62 T;  3T1Y T;  4DV4 T;  4DR2 T;  4LF5 T;  2VQF T;  4LFA T;  4DR1 T; 
#chains in the Genus database with same CATH topology
 3C50 A;  2V26 A;  3RI5 A;  2IC6 A;  3ANW A;  3OJA A;  4V1A v;  3VR9 A;  3K3O A;  4LF4 T;  2K24 A;  2UXX B;  5CA1 E;  2JJ9 A;  4MLK A;  2BDE A;  4AKI A;  5LNK A;  5AQJ B;  4YTN A;  4YSY A;  4PFO A;  1WYB A;  4H9R C;  4L9I A;  3VRA A;  3PU8 A;  5EZY E;  1MNE A;  2XM1 A;  4F6R C;  5GON E;  3RYH E;  4COF A;  5L3C B;  4ZS3 A;  4B3R T;  2UUA T;  4A97 A;  3AXJ A;  4WBO A;  5AQH B;  4CN6 A;  1M62 A;  5AQQ B;  5DQV A;  4WW0 A;  4H63 V;  5CA0 E;  4L5G A;  1NEK A;  1WYC A;  4JUY A;  3I0Q A;  4JEH B;  2MPK A;  3WI3 A;  3MA9 A;  3E0Z A;  2CBJ A;  2Q9Q A;  2W66 A;  3AA7 B;  4HWH A;  2E8I A;  1IJ6 A;  5A1L A;  1T8B A;  2IW5 B;  4IL9 A;  2LHR A;  2KMF A;  3ONJ A;  1MMN A;  2OV9 A;  5FL1 A;  3UFG A;  3L39 A;  2F4V T;  3ABV A;  4I43 B;  5ADX L;  5LJN A;  4U2Z A;  3EAB A;  2VK9 A;  3PDY A;  4CZZ B;  2LOP A;  2PFV A;  3EDV A;  1KEY A;  3B13 A;  3FZL B;  5JQG E;  4ADZ A;  2XHE B;  4I0U A;  1N33 T;  4EYU A;  2QVA A;  4LMK A;  4QH4 A;  3QB5 A;  2IC9 A;  2KXP B;  2NP9 A;  5LBM A;  2LM9 A;  2WWU A;  5HYA A;  4TNW A;  1Z0P A;  3EDU A;  4P09 A;  3UUM A;  5FXX A;  2NOX A;  3F2E A;  2WCA A;  3O1J A;  3RQW A;  3A5X A;  1IBL T;  4HE8 A;  3AAE B;  2UXN B;  5FXZ A;  2ODV A;  4TN7 B;  3M65 A;  5L3D B;  2BKO A;  4DMV A;  1Y64 B;  3AA6 B;  2KSR A;  1W9R A;  1KNP A;  3RYC E;  1MIW A;  2DWK A;  5L3B B;  3CX7 B;  3X1D A;  4LF5 T;  3FHN A;  2KT9 A;  1S35 A;  3GN5 B;  3UUB A;  5HAX A;  4EIW A;  3AEG A;  4X20 E;  4FJO A;  2KIN B;  5HCJ A;  1IBM T;  2DWG A;  3I9Y A;  5JVD E;  1FMW A;  5CB4 E;  2GK9 A;  1Y01 A;  1IBK T;  3ZMZ B;  1OED C;  4HGA A;  1W0B A;  3P4S A;  2BS4 A;  2ZMA A;  4H9S E;  5KDM C;  2YOE A;  3C98 B;  5JDH A;  4B6X A;  4X66 T;  4UXN B;  4DR5 T;  2X0H A;  2CXF A;  2HN2 A;  2W2U A;  2RP4 A;  2NTX A;  5AQU B;  4CI3 B;  4ZHQ E;  2K3W A;  3UQ4 A;  4E7S A;  3NRY A;  4U72 A;  2BG9 C;  2X51 A;  1VCS A;  2QRX A;  3C64 A;  2W67 A;  1D0Y A;  1NEN A;  2BVM A;  4ZXL A;  2M6I A;  4NIQ A;  4WYV A;  3VU7 H;  3NKZ A;  2XJ7 A;  1IJ5 A;  2Y6X A;  1HX1 B;  2OA5 A;  4TWF A;  1FIO A;  2V7I A;  5LMU T;  2DI4 A;  2V5D A;  4UF0 A;  4GK5 E;  4IIJ E;  5FKY A;  4IE4 A;  3VKH A;  4DR4 T;  2J1D G;  4TWH A;  1G8X A;  1OED B;  3IEE A;  3MZK B;  3PUZ F;  3LK2 B;  3SOL A;  5F5W A;  2BBH A;  3ZEF B;  5KX5 E;  3T1Y T;  4DV4 T;  1HS7 A;  5CFB A;  2I6H A;  3AEA A;  2A3D A;  2BG9 B;  2N1G A;  1MMD A;  4DBR A;  2D0U A;  4PNI A;  4AIU A;  4BJM A;  4LMJ A;  5JR9 C;  5HXC A;  3EI0 A;  3FB2 A;  4GIW A;  4HWF A;  5HXS A;  4EEB A;  2V6Y A;  5LBQ B;  3RLF F;  3N2K E;  2BKN A;  2J4G A;  2X9X A;  3ZJ2 A;  3AEE A;  2W62 A;  2LRK A;  5L3F B;  2IDO B;  5JRC A;  3SRZ A;  2BZB A;  3KFW X;  3UT5 E;  2EHO B;  4MHC A;  3J7Y q;  4OYK A;  2YEV C;  5ABF A;  4ASK A;  1BR4 A;  2YU1 A;  1T7S A;  3HI2 A;  1SUM B;  4HKA A;  5EK2 A;  2WU5 A;  4BJN A;  4DV7 T;  2DLR A;  3AEB A;  3MAC A;  2BS2 A;  5JR9 B;  5LJM A;  4PFP A;  3B5M A;  5L47 A;  3PUW F;  3D0T A;  3AA1 B;  3CQC B;  2XQ4 A;  3PUV F;  3I9W A;  1HNW T;  2PJQ A;  2FJB A;  2H3R A;  1H7C A;  2UUC T;  2L9Q A;  3PTR B;  2K9A A;  2W00 A;  4NUV A;  3NBX X;  4TUY E;  4ZZB A;  3P4Q A;  1DU2 A;  3ZJ1 A;  3RRW A;  5HXR A;  1J1J A;  1I94 T;  1HR0 T;  4KI0 F;  1WR0 A;  3UTK A;  4JV5 T;  1MIV A;  2DL1 A;  3RX6 A;  1XMQ T;  2YK0 A;  4DR6 T;  3RIF A;  4U2Y A;  4NXN T;  3C4Z A;  4IRE A;  2VVS A;  4UF0 B;  2ACZ A;  3N9L A;  4DID B;  3RHW A;  3H37 A;  4MFR A;  4B3M T;  3B57 A;  4AKL A;  3TKL B;  4YSX A;  4PK5 A;  2YN6 A;  3ONL C;  1WRD A;  2HPL A;  2P9B A;  3OTO T;  2XQ8 A;  3T8O A;  3PJA A;  1FEW A;  4EXT A;  4EV6 A;  3ESL A;  2NW9 A;  2XQ7 A;  3HKC E;  3KV4 A;  5FNV E;  3ETU A;  5LHI B;  5E0O A;  4AKG A;  3GWH A;  2VQF T;  4UV8 B;  5KXJ A;  3FZK B;  4GYS A;  2XTL A;  3O1H A;  2CEA A;  5AQG B;  5FY7 A;  2HPJ A;  5FL0 A;  2D0T A;  4IDP A;  1U4Q A;  5HXE A;  1N34 T;  4O4H E;  4UVB B;  5JDQ A;  3PU3 A;  4Z8X A;  2V7J A;  2UXB T;  2MOZ A;  3GA8 A;  4U7Y A;  3E22 E;  2BBJ A;  3HKD E;  2MAW A;  5JRE A;  2VKO A;  4ILA A;  1YD8 G;  2ZM2 A;  5F3J A;  3OYZ A;  5DJQ C;  2NW7 A;  2KWH A;  3P8C D;  2D9D A;  4EZH A;  1L0V A;  3CK6 A;  2B76 A;  2LLY A;  1NAF A;  1XDP A;  3ZCI A;  3CPZ A;  2WDQ A;  1HF8 A;  2LSY A;  3DTO A;  3DP7 A;  3PUQ A;  2V7K A;  2C5K T;  3KV9 A;  2E9X D;  4KP3 C;  2G0U A;  3AE6 A;  2SPC A;  4HFI A;  5ABH A;  5EK3 A;  2C5I T;  4YTM A;  1EZ3 A;  2Y48 B;  4JEU B;  3K3Q C;  2XSB A;  1ZHC A;  3SFE A;  4FI5 A;  3ZT7 A;  2XQ9 A;  4Z90 A;  1VRB A;  3AE9 A;  3BK9 A;  4L0R A;  2WSS V;  4C90 A;  2VKD A;  2LHN A;  3P4R A;  2CHO A;  4CXW A;  3FBZ A;  4JLE A;  3T1H T;  2X66 A;  2XSA A;  4BAY B;  4IST A;  1GQE A;  3LJC A;  3HR0 A;  2KWI B;  4ZOL E;  3IBP A;  3AVR A;  3N2O A;  2M6B A;  3Q2M A;  2E9X C;  5J2U E;  5LG3 A;  4GKJ T;  3RIU C;  3CWZ B;  5LHG B;  3PUX F;  3AE4 A;  3J9X 1;  2MBG A;  2X9W A;  3NVO A;  4AQF A;  2WB5 A;  2LKG A;  3AE3 A;  4LFC T;  4QHO A;  4AXP A;  4AQY T;  4QWN B;  1D1C A;  3MKD A;  3RPU A;  4QKN A;  4EED A;  3JAF A;  3F57 A;  1YKE B;  4H9O C;  3AB3 B;  2VVN A;  1LRZ A;  3LBX A;  2WAU A;  2X68 A;  4ISS A;  3Q5D A;  3UFE A;  2Q9Q D;  2CHN A;  2KZ7 B;  3P4W A;  2LSJ A;  2H7V C;  2A2F X;  2BVL A;  5HWX A;  1W0A A;  5HEH A;  3A7M A;  4IHJ E;  5IYZ E;  2H88 A;  3ZT6 A;  3RQU A;  5AFU L;  3A8Y C;  3CQX C;  2E9X B;  2JMH A;  1HX8 A;  3PUR A;  3ZC1 A;  5FXV A;  4DUY T;  2FJA A;  3I1A A;  4P0A A;  4ILB A;  1VCT A;  1UCU A;  1IAP A;  4OX9 T;  4ILC A;  4HFC A;  5JTG A;  3ANW B;  3KV6 A;  3JC6 D;  2X9H A;  1KK7 A;  2CRB A;  4HWI B;  4I50 E;  2WU2 A;  3Q9D A;  2Q9Q C;  3K1S A;  5AQN B;  4PJJ A;  1HNZ T;  4JI5 T;  4LFB T;  3V5U A;  1S94 A;  1XNQ T;  3UU6 A;  2CPT A;  4H9N C;  1D1A A;  3AE7 A;  2YIN A;  5FY1 A;  3AED A;  2EHO D;  3ZMV B;  5LHH B;  3NWI A;  4ZI7 E;  5AQF B;  5HWY A;  4XZC A;  5J2T E;  1D0Z A;  3QNU A;  5IWA T;  1ZEE A;  3EUH A;  4DV2 T;  1JNZ A;  3PE0 A;  1BR1 A;  3CIR A;  4X1K E;  4DBQ A;  3OYX A;  3AXJ B;  3JC6 C;  3MK7 C;  4DV3 T;  2UU9 T;  1D1B A;  5CJ5 A;  4X62 T;  1XDO A;  3QC9 A;  2XAG B;  5AQS B;  2Q9Q B;  5HEG A;  2K48 A;  3JAD A;  2IHR 1;  1U5P A;  2V1D B;  2EHO C;  2VWA A;  2XQ6 A;  4JI2 T;  5C8Y E;  2VQE T;  3CX6 B;  2LM2 A;  2W63 A;  4JYA T;  4QH5 A;  2PTF A;  4KHP T;  4K0U A;  5J1G A;  2LOS A;  2UUB T;  3ZMT B;  4HFE A;  2DHR A;  4B3T T;  3HL6 A;  3ZKR A;  4OK0 A;  4UVC B;  5LG4 A;  4IDN A;  1XWM A;  4XAX B;  1OED E;  4DV6 T;  1UUR A;  3LDQ B;  5EK4 A;  4O8S A;  3ZMU B;  2I59 A;  5FXW A;  3U3I A;  3LBX B;  1ZP0 A;  3QOF A;  4A56 A;  1YQ3 A;  3OPC A;  5HEJ A;  4AI6 A;  4IE7 A;  2WZI A;  4EB6 E;  4UR9 A;  2L3L A;  3KVB A;  4ZI2 D;  4LF6 T;  2LJL A;  4UVA B;  4JI8 T;  5LGT B;  1Z8U A;  4YTP A;  4CI2 B;  5AQV B;  4H9P C;  3UU5 A;  4O4I E;  1FMV A;  2AE9 A;  1HG5 A;  4X5T A;  2IML A;  5HEO A;  2XPK A;  3WAK A;  4CN1 A;  2ACX A;  3C4X A;  4TWD A;  2X0L B;  2XAF B;  3UQ7 A;  2V7L A;  4UIG A;  5FP3 A;  5L4H A;  5LGN B;  2V6X A;  4DUZ T;  5DAB A;  2J62 A;  4ZI2 C;  3N9N A;  4A98 A;  3CQG B;  1HCI A;  4DV1 T;  2HHH T;  5AQT B;  3LK3 B;  2LSG A;  1LKX A;  4I55 E;  2XM2 A;  3ETV A;  2QGS A;  3N9Q A;  5LA6 E;  3TLV A;  1AJ3 A;  2CWY A;  4NXM T;  3P50 A;  2L8K A;  3RRC A;  3ZSS A;  4KUM B;  4TV8 E;  5F8P A;  1ZV4 X;  3FZH B;  5FYM A;  5BMV E;  2XAS B;  4LF8 T;  3P7I A;  4KHZ F;  1B7T A;  5JH7 E;  2E5V A;  2VL0 A;  2HH7 A;  2WBL A;  5L2L A;  2CXD A;  2FBW A;  4IE0 A;  4UV9 B;  4H63 H;  4JI3 T;  3N5L A;  1D0X A;  3HA4 A;  3ZYM A;  2J47 A;  3TLS A;  3ZYL A;  2XAJ B;  4U33 A;  1HTJ F;  2NTY A;  3N9M A;  3QB5 K;  2W4X A;  3ZT5 A;  4IDO A;  2FJE A;  3BQL A;  3ZN0 B;  2WMO A;  5KMG P;  3ZCJ A;  1KF6 A;  3S4U A;  1YQ4 A;  4YHH T;  5LCY A;  3N9O A;  4TV9 E;  3M3Z B;  3SWH A;  3KV5 A;  4I4T E;  3RIA A;  1ZOY A;  2W0G A;  3ZPO A;  2V6Y B;  2AXD S;  3QK6 A;  2V8S V;  2V7M A;  3CKD A;  5JRC B;  1M7K A;  2JPF A;  2YU2 A;  2CCQ A;  2UXD T;  2R6G F;  5AQO B;  4DND A;  4NPP A;  4BA9 A;  1YXR A;  2MYS A;  1T98 A;  3WAJ A;  2A9U A;  2JMK A;  1E1H B;  4HFD A;  2W61 A;  2XUE A;  5ABF B;  3KIN B;  2CLY B;  5HXH A;  5JDG A;  2ODU A;  2N2N A;  3PUA A;  4TNV A;  2MTQ A;  1QSD A;  2K5B B;  4IGU A;  2XAQ B;  3G06 A;  1UX5 A;  2VUR A;  4O4L E;  2WP9 A;  2FJD A;  1I6Z A;  2CBI A;  5DQW A;  3RYF E;  4AQG A;  5AQM B;  5TAO A;  2N9D A;  3IA3 A;  5JDN A;  3O4X E;  3GN5 A;  4JBW F;  4TZ4 C;  5LGU B;  3Q5X A;  3PUG A;  3ZYK A;  1HG2 A;  3RF1 A;  3HKE E;  5LOV E;  4E7Z A;  4QH1 A;  4IDZ A;  3RC3 A;  4P0B A;  3AVS A;  3NRX A;  3EHZ A;  5AQL B;  4U3C A;  3VRB A;  4DVD A;  4DO0 A;  4N78 D;  2YKS A;  3UU3 A;  4G2A A;  4O2A E;  1UX4 A;  2WDR A;  2Z6E A;  3K8P C;  4QXH B;  4LF7 T;  3VR8 A;  4YY3 T;  4F8H A;  3KVA A;  2ES0 A;  4X64 T;  3CX8 B;  5ETW A;  1YW0 A;  4KX6 A;  1J5W A;  1HFA A;  3W15 B;  3FZF B;  2PG8 A;  2CE7 A;  3AE2 A;  3R84 B;  4ZI3 D;  3OVU A;  5C2T A;  4YLH A;  5FVL A;  4JI0 T;  2ZM6 T;  2IIU A;  4WNK A;  3P4P A;  1KNZ A;  1SE7 A;  4QXC B;  4YFS A;  1CHU A;  2XQ5 A;  1OED A;  4HFV A;  2UXC T;  4KMC A;  3RH3 A;  3FXE B;  5FVK A;  3RYI E;  2RA1 A;  4OYJ A;  4QX8 B;  1BR2 A;  4IL4 A;  3CVR A;  3RC8 A;  3Q5E A;  1MMG A;  4H9Q C;  3HKB E;  2YDR A;  3UUN A;  2WS3 A;  4ZI3 C;  3FBL A;  2KND A;  2BG9 A;  3RGL A;  1V9D A;  5LP6 E;  5JDF A;  4AKR B;  2BKP A;  1WFD A;  1US7 B;  1KFY A;  2FUP A;  3JCF A;  5BR8 T;  1VOM A;  5J0Z A;  5FMN A;  4GK0 E;  2IUB A;  4PJN A;  3NZP A;  1UK5 A;  3R6N A;  4HN9 A;  2LT3 A;  4TX5 A;  2EHO A;  3LG7 A;  4HEA A;  1YKH B;  4P1N A;  2CA5 A;  3UUX B;  1UGO A;  2JQ9 A;  4CXX A;  4DR7 T;  3ZN1 B;  2OLT A;  5H6Q B;  2QYW A;  4WBN E;  2XQY A;  4ANJ A;  1IZN B;  2CMR A;  2NW8 A;  3O1I A;  3C51 A;  3H3M A;  4EOZ B;  5JR9 A;  2D5U A;  3UUL A;  4K0K T;  4OHF A;  4YT0 A;  1MIY A;  4X1Y E;  2XQA A;  3ZC0 A;  1T72 A;  4X1I E;  3AAA B;  2E2A A;  3TLT A;  3FXD B;  5H6R B;  4AQF C;  3AA0 B;  5ABE A;  3IF8 B;  2CWO A;  4O2B E;  3SS1 A;  1JNR A;  4JI6 T;  2LSI A;  4PK4 A;  1HNX T;  3NZQ A;  4GYR A;  4OFZ A;  4PK6 A;  4Q25 A;  2BS3 A;  1MND A;  2H89 A;  1R8I A;  3MXZ A;  2VB6 A;  2C5J A;  3AE1 A;  1N36 T;  3KDS E;  3PV0 F;  1WLX A;  3K3N A;  4HWC A;  4GKK T;  3LFM A;  3CML A;  4GOU A;  2WY2 A;  2B1E A;  4ZEY A;  4Z91 A;  4PW8 A;  1WR6 A;  3LSV A;  3U78 A;  4LML A;  2ZM0 A;  1G73 A;  4CI1 B;  3ONX A;  4IDQ A;  5HCM A;  4IE5 A;  4HWD A;  5CGM A;  2VKH A;  4JI4 T;  4JI7 T;  5ABG A;  4MBQ A;  2WWV A;  4CXY A;  2X0Y A;  3UU4 A;  2ZLY A;  4DV0 T;  3L3P A;  1OWA A;  3L8R A;  3AEF A;  3EAM A;  1XNR T;  1O3X A;  3TLU A;  4WZX A;  3UU8 A;  4G63 A;  2JQH A;  3ZMS B;  3JAE A;  4YXD A;  3MJX A;  5AQK B;  4JI1 T;  2XAH B;  2NR4 A;  4J2C A;  2WQY A;  2WM9 A;  4O4J E;  4ZS2 A;  5HEU A;  3PJA J;  3L09 A;  4DR2 T;  4CN4 A;  5JDL A;  2KLQ A;  2X67 A;  4U31 A;  2BG9 E;  2A72 A;  2WMN A;  4LFA T;  4DMW A;  2JIW A;  4B3S T;  1KNR A;  4LF9 T;  3OBV E;  5IHY A;  4IT4 A;  4ZZC A;  1SA0 E;  4EAH A;  4AIS A;  4DV5 T;  4QX7 B;  4X65 T;  2JQK A;  4HFB A;  4ILU A;  1WCR A;  1E2A A;  4CQI A;  5LXT E;  4UEL A;  2C0S A;  2HN1 A;  3BQK A;  3N9P A;  2H7O A;  4PAG A;  3KBT A;  5M4Y A;  3SFD A;  1QLB A;  4ERR A;  5LMN T;  3QUJ A;  3VKG A;  5LB7 B;  2LEH A;  4XBF B;  2LSK A;  4HTE A;  1LVF A;  4HFH A;  4IE6 A;  2NWB A;  2Y8D A;  4YJ2 E;  1UUS A;  5L3E B;  2JRK A;  4PJL A;  2DCF A;  5L3G B;  1X9B A;  2YDS A;  3GMI A;  2VKJ A;  5C3J A;  3DJB A;  4U74 A;  1J5E T;  4M1P A;  2WDV A;  4PJM A;  2XQ3 A;  3I0O A;  5AQR B;  4EYY R;  3KBU A;  1QUU A;  3OKQ A;  2CM0 A;  3IHR A;  3H3A A;  2XZE A;  3PUY F;  2WZH A;  4U7I A;  5FY0 A;  4EZ4 A;  2DNX A;  1E7P A;  4AKH A;  1N32 T;  3F31 A;  2PBI A;  4YHJ A;  3PUS A;  1LVK A;  2VL8 A;  4EGW A;  2YDQ A;  1ZKE A;  3BQI A;  4QXB B;  2CLY C;  5AQP B;  2LRL A;  2QA7 A;  4UEM A;  3Q5W A;  1X79 A;  2M67 A;  5LYJ E;  1SHZ C;  3FZM B;  3ZST A;  1XZY A;  4KBM B;  4MAL A;  1NWM X;  5JDM A;  2E5L T;  3AEC A;  2LE8 A;  2RPA A;  4DR3 T;  2ZM8 A;  3AE5 A;  5L4E A;  2XY8 B;  2IAK A;  1OXZ A;  3LK4 2;  2X9Y A;  3RKG A;  2JQQ A;  3O9X A;  3C4W A;  2V5C A;  3E08 A;  2CXL A;  2D2S A;  3V5S A;  3ZLI A;  4YJ3 E;  3AAI A;  4YSZ A;  1FJG T;  3N2G E;  2VAS A;  3TLW A;  4C91 A;  1XMO T;  5IUX A;  4NUU A;  2LKH A;  5AQI B;  3RKO A;  1W09 A;  1BR0 A;  3VHL A;  2E9X A;  4A5X A;  1CUN A;  3RIU A;  2I0M A;  3EVY A;  3AE8 A;  1MMA A;  4DR1 T; 
#chains in the Genus database with same CATH homology
 4B3S T;  1HNW T;  1IBM T;  1HNX T;  2UUC T;  4LF9 T;  1N32 T;  2F4V T;  1IBK T;  5BR8 T;  4DUY T;  4JI2 T;  3T1H T;  4DV5 T;  2VQE T;  4DUZ T;  4JYA T;  4X65 T;  4OX9 T;  4KHP T;  4YHH T;  4DV1 T;  1I94 T;  2UUB T;  1HR0 T;  2HHH T;  4X66 T;  1N36 T;  4B3T T;  1N34 T;  4LF4 T;  4YY3 T;  4LF7 T;  4DR5 T;  4X64 T;  4JI6 T;  4GKK T;  2UXB T;  4JV5 T;  1HNZ T;  4JI5 T;  1XMQ T;  4LFB T;  4GKJ T;  1N33 T;  1XNQ T;  4DR6 T;  5LMN T;  4NXM T;  4DV6 T;  2E5L T;  2UXD T;  4NXN T;  4DR3 T;  4LFC T;  4JI0 T;  2ZM6 T;  4DR7 T;  4LF8 T;  4AQY T;  4B3M T;  4JI4 T;  5IWA T;  4DV2 T;  4B3R T;  4JI7 T;  3OTO T;  5LMU T;  2UUA T;  1IBL T;  4LF6 T;  4JI8 T;  4DV7 T;  4DV0 T;  1FJG T;  4K0K T;  1XNR T;  4DR4 T;  2UXC T;  1J5E T;  4DV3 T;  1XMO T;  4JI3 T;  2UU9 T;  4JI1 T;  4X62 T;  3T1Y T;  4DV4 T;  4DR2 T;  4LF5 T;  2VQF T;  4LFA T;  4DR1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...