5IWAT

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
103
structure length
103
Chain Sequence
KKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 34
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5iwaT00
4LF4T 4DR4T 4LF7T 2UUBT 4NXNT 4LF5T 1XNRT 2UXCT 4DR1T 4DUZT 4YHHT 1XMQT 5IWAT 2HHHT 2ZM6T 1N33T 4JI7T 5LMNT 4B3ST 4LFAT 5LMUT 4GKKT 2F4VT 4DR2T 4LFBT 4DV7T 4DUYT 4LF9T 1FJGT 4DV1T 3T1YT 1HR0T 4JI3T 4DR6T 1IBKT 4JI0T 4LF8T 2UU9T 1IBMT 4DR5T 4DV4T 4YY3T 1I94T 4JI5T 4NXMT 2E5LT 4DV2T 1HNWT 4DV6T 4K0KT 4X64T 4JYAT 4JI6T 4DV3T 4DR3T 4OX9T 4LFCT 4X62T 1XMOT 4AQYT 1XNQT 4JI2T 4B3TT 4JI4T 4GKJT 1J5ET 4DR7T 3T1HT 4LF6T 4JI1T 2UXDT 2UUCT 4KHPT 1HNZT 4JV5T 1N32T 5BR8T 4DV0T 4X65T 4DV5T 4X66T 2UUAT 1N36T 2VQET 3OTOT 2VQFT 1IBLT 1N34T 2UXBT 1HNXT 4B3RT 4JI8T 4B3MT
chains in the Genus database with same CATH superfamily
1NWMX 1YKHB 1T7SA 3GN5A 3LFMA 1HTJF 4WBOA 4C91A 4IIJE 4DR4T 1YXRA 4EYUA 1D1BA 2DHRA 2DI4A 1J1JA 3PUZF 4IT4A 4TV9E 4N78D 1WFDA 4Z90A 5FL1A 4KMCA 2XQ3A 1XDOA 2W4XA 3TKLB 3KV4A 4ZI3C 2XQAA 4IDPA 4LF5T 5L4HA 3UTKA 4MFRA 5L3CB 1VCSA 1I6ZA 3UUNA 2BKPA 2QRXA 2X66A 2UXCT 1HS7A 3V5SA 2LRKA 2W62A 4PAGA 4OFZA 5FNVE 3N9QA 3RLFF 2ZM0A 3ZN0B 4AKHA 3E22E 2H89A 2V7KA 2G0UA 3CVRA 2XQ5A 2D0UA 3I9YA 5AFUL 2JQ9A 3HI2A 4O4HE 5HEHA 4B3ST 2WDRA 2FJDA 3NRYA 1BR4A 4EB6E 3LBXB 3CPZA 1T72A 2N1GA 2RP4A 3ZLIA 2WZIA 3UU6A 1WYBA 4JEHB 1LVFA 2UXXB 3AE1A 3ANWA 1D0ZA 4IL4A 3ZSTA 3M3ZB 2C5IT 2YKSA 2ZLYA 4QXHB 4U31A 5DABA 1HX1B 5FXZA 2X68A 3FBZA 2LSKA 2XASB 4UEMA 1OEDC 4JLEA 5ABHA 4LFBT 1ZP0A 2BBHA 2MPKA 1L0VA 2XAFB 3FZHB 2V5CA 3O1IA 1B7TA 4TNWA 2X9XA 3KV5A 1HF8A 4IDZA 3DJBA 5AQLB 3UFGA 3FXDB 1GQEA 3CX6B 3A7MA 3GMIA 3ONLC 2NW9A 2MAWA 3AB3B 3C50A 5LXTE 5CA1E 1T8BA 4TX5A 1IJ5A 2DWGA 2VKJA 2PTFA 2E9XC 3T1YT 4ZS2A 5EK2A 4BJNA 4A56A 4JI3T 3PUSA 4IREA 2PG8A 4COFA 5AQPB 4BAYB 5AQUB 4WBNE 1IBKT 3L39A 2Y8DA 3RI5A 3RQUA 4HGAA 3RF1A 4JI0T 4IE7A 2KWHA 4O4IE 2Y6XA 2OA5A 3MKDA 4AI6A 3QUJA 3Q9DA 4JI5T 4DV2T 4EOZB 3IA3A 3I1AA 5JDLA 2MTQA 2V6YB 2WB5A 3R84B 3UU3A 3C4XA 2XPKA 2LSYA 2CPTA 4O4JE 1LVKA 4JI6T 3AA1B 3JC6D 2NW8A 3ZMUB 1ZEEA 4X62T 2WCAA 4IE0A 1XMOT 3OKQA 1US7B 4ISSA 4PK6A 5LBQB 1XNQT 2WU2A 5AQNB 2XY8B 3DP7A 4TNVA 5HCJA 5L3FB 5FVKA 4JI2T 1E1HB 3PUAA 1NAFA 5IHYA 2D9DA 3RC8A 3IBPA 3ZYKA 5LHGB 2CEAA 4KBMB 1FMWA 4QHOA 2PJQA 5JRCB 4YTPA 2H3RA 3RX6A 3ZSSA 3N5LA 4ZHQE 5CA0E 2XQYA 3P4PA 5HXEA 3QB5A 2IMLA 1JNZA 2J62A 2JMKA 3N2OA 3NZQA 4TUYE 5LP6E 4Z91A 3S4UA 3L8RA 5GONE 2FUPA 4HWFA 2UUCT 1YQ4A 2CE7A 2LSJA 3P8CD 3VRAA 3KV6A 1X9BA 2NTYA 2KSRA 4U7IA 2JMHA 4CXYA 1MNEA 1WCRA 1UX4A 4G63A 1N36T 2VQET 3HKEE 3AEFA 3GWHA 3ZEFB 2Q9QB 2HPLA 3AECA 4NUVA 3RH3A 5HXRA 3OYXA 4EZHA 1W0BA 2ACXA 5LOVE 1QSDA 2ODVA 3LG7A 4H9NC 3AA6B 4FJOA 4HEAA 4L0RA 3C98B 4XAXB 3ABVA 4YFSA 5LG3A 3C4WA 1HNXT 2UXBT 3RQWA 2RA1A 2QA7A 1IJ6A 2J47A 4YSXA 5DJQC 5CGMA 2V5DA 2XUEA 4CN1A 1KNZA 2E5VA 3HKBE 4L5GA 2V7MA 3RIUA 5JTGA 5FXVA 5KMGP 3NWIA 5ADXL 4JUYA 3F2EA 3HR0A 2IHR1 1FMVA 4MLKA 2XZEA 3N9MA 3ZJ2A 4ZXLA 4OHFA 4J2CA 2BS4A 2YINA 4HWHA 3AAIA 1WR6A 3QK6A 4P0AA 2LLYA 2UXNB 1SHZC 4TZ4C 5AQGB 4DUZT 3OYZA 2MBGA 3F57A 3UU8A 1XMQT 2PFVA 5HEGA 3LK42 1CUNA 2N9DA 4I4TE 3RYHE 1G8XA 4ERRA 4V1Av 2YK0A 3OBVE 5LA6E 3ZMSB 4ASKA 4FI5A 4IE4A 4F8HA 2V6XA 4JI7T 1D0YA 3SS1A 3TLSA 5KDMC 2WP9A 2XJ7A 2ZMAA 3AEDA 4ZOLE 3AE4A 3HKCE 1D0XA 5JRCA 2W00A 3ZT5A 4ZZBA 1OWAA 2XHEB 4X20E 5JDHA 4EEBA 4YHHT 4I55E 4ZI7E 3TLTA 4K0UA 3JAFA 5CJ5A 4AKIA 3B57A 2D5UA 3FHNA 2E9XA 2WAUA 2VKOA 3JCFA 1FJGT 2CXLA 4TWHA 3I9WA 3C4ZA 2K5BB 4QXBB 5J2UE 3AEAA 4H9OC 3FB2A 3LDQB 2YU1A 4L9IA 4DV1T 4EIWA 2EHOB 4IDNA 2BVLA 2CRBA 1W09A 2LE8A 3ZC1A 4CXXA 5LYJE 3RHWA 2Q9QA 3KVBA 3L09A 2CWYA 1MMAA 3KDSE 3SWHA 5ABFB 4DR6T 3RRWA 3K1SA 1UUSA 3Q5XA 2I59A 4TV8E 3KBUA 5L3DB 2WBLA 2NP9A 2BZBA 3FZLB 4YTNA 4LMKA 3ZT6A 1XZYA 2CLYC 3CQCB 4LF8T 3W15B 2UU9T 4YY3T 1VOMA 3AXJB 3ONXA 5LBMA 2E5LT 3AXJA 4YSZA 5FKYA 4WW0A 2Z6EA 1EZ3A 5F8PA 1HFAA 2LSIA 2IAKA 1MMNA 4JI1T 4JYAT 2IC9A 3EI0A 2A3DA 3OPCA 4U2ZA 1SUMB 3LJCA 5H6RB 4DV3T 2WS3A 3CQGB 3LSVA 3PJAJ 4YT0A 5ABFA 4DR3T 4OX9T 2WMOA 1S35A 3JAEA 2KWIB 4GK5E 5JDMA 1OEDE 4GYSA 1MMGA 2ACZA 3V5UA 3M65A 3N9LA 4IL9A 1MNDA 3UU4A 2YEVC 4A98A 2L3LA 5FL0A 5CB4E 5DQVA 4F6RC 2XAGB 5LG4A 3CX8B 4YLHA 3P7IA 3ANWB 2J1DG 2A2FX 3VU7H 2NOXA 1D1AA 1MIYA 5EK3A 1T98A 2FJBA 3IF8B 3N9NA 2XM1A 5AQOB 4AQGA 3QNUA 4GKJT 2WMNA 3WAJA 4DNDA 3A8YC 1UX5A 2GK9A 2XTLA 2W2UA 3MACA 3OVUA 2YOEA 3RYIE 2VB6A 3TLUA 5LJMA 2EHOD 3AE6A 3KV9A 3N9OA 2EHOC 3HA4A 4IGUA 1OEDB 2D0TA 1MIVA 4HTEA 1N32T 4I43B 2WM9A 3PURA 3ETVA 2J4GA 4QWNB 2RPAA 4ZEYA 4X65T 2YN6A 3SOLA 3CQXC 5HXCA 2XM2A 2K9AA 1E2AA 2LT3A 2PBIA 2VQFT 4GIWA 2XQ9A 5FYMA 3SFEA 1MIWA 3AAEB 3CIRA 3RIUC 3P4QA 3R6NA 3CKDA 2X67A 3MJXA 3C64A 4B3RT 1OXZA 3UUXB 4EXTA 3TLVA 4EEDA 3EABA 2LKHA 3SRZA 1ZV4X 5F5WA 4CN4A 2V26A 2KNDA 4LF4T 1Z8UA 4DO0A 2LHNA 5ABEA 3U78A 3EUHA 5L4EA 2JRKA 1LKXA 2BG9C 3PUYF 1ZOYA 4KHZF 4HWDA 4ZI2D 3ONJA 1XDPA 4X1IE 5LB7B 4E7ZA 4ZI2C 2ZM2A 1JNRA 3N9PA 5CFBA 3O9XA 1MMDA 4JI4T 3VKGA 2E2AA 2AXDS 5HCMA 3RYCE 2W63A 3NZPA 4QXCB 4YTMA 1G73A 4HFVA 2XQ4A 1U4QA 4U74A 5IWAT 4H9RC 5H6QB 5AQJB 2HHHT 2ZM6T 1N33T 3N2KE 4P1NA 4LFAT 4DVDA 3CWZB 2WWUA 2X9WA 3LK2B 4H9QC 1HG5A 2IUBA 4QX8B 4UVAB 1J5WA 4KUMB 5ETWA 4A5XA 4HFHA 5C3JA 1YQ3A 2F4VT 2LKGA 3E0ZA 3K3NA 2X0HA 3L3PA 3MA9A 5ABGA 5L3EB 4ILCA 3AAAB 5HWYA 4DR2T 3FZKB 3O4XE 3VHLA 2BVMA 4M1PA 3K3QC 5LGTB 3IEEA 3AEBA 3KVAA 4DV7T 4CI1B 1KNRA 3H3AA 2CM0A 3AE7A 4MALA 5FY1A 1SE7A 3F31A 4LF9T 5FY0A 2B1EA 2Q9QC 2BDEA 2VWAA 5C2TA 2YDSA 4UV9B 4DMWA 4OYKA 3AE2A 4NPPA 2NR4A 2HH7A 4UV8B 2LJLA 3FBLA 3HL6A 2JQKA 5J2TE 3RKOA 2I0MA 3PV0F 1S94A 2B76A 3EAMA 3PUXF 4E7SA 4CQIA 2DNXA 5AQKB 2LM9A 1YD8G 5HEOA 4YSYA 5A1LA 2E9XB 3FZMB 4MBQA 4EYYR 4KP3C 5JVDE 2LM2A 1Y64B 2K3WA 2V7JA 3RIAA 4LMLA 5LNKA 3AA7B 4JEUB 4DR5T 1I94T 2X0LB 4NXMT 4PJJA 1UGOA 2H7VC 2NW7A 3ZMTB 5IUXA 1W9RA 4ZS3A 2M6IA 3U3IA 3QB5K 4C90A 4YXDA 3Q5DA 4DV6T 1HNWT 4CXWA 2OV9A 4YJ2E 2XQ6A 2V8SV 2XQ7A 4G2AA 2W61A 3NKZA 4DBRA 4LFCT 2KMFA 1CHUA 3BQLA 2KLQA 4O2AE 4AQYT 2XQ8A 1BR0A 4AKGA 3RKGA 3P50A 2LOSA 2AE9A 5L2LA 4KHPT 4IE5A 3K3OA 2VKDA 4PK5A 3RC3A 4CN6A 4DBQA 4HFBA 5C8YE 1BR1A 3AA0B 3ZC0A 2E8IA 2R6GF 3MK7C 5HAXA 3PU8A 4Q25A 3C51A 3ZJ1A 5AQHB 4BJMA 2DLRA 1X79A 2XAHB 2M6BA 2VKHA 2JQQA 4IDOA 5FY7A 2L8KA 1WRDA 2HN1A 1SA0E 3MZKB 3CX7B 5J1GA 2CCQA 4GOUA 4GYRA 3AEGA 5EK4A 2WWVA 2EHOA 5AQFB 2HN2A 4U72A 2HPJA 2K24A 2WDQA 4H63H 3T1HT 4LF6T 3EHZA 5LGNB 4DR7T 4X5TA 2CBJA 4WZXA 5JR9A 2WQYA 1ZHCA 2XSBA 3FXEB 4HKAA 4ILAA 4MHCA 4UF0B 4AXPA 5J0ZA 3ZN1B 5JDNA 2IIUA 4PFPA 1DU2A 2V7IA 5AQMB 3WAKA 2CWOA 3D0TA 2BKOA 4ILUA 4UIGA 4DMVA 1HNZT 2KXPB 4XBFB 3RPUA 4PFOA 4HFEA 4DV0T 4KX6A 2E9XD 2A9UA 4AQFA 2DL1A 5F3JA 3ZCJA 2JQHA 2NWBA 4X1KE 1U5PA 3N2GE 2CHOA 3OTOT 1HG2A 5LGUB 1UK5A 3I0QA 1R8IA 2OLTA 2P9BA 4CI2B 1H7CA 2XSAA 5AQVB 5L3GB 1NEKA 2CMRA 1FEWA 2JPFA 3AVRA 4IE6A 3ZMZB 2BBJA 4AIUA 1N34T 1M7KA 4PJLA 1AJ3A 2BG9A 2V1DB 3Q2MA 4QX7B 3AE9A 2BG9B 4UR9A 5JDGA 4JI8T 2JIWA 1Z0PA 3BQKA 3JADA 3AE3A 4GK0E 2CBIA 2BS3A 2LRLA 4I50E 3ZYMA 3GN5B 2W66A 4XZCA 3P4WA 4O2BE 4LF7T 5JH7E 2Y48B 2UUBT 5KXJA 1WYCA 4KI0F 2L9QA 4EV6A 3H37A 5DQWA 2LHRA 3QOFA 1M62A 5LCYA 1QLBA 4CZZB 3PTRB 4ANJA 4NXNT 4TWDA 3UFEA 3UQ4A 1XNRT 4AISA 5JR9C 2Q9QD 4H9PC 3PU3A 2CA5A 4CI3B 4EZ4A 4DR1T 2WU5A 2H7OA 4IDQA 4LMJA 4HWIB 3EDUA 3KINB 3UUBA 5HXHA 1IAPA 5HYAA 5JQGE 4UXNB 4UF0A 3K8PC 5FP3A 2YDQA 4WNKA 3RRCA 5JR9B 2WZHA 3A5XA 4WYVA 5LMNT 4QKNA 4JBWF 2KT9A 3QC9A 4AQFC 3O1HA 5LHIB 4X1YE 2IW5B 3UT5E 1YKEB 2YDRA 5HEUA 1FIOA 2YU2A 3ZYLA 2VL0A 3UULA 2IDOB 3OJAA 4O4LE 3ZPOA 5LMUT 3G06A 2V6YA 2XAQB 3ZT7A 2BKNA 1KEYA 2WDVA 4Z8XA 4O8SA 3AEEA 1QUUA 5JDFA 3VR9A 4U2YA 3RGLA 3J7Yq 4DUYT 3PUGA 4ILBA 1UURA 2FJEA 3JC6C 4IHJE 3NBXX 2V7LA 3ESLA 3TLWA 1KF6A 4H63V 2LEHA 3VKHA 1OEDA 1W0AA 4PNIA 3B5MA 4U33A 5HEJA 2W67A 2C5KT 2A72A 3ETUA 4UELA 2C0SA 4ADZA 3LK3B 3UUMA 1KNPA 2QGSA 2ODUA 3KFWX 2ZM8A 2VURA 3BK9A 5AQSB 1HR0T 4P09A 3ZMVB 1E7PA 2X51A 3ZKRA 2XAJB 2FJAA 1HX8A 3EDVA 4OK0A 4UVCB 5AQRB 1KK7A 1O3XA 2LSGA 3HKDE 4ISTA 3Q5EA 2VK9A 4BA9A 5HWXA 4HFDA 5FMNA 2QYWA 3GA8A 3ZCIA 4NUUA 4HE8A 4DV4T 1IBMT 5EZYE 3UQ7A 2K48A 3Q5WA 3NVOA 4AKRB 2BS2A 4PK4A 4YJ3E 4B6XA 1WR0A 4K0KT 4ZZCA 3DTOA 2CLYB 2X0YA 2X9YA 3PE0A 3E08A 3PUWF 5AQIB 1VRBA 2VVSA 4X64T 2MOZA 3PUVF 4ZI3D 3UU5A 1BR2A 4HN9A 4TN7B 4PJNA 4DIDB 4EGWA 2H88A 5L47A 3P4SA 5AQQB 5AQTB 2I6HA 4U3CA 1KFYA 1V9DA 2M67A 3PDYA 1IZNB 4P0BA 2JJ9A 2KZ7B 2WY2A 4NIQA 2MYSA 5TAOA 2DCFA 5LHHB 5JREA 4AKLA 2SPCA 4HWCA 2CHNA 1WLXA 4B3TT 3WI3A 4UVBB 4EAHA 5HXSA 1D1CA 2FBWA 3FZFB 3T8OA 5FVLA 3AVSA 5KX5E 1J5ET 5BMVE 3I0OA 2LOPA 1Y01A 2N2NA 2NTXA 4HFCA 3B13A 5FXWA 5L3BB 4QH5A 4GKKT 1ZKEA 2C5JA 2DWKA 3O1JA 4QH4A 3RIFA 2KINB 2UXDT 1YW0A 3AE8A 2QVAA 1VCTA 3P4RA 3PUQA 4QH1A 5FXXA 4JV5T 3IHRA 3MXZA 4OYJA 2W0GA 2CXFA 2VVNA 5E0OA 3X1DA 5LJNA 5BR8T 2BG9E 3AE5A 3CK6A 4DV5T 1HCIA 3EVYA 4X66T 3H3MA 2UUAT 3SFDA 3VRBA 2ES0A 4H9SE 3NRXA 5JDQA 1UCUA 3BQIA 3CMLA 1XWMA 4PW8A 3J9X1 3KBTA 4I0UA 3RYFE 2D2SA 2X9HA 1LRZA 3LBXA 1IBLT 4U7YA 3VR8A 4YHJA 2VL8A 1NENA 4PJMA 2VASA 2WSSV 4TWFA 2CXDA 3PJAA 5IYZE 4A97A 4HFIA 2IC6A 4B3MT 5M4YA
chains in the Genus database with same CATH topology
4LF4T 4DR4T 4LF7T 2UUBT 4NXNT 4LF5T 1XNRT 2UXCT 4DR1T 4DUZT 4YHHT 1XMQT 5IWAT 2HHHT 2ZM6T 1N33T 4JI7T 5LMNT 4B3ST 4LFAT 5LMUT 4GKKT 2F4VT 4DR2T 4LFBT 4DV7T 4DUYT 4LF9T 1FJGT 4DV1T 3T1YT 1HR0T 4JI3T 4DR6T 1IBKT 4JI0T 4LF8T 2UU9T 1IBMT 4DR5T 4DV4T 4YY3T 1I94T 4JI5T 4NXMT 2E5LT 4DV2T 1HNWT 4DV6T 4K0KT 4X64T 4JYAT 4JI6T 4DV3T 4DR3T 4OX9T 4LFCT 4X62T 1XMOT 4AQYT 1XNQT 4JI2T 4B3TT 4JI4T 4GKJT 1J5ET 4DR7T 3T1HT 4LF6T 4JI1T 2UXDT 2UUCT 4KHPT 1HNZT 4JV5T 1N32T 5BR8T 4DV0T 4X65T 4DV5T 4X66T 2UUAT 1N36T 2VQET 3OTOT 2VQFT 1IBLT 1N34T 2UXBT 1HNXT 4B3RT 4JI8T 4B3MT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 T;  4DR4 T;  4LF7 T;  2UUB T;  4NXN T;  4LF5 T;  1XNR T;  2UXC T;  4DR1 T;  4DUZ T;  4YHH T;  1XMQ T;  5IWA T;  2HHH T;  2ZM6 T;  1N33 T;  4JI7 T;  5LMN T;  4B3S T;  4LFA T;  5LMU T;  4GKK T;  2F4V T;  4DR2 T;  4LFB T;  4DV7 T;  4DUY T;  4LF9 T;  1FJG T;  4DV1 T;  3T1Y T;  1HR0 T;  4JI3 T;  4DR6 T;  1IBK T;  4JI0 T;  4LF8 T;  2UU9 T;  1IBM T;  4DR5 T;  4DV4 T;  4YY3 T;  1I94 T;  4JI5 T;  4NXM T;  2E5L T;  4DV2 T;  1HNW T;  4DV6 T;  4K0K T;  4X64 T;  4JYA T;  4JI6 T;  4DV3 T;  4DR3 T;  4OX9 T;  4LFC T;  4X62 T;  1XMO T;  4AQY T;  1XNQ T;  4JI2 T;  4B3T T;  4JI4 T;  4GKJ T;  1J5E T;  4DR7 T;  3T1H T;  4LF6 T;  4JI1 T;  2UXD T;  2UUC T;  4KHP T;  1HNZ T;  4JV5 T;  1N32 T;  5BR8 T;  4DV0 T;  4X65 T;  4DV5 T;  4X66 T;  2UUA T;  1N36 T;  2VQE T;  3OTO T;  2VQF T;  1IBL T;  1N34 T;  2UXB T;  1HNX T;  4B3R T;  4JI8 T;  4B3M T; 
#chains in the Genus database with same CATH topology
 1NWM X;  1YKH B;  1T7S A;  3GN5 A;  3LFM A;  1HTJ F;  4WBO A;  4C91 A;  4IIJ E;  4DR4 T;  1YXR A;  4EYU A;  1D1B A;  2DHR A;  2DI4 A;  1J1J A;  3PUZ F;  4IT4 A;  4TV9 E;  4N78 D;  1WFD A;  4Z90 A;  5FL1 A;  4KMC A;  2XQ3 A;  1XDO A;  2W4X A;  3TKL B;  3KV4 A;  4ZI3 C;  2XQA A;  4IDP A;  4LF5 T;  5L4H A;  3UTK A;  4MFR A;  5L3C B;  1VCS A;  1I6Z A;  3UUN A;  2BKP A;  2QRX A;  2X66 A;  2UXC T;  1HS7 A;  3V5S A;  2LRK A;  2W62 A;  4PAG A;  4OFZ A;  5FNV E;  3N9Q A;  3RLF F;  2ZM0 A;  3ZN0 B;  4AKH A;  3E22 E;  2H89 A;  2V7K A;  2G0U A;  3CVR A;  2XQ5 A;  2D0U A;  3I9Y A;  5AFU L;  2JQ9 A;  3HI2 A;  4O4H E;  5HEH A;  4B3S T;  2WDR A;  2FJD A;  3NRY A;  1BR4 A;  4EB6 E;  3LBX B;  3CPZ A;  1T72 A;  2N1G A;  2RP4 A;  3ZLI A;  2WZI A;  3UU6 A;  1WYB A;  4JEH B;  1LVF A;  2UXX B;  3AE1 A;  3ANW A;  1D0Z A;  4IL4 A;  3ZST A;  3M3Z B;  2C5I T;  2YKS A;  2ZLY A;  4QXH B;  4U31 A;  5DAB A;  1HX1 B;  5FXZ A;  2X68 A;  3FBZ A;  2LSK A;  2XAS B;  4UEM A;  1OED C;  4JLE A;  5ABH A;  4LFB T;  1ZP0 A;  2BBH A;  2MPK A;  1L0V A;  2XAF B;  3FZH B;  2V5C A;  3O1I A;  1B7T A;  4TNW A;  2X9X A;  3KV5 A;  1HF8 A;  4IDZ A;  3DJB A;  5AQL B;  3UFG A;  3FXD B;  1GQE A;  3CX6 B;  3A7M A;  3GMI A;  3ONL C;  2NW9 A;  2MAW A;  3AB3 B;  3C50 A;  5LXT E;  5CA1 E;  1T8B A;  4TX5 A;  1IJ5 A;  2DWG A;  2VKJ A;  2PTF A;  2E9X C;  3T1Y T;  4ZS2 A;  5EK2 A;  4BJN A;  4A56 A;  4JI3 T;  3PUS A;  4IRE A;  2PG8 A;  4COF A;  5AQP B;  4BAY B;  5AQU B;  4WBN E;  1IBK T;  3L39 A;  2Y8D A;  3RI5 A;  3RQU A;  4HGA A;  3RF1 A;  4JI0 T;  4IE7 A;  2KWH A;  4O4I E;  2Y6X A;  2OA5 A;  3MKD A;  4AI6 A;  3QUJ A;  3Q9D A;  4JI5 T;  4DV2 T;  4EOZ B;  3IA3 A;  3I1A A;  5JDL A;  2MTQ A;  2V6Y B;  2WB5 A;  3R84 B;  3UU3 A;  3C4X A;  2XPK A;  2LSY A;  2CPT A;  4O4J E;  1LVK A;  4JI6 T;  3AA1 B;  3JC6 D;  2NW8 A;  3ZMU B;  1ZEE A;  4X62 T;  2WCA A;  4IE0 A;  1XMO T;  3OKQ A;  1US7 B;  4ISS A;  4PK6 A;  5LBQ B;  1XNQ T;  2WU2 A;  5AQN B;  2XY8 B;  3DP7 A;  4TNV A;  5HCJ A;  5L3F B;  5FVK A;  4JI2 T;  1E1H B;  3PUA A;  1NAF A;  5IHY A;  2D9D A;  3RC8 A;  3IBP A;  3ZYK A;  5LHG B;  2CEA A;  4KBM B;  1FMW A;  4QHO A;  2PJQ A;  5JRC B;  4YTP A;  2H3R A;  3RX6 A;  3ZSS A;  3N5L A;  4ZHQ E;  5CA0 E;  2XQY A;  3P4P A;  5HXE A;  3QB5 A;  2IML A;  1JNZ A;  2J62 A;  2JMK A;  3N2O A;  3NZQ A;  4TUY E;  5LP6 E;  4Z91 A;  3S4U A;  3L8R A;  5GON E;  2FUP A;  4HWF A;  2UUC T;  1YQ4 A;  2CE7 A;  2LSJ A;  3P8C D;  3VRA A;  3KV6 A;  1X9B A;  2NTY A;  2KSR A;  4U7I A;  2JMH A;  4CXY A;  1MNE A;  1WCR A;  1UX4 A;  4G63 A;  1N36 T;  2VQE T;  3HKE E;  3AEF A;  3GWH A;  3ZEF B;  2Q9Q B;  2HPL A;  3AEC A;  4NUV A;  3RH3 A;  5HXR A;  3OYX A;  4EZH A;  1W0B A;  2ACX A;  5LOV E;  1QSD A;  2ODV A;  3LG7 A;  4H9N C;  3AA6 B;  4FJO A;  4HEA A;  4L0R A;  3C98 B;  4XAX B;  3ABV A;  4YFS A;  5LG3 A;  3C4W A;  1HNX T;  2UXB T;  3RQW A;  2RA1 A;  2QA7 A;  1IJ6 A;  2J47 A;  4YSX A;  5DJQ C;  5CGM A;  2V5D A;  2XUE A;  4CN1 A;  1KNZ A;  2E5V A;  3HKB E;  4L5G A;  2V7M A;  3RIU A;  5JTG A;  5FXV A;  5KMG P;  3NWI A;  5ADX L;  4JUY A;  3F2E A;  3HR0 A;  2IHR 1;  1FMV A;  4MLK A;  2XZE A;  3N9M A;  3ZJ2 A;  4ZXL A;  4OHF A;  4J2C A;  2BS4 A;  2YIN A;  4HWH A;  3AAI A;  1WR6 A;  3QK6 A;  4P0A A;  2LLY A;  2UXN B;  1SHZ C;  4TZ4 C;  5AQG B;  4DUZ T;  3OYZ A;  2MBG A;  3F57 A;  3UU8 A;  1XMQ T;  2PFV A;  5HEG A;  3LK4 2;  1CUN A;  2N9D A;  4I4T E;  3RYH E;  1G8X A;  4ERR A;  4V1A v;  2YK0 A;  3OBV E;  5LA6 E;  3ZMS B;  4ASK A;  4FI5 A;  4IE4 A;  4F8H A;  2V6X A;  4JI7 T;  1D0Y A;  3SS1 A;  3TLS A;  5KDM C;  2WP9 A;  2XJ7 A;  2ZMA A;  3AED A;  4ZOL E;  3AE4 A;  3HKC E;  1D0X A;  5JRC A;  2W00 A;  3ZT5 A;  4ZZB A;  1OWA A;  2XHE B;  4X20 E;  5JDH A;  4EEB A;  4YHH T;  4I55 E;  4ZI7 E;  3TLT A;  4K0U A;  3JAF A;  5CJ5 A;  4AKI A;  3B57 A;  2D5U A;  3FHN A;  2E9X A;  2WAU A;  2VKO A;  3JCF A;  1FJG T;  2CXL A;  4TWH A;  3I9W A;  3C4Z A;  2K5B B;  4QXB B;  5J2U E;  3AEA A;  4H9O C;  3FB2 A;  3LDQ B;  2YU1 A;  4L9I A;  4DV1 T;  4EIW A;  2EHO B;  4IDN A;  2BVL A;  2CRB A;  1W09 A;  2LE8 A;  3ZC1 A;  4CXX A;  5LYJ E;  3RHW A;  2Q9Q A;  3KVB A;  3L09 A;  2CWY A;  1MMA A;  3KDS E;  3SWH A;  5ABF B;  4DR6 T;  3RRW A;  3K1S A;  1UUS A;  3Q5X A;  2I59 A;  4TV8 E;  3KBU A;  5L3D B;  2WBL A;  2NP9 A;  2BZB A;  3FZL B;  4YTN A;  4LMK A;  3ZT6 A;  1XZY A;  2CLY C;  3CQC B;  4LF8 T;  3W15 B;  2UU9 T;  4YY3 T;  1VOM A;  3AXJ B;  3ONX A;  5LBM A;  2E5L T;  3AXJ A;  4YSZ A;  5FKY A;  4WW0 A;  2Z6E A;  1EZ3 A;  5F8P A;  1HFA A;  2LSI A;  2IAK A;  1MMN A;  4JI1 T;  4JYA T;  2IC9 A;  3EI0 A;  2A3D A;  3OPC A;  4U2Z A;  1SUM B;  3LJC A;  5H6R B;  4DV3 T;  2WS3 A;  3CQG B;  3LSV A;  3PJA J;  4YT0 A;  5ABF A;  4DR3 T;  4OX9 T;  2WMO A;  1S35 A;  3JAE A;  2KWI B;  4GK5 E;  5JDM A;  1OED E;  4GYS A;  1MMG A;  2ACZ A;  3V5U A;  3M65 A;  3N9L A;  4IL9 A;  1MND A;  3UU4 A;  2YEV C;  4A98 A;  2L3L A;  5FL0 A;  5CB4 E;  5DQV A;  4F6R C;  2XAG B;  5LG4 A;  3CX8 B;  4YLH A;  3P7I A;  3ANW B;  2J1D G;  2A2F X;  3VU7 H;  2NOX A;  1D1A A;  1MIY A;  5EK3 A;  1T98 A;  2FJB A;  3IF8 B;  3N9N A;  2XM1 A;  5AQO B;  4AQG A;  3QNU A;  4GKJ T;  2WMN A;  3WAJ A;  4DND A;  3A8Y C;  1UX5 A;  2GK9 A;  2XTL A;  2W2U A;  3MAC A;  3OVU A;  2YOE A;  3RYI E;  2VB6 A;  3TLU A;  5LJM A;  2EHO D;  3AE6 A;  3KV9 A;  3N9O A;  2EHO C;  3HA4 A;  4IGU A;  1OED B;  2D0T A;  1MIV A;  4HTE A;  1N32 T;  4I43 B;  2WM9 A;  3PUR A;  3ETV A;  2J4G A;  4QWN B;  2RPA A;  4ZEY A;  4X65 T;  2YN6 A;  3SOL A;  3CQX C;  5HXC A;  2XM2 A;  2K9A A;  1E2A A;  2LT3 A;  2PBI A;  2VQF T;  4GIW A;  2XQ9 A;  5FYM A;  3SFE A;  1MIW A;  3AAE B;  3CIR A;  3RIU C;  3P4Q A;  3R6N A;  3CKD A;  2X67 A;  3MJX A;  3C64 A;  4B3R T;  1OXZ A;  3UUX B;  4EXT A;  3TLV A;  4EED A;  3EAB A;  2LKH A;  3SRZ A;  1ZV4 X;  5F5W A;  4CN4 A;  2V26 A;  2KND A;  4LF4 T;  1Z8U A;  4DO0 A;  2LHN A;  5ABE A;  3U78 A;  3EUH A;  5L4E A;  2JRK A;  1LKX A;  2BG9 C;  3PUY F;  1ZOY A;  4KHZ F;  4HWD A;  4ZI2 D;  3ONJ A;  1XDP A;  4X1I E;  5LB7 B;  4E7Z A;  4ZI2 C;  2ZM2 A;  1JNR A;  3N9P A;  5CFB A;  3O9X A;  1MMD A;  4JI4 T;  3VKG A;  2E2A A;  2AXD S;  5HCM A;  3RYC E;  2W63 A;  3NZP A;  4QXC B;  4YTM A;  1G73 A;  4HFV A;  2XQ4 A;  1U4Q A;  4U74 A;  5IWA T;  4H9R C;  5H6Q B;  5AQJ B;  2HHH T;  2ZM6 T;  1N33 T;  3N2K E;  4P1N A;  4LFA T;  4DVD A;  3CWZ B;  2WWU A;  2X9W A;  3LK2 B;  4H9Q C;  1HG5 A;  2IUB A;  4QX8 B;  4UVA B;  1J5W A;  4KUM B;  5ETW A;  4A5X A;  4HFH A;  5C3J A;  1YQ3 A;  2F4V T;  2LKG A;  3E0Z A;  3K3N A;  2X0H A;  3L3P A;  3MA9 A;  5ABG A;  5L3E B;  4ILC A;  3AAA B;  5HWY A;  4DR2 T;  3FZK B;  3O4X E;  3VHL A;  2BVM A;  4M1P A;  3K3Q C;  5LGT B;  3IEE A;  3AEB A;  3KVA A;  4DV7 T;  4CI1 B;  1KNR A;  3H3A A;  2CM0 A;  3AE7 A;  4MAL A;  5FY1 A;  1SE7 A;  3F31 A;  4LF9 T;  5FY0 A;  2B1E A;  2Q9Q C;  2BDE A;  2VWA A;  5C2T A;  2YDS A;  4UV9 B;  4DMW A;  4OYK A;  3AE2 A;  4NPP A;  2NR4 A;  2HH7 A;  4UV8 B;  2LJL A;  3FBL A;  3HL6 A;  2JQK A;  5J2T E;  3RKO A;  2I0M A;  3PV0 F;  1S94 A;  2B76 A;  3EAM A;  3PUX F;  4E7S A;  4CQI A;  2DNX A;  5AQK B;  2LM9 A;  1YD8 G;  5HEO A;  4YSY A;  5A1L A;  2E9X B;  3FZM B;  4MBQ A;  4EYY R;  4KP3 C;  5JVD E;  2LM2 A;  1Y64 B;  2K3W A;  2V7J A;  3RIA A;  4LML A;  5LNK A;  3AA7 B;  4JEU B;  4DR5 T;  1I94 T;  2X0L B;  4NXM T;  4PJJ A;  1UGO A;  2H7V C;  2NW7 A;  3ZMT B;  5IUX A;  1W9R A;  4ZS3 A;  2M6I A;  3U3I A;  3QB5 K;  4C90 A;  4YXD A;  3Q5D A;  4DV6 T;  1HNW T;  4CXW A;  2OV9 A;  4YJ2 E;  2XQ6 A;  2V8S V;  2XQ7 A;  4G2A A;  2W61 A;  3NKZ A;  4DBR A;  4LFC T;  2KMF A;  1CHU A;  3BQL A;  2KLQ A;  4O2A E;  4AQY T;  2XQ8 A;  1BR0 A;  4AKG A;  3RKG A;  3P50 A;  2LOS A;  2AE9 A;  5L2L A;  4KHP T;  4IE5 A;  3K3O A;  2VKD A;  4PK5 A;  3RC3 A;  4CN6 A;  4DBQ A;  4HFB A;  5C8Y E;  1BR1 A;  3AA0 B;  3ZC0 A;  2E8I A;  2R6G F;  3MK7 C;  5HAX A;  3PU8 A;  4Q25 A;  3C51 A;  3ZJ1 A;  5AQH B;  4BJM A;  2DLR A;  1X79 A;  2XAH B;  2M6B A;  2VKH A;  2JQQ A;  4IDO A;  5FY7 A;  2L8K A;  1WRD A;  2HN1 A;  1SA0 E;  3MZK B;  3CX7 B;  5J1G A;  2CCQ A;  4GOU A;  4GYR A;  3AEG A;  5EK4 A;  2WWV A;  2EHO A;  5AQF B;  2HN2 A;  4U72 A;  2HPJ A;  2K24 A;  2WDQ A;  4H63 H;  3T1H T;  4LF6 T;  3EHZ A;  5LGN B;  4DR7 T;  4X5T A;  2CBJ A;  4WZX A;  5JR9 A;  2WQY A;  1ZHC A;  2XSB A;  3FXE B;  4HKA A;  4ILA A;  4MHC A;  4UF0 B;  4AXP A;  5J0Z A;  3ZN1 B;  5JDN A;  2IIU A;  4PFP A;  1DU2 A;  2V7I A;  5AQM B;  3WAK A;  2CWO A;  3D0T A;  2BKO A;  4ILU A;  4UIG A;  4DMV A;  1HNZ T;  2KXP B;  4XBF B;  3RPU A;  4PFO A;  4HFE A;  4DV0 T;  4KX6 A;  2E9X D;  2A9U A;  4AQF A;  2DL1 A;  5F3J A;  3ZCJ A;  2JQH A;  2NWB A;  4X1K E;  1U5P A;  3N2G E;  2CHO A;  3OTO T;  1HG2 A;  5LGU B;  1UK5 A;  3I0Q A;  1R8I A;  2OLT A;  2P9B A;  4CI2 B;  1H7C A;  2XSA A;  5AQV B;  5L3G B;  1NEK A;  2CMR A;  1FEW A;  2JPF A;  3AVR A;  4IE6 A;  3ZMZ B;  2BBJ A;  4AIU A;  1N34 T;  1M7K A;  4PJL A;  1AJ3 A;  2BG9 A;  2V1D B;  3Q2M A;  4QX7 B;  3AE9 A;  2BG9 B;  4UR9 A;  5JDG A;  4JI8 T;  2JIW A;  1Z0P A;  3BQK A;  3JAD A;  3AE3 A;  4GK0 E;  2CBI A;  2BS3 A;  2LRL A;  4I50 E;  3ZYM A;  3GN5 B;  2W66 A;  4XZC A;  3P4W A;  4O2B E;  4LF7 T;  5JH7 E;  2Y48 B;  2UUB T;  5KXJ A;  1WYC A;  4KI0 F;  2L9Q A;  4EV6 A;  3H37 A;  5DQW A;  2LHR A;  3QOF A;  1M62 A;  5LCY A;  1QLB A;  4CZZ B;  3PTR B;  4ANJ A;  4NXN T;  4TWD A;  3UFE A;  3UQ4 A;  1XNR T;  4AIS A;  5JR9 C;  2Q9Q D;  4H9P C;  3PU3 A;  2CA5 A;  4CI3 B;  4EZ4 A;  4DR1 T;  2WU5 A;  2H7O A;  4IDQ A;  4LMJ A;  4HWI B;  3EDU A;  3KIN B;  3UUB A;  5HXH A;  1IAP A;  5HYA A;  5JQG E;  4UXN B;  4UF0 A;  3K8P C;  5FP3 A;  2YDQ A;  4WNK A;  3RRC A;  5JR9 B;  2WZH A;  3A5X A;  4WYV A;  5LMN T;  4QKN A;  4JBW F;  2KT9 A;  3QC9 A;  4AQF C;  3O1H A;  5LHI B;  4X1Y E;  2IW5 B;  3UT5 E;  1YKE B;  2YDR A;  5HEU A;  1FIO A;  2YU2 A;  3ZYL A;  2VL0 A;  3UUL A;  2IDO B;  3OJA A;  4O4L E;  3ZPO A;  5LMU T;  3G06 A;  2V6Y A;  2XAQ B;  3ZT7 A;  2BKN A;  1KEY A;  2WDV A;  4Z8X A;  4O8S A;  3AEE A;  1QUU A;  5JDF A;  3VR9 A;  4U2Y A;  3RGL A;  3J7Y q;  4DUY T;  3PUG A;  4ILB A;  1UUR A;  2FJE A;  3JC6 C;  4IHJ E;  3NBX X;  2V7L A;  3ESL A;  3TLW A;  1KF6 A;  4H63 V;  2LEH A;  3VKH A;  1OED A;  1W0A A;  4PNI A;  3B5M A;  4U33 A;  5HEJ A;  2W67 A;  2C5K T;  2A72 A;  3ETU A;  4UEL A;  2C0S A;  4ADZ A;  3LK3 B;  3UUM A;  1KNP A;  2QGS A;  2ODU A;  3KFW X;  2ZM8 A;  2VUR A;  3BK9 A;  5AQS B;  1HR0 T;  4P09 A;  3ZMV B;  1E7P A;  2X51 A;  3ZKR A;  2XAJ B;  2FJA A;  1HX8 A;  3EDV A;  4OK0 A;  4UVC B;  5AQR B;  1KK7 A;  1O3X A;  2LSG A;  3HKD E;  4IST A;  3Q5E A;  2VK9 A;  4BA9 A;  5HWX A;  4HFD A;  5FMN A;  2QYW A;  3GA8 A;  3ZCI A;  4NUU A;  4HE8 A;  4DV4 T;  1IBM T;  5EZY E;  3UQ7 A;  2K48 A;  3Q5W A;  3NVO A;  4AKR B;  2BS2 A;  4PK4 A;  4YJ3 E;  4B6X A;  1WR0 A;  4K0K T;  4ZZC A;  3DTO A;  2CLY B;  2X0Y A;  2X9Y A;  3PE0 A;  3E08 A;  3PUW F;  5AQI B;  1VRB A;  2VVS A;  4X64 T;  2MOZ A;  3PUV F;  4ZI3 D;  3UU5 A;  1BR2 A;  4HN9 A;  4TN7 B;  4PJN A;  4DID B;  4EGW A;  2H88 A;  5L47 A;  3P4S A;  5AQQ B;  5AQT B;  2I6H A;  4U3C A;  1KFY A;  1V9D A;  2M67 A;  3PDY A;  1IZN B;  4P0B A;  2JJ9 A;  2KZ7 B;  2WY2 A;  4NIQ A;  2MYS A;  5TAO A;  2DCF A;  5LHH B;  5JRE A;  4AKL A;  2SPC A;  4HWC A;  2CHN A;  1WLX A;  4B3T T;  3WI3 A;  4UVB B;  4EAH A;  5HXS A;  1D1C A;  2FBW A;  3FZF B;  3T8O A;  5FVL A;  3AVS A;  5KX5 E;  1J5E T;  5BMV E;  3I0O A;  2LOP A;  1Y01 A;  2N2N A;  2NTX A;  4HFC A;  3B13 A;  5FXW A;  5L3B B;  4QH5 A;  4GKK T;  1ZKE A;  2C5J A;  2DWK A;  3O1J A;  4QH4 A;  3RIF A;  2KIN B;  2UXD T;  1YW0 A;  3AE8 A;  2QVA A;  1VCT A;  3P4R A;  3PUQ A;  4QH1 A;  5FXX A;  4JV5 T;  3IHR A;  3MXZ A;  4OYJ A;  2W0G A;  2CXF A;  2VVN A;  5E0O A;  3X1D A;  5LJN A;  5BR8 T;  2BG9 E;  3AE5 A;  3CK6 A;  4DV5 T;  1HCI A;  3EVY A;  4X66 T;  3H3M A;  2UUA T;  3SFD A;  3VRB A;  2ES0 A;  4H9S E;  3NRX A;  5JDQ A;  1UCU A;  3BQI A;  3CML A;  1XWM A;  4PW8 A;  3J9X 1;  3KBT A;  4I0U A;  3RYF E;  2D2S A;  2X9H A;  1LRZ A;  3LBX A;  1IBL T;  4U7Y A;  3VR8 A;  4YHJ A;  2VL8 A;  1NEN A;  4PJM A;  2VAS A;  2WSS V;  4TWF A;  2CXD A;  3PJA A;  5IYZ E;  4A97 A;  4HFI A;  2IC6 A;  4B3M T;  5M4Y A; 
#chains in the Genus database with same CATH homology
 4LF4 T;  4DR4 T;  4LF7 T;  2UUB T;  4NXN T;  4LF5 T;  1XNR T;  2UXC T;  4DR1 T;  4DUZ T;  4YHH T;  1XMQ T;  5IWA T;  2HHH T;  2ZM6 T;  1N33 T;  4JI7 T;  5LMN T;  4B3S T;  4LFA T;  5LMU T;  4GKK T;  2F4V T;  4DR2 T;  4LFB T;  4DV7 T;  4DUY T;  4LF9 T;  1FJG T;  4DV1 T;  3T1Y T;  1HR0 T;  4JI3 T;  4DR6 T;  1IBK T;  4JI0 T;  4LF8 T;  2UU9 T;  1IBM T;  4DR5 T;  4DV4 T;  4YY3 T;  1I94 T;  4JI5 T;  4NXM T;  2E5L T;  4DV2 T;  1HNW T;  4DV6 T;  4K0K T;  4X64 T;  4JYA T;  4JI6 T;  4DV3 T;  4DR3 T;  4OX9 T;  4LFC T;  4X62 T;  1XMO T;  4AQY T;  1XNQ T;  4JI2 T;  4B3T T;  4JI4 T;  4GKJ T;  1J5E T;  4DR7 T;  3T1H T;  4LF6 T;  4JI1 T;  2UXD T;  2UUC T;  4KHP T;  1HNZ T;  4JV5 T;  1N32 T;  5BR8 T;  4DV0 T;  4X65 T;  4DV5 T;  4X66 T;  2UUA T;  1N36 T;  2VQE T;  3OTO T;  2VQF T;  1IBL T;  1N34 T;  2UXB T;  1HNX T;  4B3R T;  4JI8 T;  4B3M T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...