5IWAT

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
103
structure length
103
Chain Sequence
b'KKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 34
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5iwaT00
4JI4T 4B3ST 4DV7T 4JI7T 4DUYT 4LFAT 2UU9T 1N34T 4JYAT 2UXCT 5LMNT 4JI2T 1J5ET 4OX9T 4X65T 4GKJT 4DV4T 4DV0T 2E5LT 1XMOT 4DR7T 1N36T 4GKKT 2UXDT 4DR3T 1HNXT 3T1YT 4DV3T 4LFCT 4JI5T 4LF5T 1I94T 4JI1T 4DR6T 1HNZT 1IBMT 1HR0T 1XNRT 4DR1T 4DR4T 4B3RT 4X62T 1N32T 4K0KT 5IWAT 4DV2T 4LF7T 2VQFT 4AQYT 4JI8T 4JV5T 4DV5T 3T1HT 4DV1T 4X64T 4DR2T 2ZM6T 4X66T 1HNWT 4NXNT 2F4VT 4YHHT 1FJGT 2HHHT 4JI3T 3OTOT 1IBKT 4LFBT 4DV6T 1XMQT 4KHPT 2UUCT 4JI0T 2UUBT 1IBLT 4NXMT 4YY3T 4JI6T 2UXBT 4B3MT 5LMUT 4LF6T 4DUZT 2UUAT 1N33T 4B3TT 1XNQT 4LF9T 2VQET 4DR5T 4LF8T 5BR8T 4LF4T
chains in the Genus database with same CATH superfamily
5ABHA 4B3ST 3AEFA 2K5BB 3UU5A 5LMNT 1GQEA 5GONE 2XSAA 2WY2A 2E5VA 3ZJ1A 5FMNA 1NAFA 4X5TA 1OEDA 3RRCA 2XQ6A 4O4JE 5LP6E 1B7TA 3TLUA 4YLHA 3N9QA 1IBMT 2I0MA 1XNRT 3Q9DA 5DJQC 3F31A 3MA9A 4U2ZA 1Z8UA 5HXHA 2VVNA 3KDSE 2R6GF 4O2AE 3P7IA 4GK5E 4IDOA 1YD8G 1I6ZA 4MALA 3H3MA 3CX7B 5A1LA 5IYZE 2OA5A 4PW8A 5CJ5A 3N2KE 2YOEA 2Q9QD 3OTOT 3OJAA 3ZC1A 3IF8B 2H7OA 1D1BA 2NOXA 5LHHB 2IUBA 3GWHA 4FI5A 3L09A 5AQHB 3LK3B 2N9DA 1XNQT 1FIOA 4O4HE 4WBOA 1SHZC 5HEJA 5TAOA 3RYHE 5M4YA 2UXCT 2X9YA 4JI2T 2MPKA 2C5JA 3PUXF 5L3GB 2KZ7B 4I4TE 5HEGA 1ZEEA 3O1JA 2RA1A 4GKKT 2BBHA 2KWIB 5LNKA 1QSDA 4CZZB 3IBPA 4LFCT 3SWHA 1EZ3A 3AE5A 2Z6EA 1SA0E 5DQWA 4ILCA 3O4XE 2VWAA 2V6YB 5HXSA 4YXDA 3PTRB 3AVRA 3K3NA 3UFEA 4IDQA 3RC3A 4JV5T 3RLFF 3UUBA 2XZEA 4AXPA 3HKEE 2EHOC 1MIWA 4AKHA 1WYCA 5EZYE 3FXDB 3EABA 4JI3T 4LFBT 3AAAB 3KBTA 3PUQA 4AKRB 2NTYA 2VASA 4PK6A 3VRAA 4GYSA 1IBLT 2CA5A 3WI3A 5JH7E 4UIGA 3WAJA 4YSYA 5AQRB 3AEAA 3O1HA 2QGSA 4LF8T 3C50A 4KX6A 3LSVA 2ZM2A 4IL4A 4H9QC 3MXZA 2V5DA 5CFBA 2C5IT 4IDZA 4X1KE 2NW7A 4ADZA 5HEHA 4BA9A 3CPZA 4LF5T 4LMLA 1FEWA 2PTFA 2W61A 4HFEA 1M7KA 5EK3A 4QX8B 2VL0A 5HAXA 2K3WA 2W4XA 5FKYA 4P1NA 5JRCA 4X62T 3ONXA 2UXXB 3RIUC 1LKXA 4LF7T 4TUYE 2LHRA 3T8OA 4DBQA 2FBWA 2IDOB 2X67A 3Q5DA 2CHNA 2CMRA 2J1DG 3N9OA 1XZYA 3ONLC 4KP3C 2W66A 4AKIA 2ES0A 2MTQA 1E1HB 5LGTB 3RH3A 5HCJA 5KXJA 3ZT5A 4JI6T 3CQXC 2LOSA 4IE4A 3SFEA 2VB6A 4ZHQE 3LJCA 3NZPA 4QKNA 3FZKB 2IIUA 3BQLA 5AQGB 4CN1A 3CK6A 2KT9A 4WW0A 4UXNB 2DLRA 4DUYT 3PUYF 2W2UA 2LKGA 5EK2A 1KNZA 4GKJT 4AQFA 4TV8E 1W0AA 3P4SA 3J7Yq 4CQIA 5L3BB 1XMOT 1J5WA 2UXDT 2LEHA 1D0YA 3KBUA 2KINB 1IAPA 1S35A 3ANWA 3N9PA 2DL1A 1SE7A 2ZM8A 1D0XA 3FXEB 2LSJA 3RRWA 4P09A 4AI6A 1BR2A 4U72A 4COFA 3PJAA 2XQ3A 5HWYA 4PJJA 3AECA 2Q9QA 3RF1A 4DV2T 1VCSA 4ZS3A 1UK5A 5AQKB 1LVKA 2VKHA 3PU3A 4DV5T 3T1HT 3ZCIA 4YSXA 2XJ7A 2XQAA 3R84B 3ZLIA 5FY1A 3C4XA 3U3IA 2J47A 4OYKA 3E22E 3JC6D 2CXFA 4PNIA 1HX8A 5JDLA 2E9XC 1KNPA 3TLWA 2G0UA 4HN9A 2B1EA 5L2LA 2XAFB 3PUZF 3QUJA 3CQGB 4JI4T 3VR8A 4ILAA 3AVSA 2D2SA 4KHZF 4IE7A 1KF6A 3RYFE 2M6BA 3UUNA 2X0YA 3AE8A 5FVLA 2BBJA 3RYCE 4JEUB 5FXVA 2ZMAA 3UU6A 1AJ3A 3ZT7A 4UV9B 4PK4A 2IC9A 3EAMA 4U2YA 1BR0A 3OYXA 5ABEA 4NPPA 1HR0T 5FYMA 4KUMB 2WQYA 5H6QB 3ZCJA 5AQSB 4DVDA 3ONJA 5JDFA 4Z90A 3UU4A 3ZYKA 2X0LB 4UF0A 2WS3A 1T72A 3FB2A 4L9IA 4AQGA 3F57A 2H7VC 4KI0F 1X9BA 1XMQT 3UTKA 4UELA 4ZS2A 4HFVA 3AA0B 2EHOD 1SUMB 3KVBA 1VOMA 4I55E 5AQUB 4HFDA 4B3TT 5ABFB 4HKAA 2MOZA 3AEBA 1T8BA 3CKDA 1OEDC 4YHJA 3LK2B 5AQPB 4OHFA 3CX6B 3ZN1B 4QXBB 4H9RC 2V7MA 3Q5XA 3ZMZB 2E9XB 3QB5A 2NW8A 3MK7C 3AAIA 3AE3A 2WSSV 4ZI3D 4E7ZA 3TLTA 5ABGA 2BG9C 1MIVA 1U5PA 1HG5A 4TZ4C 3T1YT 2LLYA 3ABVA 3N9NA 5E0OA 3RX6A 3A5XA 5F3JA 3EUHA 4O8SA 1KEYA 3E08A 2YDSA 1WLXA 2BKPA 5IUXA 3MJXA 3NBXX 4DR4T 2I59A 2CCQA 3OYZA 4K0KT 4ZI7E 3ZYLA 4WZXA 5FXWA 3JAEA 4PK5A 3KVAA 3LBXA 4QWNB 2ZM0A 3JAFA 5LG3A 3P8CD 2JQ9A 2LKHA 3AAEB 4E7SA 5KX5E 4QXCB 3BQKA 1W0BA 1YKEB 2WCAA 3QK6A 3U78A 3AEEA 4P0AA 4AIUA 2V7KA 2V7LA 3JC6C 2XUEA 5LMUT 3PUWF 5LBQB 3I1AA 4O4IE 4EAHA 4CN6A 2X9XA 3NRYA 5JR9A 2WMNA 1YW0A 2YEVC 1UX5A 4HTEA 1XDOA 4MBQA 2J62A 4IT4A 2UU9T 4JYAT 4IDPA 2D9DA 5L3DB 4TX5A 1XDPA 3LFMA 4U3CA 4C90A 3RHWA 1OEDB 2J4GA 2MBGA 4LMJA 4UVCB 3NRXA 2K48A 2FJAA 3A8YC 4NIQA 5C2TA 1T7SA 2NR4A 4ANJA 3UUMA 2CXDA 3MZKB 5LJMA 2BG9B 5LGUB 5JTGA 2YU1A 2XQ7A 2WWVA 5FY0A 2MYSA 2RPAA 5FXZA 5CB4E 2VK9A 2HPJA 2LT3A 1BR1A 4IHJE 4ISTA 2Y6XA 2XSBA 3ETVA 3QB5K 2E2AA 4UVAB 3OVUA 1QUUA 1NEKA 3PUAA 1HF8A 1HTJF 4ILBA 2CLYC 4NXMT 3AA7B 2N2NA 3EDUA 2JPFA 2DWKA 2NW9A 2XQ5A 4TV9E 1H7CA 3BK9A 3AXJA 1FJGT 3B13A 2D0UA 3IHRA 2E9XD 3ZN0B 5HCMA 4QH4A 5CGMA 2E5LT 2DI4A 2DHRA 4L0RA 2WDVA 4ZI3C 3ZYMA 1J1JA 2BKNA 2X0HA 4HWIB 4HFBA 4KBMB 3ZMUB 2JQKA 1ZOYA 4I43B 2IAKA 2KMFA 2C5KT 3ZEFB 4JI1T 2IC6A 1YKHB 4BAYB 2YINA 1W9RA 1V9DA 1UGOA 2BS3A 5FVKA 4IGUA 3HKDE 4H63H 4AKLA 3AE9A 4AQYT 3I9WA 2E8IA 4B6XA 5LHGB 4X66T 1HNWT 5BMVE 2EHOA 3A7MA 1L0VA 4PJMA 4H9OC 4IE6A 2XM2A 3HR0A 3AB3B 3RI5A 4IDNA 3GMIA 2VURA 4QH5A 4DUZT 2V7IA 3P4PA 4EEDA 3K3OA 3OPCA 4HEAA 2CLYB 4DR3T 2Y8DA 2WAUA 5LBMA 5L3CB 3P50A 2XASB 2CEAA 4U33A 3DJBA 4KMCA 3ZMTB 5F8PA 2XM1A 1OEDE 3AE6A 4ZZBA 2YK0A 4YTPA 1N36T 2BS4A 2K24A 4HFIA 2XAQB 3F2EA 4JI5T 2YN6A 1D1CA 3C4WA 2BG9E 2X51A 3H3AA 5JRCB 3S4UA 4DR6T 3CMLA 3L39A 3UUXB 4H9NC 5JDNA 1WFDA 1ZP0A 5J0ZA 4GIWA 3RIUA 4A97A 2CRBA 4G2AA 4U74A 1UCUA 3FBZA 4XBFB 4ZI2C 5HXEA 2FUPA 4A5XA 2W0GA 5L4EA 5JDMA 2LM9A 2HHHT 4H9PC 3N2OA 5FP3A 3C51A 3UFGA 3RQUA 4CXYA 4U31A 1OWAA 4ZXLA 2UXBT 4MFRA 1ZV4X 4LF6T 1T98A 2UUAT 1VCTA 3KV5A 2BZBA 3PUGA 5L3FB 4MHCA 5JDQA 1WR6A 2KNDA 3EI0A 4A56A 3QC9A 3ZMVB 3HKCE 2ACXA 2L9QA 2WB5A 4UVBB 4EZHA 3KV4A 1HX1B 3VR9A 3EVYA 4IL9A 1UX4A 5LHIB 5LB7B 1HFAA 5HEOA 1MMNA 4TWDA 3ANWB 3GA8A 2YU2A 3AE4A 3K3QC 2CE7A 4DV3T 2A9UA 4HFHA 5DQVA 2XQ4A 4ZEYA 1FMVA 1MNEA 2VL8A 2LM2A 3LG7A 3Q5EA 4B3RT 2NWBA 4DNDA 3RGLA 3MKDA 4N78D 3LK42 2DWGA 2SPCA 1UUSA 4HWFA 3IA3A 2ZM6T 3C98B 3JCFA 4U7IA 3PV0F 4FJOA 3GN5A 1CUNA 2WDQA 4C91A 3NVOA 1WRDA 3M3ZB 1JNZA 1MMDA 1IBKT 4GOUA 3CX8B 1KNRA 2W00A 4J2CA 2BVLA 4EYUA 4YJ2E 1LRZA 1JNRA 5AQVB 2BDEA 2JMKA 3AE1A 3QOFA 2XAHB 3RPUA 2V26A 1YQ3A 1D1AA 5KDMC 4OFZA 1U4QA 4JI7T 5CA1E 5HWXA 2AE9A 1WR0A 3KV6A 3L3PA 1X79A 4OX9T 2CWOA 4UR9A 4HWCA 2HPLA 3RIAA 3MACA 4V1Av 1YQ4A 4ISSA 2LE8A 2CM0A 2FJEA 3C64A 1Z0PA 1IJ5A 3AA6B 4OK0A 5AQMB 5H6RB 5HXRA 1M62A 4QHOA 4NUVA 4DR1T 1ZKEA 2WMOA 2ZLYA 3B5MA 5IWAT 3O1IA 1UURA 2HN2A 1XWMA 4IE0A 3TLSA 4JI8T 4AISA 5J2UE 5FNVE 2A72A 1NENA 3PU8A 4JLEA 4TWHA 5AQFB 4DV6T 4JI0T 2QA7A 3UULA 2LJLA 5J1GA 1CHUA 3NZQA 2JRKA 2LHNA 1HS7A 2WU2A 3WAKA 4CXWA 4Z8XA 5LJNA 2VKOA 2V8SV 1HG2A 4DV7T 4EGWA 4WNKA 5LXTE 2ODUA 2HH7A 3L8RA 2WZHA 3HI2A 2BVMA 2H88A 2BG9A 3ETUA 2W63A 2VKDA 2CWYA 1WCRA 5LYJE 3ZPOA 5C8YE 3HA4A 1O3XA 2XQ8A 3EDVA 3RQWA 2WP9A 2VVSA 2PBIA 2WBLA 2YDRA 5FL1A 3LBXB 2V6YA 5C3JA 3I9YA 1BR4A 3X1DA 2CPTA 4DR2T 3Q5WA 5AFUL 2M6IA 4EV6A 2NP9A 2OLTA 4AKGA 2FJBA 4H63V 4YTNA 1MIYA 4Z91A 4ASKA 3K1SA 4YT0A 5AQNB 4DO0A 1D0ZA 4EXTA 2CXLA 2CBJA 5ETWA 4ZI2D 4MLKA 5AQIB 4QX7B 5JR9B 2LSGA 4PAGA 2X9WA 1MNDA 1N33T 4LMKA 4HWDA 4I50E 3SS1A 1Y64B 2ACZA 4CN4A 2V6XA 4WYVA 2KLQA 3I0QA 4LFAT 4BJMA 2YDQA 2H3RA 1US7B 4DV4T 1E2AA 4DV0T 5LCYA 2KSRA 2ODVA 5AQQB 3CVRA 3RIFA 4TNVA 4ZZCA 4QXHB 3VKHA 3VU7H 5L47A 3CQCB 1HNXT 2WDRA 2DNXA 2QYWA 5AQJB 3DTOA 2XPKA 3RKOA 1MMGA 4X1IE 2IHR1 3OBVE 3J9X1 2Y48B 5FL0A 1HNZT 2B76A 3RYIE 1FMWA 1YXRA 1DU2A 3FZHB 3HKBE 5JVDE 5FY7A 4GK0E 2NTXA 2VQFT 1WYBA 3ZKRA 4X64T 4P0BA 4TWFA 2RP4A 4JEHB 2P9BA 4GYRA 4PFOA 4ZOLE 2IW5B 2CHOA 3UT5E 5HXCA 4JUYA 4KHPT 4IE5A 2UUBT 1G8XA 3N9MA 3P4QA 4Q25A 1VRBA 3AXJB 2AXDS 1S94A 2WWUA 2VQET 4LF4T 3E0ZA 4IIJE 4X20E 4YJ3E 4UV8B 1N34T 1IZNB 4DIDB 3Q2MA 4AQFC 3C4ZA 3ZSSA 3PE0A 4YFSA 3SOLA 5ADXL 3B57A 3KINB 5KMGP 4YTMA 2BKOA 4HWHA 4TN7B 3SFDA 2XY8B 4U7YA 1KFYA 3PUVF 2JMHA 2KWHA 1MMAA 3UU8A 2UXNB 4TNWA 5AQTB 3CIRA 2WZIA 1Y01A 1OXZA 2QVAA 5LGNB 2XAGB 4CI1B 1N32T 4EZ4A 2Q9QC 4DMWA 3O9XA 3PJAJ 2L3LA 2EHOB 2X68A 5HYAA 2K9AA 3BQIA 2N1GA 4DV1T 3NWIA 3CWZB 2WM9A 5DABA 2F4VT 3P4RA 3ZMSB 4YHHT 5JDHA 2BS2A 3FZLB 2XQ9A 4WBNE 3ZC0A 3EHZA 3FZMB 4PJNA 3LDQB 2FJDA 2L8KA 2CBIA 4B3MT 2H89A 4YSZA 5JQGE 3KV9A 4XAXB 2XHEB 4LF9T 2LOPA 4EIWA 4OYJA 3UU3A 4I0UA 5LG4A 2W67A 5BR8T 3DP7A 3G06A 1LVFA 4PJLA 3RC8A 4X65T 2WU5A 3AEGA 3AE2A 3PUSA 3M65A 3TLVA 1I94T 3ZT6A 4HFCA 3N5LA 5F5WA 4L5GA 4O4LE 4ILUA 2XQYA 3H37A 4CI2B 2LRLA 2QRXA 3P4WA 5IHYA 4EB6E 2LSKA 3AE7A 4F8HA 4NUUA 3HL6A 1KK7A 4DBRA 3QNUA 5AQOB 2JQHA 4CXXA 2LSIA 2JIWA 4EYYR 4BJNA 3NKZA 5HEUA 2IMLA 2Q9QB 2A3DA 2XAJB 2D0TA 3VRBA 3FBLA 2GK9A 1HCIA 4QH1A 3K8PC 3N9LA 2XTLA 4H9SE 3FZFB 3IEEA 3TKLB 2A2FX 4CI3B 2V5CA 3R6NA 3I0OA 2V7JA 3KFWX 4JBWF 5ABFA 3JADA 5L4HA 3UQ7A 4EEBA 4F6RC 5L3EB 3D0TA 4G63A 2X66A 4PFPA 1J5ET 3VHLA 4M1PA 2E9XA 4X1YE 2VKJA 4IREA 5EK4A 4K0UA 4DR7T 2JQQA 4UEMA 4DMVA 2MAWA 2PFVA 1G73A 1E7PA 2PG8A 3W15B 4HGAA 4A98A 2M67A 1NWMX 3SRZA 1R8IA 3FHNA 2W62A 2LRKA 3V5UA 2HN1A 3UQ4A 3OKQA 5AQLB 4HE8A 2X9HA 2PJQA 2KXPB 2JJ9A 5JREA 3GN5B 5LOVE 3V5SA 3VKGA 2OV9A 4NXNT 3ESLA 2D5UA 4XZCA 4EOZB 1W09A 2YKSA 2LSYA 5FXXA 3PDYA 5JDGA 1QLBA 1IJ6A 3RKGA 4ERRA 3N2GE 4UF0B 2UUCT 1ZHCA 2C0SA 5CA0E 4YY3T 3AEDA 3AA1B 2DCFA 5J2TE 2I6HA 4O2BE 3ZSTA 3PURA 5JR9C 4DR5T 2V1DB 5LA6E 3ZJ2A
chains in the Genus database with same CATH topology
4JI4T 4B3ST 4DV7T 4JI7T 4DUYT 4LFAT 2UU9T 1N34T 4JYAT 2UXCT 5LMNT 4JI2T 1J5ET 4OX9T 4X65T 4GKJT 4DV4T 4DV0T 2E5LT 1XMOT 4DR7T 1N36T 4GKKT 2UXDT 4DR3T 1HNXT 3T1YT 4DV3T 4LFCT 4JI5T 4LF5T 1I94T 4JI1T 4DR6T 1HNZT 1IBMT 1HR0T 1XNRT 4DR1T 4DR4T 4B3RT 4X62T 1N32T 4K0KT 5IWAT 4DV2T 4LF7T 2VQFT 4AQYT 4JI8T 4JV5T 4DV5T 3T1HT 4DV1T 4X64T 4DR2T 2ZM6T 4X66T 1HNWT 4NXNT 2F4VT 4YHHT 1FJGT 2HHHT 4JI3T 3OTOT 1IBKT 4LFBT 4DV6T 1XMQT 4KHPT 2UUCT 4JI0T 2UUBT 1IBLT 4NXMT 4YY3T 4JI6T 2UXBT 4B3MT 5LMUT 4LF6T 4DUZT 2UUAT 1N33T 4B3TT 1XNQT 4LF9T 2VQET 4DR5T 4LF8T 5BR8T 4LF4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 T;  4B3S T;  4DV7 T;  4JI7 T;  4DUY T;  4LFA T;  2UU9 T;  1N34 T;  4JYA T;  2UXC T;  5LMN T;  4JI2 T;  1J5E T;  4OX9 T;  4X65 T;  4GKJ T;  4DV4 T;  4DV0 T;  2E5L T;  1XMO T;  4DR7 T;  1N36 T;  4GKK T;  2UXD T;  4DR3 T;  1HNX T;  3T1Y T;  4DV3 T;  4LFC T;  4JI5 T;  4LF5 T;  1I94 T;  4JI1 T;  4DR6 T;  1HNZ T;  1IBM T;  1HR0 T;  1XNR T;  4DR1 T;  4DR4 T;  4B3R T;  4X62 T;  1N32 T;  4K0K T;  5IWA T;  4DV2 T;  4LF7 T;  2VQF T;  4AQY T;  4JI8 T;  4JV5 T;  4DV5 T;  3T1H T;  4DV1 T;  4X64 T;  4DR2 T;  2ZM6 T;  4X66 T;  1HNW T;  4NXN T;  2F4V T;  4YHH T;  1FJG T;  2HHH T;  4JI3 T;  3OTO T;  1IBK T;  4LFB T;  4DV6 T;  1XMQ T;  4KHP T;  2UUC T;  4JI0 T;  2UUB T;  1IBL T;  4NXM T;  4YY3 T;  4JI6 T;  2UXB T;  4B3M T;  5LMU T;  4LF6 T;  4DUZ T;  2UUA T;  1N33 T;  4B3T T;  1XNQ T;  4LF9 T;  2VQE T;  4DR5 T;  4LF8 T;  5BR8 T;  4LF4 T; 
#chains in the Genus database with same CATH topology
 5ABH A;  4B3S T;  3AEF A;  2K5B B;  3UU5 A;  5LMN T;  1GQE A;  5GON E;  2XSA A;  2WY2 A;  2E5V A;  3ZJ1 A;  5FMN A;  1NAF A;  4X5T A;  1OED A;  3RRC A;  2XQ6 A;  4O4J E;  5LP6 E;  1B7T A;  3TLU A;  4YLH A;  3N9Q A;  1IBM T;  2I0M A;  1XNR T;  3Q9D A;  5DJQ C;  3F31 A;  3MA9 A;  4U2Z A;  1Z8U A;  5HXH A;  2VVN A;  3KDS E;  2R6G F;  4O2A E;  3P7I A;  4GK5 E;  4IDO A;  1YD8 G;  1I6Z A;  4MAL A;  3H3M A;  3CX7 B;  5A1L A;  5IYZ E;  2OA5 A;  4PW8 A;  5CJ5 A;  3N2K E;  2YOE A;  2Q9Q D;  3OTO T;  3OJA A;  3ZC1 A;  3IF8 B;  2H7O A;  1D1B A;  2NOX A;  5LHH B;  2IUB A;  3GWH A;  4FI5 A;  3L09 A;  5AQH B;  3LK3 B;  2N9D A;  1XNQ T;  1FIO A;  4O4H E;  4WBO A;  1SHZ C;  5HEJ A;  5TAO A;  3RYH E;  5M4Y A;  2UXC T;  2X9Y A;  4JI2 T;  2MPK A;  2C5J A;  3PUX F;  5L3G B;  2KZ7 B;  4I4T E;  5HEG A;  1ZEE A;  3O1J A;  2RA1 A;  4GKK T;  2BBH A;  2KWI B;  5LNK A;  1QSD A;  4CZZ B;  3IBP A;  4LFC T;  3SWH A;  1EZ3 A;  3AE5 A;  2Z6E A;  1SA0 E;  5DQW A;  4ILC A;  3O4X E;  2VWA A;  2V6Y B;  5HXS A;  4YXD A;  3PTR B;  3AVR A;  3K3N A;  3UFE A;  4IDQ A;  3RC3 A;  4JV5 T;  3RLF F;  3UUB A;  2XZE A;  4AXP A;  3HKE E;  2EHO C;  1MIW A;  4AKH A;  1WYC A;  5EZY E;  3FXD B;  3EAB A;  4JI3 T;  4LFB T;  3AAA B;  3KBT A;  3PUQ A;  4AKR B;  2NTY A;  2VAS A;  4PK6 A;  3VRA A;  4GYS A;  1IBL T;  2CA5 A;  3WI3 A;  5JH7 E;  4UIG A;  3WAJ A;  4YSY A;  5AQR B;  3AEA A;  3O1H A;  2QGS A;  4LF8 T;  3C50 A;  4KX6 A;  3LSV A;  2ZM2 A;  4IL4 A;  4H9Q C;  3MXZ A;  2V5D A;  5CFB A;  2C5I T;  4IDZ A;  4X1K E;  2NW7 A;  4ADZ A;  5HEH A;  4BA9 A;  3CPZ A;  4LF5 T;  4LML A;  1FEW A;  2PTF A;  2W61 A;  4HFE A;  1M7K A;  5EK3 A;  4QX8 B;  2VL0 A;  5HAX A;  2K3W A;  2W4X A;  5FKY A;  4P1N A;  5JRC A;  4X62 T;  3ONX A;  2UXX B;  3RIU C;  1LKX A;  4LF7 T;  4TUY E;  2LHR A;  3T8O A;  4DBQ A;  2FBW A;  2IDO B;  2X67 A;  3Q5D A;  2CHN A;  2CMR A;  2J1D G;  3N9O A;  1XZY A;  3ONL C;  4KP3 C;  2W66 A;  4AKI A;  2ES0 A;  2MTQ A;  1E1H B;  5LGT B;  3RH3 A;  5HCJ A;  5KXJ A;  3ZT5 A;  4JI6 T;  3CQX C;  2LOS A;  4IE4 A;  3SFE A;  2VB6 A;  4ZHQ E;  3LJC A;  3NZP A;  4QKN A;  3FZK B;  2IIU A;  3BQL A;  5AQG B;  4CN1 A;  3CK6 A;  2KT9 A;  4WW0 A;  4UXN B;  2DLR A;  4DUY T;  3PUY F;  2W2U A;  2LKG A;  5EK2 A;  1KNZ A;  4GKJ T;  4AQF A;  4TV8 E;  1W0A A;  3P4S A;  3J7Y q;  4CQI A;  5L3B B;  1XMO T;  1J5W A;  2UXD T;  2LEH A;  1D0Y A;  3KBU A;  2KIN B;  1IAP A;  1S35 A;  3ANW A;  3N9P A;  2DL1 A;  1SE7 A;  2ZM8 A;  1D0X A;  3FXE B;  2LSJ A;  3RRW A;  4P09 A;  4AI6 A;  1BR2 A;  4U72 A;  4COF A;  3PJA A;  2XQ3 A;  5HWY A;  4PJJ A;  3AEC A;  2Q9Q A;  3RF1 A;  4DV2 T;  1VCS A;  4ZS3 A;  1UK5 A;  5AQK B;  1LVK A;  2VKH A;  3PU3 A;  4DV5 T;  3T1H T;  3ZCI A;  4YSX A;  2XJ7 A;  2XQA A;  3R84 B;  3ZLI A;  5FY1 A;  3C4X A;  3U3I A;  2J47 A;  4OYK A;  3E22 E;  3JC6 D;  2CXF A;  4PNI A;  1HX8 A;  5JDL A;  2E9X C;  1KNP A;  3TLW A;  2G0U A;  4HN9 A;  2B1E A;  5L2L A;  2XAF B;  3PUZ F;  3QUJ A;  3CQG B;  4JI4 T;  3VR8 A;  4ILA A;  3AVS A;  2D2S A;  4KHZ F;  4IE7 A;  1KF6 A;  3RYF E;  2M6B A;  3UUN A;  2X0Y A;  3AE8 A;  5FVL A;  2BBJ A;  3RYC E;  4JEU B;  5FXV A;  2ZMA A;  3UU6 A;  1AJ3 A;  3ZT7 A;  4UV9 B;  4PK4 A;  2IC9 A;  3EAM A;  4U2Y A;  1BR0 A;  3OYX A;  5ABE A;  4NPP A;  1HR0 T;  5FYM A;  4KUM B;  2WQY A;  5H6Q B;  3ZCJ A;  5AQS B;  4DVD A;  3ONJ A;  5JDF A;  4Z90 A;  3UU4 A;  3ZYK A;  2X0L B;  4UF0 A;  2WS3 A;  1T72 A;  3FB2 A;  4L9I A;  4AQG A;  3F57 A;  2H7V C;  4KI0 F;  1X9B A;  1XMQ T;  3UTK A;  4UEL A;  4ZS2 A;  4HFV A;  3AA0 B;  2EHO D;  1SUM B;  3KVB A;  1VOM A;  4I55 E;  5AQU B;  4HFD A;  4B3T T;  5ABF B;  4HKA A;  2MOZ A;  3AEB A;  1T8B A;  3CKD A;  1OED C;  4YHJ A;  3LK2 B;  5AQP B;  4OHF A;  3CX6 B;  3ZN1 B;  4QXB B;  4H9R C;  2V7M A;  3Q5X A;  3ZMZ B;  2E9X B;  3QB5 A;  2NW8 A;  3MK7 C;  3AAI A;  3AE3 A;  2WSS V;  4ZI3 D;  4E7Z A;  3TLT A;  5ABG A;  2BG9 C;  1MIV A;  1U5P A;  1HG5 A;  4TZ4 C;  3T1Y T;  2LLY A;  3ABV A;  3N9N A;  5E0O A;  3RX6 A;  3A5X A;  5F3J A;  3EUH A;  4O8S A;  1KEY A;  3E08 A;  2YDS A;  1WLX A;  2BKP A;  5IUX A;  3MJX A;  3NBX X;  4DR4 T;  2I59 A;  2CCQ A;  3OYZ A;  4K0K T;  4ZI7 E;  3ZYL A;  4WZX A;  5FXW A;  3JAE A;  4PK5 A;  3KVA A;  3LBX A;  4QWN B;  2ZM0 A;  3JAF A;  5LG3 A;  3P8C D;  2JQ9 A;  2LKH A;  3AAE B;  4E7S A;  5KX5 E;  4QXC B;  3BQK A;  1W0B A;  1YKE B;  2WCA A;  3QK6 A;  3U78 A;  3AEE A;  4P0A A;  4AIU A;  2V7K A;  2V7L A;  3JC6 C;  2XUE A;  5LMU T;  3PUW F;  5LBQ B;  3I1A A;  4O4I E;  4EAH A;  4CN6 A;  2X9X A;  3NRY A;  5JR9 A;  2WMN A;  1YW0 A;  2YEV C;  1UX5 A;  4HTE A;  1XDO A;  4MBQ A;  2J62 A;  4IT4 A;  2UU9 T;  4JYA T;  4IDP A;  2D9D A;  5L3D B;  4TX5 A;  1XDP A;  3LFM A;  4U3C A;  4C90 A;  3RHW A;  1OED B;  2J4G A;  2MBG A;  4LMJ A;  4UVC B;  3NRX A;  2K48 A;  2FJA A;  3A8Y C;  4NIQ A;  5C2T A;  1T7S A;  2NR4 A;  4ANJ A;  3UUM A;  2CXD A;  3MZK B;  5LJM A;  2BG9 B;  5LGU B;  5JTG A;  2YU1 A;  2XQ7 A;  2WWV A;  5FY0 A;  2MYS A;  2RPA A;  5FXZ A;  5CB4 E;  2VK9 A;  2HPJ A;  2LT3 A;  1BR1 A;  4IHJ E;  4IST A;  2Y6X A;  2XSB A;  3ETV A;  3QB5 K;  2E2A A;  4UVA B;  3OVU A;  1QUU A;  1NEK A;  3PUA A;  1HF8 A;  1HTJ F;  4ILB A;  2CLY C;  4NXM T;  3AA7 B;  2N2N A;  3EDU A;  2JPF A;  2DWK A;  2NW9 A;  2XQ5 A;  4TV9 E;  1H7C A;  3BK9 A;  3AXJ A;  1FJG T;  3B13 A;  2D0U A;  3IHR A;  2E9X D;  3ZN0 B;  5HCM A;  4QH4 A;  5CGM A;  2E5L T;  2DI4 A;  2DHR A;  4L0R A;  2WDV A;  4ZI3 C;  3ZYM A;  1J1J A;  2BKN A;  2X0H A;  4HWI B;  4HFB A;  4KBM B;  3ZMU B;  2JQK A;  1ZOY A;  4I43 B;  2IAK A;  2KMF A;  2C5K T;  3ZEF B;  4JI1 T;  2IC6 A;  1YKH B;  4BAY B;  2YIN A;  1W9R A;  1V9D A;  1UGO A;  2BS3 A;  5FVK A;  4IGU A;  3HKD E;  4H63 H;  4AKL A;  3AE9 A;  4AQY T;  3I9W A;  2E8I A;  4B6X A;  5LHG B;  4X66 T;  1HNW T;  5BMV E;  2EHO A;  3A7M A;  1L0V A;  4PJM A;  4H9O C;  4IE6 A;  2XM2 A;  3HR0 A;  3AB3 B;  3RI5 A;  4IDN A;  3GMI A;  2VUR A;  4QH5 A;  4DUZ T;  2V7I A;  3P4P A;  4EED A;  3K3O A;  3OPC A;  4HEA A;  2CLY B;  4DR3 T;  2Y8D A;  2WAU A;  5LBM A;  5L3C B;  3P50 A;  2XAS B;  2CEA A;  4U33 A;  3DJB A;  4KMC A;  3ZMT B;  5F8P A;  2XM1 A;  1OED E;  3AE6 A;  4ZZB A;  2YK0 A;  4YTP A;  1N36 T;  2BS4 A;  2K24 A;  4HFI A;  2XAQ B;  3F2E A;  4JI5 T;  2YN6 A;  1D1C A;  3C4W A;  2BG9 E;  2X51 A;  3H3A A;  5JRC B;  3S4U A;  4DR6 T;  3CML A;  3L39 A;  3UUX B;  4H9N C;  5JDN A;  1WFD A;  1ZP0 A;  5J0Z A;  4GIW A;  3RIU A;  4A97 A;  2CRB A;  4G2A A;  4U74 A;  1UCU A;  3FBZ A;  4XBF B;  4ZI2 C;  5HXE A;  2FUP A;  4A5X A;  2W0G A;  5L4E A;  5JDM A;  2LM9 A;  2HHH T;  4H9P C;  3N2O A;  5FP3 A;  3C51 A;  3UFG A;  3RQU A;  4CXY A;  4U31 A;  1OWA A;  4ZXL A;  2UXB T;  4MFR A;  1ZV4 X;  4LF6 T;  1T98 A;  2UUA T;  1VCT A;  3KV5 A;  2BZB A;  3PUG A;  5L3F B;  4MHC A;  5JDQ A;  1WR6 A;  2KND A;  3EI0 A;  4A56 A;  3QC9 A;  3ZMV B;  3HKC E;  2ACX A;  2L9Q A;  2WB5 A;  4UVB B;  4EZH A;  3KV4 A;  1HX1 B;  3VR9 A;  3EVY A;  4IL9 A;  1UX4 A;  5LHI B;  5LB7 B;  1HFA A;  5HEO A;  1MMN A;  4TWD A;  3ANW B;  3GA8 A;  2YU2 A;  3AE4 A;  3K3Q C;  2CE7 A;  4DV3 T;  2A9U A;  4HFH A;  5DQV A;  2XQ4 A;  4ZEY A;  1FMV A;  1MNE A;  2VL8 A;  2LM2 A;  3LG7 A;  3Q5E A;  4B3R T;  2NWB A;  4DND A;  3RGL A;  3MKD A;  4N78 D;  3LK4 2;  2DWG A;  2SPC A;  1UUS A;  4HWF A;  3IA3 A;  2ZM6 T;  3C98 B;  3JCF A;  4U7I A;  3PV0 F;  4FJO A;  3GN5 A;  1CUN A;  2WDQ A;  4C91 A;  3NVO A;  1WRD A;  3M3Z B;  1JNZ A;  1MMD A;  1IBK T;  4GOU A;  3CX8 B;  1KNR A;  2W00 A;  4J2C A;  2BVL A;  4EYU A;  4YJ2 E;  1LRZ A;  1JNR A;  5AQV B;  2BDE A;  2JMK A;  3AE1 A;  3QOF A;  2XAH B;  3RPU A;  2V26 A;  1YQ3 A;  1D1A A;  5KDM C;  4OFZ A;  1U4Q A;  4JI7 T;  5CA1 E;  5HWX A;  2AE9 A;  1WR0 A;  3KV6 A;  3L3P A;  1X79 A;  4OX9 T;  2CWO A;  4UR9 A;  4HWC A;  2HPL A;  3RIA A;  3MAC A;  4V1A v;  1YQ4 A;  4ISS A;  2LE8 A;  2CM0 A;  2FJE A;  3C64 A;  1Z0P A;  1IJ5 A;  3AA6 B;  4OK0 A;  5AQM B;  5H6R B;  5HXR A;  1M62 A;  4QHO A;  4NUV A;  4DR1 T;  1ZKE A;  2WMO A;  2ZLY A;  3B5M A;  5IWA T;  3O1I A;  1UUR A;  2HN2 A;  1XWM A;  4IE0 A;  3TLS A;  4JI8 T;  4AIS A;  5J2U E;  5FNV E;  2A72 A;  1NEN A;  3PU8 A;  4JLE A;  4TWH A;  5AQF B;  4DV6 T;  4JI0 T;  2QA7 A;  3UUL A;  2LJL A;  5J1G A;  1CHU A;  3NZQ A;  2JRK A;  2LHN A;  1HS7 A;  2WU2 A;  3WAK A;  4CXW A;  4Z8X A;  5LJN A;  2VKO A;  2V8S V;  1HG2 A;  4DV7 T;  4EGW A;  4WNK A;  5LXT E;  2ODU A;  2HH7 A;  3L8R A;  2WZH A;  3HI2 A;  2BVM A;  2H88 A;  2BG9 A;  3ETU A;  2W63 A;  2VKD A;  2CWY A;  1WCR A;  5LYJ E;  3ZPO A;  5C8Y E;  3HA4 A;  1O3X A;  2XQ8 A;  3EDV A;  3RQW A;  2WP9 A;  2VVS A;  2PBI A;  2WBL A;  2YDR A;  5FL1 A;  3LBX B;  2V6Y A;  5C3J A;  3I9Y A;  1BR4 A;  3X1D A;  2CPT A;  4DR2 T;  3Q5W A;  5AFU L;  2M6I A;  4EV6 A;  2NP9 A;  2OLT A;  4AKG A;  2FJB A;  4H63 V;  4YTN A;  1MIY A;  4Z91 A;  4ASK A;  3K1S A;  4YT0 A;  5AQN B;  4DO0 A;  1D0Z A;  4EXT A;  2CXL A;  2CBJ A;  5ETW A;  4ZI2 D;  4MLK A;  5AQI B;  4QX7 B;  5JR9 B;  2LSG A;  4PAG A;  2X9W A;  1MND A;  1N33 T;  4LMK A;  4HWD A;  4I50 E;  3SS1 A;  1Y64 B;  2ACZ A;  4CN4 A;  2V6X A;  4WYV A;  2KLQ A;  3I0Q A;  4LFA T;  4BJM A;  2YDQ A;  2H3R A;  1US7 B;  4DV4 T;  1E2A A;  4DV0 T;  5LCY A;  2KSR A;  2ODV A;  5AQQ B;  3CVR A;  3RIF A;  4TNV A;  4ZZC A;  4QXH B;  3VKH A;  3VU7 H;  5L47 A;  3CQC B;  1HNX T;  2WDR A;  2DNX A;  2QYW A;  5AQJ B;  3DTO A;  2XPK A;  3RKO A;  1MMG A;  4X1I E;  2IHR 1;  3OBV E;  3J9X 1;  2Y48 B;  5FL0 A;  1HNZ T;  2B76 A;  3RYI E;  1FMW A;  1YXR A;  1DU2 A;  3FZH B;  3HKB E;  5JVD E;  5FY7 A;  4GK0 E;  2NTX A;  2VQF T;  1WYB A;  3ZKR A;  4X64 T;  4P0B A;  4TWF A;  2RP4 A;  4JEH B;  2P9B A;  4GYR A;  4PFO A;  4ZOL E;  2IW5 B;  2CHO A;  3UT5 E;  5HXC A;  4JUY A;  4KHP T;  4IE5 A;  2UUB T;  1G8X A;  3N9M A;  3P4Q A;  4Q25 A;  1VRB A;  3AXJ B;  2AXD S;  1S94 A;  2WWU A;  2VQE T;  4LF4 T;  3E0Z A;  4IIJ E;  4X20 E;  4YJ3 E;  4UV8 B;  1N34 T;  1IZN B;  4DID B;  3Q2M A;  4AQF C;  3C4Z A;  3ZSS A;  3PE0 A;  4YFS A;  3SOL A;  5ADX L;  3B57 A;  3KIN B;  5KMG P;  4YTM A;  2BKO A;  4HWH A;  4TN7 B;  3SFD A;  2XY8 B;  4U7Y A;  1KFY A;  3PUV F;  2JMH A;  2KWH A;  1MMA A;  3UU8 A;  2UXN B;  4TNW A;  5AQT B;  3CIR A;  2WZI A;  1Y01 A;  1OXZ A;  2QVA A;  5LGN B;  2XAG B;  4CI1 B;  1N32 T;  4EZ4 A;  2Q9Q C;  4DMW A;  3O9X A;  3PJA J;  2L3L A;  2EHO B;  2X68 A;  5HYA A;  2K9A A;  3BQI A;  2N1G A;  4DV1 T;  3NWI A;  3CWZ B;  2WM9 A;  5DAB A;  2F4V T;  3P4R A;  3ZMS B;  4YHH T;  5JDH A;  2BS2 A;  3FZL B;  2XQ9 A;  4WBN E;  3ZC0 A;  3EHZ A;  3FZM B;  4PJN A;  3LDQ B;  2FJD A;  2L8K A;  2CBI A;  4B3M T;  2H89 A;  4YSZ A;  5JQG E;  3KV9 A;  4XAX B;  2XHE B;  4LF9 T;  2LOP A;  4EIW A;  4OYJ A;  3UU3 A;  4I0U A;  5LG4 A;  2W67 A;  5BR8 T;  3DP7 A;  3G06 A;  1LVF A;  4PJL A;  3RC8 A;  4X65 T;  2WU5 A;  3AEG A;  3AE2 A;  3PUS A;  3M65 A;  3TLV A;  1I94 T;  3ZT6 A;  4HFC A;  3N5L A;  5F5W A;  4L5G A;  4O4L E;  4ILU A;  2XQY A;  3H37 A;  4CI2 B;  2LRL A;  2QRX A;  3P4W A;  5IHY A;  4EB6 E;  2LSK A;  3AE7 A;  4F8H A;  4NUU A;  3HL6 A;  1KK7 A;  4DBR A;  3QNU A;  5AQO B;  2JQH A;  4CXX A;  2LSI A;  2JIW A;  4EYY R;  4BJN A;  3NKZ A;  5HEU A;  2IML A;  2Q9Q B;  2A3D A;  2XAJ B;  2D0T A;  3VRB A;  3FBL A;  2GK9 A;  1HCI A;  4QH1 A;  3K8P C;  3N9L A;  2XTL A;  4H9S E;  3FZF B;  3IEE A;  3TKL B;  2A2F X;  4CI3 B;  2V5C A;  3R6N A;  3I0O A;  2V7J A;  3KFW X;  4JBW F;  5ABF A;  3JAD A;  5L4H A;  3UQ7 A;  4EEB A;  4F6R C;  5L3E B;  3D0T A;  4G63 A;  2X66 A;  4PFP A;  1J5E T;  3VHL A;  4M1P A;  2E9X A;  4X1Y E;  2VKJ A;  4IRE A;  5EK4 A;  4K0U A;  4DR7 T;  2JQQ A;  4UEM A;  4DMV A;  2MAW A;  2PFV A;  1G73 A;  1E7P A;  2PG8 A;  3W15 B;  4HGA A;  4A98 A;  2M67 A;  1NWM X;  3SRZ A;  1R8I A;  3FHN A;  2W62 A;  2LRK A;  3V5U A;  2HN1 A;  3UQ4 A;  3OKQ A;  5AQL B;  4HE8 A;  2X9H A;  2PJQ A;  2KXP B;  2JJ9 A;  5JRE A;  3GN5 B;  5LOV E;  3V5S A;  3VKG A;  2OV9 A;  4NXN T;  3ESL A;  2D5U A;  4XZC A;  4EOZ B;  1W09 A;  2YKS A;  2LSY A;  5FXX A;  3PDY A;  5JDG A;  1QLB A;  1IJ6 A;  3RKG A;  4ERR A;  3N2G E;  4UF0 B;  2UUC T;  1ZHC A;  2C0S A;  5CA0 E;  4YY3 T;  3AED A;  3AA1 B;  2DCF A;  5J2T E;  2I6H A;  4O2B E;  3ZST A;  3PUR A;  5JR9 C;  4DR5 T;  2V1D B;  5LA6 E;  3ZJ2 A; 
#chains in the Genus database with same CATH homology
 4JI4 T;  4B3S T;  4DV7 T;  4JI7 T;  4DUY T;  4LFA T;  2UU9 T;  1N34 T;  4JYA T;  2UXC T;  5LMN T;  4JI2 T;  1J5E T;  4OX9 T;  4X65 T;  4GKJ T;  4DV4 T;  4DV0 T;  2E5L T;  1XMO T;  4DR7 T;  1N36 T;  4GKK T;  2UXD T;  4DR3 T;  1HNX T;  3T1Y T;  4DV3 T;  4LFC T;  4JI5 T;  4LF5 T;  1I94 T;  4JI1 T;  4DR6 T;  1HNZ T;  1IBM T;  1HR0 T;  1XNR T;  4DR1 T;  4DR4 T;  4B3R T;  4X62 T;  1N32 T;  4K0K T;  5IWA T;  4DV2 T;  4LF7 T;  2VQF T;  4AQY T;  4JI8 T;  4JV5 T;  4DV5 T;  3T1H T;  4DV1 T;  4X64 T;  4DR2 T;  2ZM6 T;  4X66 T;  1HNW T;  4NXN T;  2F4V T;  4YHH T;  1FJG T;  2HHH T;  4JI3 T;  3OTO T;  1IBK T;  4LFB T;  4DV6 T;  1XMQ T;  4KHP T;  2UUC T;  4JI0 T;  2UUB T;  1IBL T;  4NXM T;  4YY3 T;  4JI6 T;  2UXB T;  4B3M T;  5LMU T;  4LF6 T;  4DUZ T;  2UUA T;  1N33 T;  4B3T T;  1XNQ T;  4LF9 T;  2VQE T;  4DR5 T;  4LF8 T;  5BR8 T;  4LF4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...