4DV7T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv7T00
4LF8T 4B3TT 4X62T 4B3ST 4JI4T 3OTOT 1XNRT 4LFAT 4AQYT 4DV4T 4NXMT 4DR7T 4DV1T 4YY3T 4LF4T 4DUYT 4YHHT 4DV6T 2UXDT 1J5ET 4GKKT 1XMQT 4K0KT 1HNXT 1HNWT 2VQFT 4DV3T 2UXCT 1FJGT 2F4VT 3T1HT 4JI6T 1N36T 4DR2T 2E5LT 1IBKT 4DV7T 5LMUT 4LF9T 1HR0T 2UUBT 4DR1T 1IBMT 4LF7T 4DV0T 5LMNT 4JI0T 4DR3T 4LF5T 4OX9T 4X66T 2VQET 2UU9T 4KHPT 4JI3T 1I94T 1N32T 4LF6T 4JYAT 2UXBT 4JI2T 2UUAT 4X65T 4DR6T 1N33T 4DV2T 4DV5T 4JV5T 5IWAT 4NXNT 2UUCT 1HNZT 4LFCT 4DR4T 5BR8T 4B3MT 2ZM6T 1N34T 3T1YT 4GKJT 4JI7T 1XMOT 4X64T 2HHHT 4JI5T 1IBLT 4JI1T 4B3RT 4LFBT 4DR5T 4JI8T 1XNQT 4DUZT
chains in the Genus database with same CATH superfamily
3LJCA 5ABGA 2LHNA 4O2AE 5CB4E 4KBMB 4AISA 3FZKB 3ZN0B 3QK6A 2WP9A 4UVCB 4IL4A 2D0UA 4YHHT 2CEAA 2J62A 5J1GA 1UGOA 2M6BA 4C91A 4TUYE 4TNVA 3ZYMA 2DNXA 4FI5A 2CA5A 4A97A 5KXJA 2ZM0A 2X51A 4G2AA 4HKAA 3AE1A 1MMNA 1Z0PA 4HFVA 4YTPA 2CM0A 3L09A 3A8YC 2LHRA 2WMOA 2B1EA 5HEOA 4UVAB 3MKDA 2FBWA 3CVRA 4X1IE 5L4HA 2BS4A 4ZOLE 1D1AA 1D1BA 5FVLA 1FMWA 5BR8T 3NRYA 3EHZA 4TV9E 4ADZA 1YW0A 2CLYC 2XQ3A 3E22E 4CXYA 4PJLA 2C5IT 3UTKA 2CWOA 2LJLA 1MIVA 4B3ST 3CWZB 2LKHA 2JQKA 4A98A 3KVBA 2H7OA 4HTEA 1HCIA 1BR1A 5AQOB 2UXDT 2CBJA 2HPJA 2JMKA 3TLVA 4WZXA 2Y48B 2BS3A 4YFSA 3C4WA 2WM9A 2W67A 1NAFA 3P4QA 3SFEA 4F6RC 2Z6EA 4HN9A 2IAKA 2JQQA 2K48A 5JQGE 4JUYA 4FJOA 2LRKA 3P50A 3QNUA 5FL0A 5L3GB 1WLXA 4BJMA 3ZC1A 2BG9B 1HG5A 3NZQA 4QXBB 4PNIA 2WU5A 5HEJA 1OEDA 1N33T 4TV8E 5LHGB 2A3DA 3FXEB 4H9PC 4KI0F 5L3CB 1WR6A 4XAXB 1T7SA 4QH1A 4CI3B 1JNZA 3UU3A 2X0HA 4ASKA 4L5GA 4UIGA 2NW7A 3ZCIA 5JRCA 1AJ3A 3TLWA 5LGUB 5HXSA 1FMVA 2K5BB 2YN6A 4ZI3D 1OEDE 1UX5A 2D2SA 1W9RA 3EDUA 4U2ZA 4EEDA 4DUYT 4TZ4C 2VVNA 2V7LA 2FUPA 3QOFA 3UT5E 2XJ7A 4TNWA 1HNWT 3HKCE 3CPZA 1M62A 3AAIA 3JADA 4U72A 5KX5E 3HKEE 4IE6A 4JI0T 4NIQA 4UELA 5LCYA 4LF6T 4Q25A 3K3OA 5ADXL 3PUGA 3N9MA 5FXXA 2XZEA 3NZPA 1LRZA 2IUBA 4AKHA 3ZN1B 1WYBA 1WYCA 3TLTA 3UU5A 3N9OA 4LMJA 4HE8A 3SOLA 3AA0B 1BR4A 5HXCA 3QB5K 2BKPA 3VRAA 3RRCA 4X62T 2XPKA 3QB5A 3VKGA 3PUZF 3FXDB 4LF4T 4YLHA 1QUUA 3AE6A 2W0GA 3OPCA 4GIWA 3SWHA 2W00A 2KMFA 4H9QC 4MFRA 5ABEA 3UULA 4DIDB 4AKGA 2FJEA 4YT0A 1VOMA 4JI6T 3FBLA 3RIFA 2D5UA 2XHEB 4DR1T 3FZLB 4LF7T 2GK9A 3MA9A 5LMNT 2IIUA 1HG2A 2UU9T 3ZC0A 1SHZC 3RPUA 5LHHB 4AXPA 3H37A 2YDSA 3CIRA 3K3NA 2PJQA 5JR9C 4EOZB 2X68A 1J1JA 5GONE 3RKGA 3CQGB 3R84B 3BK9A 2IMLA 3ZMTB 4MBQA 3KV6A 5HEHA 2R6GF 5FKYA 3WI3A 4JI1T 4B3RT 3PURA 3A7MA 2N2NA 4WYVA 4LF8T 4PW8A 3PU8A 3P4RA 3ZMSB 5AQMB 5E0OA 3AVRA 1SA0E 4UF0A 4HFEA 2JMHA 1Z8UA 4P1NA 1MMGA 4NUVA 2Q9QB 4U7YA 3DJBA 3AVSA 2CXLA 3GN5B 4HFDA 2E9XB 3MACA 5AQVB 3GMIA 4O2BE 3CQCB 1FJGT 2IHR1 1SE7A 3HA4A 1BR0A 3AEDA 5JDMA 2FJBA 4OYJA 3ZLIA 3J7Yq 5AQFB 5HEUA 4X66T 4PFPA 3L8RA 2VB6A 5LGNB 2V7IA 2NTYA 5AQUB 3ZT6A 4CI1B 4KHZF 5DQVA 3K1SA 2Y6XA 2BBHA 3ZCJA 5JTGA 2PFVA 5FXZA 3O1HA 4H63H 1W0AA 3IF8B 2RA1A 5F8PA 5L3FB 4P0BA 5LNKA 1SUMB 1HX8A 2K24A 4CN6A 3N2OA 5LGTB 4PK5A 5JDQA 4MALA 3AEAA 5LBQB 1IAPA 4EEBA 2N9DA 4YJ3E 3ZJ1A 1IBLT 4LFBT 2EHOB 1V9DA 3RHWA 4HFCA 4I50E 3ZKRA 2BZBA 1UURA 3FHNA 3AE4A 2WS3A 3D0TA 2AXDS 1KFYA 4YTMA 5F3JA 2WDRA 2X9WA 2XQ7A 2WDQA 3LSVA 4KMCA 4YTNA 3FB2A 5FL1A 5TAOA 2L3LA 2LSJA 3LK3B 4ANJA 4DO0A 5L3DB 4TWDA 4CQIA 4LMKA 2ODUA 2J4GA 5JREA 3EDVA 4C90A 2JPFA 5LB7B 2X66A 5AQTB 2VK9A 5JDNA 2BG9C 5LP6E 3JC6C 2FJAA 3ANWB 4O4HE 1I94T 1D0YA 4HWCA 1MMAA 3UU6A 3NVOA 5KMGP 3BQLA 2UXBT 1H7CA 3K3QC 2JQHA 5C2TA 4AQFC 5FYMA 3PU3A 4IE4A 3JCFA 2LSIA 2E9XA 3WAKA 5AQLB 4O4IE 3UU4A 4ZI7E 5CA0E 5AQGB 5IYZE 5LG3A 3C51A 2CXFA 3AAEB 3UFGA 1IZNB 4U31A 1XZYA 4UV9B 4HFHA 1IJ5A 4EYUA 4WNKA 3G06A 2BDEA 2K9AA 3KVAA 5DJQC 4YSYA 1ZOYA 2XUEA 4IDQA 4TWHA 4PJNA 4OHFA 2JQ9A 3ZSSA 2PTFA 4ISSA 3RC3A 4NXMT 2BS2A 3ONJA 4AIUA 2G0UA 1L0VA 3J9X1 2ES0A 2J47A 2KSRA 4XBFB 5AQSB 5JDLA 2KZ7B 3AB3B 4DVDA 4IDZA 1VCSA 2YDQA 1OXZA 4DNDA 4ZS3A 4Z90A 1B7TA 2KLQA 3OBVE 5FY7A 5FMNA 4I0UA 3V5UA 5JR9A 5JVDE 2WCAA 4COFA 2ODVA 1KNPA 3AE7A 4LF5T 2W4XA 2V6YB 3OYZA 2CHNA 4L9IA 4O4LE 4JYAT 2LSGA 3C50A 4U7IA 1FIOA 2XQ8A 4O4JE 3F2EA 4IL9A 2NTXA 3L39A 3TLSA 4HEAA 1XDPA 4IREA 3FZFB 4BAYB 2UUCT 4EB6E 3ZMUB 5C8YE 4IE7A 3VKHA 5ABFB 2BKNA 3ANWA 5EZYE 3AE5A 4GYRA 3SFDA 3RQUA 3N9LA 2NR4A 3QUJA 5JDFA 2IC9A 4U3CA 3PUSA 5FY0A 3SS1A 3FBZA 3AE8A 2MOZA 3Q9DA 4WBOA 1D0XA 1YXRA 2K3WA 4U2YA 1E7PA 1O3XA 1XMQT 3IA3A 5JDHA 5FP3A 4ZS2A 4KP3C 2DWGA 3I1AA 2QGSA 4KUMB 1BR2A 4X1YE 2WBLA 5LMUT 1X79A 3CK6A 5EK3A 2MYSA 5AQRB 4IDOA 4A56A 3NBXX 4JI3T 5FNVE 1CUNA 4V1Av 4X5TA 3UU8A 2QYWA 4ISTA 5CGMA 1U5PA 4P0AA 4ZI2C 2V5DA 4UR9A 2UXXB 3KBUA 3HKDE 2J1DG 4PFOA 2MAWA 2WMNA 3ZMVB 4LFCT 2X9XA 3CX6B 4KX6A 1QSDA 3T8OA 4DBRA 2DI4A 2WB5A 3VU7H 4X1KE 2JRKA 3GA8A 4JI8T 5AQIB 5AQJB 4CI2B 3ONXA 4B3TT 2Q9QC 4P09A 3CX7B 1DU2A 2WSSV 3WAJA 4AQYT 2ZM8A 5LJMA 3ZYLA 4PAGA 2E9XC 3FZMB 2ACXA 2MPKA 4I43B 1UCUA 3AEEA 5HYAA 4LMLA 3NRXA 4AKRB 2BG9A 2NW9A 1YKHB 3LBXB 2QVAA 3UQ7A 3ZJ2A 2VQFT 4DV3T 5KDMC 5DABA 2LSYA 5CA1E 1NENA 3S4UA 5L4EA 3C4ZA 4AQFA 3ZYKA 3CQXC 3N2KE 4AKIA 2VL8A 3H3AA 2LE8A 5J2TE 3PUQA 3AXJB 4H9OC 1QLBA 3OJAA 2V5CA 5FVKA 2VKOA 1ZEEA 5FY1A 5HAXA 2WZIA 3Q5XA 2BG9E 4HFIA 1KNRA 5EK2A 3C64A 4ZEYA 3SRZA 5H6RB 2EHOC 4QX8B 3AE3A 2A72A 3I9YA 1UUSA 3MJXA 2XQ4A 3KV9A 2HHHT 2X0YA 2D0TA 2HN1A 3RRWA 1WRDA 4ZZCA 4XZCA 2OV9A 1I6ZA 1OWAA 2YDRA 2XQ6A 3AA6B 3FZHB 2MBGA 4IGUA 1R8IA 3OTOT 4LFAT 4TX5A 1HFAA 3JAFA 3PUWF 4YY3T 3V5SA 4X20E 2KWIB 2LLYA 3UUXB 2W62A 4GYSA 4Z91A 4UEMA 5BMVE 3AE2A 2I6HA 3ONLC 4K0UA 2HH7A 5AQPB 4ZHQE 3JC6D 1S35A 1EZ3A 2IC6A 1IBMT 2QRXA 5L3BB 3N9QA 1VRBA 3LFMA 2XAJB 4B6XA 1E1HB 4OX9T 5L47A 2XQ5A 3C4XA 4M1PA 1JNRA 3U78A 2VL0A 3DTOA 2UUAT 4QXCB 2UXNB 4YJ2E 2RP4A 3AA7B 4QKNA 3UFEA 4IE0A 3ZEFB 2IDOB 2IW5B 4AKLA 5IWAT 3LDQB 2XQYA 1MNDA 3L3PA 3HKBE 2DWKA 2M6IA 4BA9A 5C3JA 1KEYA 3ZT5A 2YKSA 4ILUA 2V7MA 5HWYA 2YU2A 2PBIA 5EK4A 3HL6A 3PDYA 2WZHA 2KXPB 4NUUA 2H3RA 3OYXA 2L9QA 1MMDA 4HGAA 3P4WA 4O8SA 2XASB 4PK4A 1J5ET 2V26A 2WDVA 1KK7A 1X9BA 4CXXA 4ILCA 4HWFA 3X1DA 2X0LB 2VWAA 3MXZA 1NEKA 3OKQA 2ZM2A 4DR2T 4DV7T 2XAQB 3OVUA 2Y8DA 2LSKA 5LA6E 3K8PC 2I0MA 1S94A 1IJ6A 3ZPOA 2XTLA 4PK6A 2FJDA 2LT3A 2V7KA 4H9RC 5CFBA 2HPLA 4UVBB 2XAGB 4JI2T 4HFBA 2OLTA 1MIYA 2VKJA 2VVSA 2DL1A 2VKDA 2WWVA 3AE9A 2C0SA 3UUMA 2H89A 2WAUA 2YK0A 3AAAB 3ETUA 2KWHA 2KT9A 2Q9QA 2CCQA 4UXNB 3GN5A 2D9DA 5JDGA 5FXVA 2XSBA 4G63A 3RF1A 1XNQT 4QX7B 4QHOA 3HR0A 1OEDB 2LOSA 4IHJE 4QH5A 3CMLA 4EV6A 5AQNB 5M4YA 1D0ZA 4HWDA 3RIAA 4DR7T 4MLKA 1YQ4A 2YU1A 1HF8A 2NOXA 4YSXA 1T72A 3AEGA 4ZXLA 4EXTA 3HI2A 1Y01A 3RYFE 3DP7A 2RPAA 4J2CA 3U3IA 2UXCT 2L8KA 1LKXA 1N36T 2WY2A 5JRCB 3RIUC 4EZHA 3IEEA 5ETWA 2ACZA 3PUYF 3VHLA 4H9SE 2XQ9A 3MK7C 4DBQA 4YSZA 3RC8A 4OFZA 1Y64B 4CZZB 4IDPA 1G8XA 4ZI2D 2EHOA 4X65T 2E8IA 2CPTA 5HXRA 3O1IA 4CN1A 3PE0A 4WW0A 3LK2B 4JBWF 1M7KA 2W61A 4AI6A 3E0ZA 3ABVA 3RYHE 1HNZT 2M67A 4B3MT 1N34T 1HTJF 4EAHA 5HEGA 3QC9A 3Q5EA 4ERRA 4H9NC 4YXDA 1XMOT 3N2GE 4DMWA 4BJNA 2Q9QD 4JEHB 2H7VC 4IDNA 2E9XD 4IIJE 4JI4T 4OYKA 2W2UA 1VCTA 3RYCE 4OK0A 4DV6T 2I59A 2LRLA 2V1DB 2DLRA 3KFWX 3N9NA 2VKHA 1US7B 4CXWA 4GK5E 2LM9A 2SPCA 5IHYA 3BQKA 4EZ4A 2XM2A 3R6NA 1XDOA 2P9BA 5HCMA 2XY8B 4E7SA 2C5JA 3EABA 3RI5A 4DV0T 4ILAA 3O4XE 3N9PA 5AQQB 1J5WA 2ZMAA 3P4SA 5LOVE 4ZZBA 2A2FX 4DR6T 2W66A 2E5VA 3UUBA 2VURA 2EHOD 4DV5T 3B13A 3RH3A 2PG8A 2XAHB 4JV5T 3KDSE 2NP9A 3I9WA 2V8SV 3PJAA 4DR4T 1HS7A 2H88A 2X9YA 5H6QB 4X64T 4JI5T 2AE9A 2CHOA 3VR8A 1NWMX 1XWMA 5DQWA 2V7JA 3Q5WA 3KV5A 1WR0A 1MNEA 4EGWA 1YD8G 2CLYB 4TN7B 4IE5A 1ZHCA 2XM1A 3EVYA 2BVLA 3A5XA 2WU2A 4DV4T 2DCFA 2V6YA 4Z8XA 3RLFF 3H3MA 3RYIE 1MIWA 1T98A 3EI0A 4IT4A 4GKKT 2LM2A 5JH7E 4K0KT 1HNXT 3AEBA 2CRBA 2WWUA 2F4VT 4U74A 3T1HT 4JLEA 1UX4A 1YKEB 3RKOA 2VQET 4UF0B 5ABFA 4KHPT 5J0ZA 1N32T 5LYJE 4H63V 4L0RA 2BKOA 3I0QA 5ABHA 3BQIA 2CXDA 3RQWA 2LOPA 3B57A 2B76A 3JAEA 3Q2MA 5CJ5A 3GWHA 2NW8A 2C5KT 1E2AA 4DV2T 3M65A 4PJMA 3ZSTA 4NXNT 1T8BA 3RGLA 5HCJA 3VRBA 3I0OA 3PUXF 5AFUL 1GQEA 5A1LA 1KF6A 5HXEA 2WQYA 3Q5DA 4JEUB 3EUHA 3AECA 2VASA 5AQHB 3KV4A 3O1JA 3KINB 3PTRB 1XNRT 3PUAA 3UUNA 4YHJA 3RIUA 4ZI3C 5F5WA 3O9XA 5LXTE 2XAFB 3TLUA 1KNZA 3P7IA 5L3EB 2E2AA 1FEWA 4HWHA 2LKGA 2KINB 4GK0E 2E5LT 4LF9T 4EIWA 4PJJA 3IBPA 3KBTA 2ZLYA 2LEHA 1UK5A 4AQGA 3N5LA 4I4TE 2A9UA 5J2UE 3NWIA 3ETVA 1HX1B 5HWXA 2W63A 4QWNB 1W0BA 5FXWA 2KNDA 5IUXA 3PUVF 2N1GA 4TWFA 5AQKB 2ZM6T 3W15B 2XSAA 3T1YT 3F57A 3AA1B 1OEDC 2QA7A 4JI7T 4DMVA 2XQAA 3LBXA 2JJ9A 2DHRA 3M3ZB 2OA5A 1WFDA 2CWYA 1LVFA 4MHCA 3AEFA 4N78D 3ZMZB 2V6XA 4DUZT 4NPPA 2MTQA 3E08A 2YEVC 3LK42 1LVKA 2X9HA 4I55E 3RX6A 4EYYR 4DV1T 4U33A 3NKZA 3UQ4A 5LBMA 3AXJA 4CN4A 3IHRA 1YQ3A 4UV8B 5LJNA 3CKDA 1WCRA 4A5XA 2YINA 3P4PA 5HXHA 2BBJA 3P8CD 1IBKT 3PV0F 1HR0T 3TKLB 2UUBT 2CMRA 4ILBA 3ZT7A 3VR9A 2CE7A 4DR3T 3B5MA 1D1CA 3EAMA 4GOUA 2YOEA 5LG4A 4QH4A 1W09A 1CHUA 2NWBA 2JIWA 3MZKB 1U4QA 2CBIA 1ZV4X 2X67A 2HN2A 3C98B 3F31A 4WBNE 3CX8B 5JR9B 2BVMA 4GKJT 3LG7A 4E7ZA 1ZKEA 4QXHB 4F8HA 5LHIB 4HWIB 1G73A 3PJAJ 3ESLA 4DR5T 1ZP0A 5L2LA
chains in the Genus database with same CATH topology
4LF8T 4B3TT 4X62T 4B3ST 4JI4T 3OTOT 1XNRT 4LFAT 4AQYT 4DV4T 4NXMT 4DR7T 4DV1T 4YY3T 4LF4T 4DUYT 4YHHT 4DV6T 2UXDT 1J5ET 4GKKT 1XMQT 4K0KT 1HNXT 1HNWT 2VQFT 4DV3T 2UXCT 1FJGT 2F4VT 3T1HT 4JI6T 1N36T 4DR2T 2E5LT 1IBKT 4DV7T 5LMUT 4LF9T 1HR0T 2UUBT 4DR1T 1IBMT 4LF7T 4DV0T 5LMNT 4JI0T 4DR3T 4LF5T 4OX9T 4X66T 2VQET 2UU9T 4KHPT 4JI3T 1I94T 1N32T 4LF6T 4JYAT 2UXBT 4JI2T 2UUAT 4X65T 4DR6T 1N33T 4DV2T 4DV5T 4JV5T 5IWAT 4NXNT 2UUCT 1HNZT 4LFCT 4DR4T 5BR8T 4B3MT 2ZM6T 1N34T 3T1YT 4GKJT 4JI7T 1XMOT 4X64T 2HHHT 4JI5T 1IBLT 4JI1T 4B3RT 4LFBT 4DR5T 4JI8T 1XNQT 4DUZT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 T;  4B3T T;  4X62 T;  4B3S T;  4JI4 T;  3OTO T;  1XNR T;  4LFA T;  4AQY T;  4DV4 T;  4NXM T;  4DR7 T;  4DV1 T;  4YY3 T;  4LF4 T;  4DUY T;  4YHH T;  4DV6 T;  2UXD T;  1J5E T;  4GKK T;  1XMQ T;  4K0K T;  1HNX T;  1HNW T;  2VQF T;  4DV3 T;  2UXC T;  1FJG T;  2F4V T;  3T1H T;  4JI6 T;  1N36 T;  4DR2 T;  2E5L T;  1IBK T;  4DV7 T;  5LMU T;  4LF9 T;  1HR0 T;  2UUB T;  4DR1 T;  1IBM T;  4LF7 T;  4DV0 T;  5LMN T;  4JI0 T;  4DR3 T;  4LF5 T;  4OX9 T;  4X66 T;  2VQE T;  2UU9 T;  4KHP T;  4JI3 T;  1I94 T;  1N32 T;  4LF6 T;  4JYA T;  2UXB T;  4JI2 T;  2UUA T;  4X65 T;  4DR6 T;  1N33 T;  4DV2 T;  4DV5 T;  4JV5 T;  5IWA T;  4NXN T;  2UUC T;  1HNZ T;  4LFC T;  4DR4 T;  5BR8 T;  4B3M T;  2ZM6 T;  1N34 T;  3T1Y T;  4GKJ T;  4JI7 T;  1XMO T;  4X64 T;  2HHH T;  4JI5 T;  1IBL T;  4JI1 T;  4B3R T;  4LFB T;  4DR5 T;  4JI8 T;  1XNQ T;  4DUZ T; 
#chains in the Genus database with same CATH topology
 3LJC A;  5ABG A;  2LHN A;  4O2A E;  5CB4 E;  4KBM B;  4AIS A;  3FZK B;  3ZN0 B;  3QK6 A;  2WP9 A;  4UVC B;  4IL4 A;  2D0U A;  4YHH T;  2CEA A;  2J62 A;  5J1G A;  1UGO A;  2M6B A;  4C91 A;  4TUY E;  4TNV A;  3ZYM A;  2DNX A;  4FI5 A;  2CA5 A;  4A97 A;  5KXJ A;  2ZM0 A;  2X51 A;  4G2A A;  4HKA A;  3AE1 A;  1MMN A;  1Z0P A;  4HFV A;  4YTP A;  2CM0 A;  3L09 A;  3A8Y C;  2LHR A;  2WMO A;  2B1E A;  5HEO A;  4UVA B;  3MKD A;  2FBW A;  3CVR A;  4X1I E;  5L4H A;  2BS4 A;  4ZOL E;  1D1A A;  1D1B A;  5FVL A;  1FMW A;  5BR8 T;  3NRY A;  3EHZ A;  4TV9 E;  4ADZ A;  1YW0 A;  2CLY C;  2XQ3 A;  3E22 E;  4CXY A;  4PJL A;  2C5I T;  3UTK A;  2CWO A;  2LJL A;  1MIV A;  4B3S T;  3CWZ B;  2LKH A;  2JQK A;  4A98 A;  3KVB A;  2H7O A;  4HTE A;  1HCI A;  1BR1 A;  5AQO B;  2UXD T;  2CBJ A;  2HPJ A;  2JMK A;  3TLV A;  4WZX A;  2Y48 B;  2BS3 A;  4YFS A;  3C4W A;  2WM9 A;  2W67 A;  1NAF A;  3P4Q A;  3SFE A;  4F6R C;  2Z6E A;  4HN9 A;  2IAK A;  2JQQ A;  2K48 A;  5JQG E;  4JUY A;  4FJO A;  2LRK A;  3P50 A;  3QNU A;  5FL0 A;  5L3G B;  1WLX A;  4BJM A;  3ZC1 A;  2BG9 B;  1HG5 A;  3NZQ A;  4QXB B;  4PNI A;  2WU5 A;  5HEJ A;  1OED A;  1N33 T;  4TV8 E;  5LHG B;  2A3D A;  3FXE B;  4H9P C;  4KI0 F;  5L3C B;  1WR6 A;  4XAX B;  1T7S A;  4QH1 A;  4CI3 B;  1JNZ A;  3UU3 A;  2X0H A;  4ASK A;  4L5G A;  4UIG A;  2NW7 A;  3ZCI A;  5JRC A;  1AJ3 A;  3TLW A;  5LGU B;  5HXS A;  1FMV A;  2K5B B;  2YN6 A;  4ZI3 D;  1OED E;  1UX5 A;  2D2S A;  1W9R A;  3EDU A;  4U2Z A;  4EED A;  4DUY T;  4TZ4 C;  2VVN A;  2V7L A;  2FUP A;  3QOF A;  3UT5 E;  2XJ7 A;  4TNW A;  1HNW T;  3HKC E;  3CPZ A;  1M62 A;  3AAI A;  3JAD A;  4U72 A;  5KX5 E;  3HKE E;  4IE6 A;  4JI0 T;  4NIQ A;  4UEL A;  5LCY A;  4LF6 T;  4Q25 A;  3K3O A;  5ADX L;  3PUG A;  3N9M A;  5FXX A;  2XZE A;  3NZP A;  1LRZ A;  2IUB A;  4AKH A;  3ZN1 B;  1WYB A;  1WYC A;  3TLT A;  3UU5 A;  3N9O A;  4LMJ A;  4HE8 A;  3SOL A;  3AA0 B;  1BR4 A;  5HXC A;  3QB5 K;  2BKP A;  3VRA A;  3RRC A;  4X62 T;  2XPK A;  3QB5 A;  3VKG A;  3PUZ F;  3FXD B;  4LF4 T;  4YLH A;  1QUU A;  3AE6 A;  2W0G A;  3OPC A;  4GIW A;  3SWH A;  2W00 A;  2KMF A;  4H9Q C;  4MFR A;  5ABE A;  3UUL A;  4DID B;  4AKG A;  2FJE A;  4YT0 A;  1VOM A;  4JI6 T;  3FBL A;  3RIF A;  2D5U A;  2XHE B;  4DR1 T;  3FZL B;  4LF7 T;  2GK9 A;  3MA9 A;  5LMN T;  2IIU A;  1HG2 A;  2UU9 T;  3ZC0 A;  1SHZ C;  3RPU A;  5LHH B;  4AXP A;  3H37 A;  2YDS A;  3CIR A;  3K3N A;  2PJQ A;  5JR9 C;  4EOZ B;  2X68 A;  1J1J A;  5GON E;  3RKG A;  3CQG B;  3R84 B;  3BK9 A;  2IML A;  3ZMT B;  4MBQ A;  3KV6 A;  5HEH A;  2R6G F;  5FKY A;  3WI3 A;  4JI1 T;  4B3R T;  3PUR A;  3A7M A;  2N2N A;  4WYV A;  4LF8 T;  4PW8 A;  3PU8 A;  3P4R A;  3ZMS B;  5AQM B;  5E0O A;  3AVR A;  1SA0 E;  4UF0 A;  4HFE A;  2JMH A;  1Z8U A;  4P1N A;  1MMG A;  4NUV A;  2Q9Q B;  4U7Y A;  3DJB A;  3AVS A;  2CXL A;  3GN5 B;  4HFD A;  2E9X B;  3MAC A;  5AQV B;  3GMI A;  4O2B E;  3CQC B;  1FJG T;  2IHR 1;  1SE7 A;  3HA4 A;  1BR0 A;  3AED A;  5JDM A;  2FJB A;  4OYJ A;  3ZLI A;  3J7Y q;  5AQF B;  5HEU A;  4X66 T;  4PFP A;  3L8R A;  2VB6 A;  5LGN B;  2V7I A;  2NTY A;  5AQU B;  3ZT6 A;  4CI1 B;  4KHZ F;  5DQV A;  3K1S A;  2Y6X A;  2BBH A;  3ZCJ A;  5JTG A;  2PFV A;  5FXZ A;  3O1H A;  4H63 H;  1W0A A;  3IF8 B;  2RA1 A;  5F8P A;  5L3F B;  4P0B A;  5LNK A;  1SUM B;  1HX8 A;  2K24 A;  4CN6 A;  3N2O A;  5LGT B;  4PK5 A;  5JDQ A;  4MAL A;  3AEA A;  5LBQ B;  1IAP A;  4EEB A;  2N9D A;  4YJ3 E;  3ZJ1 A;  1IBL T;  4LFB T;  2EHO B;  1V9D A;  3RHW A;  4HFC A;  4I50 E;  3ZKR A;  2BZB A;  1UUR A;  3FHN A;  3AE4 A;  2WS3 A;  3D0T A;  2AXD S;  1KFY A;  4YTM A;  5F3J A;  2WDR A;  2X9W A;  2XQ7 A;  2WDQ A;  3LSV A;  4KMC A;  4YTN A;  3FB2 A;  5FL1 A;  5TAO A;  2L3L A;  2LSJ A;  3LK3 B;  4ANJ A;  4DO0 A;  5L3D B;  4TWD A;  4CQI A;  4LMK A;  2ODU A;  2J4G A;  5JRE A;  3EDV A;  4C90 A;  2JPF A;  5LB7 B;  2X66 A;  5AQT B;  2VK9 A;  5JDN A;  2BG9 C;  5LP6 E;  3JC6 C;  2FJA A;  3ANW B;  4O4H E;  1I94 T;  1D0Y A;  4HWC A;  1MMA A;  3UU6 A;  3NVO A;  5KMG P;  3BQL A;  2UXB T;  1H7C A;  3K3Q C;  2JQH A;  5C2T A;  4AQF C;  5FYM A;  3PU3 A;  4IE4 A;  3JCF A;  2LSI A;  2E9X A;  3WAK A;  5AQL B;  4O4I E;  3UU4 A;  4ZI7 E;  5CA0 E;  5AQG B;  5IYZ E;  5LG3 A;  3C51 A;  2CXF A;  3AAE B;  3UFG A;  1IZN B;  4U31 A;  1XZY A;  4UV9 B;  4HFH A;  1IJ5 A;  4EYU A;  4WNK A;  3G06 A;  2BDE A;  2K9A A;  3KVA A;  5DJQ C;  4YSY A;  1ZOY A;  2XUE A;  4IDQ A;  4TWH A;  4PJN A;  4OHF A;  2JQ9 A;  3ZSS A;  2PTF A;  4ISS A;  3RC3 A;  4NXM T;  2BS2 A;  3ONJ A;  4AIU A;  2G0U A;  1L0V A;  3J9X 1;  2ES0 A;  2J47 A;  2KSR A;  4XBF B;  5AQS B;  5JDL A;  2KZ7 B;  3AB3 B;  4DVD A;  4IDZ A;  1VCS A;  2YDQ A;  1OXZ A;  4DND A;  4ZS3 A;  4Z90 A;  1B7T A;  2KLQ A;  3OBV E;  5FY7 A;  5FMN A;  4I0U A;  3V5U A;  5JR9 A;  5JVD E;  2WCA A;  4COF A;  2ODV A;  1KNP A;  3AE7 A;  4LF5 T;  2W4X A;  2V6Y B;  3OYZ A;  2CHN A;  4L9I A;  4O4L E;  4JYA T;  2LSG A;  3C50 A;  4U7I A;  1FIO A;  2XQ8 A;  4O4J E;  3F2E A;  4IL9 A;  2NTX A;  3L39 A;  3TLS A;  4HEA A;  1XDP A;  4IRE A;  3FZF B;  4BAY B;  2UUC T;  4EB6 E;  3ZMU B;  5C8Y E;  4IE7 A;  3VKH A;  5ABF B;  2BKN A;  3ANW A;  5EZY E;  3AE5 A;  4GYR A;  3SFD A;  3RQU A;  3N9L A;  2NR4 A;  3QUJ A;  5JDF A;  2IC9 A;  4U3C A;  3PUS A;  5FY0 A;  3SS1 A;  3FBZ A;  3AE8 A;  2MOZ A;  3Q9D A;  4WBO A;  1D0X A;  1YXR A;  2K3W A;  4U2Y A;  1E7P A;  1O3X A;  1XMQ T;  3IA3 A;  5JDH A;  5FP3 A;  4ZS2 A;  4KP3 C;  2DWG A;  3I1A A;  2QGS A;  4KUM B;  1BR2 A;  4X1Y E;  2WBL A;  5LMU T;  1X79 A;  3CK6 A;  5EK3 A;  2MYS A;  5AQR B;  4IDO A;  4A56 A;  3NBX X;  4JI3 T;  5FNV E;  1CUN A;  4V1A v;  4X5T A;  3UU8 A;  2QYW A;  4IST A;  5CGM A;  1U5P A;  4P0A A;  4ZI2 C;  2V5D A;  4UR9 A;  2UXX B;  3KBU A;  3HKD E;  2J1D G;  4PFO A;  2MAW A;  2WMN A;  3ZMV B;  4LFC T;  2X9X A;  3CX6 B;  4KX6 A;  1QSD A;  3T8O A;  4DBR A;  2DI4 A;  2WB5 A;  3VU7 H;  4X1K E;  2JRK A;  3GA8 A;  4JI8 T;  5AQI B;  5AQJ B;  4CI2 B;  3ONX A;  4B3T T;  2Q9Q C;  4P09 A;  3CX7 B;  1DU2 A;  2WSS V;  3WAJ A;  4AQY T;  2ZM8 A;  5LJM A;  3ZYL A;  4PAG A;  2E9X C;  3FZM B;  2ACX A;  2MPK A;  4I43 B;  1UCU A;  3AEE A;  5HYA A;  4LML A;  3NRX A;  4AKR B;  2BG9 A;  2NW9 A;  1YKH B;  3LBX B;  2QVA A;  3UQ7 A;  3ZJ2 A;  2VQF T;  4DV3 T;  5KDM C;  5DAB A;  2LSY A;  5CA1 E;  1NEN A;  3S4U A;  5L4E A;  3C4Z A;  4AQF A;  3ZYK A;  3CQX C;  3N2K E;  4AKI A;  2VL8 A;  3H3A A;  2LE8 A;  5J2T E;  3PUQ A;  3AXJ B;  4H9O C;  1QLB A;  3OJA A;  2V5C A;  5FVK A;  2VKO A;  1ZEE A;  5FY1 A;  5HAX A;  2WZI A;  3Q5X A;  2BG9 E;  4HFI A;  1KNR A;  5EK2 A;  3C64 A;  4ZEY A;  3SRZ A;  5H6R B;  2EHO C;  4QX8 B;  3AE3 A;  2A72 A;  3I9Y A;  1UUS A;  3MJX A;  2XQ4 A;  3KV9 A;  2HHH T;  2X0Y A;  2D0T A;  2HN1 A;  3RRW A;  1WRD A;  4ZZC A;  4XZC A;  2OV9 A;  1I6Z A;  1OWA A;  2YDR A;  2XQ6 A;  3AA6 B;  3FZH B;  2MBG A;  4IGU A;  1R8I A;  3OTO T;  4LFA T;  4TX5 A;  1HFA A;  3JAF A;  3PUW F;  4YY3 T;  3V5S A;  4X20 E;  2KWI B;  2LLY A;  3UUX B;  2W62 A;  4GYS A;  4Z91 A;  4UEM A;  5BMV E;  3AE2 A;  2I6H A;  3ONL C;  4K0U A;  2HH7 A;  5AQP B;  4ZHQ E;  3JC6 D;  1S35 A;  1EZ3 A;  2IC6 A;  1IBM T;  2QRX A;  5L3B B;  3N9Q A;  1VRB A;  3LFM A;  2XAJ B;  4B6X A;  1E1H B;  4OX9 T;  5L47 A;  2XQ5 A;  3C4X A;  4M1P A;  1JNR A;  3U78 A;  2VL0 A;  3DTO A;  2UUA T;  4QXC B;  2UXN B;  4YJ2 E;  2RP4 A;  3AA7 B;  4QKN A;  3UFE A;  4IE0 A;  3ZEF B;  2IDO B;  2IW5 B;  4AKL A;  5IWA T;  3LDQ B;  2XQY A;  1MND A;  3L3P A;  3HKB E;  2DWK A;  2M6I A;  4BA9 A;  5C3J A;  1KEY A;  3ZT5 A;  2YKS A;  4ILU A;  2V7M A;  5HWY A;  2YU2 A;  2PBI A;  5EK4 A;  3HL6 A;  3PDY A;  2WZH A;  2KXP B;  4NUU A;  2H3R A;  3OYX A;  2L9Q A;  1MMD A;  4HGA A;  3P4W A;  4O8S A;  2XAS B;  4PK4 A;  1J5E T;  2V26 A;  2WDV A;  1KK7 A;  1X9B A;  4CXX A;  4ILC A;  4HWF A;  3X1D A;  2X0L B;  2VWA A;  3MXZ A;  1NEK A;  3OKQ A;  2ZM2 A;  4DR2 T;  4DV7 T;  2XAQ B;  3OVU A;  2Y8D A;  2LSK A;  5LA6 E;  3K8P C;  2I0M A;  1S94 A;  1IJ6 A;  3ZPO A;  2XTL A;  4PK6 A;  2FJD A;  2LT3 A;  2V7K A;  4H9R C;  5CFB A;  2HPL A;  4UVB B;  2XAG B;  4JI2 T;  4HFB A;  2OLT A;  1MIY A;  2VKJ A;  2VVS A;  2DL1 A;  2VKD A;  2WWV A;  3AE9 A;  2C0S A;  3UUM A;  2H89 A;  2WAU A;  2YK0 A;  3AAA B;  3ETU A;  2KWH A;  2KT9 A;  2Q9Q A;  2CCQ A;  4UXN B;  3GN5 A;  2D9D A;  5JDG A;  5FXV A;  2XSB A;  4G63 A;  3RF1 A;  1XNQ T;  4QX7 B;  4QHO A;  3HR0 A;  1OED B;  2LOS A;  4IHJ E;  4QH5 A;  3CML A;  4EV6 A;  5AQN B;  5M4Y A;  1D0Z A;  4HWD A;  3RIA A;  4DR7 T;  4MLK A;  1YQ4 A;  2YU1 A;  1HF8 A;  2NOX A;  4YSX A;  1T72 A;  3AEG A;  4ZXL A;  4EXT A;  3HI2 A;  1Y01 A;  3RYF E;  3DP7 A;  2RPA A;  4J2C A;  3U3I A;  2UXC T;  2L8K A;  1LKX A;  1N36 T;  2WY2 A;  5JRC B;  3RIU C;  4EZH A;  3IEE A;  5ETW A;  2ACZ A;  3PUY F;  3VHL A;  4H9S E;  2XQ9 A;  3MK7 C;  4DBQ A;  4YSZ A;  3RC8 A;  4OFZ A;  1Y64 B;  4CZZ B;  4IDP A;  1G8X A;  4ZI2 D;  2EHO A;  4X65 T;  2E8I A;  2CPT A;  5HXR A;  3O1I A;  4CN1 A;  3PE0 A;  4WW0 A;  3LK2 B;  4JBW F;  1M7K A;  2W61 A;  4AI6 A;  3E0Z A;  3ABV A;  3RYH E;  1HNZ T;  2M67 A;  4B3M T;  1N34 T;  1HTJ F;  4EAH A;  5HEG A;  3QC9 A;  3Q5E A;  4ERR A;  4H9N C;  4YXD A;  1XMO T;  3N2G E;  4DMW A;  4BJN A;  2Q9Q D;  4JEH B;  2H7V C;  4IDN A;  2E9X D;  4IIJ E;  4JI4 T;  4OYK A;  2W2U A;  1VCT A;  3RYC E;  4OK0 A;  4DV6 T;  2I59 A;  2LRL A;  2V1D B;  2DLR A;  3KFW X;  3N9N A;  2VKH A;  1US7 B;  4CXW A;  4GK5 E;  2LM9 A;  2SPC A;  5IHY A;  3BQK A;  4EZ4 A;  2XM2 A;  3R6N A;  1XDO A;  2P9B A;  5HCM A;  2XY8 B;  4E7S A;  2C5J A;  3EAB A;  3RI5 A;  4DV0 T;  4ILA A;  3O4X E;  3N9P A;  5AQQ B;  1J5W A;  2ZMA A;  3P4S A;  5LOV E;  4ZZB A;  2A2F X;  4DR6 T;  2W66 A;  2E5V A;  3UUB A;  2VUR A;  2EHO D;  4DV5 T;  3B13 A;  3RH3 A;  2PG8 A;  2XAH B;  4JV5 T;  3KDS E;  2NP9 A;  3I9W A;  2V8S V;  3PJA A;  4DR4 T;  1HS7 A;  2H88 A;  2X9Y A;  5H6Q B;  4X64 T;  4JI5 T;  2AE9 A;  2CHO A;  3VR8 A;  1NWM X;  1XWM A;  5DQW A;  2V7J A;  3Q5W A;  3KV5 A;  1WR0 A;  1MNE A;  4EGW A;  1YD8 G;  2CLY B;  4TN7 B;  4IE5 A;  1ZHC A;  2XM1 A;  3EVY A;  2BVL A;  3A5X A;  2WU2 A;  4DV4 T;  2DCF A;  2V6Y A;  4Z8X A;  3RLF F;  3H3M A;  3RYI E;  1MIW A;  1T98 A;  3EI0 A;  4IT4 A;  4GKK T;  2LM2 A;  5JH7 E;  4K0K T;  1HNX T;  3AEB A;  2CRB A;  2WWU A;  2F4V T;  4U74 A;  3T1H T;  4JLE A;  1UX4 A;  1YKE B;  3RKO A;  2VQE T;  4UF0 B;  5ABF A;  4KHP T;  5J0Z A;  1N32 T;  5LYJ E;  4H63 V;  4L0R A;  2BKO A;  3I0Q A;  5ABH A;  3BQI A;  2CXD A;  3RQW A;  2LOP A;  3B57 A;  2B76 A;  3JAE A;  3Q2M A;  5CJ5 A;  3GWH A;  2NW8 A;  2C5K T;  1E2A A;  4DV2 T;  3M65 A;  4PJM A;  3ZST A;  4NXN T;  1T8B A;  3RGL A;  5HCJ A;  3VRB A;  3I0O A;  3PUX F;  5AFU L;  1GQE A;  5A1L A;  1KF6 A;  5HXE A;  2WQY A;  3Q5D A;  4JEU B;  3EUH A;  3AEC A;  2VAS A;  5AQH B;  3KV4 A;  3O1J A;  3KIN B;  3PTR B;  1XNR T;  3PUA A;  3UUN A;  4YHJ A;  3RIU A;  4ZI3 C;  5F5W A;  3O9X A;  5LXT E;  2XAF B;  3TLU A;  1KNZ A;  3P7I A;  5L3E B;  2E2A A;  1FEW A;  4HWH A;  2LKG A;  2KIN B;  4GK0 E;  2E5L T;  4LF9 T;  4EIW A;  4PJJ A;  3IBP A;  3KBT A;  2ZLY A;  2LEH A;  1UK5 A;  4AQG A;  3N5L A;  4I4T E;  2A9U A;  5J2U E;  3NWI A;  3ETV A;  1HX1 B;  5HWX A;  2W63 A;  4QWN B;  1W0B A;  5FXW A;  2KND A;  5IUX A;  3PUV F;  2N1G A;  4TWF A;  5AQK B;  2ZM6 T;  3W15 B;  2XSA A;  3T1Y T;  3F57 A;  3AA1 B;  1OED C;  2QA7 A;  4JI7 T;  4DMV A;  2XQA A;  3LBX A;  2JJ9 A;  2DHR A;  3M3Z B;  2OA5 A;  1WFD A;  2CWY A;  1LVF A;  4MHC A;  3AEF A;  4N78 D;  3ZMZ B;  2V6X A;  4DUZ T;  4NPP A;  2MTQ A;  3E08 A;  2YEV C;  3LK4 2;  1LVK A;  2X9H A;  4I55 E;  3RX6 A;  4EYY R;  4DV1 T;  4U33 A;  3NKZ A;  3UQ4 A;  5LBM A;  3AXJ A;  4CN4 A;  3IHR A;  1YQ3 A;  4UV8 B;  5LJN A;  3CKD A;  1WCR A;  4A5X A;  2YIN A;  3P4P A;  5HXH A;  2BBJ A;  3P8C D;  1IBK T;  3PV0 F;  1HR0 T;  3TKL B;  2UUB T;  2CMR A;  4ILB A;  3ZT7 A;  3VR9 A;  2CE7 A;  4DR3 T;  3B5M A;  1D1C A;  3EAM A;  4GOU A;  2YOE A;  5LG4 A;  4QH4 A;  1W09 A;  1CHU A;  2NWB A;  2JIW A;  3MZK B;  1U4Q A;  2CBI A;  1ZV4 X;  2X67 A;  2HN2 A;  3C98 B;  3F31 A;  4WBN E;  3CX8 B;  5JR9 B;  2BVM A;  4GKJ T;  3LG7 A;  4E7Z A;  1ZKE A;  4QXH B;  4F8H A;  5LHI B;  4HWI B;  1G73 A;  3PJA J;  3ESL A;  4DR5 T;  1ZP0 A;  5L2L A; 
#chains in the Genus database with same CATH homology
 4LF8 T;  4B3T T;  4X62 T;  4B3S T;  4JI4 T;  3OTO T;  1XNR T;  4LFA T;  4AQY T;  4DV4 T;  4NXM T;  4DR7 T;  4DV1 T;  4YY3 T;  4LF4 T;  4DUY T;  4YHH T;  4DV6 T;  2UXD T;  1J5E T;  4GKK T;  1XMQ T;  4K0K T;  1HNX T;  1HNW T;  2VQF T;  4DV3 T;  2UXC T;  1FJG T;  2F4V T;  3T1H T;  4JI6 T;  1N36 T;  4DR2 T;  2E5L T;  1IBK T;  4DV7 T;  5LMU T;  4LF9 T;  1HR0 T;  2UUB T;  4DR1 T;  1IBM T;  4LF7 T;  4DV0 T;  5LMN T;  4JI0 T;  4DR3 T;  4LF5 T;  4OX9 T;  4X66 T;  2VQE T;  2UU9 T;  4KHP T;  4JI3 T;  1I94 T;  1N32 T;  4LF6 T;  4JYA T;  2UXB T;  4JI2 T;  2UUA T;  4X65 T;  4DR6 T;  1N33 T;  4DV2 T;  4DV5 T;  4JV5 T;  5IWA T;  4NXN T;  2UUC T;  1HNZ T;  4LFC T;  4DR4 T;  5BR8 T;  4B3M T;  2ZM6 T;  1N34 T;  3T1Y T;  4GKJ T;  4JI7 T;  1XMO T;  4X64 T;  2HHH T;  4JI5 T;  1IBL T;  4JI1 T;  4B3R T;  4LFB T;  4DR5 T;  4JI8 T;  1XNQ T;  4DUZ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...