4DV7T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv7T00
4LF4T 4X62T 4B3ST 1HR0T 5LMNT 4NXMT 4JI2T 5IWAT 4JV5T 4NXNT 1HNXT 2ZM6T 2UXCT 4DV0T 1XNQT 2VQET 1HNWT 4K0KT 2HHHT 4LF8T 4DR4T 2UUCT 4YY3T 4DR6T 4YHHT 1N36T 1XNRT 4DV5T 1J5ET 4GKKT 4B3RT 4DUYT 4LFAT 4B3TT 3OTOT 2UUBT 2UXBT 4LFCT 4JI7T 4X65T 4B3MT 4LF9T 4DV3T 1FJGT 4DV2T 4X64T 1N34T 4X66T 4DR1T 3T1HT 1IBLT 4OX9T 1N32T 1HNZT 3T1YT 5BR8T 1I94T 4AQYT 4LF6T 4LF5T 4LFBT 4DR5T 1IBMT 4JI1T 2E5LT 4DV1T 1XMQT 4JI5T 2UU9T 4DV4T 4JI6T 4GKJT 4DV7T 4DR3T 2F4VT 4DR7T 2VQFT 1IBKT 4JI8T 4LF7T 4KHPT 4DUZT 2UUAT 4DV6T 2UXDT 1N33T 4JYAT 4JI4T 4JI3T 4DR2T 4JI0T 5LMUT 1XMOT
chains in the Genus database with same CATH superfamily
4GIWA 4ANJA 2X9XA 1JNZA 2LHRA 2YU2A 1KEYA 3NKZA 5L47A 3MACA 3GN5A 1AJ3A 4HFDA 2DNXA 4HFHA 4U3CA 3PUQA 4K0KT 3NZQA 2B1EA 4HTEA 2Y48B 4U74A 3VR8A 4XAXB 3S4UA 1XZYA 1D1AA 4YHHT 1N36T 1G73A 4IE7A 2QVAA 5C2TA 3RYFE 5EK3A 4H63H 3PUAA 4YSXA 3AEGA 5AQFB 4CN4A 4TUYE 1W09A 2V8SV 2W4XA 1N32T 3IBPA 4CXXA 4ZS2A 4ZHQE 3PV0F 3AXJB 5DQVA 2XSBA 2UU9T 4AI6A 1MIVA 1MIYA 1Y64B 3LK3B 4DR3T 1W0BA 4IDQA 4AKRB 3AE6A 1ZKEA 3P4QA 3O1IA 2X0LB 3R6NA 4ISSA 2K9AA 2LE8A 1SUMB 4DIDB 4QH4A 1LKXA 1ZOYA 2M6IA 3PJAA 3O1HA 2LRKA 5JTGA 4EGWA 2WZHA 5AQJB 3O9XA 1IZNB 4I55E 3HA4A 4HFCA 3O4XE 1UX5A 3C4WA 1SHZC 2ODUA 1NWMX 4PW8A 2WBLA 3VU7H 3TKLB 4HWDA 5AQTB 1XDPA 5LG4A 3C50A 2LM9A 2WDRA 3H3MA 4LFAT 3RX6A 4EEDA 5JR9C 4ZXLA 3KV9A 4I4TE 3P4PA 4OX9T 4IE6A 3AAIA 4P0AA 4O2AE 4TZ4C 4XZCA 3W15B 3RI5A 3JAEA 4UVAB 4LF6T 4CI1B 5FL1A 4CQIA 3SFEA 1LRZA 3ONLC 1XMQT 1YKHB 3AE2A 3E22E 1CUNA 5CFBA 2D0TA 3ZJ1A 4OYKA 4ZI2C 1MMDA 3RC8A 5L3BB 3R84B 3MK7C 4COFA 4DUZT 3N9OA 2UUAT 4DMVA 2RPAA 2UXDT 5LCYA 3QUJA 3KVAA 2C5IT 4EOZB 3HKEE 1KNZA 2ZLYA 3LK42 3EVYA 3K3NA 3ETUA 2NOXA 2ZM6T 4AISA 2UXCT 3UU3A 4EAHA 4U2YA 2XHEB 3QK6A 1ZHCA 1WR0A 2VKHA 4EYYR 2WP9A 3UU5A 5IUXA 2XY8B 1BR2A 1QUUA 3JCFA 4C90A 2XAHB 5LXTE 2NP9A 1BR1A 4YLHA 2V6YA 4A5XA 4YXDA 4L5GA 1Y01A 4YJ3E 4X64T 2YK0A 3PE0A 1OEDA 3RYHE 2C5KT 4H9SE 5LJMA 2ZM8A 3K3QC 2J4GA 5IHYA 4DV4T 2E2AA 4HEAA 5E0OA 4EEBA 1W9RA 4LMJA 2CBJA 5F5WA 5EK2A 5FXXA 2BKNA 2V6XA 1WR6A 3FZHB 3JC6C 1Z8UA 2CA5A 3LK2B 2IW5B 2CE7A 4CN6A 1B7TA 4PNIA 2W0GA 4IL9A 2IIUA 5HCMA 4UIGA 4YJ2E 2IUBA 3AB3B 3AE3A 2WMOA 3N9PA 4O4LE 1KNPA 2K5BB 2VQET 4ZI7E 4O8SA 4LMLA 3FXEB 2X51A 3L39A 2QGSA 4LF8T 2N1GA 3QOFA 4G63A 3Q2MA 3ZMSB 2M67A 5FXZA 4P1NA 1XWMA 2CPTA 4EIWA 2Y6XA 3RF1A 3RIAA 4LFCT 3ZJ2A 5FL0A 5HXEA 3D0TA 2WAUA 5DJQC 3CX8B 5KXJA 2QYWA 4O2BE 5FY0A 2W00A 4X66T 4GOUA 4YTMA 2XQ8A 2WSSV 3N2OA 2LOPA 3RIUC 2KLQA 4YSZA 4CXYA 3K3OA 2N2NA 4IE0A 1IBMT 3U3IA 3N2KE 3Q5XA 2VASA 4P09A 5L3DB 2ODVA 5JDFA 4TV8E 3KV5A 3SFDA 3I0QA 5H6RB 3OYXA 4ZI3D 4TWHA 5LNKA 3RQWA 4MFRA 1M7KA 2K48A 5FVKA 3U78A 2KINB 4IE4A 2XM2A 4X1IE 4OYJA 3EAMA 3BK9A 3CX6B 2BS3A 1E2AA 3RLFF 5C3JA 4X1YE 2ZM0A 3UUNA 5KX5E 2WDVA 3N9NA 3PUXF 3QNUA 1VRBA 3KV4A 2H89A 1HCIA 3DJBA 4A56A 3RIUA 4TN7B 2XAGB 4ILBA 4NPPA 1J5WA 4Q25A 2BKPA 5JDNA 1MMNA 2OV9A 2XM1A 4NIQA 3PTRB 2XJ7A 3CMLA 5KMGP 4PJMA 4DMWA 2WDQA 5L4HA 4B3RT 4DUYT 4JUYA 3WAKA 1D0ZA 5FP3A 2B76A 4X65T 4H9QC 2G0UA 4KHZF 5HXSA 2IDOB 5F8PA 4JEHB 3V5SA 1I6ZA 1YD8G 4TNWA 5AQGB 2V5DA 4CN1A 1I94T 1V9DA 1LVKA 3M3ZB 2VL8A 4MLKA 4BJMA 2W67A 2VVNA 5LBQB 4DV7T 1M62A 4HFVA 2GK9A 1IBKT 2HN1A 3N9MA 3AE5A 5AQUB 2OA5A 3VHLA 2H88A 3FZFB 1E1HB 5LG3A 2KSRA 2NW7A 1KF6A 4ILUA 2VVSA 4JI3T 4DR2T 3ZMZB 2A72A 3MXZA 2IC9A 2JQHA 2X66A 3AE9A 3NBXX 1OEDB 5IWAT 4H9RC 2FUPA 1WLXA 1HG2A 4GYSA 2E5VA 4FI5A 5AQOB 1MMAA 3UULA 2KT9A 4DO0A 3AEAA 4H9NC 1KNRA 3V5UA 4B3TT 3NWIA 2KMFA 3PURA 4AKGA 5HWYA 4IE5A 2VB6A 3Q5WA 4DBRA 5DABA 2LRLA 5KDMC 1N34T 3KV6A 1IBLT 4J2CA 4HFIA 5BMVE 2KXPB 5M4YA 4PK4A 2HH7A 5FY7A 4HKAA 5JVDE 1YXRA 2H7VC 4PK5A 4LFBT 4QWNB 2XQ4A 2E8IA 4JI5T 2DWKA 2BG9E 2Q9QB 2V5CA 2LT3A 3K8PC 2IC6A 4KMCA 4GKJT 4A97A 3SRZA 4AXPA 2MPKA 3AECA 5JQGE 2BBJA 1D0YA 2HN2A 3OKQA 3IF8B 5LGUB 2LSYA 4I0UA 3C64A 2CHNA 2C0SA 2XAFB 4TWDA 2VK9A 2BDEA 4AKHA 2LSJA 2L3LA 3I9YA 4ADZA 1YQ4A 3KFWX 5ETWA 2LM2A 3VR9A 1J1JA 3QC9A 3GA8A 2E9XB 2WU2A 2HHHT 2V7JA 3RC3A 4KP3C 1T72A 5LB7B 3EI0A 2CXFA 4JEUB 3FXDB 4GKKT 2WB5A 5ABHA 3ZKRA 2UUBT 4IGUA 4E7SA 2DCFA 4N78D 2W66A 4LF9T 3BQIA 1SA0E 5JH7E 2N9DA 2W63A 1W0AA 2X9WA 4DR1T 2CBIA 4UELA 3C98B 2QRXA 3ZT7A 5BR8T 4GK0E 2PJQA 3CPZA 4IDPA 2FJDA 4ZI2D 1UUSA 2XQ7A 2HPLA 2BG9B 4AKIA 2V7IA 3ZEFB 3P4RA 3QB5A 2LSKA 3H37A 5AFUL 2P9BA 2CHOA 5AQRB 3CX7B 2PG8A 4JYAT 3LBXB 3UFEA 5HYAA 2XUEA 3LG7A 1JNRA 1T8BA 4EZHA 4JI4T 2JMHA 3Q5EA 2JQKA 2YEVC 3PUZF 2WMNA 3UUXB 1FMVA 1BR0A 1VOMA 2XQ9A 4ZOLE 2ES0A 3N2GE 2IMLA 4ZZCA 1D1BA 1MMGA 1OEDC 3TLUA 3I1AA 1OWAA 4IT4A 2L9QA 3PUYF 1IJ6A 1J5ET 4YSYA 4H9PC 3AVRA 5L2LA 2KWHA 3ZYLA 3L09A 4O4HE 2XSAA 3FHNA 2XPKA 3UU8A 5LOVE 4ERRA 3MZKB 5J2TE 4DV1T 1ZEEA 2QA7A 3UUMA 3ZLIA 3ZYKA 2DLRA 2AE9A 4H63V 4TNVA 4JI6T 2VKJA 4OK0A 2WM9A 4CI3B 4JI8T 4GYRA 3ZC0A 3ANWB 3H3AA 3RKGA 2W2UA 1UGOA 2Q9QC 3EDVA 4DVDA 3TLVA 2CWOA 3TLWA 3KINB 3AE8A 2YKSA 4K0UA 3I9WA 2BS2A 2YDRA 4YHJA 1FIOA 3HKBE 2V26A 2CXDA 4NXMT 3ONXA 1ZP0A 3UFGA 3ZMVB 3CKDA 4M1PA 3J9X1 2JJ9A 4X5TA 2ZM2A 4HFEA 4UV9B 2E9XC 4XBFB 3MKDA 2XQAA 2Q9QA 3HL6A 4DV3T 2IHR1 2R6GF 4KX6A 3EDUA 5HXRA 4U7YA 1OXZA 4PJLA 3CK6A 1HNZT 5FY1A 3EABA 3MA9A 4IDNA 4AQYT 4TV9E 3C4XA 3LDQB 2LLYA 1D1CA 2YN6A 2NTXA 3ESLA 2YDSA 1WCRA 3N5LA 4ASKA 4TX5A 4YTPA 2DL1A 4HWIB 4QHOA 4ZZBA 3ZC1A 2EHOD 2BS4A 1XDOA 5LA6E 2BG9C 3K1SA 4WZXA 1R8IA 2E9XA 1NAFA 4WBOA 2ACXA 4AQFC 4IIJE 1XMOT 3C4ZA 4U31A 5LHGB 3RKOA 4BA9A 2W61A 3FZLB 2PBIA 3GWHA 2MBGA 5LJNA 4ZS3A 4Z90A 2XZEA 3AA0B 5EK4A 2D9DA 3HKCE 4UVBB 2LHNA 2BKOA 4KI0F 1E7PA 4QH5A 1IAPA 4MALA 2MYSA 3DTOA 1HX8A 2UUCT 4IREA 4EZ4A 2L8KA 3RYIE 2CRBA 5L3EB 3ZMTB 5LBMA 3B5MA 4JI7T 2XQ5A 4B3MT 2ACZA 4DNDA 2BG9A 4PFOA 1HFAA 2KNDA 3T1HT 3RPUA 5JDMA 4AQFA 2ZMAA 3CVRA 2XASB 4PAGA 4WW0A 3AEFA 1HF8A 3LBXA 1L0VA 4V1Av 3T8OA 2DHRA 2NW9A 3OPCA 4EXTA 3F31A 3OYZA 2VQFT 4L9IA 2KZ7B 5J2UE 4OHFA 2LSGA 2X67A 5LHHB 2V1DB 1N33T 3ZSTA 4BAYB 1KK7A 1X9BA 5IYZE 4U2ZA 3A5XA 5ABFB 3RRCA 3ZPOA 4UEMA 4Z8XA 4X62T 2I0MA 3AA1B 3L8RA 2H7OA 4JV5T 4ILCA 3A8YC 4EYUA 2KWIB 5L4EA 5AQLB 4NUUA 5FKYA 5LHIB 3P4SA 5CGMA 3E0ZA 2SPCA 4UR9A 4HWCA 4GK5E 4JLEA 3L3PA 4U7IA 5AQSB 3AE4A 2DI4A 4Z91A 4P0BA 4PK6A 4DR6T 4DV5T 2A2FX 2HPJA 5CA0E 3UT5E 1UX4A 4WYVA 5F3JA 5L3FB 1NENA 3Q9DA 3MJXA 3J7Yq 3AEDA 3ANWA 1HX1B 4HGAA 2PFVA 5EZYE 2H3RA 2JRKA 1IJ5A 2XQ6A 3NZPA 2BVLA 1UK5A 3ZYMA 4AQGA 2RA1A 1GQEA 3NRXA 3OJAA 3VKHA 4LF7T 3RH3A 2X0HA 4KUMB 2MTQA 2I6HA 2J1DG 4F8HA 5LYJE 2A9UA 3BQLA 3CWZB 1HG5A 3ABVA 2AXDS 2J62A 2XAQB 3SS1A 3RYCE 2A3DA 5JDLA 2WY2A 1U5PA 5CA1E 4B3ST 1YW0A 3GMIA 3LFMA 4IDOA 4YFSA 1ZV4X 2VWAA 2LOSA 2K24A 4QH1A 3AA6B 2K3WA 2LJLA 2OLTA 2NWBA 1UURA 5HEJA 4MHCA 2FJEA 3P50A 2LEHA 1FJGT 4DV2T 5AQMB 2YU1A 5JDQA 4QXBB 3T1YT 2CXLA 4UVCB 4LF5T 2E5LT 4PJNA 4AKLA 3FBLA 3ZN1B 2V7MA 4QXCB 2NW8A 2YOEA 3ZCIA 1KFYA 2FJBA 5JRCB 1BR4A 4HWHA 3PU8A 3CQGB 4L0RA 3DP7A 3ZMUB 2WWUA 4OFZA 2LSIA 3UTKA 3AA7B 5L3CB 2M6BA 5HEGA 3PUGA 5LMUT 3IEEA 2BBHA 4CZZB 3FZMB 4LF4T 3X1DA 5AQPB 2CLYB 2JQ9A 4JI2T 1HS7A 1HNXT 5JDHA 2DWGA 3ZCJA 4X1KE 4DV0T 3KBTA 4C91A 5FMNA 3P8CD 2CM0A 4O4IE 3AAAB 3KVBA 4YY3T 2BVMA 4UV8B 3TLTA 5AQQB 5J0ZA 2EHOB 4QX7B 3Q5DA 2NR4A 5L3GB 4FJOA 3PJAJ 3CIRA 5A1LA 1MIWA 1YKEB 5LGTB 4F6RC 4UF0B 2JQQA 3HKDE 3SWHA 4KBMB 2D0UA 4JI1T 2FJAA 3CQXC 3ONJA 2I59A 4I50E 2X9YA 3JADA 3KBUA 3AE1A 5ABFA 2JMKA 2F4VT 1G8XA 5JR9A 2V7LA 4QKNA 2Q9QD 1VCSA 1O3XA 3LSVA 2IAKA 2W62A 2J47A 4ZEYA 2BZBA 3QB5K 2FBWA 2Z6EA 5HCJA 4AIUA 1MNEA 3E08A 3JAFA 5LGNB 3KDSE 4IL4A 3JC6D 3RIFA 2WU5A 1Z0PA 4O4JE 4NXNT 3UQ4A 2YDQA 3F2EA 4UXNB 1XNQT 1HNWT 2Y8DA 5JDGA 2XAJB 1VCTA 1T7SA 3OVUA 1MNDA 3ZN0B 5ADXL 2D5UA 4DR4T 5HXCA 2E9XD 3IHRA 2C5JA 1XNRT 2VL0A 3ZT6A 2X0YA 5ABGA 4PFPA 5C8YE 3B57A 3GN5B 2V7KA 3HI2A 4CXWA 3I0OA 5JREA 3PUSA 3ZT5A 3F57A 3AVSA 4IHJE 2JIWA 2WCAA 5AQHB 3VRAA 4MBQA 3N9LA 1WYBA 3ZSSA 3FB2A 2LKHA 4CI2B 1NEKA 5H6QB 2WS3A 4I43B 2X68A 1CHUA 3AE7A 3AEBA 4EV6A 3UU4A 5FXWA 4B6XA 3RRWA 4DV6T 2XTLA 2VKDA 1WYCA 2WWVA 1DU2A 5HWXA 4PJJA 1LVFA 3FBZA 3RQUA 2LKGA 3OBVE 3AAEB 5HAXA 2MAWA 4HWFA 1X79A 3EUHA 4JBWF 5AQKB 4WNKA 2D2SA 3WI3A 3AXJA 3RHWA 1UCUA 3WAJA 1FEWA 3RGLA 1YQ3A 1U4QA 4EB6E 2CLYC 4IDZA 4DBQA 3PU3A 3SOLA 4ISTA 1T98A 5AQNB 1HTJF 1QLBA 2UXXB 2WZIA 2UXNB 5FNVE 3O1JA 5HEHA 1EZ3A 5JRCA 1WFDA 2EHOC 4X20E 4DR5T 2CEAA 3EHZA 5FYMA 2WQYA 1D0XA 3IA3A 3HR0A 3NRYA 3P4WA 5GONE 4TWFA 4ZI3C 1OEDE 4A98A 2YINA 5FXVA 3PUVF 5AQVB 4YTNA 3BQKA 5AQIB 4ILAA 3VRBA 2RP4A 4WBNE 1FMWA 4HE8A 5ABEA 3UQ7A 1HR0T 5LMNT 2CWYA 4H9OC 2X9HA 5LP6E 4BJNA 4HN9A 2EHOA 4YT0A 3P7IA 3M65A 5JR9B 4UF0A 3PDYA 3NVOA 4QX8B 5HEUA 3N9QA 1WRDA 2PTFA 3FZKB 2CCQA 5J1GA 3OTOT 3LJCA 2UXBT 3UU6A 3C51A 5CB4E 3VKGA 4G2AA 2JPFA 2NTYA 1S94A 3PUWF 2VKOA 3B13A 5FVLA 1QSDA 5HEOA 4QXHB 5TAOA 2CMRA 2V6YB 3A7MA 4LMKA 4NUVA 3AEEA 2MOZA 4DR7T 1S35A 1US7B 4KHPT 3G06A 2VURA 3TLSA 1H7CA 5HXHA 3ETVA 5CJ5A 4U33A 3CQCB 4U72A 1SE7A 2XQ3A 3UUBA 2XQYA 4JI0T 4E7ZA 5DQWA 4HFBA
chains in the Genus database with same CATH topology
4LF4T 4X62T 4B3ST 1HR0T 5LMNT 4NXMT 4JI2T 5IWAT 4JV5T 4NXNT 1HNXT 2ZM6T 2UXCT 4DV0T 1XNQT 2VQET 1HNWT 4K0KT 2HHHT 4LF8T 4DR4T 2UUCT 4YY3T 4DR6T 4YHHT 1N36T 1XNRT 4DV5T 1J5ET 4GKKT 4B3RT 4DUYT 4LFAT 4B3TT 3OTOT 2UUBT 2UXBT 4LFCT 4JI7T 4X65T 4B3MT 4LF9T 4DV3T 1FJGT 4DV2T 4X64T 1N34T 4X66T 4DR1T 3T1HT 1IBLT 4OX9T 1N32T 1HNZT 3T1YT 5BR8T 1I94T 4AQYT 4LF6T 4LF5T 4LFBT 4DR5T 1IBMT 4JI1T 2E5LT 4DV1T 1XMQT 4JI5T 2UU9T 4DV4T 4JI6T 4GKJT 4DV7T 4DR3T 2F4VT 4DR7T 2VQFT 1IBKT 4JI8T 4LF7T 4KHPT 4DUZT 2UUAT 4DV6T 2UXDT 1N33T 4JYAT 4JI4T 4JI3T 4DR2T 4JI0T 5LMUT 1XMOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 T;  4X62 T;  4B3S T;  1HR0 T;  5LMN T;  4NXM T;  4JI2 T;  5IWA T;  4JV5 T;  4NXN T;  1HNX T;  2ZM6 T;  2UXC T;  4DV0 T;  1XNQ T;  2VQE T;  1HNW T;  4K0K T;  2HHH T;  4LF8 T;  4DR4 T;  2UUC T;  4YY3 T;  4DR6 T;  4YHH T;  1N36 T;  1XNR T;  4DV5 T;  1J5E T;  4GKK T;  4B3R T;  4DUY T;  4LFA T;  4B3T T;  3OTO T;  2UUB T;  2UXB T;  4LFC T;  4JI7 T;  4X65 T;  4B3M T;  4LF9 T;  4DV3 T;  1FJG T;  4DV2 T;  4X64 T;  1N34 T;  4X66 T;  4DR1 T;  3T1H T;  1IBL T;  4OX9 T;  1N32 T;  1HNZ T;  3T1Y T;  5BR8 T;  1I94 T;  4AQY T;  4LF6 T;  4LF5 T;  4LFB T;  4DR5 T;  1IBM T;  4JI1 T;  2E5L T;  4DV1 T;  1XMQ T;  4JI5 T;  2UU9 T;  4DV4 T;  4JI6 T;  4GKJ T;  4DV7 T;  4DR3 T;  2F4V T;  4DR7 T;  2VQF T;  1IBK T;  4JI8 T;  4LF7 T;  4KHP T;  4DUZ T;  2UUA T;  4DV6 T;  2UXD T;  1N33 T;  4JYA T;  4JI4 T;  4JI3 T;  4DR2 T;  4JI0 T;  5LMU T;  1XMO T; 
#chains in the Genus database with same CATH topology
 4GIW A;  4ANJ A;  2X9X A;  1JNZ A;  2LHR A;  2YU2 A;  1KEY A;  3NKZ A;  5L47 A;  3MAC A;  3GN5 A;  1AJ3 A;  4HFD A;  2DNX A;  4HFH A;  4U3C A;  3PUQ A;  4K0K T;  3NZQ A;  2B1E A;  4HTE A;  2Y48 B;  4U74 A;  3VR8 A;  4XAX B;  3S4U A;  1XZY A;  1D1A A;  4YHH T;  1N36 T;  1G73 A;  4IE7 A;  2QVA A;  5C2T A;  3RYF E;  5EK3 A;  4H63 H;  3PUA A;  4YSX A;  3AEG A;  5AQF B;  4CN4 A;  4TUY E;  1W09 A;  2V8S V;  2W4X A;  1N32 T;  3IBP A;  4CXX A;  4ZS2 A;  4ZHQ E;  3PV0 F;  3AXJ B;  5DQV A;  2XSB A;  2UU9 T;  4AI6 A;  1MIV A;  1MIY A;  1Y64 B;  3LK3 B;  4DR3 T;  1W0B A;  4IDQ A;  4AKR B;  3AE6 A;  1ZKE A;  3P4Q A;  3O1I A;  2X0L B;  3R6N A;  4ISS A;  2K9A A;  2LE8 A;  1SUM B;  4DID B;  4QH4 A;  1LKX A;  1ZOY A;  2M6I A;  3PJA A;  3O1H A;  2LRK A;  5JTG A;  4EGW A;  2WZH A;  5AQJ B;  3O9X A;  1IZN B;  4I55 E;  3HA4 A;  4HFC A;  3O4X E;  1UX5 A;  3C4W A;  1SHZ C;  2ODU A;  1NWM X;  4PW8 A;  2WBL A;  3VU7 H;  3TKL B;  4HWD A;  5AQT B;  1XDP A;  5LG4 A;  3C50 A;  2LM9 A;  2WDR A;  3H3M A;  4LFA T;  3RX6 A;  4EED A;  5JR9 C;  4ZXL A;  3KV9 A;  4I4T E;  3P4P A;  4OX9 T;  4IE6 A;  3AAI A;  4P0A A;  4O2A E;  4TZ4 C;  4XZC A;  3W15 B;  3RI5 A;  3JAE A;  4UVA B;  4LF6 T;  4CI1 B;  5FL1 A;  4CQI A;  3SFE A;  1LRZ A;  3ONL C;  1XMQ T;  1YKH B;  3AE2 A;  3E22 E;  1CUN A;  5CFB A;  2D0T A;  3ZJ1 A;  4OYK A;  4ZI2 C;  1MMD A;  3RC8 A;  5L3B B;  3R84 B;  3MK7 C;  4COF A;  4DUZ T;  3N9O A;  2UUA T;  4DMV A;  2RPA A;  2UXD T;  5LCY A;  3QUJ A;  3KVA A;  2C5I T;  4EOZ B;  3HKE E;  1KNZ A;  2ZLY A;  3LK4 2;  3EVY A;  3K3N A;  3ETU A;  2NOX A;  2ZM6 T;  4AIS A;  2UXC T;  3UU3 A;  4EAH A;  4U2Y A;  2XHE B;  3QK6 A;  1ZHC A;  1WR0 A;  2VKH A;  4EYY R;  2WP9 A;  3UU5 A;  5IUX A;  2XY8 B;  1BR2 A;  1QUU A;  3JCF A;  4C90 A;  2XAH B;  5LXT E;  2NP9 A;  1BR1 A;  4YLH A;  2V6Y A;  4A5X A;  4YXD A;  4L5G A;  1Y01 A;  4YJ3 E;  4X64 T;  2YK0 A;  3PE0 A;  1OED A;  3RYH E;  2C5K T;  4H9S E;  5LJM A;  2ZM8 A;  3K3Q C;  2J4G A;  5IHY A;  4DV4 T;  2E2A A;  4HEA A;  5E0O A;  4EEB A;  1W9R A;  4LMJ A;  2CBJ A;  5F5W A;  5EK2 A;  5FXX A;  2BKN A;  2V6X A;  1WR6 A;  3FZH B;  3JC6 C;  1Z8U A;  2CA5 A;  3LK2 B;  2IW5 B;  2CE7 A;  4CN6 A;  1B7T A;  4PNI A;  2W0G A;  4IL9 A;  2IIU A;  5HCM A;  4UIG A;  4YJ2 E;  2IUB A;  3AB3 B;  3AE3 A;  2WMO A;  3N9P A;  4O4L E;  1KNP A;  2K5B B;  2VQE T;  4ZI7 E;  4O8S A;  4LML A;  3FXE B;  2X51 A;  3L39 A;  2QGS A;  4LF8 T;  2N1G A;  3QOF A;  4G63 A;  3Q2M A;  3ZMS B;  2M67 A;  5FXZ A;  4P1N A;  1XWM A;  2CPT A;  4EIW A;  2Y6X A;  3RF1 A;  3RIA A;  4LFC T;  3ZJ2 A;  5FL0 A;  5HXE A;  3D0T A;  2WAU A;  5DJQ C;  3CX8 B;  5KXJ A;  2QYW A;  4O2B E;  5FY0 A;  2W00 A;  4X66 T;  4GOU A;  4YTM A;  2XQ8 A;  2WSS V;  3N2O A;  2LOP A;  3RIU C;  2KLQ A;  4YSZ A;  4CXY A;  3K3O A;  2N2N A;  4IE0 A;  1IBM T;  3U3I A;  3N2K E;  3Q5X A;  2VAS A;  4P09 A;  5L3D B;  2ODV A;  5JDF A;  4TV8 E;  3KV5 A;  3SFD A;  3I0Q A;  5H6R B;  3OYX A;  4ZI3 D;  4TWH A;  5LNK A;  3RQW A;  4MFR A;  1M7K A;  2K48 A;  5FVK A;  3U78 A;  2KIN B;  4IE4 A;  2XM2 A;  4X1I E;  4OYJ A;  3EAM A;  3BK9 A;  3CX6 B;  2BS3 A;  1E2A A;  3RLF F;  5C3J A;  4X1Y E;  2ZM0 A;  3UUN A;  5KX5 E;  2WDV A;  3N9N A;  3PUX F;  3QNU A;  1VRB A;  3KV4 A;  2H89 A;  1HCI A;  3DJB A;  4A56 A;  3RIU A;  4TN7 B;  2XAG B;  4ILB A;  4NPP A;  1J5W A;  4Q25 A;  2BKP A;  5JDN A;  1MMN A;  2OV9 A;  2XM1 A;  4NIQ A;  3PTR B;  2XJ7 A;  3CML A;  5KMG P;  4PJM A;  4DMW A;  2WDQ A;  5L4H A;  4B3R T;  4DUY T;  4JUY A;  3WAK A;  1D0Z A;  5FP3 A;  2B76 A;  4X65 T;  4H9Q C;  2G0U A;  4KHZ F;  5HXS A;  2IDO B;  5F8P A;  4JEH B;  3V5S A;  1I6Z A;  1YD8 G;  4TNW A;  5AQG B;  2V5D A;  4CN1 A;  1I94 T;  1V9D A;  1LVK A;  3M3Z B;  2VL8 A;  4MLK A;  4BJM A;  2W67 A;  2VVN A;  5LBQ B;  4DV7 T;  1M62 A;  4HFV A;  2GK9 A;  1IBK T;  2HN1 A;  3N9M A;  3AE5 A;  5AQU B;  2OA5 A;  3VHL A;  2H88 A;  3FZF B;  1E1H B;  5LG3 A;  2KSR A;  2NW7 A;  1KF6 A;  4ILU A;  2VVS A;  4JI3 T;  4DR2 T;  3ZMZ B;  2A72 A;  3MXZ A;  2IC9 A;  2JQH A;  2X66 A;  3AE9 A;  3NBX X;  1OED B;  5IWA T;  4H9R C;  2FUP A;  1WLX A;  1HG2 A;  4GYS A;  2E5V A;  4FI5 A;  5AQO B;  1MMA A;  3UUL A;  2KT9 A;  4DO0 A;  3AEA A;  4H9N C;  1KNR A;  3V5U A;  4B3T T;  3NWI A;  2KMF A;  3PUR A;  4AKG A;  5HWY A;  4IE5 A;  2VB6 A;  3Q5W A;  4DBR A;  5DAB A;  2LRL A;  5KDM C;  1N34 T;  3KV6 A;  1IBL T;  4J2C A;  4HFI A;  5BMV E;  2KXP B;  5M4Y A;  4PK4 A;  2HH7 A;  5FY7 A;  4HKA A;  5JVD E;  1YXR A;  2H7V C;  4PK5 A;  4LFB T;  4QWN B;  2XQ4 A;  2E8I A;  4JI5 T;  2DWK A;  2BG9 E;  2Q9Q B;  2V5C A;  2LT3 A;  3K8P C;  2IC6 A;  4KMC A;  4GKJ T;  4A97 A;  3SRZ A;  4AXP A;  2MPK A;  3AEC A;  5JQG E;  2BBJ A;  1D0Y A;  2HN2 A;  3OKQ A;  3IF8 B;  5LGU B;  2LSY A;  4I0U A;  3C64 A;  2CHN A;  2C0S A;  2XAF B;  4TWD A;  2VK9 A;  2BDE A;  4AKH A;  2LSJ A;  2L3L A;  3I9Y A;  4ADZ A;  1YQ4 A;  3KFW X;  5ETW A;  2LM2 A;  3VR9 A;  1J1J A;  3QC9 A;  3GA8 A;  2E9X B;  2WU2 A;  2HHH T;  2V7J A;  3RC3 A;  4KP3 C;  1T72 A;  5LB7 B;  3EI0 A;  2CXF A;  4JEU B;  3FXD B;  4GKK T;  2WB5 A;  5ABH A;  3ZKR A;  2UUB T;  4IGU A;  4E7S A;  2DCF A;  4N78 D;  2W66 A;  4LF9 T;  3BQI A;  1SA0 E;  5JH7 E;  2N9D A;  2W63 A;  1W0A A;  2X9W A;  4DR1 T;  2CBI A;  4UEL A;  3C98 B;  2QRX A;  3ZT7 A;  5BR8 T;  4GK0 E;  2PJQ A;  3CPZ A;  4IDP A;  2FJD A;  4ZI2 D;  1UUS A;  2XQ7 A;  2HPL A;  2BG9 B;  4AKI A;  2V7I A;  3ZEF B;  3P4R A;  3QB5 A;  2LSK A;  3H37 A;  5AFU L;  2P9B A;  2CHO A;  5AQR B;  3CX7 B;  2PG8 A;  4JYA T;  3LBX B;  3UFE A;  5HYA A;  2XUE A;  3LG7 A;  1JNR A;  1T8B A;  4EZH A;  4JI4 T;  2JMH A;  3Q5E A;  2JQK A;  2YEV C;  3PUZ F;  2WMN A;  3UUX B;  1FMV A;  1BR0 A;  1VOM A;  2XQ9 A;  4ZOL E;  2ES0 A;  3N2G E;  2IML A;  4ZZC A;  1D1B A;  1MMG A;  1OED C;  3TLU A;  3I1A A;  1OWA A;  4IT4 A;  2L9Q A;  3PUY F;  1IJ6 A;  1J5E T;  4YSY A;  4H9P C;  3AVR A;  5L2L A;  2KWH A;  3ZYL A;  3L09 A;  4O4H E;  2XSA A;  3FHN A;  2XPK A;  3UU8 A;  5LOV E;  4ERR A;  3MZK B;  5J2T E;  4DV1 T;  1ZEE A;  2QA7 A;  3UUM A;  3ZLI A;  3ZYK A;  2DLR A;  2AE9 A;  4H63 V;  4TNV A;  4JI6 T;  2VKJ A;  4OK0 A;  2WM9 A;  4CI3 B;  4JI8 T;  4GYR A;  3ZC0 A;  3ANW B;  3H3A A;  3RKG A;  2W2U A;  1UGO A;  2Q9Q C;  3EDV A;  4DVD A;  3TLV A;  2CWO A;  3TLW A;  3KIN B;  3AE8 A;  2YKS A;  4K0U A;  3I9W A;  2BS2 A;  2YDR A;  4YHJ A;  1FIO A;  3HKB E;  2V26 A;  2CXD A;  4NXM T;  3ONX A;  1ZP0 A;  3UFG A;  3ZMV B;  3CKD A;  4M1P A;  3J9X 1;  2JJ9 A;  4X5T A;  2ZM2 A;  4HFE A;  4UV9 B;  2E9X C;  4XBF B;  3MKD A;  2XQA A;  2Q9Q A;  3HL6 A;  4DV3 T;  2IHR 1;  2R6G F;  4KX6 A;  3EDU A;  5HXR A;  4U7Y A;  1OXZ A;  4PJL A;  3CK6 A;  1HNZ T;  5FY1 A;  3EAB A;  3MA9 A;  4IDN A;  4AQY T;  4TV9 E;  3C4X A;  3LDQ B;  2LLY A;  1D1C A;  2YN6 A;  2NTX A;  3ESL A;  2YDS A;  1WCR A;  3N5L A;  4ASK A;  4TX5 A;  4YTP A;  2DL1 A;  4HWI B;  4QHO A;  4ZZB A;  3ZC1 A;  2EHO D;  2BS4 A;  1XDO A;  5LA6 E;  2BG9 C;  3K1S A;  4WZX A;  1R8I A;  2E9X A;  1NAF A;  4WBO A;  2ACX A;  4AQF C;  4IIJ E;  1XMO T;  3C4Z A;  4U31 A;  5LHG B;  3RKO A;  4BA9 A;  2W61 A;  3FZL B;  2PBI A;  3GWH A;  2MBG A;  5LJN A;  4ZS3 A;  4Z90 A;  2XZE A;  3AA0 B;  5EK4 A;  2D9D A;  3HKC E;  4UVB B;  2LHN A;  2BKO A;  4KI0 F;  1E7P A;  4QH5 A;  1IAP A;  4MAL A;  2MYS A;  3DTO A;  1HX8 A;  2UUC T;  4IRE A;  4EZ4 A;  2L8K A;  3RYI E;  2CRB A;  5L3E B;  3ZMT B;  5LBM A;  3B5M A;  4JI7 T;  2XQ5 A;  4B3M T;  2ACZ A;  4DND A;  2BG9 A;  4PFO A;  1HFA A;  2KND A;  3T1H T;  3RPU A;  5JDM A;  4AQF A;  2ZMA A;  3CVR A;  2XAS B;  4PAG A;  4WW0 A;  3AEF A;  1HF8 A;  3LBX A;  1L0V A;  4V1A v;  3T8O A;  2DHR A;  2NW9 A;  3OPC A;  4EXT A;  3F31 A;  3OYZ A;  2VQF T;  4L9I A;  2KZ7 B;  5J2U E;  4OHF A;  2LSG A;  2X67 A;  5LHH B;  2V1D B;  1N33 T;  3ZST A;  4BAY B;  1KK7 A;  1X9B A;  5IYZ E;  4U2Z A;  3A5X A;  5ABF B;  3RRC A;  3ZPO A;  4UEM A;  4Z8X A;  4X62 T;  2I0M A;  3AA1 B;  3L8R A;  2H7O A;  4JV5 T;  4ILC A;  3A8Y C;  4EYU A;  2KWI B;  5L4E A;  5AQL B;  4NUU A;  5FKY A;  5LHI B;  3P4S A;  5CGM A;  3E0Z A;  2SPC A;  4UR9 A;  4HWC A;  4GK5 E;  4JLE A;  3L3P A;  4U7I A;  5AQS B;  3AE4 A;  2DI4 A;  4Z91 A;  4P0B A;  4PK6 A;  4DR6 T;  4DV5 T;  2A2F X;  2HPJ A;  5CA0 E;  3UT5 E;  1UX4 A;  4WYV A;  5F3J A;  5L3F B;  1NEN A;  3Q9D A;  3MJX A;  3J7Y q;  3AED A;  3ANW A;  1HX1 B;  4HGA A;  2PFV A;  5EZY E;  2H3R A;  2JRK A;  1IJ5 A;  2XQ6 A;  3NZP A;  2BVL A;  1UK5 A;  3ZYM A;  4AQG A;  2RA1 A;  1GQE A;  3NRX A;  3OJA A;  3VKH A;  4LF7 T;  3RH3 A;  2X0H A;  4KUM B;  2MTQ A;  2I6H A;  2J1D G;  4F8H A;  5LYJ E;  2A9U A;  3BQL A;  3CWZ B;  1HG5 A;  3ABV A;  2AXD S;  2J62 A;  2XAQ B;  3SS1 A;  3RYC E;  2A3D A;  5JDL A;  2WY2 A;  1U5P A;  5CA1 E;  4B3S T;  1YW0 A;  3GMI A;  3LFM A;  4IDO A;  4YFS A;  1ZV4 X;  2VWA A;  2LOS A;  2K24 A;  4QH1 A;  3AA6 B;  2K3W A;  2LJL A;  2OLT A;  2NWB A;  1UUR A;  5HEJ A;  4MHC A;  2FJE A;  3P50 A;  2LEH A;  1FJG T;  4DV2 T;  5AQM B;  2YU1 A;  5JDQ A;  4QXB B;  3T1Y T;  2CXL A;  4UVC B;  4LF5 T;  2E5L T;  4PJN A;  4AKL A;  3FBL A;  3ZN1 B;  2V7M A;  4QXC B;  2NW8 A;  2YOE A;  3ZCI A;  1KFY A;  2FJB A;  5JRC B;  1BR4 A;  4HWH A;  3PU8 A;  3CQG B;  4L0R A;  3DP7 A;  3ZMU B;  2WWU A;  4OFZ A;  2LSI A;  3UTK A;  3AA7 B;  5L3C B;  2M6B A;  5HEG A;  3PUG A;  5LMU T;  3IEE A;  2BBH A;  4CZZ B;  3FZM B;  4LF4 T;  3X1D A;  5AQP B;  2CLY B;  2JQ9 A;  4JI2 T;  1HS7 A;  1HNX T;  5JDH A;  2DWG A;  3ZCJ A;  4X1K E;  4DV0 T;  3KBT A;  4C91 A;  5FMN A;  3P8C D;  2CM0 A;  4O4I E;  3AAA B;  3KVB A;  4YY3 T;  2BVM A;  4UV8 B;  3TLT A;  5AQQ B;  5J0Z A;  2EHO B;  4QX7 B;  3Q5D A;  2NR4 A;  5L3G B;  4FJO A;  3PJA J;  3CIR A;  5A1L A;  1MIW A;  1YKE B;  5LGT B;  4F6R C;  4UF0 B;  2JQQ A;  3HKD E;  3SWH A;  4KBM B;  2D0U A;  4JI1 T;  2FJA A;  3CQX C;  3ONJ A;  2I59 A;  4I50 E;  2X9Y A;  3JAD A;  3KBU A;  3AE1 A;  5ABF A;  2JMK A;  2F4V T;  1G8X A;  5JR9 A;  2V7L A;  4QKN A;  2Q9Q D;  1VCS A;  1O3X A;  3LSV A;  2IAK A;  2W62 A;  2J47 A;  4ZEY A;  2BZB A;  3QB5 K;  2FBW A;  2Z6E A;  5HCJ A;  4AIU A;  1MNE A;  3E08 A;  3JAF A;  5LGN B;  3KDS E;  4IL4 A;  3JC6 D;  3RIF A;  2WU5 A;  1Z0P A;  4O4J E;  4NXN T;  3UQ4 A;  2YDQ A;  3F2E A;  4UXN B;  1XNQ T;  1HNW T;  2Y8D A;  5JDG A;  2XAJ B;  1VCT A;  1T7S A;  3OVU A;  1MND A;  3ZN0 B;  5ADX L;  2D5U A;  4DR4 T;  5HXC A;  2E9X D;  3IHR A;  2C5J A;  1XNR T;  2VL0 A;  3ZT6 A;  2X0Y A;  5ABG A;  4PFP A;  5C8Y E;  3B57 A;  3GN5 B;  2V7K A;  3HI2 A;  4CXW A;  3I0O A;  5JRE A;  3PUS A;  3ZT5 A;  3F57 A;  3AVS A;  4IHJ E;  2JIW A;  2WCA A;  5AQH B;  3VRA A;  4MBQ A;  3N9L A;  1WYB A;  3ZSS A;  3FB2 A;  2LKH A;  4CI2 B;  1NEK A;  5H6Q B;  2WS3 A;  4I43 B;  2X68 A;  1CHU A;  3AE7 A;  3AEB A;  4EV6 A;  3UU4 A;  5FXW A;  4B6X A;  3RRW A;  4DV6 T;  2XTL A;  2VKD A;  1WYC A;  2WWV A;  1DU2 A;  5HWX A;  4PJJ A;  1LVF A;  3FBZ A;  3RQU A;  2LKG A;  3OBV E;  3AAE B;  5HAX A;  2MAW A;  4HWF A;  1X79 A;  3EUH A;  4JBW F;  5AQK B;  4WNK A;  2D2S A;  3WI3 A;  3AXJ A;  3RHW A;  1UCU A;  3WAJ A;  1FEW A;  3RGL A;  1YQ3 A;  1U4Q A;  4EB6 E;  2CLY C;  4IDZ A;  4DBQ A;  3PU3 A;  3SOL A;  4IST A;  1T98 A;  5AQN B;  1HTJ F;  1QLB A;  2UXX B;  2WZI A;  2UXN B;  5FNV E;  3O1J A;  5HEH A;  1EZ3 A;  5JRC A;  1WFD A;  2EHO C;  4X20 E;  4DR5 T;  2CEA A;  3EHZ A;  5FYM A;  2WQY A;  1D0X A;  3IA3 A;  3HR0 A;  3NRY A;  3P4W A;  5GON E;  4TWF A;  4ZI3 C;  1OED E;  4A98 A;  2YIN A;  5FXV A;  3PUV F;  5AQV B;  4YTN A;  3BQK A;  5AQI B;  4ILA A;  3VRB A;  2RP4 A;  4WBN E;  1FMW A;  4HE8 A;  5ABE A;  3UQ7 A;  1HR0 T;  5LMN T;  2CWY A;  4H9O C;  2X9H A;  5LP6 E;  4BJN A;  4HN9 A;  2EHO A;  4YT0 A;  3P7I A;  3M65 A;  5JR9 B;  4UF0 A;  3PDY A;  3NVO A;  4QX8 B;  5HEU A;  3N9Q A;  1WRD A;  2PTF A;  3FZK B;  2CCQ A;  5J1G A;  3OTO T;  3LJC A;  2UXB T;  3UU6 A;  3C51 A;  5CB4 E;  3VKG A;  4G2A A;  2JPF A;  2NTY A;  1S94 A;  3PUW F;  2VKO A;  3B13 A;  5FVL A;  1QSD A;  5HEO A;  4QXH B;  5TAO A;  2CMR A;  2V6Y B;  3A7M A;  4LMK A;  4NUV A;  3AEE A;  2MOZ A;  4DR7 T;  1S35 A;  1US7 B;  4KHP T;  3G06 A;  2VUR A;  3TLS A;  1H7C A;  5HXH A;  3ETV A;  5CJ5 A;  4U33 A;  3CQC B;  4U72 A;  1SE7 A;  2XQ3 A;  3UUB A;  2XQY A;  4JI0 T;  4E7Z A;  5DQW A;  4HFB A; 
#chains in the Genus database with same CATH homology
 4LF4 T;  4X62 T;  4B3S T;  1HR0 T;  5LMN T;  4NXM T;  4JI2 T;  5IWA T;  4JV5 T;  4NXN T;  1HNX T;  2ZM6 T;  2UXC T;  4DV0 T;  1XNQ T;  2VQE T;  1HNW T;  4K0K T;  2HHH T;  4LF8 T;  4DR4 T;  2UUC T;  4YY3 T;  4DR6 T;  4YHH T;  1N36 T;  1XNR T;  4DV5 T;  1J5E T;  4GKK T;  4B3R T;  4DUY T;  4LFA T;  4B3T T;  3OTO T;  2UUB T;  2UXB T;  4LFC T;  4JI7 T;  4X65 T;  4B3M T;  4LF9 T;  4DV3 T;  1FJG T;  4DV2 T;  4X64 T;  1N34 T;  4X66 T;  4DR1 T;  3T1H T;  1IBL T;  4OX9 T;  1N32 T;  1HNZ T;  3T1Y T;  5BR8 T;  1I94 T;  4AQY T;  4LF6 T;  4LF5 T;  4LFB T;  4DR5 T;  1IBM T;  4JI1 T;  2E5L T;  4DV1 T;  1XMQ T;  4JI5 T;  2UU9 T;  4DV4 T;  4JI6 T;  4GKJ T;  4DV7 T;  4DR3 T;  2F4V T;  4DR7 T;  2VQF T;  1IBK T;  4JI8 T;  4LF7 T;  4KHP T;  4DUZ T;  2UUA T;  4DV6 T;  2UXD T;  1N33 T;  4JYA T;  4JI4 T;  4JI3 T;  4DR2 T;  4JI0 T;  5LMU T;  1XMO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...