4DV7T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv7T00
1N34T 4KHPT 2F4VT 1HNZT 4OX9T 4LF4T 1HNXT 4LF7T 4DR3T 4LF9T 4AQYT 2UUBT 1XMQT 3OTOT 2UXDT 2UXBT 1XNRT 4LFCT 4LF6T 4NXNT 1FJGT 2UUAT 4LF8T 4JI6T 4JI0T 4GKJT 4B3ST 2VQFT 1N33T 4JI3T 5BR8T 3T1HT 4JI4T 4JV5T 4DR5T 4DV2T 1IBLT 5LMUT 4DR2T 2ZM6T 4DR7T 4DUYT 4JI5T 4NXMT 4B3TT 4X64T 4DV1T 2E5LT 4LF5T 1J5ET 2UU9T 4YHHT 4X65T 4X66T 4LFAT 1HR0T 5LMNT 4DR6T 4DV6T 1N32T 1XMOT 1IBKT 4JYAT 4DV0T 1N36T 4K0KT 4DR4T 4JI7T 1HNWT 4DV7T 2UXCT 4DR1T 4DUZT 4GKKT 5IWAT 2UUCT 1I94T 4DV3T 3T1YT 4B3MT 4JI2T 4X62T 4B3RT 4LFBT 4YY3T 4DV5T 1IBMT 2VQET 4JI8T 1XNQT 4JI1T 4DV4T 2HHHT
chains in the Genus database with same CATH superfamily
5J1GA 1WR0A 1N34T 1MMDA 2X0HA 3IA3A 3WAKA 3EHZA 3KV6A 5ABEA 1J5WA 2HPLA 1DU2A 2B76A 1M7KA 2LHNA 2AXDS 3HI2A 3RIFA 5JDFA 3SFDA 3UUBA 3ZJ1A 4NPPA 4PJJA 3KBTA 4JLEA 1OEDA 4OX9T 3ANWA 5EK3A 3ZSTA 1D1AA 1YQ4A 2KXPB 4JUYA 5JDMA 1MMGA 1J1JA 5FVKA 3AB3B 5LBMA 5ABGA 4X5TA 5HCJA 2GK9A 2JQHA 2WY2A 4DBRA 5JR9C 3BK9A 3QK6A 3AE4A 1XMQT 3H3AA 3J7Yq 3FZMB 3IEEA 3SWHA 4PK4A 4MHCA 3PUYF 1UUSA 2RP4A 3ZMZB 2ES0A 3GMIA 3UUMA 5JDHA 3V5SA 2KSRA 4IDQA 1E1HB 1MNEA 2CHNA 3O1IA 2UUBT 1KNZA 1SA0E 1HF8A 2BG9C 2WZIA 3Q5WA 5FYMA 5LBQB 5F3JA 2J1DG 2C5IT 2UXBT 4IE7A 1MIVA 2CLYB 2CXDA 4WW0A 1XNRT 1L0VA 2Q9QC 3AE5A 4LF6T 4CXXA 4LFCT 3HKCE 1UK5A 2I6HA 2VWAA 4UR9A 2K48A 2BG9E 4O4JE 3DP7A 1OWAA 2W2UA 3BQLA 4ZXLA 3X1DA 1HS7A 5BMVE 1D0XA 4GKJT 1BR2A 2A3DA 3ZT5A 3CVRA 2ACZA 1CUNA 4OHFA 3ZKRA 3SRZA 1WFDA 3ZMTB 5AQGB 5HWXA 5JH7E 5LJMA 4EZ4A 3P4RA 4WZXA 4DO0A 2BS4A 3AE6A 3O4XE 4N78D 1E7PA 4PK5A 2IDOB 5AQOB 3ZCJA 2KNDA 4WNKA 4CQIA 4YJ2E 2VKJA 3TKLB 3EI0A 5FMNA 1XWMA 4JV5T 2DLRA 2E2AA 2LT3A 4BA9A 1OEDC 3CX8B 3JC6C 3C64A 2LOSA 4UF0B 5KX5E 3K3NA 4COFA 1IBLT 1NAFA 2BKOA 5JDLA 3ZEFB 2PG8A 3C4ZA 1UGOA 2AE9A 2BS2A 4QWNB 2OLTA 2VB6A 2NW7A 1LRZA 2C5JA 2XQ4A 4KP3C 3SS1A 5HXCA 3PJAJ 1Z8UA 3ETUA 3NVOA 4YTPA 2PBIA 4B3TT 4A97A 2PTFA 2E5LT 2JMKA 2CRBA 3UU6A 2VKDA 3UFGA 3JADA 3H37A 3KFWX 2IC6A 4CXYA 3PURA 5HCMA 5GONE 4P0AA 3NZQA 2Q9QD 3K3QC 1KNPA 1U5PA 3RLFF 5ADXL 1HR0T 5JRCA 1YKHB 4H63H 1HTJF 1W0BA 2X66A 2XQ8A 3ZC1A 2CHOA 2FBWA 3FXDB 1N32T 3I9WA 3H3MA 2Y6XA 2LE8A 4JYAT 1NEKA 1QUUA 4CI1B 4EAHA 3RIUA 4ILCA 4UV9B 5JRCB 3RC8A 3FB2A 4KMCA 4AKHA 3CX6B 3UT5E 5CJ5A 5LP6E 4ZI7E 2WU2A 1Y01A 4IREA 2M6BA 4OYJA 4UVBB 5HAXA 2SPCA 3IBPA 4KI0F 4MLKA 4U31A 2XAFB 2DCFA 2XSAA 2D2SA 2MOZA 2W4XA 3GN5A 3FHNA 4TWFA 4U33A 2HN2A 2LSJA 5KMGP 1SUMB 2HPJA 3AEBA 2W62A 3RYFE 2VASA 2OV9A 4FJOA 4Z90A 5FXXA 2V1DB 4DBQA 3GN5B 2YK0A 4ILAA 4U72A 4ZI2C 3KV4A 2CE7A 3DTOA 4H63V 4PJLA 2KT9A 3CQXC 3C51A 3C50A 2YU2A 3ETVA 3JCFA 3KVAA 4U2ZA 2VQET 2PFVA 4JI8T 3ZCIA 1XNQT 1T7SA 5FNVE 4JI1T 2W61A 2LM9A 4ILUA 3PE0A 4U7IA 3W15B 5LG4A 3O1HA 5CGMA 2HHHT 1IZNB 2H3RA 3AA7B 1KNRA 2QVAA 5AQKB 3Q5XA 3F57A 5F8PA 3RQUA 4ZI3C 3NWIA 2F4VT 1B7TA 2ZLYA 3MK7C 3AA1B 3OPCA 2N2NA 4HFBA 4WBNE 1LKXA 2QGSA 1OEDE 4GK0E 1Y64B 3B13A 1FIOA 3J9X1 4IDOA 3CK6A 4HFDA 4YT0A 1SHZC 2ODUA 1NENA 3L09A 4ILBA 4CN6A 4PAGA 5IYZE 4MALA 5AQNB 3ZLIA 3N2OA 2BG9A 3O1JA 4KX6A 5EZYE 5C8YE 4KUMB 4IE6A 2DWKA 1CHUA 5AQHB 2WWVA 5H6QB 4AI6A 2WDVA 3HKEE 2LRKA 5LA6E 1UCUA 3AEDA 4TWDA 4DR3T 2NR4A 2W67A 4TN7B 2VQFT 1D0YA 3PUAA 1YQ3A 4X1YE 4AQYT 4UVCB 3V5UA 2WU5A 2LSGA 1UURA 2EHOC 4QKNA 2JMHA 4QXHB 3KINB 3N9MA 2VURA 3CQCB 2YDRA 2BBJA 2LM2A 3AE7A 3I0QA 1BR1A 3LJCA 3JAFA 4DMWA 5HXHA 3HKDE 3P4QA 4K0UA 2X67A 3RYCE 1FJGT 1E2AA 3AA6B 1UX4A 4TNVA 1WYBA 3U3IA 5FXWA 3UUNA 5FY7A 4JI6T 4HKAA 4UELA 5A1LA 5HXEA 3P7IA 3A7MA 2KINB 4DNDA 5HYAA 4WBOA 1FMVA 1KFYA 3TLUA 3RRWA 1N33T 4ASKA 3RF1A 2DWGA 2CXFA 3FZHB 4HWIB 3B5MA 3N2GE 3QOFA 2LSKA 4I50E 1GQEA 2XSBA 2NTYA 2VVSA 4P0BA 3ZN1B 2X0LB 3CIRA 2D5UA 3OYXA 4JBWF 3GA8A 2KWHA 4HEAA 4G63A 4IE4A 2H7OA 1ZV4X 3PU3A 3LK3B 3PUSA 3WAJA 4AIUA 4EYUA 5C2TA 4ZS3A 5DABA 3AEAA 1X79A 3VKGA 4M1PA 3C4XA 1WLXA 4AKRB 2WB5A 4CI3B 3ZT6A 4C91A 4EEDA 5JREA 5LMUT 2HH7A 3E0ZA 2CM0A 3K1SA 2CA5A 3PTRB 2V6YB 4PNIA 4DV0T 4DVDA 5FKYA 3RYHE 3ONXA 5L3BB 5LGUB 4JI5T 4NXMT 1KF6A 3PUWF 2XAGB 1J5ET 1Z0PA 2BKPA 3QC9A 1IJ6A 2Z6EA 3RIUC 4AISA 5AFUL 2IMLA 2EHOA 2V7MA 1G73A 3P8CD 2XQ6A 4CXWA 4X66T 3PUXF 2CCQA 3KBUA 2BDEA 3MXZA 4TNWA 5AQRB 1YW0A 4CZZB 3UQ7A 3RGLA 4DIDB 4TV8E 5LMNT 2E9XB 2UXXB 1QSDA 1XMOT 2CLYC 3AEFA 3L3PA 4UVAB 3I0OA 3OVUA 3ZJ2A 3AVRA 4BAYB 3UFEA 5ABFB 3L8RA 5JVDE 1N36T 3PUGA 3E08A 3VR8A 1X9BA 4EEBA 4DR4T 2WDRA 5HEGA 5LGNB 3R84B 5JR9A 1VRBA 2V5CA 3D0TA 3KV9A 5AQJB 3VRBA 5J2TE 1HNWT 3U78A 3N9LA 2CEAA 3LBXB 4IL4A 3EDVA 4BJNA 4UEMA 4ANJA 4ZI2D 5L3GB 2XQYA 3BQIA 3ONLC 4AXPA 1I6ZA 2EHOD 3AAEB 5IWAT 2UUCT 2BS3A 2KWIB 1I94T 4DV3T 1ZHCA 2VL0A 1W09A 2W63A 2UXNB 3S4UA 3T1YT 2XJ7A 5L47A 3CPZA 3LG7A 2LSYA 5AQSB 4KHZF 4QXCB 1MIWA 2WBLA 2JJ9A 3AE2A 1HG5A 2WMNA 2XASB 4LMLA 3A8YC 5FL0A 4B6XA 3VKHA 1KK7A 3PUQA 3RI5A 3KDSE 2EHOB 2VK9A 2X9WA 2L9QA 2V7JA 4U3CA 5E0OA 1D1CA 3UU8A 4DV4T 2I0MA 2LJLA 4PW8A 4UF0A 4IDNA 2JPFA 2WP9A 3FZKB 3MJXA 4ADZA 1HFAA 4QX7B 4NIQA 3K8PC 2CBJA 3VR9A 4EYYR 4ZS2A 1D0ZA 5L4EA 2X0YA 3KV5A 3OBVE 3UUXB 4OYKA 4TZ4C 3A5XA 1VCTA 5AQPB 5FY1A 3EUHA 2KLQA 2ODVA 3N2KE 3PUVF 5CA0E 5HEJA 1ZP0A 2WS3A 3HA4A 3MACA 1T8BA 4QH1A 4DMVA 1IAPA 3VRAA 4LF4T 5FL1A 4HFIA 2H7VC 2IIUA 3LK2B 2MAWA 2V6XA 1HX1B 2KMFA 3AEGA 1HNXT 4TWHA 3RRCA 2JQ9A 3RKOA 4LF7T 3CKDA 2BZBA 2E5VA 4OFZA 4O8SA 3IHRA 3Q5DA 4GK5E 3OKQA 3FBLA 4I43B 3EAMA 2IW5B 5FP3A 5L3CB 4HFCA 4A98A 2DNXA 2B1EA 3ZMVB 3OTOT 2X9HA 2K3WA 3ZMSB 2W66A 3PJAA 4ZOLE 3ZYKA 4NXNT 3MKDA 1OEDB 3FZLB 2XAJB 4G2AA 5KXJA 2JRKA 2X68A 4GOUA 5AQQB 3K3OA 5HXSA 5LHHB 4X20E 4YFSA 3R6NA 4HN9A 3PDYA 4PJMA 5JDNA 5FY0A 3E22E 4QHOA 3JAEA 4IGUA 4Z8XA 3RPUA 2ZM0A 4CN4A 4CN1A 1XDPA 2FJBA 2V5DA 3OYZA 4TUYE 3ZSSA 2DL1A 4P09A 4U2YA 5DQVA 2NOXA 3TLSA 4ZZCA 4IL9A 4XBFB 5L3DB 1S35A 5M4YA 4TV9E 1YKEB 5LB7B 2RPAA 1T72A 4DUZT 3F31A 2A2FX 4JI4T 5LNKA 5FVLA 4HWHA 5L2LA 4DR5T 4DV2T 3EDUA 2WDQA 2XAQB 3ONJA 3HKBE 2D0UA 2XQ5A 4P1NA 4DR2T 1EZ3A 3G06A 3GWHA 4IIJE 4LMJA 4PK6A 4DR7T 1R8IA 4HWDA 5JDQA 4IT4A 4YSYA 2FJEA 4H9SE 3CWZB 4H9OC 2IHR1 2ZMAA 3P50A 4I0UA 4H9QC 4A56A 2J4GA 2W0GA 2LKHA 4X64T 4LF5T 2K9AA 4ZEYA 5HWYA 4YXDA 5HEOA 5JQGE 4JI7T 2W00A 3NRYA 5F5WA 4X1IE 2A72A 4CI2B 4QH5A 4L5GA 5CA1E 1ZEEA 4LFAT 2XZEA 1IJ5A 3IF8B 5L3EB 5LCYA 2CBIA 4ZHQE 3BQKA 4HE8A 5ABFA 4AKIA 1FEWA 1WRDA 2V6YA 4MFRA 3ZYLA 5HEHA 5CFBA 4DR6T 5LOVE 4EZHA 4H9RC 1AJ3A 2Q9QB 3CQGB 3QNUA 5DQWA 3QB5K 4IHJE 2WM9A 2FUPA 4K0KT 3N9OA 3UQ4A 4AQFA 5AQLB 1LVFA 2XQ9A 4NUUA 1JNZA 3PUZF 3MZKB 3ANWB 2J62A 4X1KE 2JQKA 2VKOA 2BBHA 1U4QA 2H89A 4NUVA 5ETWA 4JEUB 5H6RB 3TLTA 4HFHA 4DR1T 3PU8A 2UXCT 3ZMUB 4HGAA 1T98A 3RIAA 3VHLA 2YKSA 2J47A 3VU7H 3AE9A 4GKKT 2OA5A 4QXBB 2IUBA 1W9RA 4HWFA 1O3XA 3B57A 3EVYA 4QH4A 2QA7A 2CWYA 2CXLA 2K24A 3Q9DA 4O4LE 1WCRA 1US7B 4H9NC 1SE7A 4JI2T 4X62T 3QUJA 3QB5A 1WR6A 1IBMT 2HN1A 5HEUA 1HX8A 4J2CA 4EGWA 3ZT7A 5EK4A 1ZOYA 2LSIA 3M3ZB 2C5KT 3PV0F 4FI5A 1YD8G 4O2AE 4U7YA 3AAIA 1M62A 3FXEB 3RKGA 3RYIE 1V9DA 2YOEA 2MPKA 4OK0A 3UU5A 3AE8A 4AQGA 4YJ3E 5AQUB 2BVLA 2LHRA 3P4WA 1UX5A 2Q9QA 3F2EA 2NW9A 4KHPT 4HFVA 3AE3A 3CMLA 3AE1A 4ZZBA 2V7KA 5CB4E 3AEEA 1HNZT 3P4SA 2I59A 2JIWA 3N5LA 1H7CA 3CX7B 3DJBA 1YXRA 2WWUA 2XY8B 3Q5EA 3AECA 5AQMB 4F8HA 3ZC0A 3RHWA 3ZPOA 3HR0A 4E7SA 3FZFB 3RQWA 3ZN0B 2WSSV 4ERRA 2LEHA 2G0UA 4AQFC 5ABHA 4GYSA 2E9XA 5EK2A 4UV8B 5AQIB 2QRXA 4ISTA 2XQAA 4ISSA 4O4IE 2M6IA 1JNRA 4O4HE 5JDGA 4LF9T 1D1BA 1OXZA 2CWOA 4XZCA 3AA0B 5L4HA 4YTNA 5LG3A 5LJNA 4H9PC 3ABVA 2L3LA 2XAHB 3NRXA 5LGTB 2BG9B 2ZM2A 4A5XA 4YSZA 2KZ7B 4AKGA 4JEHB 2UXDT 4L9IA 5AQTB 2MTQA 2NW8A 3SFEA 1XDOA 2D0TA 2X9YA 2VKHA 5J0ZA 5JTGA 2P9BA 2UUAT 2WCAA 4LF8T 3LBXA 2E8IA 3OJAA 4JI0T 2V26A 4IE0A 4BJMA 3TLWA 3UU3A 5J2UE 5JR9B 3LK42 4B3ST 2WMOA 4U74A 3AVSA 4WYVA 5LHIB 2VL8A 1LVKA 1XZYA 2CMRA 2QYWA 3C4WA 5AQFB 2YN6A 1HG2A 3P4PA 2XM1A 2D9DA 5LXTE 2XPKA 1KEYA 2YDQA 3L39A 2DI4A 3AXJA 5BR8T 3T1HT 3MA9A 5FXZA 2V8SV 2YEVC 5AQVB 4EB6E 4PJNA 2V7LA 4IDPA 4TX5A 4YLHA 1W0AA 3NBXX 5C3JA 3KVBA 3N9NA 3LFMA 2PJQA 4L0RA 4E7ZA 5LHGB 1MIYA 2RA1A 3N9QA 4YSXA 1VCSA 2IC9A 2VVNA 5TAOA 2ZM6T 4JI3T 2MYSA 2WZHA 2N1GA 4I4TE 4F6RC 4DUYT 1QLBA 2E9XD 2X9XA 4HWCA 3SOLA 1MMAA 2XM2A 3NKZA 4IDZA 1MMNA 2XQ7A 5DJQC 2ZM8A 4DV1T 4B3RT 4I55E 2A9UA 4V1Av 2Y8DA 2UU9T 2BVMA 4YHHT 5LYJE 3TLVA 4X65T 2X51A 4XAXB 2M67A 2K5BB 2FJAA 3LDQB 3EABA 2L8KA 3O9XA 5L3FB 2YDSA 3AXJB 4HFEA 2XTLA 4EV6A 4DV6T 1IBKT 4Q25A 2H88A 1S94A 4LMKA 4YTMA 2WAUA 2XUEA 4C90A 1HCIA 5KDMC 3RH3A 1VOMA 1G8XA 3FBZA 3M65A 3AAAB 4UIGA 4EOZB 2LRLA 4KBMB 2WQYA 1MNDA 2NP9A 3C98B 4UXNB 3UU4A 4AKLA 4DV7T 2CPTA 2LLYA 4IE5A 3N9PA 3ZYMA 2XHEB 5IHYA 3UULA 4Z91A 4MBQA 2DHRA 4QX8B 4PFOA 5HXRA 2XQ3A 1BR4A 2V7IA 2C0SA 3T8OA 4PFPA 3JC6D 3NZPA 4HTEA 3HL6A 2E9XC 1ZKEA 2LKGA 3LSVA 2N9DA 2NWBA 4GIWA 4GYRA 5FXVA 2LOPA 3I9YA 4B3MT 2IAKA 4LFBT 2FJDA 4YHJA 3WI3A 2BKNA 4YY3T 3ESLA 2MBGA 2YINA 2YU1A 3I1AA 4DV5T 4EIWA 1NWMX 3RX6A 1FMWA 2NTXA 2Y48B 4EXTA 3UTKA 4ZI3D 5IUXA 3RC3A 1BR0A 4O2BE 2ACXA 1WYCA 3Q2MA 2JQQA 2R6GF
chains in the Genus database with same CATH topology
1N34T 4KHPT 2F4VT 1HNZT 4OX9T 4LF4T 1HNXT 4LF7T 4DR3T 4LF9T 4AQYT 2UUBT 1XMQT 3OTOT 2UXDT 2UXBT 1XNRT 4LFCT 4LF6T 4NXNT 1FJGT 2UUAT 4LF8T 4JI6T 4JI0T 4GKJT 4B3ST 2VQFT 1N33T 4JI3T 5BR8T 3T1HT 4JI4T 4JV5T 4DR5T 4DV2T 1IBLT 5LMUT 4DR2T 2ZM6T 4DR7T 4DUYT 4JI5T 4NXMT 4B3TT 4X64T 4DV1T 2E5LT 4LF5T 1J5ET 2UU9T 4YHHT 4X65T 4X66T 4LFAT 1HR0T 5LMNT 4DR6T 4DV6T 1N32T 1XMOT 1IBKT 4JYAT 4DV0T 1N36T 4K0KT 4DR4T 4JI7T 1HNWT 4DV7T 2UXCT 4DR1T 4DUZT 4GKKT 5IWAT 2UUCT 1I94T 4DV3T 3T1YT 4B3MT 4JI2T 4X62T 4B3RT 4LFBT 4YY3T 4DV5T 1IBMT 2VQET 4JI8T 1XNQT 4JI1T 4DV4T 2HHHT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 T;  4KHP T;  2F4V T;  1HNZ T;  4OX9 T;  4LF4 T;  1HNX T;  4LF7 T;  4DR3 T;  4LF9 T;  4AQY T;  2UUB T;  1XMQ T;  3OTO T;  2UXD T;  2UXB T;  1XNR T;  4LFC T;  4LF6 T;  4NXN T;  1FJG T;  2UUA T;  4LF8 T;  4JI6 T;  4JI0 T;  4GKJ T;  4B3S T;  2VQF T;  1N33 T;  4JI3 T;  5BR8 T;  3T1H T;  4JI4 T;  4JV5 T;  4DR5 T;  4DV2 T;  1IBL T;  5LMU T;  4DR2 T;  2ZM6 T;  4DR7 T;  4DUY T;  4JI5 T;  4NXM T;  4B3T T;  4X64 T;  4DV1 T;  2E5L T;  4LF5 T;  1J5E T;  2UU9 T;  4YHH T;  4X65 T;  4X66 T;  4LFA T;  1HR0 T;  5LMN T;  4DR6 T;  4DV6 T;  1N32 T;  1XMO T;  1IBK T;  4JYA T;  4DV0 T;  1N36 T;  4K0K T;  4DR4 T;  4JI7 T;  1HNW T;  4DV7 T;  2UXC T;  4DR1 T;  4DUZ T;  4GKK T;  5IWA T;  2UUC T;  1I94 T;  4DV3 T;  3T1Y T;  4B3M T;  4JI2 T;  4X62 T;  4B3R T;  4LFB T;  4YY3 T;  4DV5 T;  1IBM T;  2VQE T;  4JI8 T;  1XNQ T;  4JI1 T;  4DV4 T;  2HHH T; 
#chains in the Genus database with same CATH topology
 5J1G A;  1WR0 A;  1N34 T;  1MMD A;  2X0H A;  3IA3 A;  3WAK A;  3EHZ A;  3KV6 A;  5ABE A;  1J5W A;  2HPL A;  1DU2 A;  2B76 A;  1M7K A;  2LHN A;  2AXD S;  3HI2 A;  3RIF A;  5JDF A;  3SFD A;  3UUB A;  3ZJ1 A;  4NPP A;  4PJJ A;  3KBT A;  4JLE A;  1OED A;  4OX9 T;  3ANW A;  5EK3 A;  3ZST A;  1D1A A;  1YQ4 A;  2KXP B;  4JUY A;  5JDM A;  1MMG A;  1J1J A;  5FVK A;  3AB3 B;  5LBM A;  5ABG A;  4X5T A;  5HCJ A;  2GK9 A;  2JQH A;  2WY2 A;  4DBR A;  5JR9 C;  3BK9 A;  3QK6 A;  3AE4 A;  1XMQ T;  3H3A A;  3J7Y q;  3FZM B;  3IEE A;  3SWH A;  4PK4 A;  4MHC A;  3PUY F;  1UUS A;  2RP4 A;  3ZMZ B;  2ES0 A;  3GMI A;  3UUM A;  5JDH A;  3V5S A;  2KSR A;  4IDQ A;  1E1H B;  1MNE A;  2CHN A;  3O1I A;  2UUB T;  1KNZ A;  1SA0 E;  1HF8 A;  2BG9 C;  2WZI A;  3Q5W A;  5FYM A;  5LBQ B;  5F3J A;  2J1D G;  2C5I T;  2UXB T;  4IE7 A;  1MIV A;  2CLY B;  2CXD A;  4WW0 A;  1XNR T;  1L0V A;  2Q9Q C;  3AE5 A;  4LF6 T;  4CXX A;  4LFC T;  3HKC E;  1UK5 A;  2I6H A;  2VWA A;  4UR9 A;  2K48 A;  2BG9 E;  4O4J E;  3DP7 A;  1OWA A;  2W2U A;  3BQL A;  4ZXL A;  3X1D A;  1HS7 A;  5BMV E;  1D0X A;  4GKJ T;  1BR2 A;  2A3D A;  3ZT5 A;  3CVR A;  2ACZ A;  1CUN A;  4OHF A;  3ZKR A;  3SRZ A;  1WFD A;  3ZMT B;  5AQG B;  5HWX A;  5JH7 E;  5LJM A;  4EZ4 A;  3P4R A;  4WZX A;  4DO0 A;  2BS4 A;  3AE6 A;  3O4X E;  4N78 D;  1E7P A;  4PK5 A;  2IDO B;  5AQO B;  3ZCJ A;  2KND A;  4WNK A;  4CQI A;  4YJ2 E;  2VKJ A;  3TKL B;  3EI0 A;  5FMN A;  1XWM A;  4JV5 T;  2DLR A;  2E2A A;  2LT3 A;  4BA9 A;  1OED C;  3CX8 B;  3JC6 C;  3C64 A;  2LOS A;  4UF0 B;  5KX5 E;  3K3N A;  4COF A;  1IBL T;  1NAF A;  2BKO A;  5JDL A;  3ZEF B;  2PG8 A;  3C4Z A;  1UGO A;  2AE9 A;  2BS2 A;  4QWN B;  2OLT A;  2VB6 A;  2NW7 A;  1LRZ A;  2C5J A;  2XQ4 A;  4KP3 C;  3SS1 A;  5HXC A;  3PJA J;  1Z8U A;  3ETU A;  3NVO A;  4YTP A;  2PBI A;  4B3T T;  4A97 A;  2PTF A;  2E5L T;  2JMK A;  2CRB A;  3UU6 A;  2VKD A;  3UFG A;  3JAD A;  3H37 A;  3KFW X;  2IC6 A;  4CXY A;  3PUR A;  5HCM A;  5GON E;  4P0A A;  3NZQ A;  2Q9Q D;  3K3Q C;  1KNP A;  1U5P A;  3RLF F;  5ADX L;  1HR0 T;  5JRC A;  1YKH B;  4H63 H;  1HTJ F;  1W0B A;  2X66 A;  2XQ8 A;  3ZC1 A;  2CHO A;  2FBW A;  3FXD B;  1N32 T;  3I9W A;  3H3M A;  2Y6X A;  2LE8 A;  4JYA T;  1NEK A;  1QUU A;  4CI1 B;  4EAH A;  3RIU A;  4ILC A;  4UV9 B;  5JRC B;  3RC8 A;  3FB2 A;  4KMC A;  4AKH A;  3CX6 B;  3UT5 E;  5CJ5 A;  5LP6 E;  4ZI7 E;  2WU2 A;  1Y01 A;  4IRE A;  2M6B A;  4OYJ A;  4UVB B;  5HAX A;  2SPC A;  3IBP A;  4KI0 F;  4MLK A;  4U31 A;  2XAF B;  2DCF A;  2XSA A;  2D2S A;  2MOZ A;  2W4X A;  3GN5 A;  3FHN A;  4TWF A;  4U33 A;  2HN2 A;  2LSJ A;  5KMG P;  1SUM B;  2HPJ A;  3AEB A;  2W62 A;  3RYF E;  2VAS A;  2OV9 A;  4FJO A;  4Z90 A;  5FXX A;  2V1D B;  4DBQ A;  3GN5 B;  2YK0 A;  4ILA A;  4U72 A;  4ZI2 C;  3KV4 A;  2CE7 A;  3DTO A;  4H63 V;  4PJL A;  2KT9 A;  3CQX C;  3C51 A;  3C50 A;  2YU2 A;  3ETV A;  3JCF A;  3KVA A;  4U2Z A;  2VQE T;  2PFV A;  4JI8 T;  3ZCI A;  1XNQ T;  1T7S A;  5FNV E;  4JI1 T;  2W61 A;  2LM9 A;  4ILU A;  3PE0 A;  4U7I A;  3W15 B;  5LG4 A;  3O1H A;  5CGM A;  2HHH T;  1IZN B;  2H3R A;  3AA7 B;  1KNR A;  2QVA A;  5AQK B;  3Q5X A;  3F57 A;  5F8P A;  3RQU A;  4ZI3 C;  3NWI A;  2F4V T;  1B7T A;  2ZLY A;  3MK7 C;  3AA1 B;  3OPC A;  2N2N A;  4HFB A;  4WBN E;  1LKX A;  2QGS A;  1OED E;  4GK0 E;  1Y64 B;  3B13 A;  1FIO A;  3J9X 1;  4IDO A;  3CK6 A;  4HFD A;  4YT0 A;  1SHZ C;  2ODU A;  1NEN A;  3L09 A;  4ILB A;  4CN6 A;  4PAG A;  5IYZ E;  4MAL A;  5AQN B;  3ZLI A;  3N2O A;  2BG9 A;  3O1J A;  4KX6 A;  5EZY E;  5C8Y E;  4KUM B;  4IE6 A;  2DWK A;  1CHU A;  5AQH B;  2WWV A;  5H6Q B;  4AI6 A;  2WDV A;  3HKE E;  2LRK A;  5LA6 E;  1UCU A;  3AED A;  4TWD A;  4DR3 T;  2NR4 A;  2W67 A;  4TN7 B;  2VQF T;  1D0Y A;  3PUA A;  1YQ3 A;  4X1Y E;  4AQY T;  4UVC B;  3V5U A;  2WU5 A;  2LSG A;  1UUR A;  2EHO C;  4QKN A;  2JMH A;  4QXH B;  3KIN B;  3N9M A;  2VUR A;  3CQC B;  2YDR A;  2BBJ A;  2LM2 A;  3AE7 A;  3I0Q A;  1BR1 A;  3LJC A;  3JAF A;  4DMW A;  5HXH A;  3HKD E;  3P4Q A;  4K0U A;  2X67 A;  3RYC E;  1FJG T;  1E2A A;  3AA6 B;  1UX4 A;  4TNV A;  1WYB A;  3U3I A;  5FXW A;  3UUN A;  5FY7 A;  4JI6 T;  4HKA A;  4UEL A;  5A1L A;  5HXE A;  3P7I A;  3A7M A;  2KIN B;  4DND A;  5HYA A;  4WBO A;  1FMV A;  1KFY A;  3TLU A;  3RRW A;  1N33 T;  4ASK A;  3RF1 A;  2DWG A;  2CXF A;  3FZH B;  4HWI B;  3B5M A;  3N2G E;  3QOF A;  2LSK A;  4I50 E;  1GQE A;  2XSB A;  2NTY A;  2VVS A;  4P0B A;  3ZN1 B;  2X0L B;  3CIR A;  2D5U A;  3OYX A;  4JBW F;  3GA8 A;  2KWH A;  4HEA A;  4G63 A;  4IE4 A;  2H7O A;  1ZV4 X;  3PU3 A;  3LK3 B;  3PUS A;  3WAJ A;  4AIU A;  4EYU A;  5C2T A;  4ZS3 A;  5DAB A;  3AEA A;  1X79 A;  3VKG A;  4M1P A;  3C4X A;  1WLX A;  4AKR B;  2WB5 A;  4CI3 B;  3ZT6 A;  4C91 A;  4EED A;  5JRE A;  5LMU T;  2HH7 A;  3E0Z A;  2CM0 A;  3K1S A;  2CA5 A;  3PTR B;  2V6Y B;  4PNI A;  4DV0 T;  4DVD A;  5FKY A;  3RYH E;  3ONX A;  5L3B B;  5LGU B;  4JI5 T;  4NXM T;  1KF6 A;  3PUW F;  2XAG B;  1J5E T;  1Z0P A;  2BKP A;  3QC9 A;  1IJ6 A;  2Z6E A;  3RIU C;  4AIS A;  5AFU L;  2IML A;  2EHO A;  2V7M A;  1G73 A;  3P8C D;  2XQ6 A;  4CXW A;  4X66 T;  3PUX F;  2CCQ A;  3KBU A;  2BDE A;  3MXZ A;  4TNW A;  5AQR B;  1YW0 A;  4CZZ B;  3UQ7 A;  3RGL A;  4DID B;  4TV8 E;  5LMN T;  2E9X B;  2UXX B;  1QSD A;  1XMO T;  2CLY C;  3AEF A;  3L3P A;  4UVA B;  3I0O A;  3OVU A;  3ZJ2 A;  3AVR A;  4BAY B;  3UFE A;  5ABF B;  3L8R A;  5JVD E;  1N36 T;  3PUG A;  3E08 A;  3VR8 A;  1X9B A;  4EEB A;  4DR4 T;  2WDR A;  5HEG A;  5LGN B;  3R84 B;  5JR9 A;  1VRB A;  2V5C A;  3D0T A;  3KV9 A;  5AQJ B;  3VRB A;  5J2T E;  1HNW T;  3U78 A;  3N9L A;  2CEA A;  3LBX B;  4IL4 A;  3EDV A;  4BJN A;  4UEM A;  4ANJ A;  4ZI2 D;  5L3G B;  2XQY A;  3BQI A;  3ONL C;  4AXP A;  1I6Z A;  2EHO D;  3AAE B;  5IWA T;  2UUC T;  2BS3 A;  2KWI B;  1I94 T;  4DV3 T;  1ZHC A;  2VL0 A;  1W09 A;  2W63 A;  2UXN B;  3S4U A;  3T1Y T;  2XJ7 A;  5L47 A;  3CPZ A;  3LG7 A;  2LSY A;  5AQS B;  4KHZ F;  4QXC B;  1MIW A;  2WBL A;  2JJ9 A;  3AE2 A;  1HG5 A;  2WMN A;  2XAS B;  4LML A;  3A8Y C;  5FL0 A;  4B6X A;  3VKH A;  1KK7 A;  3PUQ A;  3RI5 A;  3KDS E;  2EHO B;  2VK9 A;  2X9W A;  2L9Q A;  2V7J A;  4U3C A;  5E0O A;  1D1C A;  3UU8 A;  4DV4 T;  2I0M A;  2LJL A;  4PW8 A;  4UF0 A;  4IDN A;  2JPF A;  2WP9 A;  3FZK B;  3MJX A;  4ADZ A;  1HFA A;  4QX7 B;  4NIQ A;  3K8P C;  2CBJ A;  3VR9 A;  4EYY R;  4ZS2 A;  1D0Z A;  5L4E A;  2X0Y A;  3KV5 A;  3OBV E;  3UUX B;  4OYK A;  4TZ4 C;  3A5X A;  1VCT A;  5AQP B;  5FY1 A;  3EUH A;  2KLQ A;  2ODV A;  3N2K E;  3PUV F;  5CA0 E;  5HEJ A;  1ZP0 A;  2WS3 A;  3HA4 A;  3MAC A;  1T8B A;  4QH1 A;  4DMV A;  1IAP A;  3VRA A;  4LF4 T;  5FL1 A;  4HFI A;  2H7V C;  2IIU A;  3LK2 B;  2MAW A;  2V6X A;  1HX1 B;  2KMF A;  3AEG A;  1HNX T;  4TWH A;  3RRC A;  2JQ9 A;  3RKO A;  4LF7 T;  3CKD A;  2BZB A;  2E5V A;  4OFZ A;  4O8S A;  3IHR A;  3Q5D A;  4GK5 E;  3OKQ A;  3FBL A;  4I43 B;  3EAM A;  2IW5 B;  5FP3 A;  5L3C B;  4HFC A;  4A98 A;  2DNX A;  2B1E A;  3ZMV B;  3OTO T;  2X9H A;  2K3W A;  3ZMS B;  2W66 A;  3PJA A;  4ZOL E;  3ZYK A;  4NXN T;  3MKD A;  1OED B;  3FZL B;  2XAJ B;  4G2A A;  5KXJ A;  2JRK A;  2X68 A;  4GOU A;  5AQQ B;  3K3O A;  5HXS A;  5LHH B;  4X20 E;  4YFS A;  3R6N A;  4HN9 A;  3PDY A;  4PJM A;  5JDN A;  5FY0 A;  3E22 E;  4QHO A;  3JAE A;  4IGU A;  4Z8X A;  3RPU A;  2ZM0 A;  4CN4 A;  4CN1 A;  1XDP A;  2FJB A;  2V5D A;  3OYZ A;  4TUY E;  3ZSS A;  2DL1 A;  4P09 A;  4U2Y A;  5DQV A;  2NOX A;  3TLS A;  4ZZC A;  4IL9 A;  4XBF B;  5L3D B;  1S35 A;  5M4Y A;  4TV9 E;  1YKE B;  5LB7 B;  2RPA A;  1T72 A;  4DUZ T;  3F31 A;  2A2F X;  4JI4 T;  5LNK A;  5FVL A;  4HWH A;  5L2L A;  4DR5 T;  4DV2 T;  3EDU A;  2WDQ A;  2XAQ B;  3ONJ A;  3HKB E;  2D0U A;  2XQ5 A;  4P1N A;  4DR2 T;  1EZ3 A;  3G06 A;  3GWH A;  4IIJ E;  4LMJ A;  4PK6 A;  4DR7 T;  1R8I A;  4HWD A;  5JDQ A;  4IT4 A;  4YSY A;  2FJE A;  4H9S E;  3CWZ B;  4H9O C;  2IHR 1;  2ZMA A;  3P50 A;  4I0U A;  4H9Q C;  4A56 A;  2J4G A;  2W0G A;  2LKH A;  4X64 T;  4LF5 T;  2K9A A;  4ZEY A;  5HWY A;  4YXD A;  5HEO A;  5JQG E;  4JI7 T;  2W00 A;  3NRY A;  5F5W A;  4X1I E;  2A72 A;  4CI2 B;  4QH5 A;  4L5G A;  5CA1 E;  1ZEE A;  4LFA T;  2XZE A;  1IJ5 A;  3IF8 B;  5L3E B;  5LCY A;  2CBI A;  4ZHQ E;  3BQK A;  4HE8 A;  5ABF A;  4AKI A;  1FEW A;  1WRD A;  2V6Y A;  4MFR A;  3ZYL A;  5HEH A;  5CFB A;  4DR6 T;  5LOV E;  4EZH A;  4H9R C;  1AJ3 A;  2Q9Q B;  3CQG B;  3QNU A;  5DQW A;  3QB5 K;  4IHJ E;  2WM9 A;  2FUP A;  4K0K T;  3N9O A;  3UQ4 A;  4AQF A;  5AQL B;  1LVF A;  2XQ9 A;  4NUU A;  1JNZ A;  3PUZ F;  3MZK B;  3ANW B;  2J62 A;  4X1K E;  2JQK A;  2VKO A;  2BBH A;  1U4Q A;  2H89 A;  4NUV A;  5ETW A;  4JEU B;  5H6R B;  3TLT A;  4HFH A;  4DR1 T;  3PU8 A;  2UXC T;  3ZMU B;  4HGA A;  1T98 A;  3RIA A;  3VHL A;  2YKS A;  2J47 A;  3VU7 H;  3AE9 A;  4GKK T;  2OA5 A;  4QXB B;  2IUB A;  1W9R A;  4HWF A;  1O3X A;  3B57 A;  3EVY A;  4QH4 A;  2QA7 A;  2CWY A;  2CXL A;  2K24 A;  3Q9D A;  4O4L E;  1WCR A;  1US7 B;  4H9N C;  1SE7 A;  4JI2 T;  4X62 T;  3QUJ A;  3QB5 A;  1WR6 A;  1IBM T;  2HN1 A;  5HEU A;  1HX8 A;  4J2C A;  4EGW A;  3ZT7 A;  5EK4 A;  1ZOY A;  2LSI A;  3M3Z B;  2C5K T;  3PV0 F;  4FI5 A;  1YD8 G;  4O2A E;  4U7Y A;  3AAI A;  1M62 A;  3FXE B;  3RKG A;  3RYI E;  1V9D A;  2YOE A;  2MPK A;  4OK0 A;  3UU5 A;  3AE8 A;  4AQG A;  4YJ3 E;  5AQU B;  2BVL A;  2LHR A;  3P4W A;  1UX5 A;  2Q9Q A;  3F2E A;  2NW9 A;  4KHP T;  4HFV A;  3AE3 A;  3CML A;  3AE1 A;  4ZZB A;  2V7K A;  5CB4 E;  3AEE A;  1HNZ T;  3P4S A;  2I59 A;  2JIW A;  3N5L A;  1H7C A;  3CX7 B;  3DJB A;  1YXR A;  2WWU A;  2XY8 B;  3Q5E A;  3AEC A;  5AQM B;  4F8H A;  3ZC0 A;  3RHW A;  3ZPO A;  3HR0 A;  4E7S A;  3FZF B;  3RQW A;  3ZN0 B;  2WSS V;  4ERR A;  2LEH A;  2G0U A;  4AQF C;  5ABH A;  4GYS A;  2E9X A;  5EK2 A;  4UV8 B;  5AQI B;  2QRX A;  4IST A;  2XQA A;  4ISS A;  4O4I E;  2M6I A;  1JNR A;  4O4H E;  5JDG A;  4LF9 T;  1D1B A;  1OXZ A;  2CWO A;  4XZC A;  3AA0 B;  5L4H A;  4YTN A;  5LG3 A;  5LJN A;  4H9P C;  3ABV A;  2L3L A;  2XAH B;  3NRX A;  5LGT B;  2BG9 B;  2ZM2 A;  4A5X A;  4YSZ A;  2KZ7 B;  4AKG A;  4JEH B;  2UXD T;  4L9I A;  5AQT B;  2MTQ A;  2NW8 A;  3SFE A;  1XDO A;  2D0T A;  2X9Y A;  2VKH A;  5J0Z A;  5JTG A;  2P9B A;  2UUA T;  2WCA A;  4LF8 T;  3LBX A;  2E8I A;  3OJA A;  4JI0 T;  2V26 A;  4IE0 A;  4BJM A;  3TLW A;  3UU3 A;  5J2U E;  5JR9 B;  3LK4 2;  4B3S T;  2WMO A;  4U74 A;  3AVS A;  4WYV A;  5LHI B;  2VL8 A;  1LVK A;  1XZY A;  2CMR A;  2QYW A;  3C4W A;  5AQF B;  2YN6 A;  1HG2 A;  3P4P A;  2XM1 A;  2D9D A;  5LXT E;  2XPK A;  1KEY A;  2YDQ A;  3L39 A;  2DI4 A;  3AXJ A;  5BR8 T;  3T1H T;  3MA9 A;  5FXZ A;  2V8S V;  2YEV C;  5AQV B;  4EB6 E;  4PJN A;  2V7L A;  4IDP A;  4TX5 A;  4YLH A;  1W0A A;  3NBX X;  5C3J A;  3KVB A;  3N9N A;  3LFM A;  2PJQ A;  4L0R A;  4E7Z A;  5LHG B;  1MIY A;  2RA1 A;  3N9Q A;  4YSX A;  1VCS A;  2IC9 A;  2VVN A;  5TAO A;  2ZM6 T;  4JI3 T;  2MYS A;  2WZH A;  2N1G A;  4I4T E;  4F6R C;  4DUY T;  1QLB A;  2E9X D;  2X9X A;  4HWC A;  3SOL A;  1MMA A;  2XM2 A;  3NKZ A;  4IDZ A;  1MMN A;  2XQ7 A;  5DJQ C;  2ZM8 A;  4DV1 T;  4B3R T;  4I55 E;  2A9U A;  4V1A v;  2Y8D A;  2UU9 T;  2BVM A;  4YHH T;  5LYJ E;  3TLV A;  4X65 T;  2X51 A;  4XAX B;  2M67 A;  2K5B B;  2FJA A;  3LDQ B;  3EAB A;  2L8K A;  3O9X A;  5L3F B;  2YDS A;  3AXJ B;  4HFE A;  2XTL A;  4EV6 A;  4DV6 T;  1IBK T;  4Q25 A;  2H88 A;  1S94 A;  4LMK A;  4YTM A;  2WAU A;  2XUE A;  4C90 A;  1HCI A;  5KDM C;  3RH3 A;  1VOM A;  1G8X A;  3FBZ A;  3M65 A;  3AAA B;  4UIG A;  4EOZ B;  2LRL A;  4KBM B;  2WQY A;  1MND A;  2NP9 A;  3C98 B;  4UXN B;  3UU4 A;  4AKL A;  4DV7 T;  2CPT A;  2LLY A;  4IE5 A;  3N9P A;  3ZYM A;  2XHE B;  5IHY A;  3UUL A;  4Z91 A;  4MBQ A;  2DHR A;  4QX8 B;  4PFO A;  5HXR A;  2XQ3 A;  1BR4 A;  2V7I A;  2C0S A;  3T8O A;  4PFP A;  3JC6 D;  3NZP A;  4HTE A;  3HL6 A;  2E9X C;  1ZKE A;  2LKG A;  3LSV A;  2N9D A;  2NWB A;  4GIW A;  4GYR A;  5FXV A;  2LOP A;  3I9Y A;  4B3M T;  2IAK A;  4LFB T;  2FJD A;  4YHJ A;  3WI3 A;  2BKN A;  4YY3 T;  3ESL A;  2MBG A;  2YIN A;  2YU1 A;  3I1A A;  4DV5 T;  4EIW A;  1NWM X;  3RX6 A;  1FMW A;  2NTX A;  2Y48 B;  4EXT A;  3UTK A;  4ZI3 D;  5IUX A;  3RC3 A;  1BR0 A;  4O2B E;  2ACX A;  1WYC A;  3Q2M A;  2JQQ A;  2R6G F; 
#chains in the Genus database with same CATH homology
 1N34 T;  4KHP T;  2F4V T;  1HNZ T;  4OX9 T;  4LF4 T;  1HNX T;  4LF7 T;  4DR3 T;  4LF9 T;  4AQY T;  2UUB T;  1XMQ T;  3OTO T;  2UXD T;  2UXB T;  1XNR T;  4LFC T;  4LF6 T;  4NXN T;  1FJG T;  2UUA T;  4LF8 T;  4JI6 T;  4JI0 T;  4GKJ T;  4B3S T;  2VQF T;  1N33 T;  4JI3 T;  5BR8 T;  3T1H T;  4JI4 T;  4JV5 T;  4DR5 T;  4DV2 T;  1IBL T;  5LMU T;  4DR2 T;  2ZM6 T;  4DR7 T;  4DUY T;  4JI5 T;  4NXM T;  4B3T T;  4X64 T;  4DV1 T;  2E5L T;  4LF5 T;  1J5E T;  2UU9 T;  4YHH T;  4X65 T;  4X66 T;  4LFA T;  1HR0 T;  5LMN T;  4DR6 T;  4DV6 T;  1N32 T;  1XMO T;  1IBK T;  4JYA T;  4DV0 T;  1N36 T;  4K0K T;  4DR4 T;  4JI7 T;  1HNW T;  4DV7 T;  2UXC T;  4DR1 T;  4DUZ T;  4GKK T;  5IWA T;  2UUC T;  1I94 T;  4DV3 T;  3T1Y T;  4B3M T;  4JI2 T;  4X62 T;  4B3R T;  4LFB T;  4YY3 T;  4DV5 T;  1IBM T;  2VQE T;  4JI8 T;  1XNQ T;  4JI1 T;  4DV4 T;  2HHH T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...