3FXEB

Crystal structure of interacting domains of icmr and icmq (seleno-derivative)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
b'TDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein IcmQ
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Unknown function
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fxeB00
1IJ6A 2IC6A 1LRZA 4L0RA 2KWIB 2X9WA 2C5KT 4EYYR 2X9XA 1IJ5A 3P7IA 3S4UA 2C5JA 2CA5A 3FXDB 1H7CA 3CKDA 3FXEB 2C5IT 3L3PA 3QK6A 2K48A 1Z0PA 2XTLA 3N5LA 2G0UA 3QUJA 4DNDA 3MXZA 4CQIA 1LVFA 4B6XA 2KWHA 4J2CA 2IC9A 1ZKEA 1QSDA 2X9YA 4FI5A 3CVRA 3TKLB 2MBGA
chains in the Genus database with same CATH superfamily
3ANWA 3EDVA 2PTFA 3EDUA 2J62A 3RC8A 2ODVA 5ABFB 4X5TA 1J5WA 3AXJA 4AI6A 3RKGA 1MMDA 2MAWA 3MZKB 2L8KA 2VB6A 2BKPA 3JADA 1Z0PA 2WAUA 4WZXA 2HH7A 3UU3A 2JQHA 4PK6A 1N33T 2DL1A 1QUUA 4LMKA 2UUAT 2K24A 3PV0F 5FL1A 2W2UA 2C5JA 4V1Av 2H7VC 3L09A 4AISA 2CHOA 4EXTA 4B3RT 5AQOB 4YLHA 2JQKA 5E0OA 4LF5T 2CXFA 5C8YE 4IDQA 2I0MA 4X1YE 2HHHT 2YKSA 4EZHA 5HXEA 2WBLA 2OA5A 3FXDB 2VVNA 2BBJA 1HFAA 2IAKA 3SRZA 1OEDC 2CBJA 5J2UE 4Z91A 1JNZA 3HI2A 5JDGA 3OYZA 4P0BA 4ADZA 5LOVE 2LRKA 2W67A 5J0ZA 2HPJA 2UXXB 4YTMA 2BDEA 3QB5K 3GA8A 3PTRB 3OJAA 3HKBE 1LVFA 2E5LT 4M1PA 3J9X1 5LYJE 4B3ST 2PG8A 2KZ7B 1UK5A 2CXLA 3ZYKA 4AKRB 3KBTA 4UEMA 1VCTA 2V6YA 2XQYA 4QH1A 5LGTB 3CQCB 4PJJA 3Q5EA 1R8IA 2WDVA 3LBXA 2CM0A 3MKDA 4ZS3A 3G06A 3RQUA 4UIGA 5JDHA 4HWDA 4JEHB 3AE6A 4YTPA 4IE0A 3O1IA 2FJBA 4CXWA 3ZN1B 3N2OA 3L8RA 3RIAA 3A5XA 3LJCA 3D0TA 4XZCA 5LHHB 2XY8B 5LNKA 3MJXA 2F4VT 5HCMA 3I0QA 3ZMZB 2DLRA 5LJMA 4KX6A 4OFZA 4QXCB 4YY3T 4HFIA 3IEEA 5LHIB 2EHOB 5L3EB 3RYFE 5JDNA 4LF7T 2LKHA 4WNKA 3R84B 2LEHA 2X9WA 4U7IA 1YQ3A 1GQEA 2JRKA 3JC6C 2NW8A 5ABEA 2K5BB 3EAMA 3LK42 1CUNA 3PJAJ 1WRDA 3NZPA 3UUXB 3PUVF 2IC9A 3ZLIA 3C4XA 1KEYA 4UVAB 2VK9A 4ZEYA 4HEAA 1OEDB 3RYCE 2K9AA 4QX8B 2XZEA 5BR8T 3JC6D 2QRXA 3UT5E 5F5WA 2MYSA 4IREA 2WZHA 5FXWA 5AFUL 3M3ZB 3TLTA 4HWCA 3RX6A 4YSZA 1DU2A 2D2SA 2WU2A 1IJ6A 4JI6T 4GYSA 2KNDA 2VKJA 4X62T 3KINB 4P1NA 1SUMB 1S35A 5C2TA 1ZV4X 2XTLA 5L4EA 4TWFA 2BS3A 3TLUA 1WCRA 5LCYA 5J1GA 4L0RA 2VVSA 3ZN0B 3K1SA 5H6RB 4JI3T 1OXZA 4C90A 3ZCIA 5JREA 4GKJT 4U3CA 3C50A 4L9IA 5CJ5A 2CBIA 2WY2A 4DNDA 2C0SA 3DJBA 2B76A 1YW0A 1BR0A 5AQQB 2J1DG 4OYKA 3SFEA 5FNVE 4OHFA 2VQFT 3FHNA 5ABFA 4GK5E 5JTGA 5CA1E 1FMWA 2CMRA 4QKNA 2VWAA 2W4XA 2LM9A 2J4GA 5DQWA 2A9UA 4PW8A 4ZI7E 4GK0E 2X51A 1IBMT 2JMHA 1XDOA 2FJEA 1Y01A 5L3BB 3MACA 2JQ9A 3L39A 1NEKA 5KMGP 4ERRA 2X9HA 3CPZA 3UFGA 3ONJA 4DO0A 1CHUA 1HTJF 3NBXX 3AA0B 2V5DA 2YDRA 2Y6XA 5HWYA 3V5UA 3RC3A 2W66A 4NUUA 4IL4A 3UFEA 3AEBA 2V7IA 4U2YA 4DR2T 2X0HA 4IE7A 2VL0A 1N36T 5LBMA 2QVAA 3K3QC 2YINA 3CWZB 2WQYA 4AKHA 2MBGA 3ZMVB 2WSSV 3PDYA 1OWAA 5LBQB 4PNIA 3ZC1A 3I9WA 5C3JA 1WLXA 4CXYA 1JNRA 4E7ZA 2RPAA 1BR2A 2E9XA 3T8OA 3VR8A 1MNEA 3Q5DA 2XQ6A 1LVKA 1J5ET 4K0UA 2R6GF 2Y48B 5HWXA 4B6XA 1IAPA 2X9YA 3OVUA 3RF1A 5KDMC 3I0OA 3UQ4A 5H6QB 3BQIA 4XAXB 1W0AA 1IJ5A 2LSKA 2V7MA 3KV9A 3PUSA 4YT0A 1HG2A 3AVRA 3U3IA 4CN4A 4JI1T 2LOSA 2D0TA 3TLSA 5BMVE 4LFBT 2YU2A 1YKHB 1HNWT 4COFA 3N9PA 3R6NA 1UGOA 3UUNA 4X1IE 4O2BE 3TLVA 3KDSE 2NW7A 4EYYR 1MIWA 1SA0E 3F2EA 4AIUA 1AJ3A 2PBIA 2CA5A 3OTOT 3N9LA 2X68A 1VCSA 4A97A 4WYVA 4BAYB 2EHOA 2D0UA 4PJNA 2WWVA 1E2AA 2W62A 3FZFB 4JV5T 3AEAA 1KNPA 4CZZB 2E9XC 5AQTB 5HXRA 1MMNA 2KT9A 3CQGB 4UVBB 5EK4A 3AEFA 3IF8B 2ACXA 3AAIA 5L3FB 2LSJA 4H9SE 4JEUB 5KX5E 4DV4T 5FVLA 4BJMA 4K0KT 3AEDA 1MMGA 5IYZE 3ZKRA 4NUVA 4IIJE 1T72A 4FJOA 3ZEFB 2CHNA 2V7JA 3QNUA 2MTQA 4ILCA 3CIRA 2VKOA 4AKGA 2DWGA 2E9XD 3HA4A 3H3MA 3ZT5A 3CX6B 4JUYA 4ZXLA 2VASA 4GOUA 2XQ5A 1WYCA 4ZI2D 2VURA 4X1KE 2I6HA 3AE8A 4OK0A 4AQFA 2AE9A 4IGUA 2UXCT 2BKOA 2EHOC 1G73A 3AA6B 5IUXA 1IBKT 3LK2B 2XJ7A 2ACZA 3P4WA 3RIFA 2IC6A 4Z90A 4H63H 2C5KT 1ZP0A 2N2NA 4P0AA 3AA7B 3KVBA 4DV6T 5FXVA 4EZ4A 4CN1A 3K8PC 1BR4A 3OPCA 3UU4A 4EAHA 3RIUA 4KHZF 3ZYMA 4IL9A 4HWIB 3LG7A 2EHOD 4JI2T 5LMNT 4LFAT 2V5CA 5JQGE 4AQYT 1YQ4A 3FBLA 1UUSA 4WW0A 3Q5XA 2E9XB 3ZJ1A 5FKYA 2XSAA 2JJ9A 2DHRA 3E22E 4AQFC 2LRLA 2JQQA 1OEDE 4BA9A 1D1CA 1MIYA 1FMVA 4EYUA 2IDOB 2ES0A 3WI3A 1KNZA 3RGLA 3P4QA 4QXBB 4JI0T 3RRWA 2D5UA 4LF6T 4KP3C 3IBPA 1SHZC 3NRXA 2KSRA 1HS7A 1E1HB 4LMLA 3JCFA 4ISTA 2HN2A 5LMUT 2BBHA 4U2ZA 4A98A 4KMCA 2G0UA 5JR9B 4L5GA 3N9QA 1VRBA 4JYAT 3VKGA 1D0ZA 3RIUC 3RQWA 4I4TE 4JI8T 3SOLA 5CA0E 5HEJA 2XQ8A 4LF8T 1I94T 2N1GA 1N32T 2ZM2A 1ZOYA 3MXZA 3C64A 2BS2A 2OV9A 3O1HA 4QHOA 1QLBA 2CRBA 2YU1A 3AEEA 4YFSA 3K3NA 1WYBA 1XMOT 2Q9QA 3HR0A 2UXDT 3FZLB 2WWUA 4IDZA 3NKZA 2IIUA 3E0ZA 1X9BA 2XAQB 3N9OA 3N9NA 4WBOA 3OBVE 2QGSA 3PU3A 2DI4A 5LG4A 2QA7A 3AA1B 3ZMUB 4DBQA 3AAEB 1H7CA 3PU8A 3HKCE 2ZMAA 2NOXA 5AQSB 5AQKB 1HX8A 1NAFA 1YKEB 5HEHA 5L2LA 3AE2A 2LJLA 3VRAA 4G63A 4DR5T 3IHRA 5DABA 1E7PA 1SE7A 3UQ7A 1MIVA 4TUYE 5TAOA 4PAGA 1UX5A 4E7SA 5LGUB 4TV9E 4ZHQE 4IE4A 3VU7H 4WBNE 3TLWA 2V6XA 5FP3A 4CI2B 4ANJA 3ONXA 3ZYLA 2DCFA 3AE4A 3AE7A 1U5PA 4TWHA 3F57A 1YXRA 1WR0A 4UV8B 1QSDA 4A5XA 3TKLB 4U74A 2WM9A 3M65A 4CI3B 3FB2A 4DUYT 5GONE 3NRYA 4YSYA 3ZSSA 4HFEA 4YTNA 3OKQA 3X1DA 3O4XE 1EZ3A 1U4QA 3AE3A 1L0VA 4U7YA 2JPFA 2Q9QD 4DV1T 3ZJ2A 4HFCA 4AQGA 3UU6A 2YK0A 4I43B 4I0UA 2VL8A 2IMLA 2XASB 1Z8UA 4H9QC 2CCQA 4LFCT 3P7IA 4PJLA 5LGNB 4MALA 1KFYA 2K48A 5LB7B 2CXDA 3AAAB 1ZHCA 4FI5A 3VKHA 2XAFB 1W09A 2ZM0A 4UV9B 4ZOLE 2CWYA 2M6BA 3RLFF 2XHEB 4PFOA 4CXXA 4ISSA 5JRCB 2HN1A 3UU8A 3O9XA 2XQ4A 4UR9A 5HCJA 4A56A 1XMQT 5A1LA 3LSVA 1LRZA 2V1DB 5EK3A 3BQKA 2X9XA 2FBWA 5FVKA 3RH3A 3HL6A 4U72A 2ZLYA 2WB5A 3RYIE 2CEAA 2CE7A 2V7LA 4TN7B 5HEUA 4BJNA 2DWKA 5L4HA 3UUBA 3AE9A 3P50A 4JI4T 3UU5A 1WR6A 4PJMA 3DP7A 1MNDA 2YEVC 3CX8B 2Q9QB 4DV5T 4EV6A 2BG9B 1O3XA 2NR4A 2FJDA 4MHCA 2LT3A 4AKLA 3HKEE 1G8XA 2L3LA 4J2CA 1ZKEA 5FXZA 3N9MA 4PFPA 1HNXT 3AE5A 3PJAA 2AXDS 4NXMT 5LJNA 2FUPA 5ETWA 3QUJA 5FY1A 5FY7A 2DNXA 5JR9A 4JI7T 4IDOA 4ZZBA 2WDQA 2CLYB 4GYRA 1IBLT 4X65T 5LG3A 4EGWA 5FL0A 3GMIA 2C5IT 3NWIA 1KF6A 5LXTE 2V8SV 2B1EA 2A3DA 3V5SA 1VOMA 2LM2A 2XM1A 1HX1B 4H9NC 4G2AA 3A8YC 2PJQA 3KVAA 4AXPA 5FYMA 2LHNA 3ONLC 4ZI2C 4U31A 2W0GA 4GKKT 2LLYA 3ZT6A 4DR4T 2XUEA 2H88A 4ILUA 3O1JA 2YDSA 3DTOA 3PUGA 4KHPT 1UURA 3WAKA 1XNQT 2X0YA 4HGAA 2XQ3A 3KV4A 3P4PA 3VHLA 5J2TE 2E2AA 3P8CD 5JR9C 2M67A 4TZ4C 3F31A 3P4RA 4B3MT 4O8SA 2H3RA 4IHJE 2LE8A 1D1AA 2BS4A 4ILBA 1M7KA 4ZS2A 5HAXA 1BR1A 4EOZB 2MOZA 2BVMA 3MK7C 4UF0B 3GN5B 3ZSTA 3GWHA 4X64T 2XAHB 5AQVB 3PURA 2A2FX 2RA1A 2LSGA 5KXJA 4TNWA 2H7OA 1LKXA 5AQJB 2V26A 5CGMA 2X0LB 3RYHE 3ZCJA 3U78A 5L3CB 4DR7T 4DMWA 4GIWA 3ZT7A 3T1HT 2N9DA 2ZM6T 2WU5A 3ZMTB 3FZHB 4I50E 4DMVA 3PE0A 4HFHA 3EUHA 4QWNB 4DV0T 1NWMX 4ZZCA 4O4LE 4DV7T 3VR9A 5AQHB 2X66A 2WMNA 4C91A 3P4SA 4KBMB 3WAJA 4DR3T 4QX7B 5DQVA 3RRCA 4UVCB 1XDPA 5CB4E 3J7Yq 3QB5A 1HR0T 4DVDA 5L3DB 3CMLA 4QH5A 1YD8G 2IHR1 3A7MA 2HPLA 1NENA 1Y64B 3RI5A 2UU9T 4HWFA 2XPKA 3QK6A 2YN6A 5JRCA 4TV8E 2JIWA 4IE5A 4TX5A 5JVDE 4U33A 1FIOA 4UELA 3AVSA 3OYXA 2YOEA 2VQET 4YHHT 2YDQA 2A72A 4LMJA 3Q9DA 2IUBA 3BQLA 5IHYA 5AQRB 3PUQA 3PUXF 3LK3B 3JAEA 5EZYE 2W00A 4LF4T 4F6RC 2UUBT 2BG9A 2XAGB 3QOFA 2UUCT 1B7TA 1UX4A 3IA3A 2ODUA 2J47A 4YSXA 3LDQB 2XSBA 4PK5A 3ZMSB 3ABVA 4HN9A 1D0YA 3I9YA 2LSIA 4AKIA 2ZM8A 4JBWF 3N2GE 2Y8DA 1S94A 1US7B 4H9PC 2CWOA 2NP9A 2KWHA 2KINB 2VKDA 2WZIA 3UTKA 1M62A 2KWIB 4KUMB 3B5MA 2W61A 2IW5B 4ASKA 4O2AE 5LP6E 1V9DA 5HXCA 2V7KA 3JAFA 2WDRA 1XWMA 3AEGA 3ANWB 3CX7B 2Z6EA 4I55E 4O4IE 5AQFB 4HFVA 3AXJB 2X67A 5F8PA 1KK7A 2KLQA 5F3JA 2NW9A 2PFVA 4HE8A 2Q9QC 2BZBA 2BG9C 2QYWA 4LF9T 3FZKB 4DR1T 4H9OC 3B13A 1I6ZA 3C51A 3QC9A 2WCAA 4X20E 2WMOA 4ZI3C 1HCIA 1T8BA 5L47A 5ABGA 4IDNA 4QH4A 2BG9E 5CFBA 4MFRA 4IDPA 5DJQC 2UXBT 2XQ9A 3NZQA 5JH7E 3C4WA 4YHJA 2CLYC 2LSYA 4DUZT 1MMAA 1IZNB 4HTEA 4P09A 5HEGA 2SPCA 4EEDA 4DBRA 5AQGB 3CQXC 4EEBA 3UUMA 5LHGB 4ZI3D 5EK2A 5ABHA 3H37A 3MA9A 3ZPOA 4UF0A 4ILAA 1UCUA 3GN5A 2XM2A 3T1YT 1D0XA 3W15B 1FJGT 3CVRA 1KNRA 3KV5A 3Q2MA 4JLEA 3CK6A 2LOPA 5HEOA 3PUAA 1HNZT 1T7SA 3EI0A 3C4ZA 5FMNA 2V6YB 4PK4A 4DV3T 3ETVA 3AE1A 3LBXB 2GK9A 4CI1B 5AQNB 4XBFB 4Q25A 3LFMA 1D1BA 4NPPA 3CKDA 3L3PA 3ETUA 5JDLA 3PUZF 3KFWX 3VRBA 3SS1A 2W63A 4QXHB 4EIWA 5HYAA 2P9BA 3EVYA 4F8HA 3SFDA 3N2KE 5JDQA 5JDMA 2KXPB 3ESLA 1XZYA 2XQAA 2H89A 4DR6T 3NVOA 5LA6E 2VKHA 3FZMB 2I59A 5HXSA 4H63V 2KMFA 4TNVA 4O4JE 4OYJA 1HG5A 3KBUA 2D9DA 4NIQA 3N5LA 5M4YA 4EB6E 4MLKA 1W9RA 4DV2T 3PUWF 2OLTA 1X79A 2FJAA 4KI0F 1HF8A 4B3TT 5AQUB 4DIDB 2K3WA 3E08A 3ZC0A 2L9QA 4HFBA 4HFDA 4HKAA 4IT4A 2XQ7A 4CQIA 3RHWA 2E5VA 4MBQA 5JDFA 2XAJB 4N78D 1W0BA 1T98A 3PUYF 3AECA 3H3AA 1FEWA 2BVLA 3B57A 2LKGA 5ADXL 2M6IA 3FXEB 2JMKA 4YJ2E 3I1AA 2NTYA 3FBZA 5AQPB 4IE6A 1N34T 3Q5WA 4O4HE 2E8IA 1WFDA 4X66T 3BK9A 4Z8XA 3S4UA 3HKDE 5HXHA 4YJ3E 3UULA 5L3GB 3C98B 5AQIB 4NXNT 2NTXA 3SWHA 4H9RC 4UXNB 5IWAT 2WP9A 2BKNA 4YXDA 4OX9T 2LHRA 2NWBA 4JI5T 1XNRT 3K3OA 5AQMB 2WS3A 2CPTA 1OEDA 5FXXA 3RPUA 5AQLB 2RP4A 4TWDA 3EABA 2MPKA 3AB3B 3EHZA 1J1JA 3RKOA 1ZEEA 5FY0A 3KV6A 4CN6A 4HWHA 2UXNB
chains in the Genus database with same CATH topology
4IE5A 3ANWA 4TX5A 3EDVA 4U74A 5JVDE 3EDUA 2WM9A 3RC8A 1LVKA 2ODVA 1FIOA 4UELA 3M65A 4CI3B 3FB2A 3AVSA 3OYXA 2A72A 4AI6A 4K0UA 1MMDA 3MZKB 5GONE 2L8KA 2VB6A 3NRYA 1Z0PA 3Q9DA 2WAUA 2Y48B 3BQLA 5IHYA 5HWXA 2HH7A 4B6XA 1IAPA 3PUQA 4PK6A 2X9YA 3LK3B 5KDMC 3I0OA 3OKQA 1QUUA 5EZYE 5H6QB 2W00A 3O4XE 3BQIA 4XAXB 1EZ3A 1U4QA 4F6RC 2K24A 1IJ5A 2JPFA 2C5JA 2LSKA 2V7MA 3KV9A 2H7VC 4V1Av 2Q9QD 3L09A 4EXTA 3PUSA 1HG2A 3AVRA 3U3IA 3ZJ2A 5LGTB 2XAGB 2LOSA 2D0TA 5BMVE 4AQGA 4YLHA 5E0OA 2YU2A 2YK0A 4I43B 1YKHB 1B7TA 2CXFA 1UX4A 5C8YE 2VL8A 3N9PA 3R6NA 3UUNA 2ODUA 2XASB 4X1IE 4O2BE 4X1YE 4PK5A 3KDSE 2NW7A 4H9QC 3ZMSB 2CCQA 4EYYR 4HN9A 1D0YA 1MIWA 1SA0E 3F2EA 4EZHA 3P7IA 5HXEA 2WBLA 1AJ3A 2OA5A 2PBIA 3I9YA 2CA5A 3FXDB 4PJLA 5LGNB 2LSIA 4AKIA 3N9LA 2ZM8A 4MALA 2K48A 2X68A 3N2GE 2Y8DA 1HFAA 2IAKA 1S94A 3SRZA 1US7B 4H9PC 4BAYB 2EHOA 2CWOA 2NP9A 2KWHA 2CXDA 2D0UA 3AAAB 1ZHCA 4FI5A 2KINB 4PJNA 3VKHA 2VKDA 2XAFB 2W62A 3UTKA 2KWIB 2ZM0A 5J2UE 4KUMB 5JDGA 3HI2A 2W61A 3OYZA 2IW5B 4CZZB 4P0BA 2E9XC 4ADZA 5LOVE 4ASKA 4UV9B 4ZOLE 2CWYA 5HXRA 1MMNA 2KT9A 3CQGB 2HPJA 2UXXB 2XHEB 4O2AE 4UVBB 2BDEA 4PFOA 5EK4A 3GA8A 4ISSA 4CXXA 5LP6E 1V9DA 5JRCB 3IF8B 3PTRB 3OJAA 3HKBE 5HXCA 3O9XA 2V7KA 1LVFA 2ACXA 3AAIA 5L3FB 4A56A 2LSJA 4H9SE 4JEUB 4M1PA 3ANWB 3CX7B 3J9X1 5KX5E 5LYJE 5A1LA 1LRZA 2PG8A 2KZ7B 2CXLA 2Z6EA 4BJMA 2V1DB 4I55E 3BQKA 4O4IE 5EK3A 2X9XA 3ZYKA 4AKRB 4HFVA 3KBTA 1MMGA 5IYZE 4UEMA 2X67A 4NUVA 3RH3A 3HL6A 4U72A 5F8PA 4IIJE 1KK7A 2XQYA 2ZLYA 4FJOA 3RYIE 2KLQA 5F3JA 3CQCB 2CEAA 2CE7A 2PFVA 4HE8A 2V7JA 2V7LA 4PJJA 2NW9A 2Q9QC 4TN7B 2BZBA 2MTQA 2DWKA 4BJNA 2VKOA 4AKGA 3LBXA 2DWGA 2E9XD 2CM0A 3HA4A 1WR6A 3CX6B 4H9OC 4PJMA 3MKDA 4JUYA 4ZS3A 3DP7A 3B13A 1MNDA 4UIGA 2YEVC 2VASA 5JDHA 3CX8B 2Q9QB 3C51A 4GOUA 4JEHB 3QC9A 1WYCA 4ZI2D 1O3XA 4X20E 2WMOA 4X1KE 4IE0A 4ZI3C 4MHCA 1HCIA 2LT3A 4AKLA 3O1IA 3HKEE 4OK0A 4AQFA 1G8XA 4CXWA 3ZN1B 3N2OA 4IGUA 2L3LA 4J2CA 1ZKEA 3A5XA 3LJCA 3D0TA 4MFRA 5DJQC 5FXZA 3N9MA 4XZCA 5LHHB 5LNKA 3NZQA 2EHOC 5JH7E 4PFPA 1G73A 3MJXA 3C4WA 3AA6B 3I0QA 3ZMZB 2DLRA 5LJMA 5LJNA 4YHJA 4OFZA 4QXCB 2CLYC 3IEEA 2LSYA 5ETWA 5LHIB 3QUJA 5FY1A 1MMAA 1IZNB 5FY7A 4HTEA 2EHOB 2DNXA 4P09A 5L3EB 2SPCA 3LK2B 5JR9A 3RYFE 5JDNA 4DBRA 4WNKA 3R84B 2IC6A 2LEHA 2CLYB 4GYRA 3CQXC 2X9WA 4H63H 2C5KT 2N2NA 3UUMA 5LHGB 4P0AA 2JRKA 4ZI3D 3AA7B 3KVBA 3GMIA 5FXVA 4EZ4A 3JC6C 2NW8A 5EK2A 3H37A 3K8PC 2K5BB 1BR4A 3LK42 1CUNA 2C5IT 5LXTE 3MA9A 1WRDA 3ZPOA 4UF0A 2B1EA 2A3DA 1UCUA 3GN5A 3NZPA 3UUXB 4EAHA 1D0XA 3ZYMA 3W15B 3LG7A 2IC9A 3V5SA 2EHOD 1VOMA 3CVRA 3KV5A 3Q2MA 4JLEA 3ZLIA 2LOPA 3ZEFB 3PUAA 4H9NC 4G2AA 3C4XA 2PJQA 4UVAB 3C4ZA 3KVAA 5FMNA 4AXPA 2VK9A 4HEAA 4PK4A 5JQGE 3ETVA 5FYMA 3RYCE 2LHNA 3FBLA 4ZI2C 2K9AA 4QX8B 2W0GA 4WW0A 3Q5XA 2E9XB 3ZJ1A 3LBXB 2GK9A 4CI1B 2JJ9A 2XUEA 3JC6D 2DHRA 3E22E 4AQFC 2JQQA 4XBFB 3UT5E 2MYSA 4BA9A 4ILUA 3LFMA 1D1BA 1D1CA 5FXWA 3O1JA 3CKDA 3DTOA 1MIYA 3PUGA 1FMVA 3L3PA 4EYUA 3ETUA 5AFUL 2ES0A 3WAKA 3WI3A 3RX6A 5JDLA 4HGAA 1KNZA 2D2SA 3KFWX 4QXBB 3KV4A 3SS1A 3VHLA 3RRWA 1IJ6A 2W63A 4GYSA 4QXHB 4EIWA 5J2TE 5HYAA 2KNDA 2D5UA 2P9BA 2VKJA 3EVYA 3P8CD 4KP3C 5JR9C 2M67A 3IBPA 1SHZC 3NRXA 3KINB 4TZ4C 1HS7A 1S35A 1E1HB 4ISTA 3N2KE 1ZV4X 5JDQA 5JDMA 3F31A 2KXPB 2XTLA 4KMCA 2G0UA 3ESLA 5JR9B 5LA6E 4O8SA 2H3RA 4IHJE 2LE8A 1D1AA 4L5GA 3N9QA 5LCYA 4ZS2A 1VRBA 5HAXA 2VKHA 5J1GA 1BR1A 1D0ZA 2I59A 4L0RA 3ZN0B 5HXSA 3VKGA 4H63V 5H6RB 2KMFA 1OXZA 4C90A 4EOZB 4I4TE 3ZCIA 4O4JE 5JREA 3SOLA 4OYJA 2MOZA 2BVMA 5CA0E 1HG5A 3KBUA 3MK7C 3C50A 4L9IA 2N1GA 3N5LA 4UF0B 4DNDA 5M4YA 2ZM2A 4EB6E 3GN5B 3MXZA 3C64A 2C0SA 3O1HA 3DJBA 3GWHA 4MLKA 2XAHB 4QHOA 1YW0A 1X79A 2YU1A 1BR0A 4YFSA 3K3NA 2J1DG 4OYKA 1WYBA 5FNVE 3PURA 2A2FX 2RA1A 4OHFA 2LSGA 3FHNA 1HF8A 4GK5E 2Q9QA 5CA1E 1FMWA 2CMRA 2H7OA 3HR0A 4QKNA 1LKXA 3E08A 2WWUA 3ZC0A 2VWAA 2L9QA 4HKAA 4IDZA 2V26A 4CQIA 3E0ZA 2LM9A 4MBQA 2X0LB 2XAQB 5JDFA 5DQWA 2XAJB 3RYHE 4N78D 4PW8A 4ZI7E 3N9OA 3N9NA 4GK0E 4WBOA 3OBVE 3ZCJA 1T98A 2X51A 2QGSA 2JMHA 3U78A 5L3CB 3PU3A 3H3AA 5L3BB 2DI4A 1FEWA 5LG4A 2QA7A 3AA1B 3ZMUB 4DMWA 2BVLA 3MACA 3B57A 4GIWA 4DBQA 3AAEB 1H7CA 2N9DA 3PU8A 3ZMTB 5ADXL 3FXEB 3HKCE 2JMKA 4YJ2E 3I1AA 5KMGP 2NTYA 2ZMAA 2NOXA 2X9HA 3CPZA 4ERRA 3FBZA 4I50E 4DMVA 1HX8A 1NAFA 4DO0A 1HTJF 4IE6A 3NBXX 1YKEB 3AA0B 3Q5WA 2Y6XA 4O4HE 3PE0A 5HWYA 5L2LA 2E8IA 2LJLA 3EUHA 3V5UA 4QWNB 3RC3A 4NUUA 1NWMX 4O4LE 3BK9A 4G63A 4Z8XA 3S4UA 3UFEA 3HKDE 5HXHA 4YJ3E 3UULA 3IHRA 2V7IA 5DABA 5L3GB 2X66A 2WMNA 4IE7A 3C98B 4C91A 4KBMB 3WAJA 5LBMA 2NTXA 4QX7B 3K3QC 3SWHA 4H9RC 5DQVA 2YINA 4UXNB 4UVCB 3RRCA 1MIVA 3CWZB 4TUYE 5CB4E 5TAOA 4PAGA 3J7Yq 1UX5A 4E7SA 5LGUB 4AKHA 2MBGA 4DVDA 5L3DB 2LHRA 4TV9E 2NWBA 4IE4A 4ZHQE 3CMLA 3VU7H 1YD8G 3ZMVB 4WBNE 2WSSV 3PDYA 1OWAA 5LBQB 5FP3A 4PNIA 2HPLA 4CI2B 4ANJA 1Y64B 3K3OA 3ONXA 3ZYLA 2DCFA 3ZC1A 3I9WA 1WLXA 1U5PA 3QK6A 4CXYA 5FXXA 4E7ZA 3F57A 3RPUA 5JRCA 2RP4A 4TV8E 1BR2A 3AB3B 4UV8B 2E9XA 1ZEEA 5FY0A 3KV6A 3RKOA 3T8OA 1QSDA 2UXNB 1MNEA 3TKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ6 A;  2IC6 A;  1LRZ A;  4L0R A;  2KWI B;  2X9W A;  2C5K T;  4EYY R;  2X9X A;  1IJ5 A;  3P7I A;  3S4U A;  2C5J A;  2CA5 A;  3FXD B;  1H7C A;  3CKD A;  3FXE B;  2C5I T;  3L3P A;  3QK6 A;  2K48 A;  1Z0P A;  2XTL A;  3N5L A;  2G0U A;  3QUJ A;  4DND A;  3MXZ A;  4CQI A;  1LVF A;  4B6X A;  2KWH A;  4J2C A;  2IC9 A;  1ZKE A;  1QSD A;  2X9Y A;  4FI5 A;  3CVR A;  3TKL B;  2MBG A; 
#chains in the Genus database with same CATH topology
 3ANW A;  3EDV A;  2PTF A;  3EDU A;  2J62 A;  3RC8 A;  2ODV A;  5ABF B;  4X5T A;  1J5W A;  3AXJ A;  4AI6 A;  3RKG A;  1MMD A;  2MAW A;  3MZK B;  2L8K A;  2VB6 A;  2BKP A;  3JAD A;  1Z0P A;  2WAU A;  4WZX A;  2HH7 A;  3UU3 A;  2JQH A;  4PK6 A;  1N33 T;  2DL1 A;  1QUU A;  4LMK A;  2UUA T;  2K24 A;  3PV0 F;  5FL1 A;  2W2U A;  2C5J A;  4V1A v;  2H7V C;  3L09 A;  4AIS A;  2CHO A;  4EXT A;  4B3R T;  5AQO B;  4YLH A;  2JQK A;  5E0O A;  4LF5 T;  2CXF A;  5C8Y E;  4IDQ A;  2I0M A;  4X1Y E;  2HHH T;  2YKS A;  4EZH A;  5HXE A;  2WBL A;  2OA5 A;  3FXD B;  2VVN A;  2BBJ A;  1HFA A;  2IAK A;  3SRZ A;  1OED C;  2CBJ A;  5J2U E;  4Z91 A;  1JNZ A;  3HI2 A;  5JDG A;  3OYZ A;  4P0B A;  4ADZ A;  5LOV E;  2LRK A;  2W67 A;  5J0Z A;  2HPJ A;  2UXX B;  4YTM A;  2BDE A;  3QB5 K;  3GA8 A;  3PTR B;  3OJA A;  3HKB E;  1LVF A;  2E5L T;  4M1P A;  3J9X 1;  5LYJ E;  4B3S T;  2PG8 A;  2KZ7 B;  1UK5 A;  2CXL A;  3ZYK A;  4AKR B;  3KBT A;  4UEM A;  1VCT A;  2V6Y A;  2XQY A;  4QH1 A;  5LGT B;  3CQC B;  4PJJ A;  3Q5E A;  1R8I A;  2WDV A;  3LBX A;  2CM0 A;  3MKD A;  4ZS3 A;  3G06 A;  3RQU A;  4UIG A;  5JDH A;  4HWD A;  4JEH B;  3AE6 A;  4YTP A;  4IE0 A;  3O1I A;  2FJB A;  4CXW A;  3ZN1 B;  3N2O A;  3L8R A;  3RIA A;  3A5X A;  3LJC A;  3D0T A;  4XZC A;  5LHH B;  2XY8 B;  5LNK A;  3MJX A;  2F4V T;  5HCM A;  3I0Q A;  3ZMZ B;  2DLR A;  5LJM A;  4KX6 A;  4OFZ A;  4QXC B;  4YY3 T;  4HFI A;  3IEE A;  5LHI B;  2EHO B;  5L3E B;  3RYF E;  5JDN A;  4LF7 T;  2LKH A;  4WNK A;  3R84 B;  2LEH A;  2X9W A;  4U7I A;  1YQ3 A;  1GQE A;  2JRK A;  3JC6 C;  2NW8 A;  5ABE A;  2K5B B;  3EAM A;  3LK4 2;  1CUN A;  3PJA J;  1WRD A;  3NZP A;  3UUX B;  3PUV F;  2IC9 A;  3ZLI A;  3C4X A;  1KEY A;  4UVA B;  2VK9 A;  4ZEY A;  4HEA A;  1OED B;  3RYC E;  2K9A A;  4QX8 B;  2XZE A;  5BR8 T;  3JC6 D;  2QRX A;  3UT5 E;  5F5W A;  2MYS A;  4IRE A;  2WZH A;  5FXW A;  5AFU L;  3M3Z B;  3TLT A;  4HWC A;  3RX6 A;  4YSZ A;  1DU2 A;  2D2S A;  2WU2 A;  1IJ6 A;  4JI6 T;  4GYS A;  2KND A;  2VKJ A;  4X62 T;  3KIN B;  4P1N A;  1SUM B;  1S35 A;  5C2T A;  1ZV4 X;  2XTL A;  5L4E A;  4TWF A;  2BS3 A;  3TLU A;  1WCR A;  5LCY A;  5J1G A;  4L0R A;  2VVS A;  3ZN0 B;  3K1S A;  5H6R B;  4JI3 T;  1OXZ A;  4C90 A;  3ZCI A;  5JRE A;  4GKJ T;  4U3C A;  3C50 A;  4L9I A;  5CJ5 A;  2CBI A;  2WY2 A;  4DND A;  2C0S A;  3DJB A;  2B76 A;  1YW0 A;  1BR0 A;  5AQQ B;  2J1D G;  4OYK A;  3SFE A;  5FNV E;  4OHF A;  2VQF T;  3FHN A;  5ABF A;  4GK5 E;  5JTG A;  5CA1 E;  1FMW A;  2CMR A;  4QKN A;  2VWA A;  2W4X A;  2LM9 A;  2J4G A;  5DQW A;  2A9U A;  4PW8 A;  4ZI7 E;  4GK0 E;  2X51 A;  1IBM T;  2JMH A;  1XDO A;  2FJE A;  1Y01 A;  5L3B B;  3MAC A;  2JQ9 A;  3L39 A;  1NEK A;  5KMG P;  4ERR A;  2X9H A;  3CPZ A;  3UFG A;  3ONJ A;  4DO0 A;  1CHU A;  1HTJ F;  3NBX X;  3AA0 B;  2V5D A;  2YDR A;  2Y6X A;  5HWY A;  3V5U A;  3RC3 A;  2W66 A;  4NUU A;  4IL4 A;  3UFE A;  3AEB A;  2V7I A;  4U2Y A;  4DR2 T;  2X0H A;  4IE7 A;  2VL0 A;  1N36 T;  5LBM A;  2QVA A;  3K3Q C;  2YIN A;  3CWZ B;  2WQY A;  4AKH A;  2MBG A;  3ZMV B;  2WSS V;  3PDY A;  1OWA A;  5LBQ B;  4PNI A;  3ZC1 A;  3I9W A;  5C3J A;  1WLX A;  4CXY A;  1JNR A;  4E7Z A;  2RPA A;  1BR2 A;  2E9X A;  3T8O A;  3VR8 A;  1MNE A;  3Q5D A;  2XQ6 A;  1LVK A;  1J5E T;  4K0U A;  2R6G F;  2Y48 B;  5HWX A;  4B6X A;  1IAP A;  2X9Y A;  3OVU A;  3RF1 A;  5KDM C;  3I0O A;  3UQ4 A;  5H6Q B;  3BQI A;  4XAX B;  1W0A A;  1IJ5 A;  2LSK A;  2V7M A;  3KV9 A;  3PUS A;  4YT0 A;  1HG2 A;  3AVR A;  3U3I A;  4CN4 A;  4JI1 T;  2LOS A;  2D0T A;  3TLS A;  5BMV E;  4LFB T;  2YU2 A;  1YKH B;  1HNW T;  4COF A;  3N9P A;  3R6N A;  1UGO A;  3UUN A;  4X1I E;  4O2B E;  3TLV A;  3KDS E;  2NW7 A;  4EYY R;  1MIW A;  1SA0 E;  3F2E A;  4AIU A;  1AJ3 A;  2PBI A;  2CA5 A;  3OTO T;  3N9L A;  2X68 A;  1VCS A;  4A97 A;  4WYV A;  4BAY B;  2EHO A;  2D0U A;  4PJN A;  2WWV A;  1E2A A;  2W62 A;  3FZF B;  4JV5 T;  3AEA A;  1KNP A;  4CZZ B;  2E9X C;  5AQT B;  5HXR A;  1MMN A;  2KT9 A;  3CQG B;  4UVB B;  5EK4 A;  3AEF A;  3IF8 B;  2ACX A;  3AAI A;  5L3F B;  2LSJ A;  4H9S E;  4JEU B;  5KX5 E;  4DV4 T;  5FVL A;  4BJM A;  4K0K T;  3AED A;  1MMG A;  5IYZ E;  3ZKR A;  4NUV A;  4IIJ E;  1T72 A;  4FJO A;  3ZEF B;  2CHN A;  2V7J A;  3QNU A;  2MTQ A;  4ILC A;  3CIR A;  2VKO A;  4AKG A;  2DWG A;  2E9X D;  3HA4 A;  3H3M A;  3ZT5 A;  3CX6 B;  4JUY A;  4ZXL A;  2VAS A;  4GOU A;  2XQ5 A;  1WYC A;  4ZI2 D;  2VUR A;  4X1K E;  2I6H A;  3AE8 A;  4OK0 A;  4AQF A;  2AE9 A;  4IGU A;  2UXC T;  2BKO A;  2EHO C;  1G73 A;  3AA6 B;  5IUX A;  1IBK T;  3LK2 B;  2XJ7 A;  2ACZ A;  3P4W A;  3RIF A;  2IC6 A;  4Z90 A;  4H63 H;  2C5K T;  1ZP0 A;  2N2N A;  4P0A A;  3AA7 B;  3KVB A;  4DV6 T;  5FXV A;  4EZ4 A;  4CN1 A;  3K8P C;  1BR4 A;  3OPC A;  3UU4 A;  4EAH A;  3RIU A;  4KHZ F;  3ZYM A;  4IL9 A;  4HWI B;  3LG7 A;  2EHO D;  4JI2 T;  5LMN T;  4LFA T;  2V5C A;  5JQG E;  4AQY T;  1YQ4 A;  3FBL A;  1UUS A;  4WW0 A;  3Q5X A;  2E9X B;  3ZJ1 A;  5FKY A;  2XSA A;  2JJ9 A;  2DHR A;  3E22 E;  4AQF C;  2LRL A;  2JQQ A;  1OED E;  4BA9 A;  1D1C A;  1MIY A;  1FMV A;  4EYU A;  2IDO B;  2ES0 A;  3WI3 A;  1KNZ A;  3RGL A;  3P4Q A;  4QXB B;  4JI0 T;  3RRW A;  2D5U A;  4LF6 T;  4KP3 C;  3IBP A;  1SHZ C;  3NRX A;  2KSR A;  1HS7 A;  1E1H B;  4LML A;  3JCF A;  4IST A;  2HN2 A;  5LMU T;  2BBH A;  4U2Z A;  4A98 A;  4KMC A;  2G0U A;  5JR9 B;  4L5G A;  3N9Q A;  1VRB A;  4JYA T;  3VKG A;  1D0Z A;  3RIU C;  3RQW A;  4I4T E;  4JI8 T;  3SOL A;  5CA0 E;  5HEJ A;  2XQ8 A;  4LF8 T;  1I94 T;  2N1G A;  1N32 T;  2ZM2 A;  1ZOY A;  3MXZ A;  3C64 A;  2BS2 A;  2OV9 A;  3O1H A;  4QHO A;  1QLB A;  2CRB A;  2YU1 A;  3AEE A;  4YFS A;  3K3N A;  1WYB A;  1XMO T;  2Q9Q A;  3HR0 A;  2UXD T;  3FZL B;  2WWU A;  4IDZ A;  3NKZ A;  2IIU A;  3E0Z A;  1X9B A;  2XAQ B;  3N9O A;  3N9N A;  4WBO A;  3OBV E;  2QGS A;  3PU3 A;  2DI4 A;  5LG4 A;  2QA7 A;  3AA1 B;  3ZMU B;  4DBQ A;  3AAE B;  1H7C A;  3PU8 A;  3HKC E;  2ZMA A;  2NOX A;  5AQS B;  5AQK B;  1HX8 A;  1NAF A;  1YKE B;  5HEH A;  5L2L A;  3AE2 A;  2LJL A;  3VRA A;  4G63 A;  4DR5 T;  3IHR A;  5DAB A;  1E7P A;  1SE7 A;  3UQ7 A;  1MIV A;  4TUY E;  5TAO A;  4PAG A;  1UX5 A;  4E7S A;  5LGU B;  4TV9 E;  4ZHQ E;  4IE4 A;  3VU7 H;  4WBN E;  3TLW A;  2V6X A;  5FP3 A;  4CI2 B;  4ANJ A;  3ONX A;  3ZYL A;  2DCF A;  3AE4 A;  3AE7 A;  1U5P A;  4TWH A;  3F57 A;  1YXR A;  1WR0 A;  4UV8 B;  1QSD A;  4A5X A;  3TKL B;  4U74 A;  2WM9 A;  3M65 A;  4CI3 B;  3FB2 A;  4DUY T;  5GON E;  3NRY A;  4YSY A;  3ZSS A;  4HFE A;  4YTN A;  3OKQ A;  3X1D A;  3O4X E;  1EZ3 A;  1U4Q A;  3AE3 A;  1L0V A;  4U7Y A;  2JPF A;  2Q9Q D;  4DV1 T;  3ZJ2 A;  4HFC A;  4AQG A;  3UU6 A;  2YK0 A;  4I43 B;  4I0U A;  2VL8 A;  2IML A;  2XAS B;  1Z8U A;  4H9Q C;  2CCQ A;  4LFC T;  3P7I A;  4PJL A;  5LGN B;  4MAL A;  1KFY A;  2K48 A;  5LB7 B;  2CXD A;  3AAA B;  1ZHC A;  4FI5 A;  3VKH A;  2XAF B;  1W09 A;  2ZM0 A;  4UV9 B;  4ZOL E;  2CWY A;  2M6B A;  3RLF F;  2XHE B;  4PFO A;  4CXX A;  4ISS A;  5JRC B;  2HN1 A;  3UU8 A;  3O9X A;  2XQ4 A;  4UR9 A;  5HCJ A;  4A56 A;  1XMQ T;  5A1L A;  3LSV A;  1LRZ A;  2V1D B;  5EK3 A;  3BQK A;  2X9X A;  2FBW A;  5FVK A;  3RH3 A;  3HL6 A;  4U72 A;  2ZLY A;  2WB5 A;  3RYI E;  2CEA A;  2CE7 A;  2V7L A;  4TN7 B;  5HEU A;  4BJN A;  2DWK A;  5L4H A;  3UUB A;  3AE9 A;  3P50 A;  4JI4 T;  3UU5 A;  1WR6 A;  4PJM A;  3DP7 A;  1MND A;  2YEV C;  3CX8 B;  2Q9Q B;  4DV5 T;  4EV6 A;  2BG9 B;  1O3X A;  2NR4 A;  2FJD A;  4MHC A;  2LT3 A;  4AKL A;  3HKE E;  1G8X A;  2L3L A;  4J2C A;  1ZKE A;  5FXZ A;  3N9M A;  4PFP A;  1HNX T;  3AE5 A;  3PJA A;  2AXD S;  4NXM T;  5LJN A;  2FUP A;  5ETW A;  3QUJ A;  5FY1 A;  5FY7 A;  2DNX A;  5JR9 A;  4JI7 T;  4IDO A;  4ZZB A;  2WDQ A;  2CLY B;  4GYR A;  1IBL T;  4X65 T;  5LG3 A;  4EGW A;  5FL0 A;  3GMI A;  2C5I T;  3NWI A;  1KF6 A;  5LXT E;  2V8S V;  2B1E A;  2A3D A;  3V5S A;  1VOM A;  2LM2 A;  2XM1 A;  1HX1 B;  4H9N C;  4G2A A;  3A8Y C;  2PJQ A;  3KVA A;  4AXP A;  5FYM A;  2LHN A;  3ONL C;  4ZI2 C;  4U31 A;  2W0G A;  4GKK T;  2LLY A;  3ZT6 A;  4DR4 T;  2XUE A;  2H88 A;  4ILU A;  3O1J A;  2YDS A;  3DTO A;  3PUG A;  4KHP T;  1UUR A;  3WAK A;  1XNQ T;  2X0Y A;  4HGA A;  2XQ3 A;  3KV4 A;  3P4P A;  3VHL A;  5J2T E;  2E2A A;  3P8C D;  5JR9 C;  2M67 A;  4TZ4 C;  3F31 A;  3P4R A;  4B3M T;  4O8S A;  2H3R A;  4IHJ E;  2LE8 A;  1D1A A;  2BS4 A;  4ILB A;  1M7K A;  4ZS2 A;  5HAX A;  1BR1 A;  4EOZ B;  2MOZ A;  2BVM A;  3MK7 C;  4UF0 B;  3GN5 B;  3ZST A;  3GWH A;  4X64 T;  2XAH B;  5AQV B;  3PUR A;  2A2F X;  2RA1 A;  2LSG A;  5KXJ A;  4TNW A;  2H7O A;  1LKX A;  5AQJ B;  2V26 A;  5CGM A;  2X0L B;  3RYH E;  3ZCJ A;  3U78 A;  5L3C B;  4DR7 T;  4DMW A;  4GIW A;  3ZT7 A;  3T1H T;  2N9D A;  2ZM6 T;  2WU5 A;  3ZMT B;  3FZH B;  4I50 E;  4DMV A;  3PE0 A;  4HFH A;  3EUH A;  4QWN B;  4DV0 T;  1NWM X;  4ZZC A;  4O4L E;  4DV7 T;  3VR9 A;  5AQH B;  2X66 A;  2WMN A;  4C91 A;  3P4S A;  4KBM B;  3WAJ A;  4DR3 T;  4QX7 B;  5DQV A;  3RRC A;  4UVC B;  1XDP A;  5CB4 E;  3J7Y q;  3QB5 A;  1HR0 T;  4DVD A;  5L3D B;  3CML A;  4QH5 A;  1YD8 G;  2IHR 1;  3A7M A;  2HPL A;  1NEN A;  1Y64 B;  3RI5 A;  2UU9 T;  4HWF A;  2XPK A;  3QK6 A;  2YN6 A;  5JRC A;  4TV8 E;  2JIW A;  4IE5 A;  4TX5 A;  5JVD E;  4U33 A;  1FIO A;  4UEL A;  3AVS A;  3OYX A;  2YOE A;  2VQE T;  4YHH T;  2YDQ A;  2A72 A;  4LMJ A;  3Q9D A;  2IUB A;  3BQL A;  5IHY A;  5AQR B;  3PUQ A;  3PUX F;  3LK3 B;  3JAE A;  5EZY E;  2W00 A;  4LF4 T;  4F6R C;  2UUB T;  2BG9 A;  2XAG B;  3QOF A;  2UUC T;  1B7T A;  1UX4 A;  3IA3 A;  2ODU A;  2J47 A;  4YSX A;  3LDQ B;  2XSB A;  4PK5 A;  3ZMS B;  3ABV A;  4HN9 A;  1D0Y A;  3I9Y A;  2LSI A;  4AKI A;  2ZM8 A;  4JBW F;  3N2G E;  2Y8D A;  1S94 A;  1US7 B;  4H9P C;  2CWO A;  2NP9 A;  2KWH A;  2KIN B;  2VKD A;  2WZI A;  3UTK A;  1M62 A;  2KWI B;  4KUM B;  3B5M A;  2W61 A;  2IW5 B;  4ASK A;  4O2A E;  5LP6 E;  1V9D A;  5HXC A;  2V7K A;  3JAF A;  2WDR A;  1XWM A;  3AEG A;  3ANW B;  3CX7 B;  2Z6E A;  4I55 E;  4O4I E;  5AQF B;  4HFV A;  3AXJ B;  2X67 A;  5F8P A;  1KK7 A;  2KLQ A;  5F3J A;  2NW9 A;  2PFV A;  4HE8 A;  2Q9Q C;  2BZB A;  2BG9 C;  2QYW A;  4LF9 T;  3FZK B;  4DR1 T;  4H9O C;  3B13 A;  1I6Z A;  3C51 A;  3QC9 A;  2WCA A;  4X20 E;  2WMO A;  4ZI3 C;  1HCI A;  1T8B A;  5L47 A;  5ABG A;  4IDN A;  4QH4 A;  2BG9 E;  5CFB A;  4MFR A;  4IDP A;  5DJQ C;  2UXB T;  2XQ9 A;  3NZQ A;  5JH7 E;  3C4W A;  4YHJ A;  2CLY C;  2LSY A;  4DUZ T;  1MMA A;  1IZN B;  4HTE A;  4P09 A;  5HEG A;  2SPC A;  4EED A;  4DBR A;  5AQG B;  3CQX C;  4EEB A;  3UUM A;  5LHG B;  4ZI3 D;  5EK2 A;  5ABH A;  3H37 A;  3MA9 A;  3ZPO A;  4UF0 A;  4ILA A;  1UCU A;  3GN5 A;  2XM2 A;  3T1Y T;  1D0X A;  3W15 B;  1FJG T;  3CVR A;  1KNR A;  3KV5 A;  3Q2M A;  4JLE A;  3CK6 A;  2LOP A;  5HEO A;  3PUA A;  1HNZ T;  1T7S A;  3EI0 A;  3C4Z A;  5FMN A;  2V6Y B;  4PK4 A;  4DV3 T;  3ETV A;  3AE1 A;  3LBX B;  2GK9 A;  4CI1 B;  5AQN B;  4XBF B;  4Q25 A;  3LFM A;  1D1B A;  4NPP A;  3CKD A;  3L3P A;  3ETU A;  5JDL A;  3PUZ F;  3KFW X;  3VRB A;  3SS1 A;  2W63 A;  4QXH B;  4EIW A;  5HYA A;  2P9B A;  3EVY A;  4F8H A;  3SFD A;  3N2K E;  5JDQ A;  5JDM A;  2KXP B;  3ESL A;  1XZY A;  2XQA A;  2H89 A;  4DR6 T;  3NVO A;  5LA6 E;  2VKH A;  3FZM B;  2I59 A;  5HXS A;  4H63 V;  2KMF A;  4TNV A;  4O4J E;  4OYJ A;  1HG5 A;  3KBU A;  2D9D A;  4NIQ A;  3N5L A;  5M4Y A;  4EB6 E;  4MLK A;  1W9R A;  4DV2 T;  3PUW F;  2OLT A;  1X79 A;  2FJA A;  4KI0 F;  1HF8 A;  4B3T T;  5AQU B;  4DID B;  2K3W A;  3E08 A;  3ZC0 A;  2L9Q A;  4HFB A;  4HFD A;  4HKA A;  4IT4 A;  2XQ7 A;  4CQI A;  3RHW A;  2E5V A;  4MBQ A;  5JDF A;  2XAJ B;  4N78 D;  1W0B A;  1T98 A;  3PUY F;  3AEC A;  3H3A A;  1FEW A;  2BVL A;  3B57 A;  2LKG A;  5ADX L;  2M6I A;  3FXE B;  2JMK A;  4YJ2 E;  3I1A A;  2NTY A;  3FBZ A;  5AQP B;  4IE6 A;  1N34 T;  3Q5W A;  4O4H E;  2E8I A;  1WFD A;  4X66 T;  3BK9 A;  4Z8X A;  3S4U A;  3HKD E;  5HXH A;  4YJ3 E;  3UUL A;  5L3G B;  3C98 B;  5AQI B;  4NXN T;  2NTX A;  3SWH A;  4H9R C;  4UXN B;  5IWA T;  2WP9 A;  2BKN A;  4YXD A;  4OX9 T;  2LHR A;  2NWB A;  4JI5 T;  1XNR T;  3K3O A;  5AQM B;  2WS3 A;  2CPT A;  1OED A;  5FXX A;  3RPU A;  5AQL B;  2RP4 A;  4TWD A;  3EAB A;  2MPK A;  3AB3 B;  3EHZ A;  1J1J A;  3RKO A;  1ZEE A;  5FY0 A;  3KV6 A;  4CN6 A;  4HWH A;  2UXN B; 
#chains in the Genus database with same CATH homology
 4IE5 A;  3ANW A;  4TX5 A;  3EDV A;  4U74 A;  5JVD E;  3EDU A;  2WM9 A;  3RC8 A;  1LVK A;  2ODV A;  1FIO A;  4UEL A;  3M65 A;  4CI3 B;  3FB2 A;  3AVS A;  3OYX A;  2A72 A;  4AI6 A;  4K0U A;  1MMD A;  3MZK B;  5GON E;  2L8K A;  2VB6 A;  3NRY A;  1Z0P A;  3Q9D A;  2WAU A;  2Y48 B;  3BQL A;  5IHY A;  5HWX A;  2HH7 A;  4B6X A;  1IAP A;  3PUQ A;  4PK6 A;  2X9Y A;  3LK3 B;  5KDM C;  3I0O A;  3OKQ A;  1QUU A;  5EZY E;  5H6Q B;  2W00 A;  3O4X E;  3BQI A;  4XAX B;  1EZ3 A;  1U4Q A;  4F6R C;  2K24 A;  1IJ5 A;  2JPF A;  2C5J A;  2LSK A;  2V7M A;  3KV9 A;  2H7V C;  4V1A v;  2Q9Q D;  3L09 A;  4EXT A;  3PUS A;  1HG2 A;  3AVR A;  3U3I A;  3ZJ2 A;  5LGT B;  2XAG B;  2LOS A;  2D0T A;  5BMV E;  4AQG A;  4YLH A;  5E0O A;  2YU2 A;  2YK0 A;  4I43 B;  1YKH B;  1B7T A;  2CXF A;  1UX4 A;  5C8Y E;  2VL8 A;  3N9P A;  3R6N A;  3UUN A;  2ODU A;  2XAS B;  4X1I E;  4O2B E;  4X1Y E;  4PK5 A;  3KDS E;  2NW7 A;  4H9Q C;  3ZMS B;  2CCQ A;  4EYY R;  4HN9 A;  1D0Y A;  1MIW A;  1SA0 E;  3F2E A;  4EZH A;  3P7I A;  5HXE A;  2WBL A;  1AJ3 A;  2OA5 A;  2PBI A;  3I9Y A;  2CA5 A;  3FXD B;  4PJL A;  5LGN B;  2LSI A;  4AKI A;  3N9L A;  2ZM8 A;  4MAL A;  2K48 A;  2X68 A;  3N2G E;  2Y8D A;  1HFA A;  2IAK A;  1S94 A;  3SRZ A;  1US7 B;  4H9P C;  4BAY B;  2EHO A;  2CWO A;  2NP9 A;  2KWH A;  2CXD A;  2D0U A;  3AAA B;  1ZHC A;  4FI5 A;  2KIN B;  4PJN A;  3VKH A;  2VKD A;  2XAF B;  2W62 A;  3UTK A;  2KWI B;  2ZM0 A;  5J2U E;  4KUM B;  5JDG A;  3HI2 A;  2W61 A;  3OYZ A;  2IW5 B;  4CZZ B;  4P0B A;  2E9X C;  4ADZ A;  5LOV E;  4ASK A;  4UV9 B;  4ZOL E;  2CWY A;  5HXR A;  1MMN A;  2KT9 A;  3CQG B;  2HPJ A;  2UXX B;  2XHE B;  4O2A E;  4UVB B;  2BDE A;  4PFO A;  5EK4 A;  3GA8 A;  4ISS A;  4CXX A;  5LP6 E;  1V9D A;  5JRC B;  3IF8 B;  3PTR B;  3OJA A;  3HKB E;  5HXC A;  3O9X A;  2V7K A;  1LVF A;  2ACX A;  3AAI A;  5L3F B;  4A56 A;  2LSJ A;  4H9S E;  4JEU B;  4M1P A;  3ANW B;  3CX7 B;  3J9X 1;  5KX5 E;  5LYJ E;  5A1L A;  1LRZ A;  2PG8 A;  2KZ7 B;  2CXL A;  2Z6E A;  4BJM A;  2V1D B;  4I55 E;  3BQK A;  4O4I E;  5EK3 A;  2X9X A;  3ZYK A;  4AKR B;  4HFV A;  3KBT A;  1MMG A;  5IYZ E;  4UEM A;  2X67 A;  4NUV A;  3RH3 A;  3HL6 A;  4U72 A;  5F8P A;  4IIJ E;  1KK7 A;  2XQY A;  2ZLY A;  4FJO A;  3RYI E;  2KLQ A;  5F3J A;  3CQC B;  2CEA A;  2CE7 A;  2PFV A;  4HE8 A;  2V7J A;  2V7L A;  4PJJ A;  2NW9 A;  2Q9Q C;  4TN7 B;  2BZB A;  2MTQ A;  2DWK A;  4BJN A;  2VKO A;  4AKG A;  3LBX A;  2DWG A;  2E9X D;  2CM0 A;  3HA4 A;  1WR6 A;  3CX6 B;  4H9O C;  4PJM A;  3MKD A;  4JUY A;  4ZS3 A;  3DP7 A;  3B13 A;  1MND A;  4UIG A;  2YEV C;  2VAS A;  5JDH A;  3CX8 B;  2Q9Q B;  3C51 A;  4GOU A;  4JEH B;  3QC9 A;  1WYC A;  4ZI2 D;  1O3X A;  4X20 E;  2WMO A;  4X1K E;  4IE0 A;  4ZI3 C;  4MHC A;  1HCI A;  2LT3 A;  4AKL A;  3O1I A;  3HKE E;  4OK0 A;  4AQF A;  1G8X A;  4CXW A;  3ZN1 B;  3N2O A;  4IGU A;  2L3L A;  4J2C A;  1ZKE A;  3A5X A;  3LJC A;  3D0T A;  4MFR A;  5DJQ C;  5FXZ A;  3N9M A;  4XZC A;  5LHH B;  5LNK A;  3NZQ A;  2EHO C;  5JH7 E;  4PFP A;  1G73 A;  3MJX A;  3C4W A;  3AA6 B;  3I0Q A;  3ZMZ B;  2DLR A;  5LJM A;  5LJN A;  4YHJ A;  4OFZ A;  4QXC B;  2CLY C;  3IEE A;  2LSY A;  5ETW A;  5LHI B;  3QUJ A;  5FY1 A;  1MMA A;  1IZN B;  5FY7 A;  4HTE A;  2EHO B;  2DNX A;  4P09 A;  5L3E B;  2SPC A;  3LK2 B;  5JR9 A;  3RYF E;  5JDN A;  4DBR A;  4WNK A;  3R84 B;  2IC6 A;  2LEH A;  2CLY B;  4GYR A;  3CQX C;  2X9W A;  4H63 H;  2C5K T;  2N2N A;  3UUM A;  5LHG B;  4P0A A;  2JRK A;  4ZI3 D;  3AA7 B;  3KVB A;  3GMI A;  5FXV A;  4EZ4 A;  3JC6 C;  2NW8 A;  5EK2 A;  3H37 A;  3K8P C;  2K5B B;  1BR4 A;  3LK4 2;  1CUN A;  2C5I T;  5LXT E;  3MA9 A;  1WRD A;  3ZPO A;  4UF0 A;  2B1E A;  2A3D A;  1UCU A;  3GN5 A;  3NZP A;  3UUX B;  4EAH A;  1D0X A;  3ZYM A;  3W15 B;  3LG7 A;  2IC9 A;  3V5S A;  2EHO D;  1VOM A;  3CVR A;  3KV5 A;  3Q2M A;  4JLE A;  3ZLI A;  2LOP A;  3ZEF B;  3PUA A;  4H9N C;  4G2A A;  3C4X A;  2PJQ A;  4UVA B;  3C4Z A;  3KVA A;  5FMN A;  4AXP A;  2VK9 A;  4HEA A;  4PK4 A;  5JQG E;  3ETV A;  5FYM A;  3RYC E;  2LHN A;  3FBL A;  4ZI2 C;  2K9A A;  4QX8 B;  2W0G A;  4WW0 A;  3Q5X A;  2E9X B;  3ZJ1 A;  3LBX B;  2GK9 A;  4CI1 B;  2JJ9 A;  2XUE A;  3JC6 D;  2DHR A;  3E22 E;  4AQF C;  2JQQ A;  4XBF B;  3UT5 E;  2MYS A;  4BA9 A;  4ILU A;  3LFM A;  1D1B A;  1D1C A;  5FXW A;  3O1J A;  3CKD A;  3DTO A;  1MIY A;  3PUG A;  1FMV A;  3L3P A;  4EYU A;  3ETU A;  5AFU L;  2ES0 A;  3WAK A;  3WI3 A;  3RX6 A;  5JDL A;  4HGA A;  1KNZ A;  2D2S A;  3KFW X;  4QXB B;  3KV4 A;  3SS1 A;  3VHL A;  3RRW A;  1IJ6 A;  2W63 A;  4GYS A;  4QXH B;  4EIW A;  5J2T E;  5HYA A;  2KND A;  2D5U A;  2P9B A;  2VKJ A;  3EVY A;  3P8C D;  4KP3 C;  5JR9 C;  2M67 A;  3IBP A;  1SHZ C;  3NRX A;  3KIN B;  4TZ4 C;  1HS7 A;  1S35 A;  1E1H B;  4IST A;  3N2K E;  1ZV4 X;  5JDQ A;  5JDM A;  3F31 A;  2KXP B;  2XTL A;  4KMC A;  2G0U A;  3ESL A;  5JR9 B;  5LA6 E;  4O8S A;  2H3R A;  4IHJ E;  2LE8 A;  1D1A A;  4L5G A;  3N9Q A;  5LCY A;  4ZS2 A;  1VRB A;  5HAX A;  2VKH A;  5J1G A;  1BR1 A;  1D0Z A;  2I59 A;  4L0R A;  3ZN0 B;  5HXS A;  3VKG A;  4H63 V;  5H6R B;  2KMF A;  1OXZ A;  4C90 A;  4EOZ B;  4I4T E;  3ZCI A;  4O4J E;  5JRE A;  3SOL A;  4OYJ A;  2MOZ A;  2BVM A;  5CA0 E;  1HG5 A;  3KBU A;  3MK7 C;  3C50 A;  4L9I A;  2N1G A;  3N5L A;  4UF0 B;  4DND A;  5M4Y A;  2ZM2 A;  4EB6 E;  3GN5 B;  3MXZ A;  3C64 A;  2C0S A;  3O1H A;  3DJB A;  3GWH A;  4MLK A;  2XAH B;  4QHO A;  1YW0 A;  1X79 A;  2YU1 A;  1BR0 A;  4YFS A;  3K3N A;  2J1D G;  4OYK A;  1WYB A;  5FNV E;  3PUR A;  2A2F X;  2RA1 A;  4OHF A;  2LSG A;  3FHN A;  1HF8 A;  4GK5 E;  2Q9Q A;  5CA1 E;  1FMW A;  2CMR A;  2H7O A;  3HR0 A;  4QKN A;  1LKX A;  3E08 A;  2WWU A;  3ZC0 A;  2VWA A;  2L9Q A;  4HKA A;  4IDZ A;  2V26 A;  4CQI A;  3E0Z A;  2LM9 A;  4MBQ A;  2X0L B;  2XAQ B;  5JDF A;  5DQW A;  2XAJ B;  3RYH E;  4N78 D;  4PW8 A;  4ZI7 E;  3N9O A;  3N9N A;  4GK0 E;  4WBO A;  3OBV E;  3ZCJ A;  1T98 A;  2X51 A;  2QGS A;  2JMH A;  3U78 A;  5L3C B;  3PU3 A;  3H3A A;  5L3B B;  2DI4 A;  1FEW A;  5LG4 A;  2QA7 A;  3AA1 B;  3ZMU B;  4DMW A;  2BVL A;  3MAC A;  3B57 A;  4GIW A;  4DBQ A;  3AAE B;  1H7C A;  2N9D A;  3PU8 A;  3ZMT B;  5ADX L;  3FXE B;  3HKC E;  2JMK A;  4YJ2 E;  3I1A A;  5KMG P;  2NTY A;  2ZMA A;  2NOX A;  2X9H A;  3CPZ A;  4ERR A;  3FBZ A;  4I50 E;  4DMV A;  1HX8 A;  1NAF A;  4DO0 A;  1HTJ F;  4IE6 A;  3NBX X;  1YKE B;  3AA0 B;  3Q5W A;  2Y6X A;  4O4H E;  3PE0 A;  5HWY A;  5L2L A;  2E8I A;  2LJL A;  3EUH A;  3V5U A;  4QWN B;  3RC3 A;  4NUU A;  1NWM X;  4O4L E;  3BK9 A;  4G63 A;  4Z8X A;  3S4U A;  3UFE A;  3HKD E;  5HXH A;  4YJ3 E;  3UUL A;  3IHR A;  2V7I A;  5DAB A;  5L3G B;  2X66 A;  2WMN A;  4IE7 A;  3C98 B;  4C91 A;  4KBM B;  3WAJ A;  5LBM A;  2NTX A;  4QX7 B;  3K3Q C;  3SWH A;  4H9R C;  5DQV A;  2YIN A;  4UXN B;  4UVC B;  3RRC A;  1MIV A;  3CWZ B;  4TUY E;  5CB4 E;  5TAO A;  4PAG A;  3J7Y q;  1UX5 A;  4E7S A;  5LGU B;  4AKH A;  2MBG A;  4DVD A;  5L3D B;  2LHR A;  4TV9 E;  2NWB A;  4IE4 A;  4ZHQ E;  3CML A;  3VU7 H;  1YD8 G;  3ZMV B;  4WBN E;  2WSS V;  3PDY A;  1OWA A;  5LBQ B;  5FP3 A;  4PNI A;  2HPL A;  4CI2 B;  4ANJ A;  1Y64 B;  3K3O A;  3ONX A;  3ZYL A;  2DCF A;  3ZC1 A;  3I9W A;  1WLX A;  1U5P A;  3QK6 A;  4CXY A;  5FXX A;  4E7Z A;  3F57 A;  3RPU A;  5JRC A;  2RP4 A;  4TV8 E;  1BR2 A;  3AB3 B;  4UV8 B;  2E9X A;  1ZEE A;  5FY0 A;  3KV6 A;  3RKO A;  3T8O A;  1QSD A;  2UXN B;  1MNE A;  3TKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...