3FXEB

Crystal structure of interacting domains of icmr and icmq (seleno-derivative)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
TDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein IcmQ
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fxeB00
1IJ5A 2X9YA 3S4UA 3P7IA 1Z0PA 3N5LA 3QK6A 2XTLA 2C5KT 1LRZA 2MBGA 4L0RA 4EYYR 2IC6A 2C5IT 4J2CA 1ZKEA 4B6XA 2G0UA 2X9XA 4CQIA 3QUJA 4DNDA 1H7CA 3FXEB 2C5JA 3MXZA 1QSDA 1LVFA 3CVRA 1IJ6A 2K48A 2IC9A 3TKLB 2KWIB 3FXDB 4FI5A 3CKDA 3L3PA 2KWHA 2X9WA 2CA5A
chains in the Genus database with same CATH superfamily
2H7VC 4JI1T 5FY7A 5JREA 2XAFB 1IBLT 1E7PA 2LSIA 2VWAA 3SOLA 2PTFA 3PJAA 2UXDT 3HKBE 2BS3A 1MIVA 3N2GE 2ODVA 4PW8A 2QA7A 4YTNA 1N34T 4U74A 4DV5T 4UXNB 1OEDE 3D0TA 4E7SA 3AE5A 2MTQA 3H37A 4QH5A 4CN4A 1UGOA 2QYWA 4AQFA 3ZT5A 4HFBA 5LGUB 2VVNA 4U72A 4JBWF 2GK9A 3AECA 3I0OA 3RYFE 4IGUA 4Z91A 2MBGA 2WSSV 2JMHA 3KFWX 2C5JA 2VKHA 1KF6A 1Y01A 4YY3T 4JI6T 4I0UA 5C8YE 3N2OA 2V8SV 4U7YA 3H3MA 4QX7B 4L0RA 3K3OA 3ZKRA 2PJQA 4OX9T 3PJAJ 4WW0A 2CWOA 5BMVE 1D0YA 3JCFA 1W9RA 3IBPA 1HX1B 5HWXA 3EI0A 3FZMB 5ABHA 4P0AA 2LRLA 4JI8T 2V7KA 5J0ZA 1WCRA 4Z8XA 2VKOA 3GN5A 4XAXB 2JQKA 3UU8A 3MK7C 4ZS2A 1WLXA 5DQWA 4X1IE 4U2YA 1KFYA 2VVSA 4AKHA 4EXTA 4O4LE 3JC6C 2D0TA 2DCFA 4AISA 2BBJA 3LJCA 3QC9A 4DV0T 2CE7A 4GKKT 5HWYA 3TLSA 1IJ6A 2HN1A 2I6HA 1MNEA 2BBHA 3RHWA 4B3TT 3R84B 4X64T 1MMDA 2NTYA 4LF8T 1X9BA 3QB5A 2E9XD 3C4XA 3ZC1A 3RGLA 4ZHQE 2CCQA 5LB7B 3ZPOA 5LHIB 2LM2A 4MBQA 4HGAA 2W61A 1XNQT 4ILCA 2KXPB 2I0MA 4H9QC 1UX5A 1AJ3A 2C5IT 2LOSA 2XZEA 4EAHA 3NWIA 4ZI2D 2XQ4A 4CZZB 2K9AA 2XAQB 1ZOYA 4EOZB 4HWFA 2CXLA 3C64A 3T1YT 2E9XA 4OYJA 4YHHT 3AE6A 2NWBA 3ZN1B 5LGNB 5L47A 1SE7A 2UXCT 2E8IA 3RQUA 2CHOA 3ZMTB 4KI0F 2XM2A 2CA5A 2XQ8A 4JI7T 2WDQA 5JRCB 2YKSA 2LSKA 1YQ4A 3AEBA 5H6RB 4CI3B 2A3DA 3MZKB 4HTEA 5IHYA 1FMWA 4YSYA 4H63H 3NKZA 4L5GA 3UU6A 4ANJA 3ANWB 4UV9B 4O4IE 3AE7A 5LG3A 3PUVF 2AE9A 3VKGA 2BG9B 3SS1A 3LG7A 4HE8A 4HWCA 4YTMA 3T1HT 2HPLA 3OVUA 3K8PC 1I94T 5JR9A 4U7IA 1YKHB 1Z8UA 4DMWA 3TLWA 4CQIA 3SFDA 3UU3A 2I59A 3ESLA 5AQOB 2H7OA 4EIWA 1WYBA 3C51A 2LEHA 2X66A 2Z6EA 3LK3B 4IDQA 4K0KT 3ZYMA 3HKEE 3KV9A 3W15B 5ETWA 5CA1E 4JLEA 4JEHB 5EK4A 3L8RA 4IE4A 2CXFA 2A2FX 5E0OA 2YDRA 4UF0B 4JUYA 4EEBA 4PK4A 3JADA 3AE2A 2WBLA 5KXJA 5H6QB 3PTRB 1YQ3A 4KHZF 4O2AE 3PUZF 2LM9A 2IUBA 2XTLA 3N9QA 3PUXF 2YU1A 4ZZCA 2YEVC 4WYVA 4U31A 5AQGB 2DWKA 3FZKB 2LSGA 2WMNA 2UXBT 5JH7E 4KMCA 3AAAB 1NEKA 3JAFA 1XMOT 3KBTA 3A5XA 3LSVA 2CXDA 5TAOA 5HXSA 4EYYR 2XM1A 4DNDA 2V6YB 3VHLA 2YN6A 2W2UA 4ADZA 1W09A 5CJ5A 4X20E 2CBJA 5LNKA 3VU7H 3CWZB 3AB3B 2E5VA 2ZM0A 3I0QA 5LXTE 4HFHA 1OEDB 4TNWA 1T7SA 5LBQB 2UXXB 1LVKA 3VKHA 1FMVA 5ABFA 5F5WA 4HKAA 2W00A 2F4VT 2ES0A 4LF6T 1KNZA 5HAXA 3RF1A 3UTKA 5LA6E 3ABVA 4DR2T 5HXRA 2CLYB 3RC8A 3IHRA 3CX7B 2FBWA 5AQVB 2XAHB 2XSBA 3ZJ1A 4A5XA 3P7IA 4QXCB 3OYXA 5AQNB 3UULA 2D0UA 5LMNT 1VCTA 4WBOA 4CN1A 4TWHA 4UR9A 3CIRA 1ZV4X 2BKPA 3KV6A 1T98A 2VL8A 1LKXA 2UUAT 4DV2T 3M65A 4I55E 4BJMA 5HXEA 3AVRA 4P0BA 2WDVA 4G2AA 4I4TE 4DR5T 2IHR1 3BK9A 3PUGA 3NBXX 1I6ZA 5L3BB 2IC9A 2XQAA 2XUEA 2C5KT 4DUYT 4X5TA 4DR1T 2CBIA 4YTPA 3WAKA 3O1JA 4IDPA 5DABA 2NR4A 2ODUA 1R8IA 4IDZA 3CX6B 4PJLA 3UU4A 4BA9A 2K48A 1D1AA 3L39A 3VRAA 4NPPA 3PE0A 3RQWA 4ZI7E 3PUAA 4EYUA 3OTOT 3ZYKA 2W4XA 2LHRA 2JPFA 2MPKA 5J1GA 3NVOA 2V1DB 2X0YA 3L3PA 1UUSA 2Q9QD 4DV3T 4CI1B 2IC6A 4JEUB 3HI2A 4YHJA 4YXDA 5L3FB 1HNXT 2WM9A 2VKJA 1N32T 4IIJE 3AXJB 4B3RT 3MXZA 2XQ6A 2WAUA 4AIUA 5HEUA 2JQQA 5IWAT 4YLHA 5AQPB 3VRBA 4AKLA 4YJ3E 1EZ3A 4GIWA 5JDFA 4JI4T 3C50A 1L0VA 2NW7A 3ONLC 3HR0A 1O3XA 3B5MA 4IE5A 4P09A 4DV4T 2M6BA 3N9LA 4DR4T 2Q9QA 3KINB 3V5UA 2XQ9A 4K0UA 2PBIA 4AQFC 4H63V 2YU2A 1N33T 2J4GA 4NUVA 2Q9QC 3J7Yq 2XAJB 2HHHT 3P4WA 4Z90A 4IE0A 4PNIA 4EZ4A 4HFEA 2E2AA 3TLVA 5FVKA 3UUMA 1IBMT 3WAJA 4DR7T 2ACZA 3IF8B 4X65T 4YFSA 3LK42 2E5LT 3O1HA 1BR4A 2XJ7A 2X9XA 3RIUA 5LJNA 3CVRA 4QH1A 2YK0A 4DBRA 4PFPA 4AQYT 5ADXL 2A9UA 3KV4A 4LMKA 4QH4A 4E7ZA 2CHNA 4N78D 4XBFB 3PU8A 4CXXA 3RRWA 3RH3A 3TLUA 1XMQT 3UUXB 1V9DA 2LE8A 1D0XA 4PAGA 4Q25A 2D9DA 1MIWA 3FBZA 2WDRA 5JDGA 3IEEA 2DL1A 1IJ5A 3ETUA 4GKJT 3DTOA 1WFDA 5HYAA 5JVDE 5FY1A 2UUBT 4CN6A 3LK2B 1J5WA 1MIYA 2KNDA 3AE1A 2WZHA 4V1Av 3RIFA 2DI4A 4ILUA 3WI3A 3AEFA 4U3CA 5IYZE 4LF5T 5L3GB 5AQFB 3QOFA 2QRXA 4ILAA 4IL9A 2N9DA 1KNPA 3UFGA 5AQQB 4TUYE 4B3MT 3JAEA 2JQ9A 2W66A 1BR1A 3MJXA 2JQHA 1CUNA 2L9QA 2PG8A 4TV8E 2E9XC 4ZOLE 3I9YA 4UEMA 4UIGA 3ZEFB 1YW0A 5HEHA 1E1HB 2OLTA 5LOVE 4LMJA 1SHZC 2IW5B 3AAIA 2A72A 2BVLA 4H9PC 4HFIA 4C90A 3ZMZB 3KDSE 4CXWA 3HA4A 4G63A 3RC3A 4ZI2C 2VKDA 1B7TA 2OV9A 3FB2A 3UU5A 2XQ3A 4DV7T 1VCSA 3AA1B 5EK3A 5FXWA 1HFAA 4TWDA 4QXBB 3N5LA 5HEOA 3ZN0B 1HTJF 5F3JA 2YDQA 4JV5T 3ZCJA 1ZEEA 3OYZA 1E2AA 2V6XA 4IREA 2EHOB 5JR9C 3TKLB 2BKOA 4I43B 4TWFA 2X9WA 5LJMA 2X9YA 3F31A 3F2EA 3LFMA 2XHEB 4H9SE 3ZC0A 5AQJB 3ZMSB 3AEEA 3R6NA 4UVCB 3CX8B 2MAWA 2X67A 2OA5A 4XZCA 2FJBA 4I50E 3ZT7A 1UX4A 2BS2A 2V26A 2WU5A 1FIOA 3QK6A 2V7LA 3RPUA 5EZYE 1IAPA 4X1YE 5FNVE 2W62A 2X9HA 5KMGP 2ACXA 3SWHA 3T8OA 2UXNB 1UURA 4DO0A 2AXDS 1X79A 3CQXC 5JRCA 5DJQC 3UUBA 1UCUA 2LJLA 2XSAA 2QVAA 4M1PA 4MHCA 2M6IA 1HS7A 1GQEA 2J1DG 2CEAA 5JTGA 1MMAA 5HXHA 2ZM6T 3ANWA 5C3JA 2JRKA 3LBXB 2V7JA 5CB4E 4EEDA 2XPKA 1JNZA 2BG9A 2CM0A 4O4JE 2XASB 5BR8T 5CA0E 3ZMUB 4WNKA 3N9NA 3ONJA 3OKQA 3KBUA 4NXNT 5AQKB 5L4HA 4JI5T 1XNRT 2BG9C 4IDNA 4KHPT 4EZHA 2LT3A 3VR9A 4O8SA 2W0GA 2XAGB 1VRBA 1KEYA 3FZFB 2LSYA 2LRKA 1J1JA 3TLTA 4GYSA 2LSJA 3FXDB 4IHJE 2H89A 3ZJ2A 4DMVA 2HH7A 1SA0E 4X66T 4UF0A 5ABGA 3ZYLA 3H3AA 5AQIB 4JYAT 1LVFA 3Q9DA 4BAYB 1M62A 5JDNA 2LKGA 1J5ET 3P4RA 5LGTB 4LF4T 3EABA 2G0UA 2KSRA 1M7KA 3RYHE 4QXHB 3P4QA 4KP3C 3AE8A 4GK5E 3EDVA 4PJMA 2BS4A 2HN2A 3Q5EA 2QGSA 3ZMVB 3NRYA 3Q5DA 3OPCA 2UU9T 2JMKA 3L09A 2V6YA 2WWUA 1U5PA 3SFEA 1HCIA 3AE3A 3UFEA 1XDOA 4NIQA 2LOPA 2B76A 4P1NA 4DVDA 2KT9A 3PV0F 2R6GF 4QWNB 2SPCA 3RLFF 5LP6E 4CI2B 4B6XA 1OEDA 3HKCE 5FXXA 2V7MA 1H7CA 2ZLYA 5HEJA 2H88A 4MLKA 3CQCB 2CRBA 2NW9A 4F8HA 1WRDA 4DIDB 3AEAA 2CPTA 1OEDC 3UT5E 3C98B 4X1KE 1ZP0A 1XWMA 4EV6A 3QB5K 4J2CA 2L3LA 5HXCA 5KDMC 2DNXA 3UUNA 3GN5B 3NZQA 4DR3T 3DP7A 5JDMA 4IE7A 2CLYC 1HF8A 4H9OC 3U3IA 2JIWA 4KBMB 4EB6E 5AQRB 2XY8B 2VASA 3A8YC 2MOZA 3AA6B 5L3DB 4NXMT 1D1BA 4JI3T 2RPAA 4YSXA 3I1AA 4GOUA 5A1LA 2RP4A 5IUXA 2ZM8A 3AA0B 4IL4A 3QUJA 4C91A 4ISSA 5JDLA 3KV5A 4DBQA 1JNRA 3J9X1 3RI5A 3P4SA 4DUZT 5FL1A 2Y6XA 3EAMA 3CPZA 3C4ZA 4IE6A 2X51A 3MACA 2XQ5A 5LYJE 2D5UA 4HFDA 2X0LB 2LHNA 3Q5WA 2WB5A 3JC6D 4U2ZA 2J47A 1KK7A 5LBMA 3RIUC 4UV8B 2XQ7A 4OK0A 4UVAB 2E9XB 2VK9A 3ZLIA 4YSZA 2BZBA 1ZHCA 4OHFA 1VOMA 1HNZT 3RKGA 1HNWT 1KNRA 5EK2A 3OJAA 3HL6A 2NP9A 1LRZA 2IDOB 1DU2A 3AXJA 3O4XE 1UK5A 1HG2A 1BR0A 4JI0T 2NOXA 3K1SA 3P50A 2FJAA 2D2SA 4LFCT 2NTXA 1U4QA 3ZCIA 1S35A 3IA3A 3AA7B 3V5SA 1N36T 5FXZA 3N9PA 2K5BB 1FJGT 3KVAA 5AQMB 3U78A 1S94A 4PFOA 1YXRA 3KVBA 4PJNA 5JR9B 2X0HA 3CQGB 2L8KA 4TV9E 3PUWF 3PDYA 3UQ4A 5KX5E 3RX6A 3K3NA 3CK6A 3B57A 5AQLB 4GYRA 3X1DA 2WP9A 2BDEA 2ZMAA 1MMGA 2WWVA 2V7IA 5CFBA 5LHHB 5L3CB 3FZHB 5FP3A 2RA1A 2WU2A 5J2TE 4QHOA 4DR6T 4PJJA 2IAKA 2W67A 1T72A 5F8PA 3E0ZA 4TNVA 4TZ4C 5FVLA 4A98A 4YT0A 5FKYA 2WMOA 4BJNA 2ZM2A 3AE4A 1CHUA 3CMLA 3RIAA 4UELA 3AEGA 2LLYA 3RYCE 3N9MA 4ISTA 4KUMB 2NW8A 2UUCT 4L9IA 3AVSA 5CGMA 3GMIA 1IBKT 4ZEYA 3PUQA 3ZT6A 4HWIB 4U33A 3K3QC 5J2UE 2X68A 2VL0A 3QNUA 1G8XA 1BR2A 5C2TA 2CMRA 4FJOA 3RYIE 2YDSA 1OXZA 2JJ9A 2VB6A 1WR6A 4HFCA 2IMLA 2WS3A 2WZIA 3FZLB 3UQ7A 1D0ZA 4LF9T 4EGWA 4ILBA 3ETVA 5ABFB 3Q2MA 4OYKA 3EVYA 1WYCA 3FXEB 1YD8G 2DHRA 1XZYA 1IZNB 1FEWA 4FI5A 3MA9A 1HX8A 4AKRB 2MYSA 2H3RA 4LFBT 1Z0PA 4PK5A 4DV6T 4KX6A 5LHGB 1WR0A 2DWGA 3C4WA 5ABEA 3MKDA 4F6RC 4WBNE 5AQHB 4MALA 4UVBB 2N1GA 3BQLA 4WZXA 2CWYA 3FBLA 5HEGA 2HPJA 2W63A 3DJBA 4HN9A 5AFUL 3PUSA 3N2KE 5LCYA 4LMLA 2EHOD 3AAEB 3AE9A 4IT4A 5JDHA 3O1IA 3PURA 1YKEB 2P9BA 4CXYA 2BVMA 4HEAA 4ZS3A 3RKOA 1NAFA 3NZPA 1NWMX 4PK6A 3AEDA 5HCJA 1T8BA 1W0BA 4TN7B 4MFRA 5HCMA 2YINA 3PU3A 5GONE 3G06A 2FJEA 2B1EA 2FJDA 1XDPA 3F57A 3RRCA 5LG4A 5L2LA 1MMNA 4X62T 3BQIA 1OWAA 2IIUA 2WY2A 4YJ2E 5AQTB 1G73A 5AQUB 3E22E 4AQGA 2EHOA 1MNDA 4JI2T 4GK0E 5LMUT 2C0SA 5JQGE 4ASKA 4AXPA 2M67A 5L4EA 2YOEA 4H9NC 4HWDA 5FYMA 2EHOC 4A56A 5FXVA 3PUYF 3SRZA 4ERRA 2V5CA 5FY0A 4IDOA 1NENA 4COFA 4AKGA 2BKNA 3GWHA 2KINB 3VR8A 4AKIA 1D1CA 2Y8DA 3ONXA 1US7B 2BG9E 2VQET 5L3EB 1QUUA 1HG5A 3EDUA 4ZI3D 2FUPA 3EUHA 2PFVA 2KLQA 5M4YA 1QSDA 2WCAA 3A7MA 3P4PA 5AQSB 2VURA 4LFAT 3NRXA 4DV1T 2J62A 2Q9QB 2K3WA 4LF7T 3ZSTA 3P8CD 4A97A 4HFVA 4O4HE 1W0AA 2Y48B 3M3ZB 4QKNA 3LDQB 2LKHA 3EHZA 3ZSSA 2KZ7B 1QLBA 4ZZBA 2DLRA 3FHNA 2KWIB 4H9RC 3CKDA 4O2BE 3LBXA 3GA8A 4AI6A 3O9XA 3E08A 2WQYA 4OFZA 1ZKEA 4QX8B 5DQVA 2N2NA 3B13A 3HKDE 1SUMB 4ZI3C 2K24A 2VQFT 2XQYA 3OBVE 3S4UA 3I9WA 5FMNA 3BQKA 1HR0T 4TX5A 2V5DA 1Y64B 4B3ST 5JDQA 4HWHA 3N9OA 4NUUA 3Q5XA 2KMFA 4ZXLA 2KWHA 5FL0A
chains in the Genus database with same CATH topology
2H7VC 1LVKA 5FY7A 2NOXA 2XAFB 1FMVA 5JREA 4QXBB 3VKHA 2LSIA 3N5LA 3ZN0B 4HKAA 2D2SA 1HTJF 2W00A 2VWAA 2NTXA 3SOLA 1U4QA 2ES0A 3ZCIA 5F3JA 1S35A 1KNZA 5HAXA 3ZCJA 3AA7B 3UTKA 5LA6E 3V5SA 1ZEEA 3HKBE 3OYZA 2EHOB 2CLYB 5FXZA 1MIVA 3N2GE 5HXRA 3N9PA 3RC8A 3IHRA 3CX7B 2K5BB 3TKLB 5JR9C 2ODVA 4PW8A 2QA7A 4I43B 2X9WA 5LJMA 4U74A 3KVAA 2X9YA 2XAHB 3F31A 3U78A 3ZJ1A 4UXNB 3P7IA 1S94A 4QXCB 3F2EA 3LFMA 2XHEB 3D0TA 3OYXA 4H9SE 4PFOA 3ZC0A 3ZMSB 4E7SA 3UULA 2D0UA 3KVBA 4PJNA 3R6NA 4UVCB 5JR9B 2MTQA 3H37A 3CX8B 2X67A 4WBOA 2OA5A 3CQGB 4AQFA 2L8KA 4XZCA 4TV9E 3PDYA 5LGUB 1ZV4X 3KV6A 1T98A 4I50E 4U72A 1UX4A 5KX5E 2VL8A 1LKXA 3RX6A 3K3NA 2V26A 2GK9A 3M65A 1FIOA 3B57A 3I0OA 4I55E 3RYFE 4BJMA 3QK6A 4GYRA 4IGUA 3AVRA 5HXEA 2V7LA 3RPUA 4P0BA 5EZYE 2MBGA 2WSSV 4G2AA 4I4TE 2BDEA 2ZMAA 1IAPA 1MMGA 2JMHA 4X1YE 5FNVE 2V7IA 3BK9A 2W62A 3PUGA 3KFWX 2X9HA 3NBXX 5KMGP 2ACXA 5L3CB 5LHHB 3SWHA 5FP3A 2C5JA 3T8OA 2VKHA 2RA1A 5L3BB 2UXNB 2IC9A 5J2TE 4DO0A 2XUEA 3CQXC 1X79A 5JRCA 2C5KT 5C8YE 4QHOA 3N2OA 5DJQC 1UCUA 4PJJA 2LJLA 3WAKA 3O1JA 4QX7B 2IAKA 4L0RA 3K3OA 4M1PA 4MHCA 5DABA 1HS7A 2ODUA 4IDZA 2PJQA 3CX6B 5F8PA 3E0ZA 4WW0A 2CWOA 4TZ4C 5BMVE 1D0YA 4PJLA 2J1DG 2CEAA 3IBPA 1MMAA 4BA9A 5HWXA 2K48A 2WMOA 5HXHA 1D1AA 4BJNA 2ZM2A 4P0AA 3ANWA 3PE0A 3CMLA 2JRKA 2V7KA 4UELA 3LBXB 2V7JA 5CB4E 3RYCE 4ZI7E 3N9MA 3PUAA 4ISTA 4KUMB 4EYUA 2NW8A 2CM0A 4O4JE 2XASB 5CA0E 3ZYKA 4Z8XA 2LHRA 2JPFA 2VKOA 3GN5A 4L9IA 5J1GA 3ZMUB 3AVSA 4XAXB 4WNKA 3N9NA 3GMIA 3MK7C 2V1DB 4ZS2A 1WLXA 5DQWA 3OKQA 3PUQA 3KBUA 4X1IE 3L3PA 3K3QC 5J2UE 2X68A 2Q9QD 4EZHA 1G8XA 1BR2A 4AKHA 4EXTA 4O4LE 2LT3A 4CI1B 4O8SA 2W0GA 3JC6C 2IC6A 2XAGB 2CMRA 4JEUB 3HI2A 2D0TA 2DCFA 4FJOA 3LJCA 3QC9A 1VRBA 4YHJA 3RYIE 2CE7A 1OXZA 2LSYA 2JJ9A 5L3FB 5HWYA 1IJ6A 2VKJA 2WM9A 4IIJE 2VB6A 4GYSA 2LSJA 3FXDB 3MXZA 1WR6A 2WAUA 2JQQA 4YLHA 1MNEA 4AKLA 4YJ3E 1EZ3A 4GIWA 4IHJE 5JDFA 1D0ZA 3R84B 1MMDA 3C50A 2NTYA 3ZJ2A 4DMVA 2HH7A 3ETVA 1SA0E 3Q2MA 4UF0A 3ZYLA 4OYKA 2NW7A 2E9XD 3H3AA 3EVYA 3HR0A 1WYCA 3FXEB 1O3XA 3C4XA 4IE5A 4P09A 3ZC1A 4ZHQE 3N9LA 1YD8G 1LVFA 2CCQA 2DHRA 3ZPOA 2Q9QA 5LHIB 1IZNB 3Q9DA 1FEWA 4BAYB 3KINB 4FI5A 4MBQA 4HGAA 3MA9A 1HX8A 2W61A 4AKRB 2MYSA 2H3RA 3V5UA 5JDNA 2KXPB 4H9QC 1UX5A 1Z0PA 4K0UA 2PBIA 4PK5A 4AQFC 4H63V 2YU2A 1AJ3A 1BR0A 4NUVA 5LGTB 5LHGB 2Q9QC 3J7Yq 2XAJB 2C5IT 2DWGA 2LOSA 2G0UA 3C4WA 3MKDA 4F6RC 3RYHE 4WBNE 4IE0A 4QXHB 4KP3C 4PNIA 4EAHA 4EZ4A 4MALA 4UVBB 4GK5E 4ZI2D 3EDVA 4PJMA 2N1GA 3BQLA 3UUMA 3WAJA 4CZZB 2CWYA 3IF8B 2QGSA 2K9AA 4YFSA 3LK42 3ZMVB 3NRYA 3O1HA 1BR4A 3FBLA 2XAQB 4EOZB 2CXLA 2JMKA 3C64A 3L09A 2E9XA 2WWUA 2HPJA 2W63A 2X9XA 3DJBA 1U5PA 4HN9A 4OYJA 5AFUL 3PUSA 1HCIA 3N2KE 5LCYA 3UFEA 2NWBA 2EHOD 2LOPA 3ZN1B 3AAEB 3CVRA 5LGNB 5LJNA 2E8IA 2YK0A 4DVDA 3ZMTB 2KT9A 4DBRA 3O1IA 3PURA 5JDHA 2CA5A 1YKEB 2P9BA 4CXYA 2BVMA 4HEAA 4PFPA 4ZS3A 2LSKA 5JRCB 5ADXL 4QWNB 5H6RB 3RKOA 1NAFA 3NZPA 2SPCA 1NWMX 3KV4A 4PK6A 5LP6E 4CI2B 4B6XA 4TN7B 3HKCE 4CI3B 4MFRA 2V7MA 5FXXA 1H7CA 2ZLYA 2YINA 2A3DA 3MZKB 4E7ZA 4MLKA 4N78D 3PU3A 5GONE 3CQCB 4XBFB 3PU8A 4CXXA 4HTEA 2NW9A 5IHYA 1FMWA 1WRDA 2B1EA 4H63H 4L5GA 3F57A 3RRCA 3UT5E 5LG4A 3RRWA 4ANJA 3C98B 3RH3A 4X1KE 5L2LA 3UUXB 1V9DA 3ANWB 1MMNA 4UV9B 2LE8A 1D0XA 3BQIA 4PAGA 4O4IE 1OWAA 4J2CA 4YJ2E 1G73A 4AQGA 3E22E 2EHOA 1MNDA 1MIWA 3FBZA 2L3LA 5JDGA 4GK0E 5HXCA 3IEEA 2C0SA 2DNXA 5JQGE 5KDMC 3VKGA 3SS1A 4ASKA 3UUNA 4AXPA 2M67A 3GN5B 3NZQA 3LG7A 4H9NC 4HE8A 3DP7A 5JDMA 4IE7A 1IJ5A 5FYMA 3ETUA 2EHOC 2CLYC 2HPLA 3DTOA 3K8PC 5JR9A 5HYAA 4A56A 5FXVA 1HF8A 1YKHB 4H9OC 3SRZA 4ERRA 5FY0A 5JVDE 3U3IA 5FY1A 4DMWA 4KBMB 4EB6E 4CQIA 2VASA 3LK2B 2I59A 4AKGA 2MOZA 3ESLA 3GWHA 2KINB 2H7OA 4EIWA 3AA6B 5L3DB 1WYBA 1MIYA 2KNDA 3C51A 2LEHA 2X66A 2Z6EA 3LK3B 1D1BA 4AKIA 3ZYMA 1D1CA 2Y8DA 3ONXA 3HKEE 3I1AA 3KV9A 3W15B 1US7B 4V1Av 4GOUA 5ETWA 5CA1E 4JLEA 5L3EB 5A1LA 4JEHB 2RP4A 5EK4A 2DI4A 2ZM8A 3AA0B 1QUUA 1HG5A 3EDUA 4IE4A 4ZI3D 2CXFA 3QUJA 2A2FX 4ILUA 3EUHA 5E0OA 3WI3A 2PFVA 4C91A 2KLQA 4ISSA 5M4YA 4UF0B 4JUYA 4PK4A 1QSDA 5JDLA 5IYZE 5L3GB 2WBLA 3KV5A 5H6QB 3PTRB 3NRXA 4DBQA 2Q9QB 4O2AE 2LM9A 3P8CD 3J9X1 2XTLA 2N9DA 3N9QA 4HFVA 2YU1A 4O4HE 2Y48B 4QKNA 4TUYE 2YEVC 2Y6XA 3CPZA 3C4ZA 4IE6A 2X51A 2KZ7B 3MACA 2DWKA 5LYJE 2D5UA 1BR1A 2X0LB 2LSGA 2WMNA 3MJXA 2DLRA 3FHNA 5JH7E 1CUNA 2KWIB 2LHNA 3Q5WA 4H9RC 4KMCA 3CKDA 3AAAB 4O2BE 2L9QA 3JC6D 2PG8A 3LBXA 4TV8E 2E9XC 4ZOLE 3KBTA 3A5XA 3I9YA 3GA8A 1KK7A 4UEMA 2CXDA 5LBMA 5TAOA 4AI6A 3O9XA 4UIGA 3ZEFB 1YW0A 3E08A 4OFZA 5HXSA 1E1HB 4UV8B 4EYYR 5LOVE 1ZKEA 1SHZC 4QX8B 4OK0A 4UVAB 5DQVA 2IW5B 4DNDA 2E9XB 2N2NA 2VK9A 3B13A 3VHLA 3HKDE 3ZLIA 3AAIA 2BZBA 1ZHCA 2A72A 2BVLA 4H9PC 4ADZA 4C90A 4OHFA 4ZI3C 3ZMZB 1VOMA 3KDSE 2K24A 4CXWA 3HA4A 2XQYA 4G63A 4X20E 3OBVE 3S4UA 5EK2A 3I9WA 5LNKA 3OJAA 3RC3A 3HL6A 4ZI2C 2VKDA 2NP9A 1LRZA 1B7TA 3VU7H 3CWZB 5FMNA 3BQKA 3FB2A 4TX5A 3AB3B 2ZM0A 1Y64B 3AA1B 5EK3A 3I0QA 5LXTE 5FXWA 5JDQA 3N9OA 3O4XE 3Q5XA 4NUUA 2KMFA 1HFAA 5LBQB 2KWHA 1HG2A 2UXXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  2X9Y A;  3S4U A;  3P7I A;  1Z0P A;  3N5L A;  3QK6 A;  2XTL A;  2C5K T;  1LRZ A;  2MBG A;  4L0R A;  4EYY R;  2IC6 A;  2C5I T;  4J2C A;  1ZKE A;  4B6X A;  2G0U A;  2X9X A;  4CQI A;  3QUJ A;  4DND A;  1H7C A;  3FXE B;  2C5J A;  3MXZ A;  1QSD A;  1LVF A;  3CVR A;  1IJ6 A;  2K48 A;  2IC9 A;  3TKL B;  2KWI B;  3FXD B;  4FI5 A;  3CKD A;  3L3P A;  2KWH A;  2X9W A;  2CA5 A; 
#chains in the Genus database with same CATH topology
 2H7V C;  4JI1 T;  5FY7 A;  5JRE A;  2XAF B;  1IBL T;  1E7P A;  2LSI A;  2VWA A;  3SOL A;  2PTF A;  3PJA A;  2UXD T;  3HKB E;  2BS3 A;  1MIV A;  3N2G E;  2ODV A;  4PW8 A;  2QA7 A;  4YTN A;  1N34 T;  4U74 A;  4DV5 T;  4UXN B;  1OED E;  3D0T A;  4E7S A;  3AE5 A;  2MTQ A;  3H37 A;  4QH5 A;  4CN4 A;  1UGO A;  2QYW A;  4AQF A;  3ZT5 A;  4HFB A;  5LGU B;  2VVN A;  4U72 A;  4JBW F;  2GK9 A;  3AEC A;  3I0O A;  3RYF E;  4IGU A;  4Z91 A;  2MBG A;  2WSS V;  2JMH A;  3KFW X;  2C5J A;  2VKH A;  1KF6 A;  1Y01 A;  4YY3 T;  4JI6 T;  4I0U A;  5C8Y E;  3N2O A;  2V8S V;  4U7Y A;  3H3M A;  4QX7 B;  4L0R A;  3K3O A;  3ZKR A;  2PJQ A;  4OX9 T;  3PJA J;  4WW0 A;  2CWO A;  5BMV E;  1D0Y A;  3JCF A;  1W9R A;  3IBP A;  1HX1 B;  5HWX A;  3EI0 A;  3FZM B;  5ABH A;  4P0A A;  2LRL A;  4JI8 T;  2V7K A;  5J0Z A;  1WCR A;  4Z8X A;  2VKO A;  3GN5 A;  4XAX B;  2JQK A;  3UU8 A;  3MK7 C;  4ZS2 A;  1WLX A;  5DQW A;  4X1I E;  4U2Y A;  1KFY A;  2VVS A;  4AKH A;  4EXT A;  4O4L E;  3JC6 C;  2D0T A;  2DCF A;  4AIS A;  2BBJ A;  3LJC A;  3QC9 A;  4DV0 T;  2CE7 A;  4GKK T;  5HWY A;  3TLS A;  1IJ6 A;  2HN1 A;  2I6H A;  1MNE A;  2BBH A;  3RHW A;  4B3T T;  3R84 B;  4X64 T;  1MMD A;  2NTY A;  4LF8 T;  1X9B A;  3QB5 A;  2E9X D;  3C4X A;  3ZC1 A;  3RGL A;  4ZHQ E;  2CCQ A;  5LB7 B;  3ZPO A;  5LHI B;  2LM2 A;  4MBQ A;  4HGA A;  2W61 A;  1XNQ T;  4ILC A;  2KXP B;  2I0M A;  4H9Q C;  1UX5 A;  1AJ3 A;  2C5I T;  2LOS A;  2XZE A;  4EAH A;  3NWI A;  4ZI2 D;  2XQ4 A;  4CZZ B;  2K9A A;  2XAQ B;  1ZOY A;  4EOZ B;  4HWF A;  2CXL A;  3C64 A;  3T1Y T;  2E9X A;  4OYJ A;  4YHH T;  3AE6 A;  2NWB A;  3ZN1 B;  5LGN B;  5L47 A;  1SE7 A;  2UXC T;  2E8I A;  3RQU A;  2CHO A;  3ZMT B;  4KI0 F;  2XM2 A;  2CA5 A;  2XQ8 A;  4JI7 T;  2WDQ A;  5JRC B;  2YKS A;  2LSK A;  1YQ4 A;  3AEB A;  5H6R B;  4CI3 B;  2A3D A;  3MZK B;  4HTE A;  5IHY A;  1FMW A;  4YSY A;  4H63 H;  3NKZ A;  4L5G A;  3UU6 A;  4ANJ A;  3ANW B;  4UV9 B;  4O4I E;  3AE7 A;  5LG3 A;  3PUV F;  2AE9 A;  3VKG A;  2BG9 B;  3SS1 A;  3LG7 A;  4HE8 A;  4HWC A;  4YTM A;  3T1H T;  2HPL A;  3OVU A;  3K8P C;  1I94 T;  5JR9 A;  4U7I A;  1YKH B;  1Z8U A;  4DMW A;  3TLW A;  4CQI A;  3SFD A;  3UU3 A;  2I59 A;  3ESL A;  5AQO B;  2H7O A;  4EIW A;  1WYB A;  3C51 A;  2LEH A;  2X66 A;  2Z6E A;  3LK3 B;  4IDQ A;  4K0K T;  3ZYM A;  3HKE E;  3KV9 A;  3W15 B;  5ETW A;  5CA1 E;  4JLE A;  4JEH B;  5EK4 A;  3L8R A;  4IE4 A;  2CXF A;  2A2F X;  5E0O A;  2YDR A;  4UF0 B;  4JUY A;  4EEB A;  4PK4 A;  3JAD A;  3AE2 A;  2WBL A;  5KXJ A;  5H6Q B;  3PTR B;  1YQ3 A;  4KHZ F;  4O2A E;  3PUZ F;  2LM9 A;  2IUB A;  2XTL A;  3N9Q A;  3PUX F;  2YU1 A;  4ZZC A;  2YEV C;  4WYV A;  4U31 A;  5AQG B;  2DWK A;  3FZK B;  2LSG A;  2WMN A;  2UXB T;  5JH7 E;  4KMC A;  3AAA B;  1NEK A;  3JAF A;  1XMO T;  3KBT A;  3A5X A;  3LSV A;  2CXD A;  5TAO A;  5HXS A;  4EYY R;  2XM1 A;  4DND A;  2V6Y B;  3VHL A;  2YN6 A;  2W2U A;  4ADZ A;  1W09 A;  5CJ5 A;  4X20 E;  2CBJ A;  5LNK A;  3VU7 H;  3CWZ B;  3AB3 B;  2E5V A;  2ZM0 A;  3I0Q A;  5LXT E;  4HFH A;  1OED B;  4TNW A;  1T7S A;  5LBQ B;  2UXX B;  1LVK A;  3VKH A;  1FMV A;  5ABF A;  5F5W A;  4HKA A;  2W00 A;  2F4V T;  2ES0 A;  4LF6 T;  1KNZ A;  5HAX A;  3RF1 A;  3UTK A;  5LA6 E;  3ABV A;  4DR2 T;  5HXR A;  2CLY B;  3RC8 A;  3IHR A;  3CX7 B;  2FBW A;  5AQV B;  2XAH B;  2XSB A;  3ZJ1 A;  4A5X A;  3P7I A;  4QXC B;  3OYX A;  5AQN B;  3UUL A;  2D0U A;  5LMN T;  1VCT A;  4WBO A;  4CN1 A;  4TWH A;  4UR9 A;  3CIR A;  1ZV4 X;  2BKP A;  3KV6 A;  1T98 A;  2VL8 A;  1LKX A;  2UUA T;  4DV2 T;  3M65 A;  4I55 E;  4BJM A;  5HXE A;  3AVR A;  4P0B A;  2WDV A;  4G2A A;  4I4T E;  4DR5 T;  2IHR 1;  3BK9 A;  3PUG A;  3NBX X;  1I6Z A;  5L3B B;  2IC9 A;  2XQA A;  2XUE A;  2C5K T;  4DUY T;  4X5T A;  4DR1 T;  2CBI A;  4YTP A;  3WAK A;  3O1J A;  4IDP A;  5DAB A;  2NR4 A;  2ODU A;  1R8I A;  4IDZ A;  3CX6 B;  4PJL A;  3UU4 A;  4BA9 A;  2K48 A;  1D1A A;  3L39 A;  3VRA A;  4NPP A;  3PE0 A;  3RQW A;  4ZI7 E;  3PUA A;  4EYU A;  3OTO T;  3ZYK A;  2W4X A;  2LHR A;  2JPF A;  2MPK A;  5J1G A;  3NVO A;  2V1D B;  2X0Y A;  3L3P A;  1UUS A;  2Q9Q D;  4DV3 T;  4CI1 B;  2IC6 A;  4JEU B;  3HI2 A;  4YHJ A;  4YXD A;  5L3F B;  1HNX T;  2WM9 A;  2VKJ A;  1N32 T;  4IIJ E;  3AXJ B;  4B3R T;  3MXZ A;  2XQ6 A;  2WAU A;  4AIU A;  5HEU A;  2JQQ A;  5IWA T;  4YLH A;  5AQP B;  3VRB A;  4AKL A;  4YJ3 E;  1EZ3 A;  4GIW A;  5JDF A;  4JI4 T;  3C50 A;  1L0V A;  2NW7 A;  3ONL C;  3HR0 A;  1O3X A;  3B5M A;  4IE5 A;  4P09 A;  4DV4 T;  2M6B A;  3N9L A;  4DR4 T;  2Q9Q A;  3KIN B;  3V5U A;  2XQ9 A;  4K0U A;  2PBI A;  4AQF C;  4H63 V;  2YU2 A;  1N33 T;  2J4G A;  4NUV A;  2Q9Q C;  3J7Y q;  2XAJ B;  2HHH T;  3P4W A;  4Z90 A;  4IE0 A;  4PNI A;  4EZ4 A;  4HFE A;  2E2A A;  3TLV A;  5FVK A;  3UUM A;  1IBM T;  3WAJ A;  4DR7 T;  2ACZ A;  3IF8 B;  4X65 T;  4YFS A;  3LK4 2;  2E5L T;  3O1H A;  1BR4 A;  2XJ7 A;  2X9X A;  3RIU A;  5LJN A;  3CVR A;  4QH1 A;  2YK0 A;  4DBR A;  4PFP A;  4AQY T;  5ADX L;  2A9U A;  3KV4 A;  4LMK A;  4QH4 A;  4E7Z A;  2CHN A;  4N78 D;  4XBF B;  3PU8 A;  4CXX A;  3RRW A;  3RH3 A;  3TLU A;  1XMQ T;  3UUX B;  1V9D A;  2LE8 A;  1D0X A;  4PAG A;  4Q25 A;  2D9D A;  1MIW A;  3FBZ A;  2WDR A;  5JDG A;  3IEE A;  2DL1 A;  1IJ5 A;  3ETU A;  4GKJ T;  3DTO A;  1WFD A;  5HYA A;  5JVD E;  5FY1 A;  2UUB T;  4CN6 A;  3LK2 B;  1J5W A;  1MIY A;  2KND A;  3AE1 A;  2WZH A;  4V1A v;  3RIF A;  2DI4 A;  4ILU A;  3WI3 A;  3AEF A;  4U3C A;  5IYZ E;  4LF5 T;  5L3G B;  5AQF B;  3QOF A;  2QRX A;  4ILA A;  4IL9 A;  2N9D A;  1KNP A;  3UFG A;  5AQQ B;  4TUY E;  4B3M T;  3JAE A;  2JQ9 A;  2W66 A;  1BR1 A;  3MJX A;  2JQH A;  1CUN A;  2L9Q A;  2PG8 A;  4TV8 E;  2E9X C;  4ZOL E;  3I9Y A;  4UEM A;  4UIG A;  3ZEF B;  1YW0 A;  5HEH A;  1E1H B;  2OLT A;  5LOV E;  4LMJ A;  1SHZ C;  2IW5 B;  3AAI A;  2A72 A;  2BVL A;  4H9P C;  4HFI A;  4C90 A;  3ZMZ B;  3KDS E;  4CXW A;  3HA4 A;  4G63 A;  3RC3 A;  4ZI2 C;  2VKD A;  1B7T A;  2OV9 A;  3FB2 A;  3UU5 A;  2XQ3 A;  4DV7 T;  1VCS A;  3AA1 B;  5EK3 A;  5FXW A;  1HFA A;  4TWD A;  4QXB B;  3N5L A;  5HEO A;  3ZN0 B;  1HTJ F;  5F3J A;  2YDQ A;  4JV5 T;  3ZCJ A;  1ZEE A;  3OYZ A;  1E2A A;  2V6X A;  4IRE A;  2EHO B;  5JR9 C;  3TKL B;  2BKO A;  4I43 B;  4TWF A;  2X9W A;  5LJM A;  2X9Y A;  3F31 A;  3F2E A;  3LFM A;  2XHE B;  4H9S E;  3ZC0 A;  5AQJ B;  3ZMS B;  3AEE A;  3R6N A;  4UVC B;  3CX8 B;  2MAW A;  2X67 A;  2OA5 A;  4XZC A;  2FJB A;  4I50 E;  3ZT7 A;  1UX4 A;  2BS2 A;  2V26 A;  2WU5 A;  1FIO A;  3QK6 A;  2V7L A;  3RPU A;  5EZY E;  1IAP A;  4X1Y E;  5FNV E;  2W62 A;  2X9H A;  5KMG P;  2ACX A;  3SWH A;  3T8O A;  2UXN B;  1UUR A;  4DO0 A;  2AXD S;  1X79 A;  3CQX C;  5JRC A;  5DJQ C;  3UUB A;  1UCU A;  2LJL A;  2XSA A;  2QVA A;  4M1P A;  4MHC A;  2M6I A;  1HS7 A;  1GQE A;  2J1D G;  2CEA A;  5JTG A;  1MMA A;  5HXH A;  2ZM6 T;  3ANW A;  5C3J A;  2JRK A;  3LBX B;  2V7J A;  5CB4 E;  4EED A;  2XPK A;  1JNZ A;  2BG9 A;  2CM0 A;  4O4J E;  2XAS B;  5BR8 T;  5CA0 E;  3ZMU B;  4WNK A;  3N9N A;  3ONJ A;  3OKQ A;  3KBU A;  4NXN T;  5AQK B;  5L4H A;  4JI5 T;  1XNR T;  2BG9 C;  4IDN A;  4KHP T;  4EZH A;  2LT3 A;  3VR9 A;  4O8S A;  2W0G A;  2XAG B;  1VRB A;  1KEY A;  3FZF B;  2LSY A;  2LRK A;  1J1J A;  3TLT A;  4GYS A;  2LSJ A;  3FXD B;  4IHJ E;  2H89 A;  3ZJ2 A;  4DMV A;  2HH7 A;  1SA0 E;  4X66 T;  4UF0 A;  5ABG A;  3ZYL A;  3H3A A;  5AQI B;  4JYA T;  1LVF A;  3Q9D A;  4BAY B;  1M62 A;  5JDN A;  2LKG A;  1J5E T;  3P4R A;  5LGT B;  4LF4 T;  3EAB A;  2G0U A;  2KSR A;  1M7K A;  3RYH E;  4QXH B;  3P4Q A;  4KP3 C;  3AE8 A;  4GK5 E;  3EDV A;  4PJM A;  2BS4 A;  2HN2 A;  3Q5E A;  2QGS A;  3ZMV B;  3NRY A;  3Q5D A;  3OPC A;  2UU9 T;  2JMK A;  3L09 A;  2V6Y A;  2WWU A;  1U5P A;  3SFE A;  1HCI A;  3AE3 A;  3UFE A;  1XDO A;  4NIQ A;  2LOP A;  2B76 A;  4P1N A;  4DVD A;  2KT9 A;  3PV0 F;  2R6G F;  4QWN B;  2SPC A;  3RLF F;  5LP6 E;  4CI2 B;  4B6X A;  1OED A;  3HKC E;  5FXX A;  2V7M A;  1H7C A;  2ZLY A;  5HEJ A;  2H88 A;  4MLK A;  3CQC B;  2CRB A;  2NW9 A;  4F8H A;  1WRD A;  4DID B;  3AEA A;  2CPT A;  1OED C;  3UT5 E;  3C98 B;  4X1K E;  1ZP0 A;  1XWM A;  4EV6 A;  3QB5 K;  4J2C A;  2L3L A;  5HXC A;  5KDM C;  2DNX A;  3UUN A;  3GN5 B;  3NZQ A;  4DR3 T;  3DP7 A;  5JDM A;  4IE7 A;  2CLY C;  1HF8 A;  4H9O C;  3U3I A;  2JIW A;  4KBM B;  4EB6 E;  5AQR B;  2XY8 B;  2VAS A;  3A8Y C;  2MOZ A;  3AA6 B;  5L3D B;  4NXM T;  1D1B A;  4JI3 T;  2RPA A;  4YSX A;  3I1A A;  4GOU A;  5A1L A;  2RP4 A;  5IUX A;  2ZM8 A;  3AA0 B;  4IL4 A;  3QUJ A;  4C91 A;  4ISS A;  5JDL A;  3KV5 A;  4DBQ A;  1JNR A;  3J9X 1;  3RI5 A;  3P4S A;  4DUZ T;  5FL1 A;  2Y6X A;  3EAM A;  3CPZ A;  3C4Z A;  4IE6 A;  2X51 A;  3MAC A;  2XQ5 A;  5LYJ E;  2D5U A;  4HFD A;  2X0L B;  2LHN A;  3Q5W A;  2WB5 A;  3JC6 D;  4U2Z A;  2J47 A;  1KK7 A;  5LBM A;  3RIU C;  4UV8 B;  2XQ7 A;  4OK0 A;  4UVA B;  2E9X B;  2VK9 A;  3ZLI A;  4YSZ A;  2BZB A;  1ZHC A;  4OHF A;  1VOM A;  1HNZ T;  3RKG A;  1HNW T;  1KNR A;  5EK2 A;  3OJA A;  3HL6 A;  2NP9 A;  1LRZ A;  2IDO B;  1DU2 A;  3AXJ A;  3O4X E;  1UK5 A;  1HG2 A;  1BR0 A;  4JI0 T;  2NOX A;  3K1S A;  3P50 A;  2FJA A;  2D2S A;  4LFC T;  2NTX A;  1U4Q A;  3ZCI A;  1S35 A;  3IA3 A;  3AA7 B;  3V5S A;  1N36 T;  5FXZ A;  3N9P A;  2K5B B;  1FJG T;  3KVA A;  5AQM B;  3U78 A;  1S94 A;  4PFO A;  1YXR A;  3KVB A;  4PJN A;  5JR9 B;  2X0H A;  3CQG B;  2L8K A;  4TV9 E;  3PUW F;  3PDY A;  3UQ4 A;  5KX5 E;  3RX6 A;  3K3N A;  3CK6 A;  3B57 A;  5AQL B;  4GYR A;  3X1D A;  2WP9 A;  2BDE A;  2ZMA A;  1MMG A;  2WWV A;  2V7I A;  5CFB A;  5LHH B;  5L3C B;  3FZH B;  5FP3 A;  2RA1 A;  2WU2 A;  5J2T E;  4QHO A;  4DR6 T;  4PJJ A;  2IAK A;  2W67 A;  1T72 A;  5F8P A;  3E0Z A;  4TNV A;  4TZ4 C;  5FVL A;  4A98 A;  4YT0 A;  5FKY A;  2WMO A;  4BJN A;  2ZM2 A;  3AE4 A;  1CHU A;  3CML A;  3RIA A;  4UEL A;  3AEG A;  2LLY A;  3RYC E;  3N9M A;  4IST A;  4KUM B;  2NW8 A;  2UUC T;  4L9I A;  3AVS A;  5CGM A;  3GMI A;  1IBK T;  4ZEY A;  3PUQ A;  3ZT6 A;  4HWI B;  4U33 A;  3K3Q C;  5J2U E;  2X68 A;  2VL0 A;  3QNU A;  1G8X A;  1BR2 A;  5C2T A;  2CMR A;  4FJO A;  3RYI E;  2YDS A;  1OXZ A;  2JJ9 A;  2VB6 A;  1WR6 A;  4HFC A;  2IML A;  2WS3 A;  2WZI A;  3FZL B;  3UQ7 A;  1D0Z A;  4LF9 T;  4EGW A;  4ILB A;  3ETV A;  5ABF B;  3Q2M A;  4OYK A;  3EVY A;  1WYC A;  3FXE B;  1YD8 G;  2DHR A;  1XZY A;  1IZN B;  1FEW A;  4FI5 A;  3MA9 A;  1HX8 A;  4AKR B;  2MYS A;  2H3R A;  4LFB T;  1Z0P A;  4PK5 A;  4DV6 T;  4KX6 A;  5LHG B;  1WR0 A;  2DWG A;  3C4W A;  5ABE A;  3MKD A;  4F6R C;  4WBN E;  5AQH B;  4MAL A;  4UVB B;  2N1G A;  3BQL A;  4WZX A;  2CWY A;  3FBL A;  5HEG A;  2HPJ A;  2W63 A;  3DJB A;  4HN9 A;  5AFU L;  3PUS A;  3N2K E;  5LCY A;  4LML A;  2EHO D;  3AAE B;  3AE9 A;  4IT4 A;  5JDH A;  3O1I A;  3PUR A;  1YKE B;  2P9B A;  4CXY A;  2BVM A;  4HEA A;  4ZS3 A;  3RKO A;  1NAF A;  3NZP A;  1NWM X;  4PK6 A;  3AED A;  5HCJ A;  1T8B A;  1W0B A;  4TN7 B;  4MFR A;  5HCM A;  2YIN A;  3PU3 A;  5GON E;  3G06 A;  2FJE A;  2B1E A;  2FJD A;  1XDP A;  3F57 A;  3RRC A;  5LG4 A;  5L2L A;  1MMN A;  4X62 T;  3BQI A;  1OWA A;  2IIU A;  2WY2 A;  4YJ2 E;  5AQT B;  1G73 A;  5AQU B;  3E22 E;  4AQG A;  2EHO A;  1MND A;  4JI2 T;  4GK0 E;  5LMU T;  2C0S A;  5JQG E;  4ASK A;  4AXP A;  2M67 A;  5L4E A;  2YOE A;  4H9N C;  4HWD A;  5FYM A;  2EHO C;  4A56 A;  5FXV A;  3PUY F;  3SRZ A;  4ERR A;  2V5C A;  5FY0 A;  4IDO A;  1NEN A;  4COF A;  4AKG A;  2BKN A;  3GWH A;  2KIN B;  3VR8 A;  4AKI A;  1D1C A;  2Y8D A;  3ONX A;  1US7 B;  2BG9 E;  2VQE T;  5L3E B;  1QUU A;  1HG5 A;  3EDU A;  4ZI3 D;  2FUP A;  3EUH A;  2PFV A;  2KLQ A;  5M4Y A;  1QSD A;  2WCA A;  3A7M A;  3P4P A;  5AQS B;  2VUR A;  4LFA T;  3NRX A;  4DV1 T;  2J62 A;  2Q9Q B;  2K3W A;  4LF7 T;  3ZST A;  3P8C D;  4A97 A;  4HFV A;  4O4H E;  1W0A A;  2Y48 B;  3M3Z B;  4QKN A;  3LDQ B;  2LKH A;  3EHZ A;  3ZSS A;  2KZ7 B;  1QLB A;  4ZZB A;  2DLR A;  3FHN A;  2KWI B;  4H9R C;  3CKD A;  4O2B E;  3LBX A;  3GA8 A;  4AI6 A;  3O9X A;  3E08 A;  2WQY A;  4OFZ A;  1ZKE A;  4QX8 B;  5DQV A;  2N2N A;  3B13 A;  3HKD E;  1SUM B;  4ZI3 C;  2K24 A;  2VQF T;  2XQY A;  3OBV E;  3S4U A;  3I9W A;  5FMN A;  3BQK A;  1HR0 T;  4TX5 A;  2V5D A;  1Y64 B;  4B3S T;  5JDQ A;  4HWH A;  3N9O A;  4NUU A;  3Q5X A;  2KMF A;  4ZXL A;  2KWH A;  5FL0 A; 
#chains in the Genus database with same CATH homology
 2H7V C;  1LVK A;  5FY7 A;  2NOX A;  2XAF B;  1FMV A;  5JRE A;  4QXB B;  3VKH A;  2LSI A;  3N5L A;  3ZN0 B;  4HKA A;  2D2S A;  1HTJ F;  2W00 A;  2VWA A;  2NTX A;  3SOL A;  1U4Q A;  2ES0 A;  3ZCI A;  5F3J A;  1S35 A;  1KNZ A;  5HAX A;  3ZCJ A;  3AA7 B;  3UTK A;  5LA6 E;  3V5S A;  1ZEE A;  3HKB E;  3OYZ A;  2EHO B;  2CLY B;  5FXZ A;  1MIV A;  3N2G E;  5HXR A;  3N9P A;  3RC8 A;  3IHR A;  3CX7 B;  2K5B B;  3TKL B;  5JR9 C;  2ODV A;  4PW8 A;  2QA7 A;  4I43 B;  2X9W A;  5LJM A;  4U74 A;  3KVA A;  2X9Y A;  2XAH B;  3F31 A;  3U78 A;  3ZJ1 A;  4UXN B;  3P7I A;  1S94 A;  4QXC B;  3F2E A;  3LFM A;  2XHE B;  3D0T A;  3OYX A;  4H9S E;  4PFO A;  3ZC0 A;  3ZMS B;  4E7S A;  3UUL A;  2D0U A;  3KVB A;  4PJN A;  3R6N A;  4UVC B;  5JR9 B;  2MTQ A;  3H37 A;  3CX8 B;  2X67 A;  4WBO A;  2OA5 A;  3CQG B;  4AQF A;  2L8K A;  4XZC A;  4TV9 E;  3PDY A;  5LGU B;  1ZV4 X;  3KV6 A;  1T98 A;  4I50 E;  4U72 A;  1UX4 A;  5KX5 E;  2VL8 A;  1LKX A;  3RX6 A;  3K3N A;  2V26 A;  2GK9 A;  3M65 A;  1FIO A;  3B57 A;  3I0O A;  4I55 E;  3RYF E;  4BJM A;  3QK6 A;  4GYR A;  4IGU A;  3AVR A;  5HXE A;  2V7L A;  3RPU A;  4P0B A;  5EZY E;  2MBG A;  2WSS V;  4G2A A;  4I4T E;  2BDE A;  2ZMA A;  1IAP A;  1MMG A;  2JMH A;  4X1Y E;  5FNV E;  2V7I A;  3BK9 A;  2W62 A;  3PUG A;  3KFW X;  2X9H A;  3NBX X;  5KMG P;  2ACX A;  5L3C B;  5LHH B;  3SWH A;  5FP3 A;  2C5J A;  3T8O A;  2VKH A;  2RA1 A;  5L3B B;  2UXN B;  2IC9 A;  5J2T E;  4DO0 A;  2XUE A;  3CQX C;  1X79 A;  5JRC A;  2C5K T;  5C8Y E;  4QHO A;  3N2O A;  5DJQ C;  1UCU A;  4PJJ A;  2LJL A;  3WAK A;  3O1J A;  4QX7 B;  2IAK A;  4L0R A;  3K3O A;  4M1P A;  4MHC A;  5DAB A;  1HS7 A;  2ODU A;  4IDZ A;  2PJQ A;  3CX6 B;  5F8P A;  3E0Z A;  4WW0 A;  2CWO A;  4TZ4 C;  5BMV E;  1D0Y A;  4PJL A;  2J1D G;  2CEA A;  3IBP A;  1MMA A;  4BA9 A;  5HWX A;  2K48 A;  2WMO A;  5HXH A;  1D1A A;  4BJN A;  2ZM2 A;  4P0A A;  3ANW A;  3PE0 A;  3CML A;  2JRK A;  2V7K A;  4UEL A;  3LBX B;  2V7J A;  5CB4 E;  3RYC E;  4ZI7 E;  3N9M A;  3PUA A;  4IST A;  4KUM B;  4EYU A;  2NW8 A;  2CM0 A;  4O4J E;  2XAS B;  5CA0 E;  3ZYK A;  4Z8X A;  2LHR A;  2JPF A;  2VKO A;  3GN5 A;  4L9I A;  5J1G A;  3ZMU B;  3AVS A;  4XAX B;  4WNK A;  3N9N A;  3GMI A;  3MK7 C;  2V1D B;  4ZS2 A;  1WLX A;  5DQW A;  3OKQ A;  3PUQ A;  3KBU A;  4X1I E;  3L3P A;  3K3Q C;  5J2U E;  2X68 A;  2Q9Q D;  4EZH A;  1G8X A;  1BR2 A;  4AKH A;  4EXT A;  4O4L E;  2LT3 A;  4CI1 B;  4O8S A;  2W0G A;  3JC6 C;  2IC6 A;  2XAG B;  2CMR A;  4JEU B;  3HI2 A;  2D0T A;  2DCF A;  4FJO A;  3LJC A;  3QC9 A;  1VRB A;  4YHJ A;  3RYI E;  2CE7 A;  1OXZ A;  2LSY A;  2JJ9 A;  5L3F B;  5HWY A;  1IJ6 A;  2VKJ A;  2WM9 A;  4IIJ E;  2VB6 A;  4GYS A;  2LSJ A;  3FXD B;  3MXZ A;  1WR6 A;  2WAU A;  2JQQ A;  4YLH A;  1MNE A;  4AKL A;  4YJ3 E;  1EZ3 A;  4GIW A;  4IHJ E;  5JDF A;  1D0Z A;  3R84 B;  1MMD A;  3C50 A;  2NTY A;  3ZJ2 A;  4DMV A;  2HH7 A;  3ETV A;  1SA0 E;  3Q2M A;  4UF0 A;  3ZYL A;  4OYK A;  2NW7 A;  2E9X D;  3H3A A;  3EVY A;  3HR0 A;  1WYC A;  3FXE B;  1O3X A;  3C4X A;  4IE5 A;  4P09 A;  3ZC1 A;  4ZHQ E;  3N9L A;  1YD8 G;  1LVF A;  2CCQ A;  2DHR A;  3ZPO A;  2Q9Q A;  5LHI B;  1IZN B;  3Q9D A;  1FEW A;  4BAY B;  3KIN B;  4FI5 A;  4MBQ A;  4HGA A;  3MA9 A;  1HX8 A;  2W61 A;  4AKR B;  2MYS A;  2H3R A;  3V5U A;  5JDN A;  2KXP B;  4H9Q C;  1UX5 A;  1Z0P A;  4K0U A;  2PBI A;  4PK5 A;  4AQF C;  4H63 V;  2YU2 A;  1AJ3 A;  1BR0 A;  4NUV A;  5LGT B;  5LHG B;  2Q9Q C;  3J7Y q;  2XAJ B;  2C5I T;  2DWG A;  2LOS A;  2G0U A;  3C4W A;  3MKD A;  4F6R C;  3RYH E;  4WBN E;  4IE0 A;  4QXH B;  4KP3 C;  4PNI A;  4EAH A;  4EZ4 A;  4MAL A;  4UVB B;  4GK5 E;  4ZI2 D;  3EDV A;  4PJM A;  2N1G A;  3BQL A;  3UUM A;  3WAJ A;  4CZZ B;  2CWY A;  3IF8 B;  2QGS A;  2K9A A;  4YFS A;  3LK4 2;  3ZMV B;  3NRY A;  3O1H A;  1BR4 A;  3FBL A;  2XAQ B;  4EOZ B;  2CXL A;  2JMK A;  3C64 A;  3L09 A;  2E9X A;  2WWU A;  2HPJ A;  2W63 A;  2X9X A;  3DJB A;  1U5P A;  4HN9 A;  4OYJ A;  5AFU L;  3PUS A;  1HCI A;  3N2K E;  5LCY A;  3UFE A;  2NWB A;  2EHO D;  2LOP A;  3ZN1 B;  3AAE B;  3CVR A;  5LGN B;  5LJN A;  2E8I A;  2YK0 A;  4DVD A;  3ZMT B;  2KT9 A;  4DBR A;  3O1I A;  3PUR A;  5JDH A;  2CA5 A;  1YKE B;  2P9B A;  4CXY A;  2BVM A;  4HEA A;  4PFP A;  4ZS3 A;  2LSK A;  5JRC B;  5ADX L;  4QWN B;  5H6R B;  3RKO A;  1NAF A;  3NZP A;  2SPC A;  1NWM X;  3KV4 A;  4PK6 A;  5LP6 E;  4CI2 B;  4B6X A;  4TN7 B;  3HKC E;  4CI3 B;  4MFR A;  2V7M A;  5FXX A;  1H7C A;  2ZLY A;  2YIN A;  2A3D A;  3MZK B;  4E7Z A;  4MLK A;  4N78 D;  3PU3 A;  5GON E;  3CQC B;  4XBF B;  3PU8 A;  4CXX A;  4HTE A;  2NW9 A;  5IHY A;  1FMW A;  1WRD A;  2B1E A;  4H63 H;  4L5G A;  3F57 A;  3RRC A;  3UT5 E;  5LG4 A;  3RRW A;  4ANJ A;  3C98 B;  3RH3 A;  4X1K E;  5L2L A;  3UUX B;  1V9D A;  3ANW B;  1MMN A;  4UV9 B;  2LE8 A;  1D0X A;  3BQI A;  4PAG A;  4O4I E;  1OWA A;  4J2C A;  4YJ2 E;  1G73 A;  4AQG A;  3E22 E;  2EHO A;  1MND A;  1MIW A;  3FBZ A;  2L3L A;  5JDG A;  4GK0 E;  5HXC A;  3IEE A;  2C0S A;  2DNX A;  5JQG E;  5KDM C;  3VKG A;  3SS1 A;  4ASK A;  3UUN A;  4AXP A;  2M67 A;  3GN5 B;  3NZQ A;  3LG7 A;  4H9N C;  4HE8 A;  3DP7 A;  5JDM A;  4IE7 A;  1IJ5 A;  5FYM A;  3ETU A;  2EHO C;  2CLY C;  2HPL A;  3DTO A;  3K8P C;  5JR9 A;  5HYA A;  4A56 A;  5FXV A;  1HF8 A;  1YKH B;  4H9O C;  3SRZ A;  4ERR A;  5FY0 A;  5JVD E;  3U3I A;  5FY1 A;  4DMW A;  4KBM B;  4EB6 E;  4CQI A;  2VAS A;  3LK2 B;  2I59 A;  4AKG A;  2MOZ A;  3ESL A;  3GWH A;  2KIN B;  2H7O A;  4EIW A;  3AA6 B;  5L3D B;  1WYB A;  1MIY A;  2KND A;  3C51 A;  2LEH A;  2X66 A;  2Z6E A;  3LK3 B;  1D1B A;  4AKI A;  3ZYM A;  1D1C A;  2Y8D A;  3ONX A;  3HKE E;  3I1A A;  3KV9 A;  3W15 B;  1US7 B;  4V1A v;  4GOU A;  5ETW A;  5CA1 E;  4JLE A;  5L3E B;  5A1L A;  4JEH B;  2RP4 A;  5EK4 A;  2DI4 A;  2ZM8 A;  3AA0 B;  1QUU A;  1HG5 A;  3EDU A;  4IE4 A;  4ZI3 D;  2CXF A;  3QUJ A;  2A2F X;  4ILU A;  3EUH A;  5E0O A;  3WI3 A;  2PFV A;  4C91 A;  2KLQ A;  4ISS A;  5M4Y A;  4UF0 B;  4JUY A;  4PK4 A;  1QSD A;  5JDL A;  5IYZ E;  5L3G B;  2WBL A;  3KV5 A;  5H6Q B;  3PTR B;  3NRX A;  4DBQ A;  2Q9Q B;  4O2A E;  2LM9 A;  3P8C D;  3J9X 1;  2XTL A;  2N9D A;  3N9Q A;  4HFV A;  2YU1 A;  4O4H E;  2Y48 B;  4QKN A;  4TUY E;  2YEV C;  2Y6X A;  3CPZ A;  3C4Z A;  4IE6 A;  2X51 A;  2KZ7 B;  3MAC A;  2DWK A;  5LYJ E;  2D5U A;  1BR1 A;  2X0L B;  2LSG A;  2WMN A;  3MJX A;  2DLR A;  3FHN A;  5JH7 E;  1CUN A;  2KWI B;  2LHN A;  3Q5W A;  4H9R C;  4KMC A;  3CKD A;  3AAA B;  4O2B E;  2L9Q A;  3JC6 D;  2PG8 A;  3LBX A;  4TV8 E;  2E9X C;  4ZOL E;  3KBT A;  3A5X A;  3I9Y A;  3GA8 A;  1KK7 A;  4UEM A;  2CXD A;  5LBM A;  5TAO A;  4AI6 A;  3O9X A;  4UIG A;  3ZEF B;  1YW0 A;  3E08 A;  4OFZ A;  5HXS A;  1E1H B;  4UV8 B;  4EYY R;  5LOV E;  1ZKE A;  1SHZ C;  4QX8 B;  4OK0 A;  4UVA B;  5DQV A;  2IW5 B;  4DND A;  2E9X B;  2N2N A;  2VK9 A;  3B13 A;  3VHL A;  3HKD E;  3ZLI A;  3AAI A;  2BZB A;  1ZHC A;  2A72 A;  2BVL A;  4H9P C;  4ADZ A;  4C90 A;  4OHF A;  4ZI3 C;  3ZMZ B;  1VOM A;  3KDS E;  2K24 A;  4CXW A;  3HA4 A;  2XQY A;  4G63 A;  4X20 E;  3OBV E;  3S4U A;  5EK2 A;  3I9W A;  5LNK A;  3OJA A;  3RC3 A;  3HL6 A;  4ZI2 C;  2VKD A;  2NP9 A;  1LRZ A;  1B7T A;  3VU7 H;  3CWZ B;  5FMN A;  3BQK A;  3FB2 A;  4TX5 A;  3AB3 B;  2ZM0 A;  1Y64 B;  3AA1 B;  5EK3 A;  3I0Q A;  5LXT E;  5FXW A;  5JDQ A;  3N9O A;  3O4X E;  3Q5X A;  4NUU A;  2KMF A;  1HFA A;  5LBQ B;  2KWH A;  1HG2 A;  2UXX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...