3M3ZB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 45
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3m3zB00
1UGOA 3A8YC 2D9DA 5AQMB 3FZKB 5AQSB 5AQVB 5AQIB 5AQHB 3FZHB 5AQOB 4HWIB 5AQTB 4HWCA 1I6ZA 5AQJB 3FZFB 5AQNB 5AQFB 4HWHA 5AQUB 1M7KA 3LDQB 5AQKB 3FZMB 1UK5A 4HWDA 5AQRB 5AQGB 4HWFA 5AQPB 1T7SA 5AQLB 1HX1B 1M62A 3M3ZB 3FZLB 5AQQB
chains in the Genus database with same CATH superfamily
3PU8A 1SHZC 3ZYKA 2UU9T 3JAEA 5FVKA 4UR9A 2XQ9A 2MAWA 2VVNA 5L47A 4AISA 2L9QA 2WU2A 2QRXA 3HKCE 2I59A 5JREA 4X64T 2WS3A 3AEAA 4QXBB 4PK5A 2FUPA 2BG9E 3WI3A 5FL0A 1CUNA 4PJLA 2W4XA 4EYYR 3K3QC 5E0OA 5IYZE 4IL9A 4UVAB 1QSDA 5HEJA 4ZZCA 1KK7A 3HKEE 2ODVA 3UUNA 2H7VC 3I9YA 3OBVE 3LK42 2D2SA 2QA7A 1UK5A 4HWDA 4ZOLE 5C8YE 2YINA 3FHNA 3HI2A 3AE5A 2E2AA 2WM9A 5IUXA 4O4HE 5JDHA 3ETUA 2CXFA 4DR2T 5AQFB 1V9DA 3E22E 4YSZA 4LF4T 2K5BB 2LE8A 4ZI3C 2J1DG 4LMKA 3AVSA 4WYVA 4NXMT 5EZYE 2LOPA 4EZHA 4HTEA 3LK2B 5FY0A 3WAKA 3O1IA 2A3DA 3NWIA 3ONXA 2VWAA 2E5VA 2ZM8A 4YT0A 3S4UA 4IDOA 2LRLA 3IF8B 4LF8T 2W62A 4JLEA 4HN9A 3AA7B 5CGMA 3RYCE 2RPAA 4UF0A 4JI6T 2XSAA 5LJNA 2WBLA 2KMFA 4O2AE 5CJ5A 4DMWA 3E08A 5HXHA 5LGNB 1HR0T 1FMVA 3EHZA 3T1HT 3O4XE 4X66T 1D0YA 2V7JA 1JNRA 3ZMVB 3I9WA 2BDEA 3OTOT 5AQPB 4JI7T 1R8IA 5DQVA 1ZOYA 2PTFA 1HF8A 4IT4A 1KFYA 3AECA 4A98A 4P1NA 1ZEEA 4IE7A 3CQXC 4AKGA 3K3NA 3O9XA 3J7Yq 4EEDA 4ISTA 4DR7T 2BG9C 2XM2A 1HX1B 2C5JA 4PNIA 3A7MA 5FYMA 2XQ7A 4JEUB 4AKHA 4YXDA 4X62T 3HKDE 1OWAA 2X51A 4HFVA 3U78A 5AQNB 4HE8A 3G06A 4PJNA 2H89A 3O1HA 1X79A 3RYIE 1YW0A 2CE7A 5HCMA 3UTKA 2X0HA 3EDUA 2BG9B 4ILBA 1E2AA 3UQ7A 4I4TE 1MNDA 2LLYA 5F5WA 4EB6E 3VKHA 2H7OA 1SE7A 5CA0E 1L0VA 2DWKA 3ZLIA 3ZCIA 2ODUA 4PFPA 3AAEB 2NOXA 4ILUA 3N5LA 5AQJB 3FB2A 2NW7A 2RP4A 1YQ4A 3Q2MA 3KV5A 2V1DB 4JI5T 2HPJA 3ZSSA 4PK4A 4PK6A 1VOMA 4PJJA 4GIWA 5FKYA 1N32T 1IAPA 4J2CA 3UUXB 2UUBT 5L3FB 2WP9A 2HHHT 2VQET 2BZBA 3ABVA 2C5KT 5HCJA 2RA1A 2KWHA 4G63A 1US7B 1J5WA 1W0BA 2VL8A 2E9XC 4BJMA 4QWNB 3QK6A 2XQ6A 4F8HA 5L3EB 4I55E 1MIWA 2WDVA 1FMWA 2JQQA 3TLUA 4LF6T 4ZXLA 4IDNA 4WBOA 3UQ4A 1HFAA 1ZHCA 4TV9E 4K0UA 2ZM2A 1KEYA 4IGUA 3V5SA 2Q9QC 4TNWA 3FBLA 2LSJA 4NPPA 2V8SV 4HEAA 4LFAT 3N9LA 4YTNA 3P4WA 4UXNB 3PUGA 3C98B 2I6HA 4Q25A 2YEVC 4TX5A 2CLYC 1NEKA 5L4EA 1WLXA 3ZPOA 3Q5WA 5L3DB 4LFBT 2ACZA 3KDSE 2CWOA 2Q9QB 4HFDA 3AE3A 3DJBA 4NUUA 3KINB 3NZQA 4O4JE 2LSKA 5JQGE 4M1PA 3ZT6A 2UXBT 3KBUA 1ZP0A 3ZN0B 3PUZF 3AE7A 3HA4A 3ZEFB 2YK0A 3RKOA 2XZEA 4X5TA 3SS1A 1T7SA 4N78D 5FXVA 2CLYB 5FNVE 4KHPT 2WDRA 3J9X1 2CBJA 3MACA 1EZ3A 3BQKA 2KWIB 3C50A 2CHOA 3RIFA 3KVAA 4I50E 4YHHT 2XQ3A 3ESLA 2J47A 1D0XA 2FJAA 5KX5E 4U72A 2VB6A 3P7IA 2UXXB 3A5XA 4EZ4A 4H9RC 2YU2A 4HWHA 3TLWA 3UT5E 2MOZA 3AEEA 2V7LA 3NRXA 3AA1B 2PJQA 2ACXA 3RYFE 2VASA 3FZLB 3V5UA 1UGOA 5BMVE 3RHWA 5JH7E 2J62A 4PW8A 2DCFA 4L9IA 2P9BA 4NXNT 3LK3B 3RKGA 2XQ5A 1N36T 4IE0A 4XAXB 2JMKA 4AIUA 2WWUA 1MIVA 2Y8DA 3W15B 1HNWT 3EDVA 3ZMTB 5KXJA 3AE8A 2DWGA 4EYUA 4LF5T 4I43B 3H3MA 5CA1E 1T72A 3NZPA 3ONJA 3ZCJA 3ZC0A 2E9XD 2KT9A 4NUVA 4I0UA 4ILAA 1VRBA 3Q5EA 2OLTA 4C90A 3DTOA 3GWHA 2X9HA 1O3XA 4QH4A 3X1DA 3LFMA 1M62A 4DO0A 2VQFT 5HEGA 3RYHE 4YJ3E 2Q9QD 3N9QA 1KNRA 4QH1A 3P4PA 1I94T 2F4VT 1T8BA 2IC9A 3JCFA 4HFIA 3MXZA 3MK7C 3ZMSB 4WW0A 1XZYA 2E5LT 4YLHA 1HG2A 1BR1A 2C5IT 4MBQA 5LMNT 4E7ZA 5AQIB 3AE6A 2KZ7B 4B3MT 1IBMT 3UU8A 3PUAA 3ANWA 2JIWA 4AXPA 3Q9DA 4X20E 4CXXA 3ZT5A 3CK6A 1WRDA 3ANWB 4CI2B 3R6NA 3CWZB 2XAJB 5C2TA 4AKLA 3UUBA 5LXTE 4JV5T 4LMJA 5FY1A 4HWIB 1FJGT 3AE2A 4DNDA 4Z8XA 2B76A 3QB5K 4ASKA 4QXCB 4DMVA 5LNKA 4ZI2C 4O2BE 4OK0A 2MPKA 3VRBA 3T1YT 2KINB 3I0QA 1BR0A 1Z8UA 4WZXA 2BKPA 2WY2A 3CKDA 3PU3A 3UU3A 3RRCA 5LYJE 3U3IA 4GK5E 1IJ6A 1UUSA 2LHRA 3RH3A 3PUVF 4JI0T 4YFSA 3DP7A 2E8IA 2YKSA 5AQVB 3OKQA 1WR0A 4CI3B 3EABA 4YHJA 4H9NC 2QGSA 2C0SA 4UF0B 4EIWA 5JDGA 5FY7A 4DBQA 2NTXA 4CN6A 4K0KT 4AI6A 4DR1T 1HX8A 1G73A 1FEWA 3I1AA 5JDMA 5J0ZA 2IC6A 3KFWX 3PJAJ 2YDSA 4ZZBA 1KNZA 2MYSA 3ZN1B 3O1JA 4IHJE 1NENA 5HYAA 3CMLA 3VHLA 1OEDA 3ZT7A 4JI3T 2V7MA 3AE4A 2LT3A 3H3AA 2XAQB 1HCIA 2V5CA 1J1JA 5LP6E 5AQRB 4TN7B 4DR3T 5LHHB 4KI0F 3L09A 4P09A 3B13A 3A8YC 4CI1B 1WYCA 2D5UA 1MMAA 2OV9A 3N2OA 4HGAA 1NAFA 4DV3T 2XAGB 3CX7B 5TAOA 3N2KE 2NW9A 4IREA 4U31A 4IE6A 4GYSA 1HNZT 3RQWA 2EHOC 4MALA 4U7YA 2M6BA 1U5PA 3NBXX 4IDPA 5KDMC 2X9YA 4CN4A 3EUHA 3HKBE 3HR0A 1KF6A 2YDRA 3EVYA 1XDPA 2V5DA 5JR9C 1XWMA 3KV4A 2OA5A 2N2NA 4GYRA 1IBKT 3ZYLA 3TLVA 5JTGA 5DQWA 2EHOA 2IIUA 4YSYA 2EHOB 3H37A 5GONE 2CRBA 4DR4T 5ABEA 1IZNB 2V26A 3SWHA 4X1YE 5JR9A 4A56A 3GA8A 3RX6A 5JR9B 4EEBA 2WMOA 2H3RA 4LF9T 1U4QA 3LDQB 3M65A 2XY8B 4ZI3D 4BJNA 3PUXF 2DNXA 5AQSB 2WQYA 1UCUA 4H9PC 3AAAB 1HTJF 2Y48B 3ETVA 4UV9B 5CB4E 2KLQA 2NTYA 2V7IA 3EI0A 4JUYA 2UXDT 2X0LB 3LJCA 1WR6A 3AE9A 3ONLC 4ANJA 5H6RB 3KVBA 5JDNA 4PFOA 5F8PA 4IE4A 3AA0B 4DV7T 4ERRA 4CZZB 2NP9A 3CX6B 5JDQA 5JDFA 1E7PA 3FZMB 4DV2T 4MLKA 4L5GA 4CQIA 1MMGA 2VKOA 2R6GF 4HFEA 2HN1A 3BK9A 4IIJE 4AQGA 3LG7A 4E7SA 3P4SA 2UXNB 4DR6T 4TWDA 3RPUA 3CQGB 5FL1A 2GK9A 3QOFA 3VR9A 3P4RA 3NVOA 4BAYB 2XUEA 3GN5A 2XTLA 3ZYMA 2SPCA 3GN5B 3FBZA 1UX5A 3PJAA 2CCQA 2B1EA 2LM2A 1S94A 3QUJA 3P8CD 2XQ4A 4U2YA 3PUYF 2K3WA 3AAIA 3PTRB 2XM1A 2NWBA 4BA9A 2XAFB 2VKJA 1T98A 2VURA 4H63V 3AEDA 4UV8B 4JI1T 2ZLYA 3B57A 4Z90A 4MHCA 5J1GA 4U7IA 4C91A 5FXXA 2JJ9A 4DIDB 1GQEA 3CX8B 2CXLA 3AA6B 3C4WA 2HPLA 5LOVE 4OHFA 2Y6XA 2CM0A 3AXJA 3K1SA 2BVLA 2FJEA 4B3TT 5AQLB 3B5MA 5LCYA 3PDYA 2WSSV 4LMLA 2PG8A 4EXTA 1ZV4X 4ZS2A 3BQLA 4H63H 2KNDA 4AQYT 2JRKA 1N34T 3AB3B 5HEHA 5HWXA 2FBWA 1DU2A 2FJBA 3PUQA 4Z91A 1W9RA 4XBFB 1SUMB 1J5ET 1VCTA 2ZMAA 4ILCA 4QX8B 3P50A 3AVRA 2CBIA 1OEDE 4EOZB 3F31A 2UUAT 5AFUL 5ABFA 5LHIB 5BR8T 5ABFB 1S35A 1E1HB 1HG5A 4AKIA 3CPZA 1YQ3A 4MFRA 5HWYA 1D1BA 3D0TA 3PURA 2WMNA 4JI2T 3PV0F 5HXRA 3CIRA 5L2LA 3P4QA 5AQTB 3QNUA 4KX6A 2W63A 2J4GA 2YOEA 2V7KA 2BS2A 4UVBB 2WWVA 5ABGA 5DJQC 5LB7B 4FI5A 5FP3A 2N9DA 2X0YA 3ZC1A 2X9XA 1D0ZA 2IMLA 3N9PA 2ES0A 2K24A 3HL6A 4OYKA 4U3CA 2DI4A 4HWCA 2IUBA 3GMIA 4KUMB 4DV1T 1BR2A 4OYJA 1W09A 5KMGP 2XHEB 3VR8A 5ABHA 4EV6A 5F3JA 4F6RC 3RQUA 2VK9A 4GKJT 2I0MA 3JC6C 5AQOB 4P0BA 4ISSA 1WYBA 2BKNA 2WB5A 2X66A 1BR4A 2DHRA 3AEBA 2A9UA 4DVDA 4IE5A 5J2UE 3RGLA 4KBMB 1W0AA 2WZHA 1UURA 2D0UA 5LA6E 3N2GE 3TKLB 5LGUB 5AQQB 3ZJ1A 3RRWA 5JVDE 3NKZA 1YKHB 2K9AA 3OPCA 2PFVA 4DV6T 4QXHB 3K3OA 2XPKA 4WBNE 2X67A 2N1GA 3N9NA 3IEEA 3WAJA 4AKRB 3N9MA 3ZJ2A 2CEAA 3IA3A 5LJMA 4X1IE 5ADXL 2QYWA 1D1AA 4CN1A 2UXCT 2XSBA 1XDOA 4EAHA 1YKEB 2XASB 2LM9A 4ZEYA 5IWAT 1QLBA 2X68A 4TWFA 2JPFA 3FZKB 2M6IA 4LFCT 5DABA 1OEDC 3Q5DA 1YD8G 3AEFA 3IHRA 3MZKB 3RC8A 4COFA 4TV8E 4OFZA 2BKOA 4HWFA 1HS7A 4O8SA 4ZS3A 2G0UA 1AJ3A 4JI4T 5AQHB 3ZMUB 2LOSA 4TUYE 2IDOB 2CHNA 2JQHA 2Z6EA 2CPTA 1OEDB 3AE1A 3C64A 3I0OA 2UUCT 2HN2A 5L3CB 2BS4A 5JRCA 4UEMA 1SA0E 4DBRA 2K48A 1ZKEA 4DV0T 3BQIA 1HNXT 3FZHB 3RI5A 3TLTA 5JRCB 3ZKRA 5J2TE 3FXEB 4EGWA 2KXPB 4V1Av 3UFEA 5LMUT 4ZHQE 3L39A 5M4YA 5EK4A 5L3BB 2V6YA 2BBHA 3JAFA 2X9WA 1JNZA 1VCSA 3CQCB 2KSRA 4ZI7E 1Z0PA 2V6YB 2YDQA 3UUMA 1MNEA 3UULA 1B7TA 2JQ9A 2IHR1 2LKGA 5HEOA 1FIOA 2WZIA 3MA9A 3C51A 2HH7A 2LEHA 5L3GB 2BG9A 4XZCA 3N9OA 4KMCA 2LRKA 5L4HA 3FZFB 4YY3T 2W0GA 4IL4A 1XNQT 4HFBA 4G2AA 4A97A 5CFBA 4DV4T 3JC6D 4X65T 4KHZF 2CMRA 2XAHB 2XQ8A 4U2ZA 3OJAA 4KP3C 3UFGA 3SFDA 2VVSA 3K8PC 3PUWF 4HFHA 2MBGA 3IBPA 4H9OC 4ZI2D 3VKGA 4AQFC 2WAUA 3FXDB 1QUUA 3E0ZA 3PUSA 4YJ2E 2CA5A 4DUZT 3AEGA 1XMQT 2XQAA 1MMNA 3RLFF 4UVCB 4PAGA 4IDZA 5FMNA 3T8OA 2FJDA 3RC3A 2W00A 1LRZA 5LHGB 3KBTA 4DUYT 3MJXA 5JDLA 4TNVA 4AQFA 2W66A 1XNRT 1OXZA 4O4LE 1Y01A 4QH5A 2YN6A 5LBMA 4JEHB 3TLSA 1I6ZA 4WNKA 5EK3A 4X1KE 3QC9A 2LSGA 4DV5T 2BS3A 3LBXA 3ZMZB 2AXDS 5LG3A 4UELA 3OYXA 3LBXB 3Q5XA 4U33A 5LG4A 1LKXA 2WDQA 1MMDA 2PBIA 4B3RT 1YXRA 4CXYA 2E9XA 2NR4A 4P0AA 3MKDA 2E9XB 5AQKB 2XQYA 4ADZA 5HAXA 4A5XA 4YTPA 3M3ZB 4DR5T 1CHUA 2VKDA 2M67A 2XJ7A 4JYAT 4TZ4C 1IBLT 1MIYA 2A72A 2Q9QA 2BBJA 5H6QB 4QKNA 5HEUA 1D1CA 2LSIA 3LSVA 2LJLA 4QHOA 3UU4A 1H7CA 4YSXA 2WU5A 1XMOT 2DL1A 3SRZA 2CXDA 3KV9A 2BVMA 4FJOA 1Y64B 1KNPA 2W61A 4NIQA 4H9QC 1G8XA 3SOLA 3L8RA 3EAMA 3VU7H 2NW8A 2V6XA 1LVKA 2JMHA 2VKHA 5FVLA 4U74A 4IDQA 5HXCA 2EHOD 2A2FX 2LSYA 2CWYA 2VL0A 3RIUC 2DLRA 2L8KA 4YTMA 4QX7B 2WCAA 3RF1A 4L0RA 3C4ZA 2IAKA 5A1LA 3QB5A 3C4XA 3PE0A 1UX4A 3UU6A 4UIGA 5IHYA 2MTQA 4OX9T 3RIUA 1X9BA 3OYZA 2D0TA 2AE9A 5LGTB 2D9DA 3OVUA 3AXJB 1WCRA 5ETWA 4JI8T 5HXSA 4GK0E 1N33T 2IW5B 5AQUB 1M7KA 3R84B 2LKHA 5EK2A 5AQGB 2H88A 1WFDA 3L3PA 3F57A 2JQKA 3CVRA 5LBQB 4PJMA 3UU5A 5AQMB 4HKAA 1NWMX 4CXWA 5FXWA 1LVFA 4O4IE 2W2UA 2QVAA 2YU1A 3JADA 3NRYA 3KV6A 2ZM0A 4JBWF 3ZSTA 4TWHA 3F2EA 1IJ5A 3SFEA 5HXEA 2LHNA 3RIAA 4GOUA 4GKKT 2W67A 4B3ST 4H9SE 5C3JA 4B6XA 2L3LA 3VRAA 2ZM6T 4LF7T 5FXZA 4HFCA
chains in the Genus database with same CATH topology
1UGOA 3A8YC 2D9DA 5AQMB 3FZKB 5AQSB 5AQVB 5AQIB 5AQHB 3FZHB 5AQOB 4HWIB 5AQTB 4HWCA 1I6ZA 5AQJB 3FZFB 5AQNB 5AQFB 4HWHA 5AQUB 1M7KA 3LDQB 5AQKB 3FZMB 1UK5A 4HWDA 5AQRB 5AQGB 4HWFA 5AQPB 1T7SA 5AQLB 1HX1B 1M62A 3M3ZB 3FZLB 5AQQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGO A;  3A8Y C;  2D9D A;  5AQM B;  3FZK B;  5AQS B;  5AQV B;  5AQI B;  5AQH B;  3FZH B;  5AQO B;  4HWI B;  5AQT B;  4HWC A;  1I6Z A;  5AQJ B;  3FZF B;  5AQN B;  5AQF B;  4HWH A;  5AQU B;  1M7K A;  3LDQ B;  5AQK B;  3FZM B;  1UK5 A;  4HWD A;  5AQR B;  5AQG B;  4HWF A;  5AQP B;  1T7S A;  5AQL B;  1HX1 B;  1M62 A;  3M3Z B;  3FZL B;  5AQQ B; 
#chains in the Genus database with same CATH topology
 3PU8 A;  1SHZ C;  3ZYK A;  2UU9 T;  3JAE A;  5FVK A;  4UR9 A;  2XQ9 A;  2MAW A;  2VVN A;  5L47 A;  4AIS A;  2L9Q A;  2WU2 A;  2QRX A;  3HKC E;  2I59 A;  5JRE A;  4X64 T;  2WS3 A;  3AEA A;  4QXB B;  4PK5 A;  2FUP A;  2BG9 E;  3WI3 A;  5FL0 A;  1CUN A;  4PJL A;  2W4X A;  4EYY R;  3K3Q C;  5E0O A;  5IYZ E;  4IL9 A;  4UVA B;  1QSD A;  5HEJ A;  4ZZC A;  1KK7 A;  3HKE E;  2ODV A;  3UUN A;  2H7V C;  3I9Y A;  3OBV E;  3LK4 2;  2D2S A;  2QA7 A;  1UK5 A;  4HWD A;  4ZOL E;  5C8Y E;  2YIN A;  3FHN A;  3HI2 A;  3AE5 A;  2E2A A;  2WM9 A;  5IUX A;  4O4H E;  5JDH A;  3ETU A;  2CXF A;  4DR2 T;  5AQF B;  1V9D A;  3E22 E;  4YSZ A;  4LF4 T;  2K5B B;  2LE8 A;  4ZI3 C;  2J1D G;  4LMK A;  3AVS A;  4WYV A;  4NXM T;  5EZY E;  2LOP A;  4EZH A;  4HTE A;  3LK2 B;  5FY0 A;  3WAK A;  3O1I A;  2A3D A;  3NWI A;  3ONX A;  2VWA A;  2E5V A;  2ZM8 A;  4YT0 A;  3S4U A;  4IDO A;  2LRL A;  3IF8 B;  4LF8 T;  2W62 A;  4JLE A;  4HN9 A;  3AA7 B;  5CGM A;  3RYC E;  2RPA A;  4UF0 A;  4JI6 T;  2XSA A;  5LJN A;  2WBL A;  2KMF A;  4O2A E;  5CJ5 A;  4DMW A;  3E08 A;  5HXH A;  5LGN B;  1HR0 T;  1FMV A;  3EHZ A;  3T1H T;  3O4X E;  4X66 T;  1D0Y A;  2V7J A;  1JNR A;  3ZMV B;  3I9W A;  2BDE A;  3OTO T;  5AQP B;  4JI7 T;  1R8I A;  5DQV A;  1ZOY A;  2PTF A;  1HF8 A;  4IT4 A;  1KFY A;  3AEC A;  4A98 A;  4P1N A;  1ZEE A;  4IE7 A;  3CQX C;  4AKG A;  3K3N A;  3O9X A;  3J7Y q;  4EED A;  4IST A;  4DR7 T;  2BG9 C;  2XM2 A;  1HX1 B;  2C5J A;  4PNI A;  3A7M A;  5FYM A;  2XQ7 A;  4JEU B;  4AKH A;  4YXD A;  4X62 T;  3HKD E;  1OWA A;  2X51 A;  4HFV A;  3U78 A;  5AQN B;  4HE8 A;  3G06 A;  4PJN A;  2H89 A;  3O1H A;  1X79 A;  3RYI E;  1YW0 A;  2CE7 A;  5HCM A;  3UTK A;  2X0H A;  3EDU A;  2BG9 B;  4ILB A;  1E2A A;  3UQ7 A;  4I4T E;  1MND A;  2LLY A;  5F5W A;  4EB6 E;  3VKH A;  2H7O A;  1SE7 A;  5CA0 E;  1L0V A;  2DWK A;  3ZLI A;  3ZCI A;  2ODU A;  4PFP A;  3AAE B;  2NOX A;  4ILU A;  3N5L A;  5AQJ B;  3FB2 A;  2NW7 A;  2RP4 A;  1YQ4 A;  3Q2M A;  3KV5 A;  2V1D B;  4JI5 T;  2HPJ A;  3ZSS A;  4PK4 A;  4PK6 A;  1VOM A;  4PJJ A;  4GIW A;  5FKY A;  1N32 T;  1IAP A;  4J2C A;  3UUX B;  2UUB T;  5L3F B;  2WP9 A;  2HHH T;  2VQE T;  2BZB A;  3ABV A;  2C5K T;  5HCJ A;  2RA1 A;  2KWH A;  4G63 A;  1US7 B;  1J5W A;  1W0B A;  2VL8 A;  2E9X C;  4BJM A;  4QWN B;  3QK6 A;  2XQ6 A;  4F8H A;  5L3E B;  4I55 E;  1MIW A;  2WDV A;  1FMW A;  2JQQ A;  3TLU A;  4LF6 T;  4ZXL A;  4IDN A;  4WBO A;  3UQ4 A;  1HFA A;  1ZHC A;  4TV9 E;  4K0U A;  2ZM2 A;  1KEY A;  4IGU A;  3V5S A;  2Q9Q C;  4TNW A;  3FBL A;  2LSJ A;  4NPP A;  2V8S V;  4HEA A;  4LFA T;  3N9L A;  4YTN A;  3P4W A;  4UXN B;  3PUG A;  3C98 B;  2I6H A;  4Q25 A;  2YEV C;  4TX5 A;  2CLY C;  1NEK A;  5L4E A;  1WLX A;  3ZPO A;  3Q5W A;  5L3D B;  4LFB T;  2ACZ A;  3KDS E;  2CWO A;  2Q9Q B;  4HFD A;  3AE3 A;  3DJB A;  4NUU A;  3KIN B;  3NZQ A;  4O4J E;  2LSK A;  5JQG E;  4M1P A;  3ZT6 A;  2UXB T;  3KBU A;  1ZP0 A;  3ZN0 B;  3PUZ F;  3AE7 A;  3HA4 A;  3ZEF B;  2YK0 A;  3RKO A;  2XZE A;  4X5T A;  3SS1 A;  1T7S A;  4N78 D;  5FXV A;  2CLY B;  5FNV E;  4KHP T;  2WDR A;  3J9X 1;  2CBJ A;  3MAC A;  1EZ3 A;  3BQK A;  2KWI B;  3C50 A;  2CHO A;  3RIF A;  3KVA A;  4I50 E;  4YHH T;  2XQ3 A;  3ESL A;  2J47 A;  1D0X A;  2FJA A;  5KX5 E;  4U72 A;  2VB6 A;  3P7I A;  2UXX B;  3A5X A;  4EZ4 A;  4H9R C;  2YU2 A;  4HWH A;  3TLW A;  3UT5 E;  2MOZ A;  3AEE A;  2V7L A;  3NRX A;  3AA1 B;  2PJQ A;  2ACX A;  3RYF E;  2VAS A;  3FZL B;  3V5U A;  1UGO A;  5BMV E;  3RHW A;  5JH7 E;  2J62 A;  4PW8 A;  2DCF A;  4L9I A;  2P9B A;  4NXN T;  3LK3 B;  3RKG A;  2XQ5 A;  1N36 T;  4IE0 A;  4XAX B;  2JMK A;  4AIU A;  2WWU A;  1MIV A;  2Y8D A;  3W15 B;  1HNW T;  3EDV A;  3ZMT B;  5KXJ A;  3AE8 A;  2DWG A;  4EYU A;  4LF5 T;  4I43 B;  3H3M A;  5CA1 E;  1T72 A;  3NZP A;  3ONJ A;  3ZCJ A;  3ZC0 A;  2E9X D;  2KT9 A;  4NUV A;  4I0U A;  4ILA A;  1VRB A;  3Q5E A;  2OLT A;  4C90 A;  3DTO A;  3GWH A;  2X9H A;  1O3X A;  4QH4 A;  3X1D A;  3LFM A;  1M62 A;  4DO0 A;  2VQF T;  5HEG A;  3RYH E;  4YJ3 E;  2Q9Q D;  3N9Q A;  1KNR A;  4QH1 A;  3P4P A;  1I94 T;  2F4V T;  1T8B A;  2IC9 A;  3JCF A;  4HFI A;  3MXZ A;  3MK7 C;  3ZMS B;  4WW0 A;  1XZY A;  2E5L T;  4YLH A;  1HG2 A;  1BR1 A;  2C5I T;  4MBQ A;  5LMN T;  4E7Z A;  5AQI B;  3AE6 A;  2KZ7 B;  4B3M T;  1IBM T;  3UU8 A;  3PUA A;  3ANW A;  2JIW A;  4AXP A;  3Q9D A;  4X20 E;  4CXX A;  3ZT5 A;  3CK6 A;  1WRD A;  3ANW B;  4CI2 B;  3R6N A;  3CWZ B;  2XAJ B;  5C2T A;  4AKL A;  3UUB A;  5LXT E;  4JV5 T;  4LMJ A;  5FY1 A;  4HWI B;  1FJG T;  3AE2 A;  4DND A;  4Z8X A;  2B76 A;  3QB5 K;  4ASK A;  4QXC B;  4DMV A;  5LNK A;  4ZI2 C;  4O2B E;  4OK0 A;  2MPK A;  3VRB A;  3T1Y T;  2KIN B;  3I0Q A;  1BR0 A;  1Z8U A;  4WZX A;  2BKP A;  2WY2 A;  3CKD A;  3PU3 A;  3UU3 A;  3RRC A;  5LYJ E;  3U3I A;  4GK5 E;  1IJ6 A;  1UUS A;  2LHR A;  3RH3 A;  3PUV F;  4JI0 T;  4YFS A;  3DP7 A;  2E8I A;  2YKS A;  5AQV B;  3OKQ A;  1WR0 A;  4CI3 B;  3EAB A;  4YHJ A;  4H9N C;  2QGS A;  2C0S A;  4UF0 B;  4EIW A;  5JDG A;  5FY7 A;  4DBQ A;  2NTX A;  4CN6 A;  4K0K T;  4AI6 A;  4DR1 T;  1HX8 A;  1G73 A;  1FEW A;  3I1A A;  5JDM A;  5J0Z A;  2IC6 A;  3KFW X;  3PJA J;  2YDS A;  4ZZB A;  1KNZ A;  2MYS A;  3ZN1 B;  3O1J A;  4IHJ E;  1NEN A;  5HYA A;  3CML A;  3VHL A;  1OED A;  3ZT7 A;  4JI3 T;  2V7M A;  3AE4 A;  2LT3 A;  3H3A A;  2XAQ B;  1HCI A;  2V5C A;  1J1J A;  5LP6 E;  5AQR B;  4TN7 B;  4DR3 T;  5LHH B;  4KI0 F;  3L09 A;  4P09 A;  3B13 A;  3A8Y C;  4CI1 B;  1WYC A;  2D5U A;  1MMA A;  2OV9 A;  3N2O A;  4HGA A;  1NAF A;  4DV3 T;  2XAG B;  3CX7 B;  5TAO A;  3N2K E;  2NW9 A;  4IRE A;  4U31 A;  4IE6 A;  4GYS A;  1HNZ T;  3RQW A;  2EHO C;  4MAL A;  4U7Y A;  2M6B A;  1U5P A;  3NBX X;  4IDP A;  5KDM C;  2X9Y A;  4CN4 A;  3EUH A;  3HKB E;  3HR0 A;  1KF6 A;  2YDR A;  3EVY A;  1XDP A;  2V5D A;  5JR9 C;  1XWM A;  3KV4 A;  2OA5 A;  2N2N A;  4GYR A;  1IBK T;  3ZYL A;  3TLV A;  5JTG A;  5DQW A;  2EHO A;  2IIU A;  4YSY A;  2EHO B;  3H37 A;  5GON E;  2CRB A;  4DR4 T;  5ABE A;  1IZN B;  2V26 A;  3SWH A;  4X1Y E;  5JR9 A;  4A56 A;  3GA8 A;  3RX6 A;  5JR9 B;  4EEB A;  2WMO A;  2H3R A;  4LF9 T;  1U4Q A;  3LDQ B;  3M65 A;  2XY8 B;  4ZI3 D;  4BJN A;  3PUX F;  2DNX A;  5AQS B;  2WQY A;  1UCU A;  4H9P C;  3AAA B;  1HTJ F;  2Y48 B;  3ETV A;  4UV9 B;  5CB4 E;  2KLQ A;  2NTY A;  2V7I A;  3EI0 A;  4JUY A;  2UXD T;  2X0L B;  3LJC A;  1WR6 A;  3AE9 A;  3ONL C;  4ANJ A;  5H6R B;  3KVB A;  5JDN A;  4PFO A;  5F8P A;  4IE4 A;  3AA0 B;  4DV7 T;  4ERR A;  4CZZ B;  2NP9 A;  3CX6 B;  5JDQ A;  5JDF A;  1E7P A;  3FZM B;  4DV2 T;  4MLK A;  4L5G A;  4CQI A;  1MMG A;  2VKO A;  2R6G F;  4HFE A;  2HN1 A;  3BK9 A;  4IIJ E;  4AQG A;  3LG7 A;  4E7S A;  3P4S A;  2UXN B;  4DR6 T;  4TWD A;  3RPU A;  3CQG B;  5FL1 A;  2GK9 A;  3QOF A;  3VR9 A;  3P4R A;  3NVO A;  4BAY B;  2XUE A;  3GN5 A;  2XTL A;  3ZYM A;  2SPC A;  3GN5 B;  3FBZ A;  1UX5 A;  3PJA A;  2CCQ A;  2B1E A;  2LM2 A;  1S94 A;  3QUJ A;  3P8C D;  2XQ4 A;  4U2Y A;  3PUY F;  2K3W A;  3AAI A;  3PTR B;  2XM1 A;  2NWB A;  4BA9 A;  2XAF B;  2VKJ A;  1T98 A;  2VUR A;  4H63 V;  3AED A;  4UV8 B;  4JI1 T;  2ZLY A;  3B57 A;  4Z90 A;  4MHC A;  5J1G A;  4U7I A;  4C91 A;  5FXX A;  2JJ9 A;  4DID B;  1GQE A;  3CX8 B;  2CXL A;  3AA6 B;  3C4W A;  2HPL A;  5LOV E;  4OHF A;  2Y6X A;  2CM0 A;  3AXJ A;  3K1S A;  2BVL A;  2FJE A;  4B3T T;  5AQL B;  3B5M A;  5LCY A;  3PDY A;  2WSS V;  4LML A;  2PG8 A;  4EXT A;  1ZV4 X;  4ZS2 A;  3BQL A;  4H63 H;  2KND A;  4AQY T;  2JRK A;  1N34 T;  3AB3 B;  5HEH A;  5HWX A;  2FBW A;  1DU2 A;  2FJB A;  3PUQ A;  4Z91 A;  1W9R A;  4XBF B;  1SUM B;  1J5E T;  1VCT A;  2ZMA A;  4ILC A;  4QX8 B;  3P50 A;  3AVR A;  2CBI A;  1OED E;  4EOZ B;  3F31 A;  2UUA T;  5AFU L;  5ABF A;  5LHI B;  5BR8 T;  5ABF B;  1S35 A;  1E1H B;  1HG5 A;  4AKI A;  3CPZ A;  1YQ3 A;  4MFR A;  5HWY A;  1D1B A;  3D0T A;  3PUR A;  2WMN A;  4JI2 T;  3PV0 F;  5HXR A;  3CIR A;  5L2L A;  3P4Q A;  5AQT B;  3QNU A;  4KX6 A;  2W63 A;  2J4G A;  2YOE A;  2V7K A;  2BS2 A;  4UVB B;  2WWV A;  5ABG A;  5DJQ C;  5LB7 B;  4FI5 A;  5FP3 A;  2N9D A;  2X0Y A;  3ZC1 A;  2X9X A;  1D0Z A;  2IML A;  3N9P A;  2ES0 A;  2K24 A;  3HL6 A;  4OYK A;  4U3C A;  2DI4 A;  4HWC A;  2IUB A;  3GMI A;  4KUM B;  4DV1 T;  1BR2 A;  4OYJ A;  1W09 A;  5KMG P;  2XHE B;  3VR8 A;  5ABH A;  4EV6 A;  5F3J A;  4F6R C;  3RQU A;  2VK9 A;  4GKJ T;  2I0M A;  3JC6 C;  5AQO B;  4P0B A;  4ISS A;  1WYB A;  2BKN A;  2WB5 A;  2X66 A;  1BR4 A;  2DHR A;  3AEB A;  2A9U A;  4DVD A;  4IE5 A;  5J2U E;  3RGL A;  4KBM B;  1W0A A;  2WZH A;  1UUR A;  2D0U A;  5LA6 E;  3N2G E;  3TKL B;  5LGU B;  5AQQ B;  3ZJ1 A;  3RRW A;  5JVD E;  3NKZ A;  1YKH B;  2K9A A;  3OPC A;  2PFV A;  4DV6 T;  4QXH B;  3K3O A;  2XPK A;  4WBN E;  2X67 A;  2N1G A;  3N9N A;  3IEE A;  3WAJ A;  4AKR B;  3N9M A;  3ZJ2 A;  2CEA A;  3IA3 A;  5LJM A;  4X1I E;  5ADX L;  2QYW A;  1D1A A;  4CN1 A;  2UXC T;  2XSB A;  1XDO A;  4EAH A;  1YKE B;  2XAS B;  2LM9 A;  4ZEY A;  5IWA T;  1QLB A;  2X68 A;  4TWF A;  2JPF A;  3FZK B;  2M6I A;  4LFC T;  5DAB A;  1OED C;  3Q5D A;  1YD8 G;  3AEF A;  3IHR A;  3MZK B;  3RC8 A;  4COF A;  4TV8 E;  4OFZ A;  2BKO A;  4HWF A;  1HS7 A;  4O8S A;  4ZS3 A;  2G0U A;  1AJ3 A;  4JI4 T;  5AQH B;  3ZMU B;  2LOS A;  4TUY E;  2IDO B;  2CHN A;  2JQH A;  2Z6E A;  2CPT A;  1OED B;  3AE1 A;  3C64 A;  3I0O A;  2UUC T;  2HN2 A;  5L3C B;  2BS4 A;  5JRC A;  4UEM A;  1SA0 E;  4DBR A;  2K48 A;  1ZKE A;  4DV0 T;  3BQI A;  1HNX T;  3FZH B;  3RI5 A;  3TLT A;  5JRC B;  3ZKR A;  5J2T E;  3FXE B;  4EGW A;  2KXP B;  4V1A v;  3UFE A;  5LMU T;  4ZHQ E;  3L39 A;  5M4Y A;  5EK4 A;  5L3B B;  2V6Y A;  2BBH A;  3JAF A;  2X9W A;  1JNZ A;  1VCS A;  3CQC B;  2KSR A;  4ZI7 E;  1Z0P A;  2V6Y B;  2YDQ A;  3UUM A;  1MNE A;  3UUL A;  1B7T A;  2JQ9 A;  2IHR 1;  2LKG A;  5HEO A;  1FIO A;  2WZI A;  3MA9 A;  3C51 A;  2HH7 A;  2LEH A;  5L3G B;  2BG9 A;  4XZC A;  3N9O A;  4KMC A;  2LRK A;  5L4H A;  3FZF B;  4YY3 T;  2W0G A;  4IL4 A;  1XNQ T;  4HFB A;  4G2A A;  4A97 A;  5CFB A;  4DV4 T;  3JC6 D;  4X65 T;  4KHZ F;  2CMR A;  2XAH B;  2XQ8 A;  4U2Z A;  3OJA A;  4KP3 C;  3UFG A;  3SFD A;  2VVS A;  3K8P C;  3PUW F;  4HFH A;  2MBG A;  3IBP A;  4H9O C;  4ZI2 D;  3VKG A;  4AQF C;  2WAU A;  3FXD B;  1QUU A;  3E0Z A;  3PUS A;  4YJ2 E;  2CA5 A;  4DUZ T;  3AEG A;  1XMQ T;  2XQA A;  1MMN A;  3RLF F;  4UVC B;  4PAG A;  4IDZ A;  5FMN A;  3T8O A;  2FJD A;  3RC3 A;  2W00 A;  1LRZ A;  5LHG B;  3KBT A;  4DUY T;  3MJX A;  5JDL A;  4TNV A;  4AQF A;  2W66 A;  1XNR T;  1OXZ A;  4O4L E;  1Y01 A;  4QH5 A;  2YN6 A;  5LBM A;  4JEH B;  3TLS A;  1I6Z A;  4WNK A;  5EK3 A;  4X1K E;  3QC9 A;  2LSG A;  4DV5 T;  2BS3 A;  3LBX A;  3ZMZ B;  2AXD S;  5LG3 A;  4UEL A;  3OYX A;  3LBX B;  3Q5X A;  4U33 A;  5LG4 A;  1LKX A;  2WDQ A;  1MMD A;  2PBI A;  4B3R T;  1YXR A;  4CXY A;  2E9X A;  2NR4 A;  4P0A A;  3MKD A;  2E9X B;  5AQK B;  2XQY A;  4ADZ A;  5HAX A;  4A5X A;  4YTP A;  3M3Z B;  4DR5 T;  1CHU A;  2VKD A;  2M67 A;  2XJ7 A;  4JYA T;  4TZ4 C;  1IBL T;  1MIY A;  2A72 A;  2Q9Q A;  2BBJ A;  5H6Q B;  4QKN A;  5HEU A;  1D1C A;  2LSI A;  3LSV A;  2LJL A;  4QHO A;  3UU4 A;  1H7C A;  4YSX A;  2WU5 A;  1XMO T;  2DL1 A;  3SRZ A;  2CXD A;  3KV9 A;  2BVM A;  4FJO A;  1Y64 B;  1KNP A;  2W61 A;  4NIQ A;  4H9Q C;  1G8X A;  3SOL A;  3L8R A;  3EAM A;  3VU7 H;  2NW8 A;  2V6X A;  1LVK A;  2JMH A;  2VKH A;  5FVL A;  4U74 A;  4IDQ A;  5HXC A;  2EHO D;  2A2F X;  2LSY A;  2CWY A;  2VL0 A;  3RIU C;  2DLR A;  2L8K A;  4YTM A;  4QX7 B;  2WCA A;  3RF1 A;  4L0R A;  3C4Z A;  2IAK A;  5A1L A;  3QB5 A;  3C4X A;  3PE0 A;  1UX4 A;  3UU6 A;  4UIG A;  5IHY A;  2MTQ A;  4OX9 T;  3RIU A;  1X9B A;  3OYZ A;  2D0T A;  2AE9 A;  5LGT B;  2D9D A;  3OVU A;  3AXJ B;  1WCR A;  5ETW A;  4JI8 T;  5HXS A;  4GK0 E;  1N33 T;  2IW5 B;  5AQU B;  1M7K A;  3R84 B;  2LKH A;  5EK2 A;  5AQG B;  2H88 A;  1WFD A;  3L3P A;  3F57 A;  2JQK A;  3CVR A;  5LBQ B;  4PJM A;  3UU5 A;  5AQM B;  4HKA A;  1NWM X;  4CXW A;  5FXW A;  1LVF A;  4O4I E;  2W2U A;  2QVA A;  2YU1 A;  3JAD A;  3NRY A;  3KV6 A;  2ZM0 A;  4JBW F;  3ZST A;  4TWH A;  3F2E A;  1IJ5 A;  3SFE A;  5HXE A;  2LHN A;  3RIA A;  4GOU A;  4GKK T;  2W67 A;  4B3S T;  4H9S E;  5C3J A;  4B6X A;  2L3L A;  3VRA A;  2ZM6 T;  4LF7 T;  5FXZ A;  4HFC A; 
#chains in the Genus database with same CATH homology
 1UGO A;  3A8Y C;  2D9D A;  5AQM B;  3FZK B;  5AQS B;  5AQV B;  5AQI B;  5AQH B;  3FZH B;  5AQO B;  4HWI B;  5AQT B;  4HWC A;  1I6Z A;  5AQJ B;  3FZF B;  5AQN B;  5AQF B;  4HWH A;  5AQU B;  1M7K A;  3LDQ B;  5AQK B;  3FZM B;  1UK5 A;  4HWD A;  5AQR B;  5AQG B;  4HWF A;  5AQP B;  1T7S A;  5AQL B;  1HX1 B;  1M62 A;  3M3Z B;  3FZL B;  5AQQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...