3M3ZB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Heat shock cognate 71 kDa protein
total genus 45
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3m3zB00
3FZKB 3FZFB 5AQOB 5AQRB 4HWHA 3A8YC 4HWDA 3M3ZB 1T7SA 5AQHB 1I6ZA 3FZLB 5AQQB 1M7KA 1HX1B 5AQSB 4HWFA 5AQFB 3LDQB 3FZMB 5AQUB 5AQTB 5AQIB 5AQGB 1UK5A 1UGOA 5AQKB 1M62A 5AQMB 5AQLB 5AQNB 2D9DA 5AQPB 4HWIB 4HWCA 5AQVB 5AQJB 3FZHB
chains in the Genus database with same CATH superfamily
2X67A 4AQFA 3HR0A 3AEDA 1WR0A 3A5XA 3Q5EA 4ISSA 4UXNB 4X5TA 2NP9A 4HWHA 3GWHA 3ZMSB 4QX8B 5CFBA 5LHIB 2W63A 3RH3A 2XQAA 3UU5A 3RC8A 2X9HA 2A72A 2WS3A 3ZN0B 4EYUA 4DV6T 2FUPA 2LEHA 5AQQB 5C8YE 3AE1A 3JAEA 2DNXA 4TWHA 5DABA 5FY0A 2XQYA 3UULA 1KNZA 5LG4A 1HNWT 4Z91A 4EZHA 3TKLB 3U3IA 2CM0A 5IUXA 1D1CA 2C0SA 5JDLA 1HX8A 3NWIA 4HGAA 3CX6B 4C91A 2AE9A 2DI4A 4CZZB 4AKIA 1IBLT 1BR1A 3CMLA 2LE8A 5TAOA 4KBMB 3RYHE 3AA1B 3VRBA 2VQET 4DUYT 1QSDA 3LK3B 2BVMA 4IE7A 2KWHA 2Q9QC 3MJXA 3ZSTA 3I9WA 5FKYA 2W4XA 3RGLA 4X62T 4CN6A 2WU2A 2M6BA 3K1SA 4XBFB 5FVLA 2VVSA 2M67A 4QH1A 3VU7H 2ZM0A 4O4IE 5JDQA 2UUCT 2NTYA 4LF5T 2QRXA 2WSSV 2MYSA 2X9WA 2Y48B 4TNVA 5IHYA 2UUAT 2X0YA 2BS3A 3KBTA 2KNDA 4WYVA 3ZMTB 2FJEA 3ZT7A 2XHEB 2HHHT 4JI7T 1MNDA 3Q2MA 3RI5A 1W9RA 3MXZA 4FJOA 1T8BA 1MMDA 2BZBA 5LBQB 5LGUB 4KUMB 4P0AA 3KVBA 4UEMA 2JRKA 5ABEA 4EAHA 1D0XA 5LG3A 1VCTA 3AEAA 4PJMA 3ZEFB 2NTXA 4ZI2D 2CHOA 1S94A 2JMHA 3BQKA 3EABA 2V7JA 3H37A 2I59A 3UU8A 3VR9A 1KEYA 2L9QA 1KF6A 3MA9A 2YN6A 4GIWA 2H7VC 4OK0A 2VQFT 3K3QC 2CBJA 3TLUA 5JDNA 1D0YA 1Y64B 2PTFA 2Z6EA 4JI6T 4U2ZA 4ERRA 4DR6T 4J2CA 1XDPA 2D2SA 2K5BB 1HNXT 2KMFA 2E9XD 3OPCA 3C4XA 1YD8G 2V8SV 4EXTA 2JQQA 2ODUA 3CX8B 3Q5WA 3UQ7A 5JRCA 4KX6A 5LCYA 3K3OA 3P50A 1YQ4A 3SRZA 4DNDA 2UXXB 4PJJA 3AEFA 4COFA 2DLRA 3MACA 4DV4T 2QVAA 2YDQA 3ONLC 2X51A 5CA1E 4YTMA 3DP7A 4HFCA 3SS1A 2XQ8A 4DMVA 3NKZA 4Q25A 2V7LA 1GQEA 2CPTA 4K0KT 2XQ6A 4B3TT 3FB2A 3O4XE 3ZPOA 4LF9T 2C5IT 4BJMA 5FY1A 2VKHA 4PFPA 1HF8A 1HG5A 1Y01A 2PG8A 3P4SA 3PUSA 4ZZBA 4AKHA 4U7YA 2BKOA 4H9PC 5HXSA 5ABFA 4AQGA 2X68A 2CRBA 2PFVA 2R6GF 3AB3B 4FI5A 4JBWF 1L0VA 3PUWF 2H3RA 5ADXL 4JI4T 5HWXA 5FY7A 2LSIA 4PK5A 3IBPA 4WZXA 4UF0B 2WWVA 1MIVA 2Q9QA 3LBXB 4OYKA 2DWKA 3N5LA 5HEUA 2I6HA 2LKGA 4BA9A 5HXRA 3P7IA 4IDQA 2UUBT 5HYAA 4NUUA 3KDSE 1ZHCA 2KXPB 2XTLA 3Q9DA 5KXJA 2IIUA 3FBZA 5IWAT 5ETWA 4N78D 3SFDA 3JC6C 2EHOA 2V7IA 3W15B 1D0ZA 4X1IE 5LBMA 2V7KA 5KDMC 2K3WA 5LNKA 3S4UA 3N2OA 4EZ4A 3CIRA 2DHRA 1VOMA 3LK42 1XDOA 4A56A 3ZN1B 3HKCE 4JI8T 1WYBA 2D5UA 2UXNB 3H3MA 1N33T 1N36T 3ZJ2A 4IL9A 3T1YT 1YW0A 3IA3A 3PUAA 4HEAA 4NPPA 4PK6A 3RIAA 2IHR1 3QOFA 3PU3A 2JIWA 2WU5A 3ZC1A 3NZQA 2ZM6T 4LFCT 5EK2A 1FIOA 1V9DA 3NVOA 1IJ5A 1IJ6A 2LHNA 3AE6A 3P4PA 4X20E 4ZEYA 5JQGE 4EV6A 2VWAA 4CN1A 3RRCA 2V1DB 2ZM8A 3K3NA 4IDPA 2OV9A 4LMLA 2VKOA 4CI3B 2X9XA 5LGTB 2J4GA 5L4HA 4HFDA 4IDZA 3AEBA 4CXXA 2LJLA 2NR4A 4H63H 3AVRA 4I50E 2QA7A 2W0GA 3Q5XA 4AXPA 5CGMA 4YHJA 5LGNB 4YJ2E 5AQMB 2ODVA 2XQ5A 1BR0A 3KVAA 5KMGP 3GMIA 4HFEA 4ILCA 1YKEB 5ABGA 3FZKB 3AECA 4Z90A 2LM2A 1HNZT 1OWAA 1UURA 2YOEA 4IT4A 2BG9B 3ZSSA 3I9YA 2CLYB 2LSJA 1YQ3A 2LM9A 3AE9A 2A9UA 4ZI7E 3IF8B 3KV4A 5L3FB 4DR4T 2E9XB 3C4WA 3F57A 4MBQA 1QLBA 4NXMT 3QNUA 5LOVE 1VCSA 5AQSB 5JVDE 5HAXA 3HA4A 3UQ4A 4DUZT 3L39A 2DWGA 2B76A 4X64T 1UUSA 2XQ4A 3RHWA 3V5UA 4EOZB 4LF4T 4L5GA 3JCFA 2E9XA 2MTQA 3ESLA 3QC9A 1LKXA 2WDQA 1FEWA 4AI6A 2HPJA 4ILBA 1HS7A 3RYFE 5DQVA 3IEEA 4M1PA 3N2GE 1VRBA 3K8PC 5AQVB 3UU3A 1SHZC 3ETVA 3ZCIA 1UX5A 2N9DA 2SPCA 4O8SA 3UTKA 2XAHB 3P8CD 1OEDE 1DU2A 3NZPA 5FP3A 2VL8A 2HN1A 4JEUB 5AFUL 4GKJT 5EK4A 3ZLIA 4HE8A 4UVBB 2LKHA 2W2UA 2XQ7A 3M3ZB 1MMAA 3MZKB 2JJ9A 5H6RB 2XQ9A 2KZ7B 4QXHB 3U78A 4ADZA 4EIWA 1XMQT 4F8HA 4LF7T 4ZOLE 4U33A 4DV5T 2RA1A 2I0MA 1XWMA 3C98B 2BS2A 2LOPA 3FZMB 2XASB 4PJNA 2CA5A 2A3DA 2OA5A 2X0LB 2LSKA 3KINB 4H9NC 2NWBA 3OYXA 5LHGB 5ABHA 3N9LA 4QHOA 3N9MA 1XNQT 3EDUA 5FXVA 4A5XA 3ZT5A 1HCIA 3OJAA 1WLXA 1MIYA 4JI1T 5DQWA 1BR2A 4IE4A 3GN5B 3PJAA 4PFOA 2VKDA 5HCMA 4UF0A 2VL0A 3EDVA 5L3EB 5LHHB 5EZYE 2CLYC 3AXJA 3ZYKA 4DBRA 4JYAT 3CVRA 2ZMAA 2C5JA 2BKPA 4F6RC 4U3CA 1J5WA 1T7SA 3RRWA 4CXWA 3DJBA 1HFAA 2EHOD 5ABFB 4JI0T 4ZS3A 1I6ZA 3OTOT 1XMOT 1NENA 4PAGA 5J1GA 2WDVA 1M7KA 3PE0A 2EHOB 2RPAA 3NRXA 3PDYA 4O4HE 5F8PA 2YK0A 1US7B 2LHRA 5CB4E 3CQXC 5AQFB 1KNRA 5EK3A 2GK9A 3RQUA 1YXRA 1WFDA 3H3AA 4H9OC 5JH7E 4OFZA 4WW0A 2JQ9A 2X66A 4NUVA 1UGOA 2VURA 4MALA 3LBXA 5DJQC 3LFMA 4UR9A 3I1AA 3TLSA 3EAMA 3ZYLA 1SE7A 2V5DA 3M65A 5LB7B 3RF1A 3OYZA 2VB6A 2WCAA 1H7CA 5AQNB 3RQWA 2W61A 1HTJF 2G0UA 2LOSA 4KHZF 2MBGA 4ZZCA 4HFVA 4ZI3C 3FZHB 2LRLA 3AA6B 2LLYA 1OEDC 4TUYE 2YKSA 3B5MA 4IHJE 5FMNA 5HEGA 3TLTA 3GA8A 4YJ3E 3AE7A 3FBLA 5FXXA 4A98A 4C90A 4P09A 2NW9A 3JC6D 3ZCJA 5L2LA 1CHUA 2CXFA 3CWZB 3LJCA 1XZYA 2LT3A 5LJMA 4IREA 3B57A 3SFEA 4DR3T 2WM9A 2MAWA 2P9BA 1LVKA 3FZLB 3PJAJ 2AXDS 4TZ4C 3RIUC 5L3BB 4YY3T 1I94T 2CHNA 2ZM2A 3CX7B 4QXCB 1HX1B 3KV6A 3WAKA 5FL1A 3AAEB 3O1HA 4AISA 4LFBT 2XM1A 3AAAB 1IZNB 5LP6E 2J62A 1ZKEA 4KMCA 4UVCB 5LA6E 4JI3T 4O4LE 3PUZF 1KFYA 4H63V 2XM2A 4GK5E 5AQKB 5FYMA 3J7Yq 2CXLA 5JTGA 4IIJE 4DIDB 3E0ZA 3UUNA 4DV7T 3UFEA 2W66A 4ZS2A 2WZIA 4H9QC 2BVLA 2IAKA 3ANWA 4ASKA 4EGWA 5HXEA 3O9XA 4X66T 2XJ7A 4G2AA 3HKDE 1HR0T 2RP4A 2WDRA 3EI0A 2YDRA 3AE2A 4ZHQE 4TWFA 2WB5A 3A8YC 4HWDA 1IAPA 1T98A 4UV8B 3AE8A 4TV8E 2MOZA 3T8OA 4QH4A 5L4EA 2ACZA 2WBLA 2K9AA 3OBVE 5JDFA 4DO0A 5L47A 2Q9QD 2WWUA 5C2TA 4YLHA 2NW8A 1YKHB 2Y6XA 3ANWB 4CN4A 2BG9C 5L3GB 1FMWA 5LMUT 4DR1T 4X65T 2FBWA 2X9YA 3A7MA 3UFGA 3QK6A 1IBMT 1BR4A 2E9XC 1LVFA 4V1Av 1WYCA 1J5ET 3T1HT 4B3ST 4OX9T 1Z8UA 4U74A 4B3MT 5L3CB 3EUHA 5JDGA 2PJQA 4HN9A 2BG9E 4TN7B 4CQIA 4HWIB 2XZEA 2BBJA 1UCUA 2WMNA 3C50A 3CK6A 4U72A 4U2YA 3AVSA 4UELA 5E0OA 5AQRB 4DMWA 4CI1B 4OYJA 1UX4A 3FZFB 2E2AA 3DTOA 2E8IA 4WNKA 4ZI2C 3NBXX 4QX7B 2UXDT 2VASA 2CEAA 3C4ZA 3ZMZB 3EVYA 4GYRA 4MFRA 2D0UA 4I43B 3PURA 4L9IA 4EYYR 3B13A 4Z8XA 3UU4A 4HWFA 1HG2A 5J2UE 2B1EA 2XPKA 1J1JA 1AJ3A 3RYCE 2W67A 4DV2T 2ZLYA 4IGUA 2H7OA 2XAJB 4KI0F 3P4RA 3ZT6A 5JR9C 4DR7T 3HKBE 4GKKT 5A1LA 2V7MA 4CI2B 2DCFA 4UV9B 2IDOB 4LFAT 4PNIA 3VHLA 3I0QA 3VRAA 3PUXF 5L3DB 1FMVA 4AIUA 4ILAA 1OXZA 2LRKA 5HEJA 1Z0PA 4WBOA 3CKDA 5FXWA 1MIWA 4HKAA 1G8XA 4IE6A 2V6XA 2JQHA 3AXJB 3AAIA 3KFWX 5CJ5A 5H6QB 1MMGA 3KBUA 3L3PA 4U7IA 5AQHB 3MKDA 3RIFA 5JREA 1S35A 4HTEA 4DR5T 4EB6E 4PJLA 2NOXA 4YSXA 5F3JA 4ZXLA 5AQUB 2BBHA 2QGSA 2DL1A 2KINB 3BQIA 4P0BA 3RC3A 1WRDA 4NXNT 3LK2B 3LG7A 4YSYA 2L3LA 4YTNA 3HI2A 3HL6A 1T72A 2BKNA 2EHOC 2IC6A 4E7ZA 2X0HA 1SUMB 2XAGB 4LF8T 2IW5B 1ZEEA 2MPKA 2D9DA 5LMNT 2YU1A 3FXDB 2CCQA 4HFHA 2E5LT 1ZOYA 2IMLA 5AQJB 4BAYB 2N1GA 1R8IA 4QKNA 3UU6A 2CE7A 3VKHA 4AKGA 1NWMX 2UXCT 2H89A 3GN5A 5JR9A 3X1DA 2WZHA 2D0TA 3KV9A 3RLFF 1FJGT 3N2KE 2FJBA 2LSYA 3CQCB 4IE5A 2V5CA 3AA7B 4JI2T 3UT5E 3WI3A 2BDEA 2HH7A 2L8KA 5LYJE 1OEDB 4UIGA 4ISTA 1D1AA 4X1YE 3ZJ1A 5HXHA 5JDHA 1KK7A 4CXYA 4QXBB 3WAJA 4I0UA 5FNVE 3EHZA 3JADA 1LRZA 5AQIB 5C3JA 5F5WA 5BR8T 4TNWA 3IHRA 1X79A 3C51A 2FJDA 2YINA 1UK5A 3E22E 4DV3T 5HEHA 1E7PA 4JV5T 1IBKT 4K0UA 4TV9E 1KNPA 3RX6A 1M62A 1X9BA 3D0TA 2YEVC 2FJAA 3R6NA 4IE0A 5JRCB 4PK4A 4GOUA 2HPLA 4ANJA 4IDOA 4MHCA 5J2TE 2XQ3A 4HWCA 4YT0A 3ZKRA 3P4QA 3F31A 2WP9A 4KP3C 1O3XA 1E1HB 2K48A 2IUBA 3C64A 2VKJA 3R84B 5HEOA 1N34T 2K24A 2ACXA 4JUYA 1WR6A 2WY2A 1JNRA 2KSRA 3N9OA 1G73A 3AE5A 4YHHT 4E7SA 3OKQA 2V6YA 4JLEA 4GK0E 3LDQB 4NIQA 4O2BE 4QWNB 5HCJA 5CA0E 4DBQA 4ILUA 3F2EA 3L8RA 5AQGB 2YDSA 3AA0B 1U5PA 3RKOA 3ZMUB 2V6YB 2NW7A 3FXEB 4U31A 3Q5DA 3PU8A 3NRYA 1W09A 2XY8B 3FHNA 3HKEE 3TLWA 4EEBA 3P4WA 2WAUA 1QUUA 2CMRA 3O1IA 3PUGA 3ZC0A 2V26A 5KX5E 2VVNA 4DR2T 2LSGA 2CWYA 2WMOA 2BG9A 2H88A 3ABVA 2JQKA 3KV5A 4I4TE 4TWDA 1N32T 1OEDA 2PBIA 2E5VA 2Y8DA 4EEDA 3AEEA 4A97A 5GONE 5HXCA 1NEKA 1NAFA 1MNEA 4PW8A 4X1KE 4AKLA 5BMVE 4DV0T 4TX5A 3I0OA 2HN2A 4B6XA 3QB5K 3VR8A 4B3RT 3CQGB 3RIUA 3BQLA 4IL4A 5FL0A 1XNRT 2JPFA 2W62A 4LMJA 4H9RC 4H9SE 4HFIA 3RPUA 3TLVA 2XAFB 3RKGA 4G63A 4O4JE 2XSBA 2M6IA 4AQYT 2UXBT 4L0RA 1E2AA 3PTRB 1ZV4X 2XAQB 5AQTB 3SWHA 4AKRB 4OHFA 1JNZA 2XSAA 3PUYF 3AE3A 3J9X1 3RYIE 4BJNA 1W0AA 2KWIB 2CWOA 1CUNA 3N9NA 1ZP0A 4DV1T 1U4QA 2CXDA 3N9PA 3UUMA 4YTPA 3AEGA 4KHPT 4GYSA 4LMKA 5AQPB 1MMNA 3QUJA 3PUVF 2ES0A 4YXDA 2Q9QB 3G06A 1B7TA 2WQYA 5JR9B 3CPZA 2KLQA 5IYZE 2VK9A 2A2FX 2XUEA 3L09A 5LXTE 2UU9T 5AQOB 3O1JA 3QB5A 3E08A 3N9QA 3PUQA 4QH5A 1EZ3A 2IC9A 3ETUA 4UVAB 2KT9A 5HWYA 3SOLA 3ZMVB 3OVUA 4LF6T 5LJNA 3ZYMA 5JDMA 1W0BA 2J47A 4YFSA 4MLKA 4JI5T 4AQFC 5FVKA 3UUBA 2QYWA 4ZI3D 2N2NA 1D1BA 2OLTA 2C5KT 3AE4A 4JEHB 3MK7C 5FXZA 3UUXB 3VKGA 4HFBA 3JAFA 4IDNA 5M4YA 3PV0F 3ONXA 4WBNE 2BS4A 3ONJA 3LSVA 2YU2A 4XZCA 2JMKA 2CBIA 4XAXB 4YSZA 4O2AE 4I55E 2W00A 1SA0E 5AQLB 3V5SA 2F4VT 4P1NA 3BK9A 1WCRA 5J0ZA 4DVDA 2J1DG
chains in the Genus database with same CATH topology
3FZKB 3FZFB 5AQOB 5AQRB 4HWHA 3A8YC 4HWDA 3M3ZB 1T7SA 5AQHB 1I6ZA 3FZLB 5AQQB 1M7KA 1HX1B 5AQSB 4HWFA 5AQFB 3LDQB 3FZMB 5AQUB 5AQTB 5AQIB 5AQGB 1UK5A 1UGOA 5AQKB 1M62A 5AQMB 5AQLB 5AQNB 2D9DA 5AQPB 4HWIB 4HWCA 5AQVB 5AQJB 3FZHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZK B;  3FZF B;  5AQO B;  5AQR B;  4HWH A;  3A8Y C;  4HWD A;  3M3Z B;  1T7S A;  5AQH B;  1I6Z A;  3FZL B;  5AQQ B;  1M7K A;  1HX1 B;  5AQS B;  4HWF A;  5AQF B;  3LDQ B;  3FZM B;  5AQU B;  5AQT B;  5AQI B;  5AQG B;  1UK5 A;  1UGO A;  5AQK B;  1M62 A;  5AQM B;  5AQL B;  5AQN B;  2D9D A;  5AQP B;  4HWI B;  4HWC A;  5AQV B;  5AQJ B;  3FZH B; 
#chains in the Genus database with same CATH topology
 2X67 A;  4AQF A;  3HR0 A;  3AED A;  1WR0 A;  3A5X A;  3Q5E A;  4ISS A;  4UXN B;  4X5T A;  2NP9 A;  4HWH A;  3GWH A;  3ZMS B;  4QX8 B;  5CFB A;  5LHI B;  2W63 A;  3RH3 A;  2XQA A;  3UU5 A;  3RC8 A;  2X9H A;  2A72 A;  2WS3 A;  3ZN0 B;  4EYU A;  4DV6 T;  2FUP A;  2LEH A;  5AQQ B;  5C8Y E;  3AE1 A;  3JAE A;  2DNX A;  4TWH A;  5DAB A;  5FY0 A;  2XQY A;  3UUL A;  1KNZ A;  5LG4 A;  1HNW T;  4Z91 A;  4EZH A;  3TKL B;  3U3I A;  2CM0 A;  5IUX A;  1D1C A;  2C0S A;  5JDL A;  1HX8 A;  3NWI A;  4HGA A;  3CX6 B;  4C91 A;  2AE9 A;  2DI4 A;  4CZZ B;  4AKI A;  1IBL T;  1BR1 A;  3CML A;  2LE8 A;  5TAO A;  4KBM B;  3RYH E;  3AA1 B;  3VRB A;  2VQE T;  4DUY T;  1QSD A;  3LK3 B;  2BVM A;  4IE7 A;  2KWH A;  2Q9Q C;  3MJX A;  3ZST A;  3I9W A;  5FKY A;  2W4X A;  3RGL A;  4X62 T;  4CN6 A;  2WU2 A;  2M6B A;  3K1S A;  4XBF B;  5FVL A;  2VVS A;  2M67 A;  4QH1 A;  3VU7 H;  2ZM0 A;  4O4I E;  5JDQ A;  2UUC T;  2NTY A;  4LF5 T;  2QRX A;  2WSS V;  2MYS A;  2X9W A;  2Y48 B;  4TNV A;  5IHY A;  2UUA T;  2X0Y A;  2BS3 A;  3KBT A;  2KND A;  4WYV A;  3ZMT B;  2FJE A;  3ZT7 A;  2XHE B;  2HHH T;  4JI7 T;  1MND A;  3Q2M A;  3RI5 A;  1W9R A;  3MXZ A;  4FJO A;  1T8B A;  1MMD A;  2BZB A;  5LBQ B;  5LGU B;  4KUM B;  4P0A A;  3KVB A;  4UEM A;  2JRK A;  5ABE A;  4EAH A;  1D0X A;  5LG3 A;  1VCT A;  3AEA A;  4PJM A;  3ZEF B;  2NTX A;  4ZI2 D;  2CHO A;  1S94 A;  2JMH A;  3BQK A;  3EAB A;  2V7J A;  3H37 A;  2I59 A;  3UU8 A;  3VR9 A;  1KEY A;  2L9Q A;  1KF6 A;  3MA9 A;  2YN6 A;  4GIW A;  2H7V C;  4OK0 A;  2VQF T;  3K3Q C;  2CBJ A;  3TLU A;  5JDN A;  1D0Y A;  1Y64 B;  2PTF A;  2Z6E A;  4JI6 T;  4U2Z A;  4ERR A;  4DR6 T;  4J2C A;  1XDP A;  2D2S A;  2K5B B;  1HNX T;  2KMF A;  2E9X D;  3OPC A;  3C4X A;  1YD8 G;  2V8S V;  4EXT A;  2JQQ A;  2ODU A;  3CX8 B;  3Q5W A;  3UQ7 A;  5JRC A;  4KX6 A;  5LCY A;  3K3O A;  3P50 A;  1YQ4 A;  3SRZ A;  4DND A;  2UXX B;  4PJJ A;  3AEF A;  4COF A;  2DLR A;  3MAC A;  4DV4 T;  2QVA A;  2YDQ A;  3ONL C;  2X51 A;  5CA1 E;  4YTM A;  3DP7 A;  4HFC A;  3SS1 A;  2XQ8 A;  4DMV A;  3NKZ A;  4Q25 A;  2V7L A;  1GQE A;  2CPT A;  4K0K T;  2XQ6 A;  4B3T T;  3FB2 A;  3O4X E;  3ZPO A;  4LF9 T;  2C5I T;  4BJM A;  5FY1 A;  2VKH A;  4PFP A;  1HF8 A;  1HG5 A;  1Y01 A;  2PG8 A;  3P4S A;  3PUS A;  4ZZB A;  4AKH A;  4U7Y A;  2BKO A;  4H9P C;  5HXS A;  5ABF A;  4AQG A;  2X68 A;  2CRB A;  2PFV A;  2R6G F;  3AB3 B;  4FI5 A;  4JBW F;  1L0V A;  3PUW F;  2H3R A;  5ADX L;  4JI4 T;  5HWX A;  5FY7 A;  2LSI A;  4PK5 A;  3IBP A;  4WZX A;  4UF0 B;  2WWV A;  1MIV A;  2Q9Q A;  3LBX B;  4OYK A;  2DWK A;  3N5L A;  5HEU A;  2I6H A;  2LKG A;  4BA9 A;  5HXR A;  3P7I A;  4IDQ A;  2UUB T;  5HYA A;  4NUU A;  3KDS E;  1ZHC A;  2KXP B;  2XTL A;  3Q9D A;  5KXJ A;  2IIU A;  3FBZ A;  5IWA T;  5ETW A;  4N78 D;  3SFD A;  3JC6 C;  2EHO A;  2V7I A;  3W15 B;  1D0Z A;  4X1I E;  5LBM A;  2V7K A;  5KDM C;  2K3W A;  5LNK A;  3S4U A;  3N2O A;  4EZ4 A;  3CIR A;  2DHR A;  1VOM A;  3LK4 2;  1XDO A;  4A56 A;  3ZN1 B;  3HKC E;  4JI8 T;  1WYB A;  2D5U A;  2UXN B;  3H3M A;  1N33 T;  1N36 T;  3ZJ2 A;  4IL9 A;  3T1Y T;  1YW0 A;  3IA3 A;  3PUA A;  4HEA A;  4NPP A;  4PK6 A;  3RIA A;  2IHR 1;  3QOF A;  3PU3 A;  2JIW A;  2WU5 A;  3ZC1 A;  3NZQ A;  2ZM6 T;  4LFC T;  5EK2 A;  1FIO A;  1V9D A;  3NVO A;  1IJ5 A;  1IJ6 A;  2LHN A;  3AE6 A;  3P4P A;  4X20 E;  4ZEY A;  5JQG E;  4EV6 A;  2VWA A;  4CN1 A;  3RRC A;  2V1D B;  2ZM8 A;  3K3N A;  4IDP A;  2OV9 A;  4LML A;  2VKO A;  4CI3 B;  2X9X A;  5LGT B;  2J4G A;  5L4H A;  4HFD A;  4IDZ A;  3AEB A;  4CXX A;  2LJL A;  2NR4 A;  4H63 H;  3AVR A;  4I50 E;  2QA7 A;  2W0G A;  3Q5X A;  4AXP A;  5CGM A;  4YHJ A;  5LGN B;  4YJ2 E;  5AQM B;  2ODV A;  2XQ5 A;  1BR0 A;  3KVA A;  5KMG P;  3GMI A;  4HFE A;  4ILC A;  1YKE B;  5ABG A;  3FZK B;  3AEC A;  4Z90 A;  2LM2 A;  1HNZ T;  1OWA A;  1UUR A;  2YOE A;  4IT4 A;  2BG9 B;  3ZSS A;  3I9Y A;  2CLY B;  2LSJ A;  1YQ3 A;  2LM9 A;  3AE9 A;  2A9U A;  4ZI7 E;  3IF8 B;  3KV4 A;  5L3F B;  4DR4 T;  2E9X B;  3C4W A;  3F57 A;  4MBQ A;  1QLB A;  4NXM T;  3QNU A;  5LOV E;  1VCS A;  5AQS B;  5JVD E;  5HAX A;  3HA4 A;  3UQ4 A;  4DUZ T;  3L39 A;  2DWG A;  2B76 A;  4X64 T;  1UUS A;  2XQ4 A;  3RHW A;  3V5U A;  4EOZ B;  4LF4 T;  4L5G A;  3JCF A;  2E9X A;  2MTQ A;  3ESL A;  3QC9 A;  1LKX A;  2WDQ A;  1FEW A;  4AI6 A;  2HPJ A;  4ILB A;  1HS7 A;  3RYF E;  5DQV A;  3IEE A;  4M1P A;  3N2G E;  1VRB A;  3K8P C;  5AQV B;  3UU3 A;  1SHZ C;  3ETV A;  3ZCI A;  1UX5 A;  2N9D A;  2SPC A;  4O8S A;  3UTK A;  2XAH B;  3P8C D;  1OED E;  1DU2 A;  3NZP A;  5FP3 A;  2VL8 A;  2HN1 A;  4JEU B;  5AFU L;  4GKJ T;  5EK4 A;  3ZLI A;  4HE8 A;  4UVB B;  2LKH A;  2W2U A;  2XQ7 A;  3M3Z B;  1MMA A;  3MZK B;  2JJ9 A;  5H6R B;  2XQ9 A;  2KZ7 B;  4QXH B;  3U78 A;  4ADZ A;  4EIW A;  1XMQ T;  4F8H A;  4LF7 T;  4ZOL E;  4U33 A;  4DV5 T;  2RA1 A;  2I0M A;  1XWM A;  3C98 B;  2BS2 A;  2LOP A;  3FZM B;  2XAS B;  4PJN A;  2CA5 A;  2A3D A;  2OA5 A;  2X0L B;  2LSK A;  3KIN B;  4H9N C;  2NWB A;  3OYX A;  5LHG B;  5ABH A;  3N9L A;  4QHO A;  3N9M A;  1XNQ T;  3EDU A;  5FXV A;  4A5X A;  3ZT5 A;  1HCI A;  3OJA A;  1WLX A;  1MIY A;  4JI1 T;  5DQW A;  1BR2 A;  4IE4 A;  3GN5 B;  3PJA A;  4PFO A;  2VKD A;  5HCM A;  4UF0 A;  2VL0 A;  3EDV A;  5L3E B;  5LHH B;  5EZY E;  2CLY C;  3AXJ A;  3ZYK A;  4DBR A;  4JYA T;  3CVR A;  2ZMA A;  2C5J A;  2BKP A;  4F6R C;  4U3C A;  1J5W A;  1T7S A;  3RRW A;  4CXW A;  3DJB A;  1HFA A;  2EHO D;  5ABF B;  4JI0 T;  4ZS3 A;  1I6Z A;  3OTO T;  1XMO T;  1NEN A;  4PAG A;  5J1G A;  2WDV A;  1M7K A;  3PE0 A;  2EHO B;  2RPA A;  3NRX A;  3PDY A;  4O4H E;  5F8P A;  2YK0 A;  1US7 B;  2LHR A;  5CB4 E;  3CQX C;  5AQF B;  1KNR A;  5EK3 A;  2GK9 A;  3RQU A;  1YXR A;  1WFD A;  3H3A A;  4H9O C;  5JH7 E;  4OFZ A;  4WW0 A;  2JQ9 A;  2X66 A;  4NUV A;  1UGO A;  2VUR A;  4MAL A;  3LBX A;  5DJQ C;  3LFM A;  4UR9 A;  3I1A A;  3TLS A;  3EAM A;  3ZYL A;  1SE7 A;  2V5D A;  3M65 A;  5LB7 B;  3RF1 A;  3OYZ A;  2VB6 A;  2WCA A;  1H7C A;  5AQN B;  3RQW A;  2W61 A;  1HTJ F;  2G0U A;  2LOS A;  4KHZ F;  2MBG A;  4ZZC A;  4HFV A;  4ZI3 C;  3FZH B;  2LRL A;  3AA6 B;  2LLY A;  1OED C;  4TUY E;  2YKS A;  3B5M A;  4IHJ E;  5FMN A;  5HEG A;  3TLT A;  3GA8 A;  4YJ3 E;  3AE7 A;  3FBL A;  5FXX A;  4A98 A;  4C90 A;  4P09 A;  2NW9 A;  3JC6 D;  3ZCJ A;  5L2L A;  1CHU A;  2CXF A;  3CWZ B;  3LJC A;  1XZY A;  2LT3 A;  5LJM A;  4IRE A;  3B57 A;  3SFE A;  4DR3 T;  2WM9 A;  2MAW A;  2P9B A;  1LVK A;  3FZL B;  3PJA J;  2AXD S;  4TZ4 C;  3RIU C;  5L3B B;  4YY3 T;  1I94 T;  2CHN A;  2ZM2 A;  3CX7 B;  4QXC B;  1HX1 B;  3KV6 A;  3WAK A;  5FL1 A;  3AAE B;  3O1H A;  4AIS A;  4LFB T;  2XM1 A;  3AAA B;  1IZN B;  5LP6 E;  2J62 A;  1ZKE A;  4KMC A;  4UVC B;  5LA6 E;  4JI3 T;  4O4L E;  3PUZ F;  1KFY A;  4H63 V;  2XM2 A;  4GK5 E;  5AQK B;  5FYM A;  3J7Y q;  2CXL A;  5JTG A;  4IIJ E;  4DID B;  3E0Z A;  3UUN A;  4DV7 T;  3UFE A;  2W66 A;  4ZS2 A;  2WZI A;  4H9Q C;  2BVL A;  2IAK A;  3ANW A;  4ASK A;  4EGW A;  5HXE A;  3O9X A;  4X66 T;  2XJ7 A;  4G2A A;  3HKD E;  1HR0 T;  2RP4 A;  2WDR A;  3EI0 A;  2YDR A;  3AE2 A;  4ZHQ E;  4TWF A;  2WB5 A;  3A8Y C;  4HWD A;  1IAP A;  1T98 A;  4UV8 B;  3AE8 A;  4TV8 E;  2MOZ A;  3T8O A;  4QH4 A;  5L4E A;  2ACZ A;  2WBL A;  2K9A A;  3OBV E;  5JDF A;  4DO0 A;  5L47 A;  2Q9Q D;  2WWU A;  5C2T A;  4YLH A;  2NW8 A;  1YKH B;  2Y6X A;  3ANW B;  4CN4 A;  2BG9 C;  5L3G B;  1FMW A;  5LMU T;  4DR1 T;  4X65 T;  2FBW A;  2X9Y A;  3A7M A;  3UFG A;  3QK6 A;  1IBM T;  1BR4 A;  2E9X C;  1LVF A;  4V1A v;  1WYC A;  1J5E T;  3T1H T;  4B3S T;  4OX9 T;  1Z8U A;  4U74 A;  4B3M T;  5L3C B;  3EUH A;  5JDG A;  2PJQ A;  4HN9 A;  2BG9 E;  4TN7 B;  4CQI A;  4HWI B;  2XZE A;  2BBJ A;  1UCU A;  2WMN A;  3C50 A;  3CK6 A;  4U72 A;  4U2Y A;  3AVS A;  4UEL A;  5E0O A;  5AQR B;  4DMW A;  4CI1 B;  4OYJ A;  1UX4 A;  3FZF B;  2E2A A;  3DTO A;  2E8I A;  4WNK A;  4ZI2 C;  3NBX X;  4QX7 B;  2UXD T;  2VAS A;  2CEA A;  3C4Z A;  3ZMZ B;  3EVY A;  4GYR A;  4MFR A;  2D0U A;  4I43 B;  3PUR A;  4L9I A;  4EYY R;  3B13 A;  4Z8X A;  3UU4 A;  4HWF A;  1HG2 A;  5J2U E;  2B1E A;  2XPK A;  1J1J A;  1AJ3 A;  3RYC E;  2W67 A;  4DV2 T;  2ZLY A;  4IGU A;  2H7O A;  2XAJ B;  4KI0 F;  3P4R A;  3ZT6 A;  5JR9 C;  4DR7 T;  3HKB E;  4GKK T;  5A1L A;  2V7M A;  4CI2 B;  2DCF A;  4UV9 B;  2IDO B;  4LFA T;  4PNI A;  3VHL A;  3I0Q A;  3VRA A;  3PUX F;  5L3D B;  1FMV A;  4AIU A;  4ILA A;  1OXZ A;  2LRK A;  5HEJ A;  1Z0P A;  4WBO A;  3CKD A;  5FXW A;  1MIW A;  4HKA A;  1G8X A;  4IE6 A;  2V6X A;  2JQH A;  3AXJ B;  3AAI A;  3KFW X;  5CJ5 A;  5H6Q B;  1MMG A;  3KBU A;  3L3P A;  4U7I A;  5AQH B;  3MKD A;  3RIF A;  5JRE A;  1S35 A;  4HTE A;  4DR5 T;  4EB6 E;  4PJL A;  2NOX A;  4YSX A;  5F3J A;  4ZXL A;  5AQU B;  2BBH A;  2QGS A;  2DL1 A;  2KIN B;  3BQI A;  4P0B A;  3RC3 A;  1WRD A;  4NXN T;  3LK2 B;  3LG7 A;  4YSY A;  2L3L A;  4YTN A;  3HI2 A;  3HL6 A;  1T72 A;  2BKN A;  2EHO C;  2IC6 A;  4E7Z A;  2X0H A;  1SUM B;  2XAG B;  4LF8 T;  2IW5 B;  1ZEE A;  2MPK A;  2D9D A;  5LMN T;  2YU1 A;  3FXD B;  2CCQ A;  4HFH A;  2E5L T;  1ZOY A;  2IML A;  5AQJ B;  4BAY B;  2N1G A;  1R8I A;  4QKN A;  3UU6 A;  2CE7 A;  3VKH A;  4AKG A;  1NWM X;  2UXC T;  2H89 A;  3GN5 A;  5JR9 A;  3X1D A;  2WZH A;  2D0T A;  3KV9 A;  3RLF F;  1FJG T;  3N2K E;  2FJB A;  2LSY A;  3CQC B;  4IE5 A;  2V5C A;  3AA7 B;  4JI2 T;  3UT5 E;  3WI3 A;  2BDE A;  2HH7 A;  2L8K A;  5LYJ E;  1OED B;  4UIG A;  4IST A;  1D1A A;  4X1Y E;  3ZJ1 A;  5HXH A;  5JDH A;  1KK7 A;  4CXY A;  4QXB B;  3WAJ A;  4I0U A;  5FNV E;  3EHZ A;  3JAD A;  1LRZ A;  5AQI B;  5C3J A;  5F5W A;  5BR8 T;  4TNW A;  3IHR A;  1X79 A;  3C51 A;  2FJD A;  2YIN A;  1UK5 A;  3E22 E;  4DV3 T;  5HEH A;  1E7P A;  4JV5 T;  1IBK T;  4K0U A;  4TV9 E;  1KNP A;  3RX6 A;  1M62 A;  1X9B A;  3D0T A;  2YEV C;  2FJA A;  3R6N A;  4IE0 A;  5JRC B;  4PK4 A;  4GOU A;  2HPL A;  4ANJ A;  4IDO A;  4MHC A;  5J2T E;  2XQ3 A;  4HWC A;  4YT0 A;  3ZKR A;  3P4Q A;  3F31 A;  2WP9 A;  4KP3 C;  1O3X A;  1E1H B;  2K48 A;  2IUB A;  3C64 A;  2VKJ A;  3R84 B;  5HEO A;  1N34 T;  2K24 A;  2ACX A;  4JUY A;  1WR6 A;  2WY2 A;  1JNR A;  2KSR A;  3N9O A;  1G73 A;  3AE5 A;  4YHH T;  4E7S A;  3OKQ A;  2V6Y A;  4JLE A;  4GK0 E;  3LDQ B;  4NIQ A;  4O2B E;  4QWN B;  5HCJ A;  5CA0 E;  4DBQ A;  4ILU A;  3F2E A;  3L8R A;  5AQG B;  2YDS A;  3AA0 B;  1U5P A;  3RKO A;  3ZMU B;  2V6Y B;  2NW7 A;  3FXE B;  4U31 A;  3Q5D A;  3PU8 A;  3NRY A;  1W09 A;  2XY8 B;  3FHN A;  3HKE E;  3TLW A;  4EEB A;  3P4W A;  2WAU A;  1QUU A;  2CMR A;  3O1I A;  3PUG A;  3ZC0 A;  2V26 A;  5KX5 E;  2VVN A;  4DR2 T;  2LSG A;  2CWY A;  2WMO A;  2BG9 A;  2H88 A;  3ABV A;  2JQK A;  3KV5 A;  4I4T E;  4TWD A;  1N32 T;  1OED A;  2PBI A;  2E5V A;  2Y8D A;  4EED A;  3AEE A;  4A97 A;  5GON E;  5HXC A;  1NEK A;  1NAF A;  1MNE A;  4PW8 A;  4X1K E;  4AKL A;  5BMV E;  4DV0 T;  4TX5 A;  3I0O A;  2HN2 A;  4B6X A;  3QB5 K;  3VR8 A;  4B3R T;  3CQG B;  3RIU A;  3BQL A;  4IL4 A;  5FL0 A;  1XNR T;  2JPF A;  2W62 A;  4LMJ A;  4H9R C;  4H9S E;  4HFI A;  3RPU A;  3TLV A;  2XAF B;  3RKG A;  4G63 A;  4O4J E;  2XSB A;  2M6I A;  4AQY T;  2UXB T;  4L0R A;  1E2A A;  3PTR B;  1ZV4 X;  2XAQ B;  5AQT B;  3SWH A;  4AKR B;  4OHF A;  1JNZ A;  2XSA A;  3PUY F;  3AE3 A;  3J9X 1;  3RYI E;  4BJN A;  1W0A A;  2KWI B;  2CWO A;  1CUN A;  3N9N A;  1ZP0 A;  4DV1 T;  1U4Q A;  2CXD A;  3N9P A;  3UUM A;  4YTP A;  3AEG A;  4KHP T;  4GYS A;  4LMK A;  5AQP B;  1MMN A;  3QUJ A;  3PUV F;  2ES0 A;  4YXD A;  2Q9Q B;  3G06 A;  1B7T A;  2WQY A;  5JR9 B;  3CPZ A;  2KLQ A;  5IYZ E;  2VK9 A;  2A2F X;  2XUE A;  3L09 A;  5LXT E;  2UU9 T;  5AQO B;  3O1J A;  3QB5 A;  3E08 A;  3N9Q A;  3PUQ A;  4QH5 A;  1EZ3 A;  2IC9 A;  3ETU A;  4UVA B;  2KT9 A;  5HWY A;  3SOL A;  3ZMV B;  3OVU A;  4LF6 T;  5LJN A;  3ZYM A;  5JDM A;  1W0B A;  2J47 A;  4YFS A;  4MLK A;  4JI5 T;  4AQF C;  5FVK A;  3UUB A;  2QYW A;  4ZI3 D;  2N2N A;  1D1B A;  2OLT A;  2C5K T;  3AE4 A;  4JEH B;  3MK7 C;  5FXZ A;  3UUX B;  3VKG A;  4HFB A;  3JAF A;  4IDN A;  5M4Y A;  3PV0 F;  3ONX A;  4WBN E;  2BS4 A;  3ONJ A;  3LSV A;  2YU2 A;  4XZC A;  2JMK A;  2CBI A;  4XAX B;  4YSZ A;  4O2A E;  4I55 E;  2W00 A;  1SA0 E;  5AQL B;  3V5S A;  2F4V T;  4P1N A;  3BK9 A;  1WCR A;  5J0Z A;  4DVD A;  2J1D G; 
#chains in the Genus database with same CATH homology
 3FZK B;  3FZF B;  5AQO B;  5AQR B;  4HWH A;  3A8Y C;  4HWD A;  3M3Z B;  1T7S A;  5AQH B;  1I6Z A;  3FZL B;  5AQQ B;  1M7K A;  1HX1 B;  5AQS B;  4HWF A;  5AQF B;  3LDQ B;  3FZM B;  5AQU B;  5AQT B;  5AQI B;  5AQG B;  1UK5 A;  1UGO A;  5AQK B;  1M62 A;  5AQM B;  5AQL B;  5AQN B;  2D9D A;  5AQP B;  4HWI B;  4HWC A;  5AQV B;  5AQJ B;  3FZH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...