3M3ZB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Heat shock cognate 71 kDa protein
publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3m3zB00
4HWHA 3LDQB 5AQHB 1M7KA 3A8YC 5AQFB 1M62A 4HWIB 1I6ZA 3FZFB 5AQVB 1UK5A 3FZHB 5AQNB 4HWFA 5AQPB 1UGOA 2D9DA 4HWCA 5AQRB 5AQOB 3M3ZB 5AQKB 4HWDA 5AQSB 3FZKB 3FZMB 5AQLB 5AQUB 5AQGB 5AQMB 1HX1B 5AQTB 5AQQB 1T7SA 3FZLB 5AQIB 5AQJB
chains in the Genus database with same CATH superfamily
2DL1A 2X9YA 2K3WA 4HE8A 2BG9A 4OFZA 2M67A 2NP9A 2LE8A 4LFAT 2XAJB 4P1NA 4X1KE 5LMUT 4DV2T 1UURA 2NW8A 2VASA 3CVRA 3N9NA 5ABEA 3LK2B 4BJMA 2L3LA 4AKIA 1UX4A 5LJMA 3CX8B 3HKCE 2J47A 3ZMSB 3ABVA 3ZT6A 3UU6A 2Q9QD 5L3GB 4M1PA 2ZM0A 3PV0F 1HS7A 4LF6T 2BBJA 4HWFA 1MMGA 2JQHA 4JI6T 2N1GA 3W15B 5GONE 3M65A 2DWGA 4TV9E 4U72A 1US7B 3K3QC 2IMLA 4ZI3C 2PBIA 4HGAA 4XBFB 4NXMT 4YTNA 3QNUA 3C64A 1B7TA 4COFA 1GQEA 4TV8E 2E8IA 4XAXB 4DR3T 1D0ZA 2BS3A 5KX5E 4PAGA 4H9RC 3GWHA 2X9HA 4UF0A 1IJ6A 1I6ZA 3I0OA 2NTYA 3CIRA 4G2AA 3H3AA 3AEGA 4HKAA 3AEDA 2LM2A 5CFBA 3N9MA 1JNZA 2CM0A 2X51A 2MAWA 4PFOA 2XQAA 3P50A 2LHNA 2KMFA 3C4WA 1WYBA 2K9AA 3JC6C 2HPLA 5JRCB 2I6HA 2WDRA 2B1EA 3LFMA 3AB3B 2DCFA 4PJMA 1YD8G 2CXFA 2CMRA 2H3RA 2AXDS 5L47A 3JAEA 3DJBA 3AE5A 2V7KA 3RYIE 1WYCA 4UV8B 5FYMA 4LF9T 3B57A 3L09A 4ILUA 4O4JE 3FZLB 4CXYA 3PDYA 3T8OA 2J1DG 3UU8A 5AQHB 1H7CA 2XQ7A 3RPUA 5AQPB 2FJAA 1W0BA 3NKZA 2ES0A 2KZ7B 4L0RA 5FL1A 2D0TA 1FMVA 1J5WA 3PUQA 4DIDB 4AKRB 4O4LE 4LF5T 3MXZA 4I55E 4QXBB 3Q2MA 4NPPA 2YU2A 1XNQT 4EYUA 3CQCB 3IA3A 4DR4T 3K8PC 3HKEE 2M6BA 4LFCT 2CPTA 2FJEA 3LG7A 3WI3A 3AE3A 3PUZF 4Z90A 1IBKT 5EK2A 2CHOA 3QUJA 3PUWF 4IHJE 3AVSA 3UQ4A 3OYXA 5FXWA 4BAYB 4U74A 2V7MA 2Z6EA 4PK6A 1XWMA 2XQ4A 3AE1A 2XQ3A 4AXPA 1Z8UA 5AQGB 2KWHA 3N2KE 1ZEEA 3CQXC 2V6XA 1YKEB 5JDNA 4A5XA 3I0QA 2WWUA 4P0AA 3IF8B 1XMOT 3X1DA 5DQWA 4H9SE 4NIQA 4TNWA 5ABHA 4GKJT 5L3BB 3O9XA 5LHHB 1HNZT 5JRCA 2CLYC 2NW9A 1BR1A 3U3IA 4F6RC 4AKGA 3O1HA 1T72A 5JDHA 3ESLA 3CMLA 5AQLB 5HEOA 1NAFA 4AQGA 1SA0E 2QA7A 3ZKRA 5C3JA 1KEYA 4J2CA 4IT4A 2PFVA 3ZMZB 2LRLA 2Y8DA 4AQFC 1OXZA 3KBTA 1X9BA 5FL0A 2OLTA 1MMAA 4AI6A 5AQTB 3MKDA 4HFEA 4DBQA 4ZOLE 3MACA 2FJDA 2M6IA 4B6XA 3UUBA 4YTPA 3DTOA 3ZMVB 4E7SA 4U2ZA 2N2NA 3ONLC 5DJQC 1V9DA 2LSIA 2KNDA 4U7IA 4HFCA 4PJLA 2H89A 4TWFA 4LF8T 1OEDC 3ANWA 3TLTA 4WZXA 5FMNA 2XAQB 2L8KA 2XTLA 3LJCA 4DMVA 2F4VT 4DUZT 5HXEA 3O1IA 3LSVA 3NZQA 3L8RA 4IE5A 3SOLA 4X66T 4TNVA 3OBVE 3CX7B 1JNRA 1HG2A 3VKHA 4B3MT 5AQQB 3OJAA 5L4HA 2XQ6A 4GYRA 5L3EB 5LP6E 1ZP0A 4I0UA 2QGSA 5FY7A 5ABFA 3GN5B 3RIAA 1ZHCA 2BS4A 4H63H 5TAOA 4TWDA 3TLWA 4UV9B 3MK7C 5AQUB 2BBHA 2PG8A 5HWYA 2VQET 2DNXA 2LOSA 5JR9B 4CI1B 4QH5A 5LYJE 5LCYA 3RI5A 2H7VC 4X5TA 3ZSTA 4IL4A 2MOZA 5LBQB 2IAKA 2JMHA 2BKPA 3A7MA 2D0UA 5AQIB 3I9YA 3AEFA 4Z91A 3RYCE 1N33T 2W00A 4PNIA 4TZ4C 3NZPA 5JH7E 2MYSA 5HEHA 4P0BA 3A5XA 5CB4E 2JQKA 5AQSB 1VCTA 4QXHB 2IC9A 4NUVA 4ZI7E 2XHEB 3N2GE 3UU3A 5IYZE 3AA6B 4C91A 1IZNB 4HWIB 1S35A 2CCQA 3AEAA 2WY2A 5ABGA 4EEDA 3OVUA 2WSSV 4UF0B 4OX9T 4JLEA 5KMGP 3EI0A 1AJ3A 3PUYF 3FZHB 1BR0A 4ILAA 3N9OA 2UUBT 3ZYLA 4U7YA 2VURA 4UVBB 5JDFA 5FXXA 5J1GA 5KXJA 3LDQB 3JADA 4IDZA 3KVAA 4UVCB 4LMJA 2X9WA 2VL8A 3ETUA 2CEAA 5FP3A 2D9DA 1D1AA 3UFEA 4EOZB 1T8BA 5IUXA 4DV6T 3GN5A 2FBWA 5BMVE 2FUPA 4B3RT 2CE7A 3AECA 4DV0T 2XAFB 4OYJA 5JR9A 5AFUL 4G63A 5F8PA 5KDMC 4HWDA 1VCSA 1Z0PA 2XM2A 3LK42 5BR8T 5HCMA 3FBZA 3RGLA 4X20E 3EABA 2ACXA 2VKJA 2QRXA 2W61A 2YKSA 3G06A 2XAGB 4JV5T 4IE7A 4JI8T 2CXDA 3CX6B 2K5BB 4PFPA 3RC3A 3NRYA 5HXRA 3UQ7A 4IE0A 2VKHA 1L0VA 3AEBA 1J5ET 4JEHB 2V6YA 4DV1T 4CQIA 5HEJA 3PUGA 5CJ5A 1QUUA 1E2AA 5AQRB 4ZI2D 2A3DA 4IREA 4DMWA 2W63A 2KT9A 2VVNA 2D2SA 4YHJA 2YDSA 5FVLA 4ISSA 3C4XA 2YDQA 4YSXA 5C2TA 4IDQA 4HFVA 3AVRA 2K24A 3Q5XA 2X0LB 3B5MA 3DP7A 4CN6A 3E08A 4IGUA 5LNKA 5JTGA 2IDOB 3IHRA 3K3NA 2MBGA 2BVLA 3PJAJ 3RH3A 2WCAA 3GMIA 4MALA 4JEUB 4JI1T 5LA6E 4QX8B 3ZEFB 1OEDE 3VRAA 4AIUA 2C5IT 1MNDA 3ZCJA 4ANJA 4AKLA 2J4GA 2HHHT 3N9PA 3UUMA 3F57A 4YFSA 3N9LA 3FXDB 2WWVA 1R8IA 2WDQA 1D1CA 5LJNA 4MFRA 2Q9QC 3UTKA 1U5PA 2MPKA 2DI4A 4I4TE 1YXRA 2E9XB 2N9DA 3TKLB 1FJGT 3B13A 4KP3C 3QK6A 5EK4A 5J2UE 4HFHA 4MBQA 1EZ3A 1UX5A 2W2UA 1WFDA 1MIWA 3KV6A 4AQYT 4QXCB 3VR8A 2SPCA 3RRWA 4KHPT 1E7PA 4I43B 3SFDA 5A1LA 3PUXF 3J9X1 4DR5T 3SFEA 3ANWB 4ASKA 2IIUA 2LSJA 2ZM8A 2JIWA 1MMDA 1IBLT 2CBJA 2I0MA 3ZMTB 1WLXA 2LJLA 1UGOA 3VHLA 4GK0E 2JMKA 1KNZA 2B76A 4YHHT 3FXEB 5LGUB 3UT5E 1XNRT 4HFDA 4YT0A 4PK4A 4DV7T 5HXCA 4EZHA 4QH4A 4ZS2A 4DBRA 2UUCT 4PW8A 2JQ9A 1KNRA 1J1JA 3CPZA 2J62A 5ABFB 2WP9A 3C51A 3RX6A 3EVYA 2CXLA 1LVFA 2JQQA 2FJBA 4H63V 3NVOA 2WBLA 3OKQA 2VK9A 2UU9T 3PUAA 3EHZA 4UVAB 3O4XE 3S4UA 5LHGB 5H6QB 2UXDT 3K1SA 2CRBA 2MTQA 2ZLYA 2XSBA 4ADZA 4UELA 2HN2A 2W66A 4WBNE 2JJ9A 3PTRB 3VRBA 2W4XA 2LSKA 3HI2A 2V1DB 1UCUA 2CA5A 3KINB 2H88A 2E9XA 5CA1E 3UU4A 5IHYA 4AISA 2WAUA 3HKBE 3HL6A 4JBWF 5L3CB 2XQ9A 5AQVB 3RRCA 3ZJ1A 2NTXA 3RF1A 3ZLIA 3P7IA 3KBUA 3CWZB 4KI0F 3AE2A 1KNPA 4HEAA 3J7Yq 3D0TA 5L4EA 2RA1A 3PUSA 3P4SA 5LMNT 3TLSA 2WB5A 2LLYA 4FJOA 3CKDA 1HTJF 3AXJA 3P4PA 4U2YA 3SS1A 2BG9C 2X67A 2DHRA 2ODVA 3N5LA 2YINA 1UUSA 5AQNB 4B3TT 4GIWA 2XQ8A 4UXNB 4LF4T 5LGNB 3OTOT 1NEKA 1G73A 4U31A 1XZYA 2YOEA 2Y48B 2D5UA 4CXWA 5JDMA 4TWHA 4DV4T 1OEDB 3FB2A 5L2LA 3SWHA 3IEEA 5JREA 1M62A 4XZCA 3UULA 2BZBA 3L39A 4WNKA 1XMQT 2XM1A 2X66A 2KSRA 2BDEA 3LBXB 4ZZCA 3RIUA 4P09A 4LF7T 2A72A 4ILBA 5LXTE 4JI3T 2XJ7A 2UUAT 3ZT5A 2XQ5A 4LFBT 3ZC0A 3BK9A 1FMWA 5JDGA 3AE8A 1Y64B 5FY1A 2IW5B 3P8CD 4OHFA 1ZV4X 3V5SA 2UXBT 2WS3A 4GKKT 3I1AA 5ADXL 1W9RA 4B3ST 4X1IE 5FNVE 3ONXA 1HF8A 1LRZA 1MIYA 3AAAB 2NW7A 1LKXA 2CWOA 5F3JA 1IAPA 2V6YB 3QB5K 2I59A 1HX1B 2E5LT 1U4QA 2AE9A 4UIGA 1HFAA 4EZ4A 1D0XA 4X62T 2LKHA 5HEGA 5LB7B 4JI5T 3NBXX 3FZMB 2NR4A 4CZZB 2LSYA 5J0ZA 2HPJA 4HWHA 4DV5T 2WDVA 4YJ3E 4EEBA 1YKHB 4DNDA 2LEHA 2UXNB 1MNEA 2V7IA 4WYVA 2V5CA 3ZC1A 4TX5A 3ZSSA 2VWAA 3P4QA 3JCFA 3RQWA 2KWIB 1HG5A 3AE9A 3HR0A 4HFBA 4QX7B 4BA9A 2IUBA 4YSZA 1HCIA 1OEDA 2NWBA 2KINB 1T7SA 5JVDE 2YN6A 4BJNA 2Y6XA 4CI2B 3UU5A 4ISTA 2WZIA 2E9XD 3LBXA 3WAJA 2ZMAA 3QB5A 5DABA 2BKOA 3JC6D 1XDOA 2EHOB 2XY8B 3OYZA 5FVKA 2WMOA 3AE7A 4DVDA 3Q5EA 4WBOA 3AE6A 5JDLA 3NRXA 4Q25A 1N34T 5HYAA 4DV3T 1BR4A 2BVMA 2CHNA 2VL0A 2PJQA 2W62A 4U33A 1W09A 4IDPA 3PJAA 2WQYA 2L9QA 3ONJA 4IL9A 2KLQA 5LG4A 3MA9A 3ZYMA 1MIVA 2LOPA 3ZMUB 2E2AA 2V7JA 1T98A 2JPFA 4EGWA 1YQ4A 1WCRA 4H9OC 3IBPA 1LVKA 4DR1T 1WR0A 4C90A 3C4ZA 4X1YE 1O3XA 1HNWT 4UEMA 2A9UA 5EK3A 1SHZC 2LHRA 2G0UA 4PJJA 3ETVA 2C5JA 4IIJE 5L3FB 3C50A 3T1YT 3QC9A 3RKGA 1W0AA 3KDSE 1N32T 2PTFA 1HR0T 4MLKA 1MMNA 3PU3A 4CN4A 3O1JA 4WW0A 4CI3B 1IBMT 3JAFA 2VKOA 5CA0E 5LG3A 2CBIA 2HH7A 1CUNA 3EDVA 4ZXLA 5LOVE 2YEVC 4JI0T 2LKGA 3PUVF 4H9NC 3AA0B 1CHUA 3TLUA 2DWKA 4ERRA 2UXCT 4NXNT 2LT3A 3N9QA 3RKOA 5HWXA 1N36T 2E9XC 2VKDA 4X64T 2XUEA 5HXHA 3RYHE 3M3ZB 2WMNA 2X68A 3L3PA 4EV6A 4KUMB 2RPAA 2VQFT 4L9IA 2BG9E 4X65T 3A8YC 5AQFB 4DR2T 2OA5A 4F8HA 2EHOA 4ZS3A 3TLVA 4YY3T 1NENA 4TUYE 4H9QC 2WU5A 4Z8XA 4HTEA 3BQKA 2XASB 4O8SA 3HA4A 3ZN0B 2GK9A 4YJ2E 5JDQA 1BR2A 3BQLA 3HKDE 3LK3B 5LBMA 2C0SA 3FHNA 3F2EA 3UFGA 2CWYA 4ZI2C 1IJ5A 3MZKB 2K48A 4EYYR 3N2OA 3Q9DA 3EDUA 4PK5A 2Q9QB 1KFYA 2QYWA 4K0KT 4TN7B 4HFIA 5LHIB 1SUMB 3AXJB 3P4RA 3RHWA 3RC8A 2W67A 4HN9A 2YDRA 2ZM6T 2XZEA 3PU8A 2LM9A 4GOUA 3GA8A 2X0HA 3FZFB 3H37A 1UK5A 3RIUC 2YU1A 4O4IE 4ZEYA 3AEEA 3ZN1B 5C8YE 2C5KT 3CQGB 4ILCA 5HXSA 5AQMB 5L3DB 2ODUA 4H9PC 2X9XA 4YXDA 3F31A 3BQIA 3NWIA 4GK5E 4PJNA 2X0YA 1DU2A 3ZCIA 5H6RB 4A98A 1HNXT 3FBLA 1YQ3A 3T1HT 3U78A 1SE7A 2KXPB 3VKGA 2YK0A 3R6NA 5E0OA 3V5UA 4IDOA 3ZPOA 4IE4A 4DR7T 4QWNB 4V1Av 4YLHA 3Q5DA 2R6GF 2OV9A 2UXXB 3QOFA 3EUHA 3KV9A 3UUXB 4JI2T 4LMKA 2VB6A 3SRZA 1VRBA 4CN1A 4EXTA 2CLYB 1FEWA 2W0GA 2A2FX 3KFWX 1D0YA 3K3OA 3MJXA 2XAHB 1YW0A 3FZKB 3AAEB 3R84B 1OWAA 5AQJB 4GYSA 2IHR1 2IC6A 2H7OA 3E0ZA 2Q9QA 3PE0A 4YSYA 4JI4T 4E7ZA 4NUUA 3RYFE 1I94T 2LRKA 3E22E 1X79A 4JI7T 4O4HE 3RQUA 4O2AE 2WU2A 4DUYT 2RP4A 2BS2A 2E5VA 3I9WA 3WAKA 4CXXA 1KF6A 2XQYA 1XDPA 4MHCA 5JR9C 3ZYKA 5FXVA 5J2TE 2V26A 1NWMX 5FXZA 3ZT7A 1QSDA 4DR6T 1ZOYA 3EAMA 2JRKA 2HN1A 3UUNA 2NOXA 4QHOA 2LSGA 4UR9A 5AQKB 3H3MA 3CK6A 1ZKEA 5M4YA 4K0UA 2ACZA 4L5GA 2EHOD 4I50E 3AA1B 2BG9B 2XPKA 4OK0A 4YTMA 3OPCA 1S94A 1Y01A 3KV5A 4FI5A 3VU7H 1WR6A 4KX6A 4EAHA 3AE4A 3KVBA 5HAXA 3VR9A 3PURA 5FKYA 2V8SV 1HX8A 2XSAA 4OYKA 4A97A 2V7LA 1QLBA 5F5WA 1FIOA 4A56A 4KHZF 5EZYE 5IWAT 5HEUA 4JYAT 4QKNA 4U3CA 4KMCA 4DO0A 5DQVA 3AA7B 1M7KA 5FY0A 4KBMB 2BKNA 5LGTB 4ZHQE 3RLFF 4IE6A 1E1HB 5JQGE 3P4WA 3C98B 4AQFA 3KV4A 1D1BA 1KK7A 4ZI3D 3Q5WA 2VVSA 2WM9A 4ZZBA 4N78D 5ETWA 1WRDA 2WZHA 4IDNA 2DLRA 3ZJ2A 2ZM2A 4JUYA 2V5DA 2P9BA 1G8XA 4O2BE 4EIWA 4HWCA 5AQOB 3RIFA 2QVAA 2EHOC 5HCJA 1VOMA 5CGMA 4QH1A 4AKHA 4EB6E 4LMLA 3AAIA
chains in the Genus database with same CATH topology
4HWHA 3LDQB 5AQHB 1M7KA 3A8YC 5AQFB 1M62A 4HWIB 1I6ZA 3FZFB 5AQVB 1UK5A 3FZHB 5AQNB 4HWFA 5AQPB 1UGOA 2D9DA 4HWCA 5AQRB 5AQOB 3M3ZB 5AQKB 4HWDA 5AQSB 3FZKB 3FZMB 5AQLB 5AQUB 5AQGB 5AQMB 1HX1B 5AQTB 5AQQB 1T7SA 3FZLB 5AQIB 5AQJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWH A;  3LDQ B;  5AQH B;  1M7K A;  3A8Y C;  5AQF B;  1M62 A;  4HWI B;  1I6Z A;  3FZF B;  5AQV B;  1UK5 A;  3FZH B;  5AQN B;  4HWF A;  5AQP B;  1UGO A;  2D9D A;  4HWC A;  5AQR B;  5AQO B;  3M3Z B;  5AQK B;  4HWD A;  5AQS B;  3FZK B;  3FZM B;  5AQL B;  5AQU B;  5AQG B;  5AQM B;  1HX1 B;  5AQT B;  5AQQ B;  1T7S A;  3FZL B;  5AQI B;  5AQJ B; 
#chains in the Genus database with same CATH topology
 2DL1 A;  2X9Y A;  2K3W A;  4HE8 A;  2BG9 A;  4OFZ A;  2M67 A;  2NP9 A;  2LE8 A;  4LFA T;  2XAJ B;  4P1N A;  4X1K E;  5LMU T;  4DV2 T;  1UUR A;  2NW8 A;  2VAS A;  3CVR A;  3N9N A;  5ABE A;  3LK2 B;  4BJM A;  2L3L A;  4AKI A;  1UX4 A;  5LJM A;  3CX8 B;  3HKC E;  2J47 A;  3ZMS B;  3ABV A;  3ZT6 A;  3UU6 A;  2Q9Q D;  5L3G B;  4M1P A;  2ZM0 A;  3PV0 F;  1HS7 A;  4LF6 T;  2BBJ A;  4HWF A;  1MMG A;  2JQH A;  4JI6 T;  2N1G A;  3W15 B;  5GON E;  3M65 A;  2DWG A;  4TV9 E;  4U72 A;  1US7 B;  3K3Q C;  2IML A;  4ZI3 C;  2PBI A;  4HGA A;  4XBF B;  4NXM T;  4YTN A;  3QNU A;  3C64 A;  1B7T A;  4COF A;  1GQE A;  4TV8 E;  2E8I A;  4XAX B;  4DR3 T;  1D0Z A;  2BS3 A;  5KX5 E;  4PAG A;  4H9R C;  3GWH A;  2X9H A;  4UF0 A;  1IJ6 A;  1I6Z A;  3I0O A;  2NTY A;  3CIR A;  4G2A A;  3H3A A;  3AEG A;  4HKA A;  3AED A;  2LM2 A;  5CFB A;  3N9M A;  1JNZ A;  2CM0 A;  2X51 A;  2MAW A;  4PFO A;  2XQA A;  3P50 A;  2LHN A;  2KMF A;  3C4W A;  1WYB A;  2K9A A;  3JC6 C;  2HPL A;  5JRC B;  2I6H A;  2WDR A;  2B1E A;  3LFM A;  3AB3 B;  2DCF A;  4PJM A;  1YD8 G;  2CXF A;  2CMR A;  2H3R A;  2AXD S;  5L47 A;  3JAE A;  3DJB A;  3AE5 A;  2V7K A;  3RYI E;  1WYC A;  4UV8 B;  5FYM A;  4LF9 T;  3B57 A;  3L09 A;  4ILU A;  4O4J E;  3FZL B;  4CXY A;  3PDY A;  3T8O A;  2J1D G;  3UU8 A;  5AQH B;  1H7C A;  2XQ7 A;  3RPU A;  5AQP B;  2FJA A;  1W0B A;  3NKZ A;  2ES0 A;  2KZ7 B;  4L0R A;  5FL1 A;  2D0T A;  1FMV A;  1J5W A;  3PUQ A;  4DID B;  4AKR B;  4O4L E;  4LF5 T;  3MXZ A;  4I55 E;  4QXB B;  3Q2M A;  4NPP A;  2YU2 A;  1XNQ T;  4EYU A;  3CQC B;  3IA3 A;  4DR4 T;  3K8P C;  3HKE E;  2M6B A;  4LFC T;  2CPT A;  2FJE A;  3LG7 A;  3WI3 A;  3AE3 A;  3PUZ F;  4Z90 A;  1IBK T;  5EK2 A;  2CHO A;  3QUJ A;  3PUW F;  4IHJ E;  3AVS A;  3UQ4 A;  3OYX A;  5FXW A;  4BAY B;  4U74 A;  2V7M A;  2Z6E A;  4PK6 A;  1XWM A;  2XQ4 A;  3AE1 A;  2XQ3 A;  4AXP A;  1Z8U A;  5AQG B;  2KWH A;  3N2K E;  1ZEE A;  3CQX C;  2V6X A;  1YKE B;  5JDN A;  4A5X A;  3I0Q A;  2WWU A;  4P0A A;  3IF8 B;  1XMO T;  3X1D A;  5DQW A;  4H9S E;  4NIQ A;  4TNW A;  5ABH A;  4GKJ T;  5L3B B;  3O9X A;  5LHH B;  1HNZ T;  5JRC A;  2CLY C;  2NW9 A;  1BR1 A;  3U3I A;  4F6R C;  4AKG A;  3O1H A;  1T72 A;  5JDH A;  3ESL A;  3CML A;  5AQL B;  5HEO A;  1NAF A;  4AQG A;  1SA0 E;  2QA7 A;  3ZKR A;  5C3J A;  1KEY A;  4J2C A;  4IT4 A;  2PFV A;  3ZMZ B;  2LRL A;  2Y8D A;  4AQF C;  1OXZ A;  3KBT A;  1X9B A;  5FL0 A;  2OLT A;  1MMA A;  4AI6 A;  5AQT B;  3MKD A;  4HFE A;  4DBQ A;  4ZOL E;  3MAC A;  2FJD A;  2M6I A;  4B6X A;  3UUB A;  4YTP A;  3DTO A;  3ZMV B;  4E7S A;  4U2Z A;  2N2N A;  3ONL C;  5DJQ C;  1V9D A;  2LSI A;  2KND A;  4U7I A;  4HFC A;  4PJL A;  2H89 A;  4TWF A;  4LF8 T;  1OED C;  3ANW A;  3TLT A;  4WZX A;  5FMN A;  2XAQ B;  2L8K A;  2XTL A;  3LJC A;  4DMV A;  2F4V T;  4DUZ T;  5HXE A;  3O1I A;  3LSV A;  3NZQ A;  3L8R A;  4IE5 A;  3SOL A;  4X66 T;  4TNV A;  3OBV E;  3CX7 B;  1JNR A;  1HG2 A;  3VKH A;  4B3M T;  5AQQ B;  3OJA A;  5L4H A;  2XQ6 A;  4GYR A;  5L3E B;  5LP6 E;  1ZP0 A;  4I0U A;  2QGS A;  5FY7 A;  5ABF A;  3GN5 B;  3RIA A;  1ZHC A;  2BS4 A;  4H63 H;  5TAO A;  4TWD A;  3TLW A;  4UV9 B;  3MK7 C;  5AQU B;  2BBH A;  2PG8 A;  5HWY A;  2VQE T;  2DNX A;  2LOS A;  5JR9 B;  4CI1 B;  4QH5 A;  5LYJ E;  5LCY A;  3RI5 A;  2H7V C;  4X5T A;  3ZST A;  4IL4 A;  2MOZ A;  5LBQ B;  2IAK A;  2JMH A;  2BKP A;  3A7M A;  2D0U A;  5AQI B;  3I9Y A;  3AEF A;  4Z91 A;  3RYC E;  1N33 T;  2W00 A;  4PNI A;  4TZ4 C;  3NZP A;  5JH7 E;  2MYS A;  5HEH A;  4P0B A;  3A5X A;  5CB4 E;  2JQK A;  5AQS B;  1VCT A;  4QXH B;  2IC9 A;  4NUV A;  4ZI7 E;  2XHE B;  3N2G E;  3UU3 A;  5IYZ E;  3AA6 B;  4C91 A;  1IZN B;  4HWI B;  1S35 A;  2CCQ A;  3AEA A;  2WY2 A;  5ABG A;  4EED A;  3OVU A;  2WSS V;  4UF0 B;  4OX9 T;  4JLE A;  5KMG P;  3EI0 A;  1AJ3 A;  3PUY F;  3FZH B;  1BR0 A;  4ILA A;  3N9O A;  2UUB T;  3ZYL A;  4U7Y A;  2VUR A;  4UVB B;  5JDF A;  5FXX A;  5J1G A;  5KXJ A;  3LDQ B;  3JAD A;  4IDZ A;  3KVA A;  4UVC B;  4LMJ A;  2X9W A;  2VL8 A;  3ETU A;  2CEA A;  5FP3 A;  2D9D A;  1D1A A;  3UFE A;  4EOZ B;  1T8B A;  5IUX A;  4DV6 T;  3GN5 A;  2FBW A;  5BMV E;  2FUP A;  4B3R T;  2CE7 A;  3AEC A;  4DV0 T;  2XAF B;  4OYJ A;  5JR9 A;  5AFU L;  4G63 A;  5F8P A;  5KDM C;  4HWD A;  1VCS A;  1Z0P A;  2XM2 A;  3LK4 2;  5BR8 T;  5HCM A;  3FBZ A;  3RGL A;  4X20 E;  3EAB A;  2ACX A;  2VKJ A;  2QRX A;  2W61 A;  2YKS A;  3G06 A;  2XAG B;  4JV5 T;  4IE7 A;  4JI8 T;  2CXD A;  3CX6 B;  2K5B B;  4PFP A;  3RC3 A;  3NRY A;  5HXR A;  3UQ7 A;  4IE0 A;  2VKH A;  1L0V A;  3AEB A;  1J5E T;  4JEH B;  2V6Y A;  4DV1 T;  4CQI A;  5HEJ A;  3PUG A;  5CJ5 A;  1QUU A;  1E2A A;  5AQR B;  4ZI2 D;  2A3D A;  4IRE A;  4DMW A;  2W63 A;  2KT9 A;  2VVN A;  2D2S A;  4YHJ A;  2YDS A;  5FVL A;  4ISS A;  3C4X A;  2YDQ A;  4YSX A;  5C2T A;  4IDQ A;  4HFV A;  3AVR A;  2K24 A;  3Q5X A;  2X0L B;  3B5M A;  3DP7 A;  4CN6 A;  3E08 A;  4IGU A;  5LNK A;  5JTG A;  2IDO B;  3IHR A;  3K3N A;  2MBG A;  2BVL A;  3PJA J;  3RH3 A;  2WCA A;  3GMI A;  4MAL A;  4JEU B;  4JI1 T;  5LA6 E;  4QX8 B;  3ZEF B;  1OED E;  3VRA A;  4AIU A;  2C5I T;  1MND A;  3ZCJ A;  4ANJ A;  4AKL A;  2J4G A;  2HHH T;  3N9P A;  3UUM A;  3F57 A;  4YFS A;  3N9L A;  3FXD B;  2WWV A;  1R8I A;  2WDQ A;  1D1C A;  5LJN A;  4MFR A;  2Q9Q C;  3UTK A;  1U5P A;  2MPK A;  2DI4 A;  4I4T E;  1YXR A;  2E9X B;  2N9D A;  3TKL B;  1FJG T;  3B13 A;  4KP3 C;  3QK6 A;  5EK4 A;  5J2U E;  4HFH A;  4MBQ A;  1EZ3 A;  1UX5 A;  2W2U A;  1WFD A;  1MIW A;  3KV6 A;  4AQY T;  4QXC B;  3VR8 A;  2SPC A;  3RRW A;  4KHP T;  1E7P A;  4I43 B;  3SFD A;  5A1L A;  3PUX F;  3J9X 1;  4DR5 T;  3SFE A;  3ANW B;  4ASK A;  2IIU A;  2LSJ A;  2ZM8 A;  2JIW A;  1MMD A;  1IBL T;  2CBJ A;  2I0M A;  3ZMT B;  1WLX A;  2LJL A;  1UGO A;  3VHL A;  4GK0 E;  2JMK A;  1KNZ A;  2B76 A;  4YHH T;  3FXE B;  5LGU B;  3UT5 E;  1XNR T;  4HFD A;  4YT0 A;  4PK4 A;  4DV7 T;  5HXC A;  4EZH A;  4QH4 A;  4ZS2 A;  4DBR A;  2UUC T;  4PW8 A;  2JQ9 A;  1KNR A;  1J1J A;  3CPZ A;  2J62 A;  5ABF B;  2WP9 A;  3C51 A;  3RX6 A;  3EVY A;  2CXL A;  1LVF A;  2JQQ A;  2FJB A;  4H63 V;  3NVO A;  2WBL A;  3OKQ A;  2VK9 A;  2UU9 T;  3PUA A;  3EHZ A;  4UVA B;  3O4X E;  3S4U A;  5LHG B;  5H6Q B;  2UXD T;  3K1S A;  2CRB A;  2MTQ A;  2ZLY A;  2XSB A;  4ADZ A;  4UEL A;  2HN2 A;  2W66 A;  4WBN E;  2JJ9 A;  3PTR B;  3VRB A;  2W4X A;  2LSK A;  3HI2 A;  2V1D B;  1UCU A;  2CA5 A;  3KIN B;  2H88 A;  2E9X A;  5CA1 E;  3UU4 A;  5IHY A;  4AIS A;  2WAU A;  3HKB E;  3HL6 A;  4JBW F;  5L3C B;  2XQ9 A;  5AQV B;  3RRC A;  3ZJ1 A;  2NTX A;  3RF1 A;  3ZLI A;  3P7I A;  3KBU A;  3CWZ B;  4KI0 F;  3AE2 A;  1KNP A;  4HEA A;  3J7Y q;  3D0T A;  5L4E A;  2RA1 A;  3PUS A;  3P4S A;  5LMN T;  3TLS A;  2WB5 A;  2LLY A;  4FJO A;  3CKD A;  1HTJ F;  3AXJ A;  3P4P A;  4U2Y A;  3SS1 A;  2BG9 C;  2X67 A;  2DHR A;  2ODV A;  3N5L A;  2YIN A;  1UUS A;  5AQN B;  4B3T T;  4GIW A;  2XQ8 A;  4UXN B;  4LF4 T;  5LGN B;  3OTO T;  1NEK A;  1G73 A;  4U31 A;  1XZY A;  2YOE A;  2Y48 B;  2D5U A;  4CXW A;  5JDM A;  4TWH A;  4DV4 T;  1OED B;  3FB2 A;  5L2L A;  3SWH A;  3IEE A;  5JRE A;  1M62 A;  4XZC A;  3UUL A;  2BZB A;  3L39 A;  4WNK A;  1XMQ T;  2XM1 A;  2X66 A;  2KSR A;  2BDE A;  3LBX B;  4ZZC A;  3RIU A;  4P09 A;  4LF7 T;  2A72 A;  4ILB A;  5LXT E;  4JI3 T;  2XJ7 A;  2UUA T;  3ZT5 A;  2XQ5 A;  4LFB T;  3ZC0 A;  3BK9 A;  1FMW A;  5JDG A;  3AE8 A;  1Y64 B;  5FY1 A;  2IW5 B;  3P8C D;  4OHF A;  1ZV4 X;  3V5S A;  2UXB T;  2WS3 A;  4GKK T;  3I1A A;  5ADX L;  1W9R A;  4B3S T;  4X1I E;  5FNV E;  3ONX A;  1HF8 A;  1LRZ A;  1MIY A;  3AAA B;  2NW7 A;  1LKX A;  2CWO A;  5F3J A;  1IAP A;  2V6Y B;  3QB5 K;  2I59 A;  1HX1 B;  2E5L T;  1U4Q A;  2AE9 A;  4UIG A;  1HFA A;  4EZ4 A;  1D0X A;  4X62 T;  2LKH A;  5HEG A;  5LB7 B;  4JI5 T;  3NBX X;  3FZM B;  2NR4 A;  4CZZ B;  2LSY A;  5J0Z A;  2HPJ A;  4HWH A;  4DV5 T;  2WDV A;  4YJ3 E;  4EEB A;  1YKH B;  4DND A;  2LEH A;  2UXN B;  1MNE A;  2V7I A;  4WYV A;  2V5C A;  3ZC1 A;  4TX5 A;  3ZSS A;  2VWA A;  3P4Q A;  3JCF A;  3RQW A;  2KWI B;  1HG5 A;  3AE9 A;  3HR0 A;  4HFB A;  4QX7 B;  4BA9 A;  2IUB A;  4YSZ A;  1HCI A;  1OED A;  2NWB A;  2KIN B;  1T7S A;  5JVD E;  2YN6 A;  4BJN A;  2Y6X A;  4CI2 B;  3UU5 A;  4IST A;  2WZI A;  2E9X D;  3LBX A;  3WAJ A;  2ZMA A;  3QB5 A;  5DAB A;  2BKO A;  3JC6 D;  1XDO A;  2EHO B;  2XY8 B;  3OYZ A;  5FVK A;  2WMO A;  3AE7 A;  4DVD A;  3Q5E A;  4WBO A;  3AE6 A;  5JDL A;  3NRX A;  4Q25 A;  1N34 T;  5HYA A;  4DV3 T;  1BR4 A;  2BVM A;  2CHN A;  2VL0 A;  2PJQ A;  2W62 A;  4U33 A;  1W09 A;  4IDP A;  3PJA A;  2WQY A;  2L9Q A;  3ONJ A;  4IL9 A;  2KLQ A;  5LG4 A;  3MA9 A;  3ZYM A;  1MIV A;  2LOP A;  3ZMU B;  2E2A A;  2V7J A;  1T98 A;  2JPF A;  4EGW A;  1YQ4 A;  1WCR A;  4H9O C;  3IBP A;  1LVK A;  4DR1 T;  1WR0 A;  4C90 A;  3C4Z A;  4X1Y E;  1O3X A;  1HNW T;  4UEM A;  2A9U A;  5EK3 A;  1SHZ C;  2LHR A;  2G0U A;  4PJJ A;  3ETV A;  2C5J A;  4IIJ E;  5L3F B;  3C50 A;  3T1Y T;  3QC9 A;  3RKG A;  1W0A A;  3KDS E;  1N32 T;  2PTF A;  1HR0 T;  4MLK A;  1MMN A;  3PU3 A;  4CN4 A;  3O1J A;  4WW0 A;  4CI3 B;  1IBM T;  3JAF A;  2VKO A;  5CA0 E;  5LG3 A;  2CBI A;  2HH7 A;  1CUN A;  3EDV A;  4ZXL A;  5LOV E;  2YEV C;  4JI0 T;  2LKG A;  3PUV F;  4H9N C;  3AA0 B;  1CHU A;  3TLU A;  2DWK A;  4ERR A;  2UXC T;  4NXN T;  2LT3 A;  3N9Q A;  3RKO A;  5HWX A;  1N36 T;  2E9X C;  2VKD A;  4X64 T;  2XUE A;  5HXH A;  3RYH E;  3M3Z B;  2WMN A;  2X68 A;  3L3P A;  4EV6 A;  4KUM B;  2RPA A;  2VQF T;  4L9I A;  2BG9 E;  4X65 T;  3A8Y C;  5AQF B;  4DR2 T;  2OA5 A;  4F8H A;  2EHO A;  4ZS3 A;  3TLV A;  4YY3 T;  1NEN A;  4TUY E;  4H9Q C;  2WU5 A;  4Z8X A;  4HTE A;  3BQK A;  2XAS B;  4O8S A;  3HA4 A;  3ZN0 B;  2GK9 A;  4YJ2 E;  5JDQ A;  1BR2 A;  3BQL A;  3HKD E;  3LK3 B;  5LBM A;  2C0S A;  3FHN A;  3F2E A;  3UFG A;  2CWY A;  4ZI2 C;  1IJ5 A;  3MZK B;  2K48 A;  4EYY R;  3N2O A;  3Q9D A;  3EDU A;  4PK5 A;  2Q9Q B;  1KFY A;  2QYW A;  4K0K T;  4TN7 B;  4HFI A;  5LHI B;  1SUM B;  3AXJ B;  3P4R A;  3RHW A;  3RC8 A;  2W67 A;  4HN9 A;  2YDR A;  2ZM6 T;  2XZE A;  3PU8 A;  2LM9 A;  4GOU A;  3GA8 A;  2X0H A;  3FZF B;  3H37 A;  1UK5 A;  3RIU C;  2YU1 A;  4O4I E;  4ZEY A;  3AEE A;  3ZN1 B;  5C8Y E;  2C5K T;  3CQG B;  4ILC A;  5HXS A;  5AQM B;  5L3D B;  2ODU A;  4H9P C;  2X9X A;  4YXD A;  3F31 A;  3BQI A;  3NWI A;  4GK5 E;  4PJN A;  2X0Y A;  1DU2 A;  3ZCI A;  5H6R B;  4A98 A;  1HNX T;  3FBL A;  1YQ3 A;  3T1H T;  3U78 A;  1SE7 A;  2KXP B;  3VKG A;  2YK0 A;  3R6N A;  5E0O A;  3V5U A;  4IDO A;  3ZPO A;  4IE4 A;  4DR7 T;  4QWN B;  4V1A v;  4YLH A;  3Q5D A;  2R6G F;  2OV9 A;  2UXX B;  3QOF A;  3EUH A;  3KV9 A;  3UUX B;  4JI2 T;  4LMK A;  2VB6 A;  3SRZ A;  1VRB A;  4CN1 A;  4EXT A;  2CLY B;  1FEW A;  2W0G A;  2A2F X;  3KFW X;  1D0Y A;  3K3O A;  3MJX A;  2XAH B;  1YW0 A;  3FZK B;  3AAE B;  3R84 B;  1OWA A;  5AQJ B;  4GYS A;  2IHR 1;  2IC6 A;  2H7O A;  3E0Z A;  2Q9Q A;  3PE0 A;  4YSY A;  4JI4 T;  4E7Z A;  4NUU A;  3RYF E;  1I94 T;  2LRK A;  3E22 E;  1X79 A;  4JI7 T;  4O4H E;  3RQU A;  4O2A E;  2WU2 A;  4DUY T;  2RP4 A;  2BS2 A;  2E5V A;  3I9W A;  3WAK A;  4CXX A;  1KF6 A;  2XQY A;  1XDP A;  4MHC A;  5JR9 C;  3ZYK A;  5FXV A;  5J2T E;  2V26 A;  1NWM X;  5FXZ A;  3ZT7 A;  1QSD A;  4DR6 T;  1ZOY A;  3EAM A;  2JRK A;  2HN1 A;  3UUN A;  2NOX A;  4QHO A;  2LSG A;  4UR9 A;  5AQK B;  3H3M A;  3CK6 A;  1ZKE A;  5M4Y A;  4K0U A;  2ACZ A;  4L5G A;  2EHO D;  4I50 E;  3AA1 B;  2BG9 B;  2XPK A;  4OK0 A;  4YTM A;  3OPC A;  1S94 A;  1Y01 A;  3KV5 A;  4FI5 A;  3VU7 H;  1WR6 A;  4KX6 A;  4EAH A;  3AE4 A;  3KVB A;  5HAX A;  3VR9 A;  3PUR A;  5FKY A;  2V8S V;  1HX8 A;  2XSA A;  4OYK A;  4A97 A;  2V7L A;  1QLB A;  5F5W A;  1FIO A;  4A56 A;  4KHZ F;  5EZY E;  5IWA T;  5HEU A;  4JYA T;  4QKN A;  4U3C A;  4KMC A;  4DO0 A;  5DQV A;  3AA7 B;  1M7K A;  5FY0 A;  4KBM B;  2BKN A;  5LGT B;  4ZHQ E;  3RLF F;  4IE6 A;  1E1H B;  5JQG E;  3P4W A;  3C98 B;  4AQF A;  3KV4 A;  1D1B A;  1KK7 A;  4ZI3 D;  3Q5W A;  2VVS A;  2WM9 A;  4ZZB A;  4N78 D;  5ETW A;  1WRD A;  2WZH A;  4IDN A;  2DLR A;  3ZJ2 A;  2ZM2 A;  4JUY A;  2V5D A;  2P9B A;  1G8X A;  4O2B E;  4EIW A;  4HWC A;  5AQO B;  3RIF A;  2QVA A;  2EHO C;  5HCJ A;  1VOM A;  5CGM A;  4QH1 A;  4AKH A;  4EB6 E;  4LML A;  3AAI A; 
#chains in the Genus database with same CATH homology
 4HWH A;  3LDQ B;  5AQH B;  1M7K A;  3A8Y C;  5AQF B;  1M62 A;  4HWI B;  1I6Z A;  3FZF B;  5AQV B;  1UK5 A;  3FZH B;  5AQN B;  4HWF A;  5AQP B;  1UGO A;  2D9D A;  4HWC A;  5AQR B;  5AQO B;  3M3Z B;  5AQK B;  4HWD A;  5AQS B;  3FZK B;  3FZM B;  5AQL B;  5AQU B;  5AQG B;  5AQM B;  1HX1 B;  5AQT B;  5AQQ B;  1T7S A;  3FZL B;  5AQI B;  5AQJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...