3M3ZB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
b'GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 45
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3m3zB00
1M7KA 3M3ZB 1T7SA 1I6ZA 3FZFB 4HWIB 4HWDA 1UGOA 3A8YC 5AQTB 4HWFA 5AQNB 5AQIB 5AQQB 3LDQB 5AQFB 3FZLB 5AQOB 3FZKB 1M62A 4HWHA 5AQMB 4HWCA 5AQKB 5AQRB 1HX1B 5AQSB 2D9DA 3FZMB 5AQGB 5AQLB 5AQVB 3FZHB 5AQJB 1UK5A 5AQUB 5AQHB 5AQPB
chains in the Genus database with same CATH superfamily
2XQ7A 2A9UA 2WU2A 2YDQA 4DNDA 3LBXA 4AKHA 3NZQA 2X51A 4TNVA 5HXRA 4AQFA 5L47A 4GOUA 4ZHQE 4N78D 3ETUA 3K1SA 4X20E 2ACZA 5IUXA 3B57A 1FIOA 2F4VT 2UXNB 1WR6A 1E2AA 1I94T 5AQFB 3NRYA 2DI4A 5BR8T 5EK4A 2QA7A 5EZYE 5JH7E 2BVMA 4HTEA 3NBXX 2MBGA 4TX5A 4JI6T 2LSJA 4ANJA 3A7MA 3UUXB 3P50A 2IAKA 2HN2A 4IE0A 2XSBA 1FJGT 2LE8A 3CVRA 4EAHA 2DLRA 1N33T 1ZKEA 4EZHA 1ZOYA 2ES0A 4B3TT 4LMJA 4DV2T 1ZHCA 4ERRA 3KFWX 4BA9A 2WBLA 2WSSV 4DBQA 3AE3A 2LHNA 5HEJA 4QX8B 2EHOA 2FJBA 5LOVE 4WBNE 5A1LA 4XBFB 3F57A 1XWMA 2V5DA 3ZSSA 4HWDA 2VL8A 5FXWA 3AE9A 4U33A 5AQQB 2V26A 4EB6E 2VASA 1CUNA 3JC6D 3RC8A 2DWGA 4H9PC 3EABA 2I0MA 5JDHA 1X79A 2ZLYA 3PURA 3B13A 3QOFA 2X0YA 5H6QB 1YKHB 4IGUA 4WNKA 4PK4A 2J47A 2Q9QA 2IHR1 2XQ9A 3N9QA 4IE5A 3H3AA 4LF8T 2MAWA 4DR3T 2QGSA 3P4PA 3C51A 2LSGA 4UV8B 3T1HT 4HWIB 4OFZA 5HXHA 4TN7B 2FBWA 2YN6A 3AE2A 3CQGB 3RH3A 1SUMB 3KVAA 3DTOA 1BR4A 4TNWA 2IC6A 4YY3T 1KK7A 4UEMA 2MPKA 4QH1A 4LFCT 1T72A 2VQFT 1L0VA 3ABVA 4IL9A 2E9XC 3Q9DA 2LEHA 4JI5T 4QH4A 3CX6B 2X67A 2DNXA 5L3FB 4IDOA 5J0ZA 2IMLA 3CMLA 2VWAA 3AEEA 1HX8A 1WYCA 5EK2A 4ZEYA 2V7IA 3GMIA 4U7IA 3LK42 4O4IE 3AEAA 4U72A 5AQRB 4NUUA 5KDMC 5FKYA 5AQJB 3OKQA 4BAYB 1HS7A 2CBJA 1T8BA 2X0LB 2WAUA 2X9YA 3JADA 4IHJE 2XASB 2E9XD 3KV5A 4DV0T 3A8YC 2WP9A 3ZEFB 2IC9A 3FB2A 3VRAA 4HFCA 5LG3A 4MHCA 2Q9QD 3RGLA 4PJMA 3ZLIA 2EHOB 5HYAA 2J62A 4ZI3C 3N9MA 3R6NA 1VOMA 1MMNA 1XMQT 2WWVA 4TWDA 3EAMA 1MMDA 4GYSA 3ZC1A 2XAGB 2BDEA 2A72A 2BG9C 3J9X1 4YSZA 1IZNB 5JDNA 2CLYC 4EIWA 2D5UA 5LHHB 2MTQA 1Y01A 1S35A 3ESLA 4UR9A 5FP3A 3KBUA 4YHHT 2IUBA 5FNVE 1UX5A 4ZI3D 3F31A 1E1HB 4EEDA 1IBLT 4GYRA 1JNRA 2I6HA 2ZM2A 4O4LE 2ZM0A 5LNKA 1NWMX 3BQIA 1JNZA 1T7SA 1NENA 2CBIA 2IDOB 1HG2A 2XM2A 3SOLA 4HWFA 2BS3A 3SFDA 3ZSTA 5IWAT 3UU3A 4AQYT 3PV0F 2W0GA 1US7B 4UIGA 3S4UA 1WFDA 1ZV4X 3N2GE 5FY0A 2OV9A 3RIAA 4UVAB 4DO0A 3B5MA 5JR9C 3T8OA 1YXRA 2XQYA 5ETWA 3UTKA 4ILBA 4GKJT 3UUBA 3F2EA 4EZ4A 2C5IT 5LYJE 3AA0B 1IAPA 3ZJ2A 2MYSA 3UU5A 4PAGA 4PK5A 2MOZA 2R6GF 4I4TE 2K5BB 1D0ZA 5M4YA 3FHNA 3ZMVB 4ZXLA 3ZMSB 2DL1A 2L3LA 1HX1B 4IL4A 1XNQT 3RC3A 2WWUA 2XY8B 3N9PA 2V7MA 2CMRA 3HKEE 4QXCB 2KWHA 2G0UA 4KI0F 2N9DA 1H7CA 3Q5XA 3WAKA 1X9BA 1SHZC 2NW9A 1SA0E 4I50E 4U3CA 1SE7A 2FJEA 5LB7B 2X9HA 5LBMA 4DR4T 3N9LA 2XM1A 4TWFA 3VR8A 4QWNB 3LK2B 5JRCA 3EHZA 5AQHB 1D0XA 3PDYA 4UVCB 2I59A 3GWHA 4PFOA 5FVKA 5AQNB 4LF6T 2VVNA 3MXZA 4IE6A 2D0UA 1IJ5A 2Z6EA 2WB5A 4UELA 1KFYA 3I1AA 3RRCA 3UU8A 1KEYA 5TAOA 4XAXB 2LSKA 2V5CA 4JI2T 1G73A 4CN6A 3IEEA 4HFVA 4HEAA 2W62A 3P4RA 5LXTE 3RYFE 3KV9A 3AE4A 4AKGA 1XDOA 4OYJA 3U78A 4KP3C 2W4XA 3M3ZB 3C50A 4YJ3E 1WR0A 3H3MA 4EOZB 4YSYA 3E08A 2CEAA 3CX7B 5FXVA 2OLTA 3MK7C 4AQGA 2E2AA 1V9DA 2E8IA 2J4GA 5JQGE 4DV5T 1KNZA 3AVRA 3K8PC 5AQOB 3P7IA 3AEBA 3I9WA 3RYIE 5AFUL 3N2KE 4EYUA 4P1NA 3IHRA 4O4HE 2JRKA 4OYKA 3ZN0B 4EEBA 3ZKRA 1OEDB 3AAAB 4ZZCA 2E5VA 2WZHA 4BJMA 3CX8B 4HN9A 3ZJ1A 2LLYA 3AEFA 4HFBA 3PU8A 5FMNA 2NOXA 3TLTA 1N32T 3MZKB 4KMCA 2HPLA 4ILAA 1HF8A 5LJNA 3LSVA 4GKKT 3EDUA 3EVYA 3TLVA 3LK3B 1MIVA 4ILCA 3MJXA 4I0UA 1Z8UA 3O4XE 4CN4A 3FBLA 4YXDA 5JRCB 4CI1B 1IJ6A 5JVDE 1N34T 1VCTA 4FJOA 3FZFB 4IREA 2LRLA 4JLEA 4TV9E 3CQXC 4DIDB 3Q5EA 3EI0A 4CI3B 2H7VC 4OHFA 1HTJF 4P0AA 2ZMAA 5LG4A 4K0KT 4J2CA 2Y48B 4IDPA 5LCYA 3PUVF 1YKEB 4OK0A 3TLSA 1BR1A 2WZIA 1CHUA 2YOEA 2X9XA 4LF9T 3W15B 4A5XA 3DP7A 5AQUB 2CRBA 4MFRA 2E9XA 2AE9A 3ZT6A 2PBIA 2CE7A 2WS3A 3HKBE 4K0UA 4DV1T 3RI5A 1E7PA 2Y6XA 1MMAA 2NR4A 3C64A 3RIFA 2CXLA 3IBPA 4F6RC 3T1YT 3LBXB 3BQLA 1OEDE 4HGAA 4ADZA 2V1DB 1FMWA 2C5KT 3QNUA 2XQAA 4ZOLE 4E7ZA 2WY2A 2FUPA 5C3JA 1G8XA 1W09A 1NAFA 2QVAA 3UQ7A 2VKDA 2XQ6A 5LBQB 1HNWT 2B76A 4DBRA 3QUJA 5FXXA 3ANWA 1AJ3A 2IIUA 4IDQA 3UU4A 4H63H 1BR0A 4X64T 3NRXA 4UV9B 2BS4A 4DUZT 2JQKA 3C4WA 3MACA 3TKLB 2V7KA 2BG9A 4AI6A 4PFPA 2ODVA 4IE4A 3H37A 3P4WA 3K3OA 4JEHB 1YD8G 4O8SA 4Q25A 3AEGA 1QUUA 2AXDS 4AIUA 2SPCA 4G63A 3ZMUB 1QSDA 4EV6A 1YQ3A 2OA5A 5H6RB 2LSIA 1BR2A 3HL6A 4UF0A 4CQIA 1I6ZA 3ZN1B 3I0QA 3ONLC 3ZYLA 2WM9A 2KINB 4QXHB 5HEGA 3AAEB 1LRZA 5FVLA 3ZT5A 3KV6A 5DQWA 3AAIA 3ZMTB 4HFIA 4JI7T 2H88A 5AQLB 2J1DG 2YK0A 2WU5A 1VRBA 4L9IA 3AECA 1VCSA 5HAXA 3IA3A 4YTMA 2X68A 2E9XB 3JAEA 4NXMT 2XJ7A 3AA1B 1MIYA 4HFEA 2NTYA 2M6IA 5JR9A 2FJAA 2Q9QB 3AE6A 3E22E 3NWIA 3UQ4A 2XUEA 2XAJB 4H9QC 4AKRB 3ZYMA 2L9QA 2VURA 3O1JA 4I43B 4TV8E 3CPZA 2XQ8A 4JI4T 4QXBB 3KINB 3PE0A 3PJAA 2WDRA 3WI3A 3FZMB 4YSXA 1O3XA 4O4JE 2D0TA 2XZEA 3N9OA 4CXXA 2V8SV 4ZZBA 1WCRA 5LGTB 3V5UA 1Z0PA 4DR6T 1UGOA 3RIUC 5LJMA 2BS2A 4PK6A 4U74A 1UK5A 2DCFA 3SRZA 2PJQA 5L3CB 2UXCT 2YU2A 4TZ4C 3ZMZB 4X5TA 1KF6A 3RRWA 5ABHA 3RHWA 3PUGA 3V5SA 4AISA 3BK9A 4X1YE 4WYVA 3EUHA 4ISSA 4LFAT 2BG9B 2X0HA 3C4ZA 2CLYB 3FXEB 4PNIA 4WW0A 2KSRA 5CGMA 2HPJA 2M6BA 2LM9A 2H89A 3QB5A 2ZM8A 3VHLA 2BKNA 5ABGA 4DV6T 4U2ZA 4Z90A 4KUMB 3DJBA 1W0AA 4ILUA 3FBZA 4DMVA 3AE8A 4UF0B 4JYAT 2XAQB 3C98B 2CXDA 3RPUA 4GK0E 4JEUB 2KXPB 5DJQC 4LF5T 5L3EB 2B1EA 5J1GA 5AQVB 3SS1A 4X65T 2XQ4A 5KXJA 1OWAA 1QLBA 1EZ3A 4CN1A 3AXJA 2NP9A 3SWHA 5FL1A 1MIWA 2GK9A 3UT5E 5JREA 4LMKA 1LVFA 4HWHA 1XMOT 2LHRA 3ZCJA 5IYZE 2UUAT 5L3BB 5HCMA 5JR9B 1ZP0A 3OJAA 3AE1A 3AA6B 2KNDA 4MALA 3RQUA 4LF4T 3K3QC 2JMHA 4B3MT 2WMOA 3JCFA 4AKLA 3RKGA 2W00A 2UUCT 5FYMA 5LP6E 3RX6A 4NUVA 2RPAA 2ACXA 2IW5B 5E0OA 1M7KA 3M65A 2QRXA 1OEDC 2JQQA 3CQCB 3OYXA 2CWYA 4UVBB 1LVKA 3L3PA 3A5XA 3I0OA 2CHNA 4P0BA 2VL0A 1HR0T 5JDLA 4QX7B 4UXNB 3VR9A 3PTRB 2WDQA 2W63A 2VK9A 4GIWA 2L8KA 3FZLB 2X66A 2KT9A 2BG9E 1XDPA 1WRDA 4NPPA 5JDFA 2CPTA 4U2YA 5IHYA 3OTOT 4U31A 3Q2MA 2P9BA 2XSAA 2K3WA 3AVSA 1YW0A 1Y64B 2BVLA 3TLWA 4EGWA 3C4XA 2PFVA 2NTXA 2ZM6T 3RF1A 4AKIA 4COFA 3ETVA 5HXEA 5CA0E 2FJDA 2LOSA 2WQYA 2XAHB 2VVSA 3NVOA 2ODUA 5J2UE 3J7Yq 4GK5E 1MNEA 1D0YA 5HXCA 5JDMA 2NW7A 3HI2A 4H9OC 3AXJB 5ABFA 4KHZF 5CA1E 2E5LT 3RLFF 4YTNA 2M67A 5LMUT 2V7JA 3PUAA 3UULA 5JDGA 4ASKA 4U7YA 2RA1A 2X9WA 4E7SA 3AB3B 5J2TE 1D1CA 5LHGB 3VKHA 2DWKA 1LKXA 3RKOA 1UUSA 3JC6C 1J5WA 3BQKA 5CB4E 4CXWA 4JBWF 4AQFC 4A56A 4NXNT 1WLXA 2UXDT 5HEUA 2YDRA 4ISTA 1UCUA 3VKGA 4ZS2A 1HNXT 4YJ2E 4JI0T 3GN5A 1FMVA 3PUWF 1DU2A 3IF8B 3ZT7A 5LGNB 4X66T 3OVUA 5L2LA 2C0SA 3I9YA 3CK6A 1GQEA 3OBVE 3UFGA 4YTPA 3UU6A 3PUZF 2JPFA 3FZKB 2HH7A 5L4HA 3VU7H 5FL0A 2W67A 4O2BE 1S94A 3O9XA 1B7TA 3FXDB 4C91A 5C8YE 2KLQA 4PJLA 4JI8T 5LHIB 1HCIA 2JQHA 3L8RA 4XZCA 2LSYA 2V6YA 2HHHT 3OYZA 4B3RT 3LDQB 5HWYA 1U5PA 2A2FX 3P8CD 4DV4T 5JTGA 3KBTA 2XHEB 4IDZA 3QC9A 2K9AA 5LMNT 3LFMA 4PW8A 4DR1T 2HN1A 3PJAJ 3Q5WA 4CXYA 4HFHA 5LA6E 3ZPOA 2EHOC 3ZYKA 4ZS3A 3NKZA 2BZBA 2A3DA 3K3NA 2RP4A 5FY7A 1N36T 1KNRA 4EYYR 4QKNA 2CXFA 3O1HA 3HKDE 2LKHA 3EDVA 4M1PA 4X1KE 2CCQA 2YKSA 1J1JA 3PUSA 4X1IE 2QYWA 2KWIB 5ABFB 3QK6A 2V7LA 5DQVA 3P4SA 3D0TA 1IBMT 1OXZA 2EHOD 2Q9QC 2CWOA 3UUNA 2VKHA 5EK3A 2W66A 4DUYT 2XAFB 3PUXF 3O1IA 4DMWA 3E0ZA 2K48A 3TLUA 4HFDA 4A98A 4YT0A 3KV4A 4JUYA 4P09A 4DR7T 5AQTB 4B3ST 3QB5K 4PJNA 3KDSE 2CM0A 2YU1A 1MNDA 4HWCA 3RYHE 3GN5B 3AE7A 3ZC0A 3RIUA 5KMGP 2LT3A 1U4QA 5AQPB 3RQWA 4IE7A 1HNZT 4WBOA 5F8PA 2JMKA 1W0BA 3HA4A 1XNRT 3HR0A 4H9RC 4HKAA 5FY1A 3CKDA 2LKGA 4DV7T 2LJLA 3L09A 4Z91A 5AQGB 4A97A 1D1BA 4CZZB 3Q5DA 4X62T 3AA7B 4JI1T 1HG5A 3UUMA 4DV3T 1IBKT 4YHJA 2YDSA 4IDNA 3PU3A 3ZCIA 2YINA 5ABEA 2N2NA 1R8IA 3CWZB 2V6YB 4LF7T 3PUQA 3SFEA 5AQMB 4BJNA 2V6XA 2D9DA 5C2TA 4H9NC 3PUYF 1YQ4A 2C5JA 2CA5A 3VRBA 3MKDA 2VB6A 2VQET 2W2UA 1M62A 4H63V 1W9RA 2NW8A 4MBQA 5AQKB 5L3DB 2BBJA 2N1GA 2UXBT 3N2OA 3ANWB 3UFEA 2LRKA 2H7OA 2K24A 1UX4A 2CHOA 4DR5T 2VKJA 2JIWA 2KZ7B 2YEVC 4NIQA 5JDQA 4IIJE 2LOPA 3U3IA 2Y8DA 5FXZA 4WZXA 2H3RA 4DVDA 3N9NA 3CIRA 2D2SA 4JI3T 4O2AE 4KHPT 2UXXB 4L5GA 3P4QA 5AQIB 4AXPA 4DR2T 5AQSB 3WAJA 3RYCE 3LJCA 3X1DA 4PJJA 5HEOA 1MMGA 5L4EA 4EXTA 2DHRA 3LG7A 4G2AA 1OEDA 4H9SE 4FI5A 2BBHA 3GA8A 5HWXA 5GONE 2UU9T 2KMFA 2VKOA 1XZYA 1HFAA 2XQ3A 2UUBT 4I55E 4LMLA 4TWHA 3N5LA 4ZI7E 4JV5T 3AE5A 4OX9T 2WCAA 1D1AA 5DABA 4L0RA 3JAFA 5KX5E 1KNPA 1UURA 2JQ9A 4ZI2C 4KBMB 1FEWA 2BKOA 4HE8A 4YFSA 3FZHB 5F5WA 3NZPA 1ZEEA 4YLHA 4CI2B 4QHOA 2LM2A 2XPKA 3L39A 4QH5A 4F8HA 3OPCA 2NWBA 5LGUB 2PG8A 2BKPA 5BMVE 3G06A 5HCJA 4Z8XA 3ONXA 4KX6A 3AEDA 3HKCE 2W61A 4ZI2D 2JJ9A 2WMNA 5HEHA 4IT4A 3MA9A 5CFBA 5L3GB 3ONJA 5CJ5A 5ADXL 4TUYE 3KVBA 4MLKA 4B6XA 1WYBA 2PTFA 3R84B 2XQ5A 4LFBT 4C90A 1J5ET 1T98A 4V1Av 2WDVA 1NEKA 2XTLA 5HXSA 5F3JA
chains in the Genus database with same CATH topology
1M7KA 3M3ZB 1T7SA 1I6ZA 3FZFB 4HWIB 4HWDA 1UGOA 3A8YC 5AQTB 4HWFA 5AQNB 5AQIB 5AQQB 3LDQB 5AQFB 3FZLB 5AQOB 3FZKB 1M62A 4HWHA 5AQMB 4HWCA 5AQKB 5AQRB 1HX1B 5AQSB 2D9DA 3FZMB 5AQGB 5AQLB 5AQVB 3FZHB 5AQJB 1UK5A 5AQUB 5AQHB 5AQPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7K A;  3M3Z B;  1T7S A;  1I6Z A;  3FZF B;  4HWI B;  4HWD A;  1UGO A;  3A8Y C;  5AQT B;  4HWF A;  5AQN B;  5AQI B;  5AQQ B;  3LDQ B;  5AQF B;  3FZL B;  5AQO B;  3FZK B;  1M62 A;  4HWH A;  5AQM B;  4HWC A;  5AQK B;  5AQR B;  1HX1 B;  5AQS B;  2D9D A;  3FZM B;  5AQG B;  5AQL B;  5AQV B;  3FZH B;  5AQJ B;  1UK5 A;  5AQU B;  5AQH B;  5AQP B; 
#chains in the Genus database with same CATH topology
 2XQ7 A;  2A9U A;  2WU2 A;  2YDQ A;  4DND A;  3LBX A;  4AKH A;  3NZQ A;  2X51 A;  4TNV A;  5HXR A;  4AQF A;  5L47 A;  4GOU A;  4ZHQ E;  4N78 D;  3ETU A;  3K1S A;  4X20 E;  2ACZ A;  5IUX A;  3B57 A;  1FIO A;  2F4V T;  2UXN B;  1WR6 A;  1E2A A;  1I94 T;  5AQF B;  3NRY A;  2DI4 A;  5BR8 T;  5EK4 A;  2QA7 A;  5EZY E;  5JH7 E;  2BVM A;  4HTE A;  3NBX X;  2MBG A;  4TX5 A;  4JI6 T;  2LSJ A;  4ANJ A;  3A7M A;  3UUX B;  3P50 A;  2IAK A;  2HN2 A;  4IE0 A;  2XSB A;  1FJG T;  2LE8 A;  3CVR A;  4EAH A;  2DLR A;  1N33 T;  1ZKE A;  4EZH A;  1ZOY A;  2ES0 A;  4B3T T;  4LMJ A;  4DV2 T;  1ZHC A;  4ERR A;  3KFW X;  4BA9 A;  2WBL A;  2WSS V;  4DBQ A;  3AE3 A;  2LHN A;  5HEJ A;  4QX8 B;  2EHO A;  2FJB A;  5LOV E;  4WBN E;  5A1L A;  4XBF B;  3F57 A;  1XWM A;  2V5D A;  3ZSS A;  4HWD A;  2VL8 A;  5FXW A;  3AE9 A;  4U33 A;  5AQQ B;  2V26 A;  4EB6 E;  2VAS A;  1CUN A;  3JC6 D;  3RC8 A;  2DWG A;  4H9P C;  3EAB A;  2I0M A;  5JDH A;  1X79 A;  2ZLY A;  3PUR A;  3B13 A;  3QOF A;  2X0Y A;  5H6Q B;  1YKH B;  4IGU A;  4WNK A;  4PK4 A;  2J47 A;  2Q9Q A;  2IHR 1;  2XQ9 A;  3N9Q A;  4IE5 A;  3H3A A;  4LF8 T;  2MAW A;  4DR3 T;  2QGS A;  3P4P A;  3C51 A;  2LSG A;  4UV8 B;  3T1H T;  4HWI B;  4OFZ A;  5HXH A;  4TN7 B;  2FBW A;  2YN6 A;  3AE2 A;  3CQG B;  3RH3 A;  1SUM B;  3KVA A;  3DTO A;  1BR4 A;  4TNW A;  2IC6 A;  4YY3 T;  1KK7 A;  4UEM A;  2MPK A;  4QH1 A;  4LFC T;  1T72 A;  2VQF T;  1L0V A;  3ABV A;  4IL9 A;  2E9X C;  3Q9D A;  2LEH A;  4JI5 T;  4QH4 A;  3CX6 B;  2X67 A;  2DNX A;  5L3F B;  4IDO A;  5J0Z A;  2IML A;  3CML A;  2VWA A;  3AEE A;  1HX8 A;  1WYC A;  5EK2 A;  4ZEY A;  2V7I A;  3GMI A;  4U7I A;  3LK4 2;  4O4I E;  3AEA A;  4U72 A;  5AQR B;  4NUU A;  5KDM C;  5FKY A;  5AQJ B;  3OKQ A;  4BAY B;  1HS7 A;  2CBJ A;  1T8B A;  2X0L B;  2WAU A;  2X9Y A;  3JAD A;  4IHJ E;  2XAS B;  2E9X D;  3KV5 A;  4DV0 T;  3A8Y C;  2WP9 A;  3ZEF B;  2IC9 A;  3FB2 A;  3VRA A;  4HFC A;  5LG3 A;  4MHC A;  2Q9Q D;  3RGL A;  4PJM A;  3ZLI A;  2EHO B;  5HYA A;  2J62 A;  4ZI3 C;  3N9M A;  3R6N A;  1VOM A;  1MMN A;  1XMQ T;  2WWV A;  4TWD A;  3EAM A;  1MMD A;  4GYS A;  3ZC1 A;  2XAG B;  2BDE A;  2A72 A;  2BG9 C;  3J9X 1;  4YSZ A;  1IZN B;  5JDN A;  2CLY C;  4EIW A;  2D5U A;  5LHH B;  2MTQ A;  1Y01 A;  1S35 A;  3ESL A;  4UR9 A;  5FP3 A;  3KBU A;  4YHH T;  2IUB A;  5FNV E;  1UX5 A;  4ZI3 D;  3F31 A;  1E1H B;  4EED A;  1IBL T;  4GYR A;  1JNR A;  2I6H A;  2ZM2 A;  4O4L E;  2ZM0 A;  5LNK A;  1NWM X;  3BQI A;  1JNZ A;  1T7S A;  1NEN A;  2CBI A;  2IDO B;  1HG2 A;  2XM2 A;  3SOL A;  4HWF A;  2BS3 A;  3SFD A;  3ZST A;  5IWA T;  3UU3 A;  4AQY T;  3PV0 F;  2W0G A;  1US7 B;  4UIG A;  3S4U A;  1WFD A;  1ZV4 X;  3N2G E;  5FY0 A;  2OV9 A;  3RIA A;  4UVA B;  4DO0 A;  3B5M A;  5JR9 C;  3T8O A;  1YXR A;  2XQY A;  5ETW A;  3UTK A;  4ILB A;  4GKJ T;  3UUB A;  3F2E A;  4EZ4 A;  2C5I T;  5LYJ E;  3AA0 B;  1IAP A;  3ZJ2 A;  2MYS A;  3UU5 A;  4PAG A;  4PK5 A;  2MOZ A;  2R6G F;  4I4T E;  2K5B B;  1D0Z A;  5M4Y A;  3FHN A;  3ZMV B;  4ZXL A;  3ZMS B;  2DL1 A;  2L3L A;  1HX1 B;  4IL4 A;  1XNQ T;  3RC3 A;  2WWU A;  2XY8 B;  3N9P A;  2V7M A;  2CMR A;  3HKE E;  4QXC B;  2KWH A;  2G0U A;  4KI0 F;  2N9D A;  1H7C A;  3Q5X A;  3WAK A;  1X9B A;  1SHZ C;  2NW9 A;  1SA0 E;  4I50 E;  4U3C A;  1SE7 A;  2FJE A;  5LB7 B;  2X9H A;  5LBM A;  4DR4 T;  3N9L A;  2XM1 A;  4TWF A;  3VR8 A;  4QWN B;  3LK2 B;  5JRC A;  3EHZ A;  5AQH B;  1D0X A;  3PDY A;  4UVC B;  2I59 A;  3GWH A;  4PFO A;  5FVK A;  5AQN B;  4LF6 T;  2VVN A;  3MXZ A;  4IE6 A;  2D0U A;  1IJ5 A;  2Z6E A;  2WB5 A;  4UEL A;  1KFY A;  3I1A A;  3RRC A;  3UU8 A;  1KEY A;  5TAO A;  4XAX B;  2LSK A;  2V5C A;  4JI2 T;  1G73 A;  4CN6 A;  3IEE A;  4HFV A;  4HEA A;  2W62 A;  3P4R A;  5LXT E;  3RYF E;  3KV9 A;  3AE4 A;  4AKG A;  1XDO A;  4OYJ A;  3U78 A;  4KP3 C;  2W4X A;  3M3Z B;  3C50 A;  4YJ3 E;  1WR0 A;  3H3M A;  4EOZ B;  4YSY A;  3E08 A;  2CEA A;  3CX7 B;  5FXV A;  2OLT A;  3MK7 C;  4AQG A;  2E2A A;  1V9D A;  2E8I A;  2J4G A;  5JQG E;  4DV5 T;  1KNZ A;  3AVR A;  3K8P C;  5AQO B;  3P7I A;  3AEB A;  3I9W A;  3RYI E;  5AFU L;  3N2K E;  4EYU A;  4P1N A;  3IHR A;  4O4H E;  2JRK A;  4OYK A;  3ZN0 B;  4EEB A;  3ZKR A;  1OED B;  3AAA B;  4ZZC A;  2E5V A;  2WZH A;  4BJM A;  3CX8 B;  4HN9 A;  3ZJ1 A;  2LLY A;  3AEF A;  4HFB A;  3PU8 A;  5FMN A;  2NOX A;  3TLT A;  1N32 T;  3MZK B;  4KMC A;  2HPL A;  4ILA A;  1HF8 A;  5LJN A;  3LSV A;  4GKK T;  3EDU A;  3EVY A;  3TLV A;  3LK3 B;  1MIV A;  4ILC A;  3MJX A;  4I0U A;  1Z8U A;  3O4X E;  4CN4 A;  3FBL A;  4YXD A;  5JRC B;  4CI1 B;  1IJ6 A;  5JVD E;  1N34 T;  1VCT A;  4FJO A;  3FZF B;  4IRE A;  2LRL A;  4JLE A;  4TV9 E;  3CQX C;  4DID B;  3Q5E A;  3EI0 A;  4CI3 B;  2H7V C;  4OHF A;  1HTJ F;  4P0A A;  2ZMA A;  5LG4 A;  4K0K T;  4J2C A;  2Y48 B;  4IDP A;  5LCY A;  3PUV F;  1YKE B;  4OK0 A;  3TLS A;  1BR1 A;  2WZI A;  1CHU A;  2YOE A;  2X9X A;  4LF9 T;  3W15 B;  4A5X A;  3DP7 A;  5AQU B;  2CRB A;  4MFR A;  2E9X A;  2AE9 A;  3ZT6 A;  2PBI A;  2CE7 A;  2WS3 A;  3HKB E;  4K0U A;  4DV1 T;  3RI5 A;  1E7P A;  2Y6X A;  1MMA A;  2NR4 A;  3C64 A;  3RIF A;  2CXL A;  3IBP A;  4F6R C;  3T1Y T;  3LBX B;  3BQL A;  1OED E;  4HGA A;  4ADZ A;  2V1D B;  1FMW A;  2C5K T;  3QNU A;  2XQA A;  4ZOL E;  4E7Z A;  2WY2 A;  2FUP A;  5C3J A;  1G8X A;  1W09 A;  1NAF A;  2QVA A;  3UQ7 A;  2VKD A;  2XQ6 A;  5LBQ B;  1HNW T;  2B76 A;  4DBR A;  3QUJ A;  5FXX A;  3ANW A;  1AJ3 A;  2IIU A;  4IDQ A;  3UU4 A;  4H63 H;  1BR0 A;  4X64 T;  3NRX A;  4UV9 B;  2BS4 A;  4DUZ T;  2JQK A;  3C4W A;  3MAC A;  3TKL B;  2V7K A;  2BG9 A;  4AI6 A;  4PFP A;  2ODV A;  4IE4 A;  3H37 A;  3P4W A;  3K3O A;  4JEH B;  1YD8 G;  4O8S A;  4Q25 A;  3AEG A;  1QUU A;  2AXD S;  4AIU A;  2SPC A;  4G63 A;  3ZMU B;  1QSD A;  4EV6 A;  1YQ3 A;  2OA5 A;  5H6R B;  2LSI A;  1BR2 A;  3HL6 A;  4UF0 A;  4CQI A;  1I6Z A;  3ZN1 B;  3I0Q A;  3ONL C;  3ZYL A;  2WM9 A;  2KIN B;  4QXH B;  5HEG A;  3AAE B;  1LRZ A;  5FVL A;  3ZT5 A;  3KV6 A;  5DQW A;  3AAI A;  3ZMT B;  4HFI A;  4JI7 T;  2H88 A;  5AQL B;  2J1D G;  2YK0 A;  2WU5 A;  1VRB A;  4L9I A;  3AEC A;  1VCS A;  5HAX A;  3IA3 A;  4YTM A;  2X68 A;  2E9X B;  3JAE A;  4NXM T;  2XJ7 A;  3AA1 B;  1MIY A;  4HFE A;  2NTY A;  2M6I A;  5JR9 A;  2FJA A;  2Q9Q B;  3AE6 A;  3E22 E;  3NWI A;  3UQ4 A;  2XUE A;  2XAJ B;  4H9Q C;  4AKR B;  3ZYM A;  2L9Q A;  2VUR A;  3O1J A;  4I43 B;  4TV8 E;  3CPZ A;  2XQ8 A;  4JI4 T;  4QXB B;  3KIN B;  3PE0 A;  3PJA A;  2WDR A;  3WI3 A;  3FZM B;  4YSX A;  1O3X A;  4O4J E;  2D0T A;  2XZE A;  3N9O A;  4CXX A;  2V8S V;  4ZZB A;  1WCR A;  5LGT B;  3V5U A;  1Z0P A;  4DR6 T;  1UGO A;  3RIU C;  5LJM A;  2BS2 A;  4PK6 A;  4U74 A;  1UK5 A;  2DCF A;  3SRZ A;  2PJQ A;  5L3C B;  2UXC T;  2YU2 A;  4TZ4 C;  3ZMZ B;  4X5T A;  1KF6 A;  3RRW A;  5ABH A;  3RHW A;  3PUG A;  3V5S A;  4AIS A;  3BK9 A;  4X1Y E;  4WYV A;  3EUH A;  4ISS A;  4LFA T;  2BG9 B;  2X0H A;  3C4Z A;  2CLY B;  3FXE B;  4PNI A;  4WW0 A;  2KSR A;  5CGM A;  2HPJ A;  2M6B A;  2LM9 A;  2H89 A;  3QB5 A;  2ZM8 A;  3VHL A;  2BKN A;  5ABG A;  4DV6 T;  4U2Z A;  4Z90 A;  4KUM B;  3DJB A;  1W0A A;  4ILU A;  3FBZ A;  4DMV A;  3AE8 A;  4UF0 B;  4JYA T;  2XAQ B;  3C98 B;  2CXD A;  3RPU A;  4GK0 E;  4JEU B;  2KXP B;  5DJQ C;  4LF5 T;  5L3E B;  2B1E A;  5J1G A;  5AQV B;  3SS1 A;  4X65 T;  2XQ4 A;  5KXJ A;  1OWA A;  1QLB A;  1EZ3 A;  4CN1 A;  3AXJ A;  2NP9 A;  3SWH A;  5FL1 A;  1MIW A;  2GK9 A;  3UT5 E;  5JRE A;  4LMK A;  1LVF A;  4HWH A;  1XMO T;  2LHR A;  3ZCJ A;  5IYZ E;  2UUA T;  5L3B B;  5HCM A;  5JR9 B;  1ZP0 A;  3OJA A;  3AE1 A;  3AA6 B;  2KND A;  4MAL A;  3RQU A;  4LF4 T;  3K3Q C;  2JMH A;  4B3M T;  2WMO A;  3JCF A;  4AKL A;  3RKG A;  2W00 A;  2UUC T;  5FYM A;  5LP6 E;  3RX6 A;  4NUV A;  2RPA A;  2ACX A;  2IW5 B;  5E0O A;  1M7K A;  3M65 A;  2QRX A;  1OED C;  2JQQ A;  3CQC B;  3OYX A;  2CWY A;  4UVB B;  1LVK A;  3L3P A;  3A5X A;  3I0O A;  2CHN A;  4P0B A;  2VL0 A;  1HR0 T;  5JDL A;  4QX7 B;  4UXN B;  3VR9 A;  3PTR B;  2WDQ A;  2W63 A;  2VK9 A;  4GIW A;  2L8K A;  3FZL B;  2X66 A;  2KT9 A;  2BG9 E;  1XDP A;  1WRD A;  4NPP A;  5JDF A;  2CPT A;  4U2Y A;  5IHY A;  3OTO T;  4U31 A;  3Q2M A;  2P9B A;  2XSA A;  2K3W A;  3AVS A;  1YW0 A;  1Y64 B;  2BVL A;  3TLW A;  4EGW A;  3C4X A;  2PFV A;  2NTX A;  2ZM6 T;  3RF1 A;  4AKI A;  4COF A;  3ETV A;  5HXE A;  5CA0 E;  2FJD A;  2LOS A;  2WQY A;  2XAH B;  2VVS A;  3NVO A;  2ODU A;  5J2U E;  3J7Y q;  4GK5 E;  1MNE A;  1D0Y A;  5HXC A;  5JDM A;  2NW7 A;  3HI2 A;  4H9O C;  3AXJ B;  5ABF A;  4KHZ F;  5CA1 E;  2E5L T;  3RLF F;  4YTN A;  2M67 A;  5LMU T;  2V7J A;  3PUA A;  3UUL A;  5JDG A;  4ASK A;  4U7Y A;  2RA1 A;  2X9W A;  4E7S A;  3AB3 B;  5J2T E;  1D1C A;  5LHG B;  3VKH A;  2DWK A;  1LKX A;  3RKO A;  1UUS A;  3JC6 C;  1J5W A;  3BQK A;  5CB4 E;  4CXW A;  4JBW F;  4AQF C;  4A56 A;  4NXN T;  1WLX A;  2UXD T;  5HEU A;  2YDR A;  4IST A;  1UCU A;  3VKG A;  4ZS2 A;  1HNX T;  4YJ2 E;  4JI0 T;  3GN5 A;  1FMV A;  3PUW F;  1DU2 A;  3IF8 B;  3ZT7 A;  5LGN B;  4X66 T;  3OVU A;  5L2L A;  2C0S A;  3I9Y A;  3CK6 A;  1GQE A;  3OBV E;  3UFG A;  4YTP A;  3UU6 A;  3PUZ F;  2JPF A;  3FZK B;  2HH7 A;  5L4H A;  3VU7 H;  5FL0 A;  2W67 A;  4O2B E;  1S94 A;  3O9X A;  1B7T A;  3FXD B;  4C91 A;  5C8Y E;  2KLQ A;  4PJL A;  4JI8 T;  5LHI B;  1HCI A;  2JQH A;  3L8R A;  4XZC A;  2LSY A;  2V6Y A;  2HHH T;  3OYZ A;  4B3R T;  3LDQ B;  5HWY A;  1U5P A;  2A2F X;  3P8C D;  4DV4 T;  5JTG A;  3KBT A;  2XHE B;  4IDZ A;  3QC9 A;  2K9A A;  5LMN T;  3LFM A;  4PW8 A;  4DR1 T;  2HN1 A;  3PJA J;  3Q5W A;  4CXY A;  4HFH A;  5LA6 E;  3ZPO A;  2EHO C;  3ZYK A;  4ZS3 A;  3NKZ A;  2BZB A;  2A3D A;  3K3N A;  2RP4 A;  5FY7 A;  1N36 T;  1KNR A;  4EYY R;  4QKN A;  2CXF A;  3O1H A;  3HKD E;  2LKH A;  3EDV A;  4M1P A;  4X1K E;  2CCQ A;  2YKS A;  1J1J A;  3PUS A;  4X1I E;  2QYW A;  2KWI B;  5ABF B;  3QK6 A;  2V7L A;  5DQV A;  3P4S A;  3D0T A;  1IBM T;  1OXZ A;  2EHO D;  2Q9Q C;  2CWO A;  3UUN A;  2VKH A;  5EK3 A;  2W66 A;  4DUY T;  2XAF B;  3PUX F;  3O1I A;  4DMW A;  3E0Z A;  2K48 A;  3TLU A;  4HFD A;  4A98 A;  4YT0 A;  3KV4 A;  4JUY A;  4P09 A;  4DR7 T;  5AQT B;  4B3S T;  3QB5 K;  4PJN A;  3KDS E;  2CM0 A;  2YU1 A;  1MND A;  4HWC A;  3RYH E;  3GN5 B;  3AE7 A;  3ZC0 A;  3RIU A;  5KMG P;  2LT3 A;  1U4Q A;  5AQP B;  3RQW A;  4IE7 A;  1HNZ T;  4WBO A;  5F8P A;  2JMK A;  1W0B A;  3HA4 A;  1XNR T;  3HR0 A;  4H9R C;  4HKA A;  5FY1 A;  3CKD A;  2LKG A;  4DV7 T;  2LJL A;  3L09 A;  4Z91 A;  5AQG B;  4A97 A;  1D1B A;  4CZZ B;  3Q5D A;  4X62 T;  3AA7 B;  4JI1 T;  1HG5 A;  3UUM A;  4DV3 T;  1IBK T;  4YHJ A;  2YDS A;  4IDN A;  3PU3 A;  3ZCI A;  2YIN A;  5ABE A;  2N2N A;  1R8I A;  3CWZ B;  2V6Y B;  4LF7 T;  3PUQ A;  3SFE A;  5AQM B;  4BJN A;  2V6X A;  2D9D A;  5C2T A;  4H9N C;  3PUY F;  1YQ4 A;  2C5J A;  2CA5 A;  3VRB A;  3MKD A;  2VB6 A;  2VQE T;  2W2U A;  1M62 A;  4H63 V;  1W9R A;  2NW8 A;  4MBQ A;  5AQK B;  5L3D B;  2BBJ A;  2N1G A;  2UXB T;  3N2O A;  3ANW B;  3UFE A;  2LRK A;  2H7O A;  2K24 A;  1UX4 A;  2CHO A;  4DR5 T;  2VKJ A;  2JIW A;  2KZ7 B;  2YEV C;  4NIQ A;  5JDQ A;  4IIJ E;  2LOP A;  3U3I A;  2Y8D A;  5FXZ A;  4WZX A;  2H3R A;  4DVD A;  3N9N A;  3CIR A;  2D2S A;  4JI3 T;  4O2A E;  4KHP T;  2UXX B;  4L5G A;  3P4Q A;  5AQI B;  4AXP A;  4DR2 T;  5AQS B;  3WAJ A;  3RYC E;  3LJC A;  3X1D A;  4PJJ A;  5HEO A;  1MMG A;  5L4E A;  4EXT A;  2DHR A;  3LG7 A;  4G2A A;  1OED A;  4H9S E;  4FI5 A;  2BBH A;  3GA8 A;  5HWX A;  5GON E;  2UU9 T;  2KMF A;  2VKO A;  1XZY A;  1HFA A;  2XQ3 A;  2UUB T;  4I55 E;  4LML A;  4TWH A;  3N5L A;  4ZI7 E;  4JV5 T;  3AE5 A;  4OX9 T;  2WCA A;  1D1A A;  5DAB A;  4L0R A;  3JAF A;  5KX5 E;  1KNP A;  1UUR A;  2JQ9 A;  4ZI2 C;  4KBM B;  1FEW A;  2BKO A;  4HE8 A;  4YFS A;  3FZH B;  5F5W A;  3NZP A;  1ZEE A;  4YLH A;  4CI2 B;  4QHO A;  2LM2 A;  2XPK A;  3L39 A;  4QH5 A;  4F8H A;  3OPC A;  2NWB A;  5LGU B;  2PG8 A;  2BKP A;  5BMV E;  3G06 A;  5HCJ A;  4Z8X A;  3ONX A;  4KX6 A;  3AED A;  3HKC E;  2W61 A;  4ZI2 D;  2JJ9 A;  2WMN A;  5HEH A;  4IT4 A;  3MA9 A;  5CFB A;  5L3G B;  3ONJ A;  5CJ5 A;  5ADX L;  4TUY E;  3KVB A;  4MLK A;  4B6X A;  1WYB A;  2PTF A;  3R84 B;  2XQ5 A;  4LFB T;  4C90 A;  1J5E T;  1T98 A;  4V1A v;  2WDV A;  1NEK A;  2XTL A;  5HXS A;  5F3J A; 
#chains in the Genus database with same CATH homology
 1M7K A;  3M3Z B;  1T7S A;  1I6Z A;  3FZF B;  4HWI B;  4HWD A;  1UGO A;  3A8Y C;  5AQT B;  4HWF A;  5AQN B;  5AQI B;  5AQQ B;  3LDQ B;  5AQF B;  3FZL B;  5AQO B;  3FZK B;  1M62 A;  4HWH A;  5AQM B;  4HWC A;  5AQK B;  5AQR B;  1HX1 B;  5AQS B;  2D9D A;  3FZM B;  5AQG B;  5AQL B;  5AQV B;  3FZH B;  5AQJ B;  1UK5 A;  5AQU B;  5AQH B;  5AQP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...