1HTJF

Structure of the rgs-like domain from pdz-rhogef
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
ESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the RGS-like domain from PDZ-RhoGEF: linking heterotrimeric g protein-coupled signaling to Rho GTPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords KIAA0380
total genus 66
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2000-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1htjF00
2I59A 2DLRA 3C50A 1SHZC 3C4ZA 2PBIA 1IAPA 3T8OA 4PNIA 1ZV4X 4YHJA 2ACXA 3QC9A 4WBOA 4IGUA 3CX6B 4GOUA 4L9IA 2ES0A 3CX7B 2A72A 1HTJF 3CX8B 3AB3B 3C4WA 3C4XA 4WNKA 3C51A
chains in the Genus database with same CATH superfamily
3K3QC 2RA1A 4O2AE 2J4GA 5HXCA 2VB6A 3CQXC 1E2AA 2XAGB 3KINB 5HCJA 5ETWA 1KNRA 4QKNA 2V7KA 3Q9DA 2UXBT 4MBQA 4QWNB 3RF1A 4IE6A 2VKOA 4PNIA 3MK7C 4QHOA 3VRBA 3ZCIA 4O4LE 3AVRA 3KBTA 3JADA 3OBVE 4BA9A 4GK0E 4WBNE 3VKGA 3ONLC 4CZZB 1KK7A 1MMAA 2LM2A 4H63V 3ZJ1A 1X9BA 3E0ZA 4NPPA 3VHLA 1XDPA 4H9PC 4DUZT 4UVAB 4GKJT 2CBJA 4H9OC 3N5LA 2C5IT 2Z6EA 1HTJF 2BBJA 4PW8A 2CCQA 4QH1A 3AB3B 4WNKA 4BJMA 2LHRA 2WDVA 3H3MA 1LRZA 3HKDE 3N9OA 2AE9A 3BQKA 3OJAA 3PU3A 3ZMTB 1U4QA 4G2AA 2HPLA 5L3GB 5KMGP 1E1HB 4LFBT 4DV4T 1OXZA 3K8PC 1G73A 4XZCA 2CM0A 2W00A 5LMNT 1SE7A 2RPAA 5FL1A 3R84B 4CN6A 5JRCB 1ZOYA 3P4SA 2MYSA 5LBQB 1XZYA 2X9WA 4X62T 4TZ4C 3N2KE 1WR6A 2K5BB 3I9YA 2CRBA 2IAKA 2DWKA 3OKQA 3RIUC 4LMLA 2KZ7B 3KVAA 3LBXA 3IA3A 4EB6E 5LGUB 1KEYA 2ES0A 4ILAA 2KINB 4U31A 4ZEYA 4WZXA 5JREA 3Q5XA 4UF0A 5FYMA 3AEBA 1FMVA 3ZEFB 5KX5E 1VOMA 1QSDA 4DR7T 4TUYE 1Y01A 2VK9A 3UFGA 2V5CA 5JDMA 1HNXT 2K9AA 1KNPA 1IBKT 2BVLA 4UELA 5LG4A 2I59A 3B5MA 2KXPB 3MACA 3N9QA 3P8CD 4AIUA 3UU4A 4UF0B 3KV9A 1YW0A 4PK6A 2B1EA 4EIWA 3O1IA 1L0VA 5HXHA 4HWCA 4YLHA 5AQNB 4DV0T 1XWMA 2JQHA 2LT3A 1HX1B 3FXEB 3TLUA 4YTNA 4HWFA 2YU1A 5HEJA 3PJAJ 2XQ9A 4MHCA 5JDGA 1IJ6A 1CUNA 3U78A 4DBRA 3UUBA 3SFDA 3CQCB 2XHEB 3FZFB 2WZIA 4JEHB 4WBOA 2NW9A 4EYUA 2VQFT 4H9QC 2YOEA 4ILCA 3EI0A 4CXXA 1HG2A 3RC8A 1LVKA 2PTFA 2VL8A 3FZMB 5JDLA 1MIYA 5LA6E 1OEDE 2CXLA 2H3RA 2K24A 4DR5T 2H88A 4JI4T 4JV5T 4COFA 3UQ7A 2LSJA 2M6IA 3WAJA 5AQHB 3IBPA 1UCUA 3AA0B 2WS3A 4HE8A 4UV8B 5F5WA 5L4HA 5LJNA 1W09A 1N34T 2Q9QB 3BK9A 3LK42 4LMKA 3N2OA 1HCIA 2B76A 3EDVA 2BG9A 5L47A 2J62A 5FMNA 2X9YA 3RKGA 2UUAT 4JI8T 4GYSA 2C5JA 5LXTE 4IDPA 4I43B 1B7TA 3TLWA 2IC9A 4A98A 4EYYR 5LGTB 1YKHB 4AQFA 2ZM2A 5FY1A 4DVDA 1Z8UA 5L3CB 4YJ2E 4PFOA 1XMQT 3M65A 3JAEA 5BR8T 3LJCA 1BR0A 5FXWA 3PJAA 4YSXA 3AVSA 3CVRA 5AQMB 3SWHA 3AAAB 4ZOLE 3ZKRA 2KWHA 3CX7B 2XQ3A 2GK9A 3ZN0B 2LKGA 3ANWA 3PUAA 4H9SE 3WAKA 4YHHT 2DI4A 1NAFA 5AQFB 4IDNA 5JR9A 1YQ4A 4X66T 3HI2A 2XQAA 4L5GA 4GIWA 4O8SA 2E5VA 3K1SA 5AQPB 5HCMA 2W66A 4JBWF 3T1YT 3LG7A 4PFPA 5AQRB 2WDRA 3SRZA 4X5TA 5DABA 4DMVA 2QRXA 4DR1T 1SA0E 2FJDA 4UR9A 2D0UA 2XM1A 5HXSA 4ILUA 1UGOA 4NUVA 1UUSA 2XZEA 3OPCA 1BR4A 3H37A 5HYAA 5LG3A 1I6ZA 3PUXF 2IUBA 2QVAA 3NKZA 2HN2A 4MALA 3RHWA 4OYKA 1S35A 4X1IE 3TLSA 4C90A 4CN4A 2WWVA 4YY3T 3Q5DA 4LF5T 5AQIB 5CA0E 4ZHQE 3L39A 1WR0A 2FJEA 2BZBA 4TWDA 4AXPA 3ZC1A 4ANJA 2LLYA 2E2AA 2WQYA 3JC6D 3VR8A 2M67A 3RH3A 2WSSV 3C51A 3MZKB 2UXNB 1D0XA 1N32T 2ZM8A 4MFRA 2C5KT 4IHJE 2V6YB 2NW7A 4UVCB 2WU2A 5FY0A 3T1HT 4DV1T 4QH4A 4AKIA 1FMWA 2NTXA 4IT4A 3O4XE 3S4UA 2XUEA 2I6HA 5JVDE 2LSKA 4KI0F 3UTKA 4AQFC 3PUZF 4B3TT 3QOFA 3KVBA 5JQGE 5L3EB 2PFVA 2IMLA 2XPKA 2X9XA 4NXMT 4LMJA 4A5XA 3UFEA 3N2GE 2UUCT 2N1GA 4X20E 2V7MA 2KT9A 3AE2A 3CPZA 3N9MA 3OYXA 2UXXB 3P4PA 4IE0A 3UT5E 2XJ7A 1YD8G 3EHZA 4ISTA 2XM2A 3U3IA 4X65T 2ZM6T 4IE5A 3NVOA 2CPTA 4EV6A 3BQLA 2FUPA 5LGNB 4LFCT 3MJXA 2V1DB 2QGSA 4P09A 1U5PA 2VKHA 2ZLYA 4QH5A 4U72A 3ZYKA 1OEDB 2EHOA 2Q9QA 2NW8A 2WWUA 3FBZA 3MA9A 4JI3T 3RYCE 4OFZA 2Y8DA 4NUUA 3AA7B 3ETUA 5EK2A 1BR1A 5AQVB 5FVKA 3EUHA 2E9XA 3X1DA 1DU2A 1KF6A 4H9RC 4HN9A 4HWDA 5AQSB 3HL6A 4EXTA 5L3DB 4JI7T 4LF4T 2SPCA 5JR9C 3RYFE 2KNDA 1NEKA 4U3CA 5AQQB 1XNQT 1D1CA 4HFEA 4KUMB 3OTOT 3PE0A 3JC6C 1IAPA 3VRAA 1OWAA 3P4QA 4B6XA 4CI2B 3RC3A 3RIFA 3T8OA 2QYWA 5CGMA 1Z0PA 1E7PA 2LEHA 3ZJ2A 3AE5A 2A3DA 3I0QA 3EVYA 5JDQA 2LSYA 3RKOA 3GWHA 5LHGB 3HKEE 1UX5A 2YU2A 1US7B 2NWBA 2XSBA 3CKDA 2CE7A 2VKJA 4GOUA 4PJJA 5IYZE 2IDOB 4ZS3A 2LRKA 4YFSA 4DV7T 1N33T 2NR4A 3PUVF 3CIRA 2L9QA 4QXHB 3VR9A 5KXJA 5J2TE 2WBLA 1WYBA 2OA5A 2CWYA 3UUNA 2G0UA 2E5LT 3AAIA 4Z8XA 3LDQB 3ZMZB 4JYAT 3C4WA 3PTRB 4A56A 2WAUA 4IE4A 5HEUA 3N9LA 2C0SA 4WW0A 3K3OA 3FZHB 4Z90A 3ZLIA 5F3JA 3LFMA 2D2SA 4KHZF 4OYJA 1QUUA 4YXDA 5F8PA 3TLTA 3ZMUB 4DR3T 2ZMAA 2W61A 5JH7E 5FKYA 2BVMA 2VVSA 1T98A 4QX8B 5FXXA 3EAMA 1NWMX 4O4HE 4LF9T 4HGAA 2XQ5A 4AKLA 4YSZA 1W0BA 5CFBA 3RIAA 2JQQA 2V6YA 5LP6E 3PUQA 2YK0A 4OHFA 4TNVA 2BS4A 3AE9A 2UXCT 4GKKT 2YN6A 2V8SV 3EABA 5EK3A 5L2LA 4AI6A 2VWAA 1VRBA 4Q25A 5ABFA 1D1AA 3PDYA 3Q5WA 2M6BA 4CXWA 3P4WA 2BDEA 4BAYB 4EGWA 5C3JA 1J5ET 4OK0A 2A9UA 2V6XA 4TWFA 4HFBA 4I0UA 4ZI2D 3C4XA 5ABFB 4P0AA 2IW5B 1WLXA 4JI1T 2BG9B 4IDQA 4ZI3D 5DQVA 4EEDA 3ZMSB 3NBXX 2CHOA 2KLQA 2W63A 2XAFB 1XDOA 3Q5EA 4M1PA 4DR2T 2NP9A 2X51A 3QB5K 3IHRA 2DNXA 1IBMT 2X66A 3AXJA 4ZS2A 4ASKA 4DNDA 5JTGA 2FJAA 5LNKA 4HFIA 4CN1A 2ACZA 4DR4T 4AISA 4AQGA 4KHPT 4EEBA 1M62A 1MNEA 4PJNA 4H63H 2BG9C 1Y64B 2BBHA 2JPFA 4U2YA 3AE8A 4XAXB 3ZT7A 3PUWF 4GYRA 1T8BA 2CXDA 5L3FB 2UU9T 2IIUA 2J1DG 4PK4A 4L9IA 2N2NA 4I4TE 3M3ZB 2KSRA 5DJQC 3I0OA 2FJBA 2CHNA 5IUXA 3O9XA 4CQIA 3F2EA 2R6GF 5CJ5A 3AAEB 1T7SA 4E7ZA 3TLVA 3GMIA 1GQEA 2AXDS 2HN1A 4IL9A 3ZT6A 3IF8B 5H6RB 2W2UA 4X64T 1MMDA 1MMNA 1WCRA 1ZP0A 2BS2A 2XQ7A 2DLRA 4TWHA 4UV9B 4DV3T 4JI5T 3LK3B 3B57A 5DQWA 5EK4A 3UU3A 4F8HA 1NENA 5LCYA 2WMNA 1IJ5A 2L8KA 4H9NC 2X67A 1HX8A 4ZI2C 2WP9A 2KWIB 5IWAT 2WY2A 4KX6A 3CMLA 2ODVA 2OLTA 2CMRA 1FEWA 4TNWA 5LYJE 2LOPA 2LSIA 1FIOA 1S94A 3HKBE 3IEEA 4IGUA 5HWYA 2YINA 4K0UA 2MAWA 2YDQA 2XQ8A 2NTYA 3UUMA 1HNWT 1T72A 2EHOB 4MLKA 1LVFA 3TKLB 4TX5A 3KV5A 3MXZA 5JRCA 4X1KE 5H6QB 1G8XA 1XMOT 3GN5A 2Y6XA 3OVUA 4PK5A 1EZ3A 3K3NA 2MOZA 3OYZA 4PAGA 3V5UA 2BG9E 5AQGB 2XAJB 3ESLA 4Z91A 5JR9B 2V7LA 3WI3A 4B3RT 2X0HA 3AE3A 2CBIA 2EHOC 3C4ZA 4JEUB 5ABEA 4JI0T 4LF7T 1OEDA 2LM9A 5HWXA 3J7Yq 4ISSA 3RQWA 4K0KT 2JMKA 2E9XC 5J0ZA 2DWGA 4E7SA 3Q2MA 3UU5A 1J1JA 4AKRB 3F57A 3CX6B 2Q9QC 4LF8T 3RYIE 5AFUL 3A5XA 3CK6A 3RGLA 1KNZA 4P0BA 3J9X1 4O4IE 3KDSE 3I1AA 5HEHA 3RYHE 2DL1A 2BKNA 2YDRA 2PJQA 3A7MA 3I9WA 2UUBT 5BMVE 2A72A 2RP4A 2HH7A 2XQ4A 1X79A 3AE6A 2IHR1 3AE1A 3UULA 2ZM0A 4U7YA 3RQUA 1QLBA 3LK2B 4HFVA 5HXRA 3V5SA 2KMFA 2V7JA 4NIQA 4ERRA 2I0MA 3R6NA 3ZYLA 5TAOA 5J2UE 3ZN1B 4KBMB 4I55E 3NRXA 2JQ9A 3N9PA 2Y48B 4HFCA 3DP7A 2W67A 2X68A 5LHHB 2MBGA 5E0OA 4O2BE 3NZQA 2XQYA 3FXDB 4YT0A 1MMGA 4GK5E 4B3ST 5FP3A 4EOZB 3NZPA 2WDQA 1IZNB 2ACXA 2D9DA 3SFEA 2VQET 4YJ3E 4V1Av 2X9HA 5L4EA 3ZCJA 3JCFA 2E9XB 2VASA 5FXVA 5EZYE 2VURA 4C91A 1R8IA 1HF8A 4DR6T 5ABGA 4DUYT 2E9XD 5KDMC 1AJ3A 5FVLA 1BR2A 2IC6A 2NOXA 2W4XA 4HEAA 1N36T 1D0ZA 3AEEA 4JLEA 4DMWA 2Q9QD 3L3PA 4A97A 2QA7A 3RI5A 3AECA 3C64A 2VL0A 2W0GA 3O1JA 3ZSTA 1D0YA 3AE7A 2L3LA 1YKEB 3AE4A 3PURA 3ZSSA 2HHHT 3P4RA 3AEAA 2PBIA 4JI6T 2WZHA 2BKOA 1JNZA 4P1NA 4EAHA 1XNRT 5LOVE 1J5WA 5L3BB 4OX9T 3EDUA 1HNZT 2BKPA 2VKDA 4ZZCA 5IHYA 4IIJE 3P7IA 4LF6T 3QB5A 2JQKA 1JNRA 1UX4A 3FZKB 3ZC0A 5AQJB 5HEOA 4CI3B 3L8RA 1HG5A 3RRCA 1LKXA 4UVBB 3SOLA 2YEVC 3UQ4A 1HR0T 2JJ9A 2V5DA 4IDZA 3ZMVB 3HR0A 4DIDB 4NXNT 5ABHA 2JIWA 3UUXB 2XAQB 2XTLA 4JUYA 4G63A 4U33A 3ZYMA 1MIWA 3DJBA 3GA8A 4YTMA 4ZI3C 2WCAA 4L0RA 2YKSA 1I94T 1UK5A 1VCSA 5LBMA 3UU6A 3QNUA 1MNDA 3FHNA 3HKCE 1W0AA 3JAFA 4YSYA 3CWZB 1SHZC 4YTPA 3QUJA 1HS7A 3FZLB 2WB5A 2X0LB 3N9NA 5AQLB 4IREA 2FBWA 5HXEA 5LMUT 5FY7A 2A2FX 3ZPOA 4FJOA 2P9BA 2V7IA 3BQIA 3MKDA 1W9RA 3ONJA 4DBQA 5ADXL 5LB7B 3QK6A 2CLYC 5M4YA 2LRLA 2N9DA 3P50A 3PUSA 5FXZA 1VCTA 2HPJA 2K48A 1IBLT 3PUGA 4HWHA 1V9DA 4IDOA 4ZXLA 3RX6A 5AQUB 2XQ6A 4DV6T 4X1YE 2WM9A 3ABVA 3D0TA 3LSVA 4O4JE 4J2CA 2EHOD 5HAXA 2MTQA 3F31A 5A1LA 3KBUA 1UURA 4N78D 3CX8B 4TV8E 5LHIB 3W15B 2WU5A 2J47A 5C8YE 4WYVA 4TN7B 1MIVA 2LOSA 2XSAA 2V26A 4IE7A 3LBXB 2H7VC 4TV9E 2XY8B 5FL0A 2F4VT 2CLYB 2CXFA 3FB2A 1SUMB 1HFAA 1ZKEA 3NWIA 4ILBA 3UU8A 3A8YC 2DHRA 4EZHA 3KFWX 2LJLA 2VVNA 4ZI7E 4AKHA 2LKHA 3VKHA 3VU7H 5J1GA 2PG8A 2WMOA 1YXRA 2LE8A 4HFDA 4QXCB 3HA4A 3RPUA 1CHUA 4B3MT 1ZV4X 2H89A 4YHJA 5JDNA 3C98B 4QXBB 3ANWB 3KV6A 3QC9A 2CA5A 4I50E 5CB4E 5AQOB 3NRYA 4F6RC 3AXJB 3H3AA 2BS3A 2XAHB 4HFHA 1O3XA 4HTEA 5C2TA 3E22E 2X0YA 3DTOA 4DV2T 2YDSA 4U74A 2DCFA 2JRKA 4AKGA 1KFYA 3RRWA 3L09A 3ZT5A 2JMHA 3AA6B 1M7KA 2MPKA 4HWIB 3SS1A 4KMCA 5GONE 3C50A 5AQTB 4IL4A 3GN5B 4HKAA 1ZEEA 4KP3C 4PJLA 4UEMA 3RIUA 4CXYA 4AQYT 1FJGT 4XBFB 3E08A 1WFDA 4DO0A 3PU8A 3KV4A 4PJMA 2OV9A 5AQKB 4DV5T 4CI1B 3ETVA 3AEGA 2K3WA 4JI2T 4EZ4A 2CWOA 1D1BA 3B13A 3G06A 1WYCA 2D0TA 4UXNB 2XASB 1H7CA 2D5UA 2W62A 3PUYF 5FNVE 3RLFF 4BJNA 5JDHA 2UXDT 1OEDC 2LHNA 3FBLA 4UIGA 2CEAA 1YQ3A 5HEGA 5CA1E 3CQGB 2H7OA 2LSGA 4QX7B 4ADZA 5JDFA 1WRDA 4FI5A 1ZHCA 2ODUA 3AA1B 3AEFA 3ONXA 4U2ZA 2E8IA 4ZZBA 3O1HA 3PV0F 4LFAT 4U7IA 5LJMA 3AEDA
chains in the Genus database with same CATH topology
3K3QC 2RA1A 4O2AE 5HXCA 2VB6A 3CQXC 2XAGB 3KINB 5ETWA 4QKNA 2V7KA 3Q9DA 4MBQA 4QWNB 4IE6A 2VKOA 4PNIA 3MK7C 4QHOA 3ZCIA 4O4LE 3AVRA 3KBTA 3OBVE 4BA9A 4WBNE 4GK0E 3VKGA 4CZZB 1KK7A 1MMAA 4H63V 3ZJ1A 3VHLA 3E0ZA 4H9PC 4UVAB 4H9OC 3N5LA 2C5IT 2Z6EA 1HTJF 4PW8A 2CCQA 4BJMA 3AB3B 4WNKA 2LHRA 3N9OA 3OJAA 1LRZA 3HKDE 3ZMTB 3BQKA 3PU3A 1U4QA 4G2AA 2HPLA 5L3GB 5KMGP 1E1HB 1OXZA 3K8PC 1G73A 4XZCA 2CM0A 2W00A 3R84B 5JRCB 2MYSA 5LBQB 2X9WA 4TZ4C 3N2KE 1WR6A 2K5BB 3I9YA 2IAKA 2DWKA 3OKQA 2KZ7B 3KVAA 3LBXA 5LGUB 4EB6E 2ES0A 2KINB 5JREA 3Q5XA 4UF0A 5FYMA 1FMVA 3ZEFB 5KX5E 1VOMA 1QSDA 4TUYE 2VK9A 5JDMA 2K9AA 2BVLA 4UELA 5LG4A 2I59A 3N9QA 2KXPB 3MACA 3P8CD 4UF0B 3KV9A 1YW0A 4PK6A 2B1EA 4EIWA 3O1IA 5HXHA 4YLHA 2LT3A 3FXEB 2YU1A 4MHCA 5JDGA 1IJ6A 1CUNA 3U78A 4DBRA 3CQCB 2XHEB 4JEHB 4WBOA 2NW9A 4EYUA 4H9QC 4CXXA 1HG2A 3RC8A 1LVKA 5JDLA 2VL8A 1MIYA 5LA6E 2CXLA 2H3RA 2K24A 2LSJA 3WAJA 5LJNA 3IBPA 1UCUA 3AA0B 4HE8A 4UV8B 2Q9QB 3BK9A 3LK42 3N2OA 1HCIA 3EDVA 5FMNA 2X9YA 4GYSA 2C5JA 5LXTE 4I43B 1B7TA 2IC9A 5LGTB 4EYYR 1YKHB 4AQFA 2ZM2A 5FY1A 4DVDA 5L3CB 4YJ2E 4PFOA 3M65A 3LJCA 1BR0A 5FXWA 3AVSA 3CVRA 3SWHA 3AAAB 4ZOLE 2KWHA 3CX7B 2GK9A 3ZN0B 3ANWA 3WAKA 3PUAA 4H9SE 2DI4A 1NAFA 5JR9A 3HI2A 4L5GA 4O8SA 4GIWA 3LG7A 4PFPA 3SRZA 5DABA 4DMVA 1SA0E 2D0UA 5HXSA 4ILUA 4NUVA 1BR4A 3H37A 5HYAA 4MALA 4C90A 4OYKA 1S35A 4X1IE 5CA0E 4ZHQE 2BZBA 4AXPA 3ZC1A 4ANJA 3JC6D 2M67A 3RH3A 2WSSV 3C51A 3MZKB 2UXNB 1D0XA 2ZM8A 4MFRA 2C5KT 4IHJE 2NW7A 4UVCB 5FY0A 4AKIA 1FMWA 2NTXA 3O4XE 3S4UA 2XUEA 5JVDE 2LSKA 3UTKA 4AQFC 3KVBA 5JQGE 5L3EB 2PFVA 2X9XA 3UFEA 3N2GE 2N1GA 4X20E 2V7MA 2KT9A 3N9MA 3CPZA 3OYXA 3U3IA 2UXXB 4IE0A 3UT5E 4ISTA 1YD8G 4IE5A 5LGNB 3BQLA 3MJXA 2V1DB 2QGSA 4P09A 1U5PA 2VKHA 2ZLYA 4U72A 3ZYKA 5JR9C 2EHOA 2Q9QA 2NW8A 2WWUA 3FBZA 3MA9A 3RYCE 4OFZA 2Y8DA 4NUUA 3AA7B 3ETUA 5EK2A 1BR1A 3EUHA 2E9XA 4H9RC 4HN9A 5L3DB 3HL6A 4EXTA 2SPCA 3RYFE 2KNDA 1D1CA 4KUMB 3PE0A 3JC6C 1IAPA 4CI2B 1OWAA 4B6XA 3RC3A 3T8OA 1Z0PA 2LEHA 3ZJ2A 2A3DA 3I0QA 3EVYA 5JDQA 2LSYA 3RKOA 3GWHA 5LHGB 3HKEE 1UX5A 2YU2A 1US7B 2NWBA 3CKDA 4GOUA 2CE7A 2VKJA 4PJJA 5IYZE 4ZS3A 4YFSA 5J2TE 2L9QA 4QXHB 2WBLA 1WYBA 2OA5A 2CWYA 3UUNA 2G0UA 3AAIA 4Z8XA 3ZMZB 3C4WA 3PTRB 4A56A 2WAUA 4IE4A 3N9LA 2C0SA 4WW0A 3K3OA 5F3JA 3ZLIA 3LFMA 2D2SA 4OYJA 1QUUA 5F8PA 3ZMUB 2ZMAA 2W61A 5JH7E 2BVMA 1T98A 4QX8B 5FXXA 1NWMX 4O4HE 4HGAA 4AKLA 5LP6E 2JQQA 3PUQA 2YK0A 4OHFA 4AI6A 5L2LA 5EK3A 2VWAA 1VRBA 1D1AA 3PDYA 3Q5WA 4CXWA 2BDEA 4BAYB 4OK0A 4ZI2D 3C4XA 4P0AA 2IW5B 1WLXA 4ZI3D 5DQVA 4AKHA 3ZMSB 3NBXX 4M1PA 2KLQA 2W63A 2XAFB 2NP9A 2X51A 3IHRA 2DNXA 2X66A 4ASKA 4ZS2A 4DNDA 5LNKA 4AQGA 1MNEA 4PJNA 4H63H 1Y64B 2JPFA 4XAXB 5L3FB 4GYRA 2CXDA 2J1DG 4PK4A 4L9IA 2N2NA 4I4TE 5DJQC 3I0OA 3O9XA 4CQIA 3F2EA 3AAEB 4E7ZA 3GMIA 3IF8B 5H6RB 1MMDA 1MMNA 2DLRA 4UV9B 3LK3B 3B57A 5DQWA 5EK4A 5LCYA 2WMNA 1IJ5A 2L8KA 4H9NC 2X67A 1HX8A 4ZI2C 2KWIB 3CMLA 2ODVA 2CMRA 1FEWA 5LYJE 2LOPA 2LSIA 1FIOA 1S94A 3HKBE 3IEEA 4IGUA 5HWYA 2YINA 4K0UA 3UUMA 2NTYA 2EHOB 4MLKA 1LVFA 3TKLB 4TX5A 3KV5A 3MXZA 5JRCA 4X1KE 5H6QB 1G8XA 3GN5A 2Y6XA 4PK5A 1EZ3A 3K3NA 2MOZA 3OYZA 4PAGA 3V5UA 2XAJB 3ESLA 5JR9B 2V7LA 3WI3A 2EHOC 3C4ZA 4JEUB 2LM9A 5HWXA 3J7Yq 4ISSA 2JMKA 2E9XC 2DWGA 4E7SA 3Q2MA 4AKRB 3F57A 3CX6B 2Q9QC 5AFUL 3RYIE 3A5XA 1KNZA 4P0BA 3J9X1 4O4IE 3KDSE 3I1AA 3RYHE 3I9WA 2PJQA 5BMVE 2A72A 2RP4A 2HH7A 3UULA 1X79A 2ZM0A 3V5SA 3LK2B 4HFVA 5HXRA 4ERRA 2KMFA 2V7JA 5J2UE 3R6NA 3ZYLA 5TAOA 3ZN1B 4KBMB 4I55E 3NRXA 3N9PA 2Y48B 3DP7A 2X68A 5LHHB 2MBGA 5E0OA 4O2BE 3NZQA 2XQYA 3FXDB 1MMGA 4GK5E 5FP3A 4EOZB 3NZPA 1IZNB 2ACXA 4YJ3E 4V1Av 2X9HA 3ZCJA 2E9XB 2VASA 5FXVA 5EZYE 4C91A 1HF8A 2E9XD 5KDMC 1AJ3A 1BR2A 2IC6A 2NOXA 4HEAA 1D0ZA 4JLEA 4DMWA 2Q9QD 3L3PA 2QA7A 3C64A 2W0GA 3O1JA 1D0YA 2L3LA 1YKEB 3PURA 2PBIA 4EAHA 5LOVE 5L3BB 3EDUA 2VKDA 5IHYA 4IIJE 3P7IA 1UX4A 3ZC0A 4CI3B 1HG5A 3RRCA 1LKXA 4UVBB 3SOLA 2YEVC 2JJ9A 4IDZA 3ZMVB 3HR0A 3UUXB 2XAQB 2XTLA 4JUYA 4G63A 3ZYMA 1MIWA 3DJBA 3GA8A 4ZI3C 4L0RA 1MNDA 3FHNA 3HKCE 3CWZB 1SHZC 1HS7A 3QUJA 2X0LB 3N9NA 5HXEA 5FY7A 2A2FX 3ZPOA 4FJOA 2P9BA 2V7IA 3BQIA 3MKDA 4DBQA 5ADXL 3QK6A 2CLYC 5M4YA 2N9DA 5FXZA 3PUSA 2HPJA 2K48A 3PUGA 1V9DA 3RX6A 4X1YE 2WM9A 3D0TA 4O4JE 5HAXA 4J2CA 2EHOD 2MTQA 3F31A 5A1LA 3KBUA 4N78D 4TV8E 3CX8B 5LHIB 3W15B 5C8YE 4TN7B 1MIVA 2LOSA 4IE7A 2V26A 4TV9E 3LBXB 2H7VC 5LBMA 2CLYB 2CXFA 3FB2A 1ZKEA 1HFAA 2DHRA 4EZHA 3KFWX 2LJLA 4ZI7E 3VKHA 3VU7H 5J1GA 2PG8A 2WMOA 2LE8A 4QXCB 3HA4A 3RPUA 1ZV4X 4YHJA 5JDNA 3C98B 4QXBB 3ANWB 3KV6A 3QC9A 2CA5A 4I50E 5CB4E 3NRYA 4F6RC 3H3AA 2XAHB 1O3XA 4HTEA 3E22E 3DTOA 4U74A 4AKGA 2DCFA 2JRKA 3RRWA 3L09A 2JMHA 3AA6B 3SS1A 4KMCA 5GONE 3C50A 3GN5B 4HKAA 1ZEEA 4KP3C 4PJLA 4UEMA 4CXYA 4XBFB 3E08A 4DO0A 3PU8A 3KV4A 4PJMA 4CI1B 3ETVA 4EZ4A 2CWOA 1D1BA 3B13A 4UXNB 1WYCA 2D0TA 2XASB 1H7CA 2D5UA 2W62A 5JDHA 5FNVE 4BJNA 2LHNA 3FBLA 4UIGA 2CEAA 5CA1E 3CQGB 2H7OA 2LSGA 4QX7B 4ADZA 5JDFA 1WRDA 4FI5A 1ZHCA 2ODUA 3AA1B 3ONXA 2E8IA 3O1HA 5LJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I59 A;  2DLR A;  3C50 A;  1SHZ C;  3C4Z A;  2PBI A;  1IAP A;  3T8O A;  4PNI A;  1ZV4 X;  4YHJ A;  2ACX A;  3QC9 A;  4WBO A;  4IGU A;  3CX6 B;  4GOU A;  4L9I A;  2ES0 A;  3CX7 B;  2A72 A;  1HTJ F;  3CX8 B;  3AB3 B;  3C4W A;  3C4X A;  4WNK A;  3C51 A; 
#chains in the Genus database with same CATH topology
 3K3Q C;  2RA1 A;  4O2A E;  2J4G A;  5HXC A;  2VB6 A;  3CQX C;  1E2A A;  2XAG B;  3KIN B;  5HCJ A;  5ETW A;  1KNR A;  4QKN A;  2V7K A;  3Q9D A;  2UXB T;  4MBQ A;  4QWN B;  3RF1 A;  4IE6 A;  2VKO A;  4PNI A;  3MK7 C;  4QHO A;  3VRB A;  3ZCI A;  4O4L E;  3AVR A;  3KBT A;  3JAD A;  3OBV E;  4BA9 A;  4GK0 E;  4WBN E;  3VKG A;  3ONL C;  4CZZ B;  1KK7 A;  1MMA A;  2LM2 A;  4H63 V;  3ZJ1 A;  1X9B A;  3E0Z A;  4NPP A;  3VHL A;  1XDP A;  4H9P C;  4DUZ T;  4UVA B;  4GKJ T;  2CBJ A;  4H9O C;  3N5L A;  2C5I T;  2Z6E A;  1HTJ F;  2BBJ A;  4PW8 A;  2CCQ A;  4QH1 A;  3AB3 B;  4WNK A;  4BJM A;  2LHR A;  2WDV A;  3H3M A;  1LRZ A;  3HKD E;  3N9O A;  2AE9 A;  3BQK A;  3OJA A;  3PU3 A;  3ZMT B;  1U4Q A;  4G2A A;  2HPL A;  5L3G B;  5KMG P;  1E1H B;  4LFB T;  4DV4 T;  1OXZ A;  3K8P C;  1G73 A;  4XZC A;  2CM0 A;  2W00 A;  5LMN T;  1SE7 A;  2RPA A;  5FL1 A;  3R84 B;  4CN6 A;  5JRC B;  1ZOY A;  3P4S A;  2MYS A;  5LBQ B;  1XZY A;  2X9W A;  4X62 T;  4TZ4 C;  3N2K E;  1WR6 A;  2K5B B;  3I9Y A;  2CRB A;  2IAK A;  2DWK A;  3OKQ A;  3RIU C;  4LML A;  2KZ7 B;  3KVA A;  3LBX A;  3IA3 A;  4EB6 E;  5LGU B;  1KEY A;  2ES0 A;  4ILA A;  2KIN B;  4U31 A;  4ZEY A;  4WZX A;  5JRE A;  3Q5X A;  4UF0 A;  5FYM A;  3AEB A;  1FMV A;  3ZEF B;  5KX5 E;  1VOM A;  1QSD A;  4DR7 T;  4TUY E;  1Y01 A;  2VK9 A;  3UFG A;  2V5C A;  5JDM A;  1HNX T;  2K9A A;  1KNP A;  1IBK T;  2BVL A;  4UEL A;  5LG4 A;  2I59 A;  3B5M A;  2KXP B;  3MAC A;  3N9Q A;  3P8C D;  4AIU A;  3UU4 A;  4UF0 B;  3KV9 A;  1YW0 A;  4PK6 A;  2B1E A;  4EIW A;  3O1I A;  1L0V A;  5HXH A;  4HWC A;  4YLH A;  5AQN B;  4DV0 T;  1XWM A;  2JQH A;  2LT3 A;  1HX1 B;  3FXE B;  3TLU A;  4YTN A;  4HWF A;  2YU1 A;  5HEJ A;  3PJA J;  2XQ9 A;  4MHC A;  5JDG A;  1IJ6 A;  1CUN A;  3U78 A;  4DBR A;  3UUB A;  3SFD A;  3CQC B;  2XHE B;  3FZF B;  2WZI A;  4JEH B;  4WBO A;  2NW9 A;  4EYU A;  2VQF T;  4H9Q C;  2YOE A;  4ILC A;  3EI0 A;  4CXX A;  1HG2 A;  3RC8 A;  1LVK A;  2PTF A;  2VL8 A;  3FZM B;  5JDL A;  1MIY A;  5LA6 E;  1OED E;  2CXL A;  2H3R A;  2K24 A;  4DR5 T;  2H88 A;  4JI4 T;  4JV5 T;  4COF A;  3UQ7 A;  2LSJ A;  2M6I A;  3WAJ A;  5AQH B;  3IBP A;  1UCU A;  3AA0 B;  2WS3 A;  4HE8 A;  4UV8 B;  5F5W A;  5L4H A;  5LJN A;  1W09 A;  1N34 T;  2Q9Q B;  3BK9 A;  3LK4 2;  4LMK A;  3N2O A;  1HCI A;  2B76 A;  3EDV A;  2BG9 A;  5L47 A;  2J62 A;  5FMN A;  2X9Y A;  3RKG A;  2UUA T;  4JI8 T;  4GYS A;  2C5J A;  5LXT E;  4IDP A;  4I43 B;  1B7T A;  3TLW A;  2IC9 A;  4A98 A;  4EYY R;  5LGT B;  1YKH B;  4AQF A;  2ZM2 A;  5FY1 A;  4DVD A;  1Z8U A;  5L3C B;  4YJ2 E;  4PFO A;  1XMQ T;  3M65 A;  3JAE A;  5BR8 T;  3LJC A;  1BR0 A;  5FXW A;  3PJA A;  4YSX A;  3AVS A;  3CVR A;  5AQM B;  3SWH A;  3AAA B;  4ZOL E;  3ZKR A;  2KWH A;  3CX7 B;  2XQ3 A;  2GK9 A;  3ZN0 B;  2LKG A;  3ANW A;  3PUA A;  4H9S E;  3WAK A;  4YHH T;  2DI4 A;  1NAF A;  5AQF B;  4IDN A;  5JR9 A;  1YQ4 A;  4X66 T;  3HI2 A;  2XQA A;  4L5G A;  4GIW A;  4O8S A;  2E5V A;  3K1S A;  5AQP B;  5HCM A;  2W66 A;  4JBW F;  3T1Y T;  3LG7 A;  4PFP A;  5AQR B;  2WDR A;  3SRZ A;  4X5T A;  5DAB A;  4DMV A;  2QRX A;  4DR1 T;  1SA0 E;  2FJD A;  4UR9 A;  2D0U A;  2XM1 A;  5HXS A;  4ILU A;  1UGO A;  4NUV A;  1UUS A;  2XZE A;  3OPC A;  1BR4 A;  3H37 A;  5HYA A;  5LG3 A;  1I6Z A;  3PUX F;  2IUB A;  2QVA A;  3NKZ A;  2HN2 A;  4MAL A;  3RHW A;  4OYK A;  1S35 A;  4X1I E;  3TLS A;  4C90 A;  4CN4 A;  2WWV A;  4YY3 T;  3Q5D A;  4LF5 T;  5AQI B;  5CA0 E;  4ZHQ E;  3L39 A;  1WR0 A;  2FJE A;  2BZB A;  4TWD A;  4AXP A;  3ZC1 A;  4ANJ A;  2LLY A;  2E2A A;  2WQY A;  3JC6 D;  3VR8 A;  2M67 A;  3RH3 A;  2WSS V;  3C51 A;  3MZK B;  2UXN B;  1D0X A;  1N32 T;  2ZM8 A;  4MFR A;  2C5K T;  4IHJ E;  2V6Y B;  2NW7 A;  4UVC B;  2WU2 A;  5FY0 A;  3T1H T;  4DV1 T;  4QH4 A;  4AKI A;  1FMW A;  2NTX A;  4IT4 A;  3O4X E;  3S4U A;  2XUE A;  2I6H A;  5JVD E;  2LSK A;  4KI0 F;  3UTK A;  4AQF C;  3PUZ F;  4B3T T;  3QOF A;  3KVB A;  5JQG E;  5L3E B;  2PFV A;  2IML A;  2XPK A;  2X9X A;  4NXM T;  4LMJ A;  4A5X A;  3UFE A;  3N2G E;  2UUC T;  2N1G A;  4X20 E;  2V7M A;  2KT9 A;  3AE2 A;  3CPZ A;  3N9M A;  3OYX A;  2UXX B;  3P4P A;  4IE0 A;  3UT5 E;  2XJ7 A;  1YD8 G;  3EHZ A;  4IST A;  2XM2 A;  3U3I A;  4X65 T;  2ZM6 T;  4IE5 A;  3NVO A;  2CPT A;  4EV6 A;  3BQL A;  2FUP A;  5LGN B;  4LFC T;  3MJX A;  2V1D B;  2QGS A;  4P09 A;  1U5P A;  2VKH A;  2ZLY A;  4QH5 A;  4U72 A;  3ZYK A;  1OED B;  2EHO A;  2Q9Q A;  2NW8 A;  2WWU A;  3FBZ A;  3MA9 A;  4JI3 T;  3RYC E;  4OFZ A;  2Y8D A;  4NUU A;  3AA7 B;  3ETU A;  5EK2 A;  1BR1 A;  5AQV B;  5FVK A;  3EUH A;  2E9X A;  3X1D A;  1DU2 A;  1KF6 A;  4H9R C;  4HN9 A;  4HWD A;  5AQS B;  3HL6 A;  4EXT A;  5L3D B;  4JI7 T;  4LF4 T;  2SPC A;  5JR9 C;  3RYF E;  2KND A;  1NEK A;  4U3C A;  5AQQ B;  1XNQ T;  1D1C A;  4HFE A;  4KUM B;  3OTO T;  3PE0 A;  3JC6 C;  1IAP A;  3VRA A;  1OWA A;  3P4Q A;  4B6X A;  4CI2 B;  3RC3 A;  3RIF A;  3T8O A;  2QYW A;  5CGM A;  1Z0P A;  1E7P A;  2LEH A;  3ZJ2 A;  3AE5 A;  2A3D A;  3I0Q A;  3EVY A;  5JDQ A;  2LSY A;  3RKO A;  3GWH A;  5LHG B;  3HKE E;  1UX5 A;  2YU2 A;  1US7 B;  2NWB A;  2XSB A;  3CKD A;  2CE7 A;  2VKJ A;  4GOU A;  4PJJ A;  5IYZ E;  2IDO B;  4ZS3 A;  2LRK A;  4YFS A;  4DV7 T;  1N33 T;  2NR4 A;  3PUV F;  3CIR A;  2L9Q A;  4QXH B;  3VR9 A;  5KXJ A;  5J2T E;  2WBL A;  1WYB A;  2OA5 A;  2CWY A;  3UUN A;  2G0U A;  2E5L T;  3AAI A;  4Z8X A;  3LDQ B;  3ZMZ B;  4JYA T;  3C4W A;  3PTR B;  4A56 A;  2WAU A;  4IE4 A;  5HEU A;  3N9L A;  2C0S A;  4WW0 A;  3K3O A;  3FZH B;  4Z90 A;  3ZLI A;  5F3J A;  3LFM A;  2D2S A;  4KHZ F;  4OYJ A;  1QUU A;  4YXD A;  5F8P A;  3TLT A;  3ZMU B;  4DR3 T;  2ZMA A;  2W61 A;  5JH7 E;  5FKY A;  2BVM A;  2VVS A;  1T98 A;  4QX8 B;  5FXX A;  3EAM A;  1NWM X;  4O4H E;  4LF9 T;  4HGA A;  2XQ5 A;  4AKL A;  4YSZ A;  1W0B A;  5CFB A;  3RIA A;  2JQQ A;  2V6Y A;  5LP6 E;  3PUQ A;  2YK0 A;  4OHF A;  4TNV A;  2BS4 A;  3AE9 A;  2UXC T;  4GKK T;  2YN6 A;  2V8S V;  3EAB A;  5EK3 A;  5L2L A;  4AI6 A;  2VWA A;  1VRB A;  4Q25 A;  5ABF A;  1D1A A;  3PDY A;  3Q5W A;  2M6B A;  4CXW A;  3P4W A;  2BDE A;  4BAY B;  4EGW A;  5C3J A;  1J5E T;  4OK0 A;  2A9U A;  2V6X A;  4TWF A;  4HFB A;  4I0U A;  4ZI2 D;  3C4X A;  5ABF B;  4P0A A;  2IW5 B;  1WLX A;  4JI1 T;  2BG9 B;  4IDQ A;  4ZI3 D;  5DQV A;  4EED A;  3ZMS B;  3NBX X;  2CHO A;  2KLQ A;  2W63 A;  2XAF B;  1XDO A;  3Q5E A;  4M1P A;  4DR2 T;  2NP9 A;  2X51 A;  3QB5 K;  3IHR A;  2DNX A;  1IBM T;  2X66 A;  3AXJ A;  4ZS2 A;  4ASK A;  4DND A;  5JTG A;  2FJA A;  5LNK A;  4HFI A;  4CN1 A;  2ACZ A;  4DR4 T;  4AIS A;  4AQG A;  4KHP T;  4EEB A;  1M62 A;  1MNE A;  4PJN A;  4H63 H;  2BG9 C;  1Y64 B;  2BBH A;  2JPF A;  4U2Y A;  3AE8 A;  4XAX B;  3ZT7 A;  3PUW F;  4GYR A;  1T8B A;  2CXD A;  5L3F B;  2UU9 T;  2IIU A;  2J1D G;  4PK4 A;  4L9I A;  2N2N A;  4I4T E;  3M3Z B;  2KSR A;  5DJQ C;  3I0O A;  2FJB A;  2CHN A;  5IUX A;  3O9X A;  4CQI A;  3F2E A;  2R6G F;  5CJ5 A;  3AAE B;  1T7S A;  4E7Z A;  3TLV A;  3GMI A;  1GQE A;  2AXD S;  2HN1 A;  4IL9 A;  3ZT6 A;  3IF8 B;  5H6R B;  2W2U A;  4X64 T;  1MMD A;  1MMN A;  1WCR A;  1ZP0 A;  2BS2 A;  2XQ7 A;  2DLR A;  4TWH A;  4UV9 B;  4DV3 T;  4JI5 T;  3LK3 B;  3B57 A;  5DQW A;  5EK4 A;  3UU3 A;  4F8H A;  1NEN A;  5LCY A;  2WMN A;  1IJ5 A;  2L8K A;  4H9N C;  2X67 A;  1HX8 A;  4ZI2 C;  2WP9 A;  2KWI B;  5IWA T;  2WY2 A;  4KX6 A;  3CML A;  2ODV A;  2OLT A;  2CMR A;  1FEW A;  4TNW A;  5LYJ E;  2LOP A;  2LSI A;  1FIO A;  1S94 A;  3HKB E;  3IEE A;  4IGU A;  5HWY A;  2YIN A;  4K0U A;  2MAW A;  2YDQ A;  2XQ8 A;  2NTY A;  3UUM A;  1HNW T;  1T72 A;  2EHO B;  4MLK A;  1LVF A;  3TKL B;  4TX5 A;  3KV5 A;  3MXZ A;  5JRC A;  4X1K E;  5H6Q B;  1G8X A;  1XMO T;  3GN5 A;  2Y6X A;  3OVU A;  4PK5 A;  1EZ3 A;  3K3N A;  2MOZ A;  3OYZ A;  4PAG A;  3V5U A;  2BG9 E;  5AQG B;  2XAJ B;  3ESL A;  4Z91 A;  5JR9 B;  2V7L A;  3WI3 A;  4B3R T;  2X0H A;  3AE3 A;  2CBI A;  2EHO C;  3C4Z A;  4JEU B;  5ABE A;  4JI0 T;  4LF7 T;  1OED A;  2LM9 A;  5HWX A;  3J7Y q;  4ISS A;  3RQW A;  4K0K T;  2JMK A;  2E9X C;  5J0Z A;  2DWG A;  4E7S A;  3Q2M A;  3UU5 A;  1J1J A;  4AKR B;  3F57 A;  3CX6 B;  2Q9Q C;  4LF8 T;  3RYI E;  5AFU L;  3A5X A;  3CK6 A;  3RGL A;  1KNZ A;  4P0B A;  3J9X 1;  4O4I E;  3KDS E;  3I1A A;  5HEH A;  3RYH E;  2DL1 A;  2BKN A;  2YDR A;  2PJQ A;  3A7M A;  3I9W A;  2UUB T;  5BMV E;  2A72 A;  2RP4 A;  2HH7 A;  2XQ4 A;  1X79 A;  3AE6 A;  2IHR 1;  3AE1 A;  3UUL A;  2ZM0 A;  4U7Y A;  3RQU A;  1QLB A;  3LK2 B;  4HFV A;  5HXR A;  3V5S A;  2KMF A;  2V7J A;  4NIQ A;  4ERR A;  2I0M A;  3R6N A;  3ZYL A;  5TAO A;  5J2U E;  3ZN1 B;  4KBM B;  4I55 E;  3NRX A;  2JQ9 A;  3N9P A;  2Y48 B;  4HFC A;  3DP7 A;  2W67 A;  2X68 A;  5LHH B;  2MBG A;  5E0O A;  4O2B E;  3NZQ A;  2XQY A;  3FXD B;  4YT0 A;  1MMG A;  4GK5 E;  4B3S T;  5FP3 A;  4EOZ B;  3NZP A;  2WDQ A;  1IZN B;  2ACX A;  2D9D A;  3SFE A;  2VQE T;  4YJ3 E;  4V1A v;  2X9H A;  5L4E A;  3ZCJ A;  3JCF A;  2E9X B;  2VAS A;  5FXV A;  5EZY E;  2VUR A;  4C91 A;  1R8I A;  1HF8 A;  4DR6 T;  5ABG A;  4DUY T;  2E9X D;  5KDM C;  1AJ3 A;  5FVL A;  1BR2 A;  2IC6 A;  2NOX A;  2W4X A;  4HEA A;  1N36 T;  1D0Z A;  3AEE A;  4JLE A;  4DMW A;  2Q9Q D;  3L3P A;  4A97 A;  2QA7 A;  3RI5 A;  3AEC A;  3C64 A;  2VL0 A;  2W0G A;  3O1J A;  3ZST A;  1D0Y A;  3AE7 A;  2L3L A;  1YKE B;  3AE4 A;  3PUR A;  3ZSS A;  2HHH T;  3P4R A;  3AEA A;  2PBI A;  4JI6 T;  2WZH A;  2BKO A;  1JNZ A;  4P1N A;  4EAH A;  1XNR T;  5LOV E;  1J5W A;  5L3B B;  4OX9 T;  3EDU A;  1HNZ T;  2BKP A;  2VKD A;  4ZZC A;  5IHY A;  4IIJ E;  3P7I A;  4LF6 T;  3QB5 A;  2JQK A;  1JNR A;  1UX4 A;  3FZK B;  3ZC0 A;  5AQJ B;  5HEO A;  4CI3 B;  3L8R A;  1HG5 A;  3RRC A;  1LKX A;  4UVB B;  3SOL A;  2YEV C;  3UQ4 A;  1HR0 T;  2JJ9 A;  2V5D A;  4IDZ A;  3ZMV B;  3HR0 A;  4DID B;  4NXN T;  5ABH A;  2JIW A;  3UUX B;  2XAQ B;  2XTL A;  4JUY A;  4G63 A;  4U33 A;  3ZYM A;  1MIW A;  3DJB A;  3GA8 A;  4YTM A;  4ZI3 C;  2WCA A;  4L0R A;  2YKS A;  1I94 T;  1UK5 A;  1VCS A;  5LBM A;  3UU6 A;  3QNU A;  1MND A;  3FHN A;  3HKC E;  1W0A A;  3JAF A;  4YSY A;  3CWZ B;  1SHZ C;  4YTP A;  3QUJ A;  1HS7 A;  3FZL B;  2WB5 A;  2X0L B;  3N9N A;  5AQL B;  4IRE A;  2FBW A;  5HXE A;  5LMU T;  5FY7 A;  2A2F X;  3ZPO A;  4FJO A;  2P9B A;  2V7I A;  3BQI A;  3MKD A;  1W9R A;  3ONJ A;  4DBQ A;  5ADX L;  5LB7 B;  3QK6 A;  2CLY C;  5M4Y A;  2LRL A;  2N9D A;  3P50 A;  3PUS A;  5FXZ A;  1VCT A;  2HPJ A;  2K48 A;  1IBL T;  3PUG A;  4HWH A;  1V9D A;  4IDO A;  4ZXL A;  3RX6 A;  5AQU B;  2XQ6 A;  4DV6 T;  4X1Y E;  2WM9 A;  3ABV A;  3D0T A;  3LSV A;  4O4J E;  4J2C A;  2EHO D;  5HAX A;  2MTQ A;  3F31 A;  5A1L A;  3KBU A;  1UUR A;  4N78 D;  3CX8 B;  4TV8 E;  5LHI B;  3W15 B;  2WU5 A;  2J47 A;  5C8Y E;  4WYV A;  4TN7 B;  1MIV A;  2LOS A;  2XSA A;  2V26 A;  4IE7 A;  3LBX B;  2H7V C;  4TV9 E;  2XY8 B;  5FL0 A;  2F4V T;  2CLY B;  2CXF A;  3FB2 A;  1SUM B;  1HFA A;  1ZKE A;  3NWI A;  4ILB A;  3UU8 A;  3A8Y C;  2DHR A;  4EZH A;  3KFW X;  2LJL A;  2VVN A;  4ZI7 E;  4AKH A;  2LKH A;  3VKH A;  3VU7 H;  5J1G A;  2PG8 A;  2WMO A;  1YXR A;  2LE8 A;  4HFD A;  4QXC B;  3HA4 A;  3RPU A;  1CHU A;  4B3M T;  1ZV4 X;  2H89 A;  4YHJ A;  5JDN A;  3C98 B;  4QXB B;  3ANW B;  3KV6 A;  3QC9 A;  2CA5 A;  4I50 E;  5CB4 E;  5AQO B;  3NRY A;  4F6R C;  3AXJ B;  3H3A A;  2BS3 A;  2XAH B;  4HFH A;  1O3X A;  4HTE A;  5C2T A;  3E22 E;  2X0Y A;  3DTO A;  4DV2 T;  2YDS A;  4U74 A;  2DCF A;  2JRK A;  4AKG A;  1KFY A;  3RRW A;  3L09 A;  3ZT5 A;  2JMH A;  3AA6 B;  1M7K A;  2MPK A;  4HWI B;  3SS1 A;  4KMC A;  5GON E;  3C50 A;  5AQT B;  4IL4 A;  3GN5 B;  4HKA A;  1ZEE A;  4KP3 C;  4PJL A;  4UEM A;  3RIU A;  4CXY A;  4AQY T;  1FJG T;  4XBF B;  3E08 A;  1WFD A;  4DO0 A;  3PU8 A;  3KV4 A;  4PJM A;  2OV9 A;  5AQK B;  4DV5 T;  4CI1 B;  3ETV A;  3AEG A;  2K3W A;  4JI2 T;  4EZ4 A;  2CWO A;  1D1B A;  3B13 A;  3G06 A;  1WYC A;  2D0T A;  4UXN B;  2XAS B;  1H7C A;  2D5U A;  2W62 A;  3PUY F;  5FNV E;  3RLF F;  4BJN A;  5JDH A;  2UXD T;  1OED C;  2LHN A;  3FBL A;  4UIG A;  2CEA A;  1YQ3 A;  5HEG A;  5CA1 E;  3CQG B;  2H7O A;  2LSG A;  4QX7 B;  4ADZ A;  5JDF A;  1WRD A;  4FI5 A;  1ZHC A;  2ODU A;  3AA1 B;  3AEF A;  3ONX A;  4U2Z A;  2E8I A;  4ZZB A;  3O1H A;  3PV0 F;  4LFA T;  4U7I A;  5LJM A;  3AED A; 
#chains in the Genus database with same CATH homology
 3K3Q C;  2RA1 A;  4O2A E;  5HXC A;  2VB6 A;  3CQX C;  2XAG B;  3KIN B;  5ETW A;  4QKN A;  2V7K A;  3Q9D A;  4MBQ A;  4QWN B;  4IE6 A;  2VKO A;  4PNI A;  3MK7 C;  4QHO A;  3ZCI A;  4O4L E;  3AVR A;  3KBT A;  3OBV E;  4BA9 A;  4WBN E;  4GK0 E;  3VKG A;  4CZZ B;  1KK7 A;  1MMA A;  4H63 V;  3ZJ1 A;  3VHL A;  3E0Z A;  4H9P C;  4UVA B;  4H9O C;  3N5L A;  2C5I T;  2Z6E A;  1HTJ F;  4PW8 A;  2CCQ A;  4BJM A;  3AB3 B;  4WNK A;  2LHR A;  3N9O A;  3OJA A;  1LRZ A;  3HKD E;  3ZMT B;  3BQK A;  3PU3 A;  1U4Q A;  4G2A A;  2HPL A;  5L3G B;  5KMG P;  1E1H B;  1OXZ A;  3K8P C;  1G73 A;  4XZC A;  2CM0 A;  2W00 A;  3R84 B;  5JRC B;  2MYS A;  5LBQ B;  2X9W A;  4TZ4 C;  3N2K E;  1WR6 A;  2K5B B;  3I9Y A;  2IAK A;  2DWK A;  3OKQ A;  2KZ7 B;  3KVA A;  3LBX A;  5LGU B;  4EB6 E;  2ES0 A;  2KIN B;  5JRE A;  3Q5X A;  4UF0 A;  5FYM A;  1FMV A;  3ZEF B;  5KX5 E;  1VOM A;  1QSD A;  4TUY E;  2VK9 A;  5JDM A;  2K9A A;  2BVL A;  4UEL A;  5LG4 A;  2I59 A;  3N9Q A;  2KXP B;  3MAC A;  3P8C D;  4UF0 B;  3KV9 A;  1YW0 A;  4PK6 A;  2B1E A;  4EIW A;  3O1I A;  5HXH A;  4YLH A;  2LT3 A;  3FXE B;  2YU1 A;  4MHC A;  5JDG A;  1IJ6 A;  1CUN A;  3U78 A;  4DBR A;  3CQC B;  2XHE B;  4JEH B;  4WBO A;  2NW9 A;  4EYU A;  4H9Q C;  4CXX A;  1HG2 A;  3RC8 A;  1LVK A;  5JDL A;  2VL8 A;  1MIY A;  5LA6 E;  2CXL A;  2H3R A;  2K24 A;  2LSJ A;  3WAJ A;  5LJN A;  3IBP A;  1UCU A;  3AA0 B;  4HE8 A;  4UV8 B;  2Q9Q B;  3BK9 A;  3LK4 2;  3N2O A;  1HCI A;  3EDV A;  5FMN A;  2X9Y A;  4GYS A;  2C5J A;  5LXT E;  4I43 B;  1B7T A;  2IC9 A;  5LGT B;  4EYY R;  1YKH B;  4AQF A;  2ZM2 A;  5FY1 A;  4DVD A;  5L3C B;  4YJ2 E;  4PFO A;  3M65 A;  3LJC A;  1BR0 A;  5FXW A;  3AVS A;  3CVR A;  3SWH A;  3AAA B;  4ZOL E;  2KWH A;  3CX7 B;  2GK9 A;  3ZN0 B;  3ANW A;  3WAK A;  3PUA A;  4H9S E;  2DI4 A;  1NAF A;  5JR9 A;  3HI2 A;  4L5G A;  4O8S A;  4GIW A;  3LG7 A;  4PFP A;  3SRZ A;  5DAB A;  4DMV A;  1SA0 E;  2D0U A;  5HXS A;  4ILU A;  4NUV A;  1BR4 A;  3H37 A;  5HYA A;  4MAL A;  4C90 A;  4OYK A;  1S35 A;  4X1I E;  5CA0 E;  4ZHQ E;  2BZB A;  4AXP A;  3ZC1 A;  4ANJ A;  3JC6 D;  2M67 A;  3RH3 A;  2WSS V;  3C51 A;  3MZK B;  2UXN B;  1D0X A;  2ZM8 A;  4MFR A;  2C5K T;  4IHJ E;  2NW7 A;  4UVC B;  5FY0 A;  4AKI A;  1FMW A;  2NTX A;  3O4X E;  3S4U A;  2XUE A;  5JVD E;  2LSK A;  3UTK A;  4AQF C;  3KVB A;  5JQG E;  5L3E B;  2PFV A;  2X9X A;  3UFE A;  3N2G E;  2N1G A;  4X20 E;  2V7M A;  2KT9 A;  3N9M A;  3CPZ A;  3OYX A;  3U3I A;  2UXX B;  4IE0 A;  3UT5 E;  4IST A;  1YD8 G;  4IE5 A;  5LGN B;  3BQL A;  3MJX A;  2V1D B;  2QGS A;  4P09 A;  1U5P A;  2VKH A;  2ZLY A;  4U72 A;  3ZYK A;  5JR9 C;  2EHO A;  2Q9Q A;  2NW8 A;  2WWU A;  3FBZ A;  3MA9 A;  3RYC E;  4OFZ A;  2Y8D A;  4NUU A;  3AA7 B;  3ETU A;  5EK2 A;  1BR1 A;  3EUH A;  2E9X A;  4H9R C;  4HN9 A;  5L3D B;  3HL6 A;  4EXT A;  2SPC A;  3RYF E;  2KND A;  1D1C A;  4KUM B;  3PE0 A;  3JC6 C;  1IAP A;  4CI2 B;  1OWA A;  4B6X A;  3RC3 A;  3T8O A;  1Z0P A;  2LEH A;  3ZJ2 A;  2A3D A;  3I0Q A;  3EVY A;  5JDQ A;  2LSY A;  3RKO A;  3GWH A;  5LHG B;  3HKE E;  1UX5 A;  2YU2 A;  1US7 B;  2NWB A;  3CKD A;  4GOU A;  2CE7 A;  2VKJ A;  4PJJ A;  5IYZ E;  4ZS3 A;  4YFS A;  5J2T E;  2L9Q A;  4QXH B;  2WBL A;  1WYB A;  2OA5 A;  2CWY A;  3UUN A;  2G0U A;  3AAI A;  4Z8X A;  3ZMZ B;  3C4W A;  3PTR B;  4A56 A;  2WAU A;  4IE4 A;  3N9L A;  2C0S A;  4WW0 A;  3K3O A;  5F3J A;  3ZLI A;  3LFM A;  2D2S A;  4OYJ A;  1QUU A;  5F8P A;  3ZMU B;  2ZMA A;  2W61 A;  5JH7 E;  2BVM A;  1T98 A;  4QX8 B;  5FXX A;  1NWM X;  4O4H E;  4HGA A;  4AKL A;  5LP6 E;  2JQQ A;  3PUQ A;  2YK0 A;  4OHF A;  4AI6 A;  5L2L A;  5EK3 A;  2VWA A;  1VRB A;  1D1A A;  3PDY A;  3Q5W A;  4CXW A;  2BDE A;  4BAY B;  4OK0 A;  4ZI2 D;  3C4X A;  4P0A A;  2IW5 B;  1WLX A;  4ZI3 D;  5DQV A;  4AKH A;  3ZMS B;  3NBX X;  4M1P A;  2KLQ A;  2W63 A;  2XAF B;  2NP9 A;  2X51 A;  3IHR A;  2DNX A;  2X66 A;  4ASK A;  4ZS2 A;  4DND A;  5LNK A;  4AQG A;  1MNE A;  4PJN A;  4H63 H;  1Y64 B;  2JPF A;  4XAX B;  5L3F B;  4GYR A;  2CXD A;  2J1D G;  4PK4 A;  4L9I A;  2N2N A;  4I4T E;  5DJQ C;  3I0O A;  3O9X A;  4CQI A;  3F2E A;  3AAE B;  4E7Z A;  3GMI A;  3IF8 B;  5H6R B;  1MMD A;  1MMN A;  2DLR A;  4UV9 B;  3LK3 B;  3B57 A;  5DQW A;  5EK4 A;  5LCY A;  2WMN A;  1IJ5 A;  2L8K A;  4H9N C;  2X67 A;  1HX8 A;  4ZI2 C;  2KWI B;  3CML A;  2ODV A;  2CMR A;  1FEW A;  5LYJ E;  2LOP A;  2LSI A;  1FIO A;  1S94 A;  3HKB E;  3IEE A;  4IGU A;  5HWY A;  2YIN A;  4K0U A;  3UUM A;  2NTY A;  2EHO B;  4MLK A;  1LVF A;  3TKL B;  4TX5 A;  3KV5 A;  3MXZ A;  5JRC A;  4X1K E;  5H6Q B;  1G8X A;  3GN5 A;  2Y6X A;  4PK5 A;  1EZ3 A;  3K3N A;  2MOZ A;  3OYZ A;  4PAG A;  3V5U A;  2XAJ B;  3ESL A;  5JR9 B;  2V7L A;  3WI3 A;  2EHO C;  3C4Z A;  4JEU B;  2LM9 A;  5HWX A;  3J7Y q;  4ISS A;  2JMK A;  2E9X C;  2DWG A;  4E7S A;  3Q2M A;  4AKR B;  3F57 A;  3CX6 B;  2Q9Q C;  5AFU L;  3RYI E;  3A5X A;  1KNZ A;  4P0B A;  3J9X 1;  4O4I E;  3KDS E;  3I1A A;  3RYH E;  3I9W A;  2PJQ A;  5BMV E;  2A72 A;  2RP4 A;  2HH7 A;  3UUL A;  1X79 A;  2ZM0 A;  3V5S A;  3LK2 B;  4HFV A;  5HXR A;  4ERR A;  2KMF A;  2V7J A;  5J2U E;  3R6N A;  3ZYL A;  5TAO A;  3ZN1 B;  4KBM B;  4I55 E;  3NRX A;  3N9P A;  2Y48 B;  3DP7 A;  2X68 A;  5LHH B;  2MBG A;  5E0O A;  4O2B E;  3NZQ A;  2XQY A;  3FXD B;  1MMG A;  4GK5 E;  5FP3 A;  4EOZ B;  3NZP A;  1IZN B;  2ACX A;  4YJ3 E;  4V1A v;  2X9H A;  3ZCJ A;  2E9X B;  2VAS A;  5FXV A;  5EZY E;  4C91 A;  1HF8 A;  2E9X D;  5KDM C;  1AJ3 A;  1BR2 A;  2IC6 A;  2NOX A;  4HEA A;  1D0Z A;  4JLE A;  4DMW A;  2Q9Q D;  3L3P A;  2QA7 A;  3C64 A;  2W0G A;  3O1J A;  1D0Y A;  2L3L A;  1YKE B;  3PUR A;  2PBI A;  4EAH A;  5LOV E;  5L3B B;  3EDU A;  2VKD A;  5IHY A;  4IIJ E;  3P7I A;  1UX4 A;  3ZC0 A;  4CI3 B;  1HG5 A;  3RRC A;  1LKX A;  4UVB B;  3SOL A;  2YEV C;  2JJ9 A;  4IDZ A;  3ZMV B;  3HR0 A;  3UUX B;  2XAQ B;  2XTL A;  4JUY A;  4G63 A;  3ZYM A;  1MIW A;  3DJB A;  3GA8 A;  4ZI3 C;  4L0R A;  1MND A;  3FHN A;  3HKC E;  3CWZ B;  1SHZ C;  1HS7 A;  3QUJ A;  2X0L B;  3N9N A;  5HXE A;  5FY7 A;  2A2F X;  3ZPO A;  4FJO A;  2P9B A;  2V7I A;  3BQI A;  3MKD A;  4DBQ A;  5ADX L;  3QK6 A;  2CLY C;  5M4Y A;  2N9D A;  5FXZ A;  3PUS A;  2HPJ A;  2K48 A;  3PUG A;  1V9D A;  3RX6 A;  4X1Y E;  2WM9 A;  3D0T A;  4O4J E;  5HAX A;  4J2C A;  2EHO D;  2MTQ A;  3F31 A;  5A1L A;  3KBU A;  4N78 D;  4TV8 E;  3CX8 B;  5LHI B;  3W15 B;  5C8Y E;  4TN7 B;  1MIV A;  2LOS A;  4IE7 A;  2V26 A;  4TV9 E;  3LBX B;  2H7V C;  5LBM A;  2CLY B;  2CXF A;  3FB2 A;  1ZKE A;  1HFA A;  2DHR A;  4EZH A;  3KFW X;  2LJL A;  4ZI7 E;  3VKH A;  3VU7 H;  5J1G A;  2PG8 A;  2WMO A;  2LE8 A;  4QXC B;  3HA4 A;  3RPU A;  1ZV4 X;  4YHJ A;  5JDN A;  3C98 B;  4QXB B;  3ANW B;  3KV6 A;  3QC9 A;  2CA5 A;  4I50 E;  5CB4 E;  3NRY A;  4F6R C;  3H3A A;  2XAH B;  1O3X A;  4HTE A;  3E22 E;  3DTO A;  4U74 A;  4AKG A;  2DCF A;  2JRK A;  3RRW A;  3L09 A;  2JMH A;  3AA6 B;  3SS1 A;  4KMC A;  5GON E;  3C50 A;  3GN5 B;  4HKA A;  1ZEE A;  4KP3 C;  4PJL A;  4UEM A;  4CXY A;  4XBF B;  3E08 A;  4DO0 A;  3PU8 A;  3KV4 A;  4PJM A;  4CI1 B;  3ETV A;  4EZ4 A;  2CWO A;  1D1B A;  3B13 A;  4UXN B;  1WYC A;  2D0T A;  2XAS B;  1H7C A;  2D5U A;  2W62 A;  5JDH A;  5FNV E;  4BJN A;  2LHN A;  3FBL A;  4UIG A;  2CEA A;  5CA1 E;  3CQG B;  2H7O A;  2LSG A;  4QX7 B;  4ADZ A;  5JDF A;  1WRD A;  4FI5 A;  1ZHC A;  2ODU A;  3AA1 B;  3ONX A;  2E8I A;  3O1H A;  5LJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...