1HTJF

Structure of the rgs-like domain from pdz-rhogef
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
ESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the RGS-like domain from PDZ-RhoGEF: linking heterotrimeric g protein-coupled signaling to Rho GTPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords KIAA0380
total genus 66
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2000-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1htjF00
2A72A 3C50A 3C4WA 2I59A 1ZV4X 2ES0A 3C4XA 3CX6B 1IAPA 4IGUA 3CX8B 3C4ZA 3CX7B 4WBOA 3T8OA 4YHJA 2ACXA 4GOUA 1SHZC 4WNKA 4L9IA 3AB3B 3C51A 2DLRA 3QC9A 4PNIA 2PBIA 1HTJF
chains in the Genus database with same CATH superfamily
2XZEA 5AFUL 4JI5T 3VHLA 5HEHA 3C4XA 2PJQA 4X66T 2CE7A 4IGUA 2W63A 2BKOA 3F31A 3GN5B 4ANJA 4UIGA 2CWOA 1BR0A 5H6RB 3CQGB 4HFVA 3N2GE 5AQIB 3N9LA 4UR9A 5FYMA 3E22E 3RLFF 3SFDA 3T8OA 2HHHT 2XAGB 2Y8DA 2FJBA 3J7Yq 5AQFB 2J47A 2W4XA 5FY7A 3ZEFB 4JI0T 3C64A 3OVUA 2WB5A 1FMVA 1W0AA 3Q5EA 2MAWA 1LVKA 4L5GA 4U2ZA 2UXNB 2I0MA 3HI2A 3IHRA 5JVDE 5EK3A 5HEOA 5L47A 2ZM6T 4LF7T 3ZYKA 1SA0E 2NW7A 2WY2A 2NOXA 2JPFA 3N5LA 3NKZA 4BJNA 4TV9E 2FJEA 5BMVE 2L8KA 5DJQC 2BG9B 2WM9A 5JDFA 2UXBT 2HPLA 2C0SA 3HKEE 3A8YC 4Z91A 1VCTA 1VRBA 3PDYA 2UUAT 4QXHB 2V8SV 5DQVA 4LMJA 1UUSA 2BVMA 3Q5XA 2LE8A 4OFZA 4IHJE 5EZYE 5JDQA 4YTPA 3UUNA 1OEDB 3I9WA 2UXCT 3DP7A 2H7OA 5F8PA 4X65T 3CIRA 3MXZA 4JLEA 4P09A 4OX9T 1ZOYA 1XZYA 3FHNA 3NZPA 4WNKA 5LB7B 1N36T 5JDLA 4JI6T 2Y48B 2BS4A 1BR1A 2BBJA 3KINB 3OYZA 1KFYA 4CN6A 5LGTB 2V1DB 2NWBA 2V6YA 4MHCA 4YHHT 2VB6A 1SUMB 4IE0A 2BG9A 3JC6C 3CQXC 3J9X1 4Q25A 3SOLA 3UU4A 2XAFB 2X9YA 5L3CB 5JRCB 2VURA 3P4QA 2ZMAA 3AE7A 4DR1T 4P1NA 4HN9A 4L0RA 5AQKB 3HL6A 4CQIA 3UU8A 1OEDA 4DMWA 5KX5E 3LFMA 4F6RC 5J2TE 4DVDA 2L3LA 2VKDA 4YTMA 4AI6A 4CXYA 2IC6A 4LF4T 2CCQA 2CXDA 2KXPB 3KV9A 4X64T 2NW8A 5LG4A 3UQ4A 4Z90A 3RIAA 5J0ZA 2MOZA 4AQFC 4PK6A 4DV2T 4QWNB 2BS2A 2A2FX 2CLYB 4ZS2A 3PJAJ 3FZKB 2HN2A 4ERRA 2IW5B 4GIWA 4IDZA 4JBWF 3HKDE 5DQWA 4JI3T 2CHOA 4DBQA 4JI4T 1KNPA 2ZM8A 3LK42 4GYRA 3ZMSB 2MBGA 3GMIA 3PUVF 1Z0PA 2JQHA 3AEGA 5LCYA 1SE7A 4H9OC 2WDRA 4IE5A 4PW8A 3QK6A 5FXVA 1W0BA 5GONE 4EEDA 2XJ7A 3JCFA 2BZBA 2X66A 4LFBT 4AXPA 2XQAA 5JDMA 4JI1T 3UTKA 2EHOD 5AQVB 5FY1A 4GK5E 4DV7T 4IIJE 2XSBA 4AKLA 1X79A 2ZLYA 1KNRA 1QUUA 3ONLC 2G0UA 4IDNA 3CWZB 4MALA 4KHPT 3VKGA 5AQSB 4DIDB 2XY8B 2C5IT 1E1HB 3QNUA 1G73A 2H7VC 1H7CA 2X0YA 2XTLA 3AECA 4HFEA 3AE3A 4MBQA 3EHZA 4U2YA 3RF1A 3WAKA 5KXJA 5L4EA 3RC8A 3SRZA 3C98B 2D0TA 2LSGA 4PJNA 4I4TE 2V7JA 2XM1A 3VRAA 4EYYR 5LGNB 3VR9A 4AKGA 3N9PA 1QLBA 2CM0A 4EEBA 5JDNA 3EAMA 4C90A 2E5LT 4PFOA 4X1YE 4IL4A 2JQ9A 4A98A 2QA7A 3JADA 5FNVE 1IAPA 4H9SE 2J62A 4EZ4A 3UU3A 2XQ4A 1CUNA 3OTOT 4KI0F 2CRBA 1J5ET 1KK7A 2IIUA 5LMNT 5CGMA 2WSSV 1WYBA 3NBXX 3RH3A 1LVFA 5HXHA 3H37A 1D0XA 4OYJA 4GOUA 2CBIA 1UCUA 4TX5A 2D9DA 2WAUA 4C91A 4L9IA 4X5TA 3RYCE 1D1AA 2LRLA 3AB3B 1HNWT 5ETWA 4DR6T 3FZMB 3QC9A 5HYAA 4IE7A 5FVKA 4ZHQE 3O9XA 5LP6E 4MLKA 4E7SA 2P9BA 4GKJT 2V5DA 3KV5A 3VU7H 3ZMTB 4DUZT 3DTOA 2XQ7A 3C4WA 1XMQT 2LKGA 1WRDA 3AE9A 3EI0A 2NW9A 4QX7B 3LBXB 1MMDA 2N2NA 2BG9E 3F2EA 4U31A 1T72A 2ZM0A 4H63H 5CB4E 5CA1E 1YQ4A 5LJNA 3BK9A 2E9XC 3SS1A 4DV0T 2Q9QA 4B3MT 1N32T 2LM9A 4OK0A 3B13A 3RIUC 2RPAA 3A7MA 2FJAA 5HEJA 3UU5A 4A5XA 4EOZB 3ZSTA 2V26A 3PU8A 4DR4T 2DL1A 2MTQA 3P8CD 4JI2T 4ZI3C 4ADZA 4IT4A 4HEAA 3M65A 4YSYA 3VRBA 3AA7B 5FL0A 2LSJA 3ANWB 1HFAA 1OWAA 4J2CA 1FIOA 5HEGA 5HXCA 3AAIA 3RRWA 3HA4A 4XBFB 3N9OA 5DABA 5EK2A 4P0AA 2WWVA 3AVSA 3GWHA 5CA0E 3PE0A 4KP3C 3I9YA 3JC6D 1HTJF 1LRZA 1FMWA 1V9DA 2M6BA 3PTRB 2V5CA 2YK0A 3AA6B 3KV6A 2E2AA 2E8IA 3C50A 3L09A 4U3CA 1ZHCA 3TKLB 4ASKA 2VK9A 5HWXA 2Z6EA 2JQQA 2YDSA 3AAAB 2J1DG 5FXXA 3RI5A 4ZZCA 3OJAA 4U74A 2DWKA 5IYZE 5HEUA 3PUAA 1HG5A 3K3NA 3Q9DA 3ZYMA 5HXRA 4KUMB 2YDQA 3W15B 2FJDA 1G8XA 3RYHE 4TNWA 4ZI3D 2BKPA 2KWHA 5L2LA 5FXZA 4ILBA 1VCSA 2X67A 1CHUA 1SHZC 1HCIA 1HG2A 3AXJB 4TWHA 4TWFA 3ZSSA 1US7B 2XAJB 5KDMC 4YTNA 4I50E 2UU9T 3PV0F 3H3AA 3I0OA 3B5MA 5AQQB 2CXLA 2XASB 4WW0A 3O1JA 4LMLA 1ZEEA 4DV4T 2DHRA 3HR0A 5JDHA 4O2AE 2QYWA 5HXSA 2LT3A 3EDUA 4ILAA 2M67A 2QVAA 3RIFA 5M4YA 3ZC0A 3RYIE 1UK5A 3ANWA 2XQ9A 1XWMA 2KLQA 2OV9A 2ODUA 5IWAT 2V7MA 2V7IA 4HFIA 3TLUA 4KBMB 2CHNA 3CX8B 4LMKA 2CWYA 1FEWA 3ETVA 2A3DA 5KMGP 4TZ4C 3ZMUB 5JREA 4G63A 5L4HA 2N1GA 3AE1A 4YJ3E 1T8BA 2SPCA 5AQNB 4COFA 1QSDA 5LHHB 4YT0A 5BR8T 2CEAA 2F4VT 5FVLA 1HX8A 3PUSA 1BR2A 2C5KT 4AKIA 1MIWA 2DNXA 5J1GA 5TAOA 2MYSA 3IEEA 2AXDS 5JTGA 4I0UA 4TNVA 2VL0A 2X9XA 4HTEA 2WMNA 3P4SA 3ONXA 4YLHA 2KT9A 4LFAT 1GQEA 3PUQA 2LKHA 5L3DB 3PURA 1HNXT 1MMAA 3ZC1A 3L8RA 1Y01A 1NENA 4UVAB 4N78D 3DJBA 2KINB 1J5WA 3MJXA 4PK4A 4HWFA 4QXBB 1DU2A 1ZP0A 3C4ZA 2I6HA 3T1HT 3I1AA 1KEYA 2C5JA 2LRKA 4WYVA 5LOVE 3N9MA 3UUXB 4YY3T 4QKNA 2IMLA 3PUWF 2LHRA 4X20E 1XDOA 5L3FB 1XMOT 1IBKT 4ZZBA 5F3JA 3CKDA 3KFWX 1YKEB 3PU3A 5ABFB 5AQLB 4KMCA 2M6IA 3BQKA 4F8HA 3AEAA 3OKQA 1VOMA 3AE6A 2PBIA 3NVOA 4DV1T 3UT5E 2KWIB 2XPKA 3ZT6A 3N2OA 3RRCA 4YFSA 3FB2A 4PK5A 3M3ZB 1T7SA 5LXTE 1N33T 5AQTB 2WCAA 3LK2B 4HKAA 4OHFA 4A56A 4ZI7E 3UFGA 5FKYA 4DNDA 5LHIB 1D1CA 2I59A 3O1IA 4EB6E 5FL1A 2LOPA 4HGAA 4O8SA 3AE2A 2QGSA 3FBZA 1L0VA 4ZI2D 2XUEA 3BQIA 4DR5T 4JI8T 5LJMA 4KX6A 3ESLA 1U5PA 3KVBA 4YJ2E 4HE8A 4ZOLE 3UU6A 4B3RT 1WR0A 4GKKT 2CXFA 5ABHA 2X9HA 1E2AA 4CZZB 3ZPOA 1D0YA 3GA8A 4BA9A 2JQKA 2IC9A 4CN1A 5ABFA 1UGOA 2OLTA 4H9NC 4A97A 3UULA 2VL8A 5CJ5A 4EYUA 2D0UA 1D1BA 2W00A 3OYXA 4IDQA 4HFCA 3AA1B 2E9XD 4DO0A 1WYCA 2BVLA 2WDVA 4PJJA 3ZN1B 3AVRA 4H9QC 2VKJA 3UQ7A 2UUBT 1I94T 2FBWA 1ZKEA 2VVSA 2K9AA 1NWMX 2WZIA 4DUYT 1T98A 4WBNE 2BBHA 2YKSA 3FZLB 3D0TA 3T1YT 3RKGA 3PUZF 5J2UE 3P7IA 3TLVA 4B3TT 3K3QC 4LF8T 3PJAA 3AE8A 1ZV4X 2BKNA 4DV6T 4LFCT 2UXDT 2CBJA 3CQCB 4OYKA 2OA5A 4UF0B 5AQGB 2AE9A 2D5UA 2PG8A 1Y64B 5LNKA 2X0LB 1FJGT 4O2BE 3ZMZB 3P4WA 2K5BB 2K24A 3O1HA 4HFHA 2QRXA 2WBLA 2NP9A 2XQ5A 4U7IA 2WQYA 5LBQB 4O4IE 4NXNT 1OEDC 2HPJA 3LJCA 4HFDA 2A9UA 3CPZA 4XZCA 3UUMA 4JV5T 1AJ3A 2XHEB 4I43B 1EZ3A 2D2SA 1UX5A 1O3XA 2XSAA 3K8PC 4JUYA 4DR3T 2Y6XA 4V1Av 1LKXA 3BQLA 3KBTA 3RGLA 1W9RA 3SFEA 4YSXA 3RX6A 2H3RA 3RPUA 4CI3B 1U4QA 4U33A 3FXDB 3LDQB 3NRXA 2XQYA 4AQFA 1IBLT 4B6XA 3OPCA 5AQRB 3EDVA 3CVRA 4QH1A 2LSIA 2K48A 3ZLIA 2VKOA 4GK0E 1MNDA 3ONJA 4HWIB 2IUBA 3EUHA 5AQPB 3H3MA 3K1SA 1WFDA 2JIWA 2WU2A 2JMKA 2YU1A 4ISTA 4O4LE 4BAYB 2X0HA 5HCMA 3Q5WA 4FI5A 3ABVA 2VQFT 2ACZA 2KSRA 4DMVA 5HXEA 2JJ9A 1IJ6A 4ILCA 4LF5T 2LEHA 1E7PA 1JNZA 1MMGA 1IZNB 3OBVE 4NUUA 5IUXA 3A5XA 3AAEB 4U7YA 4YXDA 2K3WA 3UFEA 4O4JE 4ZXLA 5L3BB 4JYAT 2VKHA 5ABEA 2BG9C 4UELA 1HF8A 2LSYA 3KBUA 3QB5A 4X1KE 4AQYT 4AIUA 4DR7T 2IAKA 3CMLA 4UV9B 3ZN0B 5AQMB 3ZYLA 2YEVC 4HWDA 2HH7A 4U72A 2WP9A 5C8YE 5L3GB 4PJLA 5AQHB 3EVYA 3TLWA 1MIVA 2CMRA 1M62A 2A72A 2MPKA 3MA9A 2B1EA 2CPTA 4O4HE 4H9PC 1UX4A 1JNRA 2PFVA 1OEDE 3V5UA 3MK7C 2GK9A 1HX1B 4EGWA 3ZJ2A 3CX6B 3MACA 4EV6A 5JH7E 1MIYA 4AKRB 2HN1A 5EK4A 4QHOA 3R6NA 2H89A 5HAXA 1YW0A 2X9WA 3N9QA 3RKOA 3VR8A 4K0UA 1X9BA 4GYSA 4I55E 4QXCB 4YSZA 3SWHA 2DCFA 3V5SA 4X1IE 1KNZA 1MMNA 4TWDA 2R6GF 4PJMA 2WDQA 3VKHA 4IREA 4PAGA 5A1LA 3AEDA 5JDGA 1S35A 4IDOA 5JR9A 3EABA 3ZJ1A 2XM2A 3PUGA 2EHOA 3RC3A 3Q2MA 4H63V 2Q9QB 3C51A 2DLRA 3F57A 2KNDA 4UEMA 3RHWA 2KMFA 2W61A 4IE6A 2LSKA 3TLSA 3PUYF 4M1PA 1MNEA 2PTFA 2W66A 2LM2A 1IJ5A 2J4GA 2WMOA 3LSVA 2XQ8A 1NAFA 1WCRA 1J1JA 2H88A 4G2AA 3TLTA 3CK6A 4ZI2C 4E7ZA 5HCJA 1B7TA 3ZCIA 4CN4A 5LMUT 1S94A 2BS3A 4EAHA 2V6YB 4NPPA 2XAHB 3KVAA 5JQGE 2CLYC 3P50A 5AQJB 3NRYA 1WR6A 5FMNA 2ZM2A 4DBRA 3IA3A 4PFPA 3RQWA 3S4UA 3N9NA 4YHJA 4DR2T 2LLYA 5JR9B 2ACXA 2UUCT 4X62T 4TV8E 2DWGA 3IF8B 4IDPA 5JRCA 5C3JA 2L9QA 2W0GA 2NR4A 2Q9QC 1HR0T 2E9XA 1I6ZA 3AA0B 3QOFA 3B57A 2UXXB 3KV4A 2RA1A 4CXXA 4AKHA 4HWHA 2KZ7B 2V7KA 2WZHA 1YD8G 2IDOB 2YINA 2E5VA 2YN6A 3L39A 3PUXF 4NUVA 4HWCA 5LYJE 4B3ST 5LA6E 4NXMT 4TN7B 5AQOB 4DV3T 1YQ3A 3AE4A 4JI7T 2WWUA 1R8IA 2RP4A 1M7KA 2EHOB 1YKHB 2N9DA 1NEKA 2WU5A 3K3OA 3NZQA 3FZFB 1UURA 2V7LA 4CI2B 5E0OA 4IL9A 3E0ZA 4IE4A 3R84B 2VVNA 3QB5K 3RIUA 4AQGA 4P0BA 5CFBA 5JR9C 1HNZT 1XNQT 2LJLA 2VQET 3KDSE 2VWAA 2W2UA 2Q9QD 1KF6A 4H9RC 3P4RA 4JEHB 4NIQA 2E9XB 4AISA 5ADXL 4K0KT 3L3PA 2DI4A 3NWIA 2X68A 3P4PA 3Q5DA 4UVBB 4LF6T 1XDPA 3AE5A 3IBPA 3MZKB 1XNRT 5LHGB 3AEBA 3FXEB 4UV8B 4ILUA 5HWYA 2FUPA 2NTYA 2YOEA 3ZKRA 2JMHA 4CI1B 5LG3A 4ISSA 3LK3B 3AEEA 4WZXA 3RYFE 1W09A 2B76A 2EHOC 4FJOA 3MKDA 2BDEA 2XAQB 2XQ6A 3UUBA 3AXJA 2V6XA 3RQUA 5C2TA 3LG7A 4UXNB 4XAXB 3FBLA 4Z8XA 3I0QA 4ZEYA 3ETUA 5AQUB 2ES0A 4LF9T 1N34T 3JAFA 2WS3A 3LBXA 1WLXA 3AEFA 5IHYA 2LOSA 3ZT7A 1OXZA 3U3IA 4EIWA 3ZCJA 3E08A 3QUJA 1YXRA 3N2KE 4HFBA 3FZHB 3CX7B 4JEUB 4TUYE 4WBOA 4KHZF 3U78A 1BR4A 4MFRA 3WAJA 5LBMA 3WI3A 4DV5T 3GN5A 3HKCE 4BJMA 2VASA 4QH4A 5FY0A 5LGUB 1Z8UA 3O4XE 1D0ZA 4UF0A 3ZT5A 3G06A 4UVCB 4EZHA 2ODVA 1IBMT 5FP3A 2NTXA 4QH5A 5F5WA 5H6QB 4CXWA 2CA5A 3ZMVB 4QX8B 2LHNA 4PNIA 2W62A 2W67A 3X1DA 5ABGA 4EXTA 5L3EB 1HS7A 3JAEA 2IHR1 2X51A 2XQ3A 2YDRA 2JRKA 2YU2A 3HKBE 5FXWA 4ZS3A
chains in the Genus database with same CATH topology
3VHLA 3C4XA 2PJQA 2CE7A 4IGUA 2W63A 3F31A 3GN5B 4ANJA 4UIGA 2CWOA 1BR0A 5H6RB 3CQGB 4HFVA 3N2GE 5FYMA 3N9LA 3T8OA 3E22E 2XAGB 2Y8DA 3J7Yq 5FY7A 3ZEFB 3C64A 1FMVA 5JVDE 1LVKA 4L5GA 2UXNB 3HI2A 3IHRA 5EK3A 3ZYKA 1SA0E 2NW7A 2NOXA 2JPFA 3N5LA 4BJNA 4TV9E 5BMVE 2L8KA 5DJQC 2WM9A 5JDFA 2HPLA 2C0SA 3HKEE 1VRBA 3PDYA 4QXHB 5DQVA 4OFZA 2BVMA 5EZYE 3Q5XA 2LE8A 5JDQA 4IHJE 3UUNA 3I9WA 3DP7A 2H7OA 5F8PA 3MXZA 4JLEA 4P09A 4WNKA 3FHNA 3NZPA 5JDLA 2Y48B 1BR1A 3KINB 3OYZA 5LGTB 2V1DB 2NWBA 4MHCA 2VB6A 4IE0A 3JC6C 3CQXC 3J9X1 3SOLA 2XAFB 2X9YA 5L3CB 2ZMAA 4HN9A 4L0RA 3HL6A 4CQIA 5KX5E 4DMWA 5J2TE 3LFMA 4F6RC 4DVDA 2L3LA 2VKDA 4AI6A 4CXYA 2IC6A 2CCQA 2CXDA 2KXPB 3KV9A 2NW8A 5LG4A 2MOZA 4AQFC 4PK6A 4QWNB 2A2FX 2CLYB 4ZS2A 4ERRA 2IW5B 4GIWA 4IDZA 5DQWA 3HKDE 4DBQA 2ZM8A 3LK42 4GYRA 3ZMSB 2MBGA 3GMIA 1Z0PA 5LCYA 4H9OC 4IE5A 4PW8A 3QK6A 5FXVA 5GONE 2BZBA 2X66A 4AXPA 5JDMA 3UTKA 2EHOD 4GK5E 4IIJE 4AKLA 1X79A 2ZLYA 1QUUA 4MALA 2G0UA 3CWZB 3VKGA 2C5IT 1E1HB 4MBQA 1G73A 2H7VC 1H7CA 2XTLA 3RC8A 3WAKA 3SRZA 3C98B 2D0TA 2LSGA 4PJNA 4I4TE 2V7JA 4EYYR 5LGNB 3N9PA 2CM0A 5JDNA 4C90A 4PFOA 4X1YE 2QA7A 5FNVE 1IAPA 4H9SE 4EZ4A 1CUNA 1KK7A 2WSSV 1WYBA 3NBXX 3RH3A 1LVFA 5HXHA 3H37A 1D0XA 4OYJA 4GOUA 1UCUA 4TX5A 2WAUA 4C91A 4L9IA 3RYCE 1D1AA 3AB3B 5ETWA 3QC9A 5HYAA 4IE7A 4ZHQE 3O9XA 5LP6E 4MLKA 4E7SA 2P9BA 3KV5A 3VU7H 3ZMTB 3DTOA 3C4WA 1WRDA 2NW9A 4QX7B 3LBXB 1MMDA 2N2NA 3F2EA 5CA1E 5LJNA 2ZM0A 4H63H 5CB4E 3BK9A 2E9XC 3SS1A 2Q9QA 2LM9A 4OK0A 3B13A 4EOZB 2V26A 3PU8A 2MTQA 3P8CD 4ADZA 4ZI3C 4HEAA 3M65A 3AA7B 2LSJA 3ANWB 1HFAA 1OWAA 4J2CA 1FIOA 5HXCA 3RRWA 3AAIA 4XBFB 3HA4A 3N9OA 5DABA 5EK2A 4P0AA 3AVSA 3GWHA 5CA0E 3PE0A 4KP3C 3I9YA 3JC6D 1HTJF 1LRZA 1FMWA 1V9DA 3PTRB 2YK0A 3L09A 3AA6B 3KV6A 4ASKA 2E8IA 3C50A 3TKLB 1ZHCA 2VK9A 2Z6EA 2JQQA 5FXXA 3AAAB 2J1DG 3OJAA 4U74A 2DWKA 5IYZE 3PUAA 1HG5A 3K3NA 3Q9DA 3ZYMA 5HXRA 4KUMB 3W15B 4ZI3D 1G8XA 3RYHE 5L2LA 2KWHA 5FXZA 5JRCB 2X67A 4AKGA 1SHZC 1HCIA 1HG2A 1US7B 2XAJB 5KDMC 4I50E 3H3AA 3I0OA 2CXLA 2XASB 4WW0A 3O1JA 1ZEEA 2DHRA 3HR0A 5JDHA 5HXSA 2LT3A 3EDUA 2M67A 3ZC0A 5M4YA 3RYIE 3ANWA 2KLQA 2ODUA 2V7MA 2V7IA 4KBMB 3CX8B 2CWYA 1FEWA 3ETVA 2A3DA 5KMGP 4TZ4C 3ZMUB 5JREA 4G63A 2N1GA 5LHHB 4YJ3E 2SPCA 1QSDA 2CEAA 1HX8A 3PUSA 1BR2A 2C5KT 4AKIA 1MIWA 2DNXA 5J1GA 5TAOA 2MYSA 3IEEA 2X9XA 4HTEA 2WMNA 4YLHA 3ONXA 2KT9A 3PUQA 5L3DB 3PURA 1MMAA 3ZC1A 4UVAB 4N78D 3DJBA 2KINB 3MJXA 4PK4A 4QXBB 3C4ZA 3I1AA 2C5JA 5LOVE 3N9MA 3UUXB 4QKNA 4X20E 5L3FB 2LHRA 5F3JA 3CKDA 3KFWX 1YKEB 3PU3A 4KMCA 3BQKA 3OKQA 1VOMA 2PBIA 3UT5E 2KWIB 3N2OA 3RRCA 4YFSA 3FB2A 4PK5A 5LXTE 3LK2B 4OHFA 4HKAA 4A56A 4ZI7E 5LHIB 4DNDA 1D1CA 2I59A 3O1IA 4EB6E 2LOPA 4HGAA 4O8SA 3FBZA 2QGSA 4ZI2D 2XUEA 3BQIA 5LJMA 3ESLA 1U5PA 3KVBA 4YJ2E 4HE8A 4ZOLE 2CXFA 2X9HA 4CZZB 3ZPOA 1D0YA 3GA8A 4BA9A 2IC9A 4H9NC 3UULA 2VL8A 4EYUA 2D0UA 1D1BA 2W00A 3OYXA 3AA1B 2E9XD 4DO0A 1WYCA 2BVLA 4PJJA 3ZN1B 3AVRA 4H9QC 2VKJA 1ZKEA 2K9AA 1NWMX 1T98A 4WBNE 3D0TA 5J2UE 3P7IA 3K3QC 1ZV4X 3CQCB 4OYKA 2OA5A 4UF0B 2D5UA 2PG8A 1Y64B 5LNKA 2X0LB 4O2BE 3ZMZB 2K5BB 2K24A 3O1HA 2WBLA 2NP9A 5LBQB 4O4IE 2HPJA 3LJCA 3CPZA 1AJ3A 3UUMA 2XHEB 4I43B 1EZ3A 2D2SA 1UX5A 1O3XA 3K8PC 4JUYA 2Y6XA 4V1Av 1LKXA 3BQLA 3KBTA 3RX6A 2H3RA 3RPUA 4CI3B 1U4QA 3FXDB 3NRXA 2XQYA 4AQFA 4B6XA 3EDVA 3CVRA 2LSIA 2K48A 3ZLIA 2VKOA 4GK0E 1MNDA 3EUHA 4O4LE 2YU1A 2JMKA 4ISTA 4BAYB 3Q5WA 4FI5A 4DMVA 5HXEA 2JJ9A 1IJ6A 2LEHA 3OBVE 4NUUA 1MMGA 1IZNB 3A5XA 3AAEB 3UFEA 4O4JE 5L3BB 2VKHA 4UELA 1HF8A 2LSYA 3KBUA 4X1KE 2IAKA 3CMLA 4UV9B 3ZN0B 3ZYLA 2YEVC 5L3GB 2HH7A 4U72A 5C8YE 4PJLA 3EVYA 1MIVA 2CMRA 2A72A 3MA9A 4O4HE 4O2AE 2B1EA 5FY1A 4H9PC 1UX4A 2PFVA 3V5UA 3MK7C 2GK9A 3ZJ2A 3CX6B 3MACA 5JH7E 1MIYA 4AKRB 5EK4A 4QHOA 3R6NA 5HAXA 1YW0A 2X9WA 3N9QA 3RKOA 4K0UA 4GYSA 4I55E 4QXCB 3SWHA 2DCFA 3V5SA 4X1IE 1KNZA 1MMNA 4PJMA 3VKHA 4PAGA 5A1LA 5JDGA 1S35A 5JR9A 3ZJ1A 3PUGA 2EHOA 3RC3A 3Q2MA 4H63V 2Q9QB 3C51A 2DLRA 3F57A 2KNDA 4UEMA 2KMFA 2W61A 4IE6A 2LSKA 4M1PA 1MNEA 4XZCA 1IJ5A 2WMOA 1NAFA 4G2AA 4ZI2C 4E7ZA 1B7TA 3ZCIA 1S94A 4EAHA 2XAHB 3KVAA 5JQGE 2CLYC 3NRYA 1WR6A 5FMNA 2ZM2A 4DBRA 4PFPA 3S4UA 3N9NA 4YHJA 5JR9B 2ACXA 4TV8E 2DWGA 3IF8B 5JRCA 2L9QA 2W0GA 2Q9QC 2E9XA 3AA0B 3B57A 2UXXB 3KV4A 2RA1A 4CXXA 4AKHA 2KZ7B 2V7KA 1YD8G 2YINA 4NUVA 5LYJE 5LA6E 4TN7B 2WWUA 2RP4A 2N9DA 2EHOB 1YKHB 3K3OA 3NZQA 2V7LA 4CI2B 5E0OA 3E0ZA 4IE4A 3R84B 4AQGA 5JR9C 4P0BA 2LJLA 3KDSE 2VWAA 4H9RC 2Q9QD 4JEHB 5ADXL 2E9XB 3L3PA 2DI4A 2X68A 4UVBB 3IBPA 3MZKB 5LHGB 3FXEB 4UV8B 4ILUA 5HWYA 2NTYA 4CI1B 2JMHA 4ISSA 3LK3B 3RYFE 2EHOC 4FJOA 3MKDA 2BDEA 2XAQB 3LG7A 4UXNB 4XAXB 3FBLA 4Z8XA 3I0QA 3ETUA 2ES0A 3LBXA 1WLXA 5IHYA 2LOSA 4EIWA 1OXZA 3U3IA 3ZCJA 3E08A 3QUJA 4TUYE 3N2KE 3U78A 5AFUL 3CX7B 4JEUB 4WBOA 5HWXA 1BR4A 4MFRA 3WAJA 5LBMA 3WI3A 3GN5A 3HKCE 4BJMA 2VASA 5FY0A 5LGUB 3O4XE 1D0ZA 4UF0A 4EZHA 4UVCB 2ODVA 5FP3A 2NTXA 5H6QB 4CXWA 2CA5A 3ZMVB 4QX8B 2LHNA 4PNIA 2W62A 5L3EB 4EXTA 1HS7A 5FXWA 2X51A 3HKBE 2JRKA 2YU2A 4ZS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A72 A;  3C50 A;  3C4W A;  2I59 A;  1ZV4 X;  2ES0 A;  3C4X A;  3CX6 B;  1IAP A;  4IGU A;  3CX8 B;  3C4Z A;  3CX7 B;  4WBO A;  3T8O A;  4YHJ A;  2ACX A;  4GOU A;  1SHZ C;  4WNK A;  4L9I A;  3AB3 B;  3C51 A;  2DLR A;  3QC9 A;  4PNI A;  2PBI A;  1HTJ F; 
#chains in the Genus database with same CATH topology
 2XZE A;  5AFU L;  4JI5 T;  3VHL A;  5HEH A;  3C4X A;  2PJQ A;  4X66 T;  2CE7 A;  4IGU A;  2W63 A;  2BKO A;  3F31 A;  3GN5 B;  4ANJ A;  4UIG A;  2CWO A;  1BR0 A;  5H6R B;  3CQG B;  4HFV A;  3N2G E;  5AQI B;  3N9L A;  4UR9 A;  5FYM A;  3E22 E;  3RLF F;  3SFD A;  3T8O A;  2HHH T;  2XAG B;  2Y8D A;  2FJB A;  3J7Y q;  5AQF B;  2J47 A;  2W4X A;  5FY7 A;  3ZEF B;  4JI0 T;  3C64 A;  3OVU A;  2WB5 A;  1FMV A;  1W0A A;  3Q5E A;  2MAW A;  1LVK A;  4L5G A;  4U2Z A;  2UXN B;  2I0M A;  3HI2 A;  3IHR A;  5JVD E;  5EK3 A;  5HEO A;  5L47 A;  2ZM6 T;  4LF7 T;  3ZYK A;  1SA0 E;  2NW7 A;  2WY2 A;  2NOX A;  2JPF A;  3N5L A;  3NKZ A;  4BJN A;  4TV9 E;  2FJE A;  5BMV E;  2L8K A;  5DJQ C;  2BG9 B;  2WM9 A;  5JDF A;  2UXB T;  2HPL A;  2C0S A;  3HKE E;  3A8Y C;  4Z91 A;  1VCT A;  1VRB A;  3PDY A;  2UUA T;  4QXH B;  2V8S V;  5DQV A;  4LMJ A;  1UUS A;  2BVM A;  3Q5X A;  2LE8 A;  4OFZ A;  4IHJ E;  5EZY E;  5JDQ A;  4YTP A;  3UUN A;  1OED B;  3I9W A;  2UXC T;  3DP7 A;  2H7O A;  5F8P A;  4X65 T;  3CIR A;  3MXZ A;  4JLE A;  4P09 A;  4OX9 T;  1ZOY A;  1XZY A;  3FHN A;  3NZP A;  4WNK A;  5LB7 B;  1N36 T;  5JDL A;  4JI6 T;  2Y48 B;  2BS4 A;  1BR1 A;  2BBJ A;  3KIN B;  3OYZ A;  1KFY A;  4CN6 A;  5LGT B;  2V1D B;  2NWB A;  2V6Y A;  4MHC A;  4YHH T;  2VB6 A;  1SUM B;  4IE0 A;  2BG9 A;  3JC6 C;  3CQX C;  3J9X 1;  4Q25 A;  3SOL A;  3UU4 A;  2XAF B;  2X9Y A;  5L3C B;  5JRC B;  2VUR A;  3P4Q A;  2ZMA A;  3AE7 A;  4DR1 T;  4P1N A;  4HN9 A;  4L0R A;  5AQK B;  3HL6 A;  4CQI A;  3UU8 A;  1OED A;  4DMW A;  5KX5 E;  3LFM A;  4F6R C;  5J2T E;  4DVD A;  2L3L A;  2VKD A;  4YTM A;  4AI6 A;  4CXY A;  2IC6 A;  4LF4 T;  2CCQ A;  2CXD A;  2KXP B;  3KV9 A;  4X64 T;  2NW8 A;  5LG4 A;  3UQ4 A;  4Z90 A;  3RIA A;  5J0Z A;  2MOZ A;  4AQF C;  4PK6 A;  4DV2 T;  4QWN B;  2BS2 A;  2A2F X;  2CLY B;  4ZS2 A;  3PJA J;  3FZK B;  2HN2 A;  4ERR A;  2IW5 B;  4GIW A;  4IDZ A;  4JBW F;  3HKD E;  5DQW A;  4JI3 T;  2CHO A;  4DBQ A;  4JI4 T;  1KNP A;  2ZM8 A;  3LK4 2;  4GYR A;  3ZMS B;  2MBG A;  3GMI A;  3PUV F;  1Z0P A;  2JQH A;  3AEG A;  5LCY A;  1SE7 A;  4H9O C;  2WDR A;  4IE5 A;  4PW8 A;  3QK6 A;  5FXV A;  1W0B A;  5GON E;  4EED A;  2XJ7 A;  3JCF A;  2BZB A;  2X66 A;  4LFB T;  4AXP A;  2XQA A;  5JDM A;  4JI1 T;  3UTK A;  2EHO D;  5AQV B;  5FY1 A;  4GK5 E;  4DV7 T;  4IIJ E;  2XSB A;  4AKL A;  1X79 A;  2ZLY A;  1KNR A;  1QUU A;  3ONL C;  2G0U A;  4IDN A;  3CWZ B;  4MAL A;  4KHP T;  3VKG A;  5AQS B;  4DID B;  2XY8 B;  2C5I T;  1E1H B;  3QNU A;  1G73 A;  2H7V C;  1H7C A;  2X0Y A;  2XTL A;  3AEC A;  4HFE A;  3AE3 A;  4MBQ A;  3EHZ A;  4U2Y A;  3RF1 A;  3WAK A;  5KXJ A;  5L4E A;  3RC8 A;  3SRZ A;  3C98 B;  2D0T A;  2LSG A;  4PJN A;  4I4T E;  2V7J A;  2XM1 A;  3VRA A;  4EYY R;  5LGN B;  3VR9 A;  4AKG A;  3N9P A;  1QLB A;  2CM0 A;  4EEB A;  5JDN A;  3EAM A;  4C90 A;  2E5L T;  4PFO A;  4X1Y E;  4IL4 A;  2JQ9 A;  4A98 A;  2QA7 A;  3JAD A;  5FNV E;  1IAP A;  4H9S E;  2J62 A;  4EZ4 A;  3UU3 A;  2XQ4 A;  1CUN A;  3OTO T;  4KI0 F;  2CRB A;  1J5E T;  1KK7 A;  2IIU A;  5LMN T;  5CGM A;  2WSS V;  1WYB A;  3NBX X;  3RH3 A;  1LVF A;  5HXH A;  3H37 A;  1D0X A;  4OYJ A;  4GOU A;  2CBI A;  1UCU A;  4TX5 A;  2D9D A;  2WAU A;  4C91 A;  4L9I A;  4X5T A;  3RYC E;  1D1A A;  2LRL A;  3AB3 B;  1HNW T;  5ETW A;  4DR6 T;  3FZM B;  3QC9 A;  5HYA A;  4IE7 A;  5FVK A;  4ZHQ E;  3O9X A;  5LP6 E;  4MLK A;  4E7S A;  2P9B A;  4GKJ T;  2V5D A;  3KV5 A;  3VU7 H;  3ZMT B;  4DUZ T;  3DTO A;  2XQ7 A;  3C4W A;  1XMQ T;  2LKG A;  1WRD A;  3AE9 A;  3EI0 A;  2NW9 A;  4QX7 B;  3LBX B;  1MMD A;  2N2N A;  2BG9 E;  3F2E A;  4U31 A;  1T72 A;  2ZM0 A;  4H63 H;  5CB4 E;  5CA1 E;  1YQ4 A;  5LJN A;  3BK9 A;  2E9X C;  3SS1 A;  4DV0 T;  2Q9Q A;  4B3M T;  1N32 T;  2LM9 A;  4OK0 A;  3B13 A;  3RIU C;  2RPA A;  3A7M A;  2FJA A;  5HEJ A;  3UU5 A;  4A5X A;  4EOZ B;  3ZST A;  2V26 A;  3PU8 A;  4DR4 T;  2DL1 A;  2MTQ A;  3P8C D;  4JI2 T;  4ZI3 C;  4ADZ A;  4IT4 A;  4HEA A;  3M65 A;  4YSY A;  3VRB A;  3AA7 B;  5FL0 A;  2LSJ A;  3ANW B;  1HFA A;  1OWA A;  4J2C A;  1FIO A;  5HEG A;  5HXC A;  3AAI A;  3RRW A;  3HA4 A;  4XBF B;  3N9O A;  5DAB A;  5EK2 A;  4P0A A;  2WWV A;  3AVS A;  3GWH A;  5CA0 E;  3PE0 A;  4KP3 C;  3I9Y A;  3JC6 D;  1HTJ F;  1LRZ A;  1FMW A;  1V9D A;  2M6B A;  3PTR B;  2V5C A;  2YK0 A;  3AA6 B;  3KV6 A;  2E2A A;  2E8I A;  3C50 A;  3L09 A;  4U3C A;  1ZHC A;  3TKL B;  4ASK A;  2VK9 A;  5HWX A;  2Z6E A;  2JQQ A;  2YDS A;  3AAA B;  2J1D G;  5FXX A;  3RI5 A;  4ZZC A;  3OJA A;  4U74 A;  2DWK A;  5IYZ E;  5HEU A;  3PUA A;  1HG5 A;  3K3N A;  3Q9D A;  3ZYM A;  5HXR A;  4KUM B;  2YDQ A;  3W15 B;  2FJD A;  1G8X A;  3RYH E;  4TNW A;  4ZI3 D;  2BKP A;  2KWH A;  5L2L A;  5FXZ A;  4ILB A;  1VCS A;  2X67 A;  1CHU A;  1SHZ C;  1HCI A;  1HG2 A;  3AXJ B;  4TWH A;  4TWF A;  3ZSS A;  1US7 B;  2XAJ B;  5KDM C;  4YTN A;  4I50 E;  2UU9 T;  3PV0 F;  3H3A A;  3I0O A;  3B5M A;  5AQQ B;  2CXL A;  2XAS B;  4WW0 A;  3O1J A;  4LML A;  1ZEE A;  4DV4 T;  2DHR A;  3HR0 A;  5JDH A;  4O2A E;  2QYW A;  5HXS A;  2LT3 A;  3EDU A;  4ILA A;  2M67 A;  2QVA A;  3RIF A;  5M4Y A;  3ZC0 A;  3RYI E;  1UK5 A;  3ANW A;  2XQ9 A;  1XWM A;  2KLQ A;  2OV9 A;  2ODU A;  5IWA T;  2V7M A;  2V7I A;  4HFI A;  3TLU A;  4KBM B;  2CHN A;  3CX8 B;  4LMK A;  2CWY A;  1FEW A;  3ETV A;  2A3D A;  5KMG P;  4TZ4 C;  3ZMU B;  5JRE A;  4G63 A;  5L4H A;  2N1G A;  3AE1 A;  4YJ3 E;  1T8B A;  2SPC A;  5AQN B;  4COF A;  1QSD A;  5LHH B;  4YT0 A;  5BR8 T;  2CEA A;  2F4V T;  5FVL A;  1HX8 A;  3PUS A;  1BR2 A;  2C5K T;  4AKI A;  1MIW A;  2DNX A;  5J1G A;  5TAO A;  2MYS A;  3IEE A;  2AXD S;  5JTG A;  4I0U A;  4TNV A;  2VL0 A;  2X9X A;  4HTE A;  2WMN A;  3P4S A;  3ONX A;  4YLH A;  2KT9 A;  4LFA T;  1GQE A;  3PUQ A;  2LKH A;  5L3D B;  3PUR A;  1HNX T;  1MMA A;  3ZC1 A;  3L8R A;  1Y01 A;  1NEN A;  4UVA B;  4N78 D;  3DJB A;  2KIN B;  1J5W A;  3MJX A;  4PK4 A;  4HWF A;  4QXB B;  1DU2 A;  1ZP0 A;  3C4Z A;  2I6H A;  3T1H T;  3I1A A;  1KEY A;  2C5J A;  2LRK A;  4WYV A;  5LOV E;  3N9M A;  3UUX B;  4YY3 T;  4QKN A;  2IML A;  3PUW F;  2LHR A;  4X20 E;  1XDO A;  5L3F B;  1XMO T;  1IBK T;  4ZZB A;  5F3J A;  3CKD A;  3KFW X;  1YKE B;  3PU3 A;  5ABF B;  5AQL B;  4KMC A;  2M6I A;  3BQK A;  4F8H A;  3AEA A;  3OKQ A;  1VOM A;  3AE6 A;  2PBI A;  3NVO A;  4DV1 T;  3UT5 E;  2KWI B;  2XPK A;  3ZT6 A;  3N2O A;  3RRC A;  4YFS A;  3FB2 A;  4PK5 A;  3M3Z B;  1T7S A;  5LXT E;  1N33 T;  5AQT B;  2WCA A;  3LK2 B;  4HKA A;  4OHF A;  4A56 A;  4ZI7 E;  3UFG A;  5FKY A;  4DND A;  5LHI B;  1D1C A;  2I59 A;  3O1I A;  4EB6 E;  5FL1 A;  2LOP A;  4HGA A;  4O8S A;  3AE2 A;  2QGS A;  3FBZ A;  1L0V A;  4ZI2 D;  2XUE A;  3BQI A;  4DR5 T;  4JI8 T;  5LJM A;  4KX6 A;  3ESL A;  1U5P A;  3KVB A;  4YJ2 E;  4HE8 A;  4ZOL E;  3UU6 A;  4B3R T;  1WR0 A;  4GKK T;  2CXF A;  5ABH A;  2X9H A;  1E2A A;  4CZZ B;  3ZPO A;  1D0Y A;  3GA8 A;  4BA9 A;  2JQK A;  2IC9 A;  4CN1 A;  5ABF A;  1UGO A;  2OLT A;  4H9N C;  4A97 A;  3UUL A;  2VL8 A;  5CJ5 A;  4EYU A;  2D0U A;  1D1B A;  2W00 A;  3OYX A;  4IDQ A;  4HFC A;  3AA1 B;  2E9X D;  4DO0 A;  1WYC A;  2BVL A;  2WDV A;  4PJJ A;  3ZN1 B;  3AVR A;  4H9Q C;  2VKJ A;  3UQ7 A;  2UUB T;  1I94 T;  2FBW A;  1ZKE A;  2VVS A;  2K9A A;  1NWM X;  2WZI A;  4DUY T;  1T98 A;  4WBN E;  2BBH A;  2YKS A;  3FZL B;  3D0T A;  3T1Y T;  3RKG A;  3PUZ F;  5J2U E;  3P7I A;  3TLV A;  4B3T T;  3K3Q C;  4LF8 T;  3PJA A;  3AE8 A;  1ZV4 X;  2BKN A;  4DV6 T;  4LFC T;  2UXD T;  2CBJ A;  3CQC B;  4OYK A;  2OA5 A;  4UF0 B;  5AQG B;  2AE9 A;  2D5U A;  2PG8 A;  1Y64 B;  5LNK A;  2X0L B;  1FJG T;  4O2B E;  3ZMZ B;  3P4W A;  2K5B B;  2K24 A;  3O1H A;  4HFH A;  2QRX A;  2WBL A;  2NP9 A;  2XQ5 A;  4U7I A;  2WQY A;  5LBQ B;  4O4I E;  4NXN T;  1OED C;  2HPJ A;  3LJC A;  4HFD A;  2A9U A;  3CPZ A;  4XZC A;  3UUM A;  4JV5 T;  1AJ3 A;  2XHE B;  4I43 B;  1EZ3 A;  2D2S A;  1UX5 A;  1O3X A;  2XSA A;  3K8P C;  4JUY A;  4DR3 T;  2Y6X A;  4V1A v;  1LKX A;  3BQL A;  3KBT A;  3RGL A;  1W9R A;  3SFE A;  4YSX A;  3RX6 A;  2H3R A;  3RPU A;  4CI3 B;  1U4Q A;  4U33 A;  3FXD B;  3LDQ B;  3NRX A;  2XQY A;  4AQF A;  1IBL T;  4B6X A;  3OPC A;  5AQR B;  3EDV A;  3CVR A;  4QH1 A;  2LSI A;  2K48 A;  3ZLI A;  2VKO A;  4GK0 E;  1MND A;  3ONJ A;  4HWI B;  2IUB A;  3EUH A;  5AQP B;  3H3M A;  3K1S A;  1WFD A;  2JIW A;  2WU2 A;  2JMK A;  2YU1 A;  4IST A;  4O4L E;  4BAY B;  2X0H A;  5HCM A;  3Q5W A;  4FI5 A;  3ABV A;  2VQF T;  2ACZ A;  2KSR A;  4DMV A;  5HXE A;  2JJ9 A;  1IJ6 A;  4ILC A;  4LF5 T;  2LEH A;  1E7P A;  1JNZ A;  1MMG A;  1IZN B;  3OBV E;  4NUU A;  5IUX A;  3A5X A;  3AAE B;  4U7Y A;  4YXD A;  2K3W A;  3UFE A;  4O4J E;  4ZXL A;  5L3B B;  4JYA T;  2VKH A;  5ABE A;  2BG9 C;  4UEL A;  1HF8 A;  2LSY A;  3KBU A;  3QB5 A;  4X1K E;  4AQY T;  4AIU A;  4DR7 T;  2IAK A;  3CML A;  4UV9 B;  3ZN0 B;  5AQM B;  3ZYL A;  2YEV C;  4HWD A;  2HH7 A;  4U72 A;  2WP9 A;  5C8Y E;  5L3G B;  4PJL A;  5AQH B;  3EVY A;  3TLW A;  1MIV A;  2CMR A;  1M62 A;  2A72 A;  2MPK A;  3MA9 A;  2B1E A;  2CPT A;  4O4H E;  4H9P C;  1UX4 A;  1JNR A;  2PFV A;  1OED E;  3V5U A;  3MK7 C;  2GK9 A;  1HX1 B;  4EGW A;  3ZJ2 A;  3CX6 B;  3MAC A;  4EV6 A;  5JH7 E;  1MIY A;  4AKR B;  2HN1 A;  5EK4 A;  4QHO A;  3R6N A;  2H89 A;  5HAX A;  1YW0 A;  2X9W A;  3N9Q A;  3RKO A;  3VR8 A;  4K0U A;  1X9B A;  4GYS A;  4I55 E;  4QXC B;  4YSZ A;  3SWH A;  2DCF A;  3V5S A;  4X1I E;  1KNZ A;  1MMN A;  4TWD A;  2R6G F;  4PJM A;  2WDQ A;  3VKH A;  4IRE A;  4PAG A;  5A1L A;  3AED A;  5JDG A;  1S35 A;  4IDO A;  5JR9 A;  3EAB A;  3ZJ1 A;  2XM2 A;  3PUG A;  2EHO A;  3RC3 A;  3Q2M A;  4H63 V;  2Q9Q B;  3C51 A;  2DLR A;  3F57 A;  2KND A;  4UEM A;  3RHW A;  2KMF A;  2W61 A;  4IE6 A;  2LSK A;  3TLS A;  3PUY F;  4M1P A;  1MNE A;  2PTF A;  2W66 A;  2LM2 A;  1IJ5 A;  2J4G A;  2WMO A;  3LSV A;  2XQ8 A;  1NAF A;  1WCR A;  1J1J A;  2H88 A;  4G2A A;  3TLT A;  3CK6 A;  4ZI2 C;  4E7Z A;  5HCJ A;  1B7T A;  3ZCI A;  4CN4 A;  5LMU T;  1S94 A;  2BS3 A;  4EAH A;  2V6Y B;  4NPP A;  2XAH B;  3KVA A;  5JQG E;  2CLY C;  3P50 A;  5AQJ B;  3NRY A;  1WR6 A;  5FMN A;  2ZM2 A;  4DBR A;  3IA3 A;  4PFP A;  3RQW A;  3S4U A;  3N9N A;  4YHJ A;  4DR2 T;  2LLY A;  5JR9 B;  2ACX A;  2UUC T;  4X62 T;  4TV8 E;  2DWG A;  3IF8 B;  4IDP A;  5JRC A;  5C3J A;  2L9Q A;  2W0G A;  2NR4 A;  2Q9Q C;  1HR0 T;  2E9X A;  1I6Z A;  3AA0 B;  3QOF A;  3B57 A;  2UXX B;  3KV4 A;  2RA1 A;  4CXX A;  4AKH A;  4HWH A;  2KZ7 B;  2V7K A;  2WZH A;  1YD8 G;  2IDO B;  2YIN A;  2E5V A;  2YN6 A;  3L39 A;  3PUX F;  4NUV A;  4HWC A;  5LYJ E;  4B3S T;  5LA6 E;  4NXM T;  4TN7 B;  5AQO B;  4DV3 T;  1YQ3 A;  3AE4 A;  4JI7 T;  2WWU A;  1R8I A;  2RP4 A;  1M7K A;  2EHO B;  1YKH B;  2N9D A;  1NEK A;  2WU5 A;  3K3O A;  3NZQ A;  3FZF B;  1UUR A;  2V7L A;  4CI2 B;  5E0O A;  4IL9 A;  3E0Z A;  4IE4 A;  3R84 B;  2VVN A;  3QB5 K;  3RIU A;  4AQG A;  4P0B A;  5CFB A;  5JR9 C;  1HNZ T;  1XNQ T;  2LJL A;  2VQE T;  3KDS E;  2VWA A;  2W2U A;  2Q9Q D;  1KF6 A;  4H9R C;  3P4R A;  4JEH B;  4NIQ A;  2E9X B;  4AIS A;  5ADX L;  4K0K T;  3L3P A;  2DI4 A;  3NWI A;  2X68 A;  3P4P A;  3Q5D A;  4UVB B;  4LF6 T;  1XDP A;  3AE5 A;  3IBP A;  3MZK B;  1XNR T;  5LHG B;  3AEB A;  3FXE B;  4UV8 B;  4ILU A;  5HWY A;  2FUP A;  2NTY A;  2YOE A;  3ZKR A;  2JMH A;  4CI1 B;  5LG3 A;  4ISS A;  3LK3 B;  3AEE A;  4WZX A;  3RYF E;  1W09 A;  2B76 A;  2EHO C;  4FJO A;  3MKD A;  2BDE A;  2XAQ B;  2XQ6 A;  3UUB A;  3AXJ A;  2V6X A;  3RQU A;  5C2T A;  3LG7 A;  4UXN B;  4XAX B;  3FBL A;  4Z8X A;  3I0Q A;  4ZEY A;  3ETU A;  5AQU B;  2ES0 A;  4LF9 T;  1N34 T;  3JAF A;  2WS3 A;  3LBX A;  1WLX A;  3AEF A;  5IHY A;  2LOS A;  3ZT7 A;  1OXZ A;  3U3I A;  4EIW A;  3ZCJ A;  3E08 A;  3QUJ A;  1YXR A;  3N2K E;  4HFB A;  3FZH B;  3CX7 B;  4JEU B;  4TUY E;  4WBO A;  4KHZ F;  3U78 A;  1BR4 A;  4MFR A;  3WAJ A;  5LBM A;  3WI3 A;  4DV5 T;  3GN5 A;  3HKC E;  4BJM A;  2VAS A;  4QH4 A;  5FY0 A;  5LGU B;  1Z8U A;  3O4X E;  1D0Z A;  4UF0 A;  3ZT5 A;  3G06 A;  4UVC B;  4EZH A;  2ODV A;  1IBM T;  5FP3 A;  2NTX A;  4QH5 A;  5F5W A;  5H6Q B;  4CXW A;  2CA5 A;  3ZMV B;  4QX8 B;  2LHN A;  4PNI A;  2W62 A;  2W67 A;  3X1D A;  5ABG A;  4EXT A;  5L3E B;  1HS7 A;  3JAE A;  2IHR 1;  2X51 A;  2XQ3 A;  2YDR A;  2JRK A;  2YU2 A;  3HKB E;  5FXW A;  4ZS3 A; 
#chains in the Genus database with same CATH homology
 3VHL A;  3C4X A;  2PJQ A;  2CE7 A;  4IGU A;  2W63 A;  3F31 A;  3GN5 B;  4ANJ A;  4UIG A;  2CWO A;  1BR0 A;  5H6R B;  3CQG B;  4HFV A;  3N2G E;  5FYM A;  3N9L A;  3T8O A;  3E22 E;  2XAG B;  2Y8D A;  3J7Y q;  5FY7 A;  3ZEF B;  3C64 A;  1FMV A;  5JVD E;  1LVK A;  4L5G A;  2UXN B;  3HI2 A;  3IHR A;  5EK3 A;  3ZYK A;  1SA0 E;  2NW7 A;  2NOX A;  2JPF A;  3N5L A;  4BJN A;  4TV9 E;  5BMV E;  2L8K A;  5DJQ C;  2WM9 A;  5JDF A;  2HPL A;  2C0S A;  3HKE E;  1VRB A;  3PDY A;  4QXH B;  5DQV A;  4OFZ A;  2BVM A;  5EZY E;  3Q5X A;  2LE8 A;  5JDQ A;  4IHJ E;  3UUN A;  3I9W A;  3DP7 A;  2H7O A;  5F8P A;  3MXZ A;  4JLE A;  4P09 A;  4WNK A;  3FHN A;  3NZP A;  5JDL A;  2Y48 B;  1BR1 A;  3KIN B;  3OYZ A;  5LGT B;  2V1D B;  2NWB A;  4MHC A;  2VB6 A;  4IE0 A;  3JC6 C;  3CQX C;  3J9X 1;  3SOL A;  2XAF B;  2X9Y A;  5L3C B;  2ZMA A;  4HN9 A;  4L0R A;  3HL6 A;  4CQI A;  5KX5 E;  4DMW A;  5J2T E;  3LFM A;  4F6R C;  4DVD A;  2L3L A;  2VKD A;  4AI6 A;  4CXY A;  2IC6 A;  2CCQ A;  2CXD A;  2KXP B;  3KV9 A;  2NW8 A;  5LG4 A;  2MOZ A;  4AQF C;  4PK6 A;  4QWN B;  2A2F X;  2CLY B;  4ZS2 A;  4ERR A;  2IW5 B;  4GIW A;  4IDZ A;  5DQW A;  3HKD E;  4DBQ A;  2ZM8 A;  3LK4 2;  4GYR A;  3ZMS B;  2MBG A;  3GMI A;  1Z0P A;  5LCY A;  4H9O C;  4IE5 A;  4PW8 A;  3QK6 A;  5FXV A;  5GON E;  2BZB A;  2X66 A;  4AXP A;  5JDM A;  3UTK A;  2EHO D;  4GK5 E;  4IIJ E;  4AKL A;  1X79 A;  2ZLY A;  1QUU A;  4MAL A;  2G0U A;  3CWZ B;  3VKG A;  2C5I T;  1E1H B;  4MBQ A;  1G73 A;  2H7V C;  1H7C A;  2XTL A;  3RC8 A;  3WAK A;  3SRZ A;  3C98 B;  2D0T A;  2LSG A;  4PJN A;  4I4T E;  2V7J A;  4EYY R;  5LGN B;  3N9P A;  2CM0 A;  5JDN A;  4C90 A;  4PFO A;  4X1Y E;  2QA7 A;  5FNV E;  1IAP A;  4H9S E;  4EZ4 A;  1CUN A;  1KK7 A;  2WSS V;  1WYB A;  3NBX X;  3RH3 A;  1LVF A;  5HXH A;  3H37 A;  1D0X A;  4OYJ A;  4GOU A;  1UCU A;  4TX5 A;  2WAU A;  4C91 A;  4L9I A;  3RYC E;  1D1A A;  3AB3 B;  5ETW A;  3QC9 A;  5HYA A;  4IE7 A;  4ZHQ E;  3O9X A;  5LP6 E;  4MLK A;  4E7S A;  2P9B A;  3KV5 A;  3VU7 H;  3ZMT B;  3DTO A;  3C4W A;  1WRD A;  2NW9 A;  4QX7 B;  3LBX B;  1MMD A;  2N2N A;  3F2E A;  5CA1 E;  5LJN A;  2ZM0 A;  4H63 H;  5CB4 E;  3BK9 A;  2E9X C;  3SS1 A;  2Q9Q A;  2LM9 A;  4OK0 A;  3B13 A;  4EOZ B;  2V26 A;  3PU8 A;  2MTQ A;  3P8C D;  4ADZ A;  4ZI3 C;  4HEA A;  3M65 A;  3AA7 B;  2LSJ A;  3ANW B;  1HFA A;  1OWA A;  4J2C A;  1FIO A;  5HXC A;  3RRW A;  3AAI A;  4XBF B;  3HA4 A;  3N9O A;  5DAB A;  5EK2 A;  4P0A A;  3AVS A;  3GWH A;  5CA0 E;  3PE0 A;  4KP3 C;  3I9Y A;  3JC6 D;  1HTJ F;  1LRZ A;  1FMW A;  1V9D A;  3PTR B;  2YK0 A;  3L09 A;  3AA6 B;  3KV6 A;  4ASK A;  2E8I A;  3C50 A;  3TKL B;  1ZHC A;  2VK9 A;  2Z6E A;  2JQQ A;  5FXX A;  3AAA B;  2J1D G;  3OJA A;  4U74 A;  2DWK A;  5IYZ E;  3PUA A;  1HG5 A;  3K3N A;  3Q9D A;  3ZYM A;  5HXR A;  4KUM B;  3W15 B;  4ZI3 D;  1G8X A;  3RYH E;  5L2L A;  2KWH A;  5FXZ A;  5JRC B;  2X67 A;  4AKG A;  1SHZ C;  1HCI A;  1HG2 A;  1US7 B;  2XAJ B;  5KDM C;  4I50 E;  3H3A A;  3I0O A;  2CXL A;  2XAS B;  4WW0 A;  3O1J A;  1ZEE A;  2DHR A;  3HR0 A;  5JDH A;  5HXS A;  2LT3 A;  3EDU A;  2M67 A;  3ZC0 A;  5M4Y A;  3RYI E;  3ANW A;  2KLQ A;  2ODU A;  2V7M A;  2V7I A;  4KBM B;  3CX8 B;  2CWY A;  1FEW A;  3ETV A;  2A3D A;  5KMG P;  4TZ4 C;  3ZMU B;  5JRE A;  4G63 A;  2N1G A;  5LHH B;  4YJ3 E;  2SPC A;  1QSD A;  2CEA A;  1HX8 A;  3PUS A;  1BR2 A;  2C5K T;  4AKI A;  1MIW A;  2DNX A;  5J1G A;  5TAO A;  2MYS A;  3IEE A;  2X9X A;  4HTE A;  2WMN A;  4YLH A;  3ONX A;  2KT9 A;  3PUQ A;  5L3D B;  3PUR A;  1MMA A;  3ZC1 A;  4UVA B;  4N78 D;  3DJB A;  2KIN B;  3MJX A;  4PK4 A;  4QXB B;  3C4Z A;  3I1A A;  2C5J A;  5LOV E;  3N9M A;  3UUX B;  4QKN A;  4X20 E;  5L3F B;  2LHR A;  5F3J A;  3CKD A;  3KFW X;  1YKE B;  3PU3 A;  4KMC A;  3BQK A;  3OKQ A;  1VOM A;  2PBI A;  3UT5 E;  2KWI B;  3N2O A;  3RRC A;  4YFS A;  3FB2 A;  4PK5 A;  5LXT E;  3LK2 B;  4OHF A;  4HKA A;  4A56 A;  4ZI7 E;  5LHI B;  4DND A;  1D1C A;  2I59 A;  3O1I A;  4EB6 E;  2LOP A;  4HGA A;  4O8S A;  3FBZ A;  2QGS A;  4ZI2 D;  2XUE A;  3BQI A;  5LJM A;  3ESL A;  1U5P A;  3KVB A;  4YJ2 E;  4HE8 A;  4ZOL E;  2CXF A;  2X9H A;  4CZZ B;  3ZPO A;  1D0Y A;  3GA8 A;  4BA9 A;  2IC9 A;  4H9N C;  3UUL A;  2VL8 A;  4EYU A;  2D0U A;  1D1B A;  2W00 A;  3OYX A;  3AA1 B;  2E9X D;  4DO0 A;  1WYC A;  2BVL A;  4PJJ A;  3ZN1 B;  3AVR A;  4H9Q C;  2VKJ A;  1ZKE A;  2K9A A;  1NWM X;  1T98 A;  4WBN E;  3D0T A;  5J2U E;  3P7I A;  3K3Q C;  1ZV4 X;  3CQC B;  4OYK A;  2OA5 A;  4UF0 B;  2D5U A;  2PG8 A;  1Y64 B;  5LNK A;  2X0L B;  4O2B E;  3ZMZ B;  2K5B B;  2K24 A;  3O1H A;  2WBL A;  2NP9 A;  5LBQ B;  4O4I E;  2HPJ A;  3LJC A;  3CPZ A;  1AJ3 A;  3UUM A;  2XHE B;  4I43 B;  1EZ3 A;  2D2S A;  1UX5 A;  1O3X A;  3K8P C;  4JUY A;  2Y6X A;  4V1A v;  1LKX A;  3BQL A;  3KBT A;  3RX6 A;  2H3R A;  3RPU A;  4CI3 B;  1U4Q A;  3FXD B;  3NRX A;  2XQY A;  4AQF A;  4B6X A;  3EDV A;  3CVR A;  2LSI A;  2K48 A;  3ZLI A;  2VKO A;  4GK0 E;  1MND A;  3EUH A;  4O4L E;  2YU1 A;  2JMK A;  4IST A;  4BAY B;  3Q5W A;  4FI5 A;  4DMV A;  5HXE A;  2JJ9 A;  1IJ6 A;  2LEH A;  3OBV E;  4NUU A;  1MMG A;  1IZN B;  3A5X A;  3AAE B;  3UFE A;  4O4J E;  5L3B B;  2VKH A;  4UEL A;  1HF8 A;  2LSY A;  3KBU A;  4X1K E;  2IAK A;  3CML A;  4UV9 B;  3ZN0 B;  3ZYL A;  2YEV C;  5L3G B;  2HH7 A;  4U72 A;  5C8Y E;  4PJL A;  3EVY A;  1MIV A;  2CMR A;  2A72 A;  3MA9 A;  4O4H E;  4O2A E;  2B1E A;  5FY1 A;  4H9P C;  1UX4 A;  2PFV A;  3V5U A;  3MK7 C;  2GK9 A;  3ZJ2 A;  3CX6 B;  3MAC A;  5JH7 E;  1MIY A;  4AKR B;  5EK4 A;  4QHO A;  3R6N A;  5HAX A;  1YW0 A;  2X9W A;  3N9Q A;  3RKO A;  4K0U A;  4GYS A;  4I55 E;  4QXC B;  3SWH A;  2DCF A;  3V5S A;  4X1I E;  1KNZ A;  1MMN A;  4PJM A;  3VKH A;  4PAG A;  5A1L A;  5JDG A;  1S35 A;  5JR9 A;  3ZJ1 A;  3PUG A;  2EHO A;  3RC3 A;  3Q2M A;  4H63 V;  2Q9Q B;  3C51 A;  2DLR A;  3F57 A;  2KND A;  4UEM A;  2KMF A;  2W61 A;  4IE6 A;  2LSK A;  4M1P A;  1MNE A;  4XZC A;  1IJ5 A;  2WMO A;  1NAF A;  4G2A A;  4ZI2 C;  4E7Z A;  1B7T A;  3ZCI A;  1S94 A;  4EAH A;  2XAH B;  3KVA A;  5JQG E;  2CLY C;  3NRY A;  1WR6 A;  5FMN A;  2ZM2 A;  4DBR A;  4PFP A;  3S4U A;  3N9N A;  4YHJ A;  5JR9 B;  2ACX A;  4TV8 E;  2DWG A;  3IF8 B;  5JRC A;  2L9Q A;  2W0G A;  2Q9Q C;  2E9X A;  3AA0 B;  3B57 A;  2UXX B;  3KV4 A;  2RA1 A;  4CXX A;  4AKH A;  2KZ7 B;  2V7K A;  1YD8 G;  2YIN A;  4NUV A;  5LYJ E;  5LA6 E;  4TN7 B;  2WWU A;  2RP4 A;  2N9D A;  2EHO B;  1YKH B;  3K3O A;  3NZQ A;  2V7L A;  4CI2 B;  5E0O A;  3E0Z A;  4IE4 A;  3R84 B;  4AQG A;  5JR9 C;  4P0B A;  2LJL A;  3KDS E;  2VWA A;  4H9R C;  2Q9Q D;  4JEH B;  5ADX L;  2E9X B;  3L3P A;  2DI4 A;  2X68 A;  4UVB B;  3IBP A;  3MZK B;  5LHG B;  3FXE B;  4UV8 B;  4ILU A;  5HWY A;  2NTY A;  4CI1 B;  2JMH A;  4ISS A;  3LK3 B;  3RYF E;  2EHO C;  4FJO A;  3MKD A;  2BDE A;  2XAQ B;  3LG7 A;  4UXN B;  4XAX B;  3FBL A;  4Z8X A;  3I0Q A;  3ETU A;  2ES0 A;  3LBX A;  1WLX A;  5IHY A;  2LOS A;  4EIW A;  1OXZ A;  3U3I A;  3ZCJ A;  3E08 A;  3QUJ A;  4TUY E;  3N2K E;  3U78 A;  5AFU L;  3CX7 B;  4JEU B;  4WBO A;  5HWX A;  1BR4 A;  4MFR A;  3WAJ A;  5LBM A;  3WI3 A;  3GN5 A;  3HKC E;  4BJM A;  2VAS A;  5FY0 A;  5LGU B;  3O4X E;  1D0Z A;  4UF0 A;  4EZH A;  4UVC B;  2ODV A;  5FP3 A;  2NTX A;  5H6Q B;  4CXW A;  2CA5 A;  3ZMV B;  4QX8 B;  2LHN A;  4PNI A;  2W62 A;  5L3E B;  4EXT A;  1HS7 A;  5FXW A;  2X51 A;  3HKB E;  2JRK A;  2YU2 A;  4ZS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...