1HTJF

Structure of the rgs-like domain from pdz-rhogef
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
ESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KIAA0380
publication title Structure of the RGS-like domain from PDZ-RhoGEF: linking heterotrimeric g protein-coupled signaling to Rho GTPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 66
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2000-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1htjF00
3AB3B 4YHJA 4WNKA 4L9IA 4PNIA 2DLRA 3C4ZA 2PBIA 3CX8B 4WBOA 3CX7B 2A72A 3CX6B 1HTJF 2I59A 3T8OA 1ZV4X 3C4WA 1IAPA 3QC9A 4GOUA 2ES0A 4IGUA 3C50A 3C51A 1SHZC 2ACXA 3C4XA
chains in the Genus database with same CATH superfamily
3X1DA 1D0ZA 5E0OA 4ZZCA 5L2LA 4G2AA 2D2SA 4OX9T 3AAIA 5HXCA 3UTKA 4ZI3D 1W9RA 3ZJ1A 3KV4A 2WZHA 3ZYKA 2E9XC 4HE8A 2CPTA 4FI5A 3RX6A 4IE6A 1SHZC 3Q5WA 2L8KA 5AFUL 1XNRT 1VCSA 3PUSA 3UU3A 2HH7A 2WMNA 2QGSA 3PU3A 2XM1A 2K3WA 2L9QA 3VKHA 5HCJA 1BR1A 2LSJA 2NTXA 1R8IA 2V7IA 3EUHA 5HCMA 3QOFA 5J1GA 4B3RT 3I9YA 3NWIA 3AAAB 2CXLA 3RHWA 2KZ7B 1HFAA 2LHNA 4YSYA 2W66A 2HN2A 2M6IA 4IDZA 5L4HA 3RF1A 3UFEA 2YEVC 3IA3A 3T1YT 1US7B 4GYSA 3FBZA 3JADA 5JVDE 5LXTE 2IDOB 3P4WA 3P4SA 3DP7A 5JRCA 5AQPB 2I59A 2BBJA 4TWHA 4COFA 4LF6T 2JMHA 5HEJA 1YD8G 5LHIB 1CHUA 5LHGB 2CWOA 4H63H 3QNUA 2J47A 2H89A 4EV6A 3R6NA 2C0SA 1HTJF 2XAGB 2VURA 4CN1A 1XZYA 4EOZB 2HN1A 2BS2A 3JC6D 2QVAA 3PDYA 2YKSA 3PTRB 4EYYR 4DV6T 5L47A 1HG5A 3FZKB 3DTOA 2NOXA 3S4UA 4DV1T 4I4TE 4PK5A 2YDQA 4GIWA 5FYMA 5TAOA 3V5SA 3TLTA 4JI4T 3TLWA 1OEDA 3NBXX 3ZMVB 3O1JA 3RYIE 4ILAA 3ZEFB 4YJ2E 5AQJB 4ZHQE 1WRDA 4TX5A 4H9PC 5JR9A 2KXPB 5IHYA 3TLSA 4DBQA 2NWBA 2MPKA 3B5MA 5HXSA 4IDNA 3UUBA 3CQCB 4EIWA 3ESLA 3RC3A 3EABA 3JAFA 2A3DA 2CCQA 3CPZA 5GONE 3CQXC 2N1GA 4QX7B 3HI2A 1JNZA 1DU2A 2H3RA 5J2UE 2E5LT 4X20E 3PUWF 1G73A 3SS1A 5ABEA 4PJNA 3Q9DA 2HPLA 5L3DB 5C8YE 2UXNB 2RP4A 2JMKA 3RQWA 3UQ7A 1IBLT 3FB2A 4DMVA 3GA8A 1I94T 4EAHA 5AQQB 4U3CA 3L8RA 4HFVA 2FJEA 3AEDA 3AVSA 3SRZA 1M7KA 2JQ9A 4B3ST 2F4VT 3AXJA 3I0OA 2BVLA 4C90A 5LA6E 3B57A 3LBXB 5AQFB 2N9DA 3K8PC 4JEHB 3IHRA 3ETVA 3PJAA 3KDSE 4DV2T 2XAJB 1IBKT 4DV5T 3LK3B 1HF8A 2WBLA 4UVAB 2WM9A 2QYWA 4O8SA 1ZHCA 2LT3A 4AISA 4YHHT 3T1HT 4HWCA 2WWVA 4IL4A 4JI5T 2XQYA 3LG7A 3HKCE 4BJNA 2E9XA 4BJMA 1HCIA 4O4IE 2V7MA 5FVKA 4HN9A 1VOMA 2YDSA 1YKHB 4NPPA 3OTOT 3MKDA 3PV0F 2LM9A 1D1AA 2EHOC 2W67A 3U3IA 3QK6A 3GN5A 3F31A 3C51A 1KK7A 3AE8A 2IC9A 4UV8B 4EZHA 5DQVA 3EHZA 3Q5EA 4EEDA 4HKAA 3P8CD 4E7SA 2LJLA 3FZMB 2XZEA 2WZIA 3HKEE 3C64A 5EK3A 4ZS3A 3KVBA 4LMLA 3RPUA 5CGMA 5DABA 5JH7E 3ZCIA 4DBRA 2JIWA 2ES0A 3Q5XA 3RC8A 5IWAT 2XQ3A 2VKJA 2BVMA 2ACXA 3C4XA 2N2NA 3EI0A 4JI1T 3CX7B 3NZPA 3AA1B 3AEBA 1IAPA 3VR9A 4O4HE 4TV9E 4ADZA 2XM2A 4ANJA 3ZMTB 2KT9A 3PUYF 4O2AE 1FEWA 2DNXA 3AB3B 2SPCA 4V1Av 2BKNA 2NW9A 3AE1A 2OV9A 4WW0A 3C98B 2LSGA 5FP3A 5HEHA 4I50E 3HR0A 3RLFF 4JLEA 3OYZA 3AA6B 3UT5E 4X5TA 1J1JA 5IYZE 4NUUA 4CXXA 2A72A 2CE7A 2CBIA 4TWFA 4IE4A 4KX6A 3ZSTA 2ZMAA 5LJMA 2B76A 3N9LA 5HXRA 3KBUA 3PUQA 4AXPA 2LRLA 2DWGA 5FY0A 3T8OA 1XDOA 5L3GB 4NXNT 2W0GA 2BG9E 4PW8A 2V1DB 3O1HA 4CI2B 4AKLA 4EXTA 2JQKA 2J4GA 4ERRA 2LRKA 2JPFA 4Q25A 3FXEB 4IIJE 3C4ZA 4O2BE 3KV5A 3K1SA 4H63V 2RA1A 1LVFA 2FJBA 1V9DA 4JI6T 1NENA 5LMNT 3CK6A 3N9MA 2XQAA 3N9PA 1D1BA 5LMUT 5H6RB 2V8SV 2VL8A 4DMWA 2NW8A 4YTPA 3UU4A 4JI8T 2A2FX 3PUVF 2NW7A 4YSXA 4ZXLA 4DUZT 1FMWA 3EVYA 3I0QA 3UU5A 2RPAA 3M65A 4JBWF 5AQSB 1T72A 5LCYA 4ILBA 3P4PA 2MYSA 2VKDA 3CQGB 2D0TA 3G06A 1KNZA 2FJAA 5CJ5A 2CLYC 5HAXA 4U2ZA 5JRCB 3NVOA 3HA4A 2JRKA 4F8HA 1O3XA 4DR3T 2XPKA 4LFAT 4OYJA 4MLKA 2NR4A 4U7IA 4DO0A 4OK0A 4IE0A 4QH4A 2UU9T 4Z90A 2W62A 3RGLA 2V5DA 3FZLB 3ZSSA 1W0AA 2KSRA 2YDRA 4KBMB 5JDQA 2OLTA 3SWHA 2EHOA 3PUXF 3RH3A 2HHHT 4A97A 2X9YA 1N34T 3FZFB 4PFPA 1XWMA 5FXWA 3ZYMA 4A5XA 4GYRA 1Z8UA 2BS3A 2M6BA 4Z91A 1QUUA 2X9HA 4LMKA 1OEDB 2K5BB 5L4EA 2R6GF 4HFCA 2VB6A 4HWHA 2WDQA 4ZS2A 3ONJA 5JR9B 5CFBA 1D0XA 5L3BB 1Y64B 5FXXA 3TLUA 4DVDA 5H6QB 4TNWA 4EEBA 3NRYA 2YK0A 3H3AA 2WDRA 4LF7T 4HFBA 4KHPT 5C3JA 2X0HA 4ZI2C 3VU7H 2CMRA 2WS3A 4IREA 4JI3T 2VL0A 4B3MT 2BKOA 3OVUA 5JDFA 2XQ4A 2XJ7A 2ACZA 4U33A 3ZYLA 5LBMA 3P4RA 3SFDA 4AKIA 2VKOA 1M62A 3ETUA 2IUBA 3NKZA 2NTYA 4CN6A 3UUXB 4WYVA 3KINB 2X9XA 1QSDA 3NZQA 4YXDA 2ODUA 2VASA 2H7OA 3RIFA 3AXJB 3UU8A 3TLVA 1LVKA 3RYFE 1S94A 4NIQA 3B13A 1MIWA 2CLYB 2D5UA 3AEEA 4L5GA 4MBQA 4A98A 4IE7A 2XY8B 2UUAT 1YW0A 3KV6A 4P1NA 5F8PA 3OJAA 1FJGT 2K24A 4DV7T 2IIUA 2C5KT 2JQHA 3A8YC 1ZOYA 2XAFB 2E9XB 1CUNA 2PBIA 5FL1A 1HG2A 2LKGA 4CN4A 4H9SE 3MZKB 4PJLA 4ZI7E 2VKHA 2ZM0A 2P9BA 5EK4A 3AAEB 3RIUC 2CRBA 2OA5A 4IDOA 3I1AA 2ZM8A 4HTEA 3UUMA 3GN5B 3I9WA 4PK6A 3ZPOA 1VRBA 3AVRA 4X1IE 5LYJE 2CHOA 5KMGP 3MK7C 3AE6A 3KFWX 4ZI3C 5KX5E 3UUNA 2UXBT 3PUGA 4K0KT 4UIGA 2E8IA 4U2YA 1L0VA 4GKKT 4NUVA 1XDPA 3QC9A 2Y6XA 1E1HB 1BR4A 5FXZA 1HX1B 5FNVE 5HYAA 3AEGA 4IL9A 3AE9A 4H9NC 2QA7A 3P50A 1FIOA 1WR0A 3Q2MA 3ZKRA 5AQGB 4AQFC 4GK0E 4HFEA 3HKBE 5J2TE 3MA9A 3FBLA 4XZCA 4F6RC 2V7KA 2MBGA 4B3TT 2W4XA 2X68A 2XSBA 3C4WA 5AQTB 3PURA 2CBJA 1EZ3A 2V6YA 2KNDA 1E2AA 3BQIA 4U31A 3U78A 5ADXL 2DI4A 2CA5A 2E5VA 3MXZA 1T98A 1W0BA 2WB5A 5FMNA 2AXDS 3HL6A 3AE3A 1KNRA 2BBHA 4BA9A 2X51A 4X62T 3CVRA 5JDLA 3K3OA 3JC6C 4AQGA 3E08A 4LF9T 1W09A 2WAUA 3H3MA 4B6XA 3A5XA 1YQ4A 4HWDA 3OPCA 2H7VC 5LNKA 2UXCT 1X9BA 2PFVA 3UQ4A 5AQRB 1U4QA 4FJOA 2IW5B 1ZP0A 2WMOA 2Y8DA 2LOSA 2XQ6A 5LGUB 4O4LE 4QH1A 1UX4A 3O4XE 2DCFA 4OYKA 4WBNE 5BR8T 2WU2A 3AEAA 3LSVA 3GMIA 4ZEYA 2E9XD 1IZNB 2YU2A 3ZN1B 3VHLA 2WWUA 2KMFA 1ZEEA 4PJJA 3WAJA 1HNZT 4UVCB 4P0AA 3UFGA 3RI5A 3CWZB 5ABHA 5EK2A 5F3JA 2VQET 1D1CA 4YSZA 3RRWA 5CA0E 2XASB 3M3ZB 1T8BA 2CEAA 3TKLB 3UULA 4HFDA 5CB4E 2X0LB 3PE0A 3MJXA 5KXJA 3FHNA 4GKJT 5FY1A 2WQYA 4DV3T 2LSYA 3OBVE 2LM2A 2LKHA 1WLXA 4LF5T 4U72A 3AA7B 4EYUA 4TWDA 2VQFT 3SOLA 1HR0T 3RIAA 3FZHB 5F5WA 2WSSV 4IDPA 1JNRA 3J9X1 4L9IA 5FL0A 5JDGA 5JREA 4X65T 2EHOB 3RIUA 4EZ4A 3O1IA 2XQ5A 3ZC1A 3VR8A 4DR2T 4I43B 4WZXA 4EB6E 5LG3A 5FKYA 3J7Yq 4H9RC 4ISSA 3L09A 3IF8B 3OYXA 2XSAA 4DR6T 3PU8A 3N2OA 3FXDB 5AQUB 5JTGA 2FJDA 4TNVA 1VCTA 2XQ8A 2ZM6T 4YHJA 2V26A 2ODVA 2MAWA 3OKQA 2VVNA 2YINA 4YJ3E 4UF0B 4LF8T 4P0BA 4TV8E 3ABVA 4IGUA 2DWKA 3W15B 4CZZB 4JUYA 1NAFA 5LP6E 2J1DG 3ZMUB 2K48A 4I0UA 2YOEA 3NRXA 5LBQB 1UURA 2PJQA 2W00A 3R84B 5JDMA 2CXDA 4BAYB 4AQFA 3EDVA 1J5ET 3E0ZA 2B1EA 4ISTA 3AA0B 3RYCE 5LHHB 4DR5T 3ZCJA 5FY7A 2K9AA 3DJBA 3ANWA 5JQGE 4HFHA 4QX8B 1Y01A 2LLYA 4CQIA 4DUYT 1N33T 2UXDT 1ZV4X 1YXRA 4KP3C 4N78D 3LDQB 5L3EB 3P7IA 4KI0F 2BKPA 3JAEA 1KFYA 4QWNB 5AQVB 3MACA 4HFIA 5ABFB 3PUZF 2YN6A 2VVSA 1UCUA 1D0YA 2UXXB 4LFBT 1SA0E 1OWAA 3D0TA 5AQMB 2WU5A 3ZT6A 5A1LA 3CIRA 1ZKEA 2CWYA 4UF0A 4DIDB 2LSKA 4Z8XA 2WP9A 2IHR1 4IE5A 2KWIB 2HPJA 4GOUA 4PAGA 1IJ5A 3P4QA 2J62A 4LMJA 2Q9QC 3O9XA 4TUYE 3ZT7A 1N36T 4CI3B 2IC6A 3H37A 3Q5DA 4L0RA 1LRZA 3PJAJ 3CX8B 5LJNA 1OXZA 2MOZA 2EHOD 3A7MA 3AE7A 2AE9A 5ETWA 1XMOT 4AQYT 3WAKA 1HX8A 4H9QC 3BQLA 3GWHA 4DNDA 1Z0PA 5AQIB 5DQWA 3CX6B 4HGAA 1NEKA 1BR0A 1WYBA 2XUEA 4DV0T 2Z6EA 2VWAA 2WCAA 1KNPA 4X1YE 2LE8A 1OEDE 2DLRA 4OFZA 2XAHB 4P09A 3VRBA 5ABFA 4XAXB 2E2AA 1HNWT 3K3QC 3CKDA 5L3FB 2X0YA 2I0MA 4MHCA 2LHRA 4YFSA 2KWHA 4JI2T 1G8XA 1MNEA 5AQHB 3QUJA 4QKNA 4ILUA 3N5LA 3ZN0B 2Y48B 1HS7A 4CXYA 4K0UA 2V7JA 2X9WA 2BZBA 2XAQB 2XQ9A 2I6HA 3EAMA 4UXNB 4NXMT 3QB5K 2M67A 2V6YB 2BG9C 3KVAA 4E7ZA 3LK42 5HEUA 3F2EA 1BR2A 1S35A 4TZ4C 1MMGA 1J5WA 4J2CA 3RKOA 4OHFA 4AKRB 3RRCA 1H7CA 1MNDA 2BDEA 4EGWA 4LF4T 2C5JA 3IEEA 5HWYA 1UK5A 3ZLIA 3F57A 4IT4A 2DL1A 2H88A 4KMCA 2GK9A 1WYCA 1YKEB 3ZC0A 4O4JE 4KUMB 4MFRA 3VRAA 1KF6A 4PFOA 2W63A 5HEGA 4A56A 4IDQA 2Q9QB 4HWIB 4LFCT 3ZT5A 5FXVA 4GK5E 1WFDA 2DHRA 1AJ3A 4ZOLE 5LGTB 4AKHA 4YY3T 4YT0A 1MIVA 2PG8A 4QXCB 4CXWA 3ONXA 1LKXA 2CXFA 4TN7B 1IBMT 3ZMSB 4JYAT 2UUCT 5HWXA 1B7TA 1MMAA 3LFMA 5HXEA 3PUAA 2WDVA 1MMNA 5LB7B 2QRXA 4PJMA 2FBWA 3AECA 1WR6A 3AE5A 4I55E 4WNKA 3BK9A 4PNIA 4KHZF 5ABGA 2W61A 4WBOA 4X64T 3KBTA 5CA1E 1X79A 3RQUA 2IAKA 2YU1A 3L3PA 1QLBA 2CM0A 5C2TA 3KV9A 5JDHA 1HNXT 4U7YA 2PTFA 4UELA 4C91A 5J0ZA 2Q9QA 3LBXA 3IBPA 4UEMA 5LG4A 4ILCA 3RKGA 2A9UA 2X66A 1E7PA 3L39A 5AQKB 4ASKA 2BG9B 3V5UA 3AEFA 2NP9A 3RYHE 2ZM2A 3EDUA 2C5IT 2IMLA 2V5CA 5AQOB 1KEYA 1N32T 4JI0T 3N9QA 2XHEB 2VK9A 4IHJE 4CI1B 3BQKA 4X1KE 3AE4A 1GQEA 2LOPA 4QH5A 2JJ9A 5KDMC 4G63A 3C50A 4M1PA 3N2GE 2V7LA 4XBFB 4YTMA 3QB5A 5HEOA 4ZI2D 4H9OC 1OEDC 2CHNA 2Q9QD 4DR4T 2G0UA 1U5PA 1SE7A 3K3NA 4UV9B 4ZZBA 2ZLYA 2LEHA 1YQ3A 4UR9A 5JR9C 2XQ7A 2UUBT 4X66T 4QHOA 4HEAA 1IJ6A 4PK4A 4DR7T 3ANWB 2D9DA 4QXBB 3HKDE 4JV5T 1T7SA 5EZYE 4JI7T 1MIYA 2BG9A 1XMQT 2V6XA 3LK2B 4YLHA 5DJQC 2WY2A 3UU6A 4MALA 2KLQA 4YTNA 5JDNA 3JCFA 3SFEA 1UGOA 2FUPA 5M4YA 5AQLB 2BS4A 5LOVE 4JEUB 4DR1T 5AQNB 5LGNB 3N9NA 1UX5A 2XTLA 3AE2A 5IUXA 5L3CB 3CMLA 2D0UA 2JQQA 4U74A 5FVLA 1SUMB 4AIUA 2MTQA 3ZMZB 1NWMX 1XNQT 3ONLC 5HXHA 3VKGA 1I6ZA 4UVBB 3N9OA 1FMVA 1WCRA 2X67A 3LJCA 4QXHB 2KINB 4DV4T 4AI6A 3N2KE 2W2UA 3E22E 1MMDA 2L3LA 4AKGA 3ZJ2A 1UUSA 4HWFA 5BMVE 2LSIA 3WI3A
chains in the Genus database with same CATH topology
4GK0E 2Z6EA 2VWAA 3HKBE 4X1YE 5J2TE 3MA9A 1D0ZA 2LE8A 4NUUA 5E0OA 2DLRA 3FBLA 4OFZA 5IYZE 2XAHB 4P09A 4XZCA 4CXXA 4F6RC 2A72A 4G2AA 2D2SA 2CE7A 4XAXB 5L2LA 2V7KA 2MBGA 3AAIA 5HXCA 3UTKA 4ZI3D 3ZJ1A 2X68A 3KV4A 3C4WA 3K3QC 3CKDA 3ZYKA 4IE4A 5L3FB 2E9XC 4HE8A 2LHRA 4MHCA 3PURA 4FI5A 4YFSA 1EZ3A 2KWHA 2ZMAA 5LJMA 1G8XA 4IE6A 3RX6A 1SHZC 1MNEA 2KNDA 3Q5WA 3QUJA 3BQIA 2L8KA 4QKNA 5AFUL 3U78A 3N9LA 4ILUA 5HXRA 3PUSA 3N5LA 2DI4A 2CA5A 3ZN0B 2HH7A 3MXZA 5ADXL 1T98A 2WMNA 2Y48B 2QGSA 1HS7A 3KBUA 3PUQA 4AXPA 3PU3A 2DWGA 5FY0A 4CXYA 4K0UA 5FMNA 2V7JA 3T8OA 2L9QA 2X9WA 3VKHA 2BZBA 2XAQB 1BR1A 3HL6A 2LSJA 2NTXA 2V7IA 5L3GB 4UXNB 3EUHA 2W0GA 4BA9A 2X51A 3CVRA 5JDLA 5J1GA 3K3OA 4PW8A 2V1DB 3JC6C 3O1HA 3I9YA 2M67A 4AQGA 4CI2B 4AKLA 3AAAB 4EXTA 3E08A 2CXLA 2WAUA 4ERRA 2JPFA 2KZ7B 3FXEB 1HFAA 4IIJE 4B6XA 3KVAA 2LHNA 4E7ZA 3A5XA 3C4ZA 3LK42 4O2BE 3F2EA 4IDZA 2H7VC 3KV5A 3UFEA 2YEVC 5LNKA 2PFVA 1BR2A 4H63V 1S35A 1U4QA 2RA1A 4FJOA 4TZ4C 2IW5B 1LVFA 1MMGA 1V9DA 2WMOA 1US7B 4GYSA 4J2CA 3RKOA 4OHFA 3FBZA 2Y8DA 3N9MA 4AKRB 2LOSA 3N9PA 3RRCA 1D1BA 5JVDE 1H7CA 5LGUB 5LXTE 4O4LE 5H6RB 1MNDA 2BDEA 1UX4A 3O4XE 2VL8A 2DCFA 3DP7A 4DMWA 2NW8A 4OYKA 4WBNE 2C5JA 3IEEA 5JRCA 5HWYA 2A2FX 2I59A 2NW7A 3ZLIA 3GMIA 2E9XD 1IZNB 3F57A 2YU2A 2JMHA 4KMCA 2GK9A 1WYCA 1YD8G 1FMWA 3ZN1B 5LHIB 1YKEB 3EVYA 3I0QA 5LHGB 3VHLA 3M65A 2CWOA 4O4JE 3ZC0A 2WWUA 2KMFA 1ZEEA 4KUMB 4PJJA 4H63H 4MFRA 3WAJA 5LCYA 4UVCB 4P0AA 2MYSA 4PFOA 2VKDA 2W63A 2D0TA 3CQGB 3CWZB 3R6NA 2C0SA 5EK2A 1KNZA 4A56A 1HTJF 2Q9QB 2CLYC 5HAXA 5F3JA 2XAGB 5JRCB 1D1CA 3HA4A 4EOZB 2JRKA 3JC6D 1O3XA 4GK5E 5FXVA 3RRWA 3PDYA 2DHRA 4OYJA 5CA0E 4MLKA 2XASB 1AJ3A 4DO0A 3TKLB 2CEAA 3PTRB 4OK0A 4EYYR 4ZOLE 3UULA 5CB4E 4IE0A 5LGTB 4AKHA 1HG5A 2X0LB 3DTOA 3PE0A 2NOXA 3S4UA 1MIVA 2PG8A 4QXCB 4I4TE 4CXWA 3MJXA 3ONXA 2W62A 4PK5A 1LKXA 3FHNA 2CXFA 4TN7B 4GIWA 5FYMA 5TAOA 3V5SA 4KBMB 5JDQA 3ZMVB 3NBXX 3ZMSB 5FY1A 3O1JA 3RYIE 3SWHA 3ZEFB 4YJ2E 2EHOA 3RH3A 2LSYA 2X9YA 4ZHQE 1WRDA 4TX5A 3OBVE 4H9PC 5JR9A 5HWXA 2KXPB 1B7TA 4PFPA 5IHYA 1WLXA 5FXWA 1MMAA 3AA7B 4U72A 3LFMA 3ZYMA 4EYUA 5HXEA 3PUAA 4DBQA 4GYRA 2NWBA 3SOLA 5HXSA 1MMNA 3CQCB 4EIWA 3ESLA 4PJMA 1QUUA 3RC3A 2WSSV 1WR6A 2X9HA 2A3DA 2CCQA 3J9X1 2K5BB 3CPZA 3BK9A 4I55E 4L9IA 4PNIA 4WNKA 2VB6A 5GONE 5JDGA 5JREA 2EHOB 2W61A 3CQXC 4WBOA 2N1GA 4EZ4A 4QX7B 3HI2A 3KBTA 3O1IA 3ZC1A 4ZS2A 5CA1E 1X79A 2H3RA 5JR9B 5J2UE 4X20E 1D0XA 2IAKA 4I43B 1G73A 5L3BB 1Y64B 2YU1A 3L3PA 5FXXA 2CM0A 4EB6E 4DVDA 3SS1A 3KV9A 5H6QB 4PJNA 5JDHA 3Q9DA 3J7Yq 2HPLA 5L3DB 4H9RC 3NRYA 5C8YE 2UXNB 4ISSA 2YK0A 3L09A 4UELA 3IF8B 3H3AA 4C91A 2Q9QA 3OYXA 2RP4A 2JMKA 3LBXA 3IBPA 4UEMA 5LG4A 3PU8A 3N2OA 3FB2A 4DMVA 3FXDB 2X66A 3GA8A 4EAHA 4ZI2C 4ASKA 3VU7H 2CMRA 3V5UA 4HFVA 2NP9A 3RYHE 2ZM2A 3AVSA 3SRZA 3EDUA 2C5IT 4YHJA 5JDFA 2V26A 2ODVA 3OKQA 3I0OA 2YINA 3ZYLA 4YJ3E 4UF0B 2BVLA 4P0BA 5LBMA 3N9QA 2XHEB 2VK9A 3B57A 3LBXB 4IHJE 4TV8E 5LA6E 4C90A 4CI1B 4IGUA 2DWKA 2N9DA 3W15B 4CZZB 4JUYA 4AKIA 3K8PC 1NAFA 2VKOA 5LP6E 4JEHB 3ETUA 3IHRA 3ETVA 2J1DG 3ZMUB 2K48A 2NTYA 3NRXA 3KDSE 5LBQB 2PJQA 2XAJB 3BQKA 4X1KE 2W00A 3UUXB 3R84B 5JDMA 2CXDA 3LK3B 1HF8A 3KINB 2WBLA 4UVAB 2WM9A 2LOPA 2X9XA 4BAYB 1QSDA 3NZQA 4AQFA 3EDVA 2JJ9A 4O8SA 2ODUA 2VASA 2H7OA 1ZHCA 3E0ZA 2LT3A 5KDMC 2B1EA 4G63A 1LVKA 3C50A 4ISTA 4M1PA 3RYFE 3AA0B 1S94A 3N2GE 3RYCE 5LHHB 3B13A 2XQYA 1MIWA 2CLYB 3HKCE 3LG7A 5FY7A 3ZCJA 2K9AA 4BJNA 3DJBA 2E9XA 3ANWA 4BJMA 5JQGE 1HCIA 2V7LA 4QX8B 2D5UA 4L5GA 4O4IE 2V7MA 4XBFB 4MBQA 4HN9A 4CQIA 1VOMA 4IE7A 1YKHB 4ZI2D 3MKDA 4H9OC 1YW0A 1ZV4X 2Q9QD 2LM9A 2G0UA 1U5PA 1D1AA 4KP3C 3K3NA 2EHOC 3KV6A 4N78D 4UV9B 3U3IA 5L3EB 2ZLYA 3QK6A 3P7IA 5F8PA 3GN5A 2LEHA 3F31A 3OJAA 3C51A 1KK7A 5JR9C 2K24A 4QHOA 4HEAA 2IC9A 1IJ6A 4UV8B 2C5KT 4QWNB 4EZHA 4PK4A 2XAFB 2E9XB 1CUNA 2PBIA 3ANWB 5DQVA 4QXBB 3MACA 3HKDE 1HG2A 4HKAA 5EZYE 1MIYA 3P8CD 4H9SE 4E7SA 1UCUA 3MZKB 4PJLA 2LJLA 4ZI7E 2VKHA 1D0YA 2UXXB 2ZM0A 2P9BA 3LK2B 5EK4A 3HKEE 4YLHA 3AAEB 3C64A 5EK3A 1SA0E 1OWAA 4ZS3A 2OA5A 3D0TA 3I1AA 3KVBA 3RPUA 2ZM8A 4HTEA 5DJQC 3UUMA 3GN5B 3I9WA 5DABA 4PK6A 3ZPOA 4MALA 5A1LA 2KLQA 1VRBA 5JH7E 3AVRA 1ZKEA 2CWYA 5JDNA 4UF0A 3ZCIA 4DBRA 4X1IE 5LYJE 2LSKA 5KMGP 5M4YA 3MK7C 4Z8XA 4IE5A 2KWIB 2HPJA 5LOVE 4GOUA 4JEUB 2ES0A 4PAGA 3Q5XA 1IJ5A 3KFWX 4ZI3C 3RC8A 5LGNB 3N9NA 1UX5A 2Q9QC 2XTLA 5KX5E 3O9XA 2VKJA 4TUYE 3UUNA 2BVMA 4CI3B 2ACXA 2IC6A 3C4XA 3H37A 2N2NA 3PUGA 5L3CB 3CMLA 4L0RA 1LRZA 2D0UA 2JQQA 4U74A 4UIGA 2E8IA 3CX8B 3CX7B 5LJNA 3NZPA 3AA1B 4NUVA 2MTQA 1OXZA 2MOZA 2EHOD 3ZMZB 1NWMX 5ETWA 1IAPA 3QC9A 5HXHA 4O4HE 4TV9E 3VKGA 4ADZA 4ANJA 3WAKA 3ZMTB 2Y6XA 4UVBB 2KT9A 1HX8A 3N9OA 1E1HB 1FMVA 4O2AE 4H9QC 1BR4A 1FEWA 2DNXA 3AB3B 3BQLA 2SPCA 4V1Av 5FXZA 2X67A 3GWHA 4DNDA 1Z0PA 5FNVE 2NW9A 5HYAA 3LJCA 4QXHB 2KINB 5DQWA 3CX6B 4WW0A 4AI6A 3N2KE 3C98B 4H9NC 2QA7A 3E22E 1MMDA 4HGAA 2L3LA 4AKGA 3ZJ2A 2LSGA 1FIOA 5FP3A 4I50E 1BR0A 5BMVE 1WYBA 2XUEA 3HR0A 3Q2MA 2LSIA 4JLEA 3OYZA 4AQFC 3WI3A 3AA6B 3UT5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB3 B;  4YHJ A;  4WNK A;  4L9I A;  4PNI A;  2DLR A;  3C4Z A;  2PBI A;  3CX8 B;  4WBO A;  3CX7 B;  2A72 A;  3CX6 B;  1HTJ F;  2I59 A;  3T8O A;  1ZV4 X;  3C4W A;  1IAP A;  3QC9 A;  4GOU A;  2ES0 A;  4IGU A;  3C50 A;  3C51 A;  1SHZ C;  2ACX A;  3C4X A; 
#chains in the Genus database with same CATH topology
 3X1D A;  1D0Z A;  5E0O A;  4ZZC A;  5L2L A;  4G2A A;  2D2S A;  4OX9 T;  3AAI A;  5HXC A;  3UTK A;  4ZI3 D;  1W9R A;  3ZJ1 A;  3KV4 A;  2WZH A;  3ZYK A;  2E9X C;  4HE8 A;  2CPT A;  4FI5 A;  3RX6 A;  4IE6 A;  1SHZ C;  3Q5W A;  2L8K A;  5AFU L;  1XNR T;  1VCS A;  3PUS A;  3UU3 A;  2HH7 A;  2WMN A;  2QGS A;  3PU3 A;  2XM1 A;  2K3W A;  2L9Q A;  3VKH A;  5HCJ A;  1BR1 A;  2LSJ A;  2NTX A;  1R8I A;  2V7I A;  3EUH A;  5HCM A;  3QOF A;  5J1G A;  4B3R T;  3I9Y A;  3NWI A;  3AAA B;  2CXL A;  3RHW A;  2KZ7 B;  1HFA A;  2LHN A;  4YSY A;  2W66 A;  2HN2 A;  2M6I A;  4IDZ A;  5L4H A;  3RF1 A;  3UFE A;  2YEV C;  3IA3 A;  3T1Y T;  1US7 B;  4GYS A;  3FBZ A;  3JAD A;  5JVD E;  5LXT E;  2IDO B;  3P4W A;  3P4S A;  3DP7 A;  5JRC A;  5AQP B;  2I59 A;  2BBJ A;  4TWH A;  4COF A;  4LF6 T;  2JMH A;  5HEJ A;  1YD8 G;  5LHI B;  1CHU A;  5LHG B;  2CWO A;  4H63 H;  3QNU A;  2J47 A;  2H89 A;  4EV6 A;  3R6N A;  2C0S A;  1HTJ F;  2XAG B;  2VUR A;  4CN1 A;  1XZY A;  4EOZ B;  2HN1 A;  2BS2 A;  3JC6 D;  2QVA A;  3PDY A;  2YKS A;  3PTR B;  4EYY R;  4DV6 T;  5L47 A;  1HG5 A;  3FZK B;  3DTO A;  2NOX A;  3S4U A;  4DV1 T;  4I4T E;  4PK5 A;  2YDQ A;  4GIW A;  5FYM A;  5TAO A;  3V5S A;  3TLT A;  4JI4 T;  3TLW A;  1OED A;  3NBX X;  3ZMV B;  3O1J A;  3RYI E;  4ILA A;  3ZEF B;  4YJ2 E;  5AQJ B;  4ZHQ E;  1WRD A;  4TX5 A;  4H9P C;  5JR9 A;  2KXP B;  5IHY A;  3TLS A;  4DBQ A;  2NWB A;  2MPK A;  3B5M A;  5HXS A;  4IDN A;  3UUB A;  3CQC B;  4EIW A;  3ESL A;  3RC3 A;  3EAB A;  3JAF A;  2A3D A;  2CCQ A;  3CPZ A;  5GON E;  3CQX C;  2N1G A;  4QX7 B;  3HI2 A;  1JNZ A;  1DU2 A;  2H3R A;  5J2U E;  2E5L T;  4X20 E;  3PUW F;  1G73 A;  3SS1 A;  5ABE A;  4PJN A;  3Q9D A;  2HPL A;  5L3D B;  5C8Y E;  2UXN B;  2RP4 A;  2JMK A;  3RQW A;  3UQ7 A;  1IBL T;  3FB2 A;  4DMV A;  3GA8 A;  1I94 T;  4EAH A;  5AQQ B;  4U3C A;  3L8R A;  4HFV A;  2FJE A;  3AED A;  3AVS A;  3SRZ A;  1M7K A;  2JQ9 A;  4B3S T;  2F4V T;  3AXJ A;  3I0O A;  2BVL A;  4C90 A;  5LA6 E;  3B57 A;  3LBX B;  5AQF B;  2N9D A;  3K8P C;  4JEH B;  3IHR A;  3ETV A;  3PJA A;  3KDS E;  4DV2 T;  2XAJ B;  1IBK T;  4DV5 T;  3LK3 B;  1HF8 A;  2WBL A;  4UVA B;  2WM9 A;  2QYW A;  4O8S A;  1ZHC A;  2LT3 A;  4AIS A;  4YHH T;  3T1H T;  4HWC A;  2WWV A;  4IL4 A;  4JI5 T;  2XQY A;  3LG7 A;  3HKC E;  4BJN A;  2E9X A;  4BJM A;  1HCI A;  4O4I E;  2V7M A;  5FVK A;  4HN9 A;  1VOM A;  2YDS A;  1YKH B;  4NPP A;  3OTO T;  3MKD A;  3PV0 F;  2LM9 A;  1D1A A;  2EHO C;  2W67 A;  3U3I A;  3QK6 A;  3GN5 A;  3F31 A;  3C51 A;  1KK7 A;  3AE8 A;  2IC9 A;  4UV8 B;  4EZH A;  5DQV A;  3EHZ A;  3Q5E A;  4EED A;  4HKA A;  3P8C D;  4E7S A;  2LJL A;  3FZM B;  2XZE A;  2WZI A;  3HKE E;  3C64 A;  5EK3 A;  4ZS3 A;  3KVB A;  4LML A;  3RPU A;  5CGM A;  5DAB A;  5JH7 E;  3ZCI A;  4DBR A;  2JIW A;  2ES0 A;  3Q5X A;  3RC8 A;  5IWA T;  2XQ3 A;  2VKJ A;  2BVM A;  2ACX A;  3C4X A;  2N2N A;  3EI0 A;  4JI1 T;  3CX7 B;  3NZP A;  3AA1 B;  3AEB A;  1IAP A;  3VR9 A;  4O4H E;  4TV9 E;  4ADZ A;  2XM2 A;  4ANJ A;  3ZMT B;  2KT9 A;  3PUY F;  4O2A E;  1FEW A;  2DNX A;  3AB3 B;  2SPC A;  4V1A v;  2BKN A;  2NW9 A;  3AE1 A;  2OV9 A;  4WW0 A;  3C98 B;  2LSG A;  5FP3 A;  5HEH A;  4I50 E;  3HR0 A;  3RLF F;  4JLE A;  3OYZ A;  3AA6 B;  3UT5 E;  4X5T A;  1J1J A;  5IYZ E;  4NUU A;  4CXX A;  2A72 A;  2CE7 A;  2CBI A;  4TWF A;  4IE4 A;  4KX6 A;  3ZST A;  2ZMA A;  5LJM A;  2B76 A;  3N9L A;  5HXR A;  3KBU A;  3PUQ A;  4AXP A;  2LRL A;  2DWG A;  5FY0 A;  3T8O A;  1XDO A;  5L3G B;  4NXN T;  2W0G A;  2BG9 E;  4PW8 A;  2V1D B;  3O1H A;  4CI2 B;  4AKL A;  4EXT A;  2JQK A;  2J4G A;  4ERR A;  2LRK A;  2JPF A;  4Q25 A;  3FXE B;  4IIJ E;  3C4Z A;  4O2B E;  3KV5 A;  3K1S A;  4H63 V;  2RA1 A;  1LVF A;  2FJB A;  1V9D A;  4JI6 T;  1NEN A;  5LMN T;  3CK6 A;  3N9M A;  2XQA A;  3N9P A;  1D1B A;  5LMU T;  5H6R B;  2V8S V;  2VL8 A;  4DMW A;  2NW8 A;  4YTP A;  3UU4 A;  4JI8 T;  2A2F X;  3PUV F;  2NW7 A;  4YSX A;  4ZXL A;  4DUZ T;  1FMW A;  3EVY A;  3I0Q A;  3UU5 A;  2RPA A;  3M65 A;  4JBW F;  5AQS B;  1T72 A;  5LCY A;  4ILB A;  3P4P A;  2MYS A;  2VKD A;  3CQG B;  2D0T A;  3G06 A;  1KNZ A;  2FJA A;  5CJ5 A;  2CLY C;  5HAX A;  4U2Z A;  5JRC B;  3NVO A;  3HA4 A;  2JRK A;  4F8H A;  1O3X A;  4DR3 T;  2XPK A;  4LFA T;  4OYJ A;  4MLK A;  2NR4 A;  4U7I A;  4DO0 A;  4OK0 A;  4IE0 A;  4QH4 A;  2UU9 T;  4Z90 A;  2W62 A;  3RGL A;  2V5D A;  3FZL B;  3ZSS A;  1W0A A;  2KSR A;  2YDR A;  4KBM B;  5JDQ A;  2OLT A;  3SWH A;  2EHO A;  3PUX F;  3RH3 A;  2HHH T;  4A97 A;  2X9Y A;  1N34 T;  3FZF B;  4PFP A;  1XWM A;  5FXW A;  3ZYM A;  4A5X A;  4GYR A;  1Z8U A;  2BS3 A;  2M6B A;  4Z91 A;  1QUU A;  2X9H A;  4LMK A;  1OED B;  2K5B B;  5L4E A;  2R6G F;  4HFC A;  2VB6 A;  4HWH A;  2WDQ A;  4ZS2 A;  3ONJ A;  5JR9 B;  5CFB A;  1D0X A;  5L3B B;  1Y64 B;  5FXX A;  3TLU A;  4DVD A;  5H6Q B;  4TNW A;  4EEB A;  3NRY A;  2YK0 A;  3H3A A;  2WDR A;  4LF7 T;  4HFB A;  4KHP T;  5C3J A;  2X0H A;  4ZI2 C;  3VU7 H;  2CMR A;  2WS3 A;  4IRE A;  4JI3 T;  2VL0 A;  4B3M T;  2BKO A;  3OVU A;  5JDF A;  2XQ4 A;  2XJ7 A;  2ACZ A;  4U33 A;  3ZYL A;  5LBM A;  3P4R A;  3SFD A;  4AKI A;  2VKO A;  1M62 A;  3ETU A;  2IUB A;  3NKZ A;  2NTY A;  4CN6 A;  3UUX B;  4WYV A;  3KIN B;  2X9X A;  1QSD A;  3NZQ A;  4YXD A;  2ODU A;  2VAS A;  2H7O A;  3RIF A;  3AXJ B;  3UU8 A;  3TLV A;  1LVK A;  3RYF E;  1S94 A;  4NIQ A;  3B13 A;  1MIW A;  2CLY B;  2D5U A;  3AEE A;  4L5G A;  4MBQ A;  4A98 A;  4IE7 A;  2XY8 B;  2UUA T;  1YW0 A;  3KV6 A;  4P1N A;  5F8P A;  3OJA A;  1FJG T;  2K24 A;  4DV7 T;  2IIU A;  2C5K T;  2JQH A;  3A8Y C;  1ZOY A;  2XAF B;  2E9X B;  1CUN A;  2PBI A;  5FL1 A;  1HG2 A;  2LKG A;  4CN4 A;  4H9S E;  3MZK B;  4PJL A;  4ZI7 E;  2VKH A;  2ZM0 A;  2P9B A;  5EK4 A;  3AAE B;  3RIU C;  2CRB A;  2OA5 A;  4IDO A;  3I1A A;  2ZM8 A;  4HTE A;  3UUM A;  3GN5 B;  3I9W A;  4PK6 A;  3ZPO A;  1VRB A;  3AVR A;  4X1I E;  5LYJ E;  2CHO A;  5KMG P;  3MK7 C;  3AE6 A;  3KFW X;  4ZI3 C;  5KX5 E;  3UUN A;  2UXB T;  3PUG A;  4K0K T;  4UIG A;  2E8I A;  4U2Y A;  1L0V A;  4GKK T;  4NUV A;  1XDP A;  3QC9 A;  2Y6X A;  1E1H B;  1BR4 A;  5FXZ A;  1HX1 B;  5FNV E;  5HYA A;  3AEG A;  4IL9 A;  3AE9 A;  4H9N C;  2QA7 A;  3P50 A;  1FIO A;  1WR0 A;  3Q2M A;  3ZKR A;  5AQG B;  4AQF C;  4GK0 E;  4HFE A;  3HKB E;  5J2T E;  3MA9 A;  3FBL A;  4XZC A;  4F6R C;  2V7K A;  2MBG A;  4B3T T;  2W4X A;  2X68 A;  2XSB A;  3C4W A;  5AQT B;  3PUR A;  2CBJ A;  1EZ3 A;  2V6Y A;  2KND A;  1E2A A;  3BQI A;  4U31 A;  3U78 A;  5ADX L;  2DI4 A;  2CA5 A;  2E5V A;  3MXZ A;  1T98 A;  1W0B A;  2WB5 A;  5FMN A;  2AXD S;  3HL6 A;  3AE3 A;  1KNR A;  2BBH A;  4BA9 A;  2X51 A;  4X62 T;  3CVR A;  5JDL A;  3K3O A;  3JC6 C;  4AQG A;  3E08 A;  4LF9 T;  1W09 A;  2WAU A;  3H3M A;  4B6X A;  3A5X A;  1YQ4 A;  4HWD A;  3OPC A;  2H7V C;  5LNK A;  2UXC T;  1X9B A;  2PFV A;  3UQ4 A;  5AQR B;  1U4Q A;  4FJO A;  2IW5 B;  1ZP0 A;  2WMO A;  2Y8D A;  2LOS A;  2XQ6 A;  5LGU B;  4O4L E;  4QH1 A;  1UX4 A;  3O4X E;  2DCF A;  4OYK A;  4WBN E;  5BR8 T;  2WU2 A;  3AEA A;  3LSV A;  3GMI A;  4ZEY A;  2E9X D;  1IZN B;  2YU2 A;  3ZN1 B;  3VHL A;  2WWU A;  2KMF A;  1ZEE A;  4PJJ A;  3WAJ A;  1HNZ T;  4UVC B;  4P0A A;  3UFG A;  3RI5 A;  3CWZ B;  5ABH A;  5EK2 A;  5F3J A;  2VQE T;  1D1C A;  4YSZ A;  3RRW A;  5CA0 E;  2XAS B;  3M3Z B;  1T8B A;  2CEA A;  3TKL B;  3UUL A;  4HFD A;  5CB4 E;  2X0L B;  3PE0 A;  3MJX A;  5KXJ A;  3FHN A;  4GKJ T;  5FY1 A;  2WQY A;  4DV3 T;  2LSY A;  3OBV E;  2LM2 A;  2LKH A;  1WLX A;  4LF5 T;  4U72 A;  3AA7 B;  4EYU A;  4TWD A;  2VQF T;  3SOL A;  1HR0 T;  3RIA A;  3FZH B;  5F5W A;  2WSS V;  4IDP A;  1JNR A;  3J9X 1;  4L9I A;  5FL0 A;  5JDG A;  5JRE A;  4X65 T;  2EHO B;  3RIU A;  4EZ4 A;  3O1I A;  2XQ5 A;  3ZC1 A;  3VR8 A;  4DR2 T;  4I43 B;  4WZX A;  4EB6 E;  5LG3 A;  5FKY A;  3J7Y q;  4H9R C;  4ISS A;  3L09 A;  3IF8 B;  3OYX A;  2XSA A;  4DR6 T;  3PU8 A;  3N2O A;  3FXD B;  5AQU B;  5JTG A;  2FJD A;  4TNV A;  1VCT A;  2XQ8 A;  2ZM6 T;  4YHJ A;  2V26 A;  2ODV A;  2MAW A;  3OKQ A;  2VVN A;  2YIN A;  4YJ3 E;  4UF0 B;  4LF8 T;  4P0B A;  4TV8 E;  3ABV A;  4IGU A;  2DWK A;  3W15 B;  4CZZ B;  4JUY A;  1NAF A;  5LP6 E;  2J1D G;  3ZMU B;  2K48 A;  4I0U A;  2YOE A;  3NRX A;  5LBQ B;  1UUR A;  2PJQ A;  2W00 A;  3R84 B;  5JDM A;  2CXD A;  4BAY B;  4AQF A;  3EDV A;  1J5E T;  3E0Z A;  2B1E A;  4IST A;  3AA0 B;  3RYC E;  5LHH B;  4DR5 T;  3ZCJ A;  5FY7 A;  2K9A A;  3DJB A;  3ANW A;  5JQG E;  4HFH A;  4QX8 B;  1Y01 A;  2LLY A;  4CQI A;  4DUY T;  1N33 T;  2UXD T;  1ZV4 X;  1YXR A;  4KP3 C;  4N78 D;  3LDQ B;  5L3E B;  3P7I A;  4KI0 F;  2BKP A;  3JAE A;  1KFY A;  4QWN B;  5AQV B;  3MAC A;  4HFI A;  5ABF B;  3PUZ F;  2YN6 A;  2VVS A;  1UCU A;  1D0Y A;  2UXX B;  4LFB T;  1SA0 E;  1OWA A;  3D0T A;  5AQM B;  2WU5 A;  3ZT6 A;  5A1L A;  3CIR A;  1ZKE A;  2CWY A;  4UF0 A;  4DID B;  2LSK A;  4Z8X A;  2WP9 A;  2IHR 1;  4IE5 A;  2KWI B;  2HPJ A;  4GOU A;  4PAG A;  1IJ5 A;  3P4Q A;  2J62 A;  4LMJ A;  2Q9Q C;  3O9X A;  4TUY E;  3ZT7 A;  1N36 T;  4CI3 B;  2IC6 A;  3H37 A;  3Q5D A;  4L0R A;  1LRZ A;  3PJA J;  3CX8 B;  5LJN A;  1OXZ A;  2MOZ A;  2EHO D;  3A7M A;  3AE7 A;  2AE9 A;  5ETW A;  1XMO T;  4AQY T;  3WAK A;  1HX8 A;  4H9Q C;  3BQL A;  3GWH A;  4DND A;  1Z0P A;  5AQI B;  5DQW A;  3CX6 B;  4HGA A;  1NEK A;  1BR0 A;  1WYB A;  2XUE A;  4DV0 T;  2Z6E A;  2VWA A;  2WCA A;  1KNP A;  4X1Y E;  2LE8 A;  1OED E;  2DLR A;  4OFZ A;  2XAH B;  4P09 A;  3VRB A;  5ABF A;  4XAX B;  2E2A A;  1HNW T;  3K3Q C;  3CKD A;  5L3F B;  2X0Y A;  2I0M A;  4MHC A;  2LHR A;  4YFS A;  2KWH A;  4JI2 T;  1G8X A;  1MNE A;  5AQH B;  3QUJ A;  4QKN A;  4ILU A;  3N5L A;  3ZN0 B;  2Y48 B;  1HS7 A;  4CXY A;  4K0U A;  2V7J A;  2X9W A;  2BZB A;  2XAQ B;  2XQ9 A;  2I6H A;  3EAM A;  4UXN B;  4NXM T;  3QB5 K;  2M67 A;  2V6Y B;  2BG9 C;  3KVA A;  4E7Z A;  3LK4 2;  5HEU A;  3F2E A;  1BR2 A;  1S35 A;  4TZ4 C;  1MMG A;  1J5W A;  4J2C A;  3RKO A;  4OHF A;  4AKR B;  3RRC A;  1H7C A;  1MND A;  2BDE A;  4EGW A;  4LF4 T;  2C5J A;  3IEE A;  5HWY A;  1UK5 A;  3ZLI A;  3F57 A;  4IT4 A;  2DL1 A;  2H88 A;  4KMC A;  2GK9 A;  1WYC A;  1YKE B;  3ZC0 A;  4O4J E;  4KUM B;  4MFR A;  3VRA A;  1KF6 A;  4PFO A;  2W63 A;  5HEG A;  4A56 A;  4IDQ A;  2Q9Q B;  4HWI B;  4LFC T;  3ZT5 A;  5FXV A;  4GK5 E;  1WFD A;  2DHR A;  1AJ3 A;  4ZOL E;  5LGT B;  4AKH A;  4YY3 T;  4YT0 A;  1MIV A;  2PG8 A;  4QXC B;  4CXW A;  3ONX A;  1LKX A;  2CXF A;  4TN7 B;  1IBM T;  3ZMS B;  4JYA T;  2UUC T;  5HWX A;  1B7T A;  1MMA A;  3LFM A;  5HXE A;  3PUA A;  2WDV A;  1MMN A;  5LB7 B;  2QRX A;  4PJM A;  2FBW A;  3AEC A;  1WR6 A;  3AE5 A;  4I55 E;  4WNK A;  3BK9 A;  4PNI A;  4KHZ F;  5ABG A;  2W61 A;  4WBO A;  4X64 T;  3KBT A;  5CA1 E;  1X79 A;  3RQU A;  2IAK A;  2YU1 A;  3L3P A;  1QLB A;  2CM0 A;  5C2T A;  3KV9 A;  5JDH A;  1HNX T;  4U7Y A;  2PTF A;  4UEL A;  4C91 A;  5J0Z A;  2Q9Q A;  3LBX A;  3IBP A;  4UEM A;  5LG4 A;  4ILC A;  3RKG A;  2A9U A;  2X66 A;  1E7P A;  3L39 A;  5AQK B;  4ASK A;  2BG9 B;  3V5U A;  3AEF A;  2NP9 A;  3RYH E;  2ZM2 A;  3EDU A;  2C5I T;  2IML A;  2V5C A;  5AQO B;  1KEY A;  1N32 T;  4JI0 T;  3N9Q A;  2XHE B;  2VK9 A;  4IHJ E;  4CI1 B;  3BQK A;  4X1K E;  3AE4 A;  1GQE A;  2LOP A;  4QH5 A;  2JJ9 A;  5KDM C;  4G63 A;  3C50 A;  4M1P A;  3N2G E;  2V7L A;  4XBF B;  4YTM A;  3QB5 A;  5HEO A;  4ZI2 D;  4H9O C;  1OED C;  2CHN A;  2Q9Q D;  4DR4 T;  2G0U A;  1U5P A;  1SE7 A;  3K3N A;  4UV9 B;  4ZZB A;  2ZLY A;  2LEH A;  1YQ3 A;  4UR9 A;  5JR9 C;  2XQ7 A;  2UUB T;  4X66 T;  4QHO A;  4HEA A;  1IJ6 A;  4PK4 A;  4DR7 T;  3ANW B;  2D9D A;  4QXB B;  3HKD E;  4JV5 T;  1T7S A;  5EZY E;  4JI7 T;  1MIY A;  2BG9 A;  1XMQ T;  2V6X A;  3LK2 B;  4YLH A;  5DJQ C;  2WY2 A;  3UU6 A;  4MAL A;  2KLQ A;  4YTN A;  5JDN A;  3JCF A;  3SFE A;  1UGO A;  2FUP A;  5M4Y A;  5AQL B;  2BS4 A;  5LOV E;  4JEU B;  4DR1 T;  5AQN B;  5LGN B;  3N9N A;  1UX5 A;  2XTL A;  3AE2 A;  5IUX A;  5L3C B;  3CML A;  2D0U A;  2JQQ A;  4U74 A;  5FVL A;  1SUM B;  4AIU A;  2MTQ A;  3ZMZ B;  1NWM X;  1XNQ T;  3ONL C;  5HXH A;  3VKG A;  1I6Z A;  4UVB B;  3N9O A;  1FMV A;  1WCR A;  2X67 A;  3LJC A;  4QXH B;  2KIN B;  4DV4 T;  4AI6 A;  3N2K E;  2W2U A;  3E22 E;  1MMD A;  2L3L A;  4AKG A;  3ZJ2 A;  1UUS A;  4HWF A;  5BMV E;  2LSI A;  3WI3 A; 
#chains in the Genus database with same CATH homology
 4GK0 E;  2Z6E A;  2VWA A;  3HKB E;  4X1Y E;  5J2T E;  3MA9 A;  1D0Z A;  2LE8 A;  4NUU A;  5E0O A;  2DLR A;  3FBL A;  4OFZ A;  5IYZ E;  2XAH B;  4P09 A;  4XZC A;  4CXX A;  4F6R C;  2A72 A;  4G2A A;  2D2S A;  2CE7 A;  4XAX B;  5L2L A;  2V7K A;  2MBG A;  3AAI A;  5HXC A;  3UTK A;  4ZI3 D;  3ZJ1 A;  2X68 A;  3KV4 A;  3C4W A;  3K3Q C;  3CKD A;  3ZYK A;  4IE4 A;  5L3F B;  2E9X C;  4HE8 A;  2LHR A;  4MHC A;  3PUR A;  4FI5 A;  4YFS A;  1EZ3 A;  2KWH A;  2ZMA A;  5LJM A;  1G8X A;  4IE6 A;  3RX6 A;  1SHZ C;  1MNE A;  2KND A;  3Q5W A;  3QUJ A;  3BQI A;  2L8K A;  4QKN A;  5AFU L;  3U78 A;  3N9L A;  4ILU A;  5HXR A;  3PUS A;  3N5L A;  2DI4 A;  2CA5 A;  3ZN0 B;  2HH7 A;  3MXZ A;  5ADX L;  1T98 A;  2WMN A;  2Y48 B;  2QGS A;  1HS7 A;  3KBU A;  3PUQ A;  4AXP A;  3PU3 A;  2DWG A;  5FY0 A;  4CXY A;  4K0U A;  5FMN A;  2V7J A;  3T8O A;  2L9Q A;  2X9W A;  3VKH A;  2BZB A;  2XAQ B;  1BR1 A;  3HL6 A;  2LSJ A;  2NTX A;  2V7I A;  5L3G B;  4UXN B;  3EUH A;  2W0G A;  4BA9 A;  2X51 A;  3CVR A;  5JDL A;  5J1G A;  3K3O A;  4PW8 A;  2V1D B;  3JC6 C;  3O1H A;  3I9Y A;  2M67 A;  4AQG A;  4CI2 B;  4AKL A;  3AAA B;  4EXT A;  3E08 A;  2CXL A;  2WAU A;  4ERR A;  2JPF A;  2KZ7 B;  3FXE B;  1HFA A;  4IIJ E;  4B6X A;  3KVA A;  2LHN A;  4E7Z A;  3A5X A;  3C4Z A;  3LK4 2;  4O2B E;  3F2E A;  4IDZ A;  2H7V C;  3KV5 A;  3UFE A;  2YEV C;  5LNK A;  2PFV A;  1BR2 A;  4H63 V;  1S35 A;  1U4Q A;  2RA1 A;  4FJO A;  4TZ4 C;  2IW5 B;  1LVF A;  1MMG A;  1V9D A;  2WMO A;  1US7 B;  4GYS A;  4J2C A;  3RKO A;  4OHF A;  3FBZ A;  2Y8D A;  3N9M A;  4AKR B;  2LOS A;  3N9P A;  3RRC A;  1D1B A;  5JVD E;  1H7C A;  5LGU B;  5LXT E;  4O4L E;  5H6R B;  1MND A;  2BDE A;  1UX4 A;  3O4X E;  2VL8 A;  2DCF A;  3DP7 A;  4DMW A;  2NW8 A;  4OYK A;  4WBN E;  2C5J A;  3IEE A;  5JRC A;  5HWY A;  2A2F X;  2I59 A;  2NW7 A;  3ZLI A;  3GMI A;  2E9X D;  1IZN B;  3F57 A;  2YU2 A;  2JMH A;  4KMC A;  2GK9 A;  1WYC A;  1YD8 G;  1FMW A;  3ZN1 B;  5LHI B;  1YKE B;  3EVY A;  3I0Q A;  5LHG B;  3VHL A;  3M65 A;  2CWO A;  4O4J E;  3ZC0 A;  2WWU A;  2KMF A;  1ZEE A;  4KUM B;  4PJJ A;  4H63 H;  4MFR A;  3WAJ A;  5LCY A;  4UVC B;  4P0A A;  2MYS A;  4PFO A;  2VKD A;  2W63 A;  2D0T A;  3CQG B;  3CWZ B;  3R6N A;  2C0S A;  5EK2 A;  1KNZ A;  4A56 A;  1HTJ F;  2Q9Q B;  2CLY C;  5HAX A;  5F3J A;  2XAG B;  5JRC B;  1D1C A;  3HA4 A;  4EOZ B;  2JRK A;  3JC6 D;  1O3X A;  4GK5 E;  5FXV A;  3RRW A;  3PDY A;  2DHR A;  4OYJ A;  5CA0 E;  4MLK A;  2XAS B;  1AJ3 A;  4DO0 A;  3TKL B;  2CEA A;  3PTR B;  4OK0 A;  4EYY R;  4ZOL E;  3UUL A;  5CB4 E;  4IE0 A;  5LGT B;  4AKH A;  1HG5 A;  2X0L B;  3DTO A;  3PE0 A;  2NOX A;  3S4U A;  1MIV A;  2PG8 A;  4QXC B;  4I4T E;  4CXW A;  3MJX A;  3ONX A;  2W62 A;  4PK5 A;  1LKX A;  3FHN A;  2CXF A;  4TN7 B;  4GIW A;  5FYM A;  5TAO A;  3V5S A;  4KBM B;  5JDQ A;  3ZMV B;  3NBX X;  3ZMS B;  5FY1 A;  3O1J A;  3RYI E;  3SWH A;  3ZEF B;  4YJ2 E;  2EHO A;  3RH3 A;  2LSY A;  2X9Y A;  4ZHQ E;  1WRD A;  4TX5 A;  3OBV E;  4H9P C;  5JR9 A;  5HWX A;  2KXP B;  1B7T A;  4PFP A;  5IHY A;  1WLX A;  5FXW A;  1MMA A;  3AA7 B;  4U72 A;  3LFM A;  3ZYM A;  4EYU A;  5HXE A;  3PUA A;  4DBQ A;  4GYR A;  2NWB A;  3SOL A;  5HXS A;  1MMN A;  3CQC B;  4EIW A;  3ESL A;  4PJM A;  1QUU A;  3RC3 A;  2WSS V;  1WR6 A;  2X9H A;  2A3D A;  2CCQ A;  3J9X 1;  2K5B B;  3CPZ A;  3BK9 A;  4I55 E;  4L9I A;  4PNI A;  4WNK A;  2VB6 A;  5GON E;  5JDG A;  5JRE A;  2EHO B;  2W61 A;  3CQX C;  4WBO A;  2N1G A;  4EZ4 A;  4QX7 B;  3HI2 A;  3KBT A;  3O1I A;  3ZC1 A;  4ZS2 A;  5CA1 E;  1X79 A;  2H3R A;  5JR9 B;  5J2U E;  4X20 E;  1D0X A;  2IAK A;  4I43 B;  1G73 A;  5L3B B;  1Y64 B;  2YU1 A;  3L3P A;  5FXX A;  2CM0 A;  4EB6 E;  4DVD A;  3SS1 A;  3KV9 A;  5H6Q B;  4PJN A;  5JDH A;  3Q9D A;  3J7Y q;  2HPL A;  5L3D B;  4H9R C;  3NRY A;  5C8Y E;  2UXN B;  4ISS A;  2YK0 A;  3L09 A;  4UEL A;  3IF8 B;  3H3A A;  4C91 A;  2Q9Q A;  3OYX A;  2RP4 A;  2JMK A;  3LBX A;  3IBP A;  4UEM A;  5LG4 A;  3PU8 A;  3N2O A;  3FB2 A;  4DMV A;  3FXD B;  2X66 A;  3GA8 A;  4EAH A;  4ZI2 C;  4ASK A;  3VU7 H;  2CMR A;  3V5U A;  4HFV A;  2NP9 A;  3RYH E;  2ZM2 A;  3AVS A;  3SRZ A;  3EDU A;  2C5I T;  4YHJ A;  5JDF A;  2V26 A;  2ODV A;  3OKQ A;  3I0O A;  2YIN A;  3ZYL A;  4YJ3 E;  4UF0 B;  2BVL A;  4P0B A;  5LBM A;  3N9Q A;  2XHE B;  2VK9 A;  3B57 A;  3LBX B;  4IHJ E;  4TV8 E;  5LA6 E;  4C90 A;  4CI1 B;  4IGU A;  2DWK A;  2N9D A;  3W15 B;  4CZZ B;  4JUY A;  4AKI A;  3K8P C;  1NAF A;  2VKO A;  5LP6 E;  4JEH B;  3ETU A;  3IHR A;  3ETV A;  2J1D G;  3ZMU B;  2K48 A;  2NTY A;  3NRX A;  3KDS E;  5LBQ B;  2PJQ A;  2XAJ B;  3BQK A;  4X1K E;  2W00 A;  3UUX B;  3R84 B;  5JDM A;  2CXD A;  3LK3 B;  1HF8 A;  3KIN B;  2WBL A;  4UVA B;  2WM9 A;  2LOP A;  2X9X A;  4BAY B;  1QSD A;  3NZQ A;  4AQF A;  3EDV A;  2JJ9 A;  4O8S A;  2ODU A;  2VAS A;  2H7O A;  1ZHC A;  3E0Z A;  2LT3 A;  5KDM C;  2B1E A;  4G63 A;  1LVK A;  3C50 A;  4IST A;  4M1P A;  3RYF E;  3AA0 B;  1S94 A;  3N2G E;  3RYC E;  5LHH B;  3B13 A;  2XQY A;  1MIW A;  2CLY B;  3HKC E;  3LG7 A;  5FY7 A;  3ZCJ A;  2K9A A;  4BJN A;  3DJB A;  2E9X A;  3ANW A;  4BJM A;  5JQG E;  1HCI A;  2V7L A;  4QX8 B;  2D5U A;  4L5G A;  4O4I E;  2V7M A;  4XBF B;  4MBQ A;  4HN9 A;  4CQI A;  1VOM A;  4IE7 A;  1YKH B;  4ZI2 D;  3MKD A;  4H9O C;  1YW0 A;  1ZV4 X;  2Q9Q D;  2LM9 A;  2G0U A;  1U5P A;  1D1A A;  4KP3 C;  3K3N A;  2EHO C;  3KV6 A;  4N78 D;  4UV9 B;  3U3I A;  5L3E B;  2ZLY A;  3QK6 A;  3P7I A;  5F8P A;  3GN5 A;  2LEH A;  3F31 A;  3OJA A;  3C51 A;  1KK7 A;  5JR9 C;  2K24 A;  4QHO A;  4HEA A;  2IC9 A;  1IJ6 A;  4UV8 B;  2C5K T;  4QWN B;  4EZH A;  4PK4 A;  2XAF B;  2E9X B;  1CUN A;  2PBI A;  3ANW B;  5DQV A;  4QXB B;  3MAC A;  3HKD E;  1HG2 A;  4HKA A;  5EZY E;  1MIY A;  3P8C D;  4H9S E;  4E7S A;  1UCU A;  3MZK B;  4PJL A;  2LJL A;  4ZI7 E;  2VKH A;  1D0Y A;  2UXX B;  2ZM0 A;  2P9B A;  3LK2 B;  5EK4 A;  3HKE E;  4YLH A;  3AAE B;  3C64 A;  5EK3 A;  1SA0 E;  1OWA A;  4ZS3 A;  2OA5 A;  3D0T A;  3I1A A;  3KVB A;  3RPU A;  2ZM8 A;  4HTE A;  5DJQ C;  3UUM A;  3GN5 B;  3I9W A;  5DAB A;  4PK6 A;  3ZPO A;  4MAL A;  5A1L A;  2KLQ A;  1VRB A;  5JH7 E;  3AVR A;  1ZKE A;  2CWY A;  5JDN A;  4UF0 A;  3ZCI A;  4DBR A;  4X1I E;  5LYJ E;  2LSK A;  5KMG P;  5M4Y A;  3MK7 C;  4Z8X A;  4IE5 A;  2KWI B;  2HPJ A;  5LOV E;  4GOU A;  4JEU B;  2ES0 A;  4PAG A;  3Q5X A;  1IJ5 A;  3KFW X;  4ZI3 C;  3RC8 A;  5LGN B;  3N9N A;  1UX5 A;  2Q9Q C;  2XTL A;  5KX5 E;  3O9X A;  2VKJ A;  4TUY E;  3UUN A;  2BVM A;  4CI3 B;  2ACX A;  2IC6 A;  3C4X A;  3H37 A;  2N2N A;  3PUG A;  5L3C B;  3CML A;  4L0R A;  1LRZ A;  2D0U A;  2JQQ A;  4U74 A;  4UIG A;  2E8I A;  3CX8 B;  3CX7 B;  5LJN A;  3NZP A;  3AA1 B;  4NUV A;  2MTQ A;  1OXZ A;  2MOZ A;  2EHO D;  3ZMZ B;  1NWM X;  5ETW A;  1IAP A;  3QC9 A;  5HXH A;  4O4H E;  4TV9 E;  3VKG A;  4ADZ A;  4ANJ A;  3WAK A;  3ZMT B;  2Y6X A;  4UVB B;  2KT9 A;  1HX8 A;  3N9O A;  1E1H B;  1FMV A;  4O2A E;  4H9Q C;  1BR4 A;  1FEW A;  2DNX A;  3AB3 B;  3BQL A;  2SPC A;  4V1A v;  5FXZ A;  2X67 A;  3GWH A;  4DND A;  1Z0P A;  5FNV E;  2NW9 A;  5HYA A;  3LJC A;  4QXH B;  2KIN B;  5DQW A;  3CX6 B;  4WW0 A;  4AI6 A;  3N2K E;  3C98 B;  4H9N C;  2QA7 A;  3E22 E;  1MMD A;  4HGA A;  2L3L A;  4AKG A;  3ZJ2 A;  2LSG A;  1FIO A;  5FP3 A;  4I50 E;  1BR0 A;  5BMV E;  1WYB A;  2XUE A;  3HR0 A;  3Q2M A;  2LSI A;  4JLE A;  3OYZ A;  4AQF C;  3WI3 A;  3AA6 B;  3UT5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...