1HTJF

Structure of the rgs-like domain from pdz-rhogef
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
ESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords KIAA0380
publication title Structure of the RGS-like domain from PDZ-RhoGEF: linking heterotrimeric g protein-coupled signaling to Rho GTPases.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2000-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1htjF00
3AB3B 4PNIA 3CX6B 3QC9A 3C4ZA 2DLRA 1IAPA 4YHJA 4WNKA 4WBOA 3C51A 1ZV4X 3C4WA 3CX7B 4L9IA 3T8OA 4IGUA 2ACXA 1HTJF 2A72A 2PBIA 4GOUA 3C4XA 3C50A 3CX8B 1SHZC 2I59A 2ES0A
chains in the Genus database with same CATH superfamily
3ZN1B 4YLHA 3RRCA 3PUWF 1HFAA 5FVKA 1SE7A 4U74A 4ZZCA 2WBLA 5AQIB 3AE7A 5CGMA 2A72A 2BG9A 3Q2MA 1KK7A 2LSJA 3RH3A 2XAQB 3KDSE 1D0YA 3UFEA 3LSVA 5HYAA 1G73A 4HEAA 2XAHB 5JQGE 1HS7A 3ONJA 4UVAB 3TLUA 2Q9QA 5IUXA 3PUZF 2PTFA 3EVYA 2D0TA 3FZKB 4I4TE 4AKGA 3HKCE 4HWFA 4A5XA 4LF8T 4E7SA 3IBPA 5LNKA 1MIVA 3OVUA 3RIUC 3SS1A 2GK9A 5KMGP 4BJNA 4AKRB 3VR8A 2XAFB 2BVMA 4COFA 3R84B 4PK5A 3EAMA 3K1SA 4H9PC 4GIWA 1YD8G 4DMVA 3L39A 3JC6D 3K8PC 4ILAA 3V5UA 2NWBA 3HL6A 1UURA 3UULA 3FBLA 3VRAA 1UX5A 5FXVA 3ZSSA 2DI4A 2DNXA 3PUAA 4P0AA 1IBLT 4H9SE 5ABGA 2OLTA 2KZ7B 1AJ3A 5LHHB 5LMUT 3W15B 4YY3T 4FI5A 3RYIE 1J5ET 3ANWA 3AE3A 4LFBT 4OK0A 1MIYA 5LGTB 1Z0PA 3RIUA 2UUBT 2PJQA 3IHRA 5KXJA 4LMLA 2V6YA 3QOFA 3JAEA 2V8SV 2XZEA 1UK5A 3ZLIA 5FXWA 4YJ3E 4X1YE 3J9X1 3FB2A 2KWHA 2XHEB 1J1JA 4JI8T 3AAIA 3TLVA 5AQRB 3LK3B 3QB5A 2H88A 1U4QA 2XQYA 3MZKB 2OA5A 2BKNA 3MACA 2KSRA 5M4YA 3I1AA 3KV4A 4YJ2E 2N2NA 2LSYA 2Y48B 2FJBA 4DNDA 5IYZE 2XPKA 3NRYA 4JEHB 2NR4A 3LK42 3UT5E 2C5JA 4YHJA 1OEDE 4J2CA 3AE9A 5AQVB 2JQHA 2NOXA 5AQQB 4IE7A 4DV1T 2LRKA 3EI0A 1WRDA 3K3QC 5ETWA 5EK2A 2CBJA 2WWUA 4ILCA 1OEDC 5FY7A 4TWDA 4O4IE 5L3DB 4TWHA 2FBWA 1LVFA 2KNDA 5AQFB 2ACXA 5LA6E 3UUBA 3P4QA 3LBXB 2HPJA 3ZMTB 2VKDA 3LK2B 4XZCA 3ZT5A 4YTNA 3OBVE 2IIUA 4I55E 2XTLA 2ACZA 5HEHA 3AA7B 3VR9A 3O1JA 1HX1B 4DR1T 4JI1T 3TKLB 4ZI3C 2WZHA 3P50A 2VL8A 1W09A 2VQFT 4HGAA 3DP7A 5AQHB 3K3NA 5JR9B 2V7MA 2CLYC 2CA5A 4GKKT 1XMOT 4QX7B 4EZHA 5H6QB 5L47A 3M65A 3O1IA 4TV8E 2IW5B 3Q5WA 1T72A 4ZZBA 2CM0A 4IREA 5JDNA 5LB7B 3CX6B 3C4ZA 2DLRA 5DJQC 2DCFA 2C5KT 4IDPA 2YEVC 3EABA 3O4XE 4G2AA 1WFDA 2JMKA 4MFRA 2EHOB 2ES0A 2X0LB 3ZEFB 2KT9A 3UU4A 3QC9A 2FJAA 2VKOA 3N9LA 3AE1A 3UTKA 2XQ3A 3ZYMA 1ZV4X 3C4WA 5IHYA 1HG2A 2H7VC 4DMWA 2IC6A 5JDLA 2WB5A 2E5LT 1SA0E 4M1PA 2CWOA 1HNXT 3LFMA 4PJMA 3N9QA 2ZM6T 2YU1A 4JUYA 3HKEE 2PG8A 4IHJE 3PUXF 2VKHA 4BAYB 5LCYA 3AA0B 2BG9B 3KVBA 3AB3B 3AAEB 4OX9T 2UXBT 3CWZB 3HR0A 3UU5A 1G8XA 2HN2A 3GMIA 5H6RB 2Q9QD 1W9RA 4LFCT 4X62T 4QKNA 2XQ9A 3N9OA 3FXDB 1LVKA 4PJNA 2Q9QB 4MBQA 1SUMB 5JDGA 2X9WA 5JDQA 3ZMSB 5JVDE 1T7SA 5FP3A 2E9XC 4U31A 4UV9B 4B3TT 4QH1A 2YDQA 5FXXA 2RA1A 3TLSA 2W2UA 5J2TE 4HFEA 4KBMB 1ZKEA 3FHNA 3HKBE 3KVAA 2NTYA 3AEDA 1KNRA 4LFAT 4LF4T 4HKAA 4NUUA 3PJAJ 3T1HT 1XWMA 1Y64B 4CN1A 3UUMA 3Q5EA 4DR7T 4HN9A 1D0ZA 3DJBA 4HFVA 2KMFA 2XAJB 4EXTA 4AQFA 4UVBB 4PW8A 2X51A 3AA1B 4CI2B 1M7KA 4ZI7E 5E0OA 5AQTB 3S4UA 1IJ6A 4UELA 1N36T 4IDNA 5FY1A 3ANWB 3OJAA 4MLKA 2H89A 4CZZB 4CN4A 1OWAA 3RX6A 5EK4A 2V6YB 3SWHA 1X79A 4ZS2A 4DR3T 5HAXA 1JNRA 3ZN0B 1V9DA 5F3JA 3MK7C 3PUSA 4UEMA 2LM2A 4IIJE 1O3XA 3CKDA 1QUUA 5LHIB 1HNZT 4IGUA 4FJOA 2IUBA 5HXEA 1US7B 3ZMVB 2J62A 4LMJA 1E2AA 3UU6A 3P4SA 3ZMUB 1KNPA 3Q5DA 3RF1A 1XNQT 4JI2T 2MBGA 3RLFF 5IWAT 2WAUA 3AEAA 2XQ6A 1HF8A 4TNWA 4JV5T 3RI5A 2WCAA 5L4EA 4KP3C 3G06A 5FKYA 3BK9A 2JJ9A 4K0KT 2LKHA 3CK6A 4QWNB 1HNWT 5HCJA 2LSKA 2IDOB 3JADA 4ZS3A 2XM1A 2ODUA 3H3MA 4O2AE 4NXMT 3MKDA 1SHZC 1UUSA 5ADXL 3HKDE 3CPZA 2YK0A 2X0HA 2I0MA 2FJEA 4CI1B 4P1NA 3IEEA 2WP9A 2A9UA 3E08A 4IL4A 2N9DA 1FMVA 5L3BB 1UGOA 1VRBA 4O8SA 5LMNT 2M6BA 2X9HA 2MOZA 3AE8A 3ZCIA 4H9QC 3AE4A 4ZEYA 3RPUA 2JMHA 1WR6A 3CX8B 2V1DB 4GYRA 4U2YA 3NBXX 5AQGB 3N5LA 3K3OA 3BQLA 1YQ3A 1R8IA 4Q25A 2XSBA 4HFDA 3UQ4A 2BZBA 4DV3T 4B3MT 4O4HE 2CXFA 2X9YA 2W4XA 4WW0A 2LLYA 5LG3A 1D1BA 4ZI3D 5EK3A 2KLQA 1VCTA 3C98B 2XQAA 3PV0F 2DHRA 4ZI2C 2ZM2A 3D0TA 2KINB 5FVLA 5J0ZA 5FMNA 2XAGB 2UXCT 2CLYB 2WM9A 4NXNT 2QYWA 1YXRA 4WYVA 4HWDA 4WBOA 5L3FB 4X1IE 4G63A 5LOVE 2X68A 4UXNB 4PK4A 2CMRA 4AI6A 2V7IA 2YOEA 5CB4E 2V5CA 2QGSA 3KV9A 1S35A 3PURA 4KUMB 2X9XA 4CQIA 2UXXB 3OTOT 3RYCE 2LOPA 5JREA 4JBWF 3LJCA 1BR1A 5LXTE 3AAAB 2IAKA 5FYMA 4JI7T 2M6IA 4IDOA 1ZEEA 4JEUB 4GKJT 2FJDA 2E2AA 2CPTA 1WCRA 2NW8A 3FZFB 4L9IA 3RGLA 4ISTA 1E1HB 2W62A 4OYKA 4A97A 2BS4A 4U72A 4CXYA 2WU5A 1MMNA 5HEJA 4KX6A 2BVLA 2V6XA 4F8HA 1VCSA 4ZHQE 4IE6A 2WMOA 1KFYA 2XM2A 1DU2A 3N9NA 1MNEA 3DTOA 4AXPA 5J1GA 3L8RA 1BR0A 1MMDA 3PTRB 2ZMAA 4PK6A 1HR0T 1X9BA 2H3RA 3RQWA 2E9XD 4DV0T 4DUYT 5LBMA 2B1EA 1CUNA 4B6XA 4EV6A 1OEDA 4EEDA 1XNRT 2XQ7A 3M3ZB 1QSDA 5FL0A 2B76A 1YW0A 1LKXA 4AISA 3TLWA 1E7PA 2WQYA 2LHNA 1N32T 3PUVF 3PE0A 3FBZA 4NUVA 5C3JA 4DR6T 4K0UA 5ABEA 1ZOYA 5LJMA 2A2FX 3VKGA 3OKQA 3MJXA 3FZHB 5JDHA 3EUHA 4X20E 3WAJA 4BA9A 4HFBA 1M62A 2K9AA 3ZC0A 3GN5B 4UV8B 4CXWA 4AKIA 3ZT6A 4GK5E 1OXZA 3B13A 4YSXA 2WZIA 5C2TA 4I0UA 4JI3T 3AE2A 3QB5K 2XQ4A 5LHGB 2CWYA 3H37A 2LOSA 2ZM8A 3KFWX 4LF9T 1WYCA 3ZCJA 4V1Av 1ZP0A 3CQGB 4X66T 5AQOB 1I6ZA 4JYAT 1IJ5A 4A56A 3RIAA 1IBKT 4UIGA 2WDRA 2Z6EA 3RYFE 4U7IA 3LG7A 1HCIA 3JCFA 2ZM0A 2UXDT 1UX4A 2JQ9A 1J5WA 4U33A 4DV7T 3HA4A 3EDVA 4CI3B 3ZMZB 2CE7A 5L3EB 4HE8A 2J1DG 3Q5XA 3ZSTA 4YHHT 3QK6A 1FJGT 3ABVA 4KHZF 4ILUA 4IDQA 4JI6T 3HI2A 3PU8A 2VB6A 1HG5A 5JR9C 4L5GA 3T1YT 5HCMA 3A8YC 4O2BE 1HTJF 3P4PA 5ABFB 4QXBB 3CIRA 2LJLA 4XAXB 3AE5A 5TAOA 2CHNA 3RKOA 2SPCA 3SFEA 2BKOA 4O4JE 2MPKA 1IBMT 3OPCA 4PJJA 4TUYE 2LRLA 4YT0A 3VRBA 4DV2T 4EB6E 1QLBA 3PUGA 2NW7A 2EHOC 4X5TA 2L9QA 2W66A 1NWMX 2JQKA 2E9XA 2LT3A 2JRKA 4DR4T 4UF0A 5HXRA 4DV4T 1FMWA 3P7IA 4JI4T 1NEKA 2MYSA 3AEBA 4LMKA 1W0AA 5JRCA 3RC3A 3UQ7A 3SFDA 1FIOA 2BG9E 4PAGA 1T8BA 4TV9E 2C0SA 3PUYF 4YTPA 2N1GA 2VQET 1KEYA 2BBHA 1WR0A 2RP4A 1D1AA 2VVNA 2D2SA 5JDFA 1S94A 1XDOA 4PJLA 2YKSA 4KHPT 3B57A 1I94T 3ZYLA 2BS3A 4ZI2D 4ZOLE 3NZPA 4X1KE 3C51A 2J4GA 4AIUA 3RHWA 2IHR1 2OV9A 4QH5A 3GN5A 5J2UE 4AKHA 4YXDA 2J47A 2XASB 3OYXA 2LEHA 3QUJA 4HFCA 4B3ST 1GQEA 4TN7B 4IDZA 2HN1A 5F8PA 5GONE 3ETUA 2V26A 5LBQB 3KBUA 4ZXLA 3J7Yq 2FUPA 2PBIA 3ZC1A 4YFSA 5FY0A 5C8YE 2E5VA 2UXNB 2NTXA 4F6RC 3RQUA 4H63V 3N2KE 3PUQA 2C5IT 2VASA 4AQGA 2WSSV 4LF5T 3RC8A 2VKJA 5LYJE 2W61A 3P4RA 2W67A 3SOLA 2JIWA 4EGWA 3PDYA 3AA6B 2KWIB 4WNKA 2L8KA 4GYSA 4A98A 1FEWA 2CEAA 3EHZA 3CX7B 5LJNA 2CCQA 4JI5T 4WZXA 2AE9A 4I43B 4HWIB 1VOMA 5L3GB 3MXZA 4KI0F 4QXCB 3AVSA 4LF6T 4NIQA 3BQIA 1OEDB 5L4HA 3F31A 1H7CA 5ABFA 1XMQT 4TWFA 3CQXC 1HX8A 2CXLA 3KINB 1KF6A 4I50E 2KXPB 3N2GE 4H9NC 4N78D 2YU2A 5FNVE 4PNIA 4L0RA 1IAPA 2CXDA 2HPLA 3A5XA 5DQWA 4GOUA 4XBFB 2K3WA 3AECA 4ERRA 4DVDA 3B5MA 1YKHB 3I9YA 5HXCA 3FZMB 1LRZA 1XDPA 2QA7A 4H63H 3I0OA 3AEEA 4EZ4A 4NPPA 2K5BB 5KDMC 3ZT7A 2XJ7A 2WMNA 1ZHCA 1NAFA 2VL0A 3ETVA 4Z91A 4MHCA 4JI0T 3NWIA 3AXJA 3I9WA 5HEOA 2QRXA 2W00A 4HFIA 2LKGA 3N9PA 3H3AA 1W0BA 2PFVA 2RPAA 3F57A 4ILBA 3FXEB 5F5WA 5DABA 2H7OA 5CA1E 3SRZA 5LGNB 3PJAA 4DBRA 4OHFA 5HWXA 3JAFA 5ABHA 1NENA 3C50A 4LF7T 3ZJ1A 3TLTA 3EDUA 1U5PA 3FZLB 2K24A 2WU2A 5AQNB 4U3CA 3IA3A 2DWGA 3P4WA 4AQYT 2DL1A 5KX5E 2Y6XA 1MMGA 5AQPB 3C64A 4U2ZA 4GK0E 4OFZA 5HEGA 3L3PA 3RRWA 3P8CD 2D5UA 2P9BA 5HXSA 2E8IA 3A7MA 2UUAT 2IMLA 4DR5T 4PFPA 4YSZA 3UU3A 2V7KA 3GA8A 5CA0E 3O9XA 2JQQA 3JC6C 2L3LA 2X67A 4ANJA 4DBQA 2W63A 2YDRA 3AEFA 2F4VT 4C91A 4YTMA 5A1LA 2E9XB 2D9DA 2XY8B 3RYHE 2A3DA 2QVAA 3CQCB 1CHUA 3X1DA 1D1CA 5HWYA 2ODVA 4UF0B 3UUXB 1KNZA 4OYJA 3R6NA 3VKHA 2MTQA 5LGUB 3RKGA 5JRCB 2BS2A 2CBIA 3N2OA 2VWAA 3I0QA 4U7YA 4H9OC 2LHRA 3NRXA 3NVOA 1JNZA 3O1HA 1UCUA 2VK9A 5BR8T 4EAHA 1MNDA 4HFHA 2BBJA 2EHOD 3QNUA 4TNVA 2ZLYA 1YQ4A 4IE0A 2BKPA 3CVRA 2X0YA 3GWHA 2BDEA 2HH7A 4HWCA 1D0XA 4CXXA 5JDMA 2LM9A 4B3RT 3KV6A 2UUCT 2YINA 3AVRA 3UU8A 5JTGA 1WYBA 1XZYA 4PFOA 4DUZT 3OYZA 5LP6E 2I59A 5HXHA 2LE8A 3VHLA 3AEGA 1YKEB 2G0UA 3ZPOA 4DO0A 2XSAA 3ZJ2A 4IT4A 1L0VA 2K48A 4E7ZA 1EZ3A 2VURA 5AQJB 4AQFC 4DIDB 4HWHA 3UUNA 1N34T 1WLXA 2WS3A 4X64T 4P0BA 4QX8B 4P09A 4BJMA 4DV6T 4UR9A 2MAWA 5AQKB 5L3CB 3WAKA 3AE6A 4AKLA 2V7JA 3MA9A 1Z8UA 2D0UA 3U78A 2XQ5A 2M67A 3E22E 4EIWA 3BQKA 4EOZB 2Y8DA 3V5SA 2UU9T 1MMAA 4CN6A 5L2LA 2NW9A 2LSGA 1N33T 4EEBA 3LBXA 2XUEA 4ASKA 2X66A 2WWVA 4Z8XA 3C4XA 3ESLA 4KMCA 4DV5T 4Z90A 4X65T 1BR4A 3ONLC 4IE4A 3RIFA 5CFBA 5AQLB 3ZKRA 4EYYR 3T8OA 3ZYKA 4UVCB 3LDQB 3F2EA 2R6GF 5JR9A 5CJ5A 3L09A 2YN6A 4TX5A 5AQUB 2V7LA 2JPFA 2WDVA 3N9MA 2CRBA 4EYUA 2IC9A 3PU3A 3WI3A 5AFUL 2NP9A 3KBTA 3CMLA 3IF8B 3E0ZA 5EZYE 4DR2T 2I6HA 3VU7H 5HEUA 2LSIA 3ONXA 3AXJB 4ISSA 5JH7E 1Y01A 2BG9C 5LG4A 1MIWA 4IL9A 2V5DA 4MALA 4O4LE 5AQMB 2VVSA 3Q9DA 4YSYA 2YDSA 3NZQA 5BMVE 2DWKA 4WBNE 2EHOA 2HHHT 5FXZA 5AQSB 3UFGA 3KV5A 1BR2A 2WY2A 4TZ4C 4HTEA 2Q9QC 3NKZA 4QXHB 4H9RC 5DQVA 5FL1A 1IZNB 1B7TA 2CHOA 3U3IA 4JLEA 4ADZA 2XQ8A 2AXDS 4IE5A 4QH4A 4QHOA 4C90A 2W0GA 2WDQA 1T98A
chains in the Genus database with same CATH topology
3FHNA 3HKBE 3ZN1B 4YLHA 3RRCA 4EZ4A 3KVAA 2NTYA 1HFAA 2K5BB 5KDMC 4U74A 1QSDA 2WBLA 2WMNA 1YW0A 1NAFA 1ZHCA 4HKAA 3ETVA 1LKXA 4MHCA 4NUUA 1Y64B 2LHNA 2A72A 3I9WA 3Q2MA 1KK7A 2LSJA 3PE0A 2W00A 3FBZA 3UUMA 3RH3A 2XAQB 4HN9A 4NUVA 3N9PA 1D0ZA 3KDSE 3H3AA 1D0YA 3UFEA 4K0UA 5HYAA 3DJBA 4HFVA 2PFVA 2KMFA 3F57A 2XAJB 4EXTA 4AQFA 2A2FX 1G73A 5LJMA 4HEAA 4UVBB 3VKGA 3FXEB 4PW8A 5DABA 2XAHB 2H7OA 2X51A 5JQGE 1HS7A 3OKQA 5CA1E 3AA1B 3MJXA 3SRZA 5JDHA 4CI2B 3EUHA 4X20E 3WAJA 4BA9A 4UVAB 5E0OA 4ZI7E 5LGNB 3S4UA 1IJ6A 4OHFA 4UELA 4DBRA 5HWXA 2K9AA 2Q9QA 3ZC0A 3C50A 3ZJ1A 3GN5B 4UV8B 5FY1A 4CXWA 4AKIA 3EDUA 1U5PA 3EVYA 2D0TA 2K24A 4I4TE 4AKGA 3ANWB 3OJAA 4GK5E 3HKCE 1OXZA 2DWGA 4MLKA 3B13A 4CZZB 4E7SA 3IBPA 5LNKA 1MIVA 5KX5E 2Y6XA 3SS1A 2GK9A 1OWAA 3RX6A 5EK4A 1MMGA 3SWHA 5KMGP 1X79A 4BJNA 3C64A 4ZS2A 4AKRB 5HAXA 5LHGB 3ZN0B 4GK0E 2XAFB 1V9DA 2CWYA 4OFZA 5F3JA 3L3PA 3H37A 2LOSA 3MK7C 2BVMA 3P8CD 3RRWA 2ZM8A 3PUSA 3KFWX 2D5UA 2P9BA 5HXSA 4UEMA 2E8IA 1WYCA 3ZCJA 4IIJE 1O3XA 3R84B 4PK5A 3CKDA 4V1Av 4H9PC 3CQGB 4GIWA 1YD8G 1QUUA 4DMVA 5LHIB 3JC6D 3K8PC 4IGUA 4PFPA 1IJ5A 4A56A 4FJOA 4UIGA 2V7KA 2Z6EA 3V5UA 3GA8A 2NWBA 3RYFE 3HL6A 3UULA 3LG7A 3FBLA 1HCIA 1UX5A 5HXEA 2ZM0A 5FXVA 1US7B 2DI4A 1UX4A 3ZMVB 5CA0E 2DNXA 3O9XA 3PUAA 2JQQA 3JC6C 4P0AA 2L3LA 2X67A 4ANJA 4DBQA 2W63A 3HA4A 3EDVA 4CI3B 4H9SE 2CE7A 3ZMZB 5L3EB 4HE8A 2J1DG 3ZMUB 4C91A 3Q5XA 2KZ7B 5A1LA 2E9XB 1AJ3A 3QK6A 5LHHB 3RYHE 2A3DA 2MBGA 3W15B 3CQCB 4FI5A 4ILUA 1D1CA 2WAUA 5HWYA 3RYIE 2ODVA 3ANWA 3HI2A 1HF8A 3PU8A 4UF0B 3UUXB 1KNZA 2VB6A 4OK0A 1MIYA 1HG5A 4OYJA 3R6NA 5LGTB 4KP3C 3VKHA 1Z0PA 2MTQA 5JR9C 5LGUB 2PJQA 3BK9A 3IHRA 4L5GA 2JJ9A 5JRCB 4QWNB 3N2OA 2VWAA 2LSKA 4O2BE 3I0QA 4H9OC 2LHRA 1HTJF 3NRXA 4ZS3A 2ODUA 4O2AE 3ZLIA 5FXWA 3MKDA 3O1HA 4QXBB 4X1YE 4YJ3E 1SHZC 3J9X1 1UCUA 2VK9A 2LJLA 5ADXL 3HKDE 4XAXB 3CPZA 3FB2A 2YK0A 5TAOA 4EAHA 2KWHA 2XHEB 3RKOA 1MNDA 2SPCA 3AAIA 4CI1B 2EHOD 3IEEA 4O4JE 3LK3B 2ZLYA 4PJJA 1U4QA 2XQYA 3E08A 4TUYE 3MZKB 2N9DA 2OA5A 4IE0A 3MACA 5M4YA 3CVRA 3I1AA 4EB6E 1FMVA 3PUGA 3KV4A 4YJ2E 2N2NA 2LSYA 5L3BB 2NW7A 2EHOC 2Y48B 1VRBA 4DNDA 5IYZE 2L9QA 1NWMX 3GWHA 3NRYA 4JEHB 4O8SA 3UT5E 3LK42 2BDEA 2HH7A 2C5JA 2E9XA 2X9HA 4YHJA 2LT3A 2MOZA 4J2CA 3ZCIA 2NOXA 1D0XA 4H9QC 4CXXA 2JRKA 4IE7A 4UF0A 3RPUA 5HXRA 5JDMA 2LM9A 1FMWA 3P7IA 2JMHA 1WR6A 1WRDA 3KV6A 3K3QC 3CX8B 2V1DB 2MYSA 4GYRA 5ETWA 2YINA 3AVRA 5EK2A 5JRCA 3NBXX 3RC3A 3N5LA 1FIOA 3K3OA 4PAGA 2WWUA 4TV9E 3BQLA 2C0SA 5FY7A 2N1GA 4O4IE 5L3DB 1WYBA 1LVFA 2BZBA 2KNDA 2RP4A 2ACXA 5LA6E 4PFOA 1D1AA 4O4HE 2D2SA 5JDFA 1S94A 2CXFA 2X9YA 2HPJA 3LBXB 3ZMTB 3OYZA 2VKDA 4WW0A 5LP6E 3LK2B 4PJLA 2I59A 3B57A 5HXHA 2LE8A 3VHLA 4XZCA 3ZYLA 1D1BA 1YKEB 2G0UA 4ZI3D 3OBVE 3ZPOA 4DO0A 4I55E 5EK3A 2KLQA 4ZI2D 2XTLA 3AA7B 3C98B 4ZOLE 3ZJ2A 3NZPA 3O1JA 4X1KE 2K48A 3C51A 4E7ZA 3TKLB 1EZ3A 4AQFC 4ZI3C 3GN5A 3UUNA 5J2UE 4AKHA 2VL8A 2DHRA 4ZI2C 2ZM2A 3D0TA 2XASB 2KINB 3OYXA 1WLXA 2LEHA 5FMNA 2XAGB 4HGAA 4P0BA 3DP7A 3QUJA 4QX8B 2CLYB 2WM9A 4P09A 4BJMA 3K3NA 5JR9B 2V7MA 2CLYC 2CA5A 4QX7B 4EZHA 5L3FB 4WBOA 4TN7B 5H6QB 5L3CB 4X1IE 4IDZA 4G63A 3WAKA 5F8PA 5GONE 4AKLA 3ETUA 2V26A 2V7JA 5LBQB 5LOVE 3KBUA 2X68A 3M65A 3MA9A 4PK4A 4UXNB 3J7Yq 2CMRA 2D0UA 3U78A 2M67A 3E22E 2PBIA 3BQKA 3O1IA 4TV8E 4EIWA 2IW5B 4YFSA 3ZC1A 5FY0A 4EOZB 3Q5WA 2Y8DA 3V5SA 4AI6A 2V7IA 5C8YE 2CM0A 1MMAA 5L2LA 5CB4E 5JDNA 2UXNB 2NTXA 2QGSA 2NW9A 3CX6B 4F6RC 3C4ZA 4H63V 3KV9A 1S35A 3PURA 2DLRA 2LSGA 2X9XA 3N2KE 4KUMB 2DCFA 3PUQA 5DJQC 2C5IT 4CQIA 2C5KT 2VASA 2UXXB 4AQGA 2WSSV 2YEVC 3O4XE 3RYCE 4G2AA 3LBXA 2LOPA 5JREA 3LJCA 3RC8A 2XUEA 4ASKA 1BR1A 2VKJA 2JMKA 2X66A 4MFRA 4Z8XA 5LXTE 5LYJE 3AAAB 3C4XA 2EHOB 3ESLA 2IAKA 4KMCA 5FYMA 2W61A 2ES0A 1BR4A 3SOLA 2X0LB 3ZEFB 2KT9A 3QC9A 1ZEEA 3N9LA 2VKOA 4JEUB 3PDYA 3AA6B 4IE4A 3UTKA 2KWIB 4WNKA 2L8KA 4GYSA 1FEWA 2CEAA 4EYYR 3ZYMA 2NW8A 1ZV4X 3C4WA 3CX7B 4L9IA 3T8OA 5IHYA 5LJNA 1HG2A 2CCQA 2H7VC 4ISTA 3ZYKA 4DMWA 2IC6A 4UVCB 4I43B 5JDLA 3F2EA 1VOMA 1SA0E 4M1PA 1E1HB 2W62A 3MXZA 3L09A 5JR9A 4OYKA 5L3GB 2CWOA 4QXCB 4TX5A 2V7LA 2JPFA 3AVSA 3LFMA 4PJMA 3BQIA 4U72A 4CXYA 3N9MA 4EYUA 3N9QA 1MMNA 3F31A 2IC9A 2YU1A 4JUYA 3PU3A 3WI3A 3HKEE 5AFUL 2BVLA 2PG8A 1H7CA 4IHJE 2NP9A 4ZHQE 4IE6A 3CQXC 3KBTA 3CMLA 3IF8B 1HX8A 2CXLA 3E0ZA 3KINB 5EZYE 2WMOA 4I50E 3VU7H 2KXPB 2LSIA 2VKHA 3N2GE 3ONXA 4H9NC 4BAYB 5LCYA 3AA0B 4N78D 4ISSA 2YU2A 3KVBA 3AB3B 5JH7E 3AAEB 5FNVE 4PNIA 3CWZB 1MIWA 3HR0A 5LG4A 4L0RA 1IAPA 4MALA 3N9NA 2CXDA 4O4LE 1MNEA 3Q9DA 1G8XA 2HPLA 3GMIA 3NZQA 5BMVE 3DTOA 2DWKA 5H6RB 4WBNE 4AXPA 2EHOA 2Q9QD 3A5XA 4QKNA 5DQWA 5FXZA 5J1GA 1BR0A 4GOUA 1MMDA 3PTRB 3N9OA 2ZMAA 3FXDB 4XBFB 4PK6A 3KV5A 1BR2A 1LVKA 4PJNA 2H3RA 2Q9QB 4MBQA 4TZ4C 4HTEA 2E9XD 5JDGA 2Q9QC 4ERRA 4DVDA 4QXHB 1YKHB 4H9RC 5DQVA 2X9WA 1IZNB 3I9YA 1B7TA 5JDQA 5LBMA 2B1EA 3ZMSB 5HXCA 5JVDE 3U3IA 4JLEA 1LRZA 4ADZA 5FP3A 2QA7A 4H63H 2E9XC 4UV9B 1CUNA 4B6XA 4IE5A 5FXXA 3I0OA 2RA1A 4QHOA 4C90A 2W0GA 5J2TE 4KBMB 1T98A 1ZKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB3 B;  4PNI A;  3CX6 B;  3QC9 A;  3C4Z A;  2DLR A;  1IAP A;  4YHJ A;  4WNK A;  4WBO A;  3C51 A;  1ZV4 X;  3C4W A;  3CX7 B;  4L9I A;  3T8O A;  4IGU A;  2ACX A;  1HTJ F;  2A72 A;  2PBI A;  4GOU A;  3C4X A;  3C50 A;  3CX8 B;  1SHZ C;  2I59 A;  2ES0 A; 
#chains in the Genus database with same CATH topology
 3ZN1 B;  4YLH A;  3RRC A;  3PUW F;  1HFA A;  5FVK A;  1SE7 A;  4U74 A;  4ZZC A;  2WBL A;  5AQI B;  3AE7 A;  5CGM A;  2A72 A;  2BG9 A;  3Q2M A;  1KK7 A;  2LSJ A;  3RH3 A;  2XAQ B;  3KDS E;  1D0Y A;  3UFE A;  3LSV A;  5HYA A;  1G73 A;  4HEA A;  2XAH B;  5JQG E;  1HS7 A;  3ONJ A;  4UVA B;  3TLU A;  2Q9Q A;  5IUX A;  3PUZ F;  2PTF A;  3EVY A;  2D0T A;  3FZK B;  4I4T E;  4AKG A;  3HKC E;  4HWF A;  4A5X A;  4LF8 T;  4E7S A;  3IBP A;  5LNK A;  1MIV A;  3OVU A;  3RIU C;  3SS1 A;  2GK9 A;  5KMG P;  4BJN A;  4AKR B;  3VR8 A;  2XAF B;  2BVM A;  4COF A;  3R84 B;  4PK5 A;  3EAM A;  3K1S A;  4H9P C;  4GIW A;  1YD8 G;  4DMV A;  3L39 A;  3JC6 D;  3K8P C;  4ILA A;  3V5U A;  2NWB A;  3HL6 A;  1UUR A;  3UUL A;  3FBL A;  3VRA A;  1UX5 A;  5FXV A;  3ZSS A;  2DI4 A;  2DNX A;  3PUA A;  4P0A A;  1IBL T;  4H9S E;  5ABG A;  2OLT A;  2KZ7 B;  1AJ3 A;  5LHH B;  5LMU T;  3W15 B;  4YY3 T;  4FI5 A;  3RYI E;  1J5E T;  3ANW A;  3AE3 A;  4LFB T;  4OK0 A;  1MIY A;  5LGT B;  1Z0P A;  3RIU A;  2UUB T;  2PJQ A;  3IHR A;  5KXJ A;  4LML A;  2V6Y A;  3QOF A;  3JAE A;  2V8S V;  2XZE A;  1UK5 A;  3ZLI A;  5FXW A;  4YJ3 E;  4X1Y E;  3J9X 1;  3FB2 A;  2KWH A;  2XHE B;  1J1J A;  4JI8 T;  3AAI A;  3TLV A;  5AQR B;  3LK3 B;  3QB5 A;  2H88 A;  1U4Q A;  2XQY A;  3MZK B;  2OA5 A;  2BKN A;  3MAC A;  2KSR A;  5M4Y A;  3I1A A;  3KV4 A;  4YJ2 E;  2N2N A;  2LSY A;  2Y48 B;  2FJB A;  4DND A;  5IYZ E;  2XPK A;  3NRY A;  4JEH B;  2NR4 A;  3LK4 2;  3UT5 E;  2C5J A;  4YHJ A;  1OED E;  4J2C A;  3AE9 A;  5AQV B;  2JQH A;  2NOX A;  5AQQ B;  4IE7 A;  4DV1 T;  2LRK A;  3EI0 A;  1WRD A;  3K3Q C;  5ETW A;  5EK2 A;  2CBJ A;  2WWU A;  4ILC A;  1OED C;  5FY7 A;  4TWD A;  4O4I E;  5L3D B;  4TWH A;  2FBW A;  1LVF A;  2KND A;  5AQF B;  2ACX A;  5LA6 E;  3UUB A;  3P4Q A;  3LBX B;  2HPJ A;  3ZMT B;  2VKD A;  3LK2 B;  4XZC A;  3ZT5 A;  4YTN A;  3OBV E;  2IIU A;  4I55 E;  2XTL A;  2ACZ A;  5HEH A;  3AA7 B;  3VR9 A;  3O1J A;  1HX1 B;  4DR1 T;  4JI1 T;  3TKL B;  4ZI3 C;  2WZH A;  3P50 A;  2VL8 A;  1W09 A;  2VQF T;  4HGA A;  3DP7 A;  5AQH B;  3K3N A;  5JR9 B;  2V7M A;  2CLY C;  2CA5 A;  4GKK T;  1XMO T;  4QX7 B;  4EZH A;  5H6Q B;  5L47 A;  3M65 A;  3O1I A;  4TV8 E;  2IW5 B;  3Q5W A;  1T72 A;  4ZZB A;  2CM0 A;  4IRE A;  5JDN A;  5LB7 B;  3CX6 B;  3C4Z A;  2DLR A;  5DJQ C;  2DCF A;  2C5K T;  4IDP A;  2YEV C;  3EAB A;  3O4X E;  4G2A A;  1WFD A;  2JMK A;  4MFR A;  2EHO B;  2ES0 A;  2X0L B;  3ZEF B;  2KT9 A;  3UU4 A;  3QC9 A;  2FJA A;  2VKO A;  3N9L A;  3AE1 A;  3UTK A;  2XQ3 A;  3ZYM A;  1ZV4 X;  3C4W A;  5IHY A;  1HG2 A;  2H7V C;  4DMW A;  2IC6 A;  5JDL A;  2WB5 A;  2E5L T;  1SA0 E;  4M1P A;  2CWO A;  1HNX T;  3LFM A;  4PJM A;  3N9Q A;  2ZM6 T;  2YU1 A;  4JUY A;  3HKE E;  2PG8 A;  4IHJ E;  3PUX F;  2VKH A;  4BAY B;  5LCY A;  3AA0 B;  2BG9 B;  3KVB A;  3AB3 B;  3AAE B;  4OX9 T;  2UXB T;  3CWZ B;  3HR0 A;  3UU5 A;  1G8X A;  2HN2 A;  3GMI A;  5H6R B;  2Q9Q D;  1W9R A;  4LFC T;  4X62 T;  4QKN A;  2XQ9 A;  3N9O A;  3FXD B;  1LVK A;  4PJN A;  2Q9Q B;  4MBQ A;  1SUM B;  5JDG A;  2X9W A;  5JDQ A;  3ZMS B;  5JVD E;  1T7S A;  5FP3 A;  2E9X C;  4U31 A;  4UV9 B;  4B3T T;  4QH1 A;  2YDQ A;  5FXX A;  2RA1 A;  3TLS A;  2W2U A;  5J2T E;  4HFE A;  4KBM B;  1ZKE A;  3FHN A;  3HKB E;  3KVA A;  2NTY A;  3AED A;  1KNR A;  4LFA T;  4LF4 T;  4HKA A;  4NUU A;  3PJA J;  3T1H T;  1XWM A;  1Y64 B;  4CN1 A;  3UUM A;  3Q5E A;  4DR7 T;  4HN9 A;  1D0Z A;  3DJB A;  4HFV A;  2KMF A;  2XAJ B;  4EXT A;  4AQF A;  4UVB B;  4PW8 A;  2X51 A;  3AA1 B;  4CI2 B;  1M7K A;  4ZI7 E;  5E0O A;  5AQT B;  3S4U A;  1IJ6 A;  4UEL A;  1N36 T;  4IDN A;  5FY1 A;  3ANW B;  3OJA A;  4MLK A;  2H89 A;  4CZZ B;  4CN4 A;  1OWA A;  3RX6 A;  5EK4 A;  2V6Y B;  3SWH A;  1X79 A;  4ZS2 A;  4DR3 T;  5HAX A;  1JNR A;  3ZN0 B;  1V9D A;  5F3J A;  3MK7 C;  3PUS A;  4UEM A;  2LM2 A;  4IIJ E;  1O3X A;  3CKD A;  1QUU A;  5LHI B;  1HNZ T;  4IGU A;  4FJO A;  2IUB A;  5HXE A;  1US7 B;  3ZMV B;  2J62 A;  4LMJ A;  1E2A A;  3UU6 A;  3P4S A;  3ZMU B;  1KNP A;  3Q5D A;  3RF1 A;  1XNQ T;  4JI2 T;  2MBG A;  3RLF F;  5IWA T;  2WAU A;  3AEA A;  2XQ6 A;  1HF8 A;  4TNW A;  4JV5 T;  3RI5 A;  2WCA A;  5L4E A;  4KP3 C;  3G06 A;  5FKY A;  3BK9 A;  2JJ9 A;  4K0K T;  2LKH A;  3CK6 A;  4QWN B;  1HNW T;  5HCJ A;  2LSK A;  2IDO B;  3JAD A;  4ZS3 A;  2XM1 A;  2ODU A;  3H3M A;  4O2A E;  4NXM T;  3MKD A;  1SHZ C;  1UUS A;  5ADX L;  3HKD E;  3CPZ A;  2YK0 A;  2X0H A;  2I0M A;  2FJE A;  4CI1 B;  4P1N A;  3IEE A;  2WP9 A;  2A9U A;  3E08 A;  4IL4 A;  2N9D A;  1FMV A;  5L3B B;  1UGO A;  1VRB A;  4O8S A;  5LMN T;  2M6B A;  2X9H A;  2MOZ A;  3AE8 A;  3ZCI A;  4H9Q C;  3AE4 A;  4ZEY A;  3RPU A;  2JMH A;  1WR6 A;  3CX8 B;  2V1D B;  4GYR A;  4U2Y A;  3NBX X;  5AQG B;  3N5L A;  3K3O A;  3BQL A;  1YQ3 A;  1R8I A;  4Q25 A;  2XSB A;  4HFD A;  3UQ4 A;  2BZB A;  4DV3 T;  4B3M T;  4O4H E;  2CXF A;  2X9Y A;  2W4X A;  4WW0 A;  2LLY A;  5LG3 A;  1D1B A;  4ZI3 D;  5EK3 A;  2KLQ A;  1VCT A;  3C98 B;  2XQA A;  3PV0 F;  2DHR A;  4ZI2 C;  2ZM2 A;  3D0T A;  2KIN B;  5FVL A;  5J0Z A;  5FMN A;  2XAG B;  2UXC T;  2CLY B;  2WM9 A;  4NXN T;  2QYW A;  1YXR A;  4WYV A;  4HWD A;  4WBO A;  5L3F B;  4X1I E;  4G63 A;  5LOV E;  2X68 A;  4UXN B;  4PK4 A;  2CMR A;  4AI6 A;  2V7I A;  2YOE A;  5CB4 E;  2V5C A;  2QGS A;  3KV9 A;  1S35 A;  3PUR A;  4KUM B;  2X9X A;  4CQI A;  2UXX B;  3OTO T;  3RYC E;  2LOP A;  5JRE A;  4JBW F;  3LJC A;  1BR1 A;  5LXT E;  3AAA B;  2IAK A;  5FYM A;  4JI7 T;  2M6I A;  4IDO A;  1ZEE A;  4JEU B;  4GKJ T;  2FJD A;  2E2A A;  2CPT A;  1WCR A;  2NW8 A;  3FZF B;  4L9I A;  3RGL A;  4IST A;  1E1H B;  2W62 A;  4OYK A;  4A97 A;  2BS4 A;  4U72 A;  4CXY A;  2WU5 A;  1MMN A;  5HEJ A;  4KX6 A;  2BVL A;  2V6X A;  4F8H A;  1VCS A;  4ZHQ E;  4IE6 A;  2WMO A;  1KFY A;  2XM2 A;  1DU2 A;  3N9N A;  1MNE A;  3DTO A;  4AXP A;  5J1G A;  3L8R A;  1BR0 A;  1MMD A;  3PTR B;  2ZMA A;  4PK6 A;  1HR0 T;  1X9B A;  2H3R A;  3RQW A;  2E9X D;  4DV0 T;  4DUY T;  5LBM A;  2B1E A;  1CUN A;  4B6X A;  4EV6 A;  1OED A;  4EED A;  1XNR T;  2XQ7 A;  3M3Z B;  1QSD A;  5FL0 A;  2B76 A;  1YW0 A;  1LKX A;  4AIS A;  3TLW A;  1E7P A;  2WQY A;  2LHN A;  1N32 T;  3PUV F;  3PE0 A;  3FBZ A;  4NUV A;  5C3J A;  4DR6 T;  4K0U A;  5ABE A;  1ZOY A;  5LJM A;  2A2F X;  3VKG A;  3OKQ A;  3MJX A;  3FZH B;  5JDH A;  3EUH A;  4X20 E;  3WAJ A;  4BA9 A;  4HFB A;  1M62 A;  2K9A A;  3ZC0 A;  3GN5 B;  4UV8 B;  4CXW A;  4AKI A;  3ZT6 A;  4GK5 E;  1OXZ A;  3B13 A;  4YSX A;  2WZI A;  5C2T A;  4I0U A;  4JI3 T;  3AE2 A;  3QB5 K;  2XQ4 A;  5LHG B;  2CWY A;  3H37 A;  2LOS A;  2ZM8 A;  3KFW X;  4LF9 T;  1WYC A;  3ZCJ A;  4V1A v;  1ZP0 A;  3CQG B;  4X66 T;  5AQO B;  1I6Z A;  4JYA T;  1IJ5 A;  4A56 A;  3RIA A;  1IBK T;  4UIG A;  2WDR A;  2Z6E A;  3RYF E;  4U7I A;  3LG7 A;  1HCI A;  3JCF A;  2ZM0 A;  2UXD T;  1UX4 A;  2JQ9 A;  1J5W A;  4U33 A;  4DV7 T;  3HA4 A;  3EDV A;  4CI3 B;  3ZMZ B;  2CE7 A;  5L3E B;  4HE8 A;  2J1D G;  3Q5X A;  3ZST A;  4YHH T;  3QK6 A;  1FJG T;  3ABV A;  4KHZ F;  4ILU A;  4IDQ A;  4JI6 T;  3HI2 A;  3PU8 A;  2VB6 A;  1HG5 A;  5JR9 C;  4L5G A;  3T1Y T;  5HCM A;  3A8Y C;  4O2B E;  1HTJ F;  3P4P A;  5ABF B;  4QXB B;  3CIR A;  2LJL A;  4XAX B;  3AE5 A;  5TAO A;  2CHN A;  3RKO A;  2SPC A;  3SFE A;  2BKO A;  4O4J E;  2MPK A;  1IBM T;  3OPC A;  4PJJ A;  4TUY E;  2LRL A;  4YT0 A;  3VRB A;  4DV2 T;  4EB6 E;  1QLB A;  3PUG A;  2NW7 A;  2EHO C;  4X5T A;  2L9Q A;  2W66 A;  1NWM X;  2JQK A;  2E9X A;  2LT3 A;  2JRK A;  4DR4 T;  4UF0 A;  5HXR A;  4DV4 T;  1FMW A;  3P7I A;  4JI4 T;  1NEK A;  2MYS A;  3AEB A;  4LMK A;  1W0A A;  5JRC A;  3RC3 A;  3UQ7 A;  3SFD A;  1FIO A;  2BG9 E;  4PAG A;  1T8B A;  4TV9 E;  2C0S A;  3PUY F;  4YTP A;  2N1G A;  2VQE T;  1KEY A;  2BBH A;  1WR0 A;  2RP4 A;  1D1A A;  2VVN A;  2D2S A;  5JDF A;  1S94 A;  1XDO A;  4PJL A;  2YKS A;  4KHP T;  3B57 A;  1I94 T;  3ZYL A;  2BS3 A;  4ZI2 D;  4ZOL E;  3NZP A;  4X1K E;  3C51 A;  2J4G A;  4AIU A;  3RHW A;  2IHR 1;  2OV9 A;  4QH5 A;  3GN5 A;  5J2U E;  4AKH A;  4YXD A;  2J47 A;  2XAS B;  3OYX A;  2LEH A;  3QUJ A;  4HFC A;  4B3S T;  1GQE A;  4TN7 B;  4IDZ A;  2HN1 A;  5F8P A;  5GON E;  3ETU A;  2V26 A;  5LBQ B;  3KBU A;  4ZXL A;  3J7Y q;  2FUP A;  2PBI A;  3ZC1 A;  4YFS A;  5FY0 A;  5C8Y E;  2E5V A;  2UXN B;  2NTX A;  4F6R C;  3RQU A;  4H63 V;  3N2K E;  3PUQ A;  2C5I T;  2VAS A;  4AQG A;  2WSS V;  4LF5 T;  3RC8 A;  2VKJ A;  5LYJ E;  2W61 A;  3P4R A;  2W67 A;  3SOL A;  2JIW A;  4EGW A;  3PDY A;  3AA6 B;  2KWI B;  4WNK A;  2L8K A;  4GYS A;  4A98 A;  1FEW A;  2CEA A;  3EHZ A;  3CX7 B;  5LJN A;  2CCQ A;  4JI5 T;  4WZX A;  2AE9 A;  4I43 B;  4HWI B;  1VOM A;  5L3G B;  3MXZ A;  4KI0 F;  4QXC B;  3AVS A;  4LF6 T;  4NIQ A;  3BQI A;  1OED B;  5L4H A;  3F31 A;  1H7C A;  5ABF A;  1XMQ T;  4TWF A;  3CQX C;  1HX8 A;  2CXL A;  3KIN B;  1KF6 A;  4I50 E;  2KXP B;  3N2G E;  4H9N C;  4N78 D;  2YU2 A;  5FNV E;  4PNI A;  4L0R A;  1IAP A;  2CXD A;  2HPL A;  3A5X A;  5DQW A;  4GOU A;  4XBF B;  2K3W A;  3AEC A;  4ERR A;  4DVD A;  3B5M A;  1YKH B;  3I9Y A;  5HXC A;  3FZM B;  1LRZ A;  1XDP A;  2QA7 A;  4H63 H;  3I0O A;  3AEE A;  4EZ4 A;  4NPP A;  2K5B B;  5KDM C;  3ZT7 A;  2XJ7 A;  2WMN A;  1ZHC A;  1NAF A;  2VL0 A;  3ETV A;  4Z91 A;  4MHC A;  4JI0 T;  3NWI A;  3AXJ A;  3I9W A;  5HEO A;  2QRX A;  2W00 A;  4HFI A;  2LKG A;  3N9P A;  3H3A A;  1W0B A;  2PFV A;  2RPA A;  3F57 A;  4ILB A;  3FXE B;  5F5W A;  5DAB A;  2H7O A;  5CA1 E;  3SRZ A;  5LGN B;  3PJA A;  4DBR A;  4OHF A;  5HWX A;  3JAF A;  5ABH A;  1NEN A;  3C50 A;  4LF7 T;  3ZJ1 A;  3TLT A;  3EDU A;  1U5P A;  3FZL B;  2K24 A;  2WU2 A;  5AQN B;  4U3C A;  3IA3 A;  2DWG A;  3P4W A;  4AQY T;  2DL1 A;  5KX5 E;  2Y6X A;  1MMG A;  5AQP B;  3C64 A;  4U2Z A;  4GK0 E;  4OFZ A;  5HEG A;  3L3P A;  3RRW A;  3P8C D;  2D5U A;  2P9B A;  5HXS A;  2E8I A;  3A7M A;  2UUA T;  2IML A;  4DR5 T;  4PFP A;  4YSZ A;  3UU3 A;  2V7K A;  3GA8 A;  5CA0 E;  3O9X A;  2JQQ A;  3JC6 C;  2L3L A;  2X67 A;  4ANJ A;  4DBQ A;  2W63 A;  2YDR A;  3AEF A;  2F4V T;  4C91 A;  4YTM A;  5A1L A;  2E9X B;  2D9D A;  2XY8 B;  3RYH E;  2A3D A;  2QVA A;  3CQC B;  1CHU A;  3X1D A;  1D1C A;  5HWY A;  2ODV A;  4UF0 B;  3UUX B;  1KNZ A;  4OYJ A;  3R6N A;  3VKH A;  2MTQ A;  5LGU B;  3RKG A;  5JRC B;  2BS2 A;  2CBI A;  3N2O A;  2VWA A;  3I0Q A;  4U7Y A;  4H9O C;  2LHR A;  3NRX A;  3NVO A;  1JNZ A;  3O1H A;  1UCU A;  2VK9 A;  5BR8 T;  4EAH A;  1MND A;  4HFH A;  2BBJ A;  2EHO D;  3QNU A;  4TNV A;  2ZLY A;  1YQ4 A;  4IE0 A;  2BKP A;  3CVR A;  2X0Y A;  3GWH A;  2BDE A;  2HH7 A;  4HWC A;  1D0X A;  4CXX A;  5JDM A;  2LM9 A;  4B3R T;  3KV6 A;  2UUC T;  2YIN A;  3AVR A;  3UU8 A;  5JTG A;  1WYB A;  1XZY A;  4PFO A;  4DUZ T;  3OYZ A;  5LP6 E;  2I59 A;  5HXH A;  2LE8 A;  3VHL A;  3AEG A;  1YKE B;  2G0U A;  3ZPO A;  4DO0 A;  2XSA A;  3ZJ2 A;  4IT4 A;  1L0V A;  2K48 A;  4E7Z A;  1EZ3 A;  2VUR A;  5AQJ B;  4AQF C;  4DID B;  4HWH A;  3UUN A;  1N34 T;  1WLX A;  2WS3 A;  4X64 T;  4P0B A;  4QX8 B;  4P09 A;  4BJM A;  4DV6 T;  4UR9 A;  2MAW A;  5AQK B;  5L3C B;  3WAK A;  3AE6 A;  4AKL A;  2V7J A;  3MA9 A;  1Z8U A;  2D0U A;  3U78 A;  2XQ5 A;  2M67 A;  3E22 E;  4EIW A;  3BQK A;  4EOZ B;  2Y8D A;  3V5S A;  2UU9 T;  1MMA A;  4CN6 A;  5L2L A;  2NW9 A;  2LSG A;  1N33 T;  4EEB A;  3LBX A;  2XUE A;  4ASK A;  2X66 A;  2WWV A;  4Z8X A;  3C4X A;  3ESL A;  4KMC A;  4DV5 T;  4Z90 A;  4X65 T;  1BR4 A;  3ONL C;  4IE4 A;  3RIF A;  5CFB A;  5AQL B;  3ZKR A;  4EYY R;  3T8O A;  3ZYK A;  4UVC B;  3LDQ B;  3F2E A;  2R6G F;  5JR9 A;  5CJ5 A;  3L09 A;  2YN6 A;  4TX5 A;  5AQU B;  2V7L A;  2JPF A;  2WDV A;  3N9M A;  2CRB A;  4EYU A;  2IC9 A;  3PU3 A;  3WI3 A;  5AFU L;  2NP9 A;  3KBT A;  3CML A;  3IF8 B;  3E0Z A;  5EZY E;  4DR2 T;  2I6H A;  3VU7 H;  5HEU A;  2LSI A;  3ONX A;  3AXJ B;  4ISS A;  5JH7 E;  1Y01 A;  2BG9 C;  5LG4 A;  1MIW A;  4IL9 A;  2V5D A;  4MAL A;  4O4L E;  5AQM B;  2VVS A;  3Q9D A;  4YSY A;  2YDS A;  3NZQ A;  5BMV E;  2DWK A;  4WBN E;  2EHO A;  2HHH T;  5FXZ A;  5AQS B;  3UFG A;  3KV5 A;  1BR2 A;  2WY2 A;  4TZ4 C;  4HTE A;  2Q9Q C;  3NKZ A;  4QXH B;  4H9R C;  5DQV A;  5FL1 A;  1IZN B;  1B7T A;  2CHO A;  3U3I A;  4JLE A;  4ADZ A;  2XQ8 A;  2AXD S;  4IE5 A;  4QH4 A;  4QHO A;  4C90 A;  2W0G A;  2WDQ A;  1T98 A; 
#chains in the Genus database with same CATH homology
 3FHN A;  3HKB E;  3ZN1 B;  4YLH A;  3RRC A;  4EZ4 A;  3KVA A;  2NTY A;  1HFA A;  2K5B B;  5KDM C;  4U74 A;  1QSD A;  2WBL A;  2WMN A;  1YW0 A;  1NAF A;  1ZHC A;  4HKA A;  3ETV A;  1LKX A;  4MHC A;  4NUU A;  1Y64 B;  2LHN A;  2A72 A;  3I9W A;  3Q2M A;  1KK7 A;  2LSJ A;  3PE0 A;  2W00 A;  3FBZ A;  3UUM A;  3RH3 A;  2XAQ B;  4HN9 A;  4NUV A;  3N9P A;  1D0Z A;  3KDS E;  3H3A A;  1D0Y A;  3UFE A;  4K0U A;  5HYA A;  3DJB A;  4HFV A;  2PFV A;  2KMF A;  3F57 A;  2XAJ B;  4EXT A;  4AQF A;  2A2F X;  1G73 A;  5LJM A;  4HEA A;  4UVB B;  3VKG A;  3FXE B;  4PW8 A;  5DAB A;  2XAH B;  2H7O A;  2X51 A;  5JQG E;  1HS7 A;  3OKQ A;  5CA1 E;  3AA1 B;  3MJX A;  3SRZ A;  5JDH A;  4CI2 B;  3EUH A;  4X20 E;  3WAJ A;  4BA9 A;  4UVA B;  5E0O A;  4ZI7 E;  5LGN B;  3S4U A;  1IJ6 A;  4OHF A;  4UEL A;  4DBR A;  5HWX A;  2K9A A;  2Q9Q A;  3ZC0 A;  3C50 A;  3ZJ1 A;  3GN5 B;  4UV8 B;  5FY1 A;  4CXW A;  4AKI A;  3EDU A;  1U5P A;  3EVY A;  2D0T A;  2K24 A;  4I4T E;  4AKG A;  3ANW B;  3OJA A;  4GK5 E;  3HKC E;  1OXZ A;  2DWG A;  4MLK A;  3B13 A;  4CZZ B;  4E7S A;  3IBP A;  5LNK A;  1MIV A;  5KX5 E;  2Y6X A;  3SS1 A;  2GK9 A;  1OWA A;  3RX6 A;  5EK4 A;  1MMG A;  3SWH A;  5KMG P;  1X79 A;  4BJN A;  3C64 A;  4ZS2 A;  4AKR B;  5HAX A;  5LHG B;  3ZN0 B;  4GK0 E;  2XAF B;  1V9D A;  2CWY A;  4OFZ A;  5F3J A;  3L3P A;  3H37 A;  2LOS A;  3MK7 C;  2BVM A;  3P8C D;  3RRW A;  2ZM8 A;  3PUS A;  3KFW X;  2D5U A;  2P9B A;  5HXS A;  4UEM A;  2E8I A;  1WYC A;  3ZCJ A;  4IIJ E;  1O3X A;  3R84 B;  4PK5 A;  3CKD A;  4V1A v;  4H9P C;  3CQG B;  4GIW A;  1YD8 G;  1QUU A;  4DMV A;  5LHI B;  3JC6 D;  3K8P C;  4IGU A;  4PFP A;  1IJ5 A;  4A56 A;  4FJO A;  4UIG A;  2V7K A;  2Z6E A;  3V5U A;  3GA8 A;  2NWB A;  3RYF E;  3HL6 A;  3UUL A;  3LG7 A;  3FBL A;  1HCI A;  1UX5 A;  5HXE A;  2ZM0 A;  5FXV A;  1US7 B;  2DI4 A;  1UX4 A;  3ZMV B;  5CA0 E;  2DNX A;  3O9X A;  3PUA A;  2JQQ A;  3JC6 C;  4P0A A;  2L3L A;  2X67 A;  4ANJ A;  4DBQ A;  2W63 A;  3HA4 A;  3EDV A;  4CI3 B;  4H9S E;  2CE7 A;  3ZMZ B;  5L3E B;  4HE8 A;  2J1D G;  3ZMU B;  4C91 A;  3Q5X A;  2KZ7 B;  5A1L A;  2E9X B;  1AJ3 A;  3QK6 A;  5LHH B;  3RYH E;  2A3D A;  2MBG A;  3W15 B;  3CQC B;  4FI5 A;  4ILU A;  1D1C A;  2WAU A;  5HWY A;  3RYI E;  2ODV A;  3ANW A;  3HI2 A;  1HF8 A;  3PU8 A;  4UF0 B;  3UUX B;  1KNZ A;  2VB6 A;  4OK0 A;  1MIY A;  1HG5 A;  4OYJ A;  3R6N A;  5LGT B;  4KP3 C;  3VKH A;  1Z0P A;  2MTQ A;  5JR9 C;  5LGU B;  2PJQ A;  3BK9 A;  3IHR A;  4L5G A;  2JJ9 A;  5JRC B;  4QWN B;  3N2O A;  2VWA A;  2LSK A;  4O2B E;  3I0Q A;  4H9O C;  2LHR A;  1HTJ F;  3NRX A;  4ZS3 A;  2ODU A;  4O2A E;  3ZLI A;  5FXW A;  3MKD A;  3O1H A;  4QXB B;  4X1Y E;  4YJ3 E;  1SHZ C;  3J9X 1;  1UCU A;  2VK9 A;  2LJL A;  5ADX L;  3HKD E;  4XAX B;  3CPZ A;  3FB2 A;  2YK0 A;  5TAO A;  4EAH A;  2KWH A;  2XHE B;  3RKO A;  1MND A;  2SPC A;  3AAI A;  4CI1 B;  2EHO D;  3IEE A;  4O4J E;  3LK3 B;  2ZLY A;  4PJJ A;  1U4Q A;  2XQY A;  3E08 A;  4TUY E;  3MZK B;  2N9D A;  2OA5 A;  4IE0 A;  3MAC A;  5M4Y A;  3CVR A;  3I1A A;  4EB6 E;  1FMV A;  3PUG A;  3KV4 A;  4YJ2 E;  2N2N A;  2LSY A;  5L3B B;  2NW7 A;  2EHO C;  2Y48 B;  1VRB A;  4DND A;  5IYZ E;  2L9Q A;  1NWM X;  3GWH A;  3NRY A;  4JEH B;  4O8S A;  3UT5 E;  3LK4 2;  2BDE A;  2HH7 A;  2C5J A;  2E9X A;  2X9H A;  4YHJ A;  2LT3 A;  2MOZ A;  4J2C A;  3ZCI A;  2NOX A;  1D0X A;  4H9Q C;  4CXX A;  2JRK A;  4IE7 A;  4UF0 A;  3RPU A;  5HXR A;  5JDM A;  2LM9 A;  1FMW A;  3P7I A;  2JMH A;  1WR6 A;  1WRD A;  3KV6 A;  3K3Q C;  3CX8 B;  2V1D B;  2MYS A;  4GYR A;  5ETW A;  2YIN A;  3AVR A;  5EK2 A;  5JRC A;  3NBX X;  3RC3 A;  3N5L A;  1FIO A;  3K3O A;  4PAG A;  2WWU A;  4TV9 E;  3BQL A;  2C0S A;  5FY7 A;  2N1G A;  4O4I E;  5L3D B;  1WYB A;  1LVF A;  2BZB A;  2KND A;  2RP4 A;  2ACX A;  5LA6 E;  4PFO A;  1D1A A;  4O4H E;  2D2S A;  5JDF A;  1S94 A;  2CXF A;  2X9Y A;  2HPJ A;  3LBX B;  3ZMT B;  3OYZ A;  2VKD A;  4WW0 A;  5LP6 E;  3LK2 B;  4PJL A;  2I59 A;  3B57 A;  5HXH A;  2LE8 A;  3VHL A;  4XZC A;  3ZYL A;  1D1B A;  1YKE B;  2G0U A;  4ZI3 D;  3OBV E;  3ZPO A;  4DO0 A;  4I55 E;  5EK3 A;  2KLQ A;  4ZI2 D;  2XTL A;  3AA7 B;  3C98 B;  4ZOL E;  3ZJ2 A;  3NZP A;  3O1J A;  4X1K E;  2K48 A;  3C51 A;  4E7Z A;  3TKL B;  1EZ3 A;  4AQF C;  4ZI3 C;  3GN5 A;  3UUN A;  5J2U E;  4AKH A;  2VL8 A;  2DHR A;  4ZI2 C;  2ZM2 A;  3D0T A;  2XAS B;  2KIN B;  3OYX A;  1WLX A;  2LEH A;  5FMN A;  2XAG B;  4HGA A;  4P0B A;  3DP7 A;  3QUJ A;  4QX8 B;  2CLY B;  2WM9 A;  4P09 A;  4BJM A;  3K3N A;  5JR9 B;  2V7M A;  2CLY C;  2CA5 A;  4QX7 B;  4EZH A;  5L3F B;  4WBO A;  4TN7 B;  5H6Q B;  5L3C B;  4X1I E;  4IDZ A;  4G63 A;  3WAK A;  5F8P A;  5GON E;  4AKL A;  3ETU A;  2V26 A;  2V7J A;  5LBQ B;  5LOV E;  3KBU A;  2X68 A;  3M65 A;  3MA9 A;  4PK4 A;  4UXN B;  3J7Y q;  2CMR A;  2D0U A;  3U78 A;  2M67 A;  3E22 E;  2PBI A;  3BQK A;  3O1I A;  4TV8 E;  4EIW A;  2IW5 B;  4YFS A;  3ZC1 A;  5FY0 A;  4EOZ B;  3Q5W A;  2Y8D A;  3V5S A;  4AI6 A;  2V7I A;  5C8Y E;  2CM0 A;  1MMA A;  5L2L A;  5CB4 E;  5JDN A;  2UXN B;  2NTX A;  2QGS A;  2NW9 A;  3CX6 B;  4F6R C;  3C4Z A;  4H63 V;  3KV9 A;  1S35 A;  3PUR A;  2DLR A;  2LSG A;  2X9X A;  3N2K E;  4KUM B;  2DCF A;  3PUQ A;  5DJQ C;  2C5I T;  4CQI A;  2C5K T;  2VAS A;  2UXX B;  4AQG A;  2WSS V;  2YEV C;  3O4X E;  3RYC E;  4G2A A;  3LBX A;  2LOP A;  5JRE A;  3LJC A;  3RC8 A;  2XUE A;  4ASK A;  1BR1 A;  2VKJ A;  2JMK A;  2X66 A;  4MFR A;  4Z8X A;  5LXT E;  5LYJ E;  3AAA B;  3C4X A;  2EHO B;  3ESL A;  2IAK A;  4KMC A;  5FYM A;  2W61 A;  2ES0 A;  1BR4 A;  3SOL A;  2X0L B;  3ZEF B;  2KT9 A;  3QC9 A;  1ZEE A;  3N9L A;  2VKO A;  4JEU B;  3PDY A;  3AA6 B;  4IE4 A;  3UTK A;  2KWI B;  4WNK A;  2L8K A;  4GYS A;  1FEW A;  2CEA A;  4EYY R;  3ZYM A;  2NW8 A;  1ZV4 X;  3C4W A;  3CX7 B;  4L9I A;  3T8O A;  5IHY A;  5LJN A;  1HG2 A;  2CCQ A;  2H7V C;  4IST A;  3ZYK A;  4DMW A;  2IC6 A;  4UVC B;  4I43 B;  5JDL A;  3F2E A;  1VOM A;  1SA0 E;  4M1P A;  1E1H B;  2W62 A;  3MXZ A;  3L09 A;  5JR9 A;  4OYK A;  5L3G B;  2CWO A;  4QXC B;  4TX5 A;  2V7L A;  2JPF A;  3AVS A;  3LFM A;  4PJM A;  3BQI A;  4U72 A;  4CXY A;  3N9M A;  4EYU A;  3N9Q A;  1MMN A;  3F31 A;  2IC9 A;  2YU1 A;  4JUY A;  3PU3 A;  3WI3 A;  3HKE E;  5AFU L;  2BVL A;  2PG8 A;  1H7C A;  4IHJ E;  2NP9 A;  4ZHQ E;  4IE6 A;  3CQX C;  3KBT A;  3CML A;  3IF8 B;  1HX8 A;  2CXL A;  3E0Z A;  3KIN B;  5EZY E;  2WMO A;  4I50 E;  3VU7 H;  2KXP B;  2LSI A;  2VKH A;  3N2G E;  3ONX A;  4H9N C;  4BAY B;  5LCY A;  3AA0 B;  4N78 D;  4ISS A;  2YU2 A;  3KVB A;  3AB3 B;  5JH7 E;  3AAE B;  5FNV E;  4PNI A;  3CWZ B;  1MIW A;  3HR0 A;  5LG4 A;  4L0R A;  1IAP A;  4MAL A;  3N9N A;  2CXD A;  4O4L E;  1MNE A;  3Q9D A;  1G8X A;  2HPL A;  3GMI A;  3NZQ A;  5BMV E;  3DTO A;  2DWK A;  5H6R B;  4WBN E;  4AXP A;  2EHO A;  2Q9Q D;  3A5X A;  4QKN A;  5DQW A;  5FXZ A;  5J1G A;  1BR0 A;  4GOU A;  1MMD A;  3PTR B;  3N9O A;  2ZMA A;  3FXD B;  4XBF B;  4PK6 A;  3KV5 A;  1BR2 A;  1LVK A;  4PJN A;  2H3R A;  2Q9Q B;  4MBQ A;  4TZ4 C;  4HTE A;  2E9X D;  5JDG A;  2Q9Q C;  4ERR A;  4DVD A;  4QXH B;  1YKH B;  4H9R C;  5DQV A;  2X9W A;  1IZN B;  3I9Y A;  1B7T A;  5JDQ A;  5LBM A;  2B1E A;  3ZMS B;  5HXC A;  5JVD E;  3U3I A;  4JLE A;  1LRZ A;  4ADZ A;  5FP3 A;  2QA7 A;  4H63 H;  2E9X C;  4UV9 B;  1CUN A;  4B6X A;  4IE5 A;  5FXX A;  3I0O A;  2RA1 A;  4QHO A;  4C90 A;  2W0G A;  5J2T E;  4KBM B;  1T98 A;  1ZKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...