1HTJF

Structure of the rgs-like domain from pdz-rhogef
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
ESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KIAA0380
publication title Structure of the RGS-like domain from PDZ-RhoGEF: linking heterotrimeric g protein-coupled signaling to Rho GTPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 66
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2000-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1htjF00
2PBIA 4WNKA 3C4XA 2DLRA 3C51A 1IAPA 4GOUA 3QC9A 4IGUA 2ES0A 3CX8B 4L9IA 2A72A 3C4ZA 4PNIA 3T8OA 2I59A 2ACXA 3C4WA 1ZV4X 3CX6B 1HTJF 4YHJA 1SHZC 3CX7B 3C50A 4WBOA 3AB3B
chains in the Genus database with same CATH superfamily
1FIOA 4LF6T 3AEBA 1G73A 4XBFB 4C91A 5CB4E 3ONLC 4I55E 3PU8A 3ZYKA 2IMLA 4XZCA 4TZ4C 1T7SA 5EK4A 2XAFB 4QH1A 2XM2A 4P09A 2NWBA 3JC6D 3PUYF 2VK9A 2UXXB 3KVBA 4U31A 2QA7A 3ZSTA 3IF8B 3TKLB 3RC3A 4EZ4A 2A3DA 2RP4A 4XAXB 2XQ8A 5F8PA 3ZC0A 3V5UA 3KDSE 4H9SE 1QSDA 3LK42 4JI2T 2WMOA 4WW0A 5FVKA 5JDNA 4DV0T 2E5VA 5LHHB 4DR5T 3AEFA 5IYZE 3C51A 2W00A 4ZI7E 4CI3B 4CXYA 3LBXA 3AE2A 2CMRA 4DV1T 2ZM0A 2WWVA 4HFEA 4ZS2A 4O4LE 1L0VA 1NEKA 4DIDB 2LT3A 3FBLA 4HWDA 5JDMA 2N2NA 4B6XA 4YT0A 5F3JA 4TNVA 2KT9A 2VVNA 3VKGA 2X66A 5DQWA 4TWFA 4WBOA 4OX9T 1G8XA 3QOFA 4Z91A 3EDVA 3B13A 5LNKA 3ZMSB 3SFDA 4HFDA 1UX4A 3CQXC 2FUPA 2CLYC 1BR1A 3ETVA 5HYAA 3HL6A 3ANWA 4EYYR 1O3XA 3C4ZA 1VOMA 2VASA 1X9BA 3Q5WA 4TV9E 5JDHA 3JADA 4U3CA 2LJLA 4YLHA 2X0LB 3E0ZA 2BS2A 4L5GA 4DR6T 4PJNA 2CBJA 5L3EB 4MBQA 3F57A 4QWNB 2Q9QC 4DV4T 4YSZA 5LP6E 4KHPT 4FI5A 4DUZT 2CLYB 4ZI3D 4X1IE 2ODVA 4KX6A 2IW5B 3ONJA 4UF0A 2JIWA 4AKRB 5HXEA 3FZLB 4IE0A 3AE6A 4F8HA 4CI1B 3AXJB 2HN1A 3V5SA 1XDOA 2KWIB 5KXJA 3FZHB 4CZZB 2E5LT 2HPLA 4J2CA 2X0YA 3I0QA 4NUVA 2Q9QB 2WWUA 4X66T 2VWAA 2DWKA 3UUMA 2L3LA 2UUBT 3AA1B 5AQHB 3AA6B 4P0BA 2NW8A 1QLBA 1MMDA 2YN6A 4DMVA 4HFVA 4HN9A 5LCYA 3EHZA 2LEHA 1XDPA 1U5PA 5IWAT 4JUYA 5FXVA 2RA1A 3LJCA 2KMFA 5M4YA 3VKHA 2BBHA 5LGTB 5HXSA 5AQNB 3RPUA 2HH7A 5J2TE 5LYJE 3CIRA 2V5CA 1Y01A 4P0AA 3AAIA 2DHRA 2WAUA 1D1AA 5LJNA 1MIWA 2Y48B 4BJNA 2IC6A 2NTXA 2E9XD 1W0BA 3LK2B 2V7KA 5HEJA 3N9PA 3K3NA 3Q5EA 4KMCA 3BQIA 5JDLA 2YU2A 4KP3C 5F5WA 3HKBE 1DU2A 2ZMAA 5CGMA 3N9NA 3NWIA 4B3TT 1BR0A 2X9HA 3CQGB 4EIWA 4AQGA 1MIYA 4JEUB 2W66A 4X1YE 2HHHT 2M6IA 2WZHA 3ZMUB 1U4QA 2VKJA 2KXPB 4ILBA 2A72A 3P4PA 1KK7A 2BG9A 2W2UA 3LDQB 4JLEA 1BR2A 2A9UA 3ZC1A 2IAKA 4O8SA 5C2TA 3B57A 3P4QA 3OPCA 5FY0A 3P8CD 2X0HA 1XNQT 4B3ST 3AE1A 4K0UA 2J62A 4PK5A 3X1DA 3SRZA 4HWHA 4TX5A 4I43B 2BKNA 3P4RA 3AE5A 4QHOA 1YKHB 4K0KT 3AB3B 1NAFA 2ZLYA 2RPAA 2IC9A 5AQVB 2V6YB 4NPPA 5JDGA 5AQLB 3PJAA 3ZMVB 4ANJA 1KNZA 4A98A 2VURA 4UIGA 3J9X1 4PK4A 2C5JA 2XTLA 4ISSA 1YQ4A 3RYFE 2IIUA 2DLRA 2YKSA 5CA1E 3PTRB 1I94T 3KV4A 1VCSA 5AQJB 2E9XB 4TWHA 2BDEA 1XWMA 3MK7C 2QYWA 2CXLA 4X1KE 5KDMC 3OTOT 1W0AA 5TAOA 5CJ5A 5H6RB 3K3QC 4EEDA 1CUNA 4AISA 2CRBA 2XSAA 1HFAA 1E7PA 5ABFA 4I4TE 2QGSA 5HCJA 4UXNB 3UUXB 3PUAA 4AQFA 5KMGP 4N78D 5FY1A 1E1HB 2XSBA 3R6NA 2XQ9A 4LFBT 2XJ7A 4HWCA 2X68A 1T8BA 5LBMA 4LFAT 1HNWT 2BBJA 5HEGA 4ZXLA 5L4EA 3Q5XA 3PUSA 2HN2A 3EI0A 5LJMA 3OVUA 2J4GA 3N2OA 4QKNA 4PFPA 4ADZA 3UU6A 1W09A 2M6BA 3SS1A 2V7IA 2LKHA 1T98A 1Y64B 1WRDA 4HGAA 2UXBT 2JQHA 1WYCA 4EGWA 5LHIB 4CI2B 4EOZB 3P4WA 2NP9A 3EVYA 4YFSA 1OWAA 4KBMB 3PUXF 3AVSA 1MMAA 1SUMB 3HA4A 3AE9A 1D0YA 3SFEA 3Q2MA 4DV5T 4L0RA 2VL0A 4HKAA 3UT5E 3KBUA 4BAYB 3OJAA 3L8RA 4JI0T 2JQ9A 2LSGA 5AQGB 4DR3T 4ILUA 5FXWA 3AE4A 1MIVA 4MHCA 2V1DB 4IL9A 4EV6A 3VRBA 4GKJT 4A5XA 4WBNE 4IDOA 4GOUA 2CBIA 4DR2T 4LF7T 3Q5DA 1NWMX 4KUMB 1D0ZA 3SOLA 3KV5A 1HNZT 2UXNB 2XM1A 2YDQA 3LBXB 2YDSA 1R8IA 2CM0A 5LA6E 3C98B 2XQ3A 4DV7T 3JC6C 2H7OA 2LM2A 3IEEA 1N34T 3JAFA 3N5LA 3PU3A 2LRLA 3UUNA 3TLUA 3F2EA 4JI4T 4IE5A 1IZNB 5CFBA 1VRBA 4IE4A 2A2FX 3RRCA 2XQ6A 4TV8E 2HPJA 4ZI2D 1UK5A 2N1GA 2H89A 2Z6EA 5DJQC 2QRXA 3PUZF 4BA9A 3N9MA 3PUVF 2OV9A 2XQ4A 4EAHA 1WLXA 5AQMB 4LF9T 4O2BE 3L09A 4E7ZA 2BZBA 1LVKA 3QC9A 2E8IA 2JQKA 4QX8B 4IE6A 2XHEB 4GYSA 3DTOA 1OEDA 4TWDA 3ZMZB 2WDVA 4A97A 2CPTA 3WI3A 2UXCT 1MNDA 2FJBA 1HX8A 3Q9DA 5LBQB 3PDYA 1YKEB 5KX5E 2CWYA 2K5BB 2NOXA 3ZT6A 2X9YA 2XAQB 2VKDA 2YOEA 3M65A 3RYCE 4ZEYA 3K8PC 4IDZA 2LE8A 3N9QA 5DQVA 1HTJF 2C5KT 4MLKA 2V7JA 1ZP0A 4IIJE 1FMVA 5JR9C 5FL1A 3HR0A 4GYRA 5FXXA 2DNXA 1FJGT 5IUXA 4YHJA 2B1EA 2EHOD 2KWHA 2CWOA 3GN5A 4OYJA 2G0UA 2XQ5A 2V7MA 2K24A 3FZMB 3KINB 4GIWA 3FZKB 3UULA 2XQYA 4JV5T 2AXDS 2XY8B 3LFMA 4LMJA 4OFZA 1KF6A 4WNKA 5HEUA 5BR8T 2FJDA 3UQ4A 4G2AA 3DP7A 1V9DA 1S35A 3R84B 5LGNB 5JVDE 2PFVA 2VVSA 1LRZA 5JR9B 4ILCA 2XAHB 4ASKA 4BJMA 4UELA 2LOSA 3AEDA 1IBKT 2WCAA 5LMNT 4ZI3C 3ZLIA 3HKEE 3B5MA 4OK0A 4TUYE 3ZCIA 3AE7A 2CE7A 4YSXA 5L2LA 2ZM8A 2WB5A 2JRKA 2MAWA 1D0XA 3CK6A 3AECA 2ZM6T 2W4XA 3KFWX 3RF1A 2E2AA 3RQUA 2Q9QA 4IDQA 5LG3A 1IJ6A 3P4SA 3EABA 5FP3A 2VL8A 4DBRA 4YTMA 4CN4A 2IHR1 3KBTA 3RGLA 2YDRA 5EZYE 3FHNA 4IT4A 3ZN0B 3I9WA 4HFBA 4JI3T 4Z8XA 4DR7T 1XZYA 4LFCT 3RKOA 4B3RT 3L39A 3LK3B 3BK9A 2VB6A 2BS4A 2EHOA 1HS7A 3AEEA 3GWHA 1N33T 2NW7A 5FVLA 1GQEA 1WFDA 2V6XA 1KNPA 2VKOA 1US7B 2M67A 4YHHT 3UTKA 3O1JA 5AQTB 4CN1A 5AQQB 2KNDA 3PV0F 1LKXA 3PUQA 2IUBA 4AIUA 1IJ5A 1JNRA 4DR1T 4OYKA 5L3GB 3H37A 2E9XC 3RIUC 4HFCA 1S94A 4PJMA 3ESLA 2DWGA 2QVAA 5EK3A 2MOZA 1H7CA 3O1IA 2WZIA 2GK9A 5J2UE 4U33A 4NIQA 4L9IA 4O4JE 2VQFT 2H7VC 2XPKA 1M7KA 4UVCB 3C4WA 3MZKB 3CVRA 4LF4T 3RYIE 5JH7E 4JYAT 4GKKT 2LSIA 2NTYA 3CKDA 3LSVA 1Z8UA 2LHNA 5L3BB 5FYMA 3VU7H 3AE3A 3ETUA 3PUWF 1MMGA 2UXDT 1CHUA 1HF8A 4HWIB 3T1HT 3C4XA 3AAEB 5ABFB 4PAGA 1KEYA 5JRCA 2JMKA 4JBWF 5AQOB 1MNEA 3P7IA 4ZOLE 3QK6A 3ZT7A 4FJOA 4CXXA 4ZHQE 4M1PA 4ERRA 2CXFA 3RHWA 5AQSB 1HG2A 3CWZB 3JAEA 4X64T 3O1HA 4HEAA 4DV2T 2C5IT 4IREA 4IE7A 4AQYT 3U3IA 3MXZA 2BVLA 4PK6A 3I9YA 3HKCE 4DV3T 4NXNT 5ADXL 2WU2A 4H9QC 3UU5A 1SE7A 2VKHA 4QH5A 3CX6B 1YXRA 1BR4A 3BQLA 5LB7B 3E08A 4HFIA 3KVAA 4KI0F 3L3PA 2R6GF 2NW9A 3QB5K 4YSYA 4X62T 3RIAA 3TLSA 2BS3A 4JI6T 2W0GA 5JQGE 4DMWA 4KHZF 3EUHA 4U7IA 5L3FB 4YJ3E 2AE9A 3ABVA 3N2GE 3NRYA 5IHYA 2XUEA 4IDPA 3P50A 5FKYA 2X9XA 2CXDA 2ODUA 5JREA 3UU8A 2FJEA 1WR0A 5C8YE 3A8YC 1B7TA 4GK5E 5ETWA 3RKGA 3TLVA 4H63H 3ZCJA 2D9DA 3J7Yq 4EEBA 4UVAB 3RLFF 5AFUL 4A56A 2V7LA 3IA3A 2NR4A 2KZ7B 2LOPA 3AE8A 4UVBB 4WYVA 1W9RA 2D0TA 3OKQA 3N9LA 4DNDA 2WM9A 2WSSV 3DJBA 1WYBA 4JEHB 3VR8A 4X65T 3ZT5A 2D5UA 2V26A 3GA8A 2Y6XA 1OEDC 4EYUA 3TLWA 4EXTA 4DUYT 2LSJA 5AQIB 3ZEFB 2LRKA 2X67A 1D1CA 3O9XA 4NUUA 3FZFB 3JCFA 4PFOA 2MBGA 5DABA 2LSYA 1HNXT 5FNVE 4H63V 3O4XE 4YY3T 5HEHA 4V1Av 4HTEA 4YTNA 3FBZA 2VQET 2WMNA 2JMHA 4NXMT 3CMLA 1IBMT 2ACZA 3AEGA 5AQFB 2XZEA 3M3ZB 3A7MA 2WY2A 1OEDB 1LVFA 3HI2A 2YU1A 4IDNA 2I6HA 4WZXA 3MACA 2BG9E 2CHOA 3NRXA 5HXRA 3A5XA 4LMKA 1E2AA 4ZZBA 3RI5A 5E0OA 4PJJA 3ANWB 4DR4T 1ZKEA 4AI6A 1SHZC 3ZSSA 5LOVE 3ONXA 2OA5A 5ABGA 3NBXX 3H3MA 5HXCA 4LF8T 2FJAA 2H3RA 2Q9QD 5HXHA 3MJXA 4X5TA 3NZQA 4U7YA 3CX8B 2MYSA 2WDRA 3PJAJ 4OHFA 4UR9A 4CQIA 3RC8A 3MA9A 4DVDA 4EB6E 1NENA 2WP9A 4MFRA 4ZI2C 3AEAA 3OYZA 3I0OA 3FXEB 2JQQA 2XQAA 5H6QB 4I0UA 4DV6T 3GN5B 2X9WA 2BVMA 4UF0B 3T8OA 3PUGA 4H9RC 5FXZA 3UUBA 3VRAA 4I50E 4B3MT 3ZN1B 3D0TA 2X51A 1ZEEA 5LXTE 3C64A 3AVRA 2IDOB 5LGUB 1J1JA 2JJ9A 4Z90A 1XMQT 1OXZA 4U2ZA 1UX5A 4LF5T 5JDQA 2V8SV 2LSKA 3UU4A 2H88A 1N32T 4QXCB 2K48A 2D2SA 4HFHA 1IBLT 5L4HA 2UU9T 3OBVE 3UFGA 1IAPA 3S4UA 1XMOT 1SA0E 5AQKB 4YXDA 3TLTA 4AKGA 1YQ3A 2B76A 1XNRT 4CN6A 2YK0A 3H3AA 3RRWA 2WU5A 1JNZA 4G63A 4IHJE 5L3CB 1I6ZA 3RX6A 2EHOC 2V5DA 3AXJA 4HE8A 5FL0A 4CXWA 2BKOA 4O4IE 5LMUT 2OLTA 3PE0A 1EZ3A 2XASB 4EZHA 5J0ZA 2N9DA 2YINA 3NVOA 2BG9C 5JR9A 2J1DG 3KV9A 5GONE 3HKDE 2UUAT 3EDUA 4UV8B 5FY7A 2CCQA 4AKHA 4UV9B 3RYHE 3AA0B 5LG4A 2KINB 3ZJ1A 3IBPA 4AKLA 3K3OA 1YD8G 1HG5A 2EHOB 4IGUA 2L8KA 3UU3A 3ZJ2A 5BMVE 2MPKA 2CHNA 3N2KE 2BG9B 2PBIA 3NKZA 4DO0A 1ZHCA 4TNWA 3EAMA 4H9NC 4PNIA 4QXHB 3NZPA 2ZM2A 2XAJB 3RH3A 3ZPOA 4U74A 2D0UA 4QH4A 2CEAA 2FBWA 3ZKRA 2LKGA 4JI8T 3UFEA 5A1LA 3W15B 3E22E 1M62A 5HWYA 3KV6A 4Q25A 4U72A 3VHLA 1HCIA 4P1NA 1X79A 1Z0PA 1UGOA 4JI1T 5HAXA 4ISTA 5FMNA 2Y8DA 3BQKA 1ZOYA 3RIFA 5LHGB 2LHRA 2WQYA 2W63A 1FMWA 3K1SA 4PW8A 2DI4A 2WS3A 5AQRB 3QB5A 5JDFA 2LM9A 3QUJA 2PJQA 2JPFA 5ABEA 4AQFC 4ILAA 4UEMA 4JI5T 1UUSA 3ZMTB 4AXPA 4O4HE 3ZYMA 4ZZCA 4JI7T 2F4VT 5L47A 5ABHA 3GMIA 3I1AA 4E7SA 5L3DB 2DCFA 2XQ7A 5JRCB 1WR6A 3C50A 4H9PC 2MTQA 4GK0E 3AAAB 3QNUA 4AKIA 2V6YA 4HWFA 3U78A 3ZYLA 2W62A 4PJLA 2KLQA 1D1BA 4LMLA 5C3JA 1KFYA 4YTPA 1FEWA 2K3WA 1J5WA 2WBLA 3CQCB 4MALA 1QUUA 2E9XA 1OEDE 3RIUA 3OYXA 2K9AA 3AA7B 2ES0A 3FB2A 1UURA 2PG8A 2J47A 3N9OA 1HR0T 5J1GA 3SWHA 5CA0E 4YJ2E 2CA5A 2PTFA 4COFA 3IHRA 2BKPA 1WCRA 5AQPB 3UQ7A 3MKDA 1KNRA 5JTGA 4ZS3A 1VCTA 4IL4A 4C90A 1YW0A 2XAGB 3LG7A 4O2AE 1AJ3A 5EK2A 5AQUB 3WAKA 2I59A 4DBQA 1UCUA 3VR9A 1ZV4X 4QXBB 3T1YT 3CX7B 2C0SA 2YEVC 2L9QA 3PURA 1T72A 3CPZA 4U2YA 2WDQA 2W61A 1J5ET 2LLYA 3RQWA 2I0MA 2W67A 5HCMA 4H9OC 5HEOA 1MMNA 2UUCT 2DL1A 3G06A 3F31A 1HX1B 4TN7B 2P9BA 2SPCA 1N36T 2ACXA 4X20E 3FXDB 3WAJA 5HWXA 4QX7B 2KSRA 4F6RC
chains in the Genus database with same CATH topology
2XTLA 4ISSA 3KFWX 3ONXA 2OA5A 3NBXX 3RYFE 1FIOA 5HXCA 2H3RA 2DLRA 1G73A 4XBFB 2Q9QD 2Q9QA 4C91A 3MJXA 5HXHA 5CA1E 5CB4E 3NZQA 3PTRB 3KV4A 1IJ6A 3CX8B 2MYSA 4OHFA 4CQIA 4I55E 3RC8A 3MA9A 3PU8A 3ZYKA 4DVDA 5FP3A 2E9XB 4EB6E 4XZCA 4TZ4C 2VL8A 4DBRA 2BDEA 5EK4A 4MFRA 3MK7C 4ZI2C 2XAFB 4P09A 2CXLA 2NWBA 3JC6D 3OYZA 4X1KE 3KBTA 5KDMC 2VK9A 3I0OA 5EZYE 3FXEB 3FHNA 2JQQA 2UXXB 3KVBA 5H6QB 3ZN0B 3I9WA 4Z8XA 5TAOA 5H6RB 3K3QC 3GN5B 2X9WA 2BVMA 4UF0B 1CUNA 3T8OA 3PUGA 2QA7A 3IF8B 3RKOA 1HFAA 4H9RC 5FXZA 3LK3B 3TKLB 3RC3A 4EZ4A 3BK9A 2A3DA 2RP4A 4I50E 2VB6A 4XAXB 2EHOA 5F8PA 3ZN1B 4I4TE 3V5UA 3ZC0A 1HS7A 2QGSA 3D0TA 2X51A 3GWHA 1ZEEA 4UXNB 3KDSE 5LXTE 3C64A 2NW7A 3AVRA 4H9SE 3UUXB 3PUAA 1QSDA 3LK42 5LGUB 2JJ9A 2WMOA 4AQFA 1OXZA 2VKOA 5KMGP 4N78D 1UX5A 5FY1A 5JDQA 1E1HB 1US7B 2M67A 4WW0A 2LSKA 3R6NA 3UTKA 5JDNA 3O1JA 2X68A 5LBMA 4QXCB 2KNDA 2K48A 1LKXA 3PUQA 5LHHB 2D2SA 3Q5XA 5IYZE 3OBVE 1IJ5A 3C51A 2W00A 3PUSA 1IAPA 3S4UA 1SA0E 4OYKA 4ZI7E 5L3GB 5LJMA 3H37A 4CI3B 4AKGA 4CXYA 3LBXA 3N2OA 2E9XC 4QKNA 4PFPA 2CMRA 1S94A 2YK0A 3H3AA 3RRWA 2ZM0A 4PJMA 3ESLA 4ADZA 4ZS2A 4O4LE 2DWGA 5EK3A 2MOZA 2LT3A 3FBLA 1H7CA 5JDMA 3O1IA 2N2NA 4G63A 3SS1A 2V7IA 4IHJE 5L3CB 3RX6A 2EHOC 2GK9A 4B6XA 5F3JA 1T98A 5J2UE 4HE8A 2KT9A 4CXWA 4O4JE 1Y64B 4L9IA 2H7VC 1WRDA 4UVCB 4HGAA 3VKGA 4O4IE 3C4WA 3MZKB 3PE0A 1EZ3A 1WYCA 3CVRA 2XASB 5LHIB 3RYIE 2X66A 4EZHA 5JH7E 5DQWA 2LSIA 2N9DA 2YINA 4WBOA 2NTYA 4CI2B 5JR9A 4EOZB 2J1DG 3KV9A 5GONE 3CKDA 3HKDE 1G8XA 2NP9A 3EDUA 4UV8B 3EVYA 4YFSA 5FY7A 1OWAA 3EDVA 4KBMB 3B13A 5LNKA 2CCQA 3AVSA 3ZMSB 4AKHA 2LHNA 4UV9B 3RYHE 5L3BB 1UX4A 3AA0B 5FYMA 1MMAA 3CQXC 3HA4A 5LG4A 1D0YA 3VU7H 3Q2MA 2KINB 2CLYC 4L0RA 1BR1A 3ETUA 3ZJ1A 1MMGA 3IBPA 4HKAA 3UT5E 3ETVA 3KBUA 4BAYB 1HF8A 5HYAA 3C4XA 4AKLA 3OJAA 3K3OA 3AAEB 3HL6A 1YD8G 1HG5A 3ANWA 2EHOB 4PAGA 4IGUA 4EYYR 1O3XA 2L8KA 2LSGA 5JRCA 3C4ZA 1VOMA 2JMKA 4ILUA 5FXWA 3ZJ2A 2VASA 5BMVE 1MIVA 1MNEA 4MHCA 3P7IA 3Q5WA 2V1DB 4TV9E 5JDHA 4ZOLE 3QK6A 2LJLA 4FJOA 4CXXA 3N2KE 4YLHA 4ZHQE 2X0LB 2PBIA 3E0ZA 4L5GA 4DO0A 4WBNE 4M1PA 1ZHCA 4ERRA 4GOUA 2CXFA 4PJNA 1HG2A 5L3EB 4H9NC 3CWZB 4MBQA 3F57A 1NWMX 4KUMB 4QWNB 4PNIA 1D0ZA 2Q9QC 3SOLA 3KV5A 3O1HA 5LP6E 4QXHB 3NZPA 2ZM2A 2XAJB 4HEAA 4FI5A 2UXNB 3RH3A 3LBXB 2C5IT 2CLYB 3ZPOA 4ZI3D 4IE7A 4U74A 2CM0A 2D0UA 5JRCB 5LA6E 3U3IA 2CEAA 4X1IE 2ODVA 3MXZA 2BVLA 2IW5B 3C98B 4UF0A 4AKRB 4PK6A 3I9YA 3HKCE 5ADXL 3JC6C 5HXEA 2H7OA 3IEEA 3UFEA 4H9QC 5A1LA 4IE0A 3N5LA 3PU3A 4CI1B 3UUNA 3W15B 3E22E 5HWYA 3KV6A 2VKHA 4U72A 3VHLA 1HCIA 3CX6B 1X79A 3F2EA 1BR4A 3V5SA 3BQLA 1Z0PA 5HAXA 4ISTA 5FMNA 2Y8DA 3E08A 3BQKA 4IE5A 2KWIB 1IZNB 1VRBA 3KVAA 3L3PA 4CZZB 4IE4A 5LHGB 2LHRA 2NW9A 2HPLA 2W63A 1FMWA 2A2FX 4PW8A 3RRCA 4TV8E 2HPJA 4J2CA 2DI4A 4ZI2D 5JDFA 2LM9A 3I0QA 3QUJA 2N1GA 2Z6EA 4NUVA 5DJQC 2Q9QB 2PJQA 2WWUA 2JPFA 4BA9A 3N9MA 4AQFC 2VWAA 2DWKA 4EAHA 2W0GA 5JQGE 1WLXA 3UUMA 2L3LA 4DMWA 4UEMA 3ZMTB 3AA1B 3EUHA 4AXPA 4O4HE 3ZYMA 4O2BE 3L09A 3AA6B 4P0BA 5L3FB 4YJ3E 2NW8A 4E7ZA 1MMDA 2BZBA 4DMVA 1LVKA 3QC9A 2E8IA 3GMIA 4HFVA 4QX8B 3N2GE 3I1AA 3NRYA 4HN9A 4IE6A 5LCYA 4E7SA 2XHEB 4GYSA 2LEHA 3DTOA 5IHYA 2XUEA 1U5PA 5L3DB 2DCFA 4JUYA 3ZMZB 3WI3A 5FXVA 2X9XA 1MNDA 2CXDA 2ODUA 1WR6A 1HX8A 2RA1A 3Q9DA 3PDYA 3C50A 4H9PC 5LBQB 5JREA 2MTQA 3LJCA 4GK0E 5C8YE 2KMFA 3AAAB 4AKIA 1YKEB 5KX5E 5M4YA 2CWYA 1B7TA 3VKHA 4GK5E 2K5BB 5ETWA 5LGTB 2NOXA 3U78A 2X9YA 5HXSA 4H63H 2XAQB 3ZCJA 2VKDA 3ZYLA 2W62A 4PJLA 3RPUA 2HH7A 3M65A 3RYCE 5J2TE 3J7Yq 5LYJE 2KLQA 1D1BA 4UVAB 4P0AA 3AAIA 4A56A 5AFUL 3K8PC 4IDZA 2LE8A 2DHRA 2V7LA 2WAUA 3N9QA 5DQVA 1HTJF 1FEWA 1D1AA 2KZ7B 2LOPA 2WBLA 3CQCB 1MIWA 5LJNA 2C5KT 2Y48B 4MALA 4BJNA 1QUUA 4UVBB 4MLKA 2IC6A 2D0TA 3OKQA 2NTXA 2V7JA 2E9XD 2E9XA 3N9LA 4DNDA 2WM9A 2WSSV 3DJBA 3OYXA 4IIJE 1WYBA 3LK2B 2K9AA 2V7KA 2ES0A 3AA7B 1FMVA 3FB2A 3N9PA 4JEHB 5JR9C 3K3NA 2D5UA 2PG8A 3HR0A 4KMCA 3N9OA 2V26A 3BQIA 5J1GA 3SWHA 5JDLA 4GYRA 5FXXA 5CA0E 4YJ2E 2CA5A 2YU2A 4KP3C 2DNXA 3GA8A 2Y6XA 3IHRA 3HKBE 4YHJA 2ZMAA 2B1EA 3N9NA 4EYUA 1BR0A 2EHOD 2KWHA 3MKDA 2X9HA 3CQGB 2CWOA 4ZS3A 4EIWA 4AQGA 4EXTA 1MIYA 4JEUB 3GN5A 4OYJA 4X1YE 2LSJA 2G0UA 3ZEFB 4C90A 1YW0A 2X67A 3ZMUB 2V7MA 1D1CA 2K24A 3O9XA 1U4QA 2VKJA 2KXPB 2XAGB 3KINB 3LG7A 4GIWA 2A72A 4NUUA 4O2AE 5EK2A 1AJ3A 3WAKA 1KK7A 2I59A 3UULA 2XQYA 4DBQA 1UCUA 4PFOA 2MBGA 1ZV4X 4JLEA 2LSYA 5DABA 5FNVE 1BR2A 4QXBB 4H63V 3O4XE 3CX7B 3LFMA 2C0SA 4V1Av 4HTEA 3ZC1A 4OFZA 2IAKA 2YEVC 3FBZA 2L9QA 4O8SA 2WMNA 3PURA 4WNKA 2JMHA 3B57A 3CPZA 4G2AA 3DP7A 1V9DA 1S35A 3R84B 2W61A 5FY0A 3CMLA 3P8CD 5JVDE 5LGNB 2PFVA 1LRZA 5JR9B 2XAHB 4ASKA 4K0UA 4BJMA 4H9OC 4PK5A 4UELA 3SRZA 1MMNA 4TX5A 4I43B 4QHOA 1YKHB 2LOSA 3AB3B 1LVFA 3HI2A 2YU1A 1NAFA 2ZLYA 2IC9A 3F31A 4ZI3C 3MACA 3ZLIA 3HKEE 3NRXA 5HXRA 4TN7B 3A5XA 5JDGA 2P9BA 4OK0A 2SPCA 4TUYE 3ZCIA 5E0OA 3ZMVB 4ANJA 1KNZA 2ACXA 4X20E 4PJJA 2CE7A 3ANWB 5L2LA 2ZM8A 1ZKEA 3FXDB 3WAJA 2JRKA 4UIGA 1D0XA 3J9X1 4PK4A 5HWXA 1SHZC 4QX7B 4AI6A 2C5JA 4F6RC 5LOVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBI A;  4WNK A;  3C4X A;  2DLR A;  3C51 A;  1IAP A;  4GOU A;  3QC9 A;  4IGU A;  2ES0 A;  3CX8 B;  4L9I A;  2A72 A;  3C4Z A;  4PNI A;  3T8O A;  2I59 A;  2ACX A;  3C4W A;  1ZV4 X;  3CX6 B;  1HTJ F;  4YHJ A;  1SHZ C;  3CX7 B;  3C50 A;  4WBO A;  3AB3 B; 
#chains in the Genus database with same CATH topology
 1FIO A;  4LF6 T;  3AEB A;  1G73 A;  4XBF B;  4C91 A;  5CB4 E;  3ONL C;  4I55 E;  3PU8 A;  3ZYK A;  2IML A;  4XZC A;  4TZ4 C;  1T7S A;  5EK4 A;  2XAF B;  4QH1 A;  2XM2 A;  4P09 A;  2NWB A;  3JC6 D;  3PUY F;  2VK9 A;  2UXX B;  3KVB A;  4U31 A;  2QA7 A;  3ZST A;  3IF8 B;  3TKL B;  3RC3 A;  4EZ4 A;  2A3D A;  2RP4 A;  4XAX B;  2XQ8 A;  5F8P A;  3ZC0 A;  3V5U A;  3KDS E;  4H9S E;  1QSD A;  3LK4 2;  4JI2 T;  2WMO A;  4WW0 A;  5FVK A;  5JDN A;  4DV0 T;  2E5V A;  5LHH B;  4DR5 T;  3AEF A;  5IYZ E;  3C51 A;  2W00 A;  4ZI7 E;  4CI3 B;  4CXY A;  3LBX A;  3AE2 A;  2CMR A;  4DV1 T;  2ZM0 A;  2WWV A;  4HFE A;  4ZS2 A;  4O4L E;  1L0V A;  1NEK A;  4DID B;  2LT3 A;  3FBL A;  4HWD A;  5JDM A;  2N2N A;  4B6X A;  4YT0 A;  5F3J A;  4TNV A;  2KT9 A;  2VVN A;  3VKG A;  2X66 A;  5DQW A;  4TWF A;  4WBO A;  4OX9 T;  1G8X A;  3QOF A;  4Z91 A;  3EDV A;  3B13 A;  5LNK A;  3ZMS B;  3SFD A;  4HFD A;  1UX4 A;  3CQX C;  2FUP A;  2CLY C;  1BR1 A;  3ETV A;  5HYA A;  3HL6 A;  3ANW A;  4EYY R;  1O3X A;  3C4Z A;  1VOM A;  2VAS A;  1X9B A;  3Q5W A;  4TV9 E;  5JDH A;  3JAD A;  4U3C A;  2LJL A;  4YLH A;  2X0L B;  3E0Z A;  2BS2 A;  4L5G A;  4DR6 T;  4PJN A;  2CBJ A;  5L3E B;  4MBQ A;  3F57 A;  4QWN B;  2Q9Q C;  4DV4 T;  4YSZ A;  5LP6 E;  4KHP T;  4FI5 A;  4DUZ T;  2CLY B;  4ZI3 D;  4X1I E;  2ODV A;  4KX6 A;  2IW5 B;  3ONJ A;  4UF0 A;  2JIW A;  4AKR B;  5HXE A;  3FZL B;  4IE0 A;  3AE6 A;  4F8H A;  4CI1 B;  3AXJ B;  2HN1 A;  3V5S A;  1XDO A;  2KWI B;  5KXJ A;  3FZH B;  4CZZ B;  2E5L T;  2HPL A;  4J2C A;  2X0Y A;  3I0Q A;  4NUV A;  2Q9Q B;  2WWU A;  4X66 T;  2VWA A;  2DWK A;  3UUM A;  2L3L A;  2UUB T;  3AA1 B;  5AQH B;  3AA6 B;  4P0B A;  2NW8 A;  1QLB A;  1MMD A;  2YN6 A;  4DMV A;  4HFV A;  4HN9 A;  5LCY A;  3EHZ A;  2LEH A;  1XDP A;  1U5P A;  5IWA T;  4JUY A;  5FXV A;  2RA1 A;  3LJC A;  2KMF A;  5M4Y A;  3VKH A;  2BBH A;  5LGT B;  5HXS A;  5AQN B;  3RPU A;  2HH7 A;  5J2T E;  5LYJ E;  3CIR A;  2V5C A;  1Y01 A;  4P0A A;  3AAI A;  2DHR A;  2WAU A;  1D1A A;  5LJN A;  1MIW A;  2Y48 B;  4BJN A;  2IC6 A;  2NTX A;  2E9X D;  1W0B A;  3LK2 B;  2V7K A;  5HEJ A;  3N9P A;  3K3N A;  3Q5E A;  4KMC A;  3BQI A;  5JDL A;  2YU2 A;  4KP3 C;  5F5W A;  3HKB E;  1DU2 A;  2ZMA A;  5CGM A;  3N9N A;  3NWI A;  4B3T T;  1BR0 A;  2X9H A;  3CQG B;  4EIW A;  4AQG A;  1MIY A;  4JEU B;  2W66 A;  4X1Y E;  2HHH T;  2M6I A;  2WZH A;  3ZMU B;  1U4Q A;  2VKJ A;  2KXP B;  4ILB A;  2A72 A;  3P4P A;  1KK7 A;  2BG9 A;  2W2U A;  3LDQ B;  4JLE A;  1BR2 A;  2A9U A;  3ZC1 A;  2IAK A;  4O8S A;  5C2T A;  3B57 A;  3P4Q A;  3OPC A;  5FY0 A;  3P8C D;  2X0H A;  1XNQ T;  4B3S T;  3AE1 A;  4K0U A;  2J62 A;  4PK5 A;  3X1D A;  3SRZ A;  4HWH A;  4TX5 A;  4I43 B;  2BKN A;  3P4R A;  3AE5 A;  4QHO A;  1YKH B;  4K0K T;  3AB3 B;  1NAF A;  2ZLY A;  2RPA A;  2IC9 A;  5AQV B;  2V6Y B;  4NPP A;  5JDG A;  5AQL B;  3PJA A;  3ZMV B;  4ANJ A;  1KNZ A;  4A98 A;  2VUR A;  4UIG A;  3J9X 1;  4PK4 A;  2C5J A;  2XTL A;  4ISS A;  1YQ4 A;  3RYF E;  2IIU A;  2DLR A;  2YKS A;  5CA1 E;  3PTR B;  1I94 T;  3KV4 A;  1VCS A;  5AQJ B;  2E9X B;  4TWH A;  2BDE A;  1XWM A;  3MK7 C;  2QYW A;  2CXL A;  4X1K E;  5KDM C;  3OTO T;  1W0A A;  5TAO A;  5CJ5 A;  5H6R B;  3K3Q C;  4EED A;  1CUN A;  4AIS A;  2CRB A;  2XSA A;  1HFA A;  1E7P A;  5ABF A;  4I4T E;  2QGS A;  5HCJ A;  4UXN B;  3UUX B;  3PUA A;  4AQF A;  5KMG P;  4N78 D;  5FY1 A;  1E1H B;  2XSB A;  3R6N A;  2XQ9 A;  4LFB T;  2XJ7 A;  4HWC A;  2X68 A;  1T8B A;  5LBM A;  4LFA T;  1HNW T;  2BBJ A;  5HEG A;  4ZXL A;  5L4E A;  3Q5X A;  3PUS A;  2HN2 A;  3EI0 A;  5LJM A;  3OVU A;  2J4G A;  3N2O A;  4QKN A;  4PFP A;  4ADZ A;  3UU6 A;  1W09 A;  2M6B A;  3SS1 A;  2V7I A;  2LKH A;  1T98 A;  1Y64 B;  1WRD A;  4HGA A;  2UXB T;  2JQH A;  1WYC A;  4EGW A;  5LHI B;  4CI2 B;  4EOZ B;  3P4W A;  2NP9 A;  3EVY A;  4YFS A;  1OWA A;  4KBM B;  3PUX F;  3AVS A;  1MMA A;  1SUM B;  3HA4 A;  3AE9 A;  1D0Y A;  3SFE A;  3Q2M A;  4DV5 T;  4L0R A;  2VL0 A;  4HKA A;  3UT5 E;  3KBU A;  4BAY B;  3OJA A;  3L8R A;  4JI0 T;  2JQ9 A;  2LSG A;  5AQG B;  4DR3 T;  4ILU A;  5FXW A;  3AE4 A;  1MIV A;  4MHC A;  2V1D B;  4IL9 A;  4EV6 A;  3VRB A;  4GKJ T;  4A5X A;  4WBN E;  4IDO A;  4GOU A;  2CBI A;  4DR2 T;  4LF7 T;  3Q5D A;  1NWM X;  4KUM B;  1D0Z A;  3SOL A;  3KV5 A;  1HNZ T;  2UXN B;  2XM1 A;  2YDQ A;  3LBX B;  2YDS A;  1R8I A;  2CM0 A;  5LA6 E;  3C98 B;  2XQ3 A;  4DV7 T;  3JC6 C;  2H7O A;  2LM2 A;  3IEE A;  1N34 T;  3JAF A;  3N5L A;  3PU3 A;  2LRL A;  3UUN A;  3TLU A;  3F2E A;  4JI4 T;  4IE5 A;  1IZN B;  5CFB A;  1VRB A;  4IE4 A;  2A2F X;  3RRC A;  2XQ6 A;  4TV8 E;  2HPJ A;  4ZI2 D;  1UK5 A;  2N1G A;  2H89 A;  2Z6E A;  5DJQ C;  2QRX A;  3PUZ F;  4BA9 A;  3N9M A;  3PUV F;  2OV9 A;  2XQ4 A;  4EAH A;  1WLX A;  5AQM B;  4LF9 T;  4O2B E;  3L09 A;  4E7Z A;  2BZB A;  1LVK A;  3QC9 A;  2E8I A;  2JQK A;  4QX8 B;  4IE6 A;  2XHE B;  4GYS A;  3DTO A;  1OED A;  4TWD A;  3ZMZ B;  2WDV A;  4A97 A;  2CPT A;  3WI3 A;  2UXC T;  1MND A;  2FJB A;  1HX8 A;  3Q9D A;  5LBQ B;  3PDY A;  1YKE B;  5KX5 E;  2CWY A;  2K5B B;  2NOX A;  3ZT6 A;  2X9Y A;  2XAQ B;  2VKD A;  2YOE A;  3M65 A;  3RYC E;  4ZEY A;  3K8P C;  4IDZ A;  2LE8 A;  3N9Q A;  5DQV A;  1HTJ F;  2C5K T;  4MLK A;  2V7J A;  1ZP0 A;  4IIJ E;  1FMV A;  5JR9 C;  5FL1 A;  3HR0 A;  4GYR A;  5FXX A;  2DNX A;  1FJG T;  5IUX A;  4YHJ A;  2B1E A;  2EHO D;  2KWH A;  2CWO A;  3GN5 A;  4OYJ A;  2G0U A;  2XQ5 A;  2V7M A;  2K24 A;  3FZM B;  3KIN B;  4GIW A;  3FZK B;  3UUL A;  2XQY A;  4JV5 T;  2AXD S;  2XY8 B;  3LFM A;  4LMJ A;  4OFZ A;  1KF6 A;  4WNK A;  5HEU A;  5BR8 T;  2FJD A;  3UQ4 A;  4G2A A;  3DP7 A;  1V9D A;  1S35 A;  3R84 B;  5LGN B;  5JVD E;  2PFV A;  2VVS A;  1LRZ A;  5JR9 B;  4ILC A;  2XAH B;  4ASK A;  4BJM A;  4UEL A;  2LOS A;  3AED A;  1IBK T;  2WCA A;  5LMN T;  4ZI3 C;  3ZLI A;  3HKE E;  3B5M A;  4OK0 A;  4TUY E;  3ZCI A;  3AE7 A;  2CE7 A;  4YSX A;  5L2L A;  2ZM8 A;  2WB5 A;  2JRK A;  2MAW A;  1D0X A;  3CK6 A;  3AEC A;  2ZM6 T;  2W4X A;  3KFW X;  3RF1 A;  2E2A A;  3RQU A;  2Q9Q A;  4IDQ A;  5LG3 A;  1IJ6 A;  3P4S A;  3EAB A;  5FP3 A;  2VL8 A;  4DBR A;  4YTM A;  4CN4 A;  2IHR 1;  3KBT A;  3RGL A;  2YDR A;  5EZY E;  3FHN A;  4IT4 A;  3ZN0 B;  3I9W A;  4HFB A;  4JI3 T;  4Z8X A;  4DR7 T;  1XZY A;  4LFC T;  3RKO A;  4B3R T;  3L39 A;  3LK3 B;  3BK9 A;  2VB6 A;  2BS4 A;  2EHO A;  1HS7 A;  3AEE A;  3GWH A;  1N33 T;  2NW7 A;  5FVL A;  1GQE A;  1WFD A;  2V6X A;  1KNP A;  2VKO A;  1US7 B;  2M67 A;  4YHH T;  3UTK A;  3O1J A;  5AQT B;  4CN1 A;  5AQQ B;  2KND A;  3PV0 F;  1LKX A;  3PUQ A;  2IUB A;  4AIU A;  1IJ5 A;  1JNR A;  4DR1 T;  4OYK A;  5L3G B;  3H37 A;  2E9X C;  3RIU C;  4HFC A;  1S94 A;  4PJM A;  3ESL A;  2DWG A;  2QVA A;  5EK3 A;  2MOZ A;  1H7C A;  3O1I A;  2WZI A;  2GK9 A;  5J2U E;  4U33 A;  4NIQ A;  4L9I A;  4O4J E;  2VQF T;  2H7V C;  2XPK A;  1M7K A;  4UVC B;  3C4W A;  3MZK B;  3CVR A;  4LF4 T;  3RYI E;  5JH7 E;  4JYA T;  4GKK T;  2LSI A;  2NTY A;  3CKD A;  3LSV A;  1Z8U A;  2LHN A;  5L3B B;  5FYM A;  3VU7 H;  3AE3 A;  3ETU A;  3PUW F;  1MMG A;  2UXD T;  1CHU A;  1HF8 A;  4HWI B;  3T1H T;  3C4X A;  3AAE B;  5ABF B;  4PAG A;  1KEY A;  5JRC A;  2JMK A;  4JBW F;  5AQO B;  1MNE A;  3P7I A;  4ZOL E;  3QK6 A;  3ZT7 A;  4FJO A;  4CXX A;  4ZHQ E;  4M1P A;  4ERR A;  2CXF A;  3RHW A;  5AQS B;  1HG2 A;  3CWZ B;  3JAE A;  4X64 T;  3O1H A;  4HEA A;  4DV2 T;  2C5I T;  4IRE A;  4IE7 A;  4AQY T;  3U3I A;  3MXZ A;  2BVL A;  4PK6 A;  3I9Y A;  3HKC E;  4DV3 T;  4NXN T;  5ADX L;  2WU2 A;  4H9Q C;  3UU5 A;  1SE7 A;  2VKH A;  4QH5 A;  3CX6 B;  1YXR A;  1BR4 A;  3BQL A;  5LB7 B;  3E08 A;  4HFI A;  3KVA A;  4KI0 F;  3L3P A;  2R6G F;  2NW9 A;  3QB5 K;  4YSY A;  4X62 T;  3RIA A;  3TLS A;  2BS3 A;  4JI6 T;  2W0G A;  5JQG E;  4DMW A;  4KHZ F;  3EUH A;  4U7I A;  5L3F B;  4YJ3 E;  2AE9 A;  3ABV A;  3N2G E;  3NRY A;  5IHY A;  2XUE A;  4IDP A;  3P50 A;  5FKY A;  2X9X A;  2CXD A;  2ODU A;  5JRE A;  3UU8 A;  2FJE A;  1WR0 A;  5C8Y E;  3A8Y C;  1B7T A;  4GK5 E;  5ETW A;  3RKG A;  3TLV A;  4H63 H;  3ZCJ A;  2D9D A;  3J7Y q;  4EEB A;  4UVA B;  3RLF F;  5AFU L;  4A56 A;  2V7L A;  3IA3 A;  2NR4 A;  2KZ7 B;  2LOP A;  3AE8 A;  4UVB B;  4WYV A;  1W9R A;  2D0T A;  3OKQ A;  3N9L A;  4DND A;  2WM9 A;  2WSS V;  3DJB A;  1WYB A;  4JEH B;  3VR8 A;  4X65 T;  3ZT5 A;  2D5U A;  2V26 A;  3GA8 A;  2Y6X A;  1OED C;  4EYU A;  3TLW A;  4EXT A;  4DUY T;  2LSJ A;  5AQI B;  3ZEF B;  2LRK A;  2X67 A;  1D1C A;  3O9X A;  4NUU A;  3FZF B;  3JCF A;  4PFO A;  2MBG A;  5DAB A;  2LSY A;  1HNX T;  5FNV E;  4H63 V;  3O4X E;  4YY3 T;  5HEH A;  4V1A v;  4HTE A;  4YTN A;  3FBZ A;  2VQE T;  2WMN A;  2JMH A;  4NXM T;  3CML A;  1IBM T;  2ACZ A;  3AEG A;  5AQF B;  2XZE A;  3M3Z B;  3A7M A;  2WY2 A;  1OED B;  1LVF A;  3HI2 A;  2YU1 A;  4IDN A;  2I6H A;  4WZX A;  3MAC A;  2BG9 E;  2CHO A;  3NRX A;  5HXR A;  3A5X A;  4LMK A;  1E2A A;  4ZZB A;  3RI5 A;  5E0O A;  4PJJ A;  3ANW B;  4DR4 T;  1ZKE A;  4AI6 A;  1SHZ C;  3ZSS A;  5LOV E;  3ONX A;  2OA5 A;  5ABG A;  3NBX X;  3H3M A;  5HXC A;  4LF8 T;  2FJA A;  2H3R A;  2Q9Q D;  5HXH A;  3MJX A;  4X5T A;  3NZQ A;  4U7Y A;  3CX8 B;  2MYS A;  2WDR A;  3PJA J;  4OHF A;  4UR9 A;  4CQI A;  3RC8 A;  3MA9 A;  4DVD A;  4EB6 E;  1NEN A;  2WP9 A;  4MFR A;  4ZI2 C;  3AEA A;  3OYZ A;  3I0O A;  3FXE B;  2JQQ A;  2XQA A;  5H6Q B;  4I0U A;  4DV6 T;  3GN5 B;  2X9W A;  2BVM A;  4UF0 B;  3T8O A;  3PUG A;  4H9R C;  5FXZ A;  3UUB A;  3VRA A;  4I50 E;  4B3M T;  3ZN1 B;  3D0T A;  2X51 A;  1ZEE A;  5LXT E;  3C64 A;  3AVR A;  2IDO B;  5LGU B;  1J1J A;  2JJ9 A;  4Z90 A;  1XMQ T;  1OXZ A;  4U2Z A;  1UX5 A;  4LF5 T;  5JDQ A;  2V8S V;  2LSK A;  3UU4 A;  2H88 A;  1N32 T;  4QXC B;  2K48 A;  2D2S A;  4HFH A;  1IBL T;  5L4H A;  2UU9 T;  3OBV E;  3UFG A;  1IAP A;  3S4U A;  1XMO T;  1SA0 E;  5AQK B;  4YXD A;  3TLT A;  4AKG A;  1YQ3 A;  2B76 A;  1XNR T;  4CN6 A;  2YK0 A;  3H3A A;  3RRW A;  2WU5 A;  1JNZ A;  4G63 A;  4IHJ E;  5L3C B;  1I6Z A;  3RX6 A;  2EHO C;  2V5D A;  3AXJ A;  4HE8 A;  5FL0 A;  4CXW A;  2BKO A;  4O4I E;  5LMU T;  2OLT A;  3PE0 A;  1EZ3 A;  2XAS B;  4EZH A;  5J0Z A;  2N9D A;  2YIN A;  3NVO A;  2BG9 C;  5JR9 A;  2J1D G;  3KV9 A;  5GON E;  3HKD E;  2UUA T;  3EDU A;  4UV8 B;  5FY7 A;  2CCQ A;  4AKH A;  4UV9 B;  3RYH E;  3AA0 B;  5LG4 A;  2KIN B;  3ZJ1 A;  3IBP A;  4AKL A;  3K3O A;  1YD8 G;  1HG5 A;  2EHO B;  4IGU A;  2L8K A;  3UU3 A;  3ZJ2 A;  5BMV E;  2MPK A;  2CHN A;  3N2K E;  2BG9 B;  2PBI A;  3NKZ A;  4DO0 A;  1ZHC A;  4TNW A;  3EAM A;  4H9N C;  4PNI A;  4QXH B;  3NZP A;  2ZM2 A;  2XAJ B;  3RH3 A;  3ZPO A;  4U74 A;  2D0U A;  4QH4 A;  2CEA A;  2FBW A;  3ZKR A;  2LKG A;  4JI8 T;  3UFE A;  5A1L A;  3W15 B;  3E22 E;  1M62 A;  5HWY A;  3KV6 A;  4Q25 A;  4U72 A;  3VHL A;  1HCI A;  4P1N A;  1X79 A;  1Z0P A;  1UGO A;  4JI1 T;  5HAX A;  4IST A;  5FMN A;  2Y8D A;  3BQK A;  1ZOY A;  3RIF A;  5LHG B;  2LHR A;  2WQY A;  2W63 A;  1FMW A;  3K1S A;  4PW8 A;  2DI4 A;  2WS3 A;  5AQR B;  3QB5 A;  5JDF A;  2LM9 A;  3QUJ A;  2PJQ A;  2JPF A;  5ABE A;  4AQF C;  4ILA A;  4UEM A;  4JI5 T;  1UUS A;  3ZMT B;  4AXP A;  4O4H E;  3ZYM A;  4ZZC A;  4JI7 T;  2F4V T;  5L47 A;  5ABH A;  3GMI A;  3I1A A;  4E7S A;  5L3D B;  2DCF A;  2XQ7 A;  5JRC B;  1WR6 A;  3C50 A;  4H9P C;  2MTQ A;  4GK0 E;  3AAA B;  3QNU A;  4AKI A;  2V6Y A;  4HWF A;  3U78 A;  3ZYL A;  2W62 A;  4PJL A;  2KLQ A;  1D1B A;  4LML A;  5C3J A;  1KFY A;  4YTP A;  1FEW A;  2K3W A;  1J5W A;  2WBL A;  3CQC B;  4MAL A;  1QUU A;  2E9X A;  1OED E;  3RIU A;  3OYX A;  2K9A A;  3AA7 B;  2ES0 A;  3FB2 A;  1UUR A;  2PG8 A;  2J47 A;  3N9O A;  1HR0 T;  5J1G A;  3SWH A;  5CA0 E;  4YJ2 E;  2CA5 A;  2PTF A;  4COF A;  3IHR A;  2BKP A;  1WCR A;  5AQP B;  3UQ7 A;  3MKD A;  1KNR A;  5JTG A;  4ZS3 A;  1VCT A;  4IL4 A;  4C90 A;  1YW0 A;  2XAG B;  3LG7 A;  4O2A E;  1AJ3 A;  5EK2 A;  5AQU B;  3WAK A;  2I59 A;  4DBQ A;  1UCU A;  3VR9 A;  1ZV4 X;  4QXB B;  3T1Y T;  3CX7 B;  2C0S A;  2YEV C;  2L9Q A;  3PUR A;  1T72 A;  3CPZ A;  4U2Y A;  2WDQ A;  2W61 A;  1J5E T;  2LLY A;  3RQW A;  2I0M A;  2W67 A;  5HCM A;  4H9O C;  5HEO A;  1MMN A;  2UUC T;  2DL1 A;  3G06 A;  3F31 A;  1HX1 B;  4TN7 B;  2P9B A;  2SPC A;  1N36 T;  2ACX A;  4X20 E;  3FXD B;  3WAJ A;  5HWX A;  4QX7 B;  2KSR A;  4F6R C; 
#chains in the Genus database with same CATH homology
 2XTL A;  4ISS A;  3KFW X;  3ONX A;  2OA5 A;  3NBX X;  3RYF E;  1FIO A;  5HXC A;  2H3R A;  2DLR A;  1G73 A;  4XBF B;  2Q9Q D;  2Q9Q A;  4C91 A;  3MJX A;  5HXH A;  5CA1 E;  5CB4 E;  3NZQ A;  3PTR B;  3KV4 A;  1IJ6 A;  3CX8 B;  2MYS A;  4OHF A;  4CQI A;  4I55 E;  3RC8 A;  3MA9 A;  3PU8 A;  3ZYK A;  4DVD A;  5FP3 A;  2E9X B;  4EB6 E;  4XZC A;  4TZ4 C;  2VL8 A;  4DBR A;  2BDE A;  5EK4 A;  4MFR A;  3MK7 C;  4ZI2 C;  2XAF B;  4P09 A;  2CXL A;  2NWB A;  3JC6 D;  3OYZ A;  4X1K E;  3KBT A;  5KDM C;  2VK9 A;  3I0O A;  5EZY E;  3FXE B;  3FHN A;  2JQQ A;  2UXX B;  3KVB A;  5H6Q B;  3ZN0 B;  3I9W A;  4Z8X A;  5TAO A;  5H6R B;  3K3Q C;  3GN5 B;  2X9W A;  2BVM A;  4UF0 B;  1CUN A;  3T8O A;  3PUG A;  2QA7 A;  3IF8 B;  3RKO A;  1HFA A;  4H9R C;  5FXZ A;  3LK3 B;  3TKL B;  3RC3 A;  4EZ4 A;  3BK9 A;  2A3D A;  2RP4 A;  4I50 E;  2VB6 A;  4XAX B;  2EHO A;  5F8P A;  3ZN1 B;  4I4T E;  3V5U A;  3ZC0 A;  1HS7 A;  2QGS A;  3D0T A;  2X51 A;  3GWH A;  1ZEE A;  4UXN B;  3KDS E;  5LXT E;  3C64 A;  2NW7 A;  3AVR A;  4H9S E;  3UUX B;  3PUA A;  1QSD A;  3LK4 2;  5LGU B;  2JJ9 A;  2WMO A;  4AQF A;  1OXZ A;  2VKO A;  5KMG P;  4N78 D;  1UX5 A;  5FY1 A;  5JDQ A;  1E1H B;  1US7 B;  2M67 A;  4WW0 A;  2LSK A;  3R6N A;  3UTK A;  5JDN A;  3O1J A;  2X68 A;  5LBM A;  4QXC B;  2KND A;  2K48 A;  1LKX A;  3PUQ A;  5LHH B;  2D2S A;  3Q5X A;  5IYZ E;  3OBV E;  1IJ5 A;  3C51 A;  2W00 A;  3PUS A;  1IAP A;  3S4U A;  1SA0 E;  4OYK A;  4ZI7 E;  5L3G B;  5LJM A;  3H37 A;  4CI3 B;  4AKG A;  4CXY A;  3LBX A;  3N2O A;  2E9X C;  4QKN A;  4PFP A;  2CMR A;  1S94 A;  2YK0 A;  3H3A A;  3RRW A;  2ZM0 A;  4PJM A;  3ESL A;  4ADZ A;  4ZS2 A;  4O4L E;  2DWG A;  5EK3 A;  2MOZ A;  2LT3 A;  3FBL A;  1H7C A;  5JDM A;  3O1I A;  2N2N A;  4G63 A;  3SS1 A;  2V7I A;  4IHJ E;  5L3C B;  3RX6 A;  2EHO C;  2GK9 A;  4B6X A;  5F3J A;  1T98 A;  5J2U E;  4HE8 A;  2KT9 A;  4CXW A;  4O4J E;  1Y64 B;  4L9I A;  2H7V C;  1WRD A;  4UVC B;  4HGA A;  3VKG A;  4O4I E;  3C4W A;  3MZK B;  3PE0 A;  1EZ3 A;  1WYC A;  3CVR A;  2XAS B;  5LHI B;  3RYI E;  2X66 A;  4EZH A;  5JH7 E;  5DQW A;  2LSI A;  2N9D A;  2YIN A;  4WBO A;  2NTY A;  4CI2 B;  5JR9 A;  4EOZ B;  2J1D G;  3KV9 A;  5GON E;  3CKD A;  3HKD E;  1G8X A;  2NP9 A;  3EDU A;  4UV8 B;  3EVY A;  4YFS A;  5FY7 A;  1OWA A;  3EDV A;  4KBM B;  3B13 A;  5LNK A;  2CCQ A;  3AVS A;  3ZMS B;  4AKH A;  2LHN A;  4UV9 B;  3RYH E;  5L3B B;  1UX4 A;  3AA0 B;  5FYM A;  1MMA A;  3CQX C;  3HA4 A;  5LG4 A;  1D0Y A;  3VU7 H;  3Q2M A;  2KIN B;  2CLY C;  4L0R A;  1BR1 A;  3ETU A;  3ZJ1 A;  1MMG A;  3IBP A;  4HKA A;  3UT5 E;  3ETV A;  3KBU A;  4BAY B;  1HF8 A;  5HYA A;  3C4X A;  4AKL A;  3OJA A;  3K3O A;  3AAE B;  3HL6 A;  1YD8 G;  1HG5 A;  3ANW A;  2EHO B;  4PAG A;  4IGU A;  4EYY R;  1O3X A;  2L8K A;  2LSG A;  5JRC A;  3C4Z A;  1VOM A;  2JMK A;  4ILU A;  5FXW A;  3ZJ2 A;  2VAS A;  5BMV E;  1MIV A;  1MNE A;  4MHC A;  3P7I A;  3Q5W A;  2V1D B;  4TV9 E;  5JDH A;  4ZOL E;  3QK6 A;  2LJL A;  4FJO A;  4CXX A;  3N2K E;  4YLH A;  4ZHQ E;  2X0L B;  2PBI A;  3E0Z A;  4L5G A;  4DO0 A;  4WBN E;  4M1P A;  1ZHC A;  4ERR A;  4GOU A;  2CXF A;  4PJN A;  1HG2 A;  5L3E B;  4H9N C;  3CWZ B;  4MBQ A;  3F57 A;  1NWM X;  4KUM B;  4QWN B;  4PNI A;  1D0Z A;  2Q9Q C;  3SOL A;  3KV5 A;  3O1H A;  5LP6 E;  4QXH B;  3NZP A;  2ZM2 A;  2XAJ B;  4HEA A;  4FI5 A;  2UXN B;  3RH3 A;  3LBX B;  2C5I T;  2CLY B;  3ZPO A;  4ZI3 D;  4IE7 A;  4U74 A;  2CM0 A;  2D0U A;  5JRC B;  5LA6 E;  3U3I A;  2CEA A;  4X1I E;  2ODV A;  3MXZ A;  2BVL A;  2IW5 B;  3C98 B;  4UF0 A;  4AKR B;  4PK6 A;  3I9Y A;  3HKC E;  5ADX L;  3JC6 C;  5HXE A;  2H7O A;  3IEE A;  3UFE A;  4H9Q C;  5A1L A;  4IE0 A;  3N5L A;  3PU3 A;  4CI1 B;  3UUN A;  3W15 B;  3E22 E;  5HWY A;  3KV6 A;  2VKH A;  4U72 A;  3VHL A;  1HCI A;  3CX6 B;  1X79 A;  3F2E A;  1BR4 A;  3V5S A;  3BQL A;  1Z0P A;  5HAX A;  4IST A;  5FMN A;  2Y8D A;  3E08 A;  3BQK A;  4IE5 A;  2KWI B;  1IZN B;  1VRB A;  3KVA A;  3L3P A;  4CZZ B;  4IE4 A;  5LHG B;  2LHR A;  2NW9 A;  2HPL A;  2W63 A;  1FMW A;  2A2F X;  4PW8 A;  3RRC A;  4TV8 E;  2HPJ A;  4J2C A;  2DI4 A;  4ZI2 D;  5JDF A;  2LM9 A;  3I0Q A;  3QUJ A;  2N1G A;  2Z6E A;  4NUV A;  5DJQ C;  2Q9Q B;  2PJQ A;  2WWU A;  2JPF A;  4BA9 A;  3N9M A;  4AQF C;  2VWA A;  2DWK A;  4EAH A;  2W0G A;  5JQG E;  1WLX A;  3UUM A;  2L3L A;  4DMW A;  4UEM A;  3ZMT B;  3AA1 B;  3EUH A;  4AXP A;  4O4H E;  3ZYM A;  4O2B E;  3L09 A;  3AA6 B;  4P0B A;  5L3F B;  4YJ3 E;  2NW8 A;  4E7Z A;  1MMD A;  2BZB A;  4DMV A;  1LVK A;  3QC9 A;  2E8I A;  3GMI A;  4HFV A;  4QX8 B;  3N2G E;  3I1A A;  3NRY A;  4HN9 A;  4IE6 A;  5LCY A;  4E7S A;  2XHE B;  4GYS A;  2LEH A;  3DTO A;  5IHY A;  2XUE A;  1U5P A;  5L3D B;  2DCF A;  4JUY A;  3ZMZ B;  3WI3 A;  5FXV A;  2X9X A;  1MND A;  2CXD A;  2ODU A;  1WR6 A;  1HX8 A;  2RA1 A;  3Q9D A;  3PDY A;  3C50 A;  4H9P C;  5LBQ B;  5JRE A;  2MTQ A;  3LJC A;  4GK0 E;  5C8Y E;  2KMF A;  3AAA B;  4AKI A;  1YKE B;  5KX5 E;  5M4Y A;  2CWY A;  1B7T A;  3VKH A;  4GK5 E;  2K5B B;  5ETW A;  5LGT B;  2NOX A;  3U78 A;  2X9Y A;  5HXS A;  4H63 H;  2XAQ B;  3ZCJ A;  2VKD A;  3ZYL A;  2W62 A;  4PJL A;  3RPU A;  2HH7 A;  3M65 A;  3RYC E;  5J2T E;  3J7Y q;  5LYJ E;  2KLQ A;  1D1B A;  4UVA B;  4P0A A;  3AAI A;  4A56 A;  5AFU L;  3K8P C;  4IDZ A;  2LE8 A;  2DHR A;  2V7L A;  2WAU A;  3N9Q A;  5DQV A;  1HTJ F;  1FEW A;  1D1A A;  2KZ7 B;  2LOP A;  2WBL A;  3CQC B;  1MIW A;  5LJN A;  2C5K T;  2Y48 B;  4MAL A;  4BJN A;  1QUU A;  4UVB B;  4MLK A;  2IC6 A;  2D0T A;  3OKQ A;  2NTX A;  2V7J A;  2E9X D;  2E9X A;  3N9L A;  4DND A;  2WM9 A;  2WSS V;  3DJB A;  3OYX A;  4IIJ E;  1WYB A;  3LK2 B;  2K9A A;  2V7K A;  2ES0 A;  3AA7 B;  1FMV A;  3FB2 A;  3N9P A;  4JEH B;  5JR9 C;  3K3N A;  2D5U A;  2PG8 A;  3HR0 A;  4KMC A;  3N9O A;  2V26 A;  3BQI A;  5J1G A;  3SWH A;  5JDL A;  4GYR A;  5FXX A;  5CA0 E;  4YJ2 E;  2CA5 A;  2YU2 A;  4KP3 C;  2DNX A;  3GA8 A;  2Y6X A;  3IHR A;  3HKB E;  4YHJ A;  2ZMA A;  2B1E A;  3N9N A;  4EYU A;  1BR0 A;  2EHO D;  2KWH A;  3MKD A;  2X9H A;  3CQG B;  2CWO A;  4ZS3 A;  4EIW A;  4AQG A;  4EXT A;  1MIY A;  4JEU B;  3GN5 A;  4OYJ A;  4X1Y E;  2LSJ A;  2G0U A;  3ZEF B;  4C90 A;  1YW0 A;  2X67 A;  3ZMU B;  2V7M A;  1D1C A;  2K24 A;  3O9X A;  1U4Q A;  2VKJ A;  2KXP B;  2XAG B;  3KIN B;  3LG7 A;  4GIW A;  2A72 A;  4NUU A;  4O2A E;  5EK2 A;  1AJ3 A;  3WAK A;  1KK7 A;  2I59 A;  3UUL A;  2XQY A;  4DBQ A;  1UCU A;  4PFO A;  2MBG A;  1ZV4 X;  4JLE A;  2LSY A;  5DAB A;  5FNV E;  1BR2 A;  4QXB B;  4H63 V;  3O4X E;  3CX7 B;  3LFM A;  2C0S A;  4V1A v;  4HTE A;  3ZC1 A;  4OFZ A;  2IAK A;  2YEV C;  3FBZ A;  2L9Q A;  4O8S A;  2WMN A;  3PUR A;  4WNK A;  2JMH A;  3B57 A;  3CPZ A;  4G2A A;  3DP7 A;  1V9D A;  1S35 A;  3R84 B;  2W61 A;  5FY0 A;  3CML A;  3P8C D;  5JVD E;  5LGN B;  2PFV A;  1LRZ A;  5JR9 B;  2XAH B;  4ASK A;  4K0U A;  4BJM A;  4H9O C;  4PK5 A;  4UEL A;  3SRZ A;  1MMN A;  4TX5 A;  4I43 B;  4QHO A;  1YKH B;  2LOS A;  3AB3 B;  1LVF A;  3HI2 A;  2YU1 A;  1NAF A;  2ZLY A;  2IC9 A;  3F31 A;  4ZI3 C;  3MAC A;  3ZLI A;  3HKE E;  3NRX A;  5HXR A;  4TN7 B;  3A5X A;  5JDG A;  2P9B A;  4OK0 A;  2SPC A;  4TUY E;  3ZCI A;  5E0O A;  3ZMV B;  4ANJ A;  1KNZ A;  2ACX A;  4X20 E;  4PJJ A;  2CE7 A;  3ANW B;  5L2L A;  2ZM8 A;  1ZKE A;  3FXD B;  3WAJ A;  2JRK A;  4UIG A;  1D0X A;  3J9X 1;  4PK4 A;  5HWX A;  1SHZ C;  4QX7 B;  4AI6 A;  2C5J A;  4F6R C;  5LOV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...