4B3RT

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3rT00
4DR1T 4NXNT 4JI3T 4OX9T 4JI6T 4JI1T 1XNQT 2VQFT 4LF9T 2E5LT 2UUBT 4B3MT 1FJGT 4X62T 4DV7T 4JI2T 4DV2T 5LMUT 4JV5T 2UXBT 4DV6T 1HR0T 4DR6T 2ZM6T 4DUYT 1XNRT 4DR4T 2HHHT 3T1YT 4AQYT 4KHPT 4LF7T 4X65T 2UUCT 3T1HT 4JYAT 1HNZT 4DV0T 4B3TT 4X66T 2VQET 2UUAT 4DV1T 4B3RT 1N34T 4JI0T 5LMNT 1I94T 4YY3T 3OTOT 4DV5T 4LF4T 4LF8T 2UU9T 4DR3T 4LF5T 1HNWT 1XMOT 1IBMT 4LF6T 4LFAT 1N33T 1N32T 4NXMT 5BR8T 4LFCT 1N36T 4JI5T 1IBLT 2F4VT 1XMQT 4K0KT 5IWAT 1J5ET 4DUZT 4DV4T 4DR5T 4GKJT 4LFBT 1HNXT 4JI8T 4DR2T 4X64T 2UXDT 4DR7T 4B3ST 2UXCT 4YHHT 4JI7T 4GKKT 1IBKT 4JI4T 4DV3T
chains in the Genus database with same CATH superfamily
4PK6A 3I1AA 2BG9A 4DBRA 4ZI7E 2LSKA 5JVDE 2WU2A 3OVUA 5CJ5A 1WYBA 3AEFA 2NP9A 5JRCA 5FYMA 4ZI3D 4JI6T 1J1JA 4TNWA 3NZQA 3B5MA 4UF0A 5AQIB 4EV6A 5IYZE 2X0LB 5LHIB 2JIWA 4JLEA 3HKCE 1XMOT 1LKXA 3PUQA 1YQ3A 2V7JA 3UU6A 2BZBA 3K8PC 3AA1B 5HEGA 3ZSTA 3TLVA 2ZLYA 4AISA 4X1IE 5BMVE 1US7B 2X66A 2Y48B 3CKDA 3PU8A 5FXWA 5AQNB 4H63H 5HXEA 4KUMB 1MIWA 2CBIA 2JMKA 5EZYE 3RQWA 2LKHA 2V6YB 2C5IT 4DMVA 2W63A 2QRXA 3E0ZA 4PFPA 2LKGA 2N2NA 3W15B 3C50A 2VWAA 3AE8A 4DUYT 2WWVA 1XNRT 3SRZA 4CXYA 2WY2A 4GOUA 2CWOA 2HPLA 4Q25A 1Y64B 2WAUA 2JQQA 3L8RA 5FXXA 5LYJE 2IW5B 4GIWA 4GYRA 5CGMA 4X65T 2WCAA 2FUPA 4HFIA 4AQGA 4JYAT 2CPTA 4UV8B 4CI1B 1NEKA 1FMWA 4IDPA 3JADA 5KDMC 4DV0T 2UXDT 4B3TT 4X66T 3O9XA 1KK7A 4HFVA 4LMLA 2VL0A 3KVBA 4TNVA 2NW7A 2ODVA 3EVYA 3RQUA 4YHJA 5HWXA 1N34T 5LMNT 3N9OA 3MK7C 1T72A 4O4HE 3L3PA 4YY3T 4DV5T 2N1GA 5AQRB 4F6RC 2UU9T 3UU5A 3C4WA 2XAGB 4CQIA 3H3AA 3AEBA 3ZT7A 3C98B 4CXWA 4DR3T 4LF5T 5JDNA 1HNWT 3ABVA 1W0AA 2LSIA 2C0SA 2V7MA 2W4XA 3NKZA 5E0OA 1SE7A 1MNDA 3FZMB 5LBMA 4AXPA 1IBMT 4LF6T 2Q9QC 2BKPA 2WBLA 4IE4A 3UFEA 4YJ3E 2IC9A 4GYSA 4E7SA 2CEAA 4EZ4A 4CN6A 3DJBA 5L47A 2LT3A 1W9RA 2QA7A 2LRKA 2XQYA 3AEDA 3TKLB 5LG4A 5AQLB 4BA9A 4AKHA 1NAFA 5HYAA 4TX5A 4HFBA 4BJNA 3ANWA 4ZOLE 3PDYA 4U3CA 1BR2A 3H3MA 5H6RB 2RA1A 2VVNA 4HE8A 2BS3A 2YDRA 3FZLB 3UUBA 2E2AA 4JI5T 1HCIA 1X79A 3AECA 3G06A 4UEMA 4XAXB 3N9NA 1YQ4A 4CI3B 2OV9A 3MXZA 3AXJA 4KBMB 1IBLT 4COFA 1CUNA 3RC8A 3ZCIA 1HF8A 2I0MA 4PJNA 2SPCA 4U72A 2NR4A 5LGUB 2XSAA 3AXJB 4IDQA 2DL1A 2DNXA 3CX8B 4U33A 5JR9A 2YOEA 5IWAT 2MYSA 1MMDA 3VHLA 4DR5T 4ANJA 4NUVA 1D0XA 3P4RA 3GA8A 5JTGA 1HFAA 1EZ3A 4WYVA 4PJJA 2K5BB 3RRWA 1SA0E 2BVMA 2C5KT 2I59A 4IE7A 3ZSSA 3PV0F 4UIGA 2G0UA 2RP4A 1NENA 2X0YA 2ZM8A 2WDQA 5L4HA 4HFCA 2XM2A 2LE8A 4P09A 2NOXA 1T7SA 3HR0A 2Z6EA 2CXDA 3JC6D 3OBVE 3RGLA 3RYFE 3ZLIA 4CN4A 5LP6E 4EB6E 2QYWA 5JDQA 4QKNA 3C4XA 4YHHT 3K3QC 4I50E 2WM9A 2HN1A 1VRBA 2Q9QB 5LOVE 2L8KA 2VQET 1FEWA 4DV3T 1B7TA 2E9XB 3ZMSB 3PU3A 4DR1T 2X51A 3Q9DA 4PK5A 2UUCT 2N9DA 2BS2A 4NXNT 3CX6B 2MTQA 4JI1T 1X9BA 3UUXB 2V5CA 3QB5K 3V5UA 2VQFT 1LVKA 4AI6A 5AQGB 3AE5A 3BQLA 2XQAA 5FL0A 1QSDA 4UR9A 5DQWA 2WP9A 1FMVA 2X9HA 3OYZA 3ZYMA 5HCMA 4AKGA 2XAFB 4JEUB 3SWHA 3P7IA 5H6QB 3ZMTB 2K3WA 1KNRA 2X68A 3FBLA 3KBUA 4EOZB 5ABFA 4O8SA 5LMUT 2JQHA 3PUAA 1SUMB 4ILUA 5A1LA 4H63V 4IDZA 4DV2T 1I6ZA 2LJLA 3H37A 1HX1B 4U74A 5EK4A 2LEHA 4DV6T 5AQUB 5LGTB 1HR0T 3CQGB 1UK5A 3CQXC 4DR6T 2X9WA 2HPJA 3CQCB 3K3OA 2VKDA 2K9AA 3BQKA 1T8BA 3ZJ1A 4DR4T 4EZHA 2HHHT 3PUYF 4KX6A 4MFRA 3WAKA 4IGUA 5FKYA 3AA6B 3FB2A 3MACA 3N2GE 4HTEA 2W67A 4QXBB 3P4PA 3P4WA 3Q5XA 3GN5B 4QWNB 2YDQA 3UUNA 4EEBA 4KHPT 2JRKA 1XWMA 3TLUA 5ABFB 5KMGP 1YW0A 3D0TA 5FY7A 2A72A 4YSYA 2ODUA 1NWMX 5JDHA 4DV7T 4H9SE 2XAQB 3ESLA 2Q9QA 5F5WA 5JH7E 2E9XA 2LHRA 2XASB 2XSBA 2XJ7A 1CHUA 3NRXA 3PUGA 4TZ4C 5LNKA 4DV1T 3B13A 5LCYA 1U4QA 2CWYA 4ISTA 2VB6A 1KNPA 3NWIA 5HEOA 2DI4A 4TWDA 5DQVA 4AKRB 1HG5A 5AQVB 5JRCB 4AQFA 2LSGA 4LF4T 1V9DA 2H7VC 3M65A 4LF8T 3RKGA 1GQEA 4ZS3A 1J5WA 5LJNA 1LVFA 3KFWX 2EHOD 2XQ7A 3Q5EA 3AB3B 1MIVA 4PFOA 4QH4A 4TUYE 4TWHA 4UXNB 2X0HA 3RIUC 2V5DA 2XAHB 2XQ8A 3ZC1A 4Z8XA 2VL8A 5EK2A 2HN2A 4HWDA 3LFMA 4HWHA 1JNRA 3RIAA 2FJAA 3Q2MA 5AQPB 2R6GF 3AAEB 3LBXA 3KINB 2I6HA 3HA4A 3NBXX 3S4UA 3ZCJA 3F57A 3L39A 3IHRA 5JR9B 3AE7A 2CM0A 2KINB 3P4SA 3ZT5A 3O1JA 2KSRA 5J2TE 2FJBA 5FMNA 4FJOA 3HKDE 3ZKRA 1UURA 2CCQA 3CX7B 2W62A 3KBTA 3HKBE 3PE0A 5AQHB 4O4IE 4KP3C 2A3DA 1R8IA 5AQQB 1DU2A 2BDEA 4HKAA 3TLSA 2CXFA 3AAAB 5L3DB 3VR9A 4IDNA 2BVLA 5LXTE 5L3GB 3IA3A 1OEDE 3UU4A 2J47A 3ZMUB 3MZKB 5L4EA 1Z8UA 4ERRA 4XBFB 4EAHA 1IJ5A 2PTFA 4K0KT 4UVBB 4AKLA 4YT0A 4A97A 3VKHA 4OYJA 2W66A 2WZIA 4QX7B 2KZ7B 4G2AA 3PJAA 2OLTA 4GKJT 2WZHA 2H3RA 3T8OA 1YKHB 4LFBT 1G8XA 2LRLA 2QVAA 2X9XA 2BKNA 2XQ4A 2YU2A 2W2UA 3RHWA 1UCUA 4C90A 3AEAA 3TLTA 2C5JA 4ADZA 3AVSA 3F2EA 2NWBA 3GMIA 4IE0A 2XZEA 4I4TE 3RLFF 2KWHA 3RYCE 2EHOC 1VCTA 4M1PA 2ES0A 3EDUA 3KDSE 1WYCA 2BG9E 2PJQA 4PK4A 3LBXB 4A56A 5GONE 2XTLA 5AQFB 4DR7T 2WU5A 3CPZA 1WCRA 1S35A 4IL4A 2CBJA 3RPUA 2BBJA 3RIUA 4JI7T 2DCFA 4F8HA 3I0OA 4JBWF 4EXTA 5ABHA 2FJDA 4QHOA 3I0QA 3AAIA 4NUUA 4QXHB 2DWKA 2GK9A 3IEEA 5HEUA 3UQ4A 3ZMZB 3AE3A 4YSZA 1BR1A 1D0ZA 2CMRA 2VASA 4KI0F 4ZHQE 5J0ZA 4JI3T 5DABA 4OX9T 4AKIA 2V7LA 4MBQA 3N9LA 4EYUA 2K48A 1XDPA 5EK3A 1L0VA 4LF9T 4IL9A 2YEVC 5AQJB 2IAKA 2HH7A 4YLHA 4CXXA 3UTKA 4QH5A 2V1DB 2QGSA 3U3IA 5C8YE 2UUBT 1UX5A 2KT9A 2PBIA 2J1DG 2LSJA 2M67A 3ONLC 2NW9A 4ISSA 4JI2T 5KXJA 4X62T 4DIDB 2D2SA 4JV5T 3LJCA 2KMFA 4YFSA 4KMCA 4PAGA 2KLQA 5ETWA 4WNKA 1WRDA 4AIUA 4GK5E 5FY0A 2OA5A 2D0TA 2YK0A 4H9NC 5LHHB 1IZNB 4MHCA 2NW8A 4TV8E 3P8CD 4EGWA 3N9QA 5L3BB 3NZPA 4WBNE 3RH3A 2E5VA 3A7MA 2K24A 5BR8T 1VOMA 2KXPB 2W61A 3EUHA 3I9YA 4KHZF 5FNVE 5FY1A 5CFBA 5JDMA 3U78A 2AE9A 1D1AA 3MA9A 3X1DA 3PTRB 4ILAA 3PJAJ 3C64A 4LF7T 3KV6A 4ILCA 2D5UA 2H88A 3E22E 3UU8A 2Y6XA 4U31A 5ABGA 4TV9E 3ZYLA 4A5XA 4HN9A 5AFUL 3N5LA 1HNZT 3R84B 2DHRA 1UUSA 4H9PC 4I0UA 2IHR1 5AQOB 5FXZA 3VU7H 1OWAA 3BK9A 3O1IA 3LK2B 1OXZA 4B3RT 3F31A 3JCFA 3EABA 4ILBA 1YXRA 2CLYB 3AE2A 4X20E 3QNUA 4HWIB 5HEHA 1HS7A 3OYXA 3SS1A 1ZKEA 2YU1A 3K1SA 4OYKA 4DVDA 5JQGE 3RRCA 2YN6A 3LSVA 4BJMA 3LK42 3ZN0B 3FXDB 4C91A 1WFDA 2UXNB 5IUXA 4YTNA 2V7KA 2PG8A 5JREA 3RYHE 3IF8B 3RYIE 4U7YA 5TAOA 3L09A 1SHZC 1OEDC 2LSYA 3AE4A 3ONJA 5AQSB 3EDVA 1VCSA 4Z91A 3UFGA 3ZYKA 4YSXA 2V6YA 3NRYA 4X1KE 5KX5E 3OTOT 2WQYA 5F8PA 4IDOA 1XZYA 1YD8G 5L2LA 1MIYA 2M6BA 4UVAB 4NPPA 4DBQA 3PUVF 4L0RA 1M7KA 4N78D 4ZS2A 3OPCA 4X1YE 5HXHA 2V26A 2MAWA 1QLBA 3RKOA 5JDLA 2IIUA 2XAJB 4LFCT 4YTMA 4GK0E 2KNDA 4O4LE 4NIQA 1ZOYA 3C51A 3PUXF 5HWYA 2JPFA 1M62A 3HI2A 3QOFA 4LMKA 3VRBA 5HXSA 2IDOB 2F4VT 4PJLA 3EHZA 4IE5A 4OFZA 3SFDA 1XMQT 4P0AA 2J62A 5C2TA 4WBOA 2Y8DA 3AVRA 5ADXL 1E1HB 4TWFA 4U2ZA 2VKJA 4PW8A 5FP3A 3J9X1 1MMAA 3ZPOA 1J5ET 2MOZA 4DV4T 2BKOA 2WS3A 4ZXLA 4V1Av 5DJQC 2W00A 3K3NA 1UGOA 2X9YA 3KVAA 2E8IA 3FBZA 4O2BE 1OEDB 2LM2A 1XDOA 1O3XA 2VVSA 4G63A 5JDFA 3RI5A 3ZEFB 1HNXT 4LMJA 3FZFB 5LB7B 2FJEA 2BG9B 2LOSA 2H89A 2P9BA 4DO0A 2E9XC 2LM9A 2WDVA 3OKQA 4OK0A 3P4QA 2JQKA 3CIRA 5JR9C 1JNZA 2H7OA 3P50A 2V7IA 2ACZA 3ONXA 4UV9B 3UULA 2UXCT 4QH1A 1D0YA 4UELA 4HWCA 2AXDS 3QC9A 4BAYB 3CVRA 4HEAA 3CMLA 1IBKT 4JI4T 4AQYT 1ZHCA 4K0UA 1AJ3A 1BR0A 4ZI3C 3JAFA 5CA1E 5FL1A 4ZZBA 1ZEEA 2CXLA 3ETVA 3ZC0A 2E9XD 5AQTB 1H7CA 1LRZA 5LGNB 1W09A 1KFYA 1WLXA 4H9RC 1MMNA 2CLYC 2XM1A 4HFEA 3ZMVB 1XNQT 1WR6A 4WW0A 2JMHA 5AQKB 3UT5E 1KEYA 1T98A 3KV5A 4IT4A 4L9IA 2WMNA 3RF1A 1YKEB 4E7ZA 2E5LT 2IMLA 4B3MT 2XPKA 2XHEB 1FJGT 3PURA 3IBPA 4U7IA 3VKGA 3AEEA 3N9PA 2IC6A 2JQ9A 2BS4A 3HL6A 4IIJE 4MALA 2MBGA 3FZKB 4CZZB 5J1GA 4EEDA 3QB5A 4HWFA 2UXBT 3EI0A 3B57A 2WDRA 2VURA 3RIFA 2VKOA 2LOPA 2WB5A 2ZM6T 2A2FX 3WI3A 2CE7A 2B1EA 2M6IA 4FI5A 3ANWB 5C3JA 5HEJA 2W0GA 4ZZCA 1WR0A 1OEDA 2B76A 2DLRA 2IUBA 3DP7A 4IE6A 4EYYR 5JDGA 2J4GA 3T1YT 2X67A 3EAMA 3HKEE 3Q5WA 4HGAA 2LHNA 5HCJA 4ZEYA 3T1HT 1D1CA 1ZP0A 4ASKA 3N9MA 1KNZA 2CRBA 2A9UA 5ABEA 4ZI2C 2UUAT 1IJ6A 4CN1A 2L9QA 2V8SV 4MLKA 3UU3A 2DWGA 4JEHB 4A98A 3AA7B 3MKDA 5J2UE 5L3FB 1I94T 4JI0T 3BQIA 2D0UA 1HG2A 2EHOA 5FVLA 5FXVA 3QUJA 4TN7B 3RX6A 5L3EB 3A8YC 2JJ9A 4H9QC 3C4ZA 4DNDA 5L3CB 3WAJA 5AQMB 3AE6A 2XQ9A 3OJAA 3ZT6A 4UVCB 2ZM0A 1HX8A 1W0BA 3AA0B 2VKHA 3E08A 3Q5DA 3ZJ2A 4WZXA 1KF6A 3RC3A 4EIWA 1Z0PA 2BG9C 3I9WA 3JC6C 3AEGA 4IHJE 2XUEA 4O4JE 4P1NA 3AE9A 4YJ2E 4O2AE 4LFAT 2Q9QD 3UUMA 3LK3B 3FZHB 1E7PA 2XQ5A 1UX4A 3LG7A 2CA5A 1BR4A 1FIOA 2WMOA 1U5PA 2XQ3A 4U2YA 2NTYA 2UXXB 3KV4A 1N33T 1ZV4X 3A5XA 1E2AA 5LJMA 1N32T 4NXMT 3O4XE 1Y01A 1N36T 4HFDA 2ACXA 2XQ6A 2VK9A 3SOLA 5F3JA 4H9OC 4X5TA 5HXCA 3FHNA 3GN5A 3VR8A 1S94A 2V6XA 2WWUA 3CK6A 4J2CA 3MJXA 4YXDA 4ZI2D 5CA0E 5LA6E 3R6NA 2LLYA 3N2OA 2YKSA 2KWIB 2D9DA 3PUWF 2RPAA 4PNIA 5M4YA 1D1BA 3NVOA 2FBWA 1MMGA 3ETUA 3PUSA 4OHFA 4QX8B 2BBHA 4HFHA 4DUZT 3CWZB 2WSSV 1IAPA 5LBQB 3FXEB 2YDSA 3AE1A 5CB4E 5HXRA 4P0BA 2MPKA 2EHOB 3TLWA 2ZM2A 2CHNA 3O1HA 4I55E 1MNEA 3M3ZB 3N2KE 4B6XA 1G73A 2ZMAA 4DMWA 5LHGB 5HAXA 5IHYA 5LG3A 4JI8T 4DR2T 3LDQB 3JAEA 2NTXA 4JUYA 3VRAA 4IREA 2PFVA 4X64T 4UF0B 3DTOA 4AQFC 5FVKA 4YTPA 3PUZF 4L5GA 3SFEA 3V5SA 3UQ7A 4QXCB 2CHOA 3ZN1B 3KV9A 3GWHA 3QK6A 4Z90A 4B3ST 2XY8B 4XZCA 1QUUA 4I43B 4CI2B 4GKKT 4PJMA 2YINA 3J7Yq 1HTJF 2L3LA
chains in the Genus database with same CATH topology
4DR1T 4NXNT 4JI3T 4OX9T 4JI6T 4JI1T 1XNQT 2VQFT 4LF9T 2E5LT 2UUBT 4B3MT 1FJGT 4X62T 4DV7T 4JI2T 4DV2T 5LMUT 4JV5T 2UXBT 4DV6T 1HR0T 4DR6T 2ZM6T 4DUYT 1XNRT 4DR4T 2HHHT 3T1YT 4AQYT 4KHPT 4LF7T 4X65T 2UUCT 3T1HT 4JYAT 1HNZT 4DV0T 4B3TT 4X66T 2VQET 2UUAT 4DV1T 4B3RT 1N34T 4JI0T 5LMNT 1I94T 4YY3T 3OTOT 4DV5T 4LF4T 4LF8T 2UU9T 4DR3T 4LF5T 1HNWT 1XMOT 1IBMT 4LF6T 4LFAT 1N33T 1N32T 4NXMT 5BR8T 4LFCT 1N36T 4JI5T 1IBLT 2F4VT 1XMQT 4K0KT 5IWAT 1J5ET 4DUZT 4DV4T 4DR5T 4GKJT 4LFBT 1HNXT 4JI8T 4DR2T 4X64T 2UXDT 4DR7T 4B3ST 2UXCT 4YHHT 4JI7T 4GKKT 1IBKT 4JI4T 4DV3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 T;  4NXN T;  4JI3 T;  4OX9 T;  4JI6 T;  4JI1 T;  1XNQ T;  2VQF T;  4LF9 T;  2E5L T;  2UUB T;  4B3M T;  1FJG T;  4X62 T;  4DV7 T;  4JI2 T;  4DV2 T;  5LMU T;  4JV5 T;  2UXB T;  4DV6 T;  1HR0 T;  4DR6 T;  2ZM6 T;  4DUY T;  1XNR T;  4DR4 T;  2HHH T;  3T1Y T;  4AQY T;  4KHP T;  4LF7 T;  4X65 T;  2UUC T;  3T1H T;  4JYA T;  1HNZ T;  4DV0 T;  4B3T T;  4X66 T;  2VQE T;  2UUA T;  4DV1 T;  4B3R T;  1N34 T;  4JI0 T;  5LMN T;  1I94 T;  4YY3 T;  3OTO T;  4DV5 T;  4LF4 T;  4LF8 T;  2UU9 T;  4DR3 T;  4LF5 T;  1HNW T;  1XMO T;  1IBM T;  4LF6 T;  4LFA T;  1N33 T;  1N32 T;  4NXM T;  5BR8 T;  4LFC T;  1N36 T;  4JI5 T;  1IBL T;  2F4V T;  1XMQ T;  4K0K T;  5IWA T;  1J5E T;  4DUZ T;  4DV4 T;  4DR5 T;  4GKJ T;  4LFB T;  1HNX T;  4JI8 T;  4DR2 T;  4X64 T;  2UXD T;  4DR7 T;  4B3S T;  2UXC T;  4YHH T;  4JI7 T;  4GKK T;  1IBK T;  4JI4 T;  4DV3 T; 
#chains in the Genus database with same CATH topology
 4PK6 A;  3I1A A;  2BG9 A;  4DBR A;  4ZI7 E;  2LSK A;  5JVD E;  2WU2 A;  3OVU A;  5CJ5 A;  1WYB A;  3AEF A;  2NP9 A;  5JRC A;  5FYM A;  4ZI3 D;  4JI6 T;  1J1J A;  4TNW A;  3NZQ A;  3B5M A;  4UF0 A;  5AQI B;  4EV6 A;  5IYZ E;  2X0L B;  5LHI B;  2JIW A;  4JLE A;  3HKC E;  1XMO T;  1LKX A;  3PUQ A;  1YQ3 A;  2V7J A;  3UU6 A;  2BZB A;  3K8P C;  3AA1 B;  5HEG A;  3ZST A;  3TLV A;  2ZLY A;  4AIS A;  4X1I E;  5BMV E;  1US7 B;  2X66 A;  2Y48 B;  3CKD A;  3PU8 A;  5FXW A;  5AQN B;  4H63 H;  5HXE A;  4KUM B;  1MIW A;  2CBI A;  2JMK A;  5EZY E;  3RQW A;  2LKH A;  2V6Y B;  2C5I T;  4DMV A;  2W63 A;  2QRX A;  3E0Z A;  4PFP A;  2LKG A;  2N2N A;  3W15 B;  3C50 A;  2VWA A;  3AE8 A;  4DUY T;  2WWV A;  1XNR T;  3SRZ A;  4CXY A;  2WY2 A;  4GOU A;  2CWO A;  2HPL A;  4Q25 A;  1Y64 B;  2WAU A;  2JQQ A;  3L8R A;  5FXX A;  5LYJ E;  2IW5 B;  4GIW A;  4GYR A;  5CGM A;  4X65 T;  2WCA A;  2FUP A;  4HFI A;  4AQG A;  4JYA T;  2CPT A;  4UV8 B;  4CI1 B;  1NEK A;  1FMW A;  4IDP A;  3JAD A;  5KDM C;  4DV0 T;  2UXD T;  4B3T T;  4X66 T;  3O9X A;  1KK7 A;  4HFV A;  4LML A;  2VL0 A;  3KVB A;  4TNV A;  2NW7 A;  2ODV A;  3EVY A;  3RQU A;  4YHJ A;  5HWX A;  1N34 T;  5LMN T;  3N9O A;  3MK7 C;  1T72 A;  4O4H E;  3L3P A;  4YY3 T;  4DV5 T;  2N1G A;  5AQR B;  4F6R C;  2UU9 T;  3UU5 A;  3C4W A;  2XAG B;  4CQI A;  3H3A A;  3AEB A;  3ZT7 A;  3C98 B;  4CXW A;  4DR3 T;  4LF5 T;  5JDN A;  1HNW T;  3ABV A;  1W0A A;  2LSI A;  2C0S A;  2V7M A;  2W4X A;  3NKZ A;  5E0O A;  1SE7 A;  1MND A;  3FZM B;  5LBM A;  4AXP A;  1IBM T;  4LF6 T;  2Q9Q C;  2BKP A;  2WBL A;  4IE4 A;  3UFE A;  4YJ3 E;  2IC9 A;  4GYS A;  4E7S A;  2CEA A;  4EZ4 A;  4CN6 A;  3DJB A;  5L47 A;  2LT3 A;  1W9R A;  2QA7 A;  2LRK A;  2XQY A;  3AED A;  3TKL B;  5LG4 A;  5AQL B;  4BA9 A;  4AKH A;  1NAF A;  5HYA A;  4TX5 A;  4HFB A;  4BJN A;  3ANW A;  4ZOL E;  3PDY A;  4U3C A;  1BR2 A;  3H3M A;  5H6R B;  2RA1 A;  2VVN A;  4HE8 A;  2BS3 A;  2YDR A;  3FZL B;  3UUB A;  2E2A A;  4JI5 T;  1HCI A;  1X79 A;  3AEC A;  3G06 A;  4UEM A;  4XAX B;  3N9N A;  1YQ4 A;  4CI3 B;  2OV9 A;  3MXZ A;  3AXJ A;  4KBM B;  1IBL T;  4COF A;  1CUN A;  3RC8 A;  3ZCI A;  1HF8 A;  2I0M A;  4PJN A;  2SPC A;  4U72 A;  2NR4 A;  5LGU B;  2XSA A;  3AXJ B;  4IDQ A;  2DL1 A;  2DNX A;  3CX8 B;  4U33 A;  5JR9 A;  2YOE A;  5IWA T;  2MYS A;  1MMD A;  3VHL A;  4DR5 T;  4ANJ A;  4NUV A;  1D0X A;  3P4R A;  3GA8 A;  5JTG A;  1HFA A;  1EZ3 A;  4WYV A;  4PJJ A;  2K5B B;  3RRW A;  1SA0 E;  2BVM A;  2C5K T;  2I59 A;  4IE7 A;  3ZSS A;  3PV0 F;  4UIG A;  2G0U A;  2RP4 A;  1NEN A;  2X0Y A;  2ZM8 A;  2WDQ A;  5L4H A;  4HFC A;  2XM2 A;  2LE8 A;  4P09 A;  2NOX A;  1T7S A;  3HR0 A;  2Z6E A;  2CXD A;  3JC6 D;  3OBV E;  3RGL A;  3RYF E;  3ZLI A;  4CN4 A;  5LP6 E;  4EB6 E;  2QYW A;  5JDQ A;  4QKN A;  3C4X A;  4YHH T;  3K3Q C;  4I50 E;  2WM9 A;  2HN1 A;  1VRB A;  2Q9Q B;  5LOV E;  2L8K A;  2VQE T;  1FEW A;  4DV3 T;  1B7T A;  2E9X B;  3ZMS B;  3PU3 A;  4DR1 T;  2X51 A;  3Q9D A;  4PK5 A;  2UUC T;  2N9D A;  2BS2 A;  4NXN T;  3CX6 B;  2MTQ A;  4JI1 T;  1X9B A;  3UUX B;  2V5C A;  3QB5 K;  3V5U A;  2VQF T;  1LVK A;  4AI6 A;  5AQG B;  3AE5 A;  3BQL A;  2XQA A;  5FL0 A;  1QSD A;  4UR9 A;  5DQW A;  2WP9 A;  1FMV A;  2X9H A;  3OYZ A;  3ZYM A;  5HCM A;  4AKG A;  2XAF B;  4JEU B;  3SWH A;  3P7I A;  5H6Q B;  3ZMT B;  2K3W A;  1KNR A;  2X68 A;  3FBL A;  3KBU A;  4EOZ B;  5ABF A;  4O8S A;  5LMU T;  2JQH A;  3PUA A;  1SUM B;  4ILU A;  5A1L A;  4H63 V;  4IDZ A;  4DV2 T;  1I6Z A;  2LJL A;  3H37 A;  1HX1 B;  4U74 A;  5EK4 A;  2LEH A;  4DV6 T;  5AQU B;  5LGT B;  1HR0 T;  3CQG B;  1UK5 A;  3CQX C;  4DR6 T;  2X9W A;  2HPJ A;  3CQC B;  3K3O A;  2VKD A;  2K9A A;  3BQK A;  1T8B A;  3ZJ1 A;  4DR4 T;  4EZH A;  2HHH T;  3PUY F;  4KX6 A;  4MFR A;  3WAK A;  4IGU A;  5FKY A;  3AA6 B;  3FB2 A;  3MAC A;  3N2G E;  4HTE A;  2W67 A;  4QXB B;  3P4P A;  3P4W A;  3Q5X A;  3GN5 B;  4QWN B;  2YDQ A;  3UUN A;  4EEB A;  4KHP T;  2JRK A;  1XWM A;  3TLU A;  5ABF B;  5KMG P;  1YW0 A;  3D0T A;  5FY7 A;  2A72 A;  4YSY A;  2ODU A;  1NWM X;  5JDH A;  4DV7 T;  4H9S E;  2XAQ B;  3ESL A;  2Q9Q A;  5F5W A;  5JH7 E;  2E9X A;  2LHR A;  2XAS B;  2XSB A;  2XJ7 A;  1CHU A;  3NRX A;  3PUG A;  4TZ4 C;  5LNK A;  4DV1 T;  3B13 A;  5LCY A;  1U4Q A;  2CWY A;  4IST A;  2VB6 A;  1KNP A;  3NWI A;  5HEO A;  2DI4 A;  4TWD A;  5DQV A;  4AKR B;  1HG5 A;  5AQV B;  5JRC B;  4AQF A;  2LSG A;  4LF4 T;  1V9D A;  2H7V C;  3M65 A;  4LF8 T;  3RKG A;  1GQE A;  4ZS3 A;  1J5W A;  5LJN A;  1LVF A;  3KFW X;  2EHO D;  2XQ7 A;  3Q5E A;  3AB3 B;  1MIV A;  4PFO A;  4QH4 A;  4TUY E;  4TWH A;  4UXN B;  2X0H A;  3RIU C;  2V5D A;  2XAH B;  2XQ8 A;  3ZC1 A;  4Z8X A;  2VL8 A;  5EK2 A;  2HN2 A;  4HWD A;  3LFM A;  4HWH A;  1JNR A;  3RIA A;  2FJA A;  3Q2M A;  5AQP B;  2R6G F;  3AAE B;  3LBX A;  3KIN B;  2I6H A;  3HA4 A;  3NBX X;  3S4U A;  3ZCJ A;  3F57 A;  3L39 A;  3IHR A;  5JR9 B;  3AE7 A;  2CM0 A;  2KIN B;  3P4S A;  3ZT5 A;  3O1J A;  2KSR A;  5J2T E;  2FJB A;  5FMN A;  4FJO A;  3HKD E;  3ZKR A;  1UUR A;  2CCQ A;  3CX7 B;  2W62 A;  3KBT A;  3HKB E;  3PE0 A;  5AQH B;  4O4I E;  4KP3 C;  2A3D A;  1R8I A;  5AQQ B;  1DU2 A;  2BDE A;  4HKA A;  3TLS A;  2CXF A;  3AAA B;  5L3D B;  3VR9 A;  4IDN A;  2BVL A;  5LXT E;  5L3G B;  3IA3 A;  1OED E;  3UU4 A;  2J47 A;  3ZMU B;  3MZK B;  5L4E A;  1Z8U A;  4ERR A;  4XBF B;  4EAH A;  1IJ5 A;  2PTF A;  4K0K T;  4UVB B;  4AKL A;  4YT0 A;  4A97 A;  3VKH A;  4OYJ A;  2W66 A;  2WZI A;  4QX7 B;  2KZ7 B;  4G2A A;  3PJA A;  2OLT A;  4GKJ T;  2WZH A;  2H3R A;  3T8O A;  1YKH B;  4LFB T;  1G8X A;  2LRL A;  2QVA A;  2X9X A;  2BKN A;  2XQ4 A;  2YU2 A;  2W2U A;  3RHW A;  1UCU A;  4C90 A;  3AEA A;  3TLT A;  2C5J A;  4ADZ A;  3AVS A;  3F2E A;  2NWB A;  3GMI A;  4IE0 A;  2XZE A;  4I4T E;  3RLF F;  2KWH A;  3RYC E;  2EHO C;  1VCT A;  4M1P A;  2ES0 A;  3EDU A;  3KDS E;  1WYC A;  2BG9 E;  2PJQ A;  4PK4 A;  3LBX B;  4A56 A;  5GON E;  2XTL A;  5AQF B;  4DR7 T;  2WU5 A;  3CPZ A;  1WCR A;  1S35 A;  4IL4 A;  2CBJ A;  3RPU A;  2BBJ A;  3RIU A;  4JI7 T;  2DCF A;  4F8H A;  3I0O A;  4JBW F;  4EXT A;  5ABH A;  2FJD A;  4QHO A;  3I0Q A;  3AAI A;  4NUU A;  4QXH B;  2DWK A;  2GK9 A;  3IEE A;  5HEU A;  3UQ4 A;  3ZMZ B;  3AE3 A;  4YSZ A;  1BR1 A;  1D0Z A;  2CMR A;  2VAS A;  4KI0 F;  4ZHQ E;  5J0Z A;  4JI3 T;  5DAB A;  4OX9 T;  4AKI A;  2V7L A;  4MBQ A;  3N9L A;  4EYU A;  2K48 A;  1XDP A;  5EK3 A;  1L0V A;  4LF9 T;  4IL9 A;  2YEV C;  5AQJ B;  2IAK A;  2HH7 A;  4YLH A;  4CXX A;  3UTK A;  4QH5 A;  2V1D B;  2QGS A;  3U3I A;  5C8Y E;  2UUB T;  1UX5 A;  2KT9 A;  2PBI A;  2J1D G;  2LSJ A;  2M67 A;  3ONL C;  2NW9 A;  4ISS A;  4JI2 T;  5KXJ A;  4X62 T;  4DID B;  2D2S A;  4JV5 T;  3LJC A;  2KMF A;  4YFS A;  4KMC A;  4PAG A;  2KLQ A;  5ETW A;  4WNK A;  1WRD A;  4AIU A;  4GK5 E;  5FY0 A;  2OA5 A;  2D0T A;  2YK0 A;  4H9N C;  5LHH B;  1IZN B;  4MHC A;  2NW8 A;  4TV8 E;  3P8C D;  4EGW A;  3N9Q A;  5L3B B;  3NZP A;  4WBN E;  3RH3 A;  2E5V A;  3A7M A;  2K24 A;  5BR8 T;  1VOM A;  2KXP B;  2W61 A;  3EUH A;  3I9Y A;  4KHZ F;  5FNV E;  5FY1 A;  5CFB A;  5JDM A;  3U78 A;  2AE9 A;  1D1A A;  3MA9 A;  3X1D A;  3PTR B;  4ILA A;  3PJA J;  3C64 A;  4LF7 T;  3KV6 A;  4ILC A;  2D5U A;  2H88 A;  3E22 E;  3UU8 A;  2Y6X A;  4U31 A;  5ABG A;  4TV9 E;  3ZYL A;  4A5X A;  4HN9 A;  5AFU L;  3N5L A;  1HNZ T;  3R84 B;  2DHR A;  1UUS A;  4H9P C;  4I0U A;  2IHR 1;  5AQO B;  5FXZ A;  3VU7 H;  1OWA A;  3BK9 A;  3O1I A;  3LK2 B;  1OXZ A;  4B3R T;  3F31 A;  3JCF A;  3EAB A;  4ILB A;  1YXR A;  2CLY B;  3AE2 A;  4X20 E;  3QNU A;  4HWI B;  5HEH A;  1HS7 A;  3OYX A;  3SS1 A;  1ZKE A;  2YU1 A;  3K1S A;  4OYK A;  4DVD A;  5JQG E;  3RRC A;  2YN6 A;  3LSV A;  4BJM A;  3LK4 2;  3ZN0 B;  3FXD B;  4C91 A;  1WFD A;  2UXN B;  5IUX A;  4YTN A;  2V7K A;  2PG8 A;  5JRE A;  3RYH E;  3IF8 B;  3RYI E;  4U7Y A;  5TAO A;  3L09 A;  1SHZ C;  1OED C;  2LSY A;  3AE4 A;  3ONJ A;  5AQS B;  3EDV A;  1VCS A;  4Z91 A;  3UFG A;  3ZYK A;  4YSX A;  2V6Y A;  3NRY A;  4X1K E;  5KX5 E;  3OTO T;  2WQY A;  5F8P A;  4IDO A;  1XZY A;  1YD8 G;  5L2L A;  1MIY A;  2M6B A;  4UVA B;  4NPP A;  4DBQ A;  3PUV F;  4L0R A;  1M7K A;  4N78 D;  4ZS2 A;  3OPC A;  4X1Y E;  5HXH A;  2V26 A;  2MAW A;  1QLB A;  3RKO A;  5JDL A;  2IIU A;  2XAJ B;  4LFC T;  4YTM A;  4GK0 E;  2KND A;  4O4L E;  4NIQ A;  1ZOY A;  3C51 A;  3PUX F;  5HWY A;  2JPF A;  1M62 A;  3HI2 A;  3QOF A;  4LMK A;  3VRB A;  5HXS A;  2IDO B;  2F4V T;  4PJL A;  3EHZ A;  4IE5 A;  4OFZ A;  3SFD A;  1XMQ T;  4P0A A;  2J62 A;  5C2T A;  4WBO A;  2Y8D A;  3AVR A;  5ADX L;  1E1H B;  4TWF A;  4U2Z A;  2VKJ A;  4PW8 A;  5FP3 A;  3J9X 1;  1MMA A;  3ZPO A;  1J5E T;  2MOZ A;  4DV4 T;  2BKO A;  2WS3 A;  4ZXL A;  4V1A v;  5DJQ C;  2W00 A;  3K3N A;  1UGO A;  2X9Y A;  3KVA A;  2E8I A;  3FBZ A;  4O2B E;  1OED B;  2LM2 A;  1XDO A;  1O3X A;  2VVS A;  4G63 A;  5JDF A;  3RI5 A;  3ZEF B;  1HNX T;  4LMJ A;  3FZF B;  5LB7 B;  2FJE A;  2BG9 B;  2LOS A;  2H89 A;  2P9B A;  4DO0 A;  2E9X C;  2LM9 A;  2WDV A;  3OKQ A;  4OK0 A;  3P4Q A;  2JQK A;  3CIR A;  5JR9 C;  1JNZ A;  2H7O A;  3P50 A;  2V7I A;  2ACZ A;  3ONX A;  4UV9 B;  3UUL A;  2UXC T;  4QH1 A;  1D0Y A;  4UEL A;  4HWC A;  2AXD S;  3QC9 A;  4BAY B;  3CVR A;  4HEA A;  3CML A;  1IBK T;  4JI4 T;  4AQY T;  1ZHC A;  4K0U A;  1AJ3 A;  1BR0 A;  4ZI3 C;  3JAF A;  5CA1 E;  5FL1 A;  4ZZB A;  1ZEE A;  2CXL A;  3ETV A;  3ZC0 A;  2E9X D;  5AQT B;  1H7C A;  1LRZ A;  5LGN B;  1W09 A;  1KFY A;  1WLX A;  4H9R C;  1MMN A;  2CLY C;  2XM1 A;  4HFE A;  3ZMV B;  1XNQ T;  1WR6 A;  4WW0 A;  2JMH A;  5AQK B;  3UT5 E;  1KEY A;  1T98 A;  3KV5 A;  4IT4 A;  4L9I A;  2WMN A;  3RF1 A;  1YKE B;  4E7Z A;  2E5L T;  2IML A;  4B3M T;  2XPK A;  2XHE B;  1FJG T;  3PUR A;  3IBP A;  4U7I A;  3VKG A;  3AEE A;  3N9P A;  2IC6 A;  2JQ9 A;  2BS4 A;  3HL6 A;  4IIJ E;  4MAL A;  2MBG A;  3FZK B;  4CZZ B;  5J1G A;  4EED A;  3QB5 A;  4HWF A;  2UXB T;  3EI0 A;  3B57 A;  2WDR A;  2VUR A;  3RIF A;  2VKO A;  2LOP A;  2WB5 A;  2ZM6 T;  2A2F X;  3WI3 A;  2CE7 A;  2B1E A;  2M6I A;  4FI5 A;  3ANW B;  5C3J A;  5HEJ A;  2W0G A;  4ZZC A;  1WR0 A;  1OED A;  2B76 A;  2DLR A;  2IUB A;  3DP7 A;  4IE6 A;  4EYY R;  5JDG A;  2J4G A;  3T1Y T;  2X67 A;  3EAM A;  3HKE E;  3Q5W A;  4HGA A;  2LHN A;  5HCJ A;  4ZEY A;  3T1H T;  1D1C A;  1ZP0 A;  4ASK A;  3N9M A;  1KNZ A;  2CRB A;  2A9U A;  5ABE A;  4ZI2 C;  2UUA T;  1IJ6 A;  4CN1 A;  2L9Q A;  2V8S V;  4MLK A;  3UU3 A;  2DWG A;  4JEH B;  4A98 A;  3AA7 B;  3MKD A;  5J2U E;  5L3F B;  1I94 T;  4JI0 T;  3BQI A;  2D0U A;  1HG2 A;  2EHO A;  5FVL A;  5FXV A;  3QUJ A;  4TN7 B;  3RX6 A;  5L3E B;  3A8Y C;  2JJ9 A;  4H9Q C;  3C4Z A;  4DND A;  5L3C B;  3WAJ A;  5AQM B;  3AE6 A;  2XQ9 A;  3OJA A;  3ZT6 A;  4UVC B;  2ZM0 A;  1HX8 A;  1W0B A;  3AA0 B;  2VKH A;  3E08 A;  3Q5D A;  3ZJ2 A;  4WZX A;  1KF6 A;  3RC3 A;  4EIW A;  1Z0P A;  2BG9 C;  3I9W A;  3JC6 C;  3AEG A;  4IHJ E;  2XUE A;  4O4J E;  4P1N A;  3AE9 A;  4YJ2 E;  4O2A E;  4LFA T;  2Q9Q D;  3UUM A;  3LK3 B;  3FZH B;  1E7P A;  2XQ5 A;  1UX4 A;  3LG7 A;  2CA5 A;  1BR4 A;  1FIO A;  2WMO A;  1U5P A;  2XQ3 A;  4U2Y A;  2NTY A;  2UXX B;  3KV4 A;  1N33 T;  1ZV4 X;  3A5X A;  1E2A A;  5LJM A;  1N32 T;  4NXM T;  3O4X E;  1Y01 A;  1N36 T;  4HFD A;  2ACX A;  2XQ6 A;  2VK9 A;  3SOL A;  5F3J A;  4H9O C;  4X5T A;  5HXC A;  3FHN A;  3GN5 A;  3VR8 A;  1S94 A;  2V6X A;  2WWU A;  3CK6 A;  4J2C A;  3MJX A;  4YXD A;  4ZI2 D;  5CA0 E;  5LA6 E;  3R6N A;  2LLY A;  3N2O A;  2YKS A;  2KWI B;  2D9D A;  3PUW F;  2RPA A;  4PNI A;  5M4Y A;  1D1B A;  3NVO A;  2FBW A;  1MMG A;  3ETU A;  3PUS A;  4OHF A;  4QX8 B;  2BBH A;  4HFH A;  4DUZ T;  3CWZ B;  2WSS V;  1IAP A;  5LBQ B;  3FXE B;  2YDS A;  3AE1 A;  5CB4 E;  5HXR A;  4P0B A;  2MPK A;  2EHO B;  3TLW A;  2ZM2 A;  2CHN A;  3O1H A;  4I55 E;  1MNE A;  3M3Z B;  3N2K E;  4B6X A;  1G73 A;  2ZMA A;  4DMW A;  5LHG B;  5HAX A;  5IHY A;  5LG3 A;  4JI8 T;  4DR2 T;  3LDQ B;  3JAE A;  2NTX A;  4JUY A;  3VRA A;  4IRE A;  2PFV A;  4X64 T;  4UF0 B;  3DTO A;  4AQF C;  5FVK A;  4YTP A;  3PUZ F;  4L5G A;  3SFE A;  3V5S A;  3UQ7 A;  4QXC B;  2CHO A;  3ZN1 B;  3KV9 A;  3GWH A;  3QK6 A;  4Z90 A;  4B3S T;  2XY8 B;  4XZC A;  1QUU A;  4I43 B;  4CI2 B;  4GKK T;  4PJM A;  2YIN A;  3J7Y q;  1HTJ F;  2L3L A; 
#chains in the Genus database with same CATH homology
 4DR1 T;  4NXN T;  4JI3 T;  4OX9 T;  4JI6 T;  4JI1 T;  1XNQ T;  2VQF T;  4LF9 T;  2E5L T;  2UUB T;  4B3M T;  1FJG T;  4X62 T;  4DV7 T;  4JI2 T;  4DV2 T;  5LMU T;  4JV5 T;  2UXB T;  4DV6 T;  1HR0 T;  4DR6 T;  2ZM6 T;  4DUY T;  1XNR T;  4DR4 T;  2HHH T;  3T1Y T;  4AQY T;  4KHP T;  4LF7 T;  4X65 T;  2UUC T;  3T1H T;  4JYA T;  1HNZ T;  4DV0 T;  4B3T T;  4X66 T;  2VQE T;  2UUA T;  4DV1 T;  4B3R T;  1N34 T;  4JI0 T;  5LMN T;  1I94 T;  4YY3 T;  3OTO T;  4DV5 T;  4LF4 T;  4LF8 T;  2UU9 T;  4DR3 T;  4LF5 T;  1HNW T;  1XMO T;  1IBM T;  4LF6 T;  4LFA T;  1N33 T;  1N32 T;  4NXM T;  5BR8 T;  4LFC T;  1N36 T;  4JI5 T;  1IBL T;  2F4V T;  1XMQ T;  4K0K T;  5IWA T;  1J5E T;  4DUZ T;  4DV4 T;  4DR5 T;  4GKJ T;  4LFB T;  1HNX T;  4JI8 T;  4DR2 T;  4X64 T;  2UXD T;  4DR7 T;  4B3S T;  2UXC T;  4YHH T;  4JI7 T;  4GKK T;  1IBK T;  4JI4 T;  4DV3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...