4B3RT

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3rT00
4DUZT 4KHPT 4DV7T 4DV6T 5IWAT 4JI6T 1N34T 4JI2T 4JI8T 4LFCT 1FJGT 4JI7T 5LMUT 1N33T 1HNZT 4NXNT 4DR7T 4JI3T 4X64T 2UXCT 4B3RT 1J5ET 1XNQT 4DR3T 4DV3T 2UUCT 2ZM6T 4DV0T 4B3MT 5BR8T 4LF5T 5LMNT 4DR6T 4AQYT 4DV2T 3T1HT 2VQFT 4YHHT 1XMQT 1I94T 4YY3T 3OTOT 4JI1T 1HR0T 4JYAT 4LFBT 2HHHT 1HNWT 4DUYT 4LF7T 4DV4T 4OX9T 2UU9T 4LF9T 4LFAT 4DR4T 1N32T 4DV5T 2UUBT 2E5LT 4GKJT 4K0KT 2F4VT 4X62T 1IBKT 1XNRT 4JI4T 2UUAT 2VQET 4B3TT 2UXDT 4DV1T 4DR1T 1XMOT 4LF6T 1HNXT 4GKKT 4DR5T 4LF8T 4X65T 4JI5T 4NXMT 4X66T 4JI0T 1IBLT 4LF4T 4DR2T 3T1YT 2UXBT 4JV5T 4B3ST 1IBMT 1N36T
chains in the Genus database with same CATH superfamily
4DUZT 3KBTA 4MFRA 5FP3A 4V1Av 4YTPA 2JMHA 4KMCA 3FXDB 2UXCT 3RHWA 3O1HA 3K8PC 5J1GA 4DV3T 4XBFB 2QGSA 2LSYA 2UUCT 3R84B 2KMFA 4JBWF 5JREA 2YINA 2Q9QD 1T7SA 5AQRB 3AEFA 2A2FX 3K3OA 5ADXL 3ZN0B 3EVYA 1OEDC 2N9DA 2NP9A 4QH4A 5AQVB 2X9YA 4PNIA 3I9WA 3RYHE 2N1GA 3C4ZA 2UUBT 3QB5K 5FXXA 3JC6C 3GWHA 2LLYA 5J2TE 4U72A 4ZI3D 3EHZA 1FMVA 3U78A 5FYMA 4QXHB 2HH7A 2E9XB 3AE4A 5LHIB 2XM2A 2PBIA 3PUWF 4AXPA 2M6IA 4JI5T 2BBJA 4EYUA 3AE6A 1EZ3A 3FZHB 1FMWA 4YJ3E 3T1YT 4HGAA 4B3ST 3K3QC 3F2EA 2KWHA 4NUUA 2XTLA 2H7VC 3TLUA 2BZBA 3P4QA 3AE2A 4OYKA 4JI6T 4K0UA 1WYCA 2WDQA 5AQJB 3G06A 5HXHA 3P4WA 2XPKA 2LOPA 3VKGA 2BBHA 2A9UA 1ZP0A 4U7IA 2QYWA 3NKZA 1IZNB 2AXDS 4IDPA 4X5TA 3T1HT 3NZPA 1IJ5A 3KFWX 2V7IA 2SPCA 5JR9B 5AQUB 4IE5A 2HHHT 4YSXA 4HE8A 2YK0A 3ZCIA 2B1EA 3RIUC 1N32T 4EZHA 1E1HB 5JDNA 2X66A 3BQLA 3AB3B 2XM1A 5L2LA 4ADZA 1KF6A 3T8OA 1D1BA 3RX6A 3EAMA 3RYCE 2H88A 4DV1T 3QOFA 1NENA 4LF6T 2DI4A 3JC6D 1ZOYA 2XQ7A 2Q9QB 1S35A 5ABFB 5HEOA 4JI0T 4FJOA 4JUYA 2MPKA 2HN1A 5H6RB 4IE0A 2CWYA 4AQFA 3QK6A 1MIYA 2JRKA 4HWHA 4P0BA 3AA1B 1OXZA 4GYSA 5C8YE 4DIDB 3PUVF 2FJBA 3PUYF 4GYRA 5HXCA 4ILUA 5JTGA 3AECA 3ZCJA 2W4XA 4CZZB 2WMOA 2V26A 5L3BB 3K1SA 3MA9A 1FIOA 4JI3T 2C5IT 5FXWA 1M62A 2IC9A 4OK0A 2JMKA 4U2ZA 5LHHB 4DMWA 2LKHA 3UQ4A 3AAIA 5JDMA 4YY3T 4YTNA 2LHNA 1HR0T 1Z8UA 1HFAA 4GK0E 2WDVA 4IT4A 5LCYA 4DV4T 4TN7B 4O4LE 4DR4T 2CM0A 5JDLA 4O4HE 3HL6A 2LJLA 1J1JA 3RQUA 2EHOA 2VURA 4AKIA 2VQET 5EZYE 2XQ4A 3AEAA 3KV4A 3I1AA 4ILAA 2NOXA 4WW0A 2X0HA 5LGTB 4UEMA 3UT5E 2WP9A 1G8XA 1D0ZA 5HAXA 4HFVA 2K9AA 3OPCA 1E7PA 5LJMA 3P4RA 5JH7E 3RQWA 4O2BE 1OEDB 5M4YA 3M65A 1BR0A 3LBXA 5KDMC 4U3CA 4YFSA 4AQGA 4UIGA 3CIRA 5JQGE 2ODUA 1HNZT 4QXBB 4X64T 3NRXA 1WLXA 3TLSA 4H63H 1KK7A 2YDRA 2YU2A 3CVRA 1US7B 4UV9B 4OFZA 5JRCA 2EHOB 4LF5T 2FJEA 3MKDA 4ZZBA 1VRBA 5L3EB 4JLEA 3SWHA 4WNKA 1LRZA 2DHRA 3ZC1A 2XZEA 4EYYR 4UXNB 3LK42 4LF7T 3S4UA 2V7JA 1W9RA 2VL0A 4G63A 4ZHQE 2XSBA 3VRBA 4C90A 2MYSA 3N2KE 3UU8A 5AFUL 2E5LT 2X0YA 2BS2A 5J2UE 2DLRA 2V7LA 3I0OA 1XMOT 3KBUA 4LF8T 2NTXA 2XQAA 5H6QB 4NUVA 1T72A 2CXDA 1U5PA 2WWUA 4IL9A 2Y6XA 3RF1A 1AJ3A 3HA4A 1W0BA 1VOMA 4DBQA 1ZV4X 3NRYA 4YLHA 3V5UA 2WM9A 5ABEA 2LSGA 5LG4A 2VVSA 4PJMA 1KEYA 3AVRA 4GIWA 4QHOA 2I6HA 2XAJB 4TWFA 5HYAA 1D0XA 5IWAT 4MLKA 4EGWA 4UELA 1FEWA 3H3MA 5LMUT 3UULA 1XWMA 1BR2A 4IL4A 5AQLB 1WR0A 5FKYA 3GN5A 4HTEA 3N5LA 2BVMA 3Q5XA 2XHEB 1WRDA 4EOZB 2KNDA 3OKQA 4UVAB 2I0MA 1WFDA 3O9XA 2J47A 2K24A 4ZI7E 5IYZE 4LFAT 4CN4A 2E9XD 2LE8A 2JIWA 3KINB 1OEDE 3ZSTA 2YN6A 3KV5A 5CA1E 2UXXB 3GA8A 3J9X1 3ZMSB 2D9DA 3ZC0A 4DR5T 4PJNA 2WMNA 5HCJA 3ABVA 3L09A 2BS3A 3AE1A 3UFGA 3SFDA 3AE3A 2CBIA 1DU2A 2ACXA 2UXBT 2WBLA 2WY2A 2CXLA 3ZKRA 1SHZC 1HG5A 2XJ7A 1VCTA 4HWCA 4ZS2A 4JI8T 4X1IE 3VR8A 5LBMA 4QH5A 2LSKA 5FY0A 4FI5A 2C0SA 1XNQT 4DR3T 5FY7A 4AQFC 1XZYA 5AQKB 1KNRA 2PFVA 4ZOLE 5HEUA 2OLTA 2VKDA 2WZIA 3FBZA 3HKEE 4QKNA 2HN2A 5J0ZA 2XAHB 3FZFB 2B76A 3IBPA 4ISTA 2VWAA 3UUMA 2KXPB 2KWIB 4EZ4A 2RP4A 2WU2A 3TLWA 2OV9A 3LDQB 5FL1A 3DP7A 1MIVA 2ZM2A 4K0KT 5L4EA 3Q9DA 2F4VT 2OA5A 4F6RC 1UK5A 5JDHA 5L4HA 1JNRA 4GKKT 1T8BA 4NXMT 3O1IA 2ZM0A 5KMGP 3FBLA 3WI3A 4U33A 2VKOA 4JV5T 2PG8A 4PK4A 3AXJA 5LHGB 2EHOC 1NAFA 3CMLA 3PJAJ 2X51A 3UTKA 1D0YA 1B7TA 3MK7C 3AA0B 4QX8B 4CXWA 2IHR1 3HI2A 1HF8A 2XQ3A 2WB5A 4CN6A 5FY1A 2V5CA 2CLYB 4WBOA 4UVBB 3QUJA 4YHJA 1G73A 3LK3B 3ZYLA 4AQYT 4DV2T 3B57A 2BKNA 2VQFT 4GOUA 1YW0A 2BKPA 3B5MA 5E0OA 2Y48B 3I9YA 2JQKA 2CPTA 2I59A 3N9NA 4A56A 4DV5T 5FVKA 2DL1A 3ZT7A 3Q2MA 1R8IA 2NTYA 5CB4E 3RH3A 4YSYA 5KX5E 2E8IA 5CGMA 3TKLB 2ZM8A 4YTMA 2JPFA 3ETVA 3ZT6A 3PTRB 4KI0F 2VASA 4A97A 2J4GA 3H37A 2NW9A 1CUNA 3UU4A 5F3JA 5LGUB 1H7CA 4DV6T 1MMDA 2CE7A 1N34T 5L3GB 4CXXA 4UF0A 4EAHA 2HPJA 2JQQA 5L47A 3SRZA 2EHOD 4AKLA 3F57A 2VVNA 3L8RA 4KBMB 3QC9A 3N9MA 3ZMUB 2KT9A 4HFCA 3ZPOA 5F8PA 5C2TA 2VB6A 3PUZF 2YDQA 4B3MT 3NZQA 5ABHA 3ZJ2A 4U2YA 3EI0A 2L3LA 2MAWA 1HNWT 2DNXA 4L9IA 1VCSA 1L0VA 1QLBA 1UX4A 5HCMA 3A8YC 1UUSA 1IBKT 3CQXC 4O4JE 3TLVA 1S94A 1YKHB 2YDSA 2UXDT 3TLTA 1ZEEA 2CA5A 4EEBA 3PJAA 4UF0B 4IDNA 2W00A 2C5KT 4CN1A 3ZN1B 3NWIA 2V8SV 2JQ9A 4BA9A 4O2AE 1D1AA 4P09A 2WZHA 2YU1A 3ETUA 5EK4A 4EB6E 2CHNA 5LB7B 3MXZA 4IDZA 1SA0E 2WWVA 3UQ7A 3N9PA 2V6YA 1N33T 2D0UA 3MACA 4CI1B 4ASKA 2XSAA 5FXVA 2XY8B 2P9BA 3C50A 4X1YE 4WBNE 2LSIA 1MNEA 3CX7B 5DQWA 4X1KE 2BG9A 4DR6T 2HPLA 2D5UA 3RYIE 4QWNB 5HWYA 1I94T 3U3IA 3UFEA 4QX7B 3N9LA 4LMKA 3JAEA 3P4PA 5FL0A 3WAKA 4Q25A 4LF9T 4YJ2E 4WZXA 2C5JA 2V7KA 4M1PA 5JDGA 5HXSA 3LJCA 3PU8A 2CBJA 4X62T 1NWMX 2W63A 3PV0F 2L8KA 2WAUA 1CHUA 4PAGA 5AQGB 5AQPB 5EK3A 2X0LB 2MTQA 4CQIA 2XUEA 5L3CB 5AQMB 1IBLT 4LF4T 4I50E 2D0TA 4HFDA 4HWIB 4NIQA 5AQTB 4LMJA 2CLYC 1WYBA 2M67A 1UURA 1HX1B 4HEAA 1QSDA 4BAYB 3LBXB 2LRLA 4F8HA 3E22E 3EDUA 5AQNB 4JI2T 2NR4A 4LFCT 2VL8A 2IW5B 1O3XA 4ZEYA 3L3PA 5TAOA 2IC6A 3VR9A 4IIJE 4A5XA 1WR6A 5FMNA 4B3RT 3CQGB 3IHRA 5JRCB 2Y8DA 4DV0T 4PFOA 3NBXX 2XAFB 4YHHT 4TWDA 2ES0A 5HEHA 4JYAT 5IUXA 3ZMVB 2CRBA 2FJDA 2L9QA 1HG2A 2VKHA 3Q5DA 4LMLA 1LKXA 1KNPA 4AIUA 2Z6EA 3GMIA 4KX6A 5CJ5A 3AEGA 4CI2B 1MNDA 5JDQA 2FUPA 2D2SA 4YT0A 4UVCB 2W2UA 4EV6A 4ILBA 5AQFB 4G2AA 2W0GA 3SS1A 2YOEA 4IGUA 3OBVE 5LYJE 2W66A 2J1DG 4H9PC 1XDPA 4HFEA 1N36T 2X9WA 3EUHA 4L5GA 2LOSA 3UU3A 2KINB 1YQ3A 4GK5E 2H3RA 4HN9A 3Q5EA 2A3DA 3MJXA 4HWDA 1UGOA 4H9SE 3GN5B 2KSRA 1ZHCA 3PU3A 5KXJA 4TNVA 4O8SA 5LMNT 2V1DB 4DMVA 3AA6B 3CWZB 1XMQT 2NW8A 2BKOA 4TNWA 3RYFE 3N2GE 5CFBA 5HEJA 1W0AA 4IE7A 4I4TE 4P1NA 4H9OC 3AAEB 4COFA 4GKJT 4MALA 3O1JA 1XNRT 4B6XA 3M3ZB 3UU6A 2FJAA 5LJNA 3C98B 3EDVA 1YXRA 2LRKA 3ZT5A 2W61A 4U31A 4OYJA 3RIAA 3RLFF 2E9XA 1HCIA 4H9QC 2IDOB 5GONE 5AQHB 3KVAA 3VKHA 1JNZA 2XQ8A 3PUAA 1V9DA 2MOZA 4IDQA 2WQYA 3LK2B 3CX6B 4UR9A 3OVUA 3RRWA 4QXCB 2KLQA 4TX5A 3RKGA 2LT3A 3P7IA 4P0AA 2WS3A 3R6NA 1HX8A 3BQIA 2BVLA 3FZKB 2H89A 1ZKEA 4U74A 5BR8T 3K3NA 3A7MA 5HEGA 1MMGA 3HR0A 2G0UA 1YKEB 3OTOT 3P50A 4U7YA 4JI1T 5JVDE 3RRCA 5JR9A 2ACZA 4OX9T 2CCQA 1MMAA 4BJMA 3N2OA 1U4QA 4DO0A 3PDYA 2DCFA 2LEHA 5DABA 3B13A 2VKJA 2BG9C 2DWGA 3AE5A 4B3TT 2QVAA 3HKCE 2XAQB 3X1DA 4PJJA 3OYZA 3FB2A 2X9XA 3O4XE 2Q9QA 5ABFA 2JQHA 5HWXA 3FXEB 4KP3C 2DWKA 2WU5A 4PJLA 3ONJA 3AXJB 2WSSV 1SUMB 3C4XA 1UCUA 1Z0PA 3E0ZA 4AKHA 1NEKA 2PJQA 2YKSA 3UUXB 2WCAA 2H7OA 3A5XA 4ISSA 4ZS3A 4DR7T 2LSJA 3SFEA 1J5ET 3EABA 2LKGA 4TV8E 3N9OA 1Y64B 4NPPA 4C91A 3J7Yq 4Z8XA 2MBGA 3PUXF 2AE9A 1IJ6A 3OJAA 4ZI2C 2XQYA 3KV6A 1E2AA 4LFBT 3H3AA 5LBQB 4UV8B 2ZMAA 4BJNA 5AQQB 2N2NA 2E2AA 4TWHA 4ZZCA 1T98A 3CPZA 2CWOA 4Z90A 2X67A 4H9RC 2IUBA 3ANWA 1MIWA 1IAPA 4Z91A 2E5VA 2V5DA 1M7KA 3ONXA 5AQOB 3SOLA 3VHLA 4AI6A 1WCRA 4DR1T 2K5BB 4YXDA 4JEHB 3P4SA 3PE0A 1HNXT 3LSVA 4X65T 4AKRB 3Q5WA 3ZJ1A 4EIWA 3UU5A 2A72A 5FNVE 5LG3A 1IBMT 4IE4A 4PW8A 5AQIB 3L39A 3NVOA 5JDFA 5LP6E 5AQSB 1Y01A 2XASB 1UX5A 3I0QA 1J5WA 3BQKA 3PUSA 1OEDA 3N9QA 3AEBA 4OHFA 3KV9A 4ANJA 1YD8G 2NW7A 1HS7A 3ANWB 3AEDA 4PK5A 4HFBA 3CKDA 3CK6A 3CX8B 3KVBA 3ZLIA 3AEEA 2PTFA 4PK6A 2UU9T 3PURA 3RKOA 4KHZF 4QH1A 4ZI2D 2W62A 4HWFA 4XZCA 5EK2A 4YSZA 2UUAT 3FZMB 4E7SA 4JEUB 1SE7A 4EEDA 3OYXA 4O4IE 4MHCA 3ZMTB 1W09A 2GK9A 4X66T 5DQVA 2BDEA 4CI3B 1I6ZA 2XQ9A 3FZLB 3V5SA 3VRAA 1BR1A 2ZLYA 3ZEFB 5IHYA 4L0RA 5L3DB 2JJ9A 4DBRA 4ILCA 3BK9A 2LHRA 4KHPT 4EXTA 2J62A 5FVLA 2WDRA 4KUMB 1XDOA 5ETWA 2X68A 3UUNA 4XAXB 2V6YB 1YQ4A 2K48A 2M6BA 3WAJA 3KDSE 3ZSSA 1X79A 3RPUA 2E9XC 2CHOA 3HKDE 1QUUA 3RIUA 1X9BA 4DVDA 4TZ4C 4MBQA 4I43B 1KNZA 4PFPA 2BG9B 3LG7A 4ERRA 3AA7B 2NWBA 2ODVA 3QB5A 5CA0E 5LOVE 3RC8A 4WYVA 2IAKA 3ZMZB 3C51A 2UXNB 2CEAA 3RC3A 3PUQA 5HXEA 1MMNA 2FBWA 4AKGA 4JI4T 2KZ7B 2QA7A 4H63V 3JAFA 3AVSA 5L3FB 4IE6A 3ONLC 5JR9C 1BR4A 4N78D 3VU7H 3ZYMA 3IF8B 3JADA 4X20E 3RIFA 5C3JA 4J2CA 3JCFA 5LXTE 4DR2T 1OWAA 1GQEA 3AAAB 3DJBA 2R6GF 5LGNB 3IA3A 3PUGA 4HKAA 3RGLA 2XQ5A 4TUYE 4DV7T 2XAGB 3QNUA 2V7MA 3AE9A 3ESLA 4IHJE 1FJGT 4TV9E 4I55E 2V6XA 4DNDA 4A98A 4JI7T 2IIUA 5FXZA 4NXNT 2RPAA 3D0TA 2Q9QC 4I0UA 2W67A 4ZXLA 2LM9A 5F5WA 4HFHA 2ZM6T 3C64A 4IDOA 4IREA 2CXFA 3HKBE 2QRXA 2K3WA 3DTOA 2X9HA 3FHNA 2VK9A 4AISA 4DUYT 2XQ6A 5ABGA 2CMRA 4CXYA 3AE8A 1KFYA 4ZI3C 1D1CA 3F31A 4E7ZA 3IEEA 2RA1A 3C4WA 4H9NC 2BS4A 4HFIA 3RI5A 5BMVE 1LVFA 2YEVC 2LM2A 5DJQC 3AE7A 3P8CD 2IMLA 1HTJF 3CQCB 3MZKB 5A1LA 2BG9E 5LA6E 3ZYKA 5HXRA 5LNKA 3W15B 3UUBA 3E08A 3LFMA 1LVKA
chains in the Genus database with same CATH topology
4DUZT 4KHPT 4DV7T 4DV6T 5IWAT 4JI6T 1N34T 4JI2T 4JI8T 4LFCT 1FJGT 4JI7T 5LMUT 1N33T 1HNZT 4NXNT 4DR7T 4JI3T 4X64T 2UXCT 4B3RT 1J5ET 1XNQT 4DR3T 4DV3T 2UUCT 2ZM6T 4DV0T 4B3MT 5BR8T 4LF5T 5LMNT 4DR6T 4AQYT 4DV2T 3T1HT 2VQFT 4YHHT 1XMQT 1I94T 4YY3T 3OTOT 4JI1T 1HR0T 4JYAT 4LFBT 2HHHT 1HNWT 4DUYT 4LF7T 4DV4T 4OX9T 2UU9T 4LF9T 4LFAT 4DR4T 1N32T 4DV5T 2UUBT 2E5LT 4GKJT 4K0KT 2F4VT 4X62T 1IBKT 1XNRT 4JI4T 2UUAT 2VQET 4B3TT 2UXDT 4DV1T 4DR1T 1XMOT 4LF6T 1HNXT 4GKKT 4DR5T 4LF8T 4X65T 4JI5T 4NXMT 4X66T 4JI0T 1IBLT 4LF4T 4DR2T 3T1YT 2UXBT 4JV5T 4B3ST 1IBMT 1N36T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ T;  4KHP T;  4DV7 T;  4DV6 T;  5IWA T;  4JI6 T;  1N34 T;  4JI2 T;  4JI8 T;  4LFC T;  1FJG T;  4JI7 T;  5LMU T;  1N33 T;  1HNZ T;  4NXN T;  4DR7 T;  4JI3 T;  4X64 T;  2UXC T;  4B3R T;  1J5E T;  1XNQ T;  4DR3 T;  4DV3 T;  2UUC T;  2ZM6 T;  4DV0 T;  4B3M T;  5BR8 T;  4LF5 T;  5LMN T;  4DR6 T;  4AQY T;  4DV2 T;  3T1H T;  2VQF T;  4YHH T;  1XMQ T;  1I94 T;  4YY3 T;  3OTO T;  4JI1 T;  1HR0 T;  4JYA T;  4LFB T;  2HHH T;  1HNW T;  4DUY T;  4LF7 T;  4DV4 T;  4OX9 T;  2UU9 T;  4LF9 T;  4LFA T;  4DR4 T;  1N32 T;  4DV5 T;  2UUB T;  2E5L T;  4GKJ T;  4K0K T;  2F4V T;  4X62 T;  1IBK T;  1XNR T;  4JI4 T;  2UUA T;  2VQE T;  4B3T T;  2UXD T;  4DV1 T;  4DR1 T;  1XMO T;  4LF6 T;  1HNX T;  4GKK T;  4DR5 T;  4LF8 T;  4X65 T;  4JI5 T;  4NXM T;  4X66 T;  4JI0 T;  1IBL T;  4LF4 T;  4DR2 T;  3T1Y T;  2UXB T;  4JV5 T;  4B3S T;  1IBM T;  1N36 T; 
#chains in the Genus database with same CATH topology
 4DUZ T;  3KBT A;  4MFR A;  5FP3 A;  4V1A v;  4YTP A;  2JMH A;  4KMC A;  3FXD B;  2UXC T;  3RHW A;  3O1H A;  3K8P C;  5J1G A;  4DV3 T;  4XBF B;  2QGS A;  2LSY A;  2UUC T;  3R84 B;  2KMF A;  4JBW F;  5JRE A;  2YIN A;  2Q9Q D;  1T7S A;  5AQR B;  3AEF A;  2A2F X;  3K3O A;  5ADX L;  3ZN0 B;  3EVY A;  1OED C;  2N9D A;  2NP9 A;  4QH4 A;  5AQV B;  2X9Y A;  4PNI A;  3I9W A;  3RYH E;  2N1G A;  3C4Z A;  2UUB T;  3QB5 K;  5FXX A;  3JC6 C;  3GWH A;  2LLY A;  5J2T E;  4U72 A;  4ZI3 D;  3EHZ A;  1FMV A;  3U78 A;  5FYM A;  4QXH B;  2HH7 A;  2E9X B;  3AE4 A;  5LHI B;  2XM2 A;  2PBI A;  3PUW F;  4AXP A;  2M6I A;  4JI5 T;  2BBJ A;  4EYU A;  3AE6 A;  1EZ3 A;  3FZH B;  1FMW A;  4YJ3 E;  3T1Y T;  4HGA A;  4B3S T;  3K3Q C;  3F2E A;  2KWH A;  4NUU A;  2XTL A;  2H7V C;  3TLU A;  2BZB A;  3P4Q A;  3AE2 A;  4OYK A;  4JI6 T;  4K0U A;  1WYC A;  2WDQ A;  5AQJ B;  3G06 A;  5HXH A;  3P4W A;  2XPK A;  2LOP A;  3VKG A;  2BBH A;  2A9U A;  1ZP0 A;  4U7I A;  2QYW A;  3NKZ A;  1IZN B;  2AXD S;  4IDP A;  4X5T A;  3T1H T;  3NZP A;  1IJ5 A;  3KFW X;  2V7I A;  2SPC A;  5JR9 B;  5AQU B;  4IE5 A;  2HHH T;  4YSX A;  4HE8 A;  2YK0 A;  3ZCI A;  2B1E A;  3RIU C;  1N32 T;  4EZH A;  1E1H B;  5JDN A;  2X66 A;  3BQL A;  3AB3 B;  2XM1 A;  5L2L A;  4ADZ A;  1KF6 A;  3T8O A;  1D1B A;  3RX6 A;  3EAM A;  3RYC E;  2H88 A;  4DV1 T;  3QOF A;  1NEN A;  4LF6 T;  2DI4 A;  3JC6 D;  1ZOY A;  2XQ7 A;  2Q9Q B;  1S35 A;  5ABF B;  5HEO A;  4JI0 T;  4FJO A;  4JUY A;  2MPK A;  2HN1 A;  5H6R B;  4IE0 A;  2CWY A;  4AQF A;  3QK6 A;  1MIY A;  2JRK A;  4HWH A;  4P0B A;  3AA1 B;  1OXZ A;  4GYS A;  5C8Y E;  4DID B;  3PUV F;  2FJB A;  3PUY F;  4GYR A;  5HXC A;  4ILU A;  5JTG A;  3AEC A;  3ZCJ A;  2W4X A;  4CZZ B;  2WMO A;  2V26 A;  5L3B B;  3K1S A;  3MA9 A;  1FIO A;  4JI3 T;  2C5I T;  5FXW A;  1M62 A;  2IC9 A;  4OK0 A;  2JMK A;  4U2Z A;  5LHH B;  4DMW A;  2LKH A;  3UQ4 A;  3AAI A;  5JDM A;  4YY3 T;  4YTN A;  2LHN A;  1HR0 T;  1Z8U A;  1HFA A;  4GK0 E;  2WDV A;  4IT4 A;  5LCY A;  4DV4 T;  4TN7 B;  4O4L E;  4DR4 T;  2CM0 A;  5JDL A;  4O4H E;  3HL6 A;  2LJL A;  1J1J A;  3RQU A;  2EHO A;  2VUR A;  4AKI A;  2VQE T;  5EZY E;  2XQ4 A;  3AEA A;  3KV4 A;  3I1A A;  4ILA A;  2NOX A;  4WW0 A;  2X0H A;  5LGT B;  4UEM A;  3UT5 E;  2WP9 A;  1G8X A;  1D0Z A;  5HAX A;  4HFV A;  2K9A A;  3OPC A;  1E7P A;  5LJM A;  3P4R A;  5JH7 E;  3RQW A;  4O2B E;  1OED B;  5M4Y A;  3M65 A;  1BR0 A;  3LBX A;  5KDM C;  4U3C A;  4YFS A;  4AQG A;  4UIG A;  3CIR A;  5JQG E;  2ODU A;  1HNZ T;  4QXB B;  4X64 T;  3NRX A;  1WLX A;  3TLS A;  4H63 H;  1KK7 A;  2YDR A;  2YU2 A;  3CVR A;  1US7 B;  4UV9 B;  4OFZ A;  5JRC A;  2EHO B;  4LF5 T;  2FJE A;  3MKD A;  4ZZB A;  1VRB A;  5L3E B;  4JLE A;  3SWH A;  4WNK A;  1LRZ A;  2DHR A;  3ZC1 A;  2XZE A;  4EYY R;  4UXN B;  3LK4 2;  4LF7 T;  3S4U A;  2V7J A;  1W9R A;  2VL0 A;  4G63 A;  4ZHQ E;  2XSB A;  3VRB A;  4C90 A;  2MYS A;  3N2K E;  3UU8 A;  5AFU L;  2E5L T;  2X0Y A;  2BS2 A;  5J2U E;  2DLR A;  2V7L A;  3I0O A;  1XMO T;  3KBU A;  4LF8 T;  2NTX A;  2XQA A;  5H6Q B;  4NUV A;  1T72 A;  2CXD A;  1U5P A;  2WWU A;  4IL9 A;  2Y6X A;  3RF1 A;  1AJ3 A;  3HA4 A;  1W0B A;  1VOM A;  4DBQ A;  1ZV4 X;  3NRY A;  4YLH A;  3V5U A;  2WM9 A;  5ABE A;  2LSG A;  5LG4 A;  2VVS A;  4PJM A;  1KEY A;  3AVR A;  4GIW A;  4QHO A;  2I6H A;  2XAJ B;  4TWF A;  5HYA A;  1D0X A;  5IWA T;  4MLK A;  4EGW A;  4UEL A;  1FEW A;  3H3M A;  5LMU T;  3UUL A;  1XWM A;  1BR2 A;  4IL4 A;  5AQL B;  1WR0 A;  5FKY A;  3GN5 A;  4HTE A;  3N5L A;  2BVM A;  3Q5X A;  2XHE B;  1WRD A;  4EOZ B;  2KND A;  3OKQ A;  4UVA B;  2I0M A;  1WFD A;  3O9X A;  2J47 A;  2K24 A;  4ZI7 E;  5IYZ E;  4LFA T;  4CN4 A;  2E9X D;  2LE8 A;  2JIW A;  3KIN B;  1OED E;  3ZST A;  2YN6 A;  3KV5 A;  5CA1 E;  2UXX B;  3GA8 A;  3J9X 1;  3ZMS B;  2D9D A;  3ZC0 A;  4DR5 T;  4PJN A;  2WMN A;  5HCJ A;  3ABV A;  3L09 A;  2BS3 A;  3AE1 A;  3UFG A;  3SFD A;  3AE3 A;  2CBI A;  1DU2 A;  2ACX A;  2UXB T;  2WBL A;  2WY2 A;  2CXL A;  3ZKR A;  1SHZ C;  1HG5 A;  2XJ7 A;  1VCT A;  4HWC A;  4ZS2 A;  4JI8 T;  4X1I E;  3VR8 A;  5LBM A;  4QH5 A;  2LSK A;  5FY0 A;  4FI5 A;  2C0S A;  1XNQ T;  4DR3 T;  5FY7 A;  4AQF C;  1XZY A;  5AQK B;  1KNR A;  2PFV A;  4ZOL E;  5HEU A;  2OLT A;  2VKD A;  2WZI A;  3FBZ A;  3HKE E;  4QKN A;  2HN2 A;  5J0Z A;  2XAH B;  3FZF B;  2B76 A;  3IBP A;  4IST A;  2VWA A;  3UUM A;  2KXP B;  2KWI B;  4EZ4 A;  2RP4 A;  2WU2 A;  3TLW A;  2OV9 A;  3LDQ B;  5FL1 A;  3DP7 A;  1MIV A;  2ZM2 A;  4K0K T;  5L4E A;  3Q9D A;  2F4V T;  2OA5 A;  4F6R C;  1UK5 A;  5JDH A;  5L4H A;  1JNR A;  4GKK T;  1T8B A;  4NXM T;  3O1I A;  2ZM0 A;  5KMG P;  3FBL A;  3WI3 A;  4U33 A;  2VKO A;  4JV5 T;  2PG8 A;  4PK4 A;  3AXJ A;  5LHG B;  2EHO C;  1NAF A;  3CML A;  3PJA J;  2X51 A;  3UTK A;  1D0Y A;  1B7T A;  3MK7 C;  3AA0 B;  4QX8 B;  4CXW A;  2IHR 1;  3HI2 A;  1HF8 A;  2XQ3 A;  2WB5 A;  4CN6 A;  5FY1 A;  2V5C A;  2CLY B;  4WBO A;  4UVB B;  3QUJ A;  4YHJ A;  1G73 A;  3LK3 B;  3ZYL A;  4AQY T;  4DV2 T;  3B57 A;  2BKN A;  2VQF T;  4GOU A;  1YW0 A;  2BKP A;  3B5M A;  5E0O A;  2Y48 B;  3I9Y A;  2JQK A;  2CPT A;  2I59 A;  3N9N A;  4A56 A;  4DV5 T;  5FVK A;  2DL1 A;  3ZT7 A;  3Q2M A;  1R8I A;  2NTY A;  5CB4 E;  3RH3 A;  4YSY A;  5KX5 E;  2E8I A;  5CGM A;  3TKL B;  2ZM8 A;  4YTM A;  2JPF A;  3ETV A;  3ZT6 A;  3PTR B;  4KI0 F;  2VAS A;  4A97 A;  2J4G A;  3H37 A;  2NW9 A;  1CUN A;  3UU4 A;  5F3J A;  5LGU B;  1H7C A;  4DV6 T;  1MMD A;  2CE7 A;  1N34 T;  5L3G B;  4CXX A;  4UF0 A;  4EAH A;  2HPJ A;  2JQQ A;  5L47 A;  3SRZ A;  2EHO D;  4AKL A;  3F57 A;  2VVN A;  3L8R A;  4KBM B;  3QC9 A;  3N9M A;  3ZMU B;  2KT9 A;  4HFC A;  3ZPO A;  5F8P A;  5C2T A;  2VB6 A;  3PUZ F;  2YDQ A;  4B3M T;  3NZQ A;  5ABH A;  3ZJ2 A;  4U2Y A;  3EI0 A;  2L3L A;  2MAW A;  1HNW T;  2DNX A;  4L9I A;  1VCS A;  1L0V A;  1QLB A;  1UX4 A;  5HCM A;  3A8Y C;  1UUS A;  1IBK T;  3CQX C;  4O4J E;  3TLV A;  1S94 A;  1YKH B;  2YDS A;  2UXD T;  3TLT A;  1ZEE A;  2CA5 A;  4EEB A;  3PJA A;  4UF0 B;  4IDN A;  2W00 A;  2C5K T;  4CN1 A;  3ZN1 B;  3NWI A;  2V8S V;  2JQ9 A;  4BA9 A;  4O2A E;  1D1A A;  4P09 A;  2WZH A;  2YU1 A;  3ETU A;  5EK4 A;  4EB6 E;  2CHN A;  5LB7 B;  3MXZ A;  4IDZ A;  1SA0 E;  2WWV A;  3UQ7 A;  3N9P A;  2V6Y A;  1N33 T;  2D0U A;  3MAC A;  4CI1 B;  4ASK A;  2XSA A;  5FXV A;  2XY8 B;  2P9B A;  3C50 A;  4X1Y E;  4WBN E;  2LSI A;  1MNE A;  3CX7 B;  5DQW A;  4X1K E;  2BG9 A;  4DR6 T;  2HPL A;  2D5U A;  3RYI E;  4QWN B;  5HWY A;  1I94 T;  3U3I A;  3UFE A;  4QX7 B;  3N9L A;  4LMK A;  3JAE A;  3P4P A;  5FL0 A;  3WAK A;  4Q25 A;  4LF9 T;  4YJ2 E;  4WZX A;  2C5J A;  2V7K A;  4M1P A;  5JDG A;  5HXS A;  3LJC A;  3PU8 A;  2CBJ A;  4X62 T;  1NWM X;  2W63 A;  3PV0 F;  2L8K A;  2WAU A;  1CHU A;  4PAG A;  5AQG B;  5AQP B;  5EK3 A;  2X0L B;  2MTQ A;  4CQI A;  2XUE A;  5L3C B;  5AQM B;  1IBL T;  4LF4 T;  4I50 E;  2D0T A;  4HFD A;  4HWI B;  4NIQ A;  5AQT B;  4LMJ A;  2CLY C;  1WYB A;  2M67 A;  1UUR A;  1HX1 B;  4HEA A;  1QSD A;  4BAY B;  3LBX B;  2LRL A;  4F8H A;  3E22 E;  3EDU A;  5AQN B;  4JI2 T;  2NR4 A;  4LFC T;  2VL8 A;  2IW5 B;  1O3X A;  4ZEY A;  3L3P A;  5TAO A;  2IC6 A;  3VR9 A;  4IIJ E;  4A5X A;  1WR6 A;  5FMN A;  4B3R T;  3CQG B;  3IHR A;  5JRC B;  2Y8D A;  4DV0 T;  4PFO A;  3NBX X;  2XAF B;  4YHH T;  4TWD A;  2ES0 A;  5HEH A;  4JYA T;  5IUX A;  3ZMV B;  2CRB A;  2FJD A;  2L9Q A;  1HG2 A;  2VKH A;  3Q5D A;  4LML A;  1LKX A;  1KNP A;  4AIU A;  2Z6E A;  3GMI A;  4KX6 A;  5CJ5 A;  3AEG A;  4CI2 B;  1MND A;  5JDQ A;  2FUP A;  2D2S A;  4YT0 A;  4UVC B;  2W2U A;  4EV6 A;  4ILB A;  5AQF B;  4G2A A;  2W0G A;  3SS1 A;  2YOE A;  4IGU A;  3OBV E;  5LYJ E;  2W66 A;  2J1D G;  4H9P C;  1XDP A;  4HFE A;  1N36 T;  2X9W A;  3EUH A;  4L5G A;  2LOS A;  3UU3 A;  2KIN B;  1YQ3 A;  4GK5 E;  2H3R A;  4HN9 A;  3Q5E A;  2A3D A;  3MJX A;  4HWD A;  1UGO A;  4H9S E;  3GN5 B;  2KSR A;  1ZHC A;  3PU3 A;  5KXJ A;  4TNV A;  4O8S A;  5LMN T;  2V1D B;  4DMV A;  3AA6 B;  3CWZ B;  1XMQ T;  2NW8 A;  2BKO A;  4TNW A;  3RYF E;  3N2G E;  5CFB A;  5HEJ A;  1W0A A;  4IE7 A;  4I4T E;  4P1N A;  4H9O C;  3AAE B;  4COF A;  4GKJ T;  4MAL A;  3O1J A;  1XNR T;  4B6X A;  3M3Z B;  3UU6 A;  2FJA A;  5LJN A;  3C98 B;  3EDV A;  1YXR A;  2LRK A;  3ZT5 A;  2W61 A;  4U31 A;  4OYJ A;  3RIA A;  3RLF F;  2E9X A;  1HCI A;  4H9Q C;  2IDO B;  5GON E;  5AQH B;  3KVA A;  3VKH A;  1JNZ A;  2XQ8 A;  3PUA A;  1V9D A;  2MOZ A;  4IDQ A;  2WQY A;  3LK2 B;  3CX6 B;  4UR9 A;  3OVU A;  3RRW A;  4QXC B;  2KLQ A;  4TX5 A;  3RKG A;  2LT3 A;  3P7I A;  4P0A A;  2WS3 A;  3R6N A;  1HX8 A;  3BQI A;  2BVL A;  3FZK B;  2H89 A;  1ZKE A;  4U74 A;  5BR8 T;  3K3N A;  3A7M A;  5HEG A;  1MMG A;  3HR0 A;  2G0U A;  1YKE B;  3OTO T;  3P50 A;  4U7Y A;  4JI1 T;  5JVD E;  3RRC A;  5JR9 A;  2ACZ A;  4OX9 T;  2CCQ A;  1MMA A;  4BJM A;  3N2O A;  1U4Q A;  4DO0 A;  3PDY A;  2DCF A;  2LEH A;  5DAB A;  3B13 A;  2VKJ A;  2BG9 C;  2DWG A;  3AE5 A;  4B3T T;  2QVA A;  3HKC E;  2XAQ B;  3X1D A;  4PJJ A;  3OYZ A;  3FB2 A;  2X9X A;  3O4X E;  2Q9Q A;  5ABF A;  2JQH A;  5HWX A;  3FXE B;  4KP3 C;  2DWK A;  2WU5 A;  4PJL A;  3ONJ A;  3AXJ B;  2WSS V;  1SUM B;  3C4X A;  1UCU A;  1Z0P A;  3E0Z A;  4AKH A;  1NEK A;  2PJQ A;  2YKS A;  3UUX B;  2WCA A;  2H7O A;  3A5X A;  4ISS A;  4ZS3 A;  4DR7 T;  2LSJ A;  3SFE A;  1J5E T;  3EAB A;  2LKG A;  4TV8 E;  3N9O A;  1Y64 B;  4NPP A;  4C91 A;  3J7Y q;  4Z8X A;  2MBG A;  3PUX F;  2AE9 A;  1IJ6 A;  3OJA A;  4ZI2 C;  2XQY A;  3KV6 A;  1E2A A;  4LFB T;  3H3A A;  5LBQ B;  4UV8 B;  2ZMA A;  4BJN A;  5AQQ B;  2N2N A;  2E2A A;  4TWH A;  4ZZC A;  1T98 A;  3CPZ A;  2CWO A;  4Z90 A;  2X67 A;  4H9R C;  2IUB A;  3ANW A;  1MIW A;  1IAP A;  4Z91 A;  2E5V A;  2V5D A;  1M7K A;  3ONX A;  5AQO B;  3SOL A;  3VHL A;  4AI6 A;  1WCR A;  4DR1 T;  2K5B B;  4YXD A;  4JEH B;  3P4S A;  3PE0 A;  1HNX T;  3LSV A;  4X65 T;  4AKR B;  3Q5W A;  3ZJ1 A;  4EIW A;  3UU5 A;  2A72 A;  5FNV E;  5LG3 A;  1IBM T;  4IE4 A;  4PW8 A;  5AQI B;  3L39 A;  3NVO A;  5JDF A;  5LP6 E;  5AQS B;  1Y01 A;  2XAS B;  1UX5 A;  3I0Q A;  1J5W A;  3BQK A;  3PUS A;  1OED A;  3N9Q A;  3AEB A;  4OHF A;  3KV9 A;  4ANJ A;  1YD8 G;  2NW7 A;  1HS7 A;  3ANW B;  3AED A;  4PK5 A;  4HFB A;  3CKD A;  3CK6 A;  3CX8 B;  3KVB A;  3ZLI A;  3AEE A;  2PTF A;  4PK6 A;  2UU9 T;  3PUR A;  3RKO A;  4KHZ F;  4QH1 A;  4ZI2 D;  2W62 A;  4HWF A;  4XZC A;  5EK2 A;  4YSZ A;  2UUA T;  3FZM B;  4E7S A;  4JEU B;  1SE7 A;  4EED A;  3OYX A;  4O4I E;  4MHC A;  3ZMT B;  1W09 A;  2GK9 A;  4X66 T;  5DQV A;  2BDE A;  4CI3 B;  1I6Z A;  2XQ9 A;  3FZL B;  3V5S A;  3VRA A;  1BR1 A;  2ZLY A;  3ZEF B;  5IHY A;  4L0R A;  5L3D B;  2JJ9 A;  4DBR A;  4ILC A;  3BK9 A;  2LHR A;  4KHP T;  4EXT A;  2J62 A;  5FVL A;  2WDR A;  4KUM B;  1XDO A;  5ETW A;  2X68 A;  3UUN A;  4XAX B;  2V6Y B;  1YQ4 A;  2K48 A;  2M6B A;  3WAJ A;  3KDS E;  3ZSS A;  1X79 A;  3RPU A;  2E9X C;  2CHO A;  3HKD E;  1QUU A;  3RIU A;  1X9B A;  4DVD A;  4TZ4 C;  4MBQ A;  4I43 B;  1KNZ A;  4PFP A;  2BG9 B;  3LG7 A;  4ERR A;  3AA7 B;  2NWB A;  2ODV A;  3QB5 A;  5CA0 E;  5LOV E;  3RC8 A;  4WYV A;  2IAK A;  3ZMZ B;  3C51 A;  2UXN B;  2CEA A;  3RC3 A;  3PUQ A;  5HXE A;  1MMN A;  2FBW A;  4AKG A;  4JI4 T;  2KZ7 B;  2QA7 A;  4H63 V;  3JAF A;  3AVS A;  5L3F B;  4IE6 A;  3ONL C;  5JR9 C;  1BR4 A;  4N78 D;  3VU7 H;  3ZYM A;  3IF8 B;  3JAD A;  4X20 E;  3RIF A;  5C3J A;  4J2C A;  3JCF A;  5LXT E;  4DR2 T;  1OWA A;  1GQE A;  3AAA B;  3DJB A;  2R6G F;  5LGN B;  3IA3 A;  3PUG A;  4HKA A;  3RGL A;  2XQ5 A;  4TUY E;  4DV7 T;  2XAG B;  3QNU A;  2V7M A;  3AE9 A;  3ESL A;  4IHJ E;  1FJG T;  4TV9 E;  4I55 E;  2V6X A;  4DND A;  4A98 A;  4JI7 T;  2IIU A;  5FXZ A;  4NXN T;  2RPA A;  3D0T A;  2Q9Q C;  4I0U A;  2W67 A;  4ZXL A;  2LM9 A;  5F5W A;  4HFH A;  2ZM6 T;  3C64 A;  4IDO A;  4IRE A;  2CXF A;  3HKB E;  2QRX A;  2K3W A;  3DTO A;  2X9H A;  3FHN A;  2VK9 A;  4AIS A;  4DUY T;  2XQ6 A;  5ABG A;  2CMR A;  4CXY A;  3AE8 A;  1KFY A;  4ZI3 C;  1D1C A;  3F31 A;  4E7Z A;  3IEE A;  2RA1 A;  3C4W A;  4H9N C;  2BS4 A;  4HFI A;  3RI5 A;  5BMV E;  1LVF A;  2YEV C;  2LM2 A;  5DJQ C;  3AE7 A;  3P8C D;  2IML A;  1HTJ F;  3CQC B;  3MZK B;  5A1L A;  2BG9 E;  5LA6 E;  3ZYK A;  5HXR A;  5LNK A;  3W15 B;  3UUB A;  3E08 A;  3LFM A;  1LVK A; 
#chains in the Genus database with same CATH homology
 4DUZ T;  4KHP T;  4DV7 T;  4DV6 T;  5IWA T;  4JI6 T;  1N34 T;  4JI2 T;  4JI8 T;  4LFC T;  1FJG T;  4JI7 T;  5LMU T;  1N33 T;  1HNZ T;  4NXN T;  4DR7 T;  4JI3 T;  4X64 T;  2UXC T;  4B3R T;  1J5E T;  1XNQ T;  4DR3 T;  4DV3 T;  2UUC T;  2ZM6 T;  4DV0 T;  4B3M T;  5BR8 T;  4LF5 T;  5LMN T;  4DR6 T;  4AQY T;  4DV2 T;  3T1H T;  2VQF T;  4YHH T;  1XMQ T;  1I94 T;  4YY3 T;  3OTO T;  4JI1 T;  1HR0 T;  4JYA T;  4LFB T;  2HHH T;  1HNW T;  4DUY T;  4LF7 T;  4DV4 T;  4OX9 T;  2UU9 T;  4LF9 T;  4LFA T;  4DR4 T;  1N32 T;  4DV5 T;  2UUB T;  2E5L T;  4GKJ T;  4K0K T;  2F4V T;  4X62 T;  1IBK T;  1XNR T;  4JI4 T;  2UUA T;  2VQE T;  4B3T T;  2UXD T;  4DV1 T;  4DR1 T;  1XMO T;  4LF6 T;  1HNX T;  4GKK T;  4DR5 T;  4LF8 T;  4X65 T;  4JI5 T;  4NXM T;  4X66 T;  4JI0 T;  1IBL T;  4LF4 T;  4DR2 T;  3T1Y T;  2UXB T;  4JV5 T;  4B3S T;  1IBM T;  1N36 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...