4B3RT

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3rT00
4JYAT 4NXMT 4DR4T 4JI4T 4JV5T 4YY3T 2UXDT 2UUBT 2UUCT 5BR8T 4DV3T 4GKKT 4DV2T 4JI1T 3T1HT 4DR7T 4AQYT 2VQET 1IBMT 4JI5T 1N33T 4LF8T 2ZM6T 4OX9T 4DV5T 4LFBT 1XNQT 4DR5T 3OTOT 4DV6T 1J5ET 1XNRT 4DV4T 1XMOT 4X66T 4KHPT 2F4VT 2UXCT 1N36T 2UU9T 1HNXT 4DR6T 4YHHT 4DUZT 4DV1T 4LFCT 4LF6T 4JI0T 1N32T 1HR0T 4DR1T 4LF9T 4LF7T 4NXNT 4JI7T 4X64T 1I94T 5IWAT 4LF5T 4B3ST 4LF4T 4DV7T 4LFAT 4JI2T 4B3TT 1HNZT 4X62T 2UXBT 1FJGT 4DR3T 2VQFT 1IBKT 4JI6T 4B3RT 4X65T 4K0KT 1XMQT 1HNWT 4JI3T 1N34T 3T1YT 4DV0T 4JI8T 5LMUT 1IBLT 4DR2T 2E5LT 4DUYT 5LMNT 4B3MT 2HHHT 4GKJT 2UUAT
chains in the Genus database with same CATH superfamily
2JMHA 3UUNA 3ONLC 4HWFA 3Q5WA 4PFOA 4ZZCA 3KV5A 2UUBT 4U74A 4CI2B 3ETVA 1UCUA 3C50A 3A7MA 3AAAB 3K3QC 4N78D 5HWYA 3UUMA 2H88A 2JIWA 2WP9A 4G63A 3U3IA 4IE4A 2ODVA 3ZCJA 5C8YE 2WMNA 3QUJA 4UVBB 2CHOA 3NRYA 3TLVA 4HFVA 3I0QA 3RKOA 4O4IE 2NOXA 3VR8A 4DV4T 5AQGB 2NW7A 2WZHA 4AKGA 2YDSA 3QB5A 2UXNB 4NUVA 3UU5A 5FP3A 3HR0A 2F4VT 1LKXA 4LMLA 4CXXA 3NZQA 3B13A 4JI0T 5HWXA 1G8XA 5IWAT 4AKHA 2J4GA 2V8SV 3PUZF 4B3TT 3OJAA 3DTOA 5EK2A 5HYAA 4ERRA 1OXZA 2P9BA 2KZ7B 2V26A 3Q5XA 4UEMA 2FUPA 1ZEEA 2XSAA 4O4JE 4PK5A 3QB5K 3U78A 3P50A 3CX6B 3RRWA 2H89A 3EDUA 4FJOA 2V1DB 2XM1A 3I9WA 1HX8A 2IIUA 4HFEA 4GKKT 3LJCA 2EHOC 2XAHB 4ILAA 5LHHB 4U33A 3DJBA 2DWKA 4P1NA 5F5WA 4CI3B 3PUVF 1N33T 4EYYR 4EB6E 3OYZA 2XQ7A 5L3BB 4WBOA 4U7YA 4I4TE 4YT0A 3E0ZA 5FL0A 2CBJA 4PJNA 3RX6A 1XMOT 2LKHA 5LYJE 3J7Yq 4O4LE 2L8KA 2Q9QD 2LOSA 4KHPT 1W9RA 4QH4A 5HEUA 4CQIA 4DNDA 3UQ4A 4ZHQE 4LFCT 5JDGA 2KSRA 3LFMA 3MACA 5AQVB 4B3ST 2VURA 2YU2A 3AXJA 1O3XA 5JDMA 3OBVE 2VVNA 3UTKA 2CCQA 2LRLA 2CLYB 3PUYF 4QXHB 4EV6A 4X65T 4Z90A 4EIWA 1HNWT 3AA1B 5DQVA 2W66A 5LGNB 3RYCE 5AQNB 3KVAA 4GYSA 2Z6EA 2ZM8A 3ZMVB 4GYRA 3AAIA 1T98A 3BQLA 5DABA 2JQ9A 2BBJA 2V7KA 4P09A 2ZM2A 5LJNA 4U2ZA 3ONXA 4Z8XA 3ZJ1A 1WLXA 4ISSA 4QXBB 3UU4A 5HEOA 3T1HT 2XQ5A 3FBLA 4NUUA 2GK9A 3CVRA 4WBNE 3RQUA 5LA6E 4HFBA 2NW9A 1J5ET 3B57A 1ZKEA 3I0OA 3P4QA 2VKJA 2WSSV 3EAMA 3AA7B 4UELA 4X66T 5LHIB 2XQ3A 2WY2A 1E1HB 2HN1A 4UVAB 5LG3A 1KNZA 4QWNB 5F8PA 2E9XD 3F57A 4H63V 2PJQA 2SPCA 4UIGA 4QXCB 2WDVA 5FY1A 4QKNA 2LKGA 4OYJA 3ZPOA 4BJMA 3LDQB 4UVCB 3UULA 2Q9QA 4JEHB 4H9NC 2JQKA 5JDFA 4A5XA 3O9XA 3KFWX 3RIUA 3RLFF 2VASA 1KK7A 3FZLB 4JI4T 2B1EA 3SS1A 3N9LA 3HKDE 1KEYA 5CA0E 3AECA 2LT3A 3VU7H 1SUMB 2IC9A 2X9XA 5L3GB 4DR7T 4AQYT 3BK9A 1U4QA 2LE8A 5AQPB 2ZM6T 1D0YA 3OVUA 3ZYMA 4HKAA 5ABFA 3MXZA 3IBPA 1HG5A 3OTOT 2PTFA 4ANJA 2X67A 3CX7B 3GMIA 3RF1A 4ZI2C 2LSYA 5E0OA 3PU8A 3LK2B 1FIOA 1HNXT 4QX7B 1XDOA 4P0BA 1T72A 2CXFA 4U2YA 3PUWF 3CKDA 1OWAA 2CEAA 1OEDB 5AQQB 1E2AA 2MYSA 5AQHB 4YJ3E 2XY8B 3R6NA 4XBFB 2WM9A 2ZMAA 1FJGT 2VQFT 4YTMA 5HEJA 2BVLA 1YXRA 4DO0A 4YSZA 2CLYC 3JC6C 2W0GA 3NVOA 5ETWA 2PG8A 4KHZF 2MBGA 3CQGB 5L3CB 3LSVA 4TV8E 1WR6A 3BQIA 2E9XA 3P4RA 2A2FX 4TWDA 1W0BA 4ILBA 3ZMZB 3AVRA 5JR9A 3UU3A 3HKEE 4IREA 3A5XA 4CI1B 2ES0A 2FBWA 4YTNA 1GQEA 1SA0E 2D0UA 3RYFE 4DV6T 2FJAA 5LHGB 5JDLA 1XZYA 3K8PC 5L3FB 2OA5A 3TLUA 3P4PA 3CPZA 5J2TE 3CMLA 3MZKB 4CN6A 3L39A 4KX6A 5L47A 1DU2A 2XAQB 4A98A 4E7ZA 5M4YA 3N2GE 1N32T 2V5CA 3V5SA 5L3EB 5AQUB 4NXNT 4BAYB 5AQMB 4LF5T 2VL8A 4CZZB 2M67A 2QGSA 5JH7E 1Y64B 3AA6B 4IE6A 1IBKT 2JQQA 3E22E 4I50E 1VRBA 1WRDA 1X9BA 4YHJA 2K3WA 5LXTE 2IMLA 3EVYA 1LRZA 4KBMB 5CGMA 2HH7A 3FXDB 4MBQA 2KMFA 3PUSA 2OV9A 4C90A 3AE6A 2KLQA 3B5MA 4V1Av 4QH5A 3EUHA 2BKOA 1NENA 2M6BA 3RC3A 3VHLA 2K9AA 2RPAA 4EEBA 1MNDA 1ZP0A 1QUUA 5KMGP 4YXDA 5CJ5A 4LF8T 4LFBT 5ABGA 5EZYE 5LJMA 2DCFA 3SFEA 3MK7C 3OYXA 2DLRA 1YD8G 3ZMSB 3AEFA 4U72A 5JRCA 2WDQA 4XZCA 5IYZE 2CXDA 5JQGE 1M7KA 3SOLA 1FMVA 5LBQB 2K24A 4H9SE 1OEDC 4MLKA 4OK0A 2YN6A 2DI4A 4OYKA 2H3RA 1YKEB 2W4XA 5J0ZA 1IAPA 1KNRA 5FXXA 1FMWA 2DNXA 4UF0B 3T1YT 2C5KT 1IJ6A 2N2NA 5KDMC 4X1IE 3C51A 4PAGA 4DV3T 1HTJF 1H7CA 1YQ4A 5AQTB 4OFZA 2J47A 3LK42 2V6YA 2XQ8A 2X9HA 3EABA 4DBQA 2LLYA 3K1SA 1U5PA 5AQKB 5ABHA 2I6HA 4H63H 3CQCB 3ABVA 4JEUB 2CRBA 4PJLA 4TX5A 3RYHE 5LG4A 4JLEA 2PFVA 2YINA 2BS3A 5C3JA 1VCTA 5F3JA 2WDRA 2YKSA 4AQFC 4FI5A 3UFGA 4C91A 3PJAA 3Q9DA 4GIWA 3PUAA 4PFPA 1ZV4X 2LEHA 2EHOA 5HEGA 4CXYA 1YW0A 3C4WA 4O2BE 4U3CA 1UURA 4L5GA 5J1GA 4HWCA 2WU5A 3AEBA 3RPUA 3J9X1 4LMKA 1S94A 2XQ4A 4M1PA 4DR3T 2W63A 4JBWF 4B3RT 4CN4A 1UX5A 3C4XA 5JTGA 4P0AA 3FBZA 2G0UA 4H9RC 1KF6A 5A1LA 2HPLA 2MAWA 5CA1E 5LB7B 4HFHA 4F6RC 2HHHT 4GK0E 2UUAT 2A3DA 3H37A 4DR4T 1US7B 5HXRA 2X0YA 3EI0A 2Y6XA 3PV0F 5LNKA 3EHZA 4I55E 3UUBA 2QRXA 3ZLIA 2AXDS 5JREA 1NWMX 2D0TA 3RC8A 1XDPA 2XZEA 2LJLA 2VQET 1JNRA 3ANWA 4A97A 2LOPA 3PU3A 4MHCA 4ZI7E 4OX9T 4PK6A 3ZN0B 2ODUA 4KMCA 1LVFA 1HX1B 4ZI2D 4YSYA 2BDEA 4ZI3C 2YEVC 1HF8A 1N36T 2VL0A 5LGUB 4EXTA 3CWZB 2CM0A 2FJEA 3GA8A 4PNIA 4X64T 2YDQA 3PDYA 2CWYA 3VRAA 4J2CA 2NTXA 2X0HA 3H3AA 5JDHA 3JAEA 4ZS2A 1IZNB 3EDVA 5LP6E 3K3OA 3JC6D 1R8IA 3GN5B 2QA7A 4X5TA 4JI8T 1QSDA 3F31A 4B3MT 4O4HE 4QH1A 1D1BA 4NXMT 3FZHB 2XAFB 3OPCA 4UR9A 4YLHA 1IJ5A 3IF8B 3IHRA 1T7SA 3VRBA 2V6XA 1HFAA 1HCIA 3RIAA 3FZKB 4IE5A 4DMWA 5CB4E 3ESLA 5JVDE 1VCSA 2X66A 4COFA 3RYIE 2RA1A 4I43B 2BVMA 3Q5DA 3WI3A 3UQ7A 3ZMUB 2XHEB 3RHWA 3AE4A 4A56A 3KINB 2UU9T 2BG9B 3KV6A 5FKYA 2CPTA 5FY0A 3RGLA 2LRKA 4HWIB 3X1DA 3HKCE 5FNVE 2IC6A 1WR0A 1Z0PA 2KT9A 5FMNA 3N2OA 4LF4T 2X68A 2A72A 4DV7T 4LFAT 3UU6A 3RRCA 1Z8UA 2LSIA 5HXEA 4JI6T 4HWDA 4IDQA 2MPKA 5EK4A 1J1JA 1N34T 2E8IA 4DV0T 2W00A 3T8OA 1IBLT 4IL4A 4ZS3A 4IDNA 4QHOA 2CXLA 3L3PA 3AB3B 2XAJB 1OEDE 4E7SA 2XASB 4AKLA 2LSKA 4EEDA 5BR8T 2NWBA 3AE2A 4DVDA 2WCAA 1WFDA 4I0UA 2C0SA 3P4SA 4KP3C 2IHR1 1ZHCA 1MIWA 3KBUA 2BBHA 3ZYKA 4DV5T 1HS7A 3KV9A 5JDNA 2XSBA 4DMVA 4BA9A 1SHZC 2J62A 3ZT6A 3AAEB 2MOZA 2CE7A 1W09A 4DR6T 2NW8A 3F2EA 4DUZT 5KX5E 5LCYA 3ZJ2A 3I9YA 3VKHA 3ZT7A 2QYWA 2C5IT 4LF9T 3RQWA 4TWHA 3K3NA 2LM9A 4HTEA 3ZMTB 1UUSA 2W67A 3RI5A 5BMVE 2X9YA 1D0XA 2W62A 4IL9A 4TNVA 3UFEA 3TLWA 2IAKA 4U7IA 1UGOA 2YDRA 1MMGA 4MFRA 5HXSA 2VVSA 4DR2T 3AE1A 1D1CA 5AQSB 2E5LT 4YFSA 4JYAT 4O2AE 2J1DG 5HCJA 3CX8B 4EYUA 3SWHA 2DHRA 3IEEA 3LK3B 5TAOA 4OHFA 3O1HA 5C2TA 3ZN1B 3AXJB 4ADZA 3KVBA 4PW8A 4NPPA 4L9IA 1MNEA 4X1YE 3UUXB 4AKRB 2I59A 1W0AA 2WQYA 2CMRA 4ZEYA 4ZZBA 2EHOD 2JRKA 2CHNA 1B7TA 4IDPA 2BG9C 2N9DA 3N2KE 3MKDA 2UXXB 5FXWA 2ACZA 2XUEA 3LG7A 2CWOA 2L9QA 3S4UA 4AXPA 2XM2A 2W61A 3AEDA 5FYMA 4JI2T 2YU1A 3L8RA 4AI6A 2X0LB 3AE8A 4DBRA 3FZMB 3AEEA 2HN2A 2A9UA 4GK5E 1NAFA 2HPJA 3ETUA 4JI3T 2K48A 3ZEFB 2FJBA 4HFCA 4ILCA 2H7OA 2JQHA 1AJ3A 5AQLB 5LMNT 4HEAA 1OEDA 3V5UA 5AQFB 2UXDT 1UK5A 4AKIA 3ZSTA 1V9DA 3ONJA 2KINB 3N9PA 5KXJA 1EZ3A 3IA3A 2R6GF 4YSXA 3Q5EA 4JI5T 2DL1A 3PTRB 3PUGA 3R84B 2NTYA 2YOEA 3WAKA 1NEKA 2ZM0A 2X51A 2Q9QB 5AQRB 1BR0A 1G73A 4ZI3D 3CQXC 3AEGA 3O1IA 2BKNA 4TV9E 5AQJB 4UXNB 5LBMA 4PJMA 3N5LA 1VOMA 1X79A 3HL6A 1HNZT 3O1JA 2UXBT 2WMOA 2W2UA 3G06A 4BJNA 4X20E 3TLSA 2D2SA 5H6QB 2WBLA 5ABFB 2VB6A 4AQFA 5AQOB 1SE7A 2B76A 4UV8B 1MMNA 3E08A 4HE8A 4DUYT 3AE5A 4GKJT 3KV4A 4NIQA 3ZYLA 4AISA 4HGAA 4F8HA 4XAXB 4CN1A 2UUCT 4DV2T 2JJ9A 3NKZA 5FL1A 5HEHA 4PK4A 3N9MA 4DIDB 3LBXA 3FZFB 1Y01A 4PJJA 2VKOA 4TN7B 3MA9A 3RIFA 1D1AA 1YQ3A 2RP4A 3VKGA 2QVAA 3A8YC 4QX8B 5HXCA 2E5VA 3RH3A 2M6IA 2DWGA 4UV9B 4H9PC 1HG2A 2N1GA 5AFUL 3L09A 3SFDA 4DV1T 4EAHA 5LOVE 2VKHA 1HR0T 1MIVA 2E9XB 4WZXA 4DR1T 4AQGA 3HA4A 4LF7T 3W15B 4WNKA 2LM2A 2ZLYA 3H3MA 2IW5B 3ZC1A 2NR4A 3M3ZB 4CXWA 4HFDA 5L4EA 1BR4A 3QOFA 5EK3A 5JR9B 1I6ZA 1J5WA 1JNZA 1CHUA 2D9DA 3AE7A 4IT4A 5HCMA 4HN9A 4EZ4A 4TUYE 2MTQA 3N9OA 2K5BB 3O4XE 2CBIA 3VR9A 4K0UA 3AEAA 4LMJA 2V7IA 4U31A 2WZIA 4YJ2E 4TZ4C 2V5DA 4WYVA 2Y8DA 5ADXL 2IUBA 5HXHA 3RKGA 4GOUA 2L3LA 5FXVA 4H9QC 4ZOLE 1BR2A 2D5UA 3TKLB 3ZKRA 4JI1T 1QLBA 4IE0A 1D0ZA 1IBMT 4G2AA 3QK6A 4UF0A 2OLTA 3N9NA 4DR5T 5AQIB 5CFBA 2Q9QC 1T8BA 1WYCA 3RIUC 3FHNA 2XQ9A 2XJ7A 2XPKA 3AVSA 3P8CD 3C4ZA 2Y48B 4JI7T 1I94T 4YTPA 5FVLA 3HKBE 3C98B 4H9OC 3NWIA 4X62T 3WAJA 2IDOB 4MALA 5DQWA 2JMKA 4K0KT 3ZC0A 3SRZA 3PUQA 1M62A 3JAFA 4ILUA 2WAUA 2BG9E 3AA0B 5HAXA 2XAGB 2JPFA 4KUMB 3KDSE 3ZCIA 5JRCB 2VKDA 1BR1A 4JV5T 2V7MA 2LHNA 1LVKA 4IE7A 4HWHA 5L3DB 4AIUA 2BZBA 3I1AA 2VK9A 1UX4A 2C5JA 3BQKA 1XNQT 3HI2A 2XQAA 5LGTB 1MMAA 4TNWA 5GONE 3ZT5A 2WU2A 3C64A 3QNUA 5IUXA 2E2AA 1MMDA 3PURA 2ACXA 2LHRA 2NP9A 1S35A 2AE9A 3CIRA 5FY7A 2PBIA 1FEWA 5JDQA 5H6RB 3NRXA 4Q25A 4EOZB 2BS4A 2V6YB 3M65A 2YK0A 3NBXX 4WW0A 2E9XC 4Z91A 4X1KE 5DJQC 4TWFA 5FXZA 2XTLA 3N9QA 2BS2A 3ZSSA 3PUXF 5JR9C 2WWUA 4L0RA 1XMQT 2KNDA 3CK6A 5LMUT 5IHYA 2XQYA 4EZHA 2LSJA 2LSGA 4IDZA 2X9WA 2KWHA 3UU8A 3PJAJ 4YY3T 3JADA 4ZXLA 2EHOB 2XQ6A 3AE3A 3OKQA 3D0TA 1WCRA 2CA5A 4IDOA 4HFIA 5FVKA 3Q2MA 4KI0F 3JCFA 2H7VC 3UT5E 3KBTA 1KNPA 2KXPB 3GN5A 5ABEA 1XNRT 3MJXA 4O8SA 3DP7A 2FJDA 2V7JA 1MIYA 5J2UE 1L0VA 4IGUA 2WB5A 5L2LA 2UXCT 2KWIB 1WYBA 1CUNA 3TLTA 3LBXB 3GWHA 3AE9A 4YHHT 3QC9A 1ZOYA 4JUYA 3FB2A 4ASKA 4LF6T 4IHJE 1YKHB 1KFYA 4ISTA 3NZPA 3P7IA 3FXEB 1E7PA 5L4HA 3ANWB 3P4WA 3PE0A 2BKPA 2I0MA 2V7LA 1XWMA 4IIJE 2VWAA 2WWVA 2WS3A 2BG9A 4EGWA 4B6XA
chains in the Genus database with same CATH topology
4JYAT 4NXMT 4DR4T 4JI4T 4JV5T 4YY3T 2UXDT 2UUBT 2UUCT 5BR8T 4DV3T 4GKKT 4DV2T 4JI1T 3T1HT 4DR7T 4AQYT 2VQET 1IBMT 4JI5T 1N33T 4LF8T 2ZM6T 4OX9T 4DV5T 4LFBT 1XNQT 4DR5T 3OTOT 4DV6T 1J5ET 1XNRT 4DV4T 1XMOT 4X66T 4KHPT 2F4VT 2UXCT 1N36T 2UU9T 1HNXT 4DR6T 4YHHT 4DUZT 4DV1T 4LFCT 4LF6T 4JI0T 1N32T 1HR0T 4DR1T 4LF9T 4LF7T 4NXNT 4JI7T 4X64T 1I94T 5IWAT 4LF5T 4B3ST 4LF4T 4DV7T 4LFAT 4JI2T 4B3TT 1HNZT 4X62T 2UXBT 1FJGT 4DR3T 2VQFT 1IBKT 4JI6T 4B3RT 4X65T 4K0KT 1XMQT 1HNWT 4JI3T 1N34T 3T1YT 4DV0T 4JI8T 5LMUT 1IBLT 4DR2T 2E5LT 4DUYT 5LMNT 4B3MT 2HHHT 4GKJT 2UUAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA T;  4NXM T;  4DR4 T;  4JI4 T;  4JV5 T;  4YY3 T;  2UXD T;  2UUB T;  2UUC T;  5BR8 T;  4DV3 T;  4GKK T;  4DV2 T;  4JI1 T;  3T1H T;  4DR7 T;  4AQY T;  2VQE T;  1IBM T;  4JI5 T;  1N33 T;  4LF8 T;  2ZM6 T;  4OX9 T;  4DV5 T;  4LFB T;  1XNQ T;  4DR5 T;  3OTO T;  4DV6 T;  1J5E T;  1XNR T;  4DV4 T;  1XMO T;  4X66 T;  4KHP T;  2F4V T;  2UXC T;  1N36 T;  2UU9 T;  1HNX T;  4DR6 T;  4YHH T;  4DUZ T;  4DV1 T;  4LFC T;  4LF6 T;  4JI0 T;  1N32 T;  1HR0 T;  4DR1 T;  4LF9 T;  4LF7 T;  4NXN T;  4JI7 T;  4X64 T;  1I94 T;  5IWA T;  4LF5 T;  4B3S T;  4LF4 T;  4DV7 T;  4LFA T;  4JI2 T;  4B3T T;  1HNZ T;  4X62 T;  2UXB T;  1FJG T;  4DR3 T;  2VQF T;  1IBK T;  4JI6 T;  4B3R T;  4X65 T;  4K0K T;  1XMQ T;  1HNW T;  4JI3 T;  1N34 T;  3T1Y T;  4DV0 T;  4JI8 T;  5LMU T;  1IBL T;  4DR2 T;  2E5L T;  4DUY T;  5LMN T;  4B3M T;  2HHH T;  4GKJ T;  2UUA T; 
#chains in the Genus database with same CATH topology
 2JMH A;  3UUN A;  3ONL C;  4HWF A;  3Q5W A;  4PFO A;  4ZZC A;  3KV5 A;  2UUB T;  4U74 A;  4CI2 B;  3ETV A;  1UCU A;  3C50 A;  3A7M A;  3AAA B;  3K3Q C;  4N78 D;  5HWY A;  3UUM A;  2H88 A;  2JIW A;  2WP9 A;  4G63 A;  3U3I A;  4IE4 A;  2ODV A;  3ZCJ A;  5C8Y E;  2WMN A;  3QUJ A;  4UVB B;  2CHO A;  3NRY A;  3TLV A;  4HFV A;  3I0Q A;  3RKO A;  4O4I E;  2NOX A;  3VR8 A;  4DV4 T;  5AQG B;  2NW7 A;  2WZH A;  4AKG A;  2YDS A;  3QB5 A;  2UXN B;  4NUV A;  3UU5 A;  5FP3 A;  3HR0 A;  2F4V T;  1LKX A;  4LML A;  4CXX A;  3NZQ A;  3B13 A;  4JI0 T;  5HWX A;  1G8X A;  5IWA T;  4AKH A;  2J4G A;  2V8S V;  3PUZ F;  4B3T T;  3OJA A;  3DTO A;  5EK2 A;  5HYA A;  4ERR A;  1OXZ A;  2P9B A;  2KZ7 B;  2V26 A;  3Q5X A;  4UEM A;  2FUP A;  1ZEE A;  2XSA A;  4O4J E;  4PK5 A;  3QB5 K;  3U78 A;  3P50 A;  3CX6 B;  3RRW A;  2H89 A;  3EDU A;  4FJO A;  2V1D B;  2XM1 A;  3I9W A;  1HX8 A;  2IIU A;  4HFE A;  4GKK T;  3LJC A;  2EHO C;  2XAH B;  4ILA A;  5LHH B;  4U33 A;  3DJB A;  2DWK A;  4P1N A;  5F5W A;  4CI3 B;  3PUV F;  1N33 T;  4EYY R;  4EB6 E;  3OYZ A;  2XQ7 A;  5L3B B;  4WBO A;  4U7Y A;  4I4T E;  4YT0 A;  3E0Z A;  5FL0 A;  2CBJ A;  4PJN A;  3RX6 A;  1XMO T;  2LKH A;  5LYJ E;  3J7Y q;  4O4L E;  2L8K A;  2Q9Q D;  2LOS A;  4KHP T;  1W9R A;  4QH4 A;  5HEU A;  4CQI A;  4DND A;  3UQ4 A;  4ZHQ E;  4LFC T;  5JDG A;  2KSR A;  3LFM A;  3MAC A;  5AQV B;  4B3S T;  2VUR A;  2YU2 A;  3AXJ A;  1O3X A;  5JDM A;  3OBV E;  2VVN A;  3UTK A;  2CCQ A;  2LRL A;  2CLY B;  3PUY F;  4QXH B;  4EV6 A;  4X65 T;  4Z90 A;  4EIW A;  1HNW T;  3AA1 B;  5DQV A;  2W66 A;  5LGN B;  3RYC E;  5AQN B;  3KVA A;  4GYS A;  2Z6E A;  2ZM8 A;  3ZMV B;  4GYR A;  3AAI A;  1T98 A;  3BQL A;  5DAB A;  2JQ9 A;  2BBJ A;  2V7K A;  4P09 A;  2ZM2 A;  5LJN A;  4U2Z A;  3ONX A;  4Z8X A;  3ZJ1 A;  1WLX A;  4ISS A;  4QXB B;  3UU4 A;  5HEO A;  3T1H T;  2XQ5 A;  3FBL A;  4NUU A;  2GK9 A;  3CVR A;  4WBN E;  3RQU A;  5LA6 E;  4HFB A;  2NW9 A;  1J5E T;  3B57 A;  1ZKE A;  3I0O A;  3P4Q A;  2VKJ A;  2WSS V;  3EAM A;  3AA7 B;  4UEL A;  4X66 T;  5LHI B;  2XQ3 A;  2WY2 A;  1E1H B;  2HN1 A;  4UVA B;  5LG3 A;  1KNZ A;  4QWN B;  5F8P A;  2E9X D;  3F57 A;  4H63 V;  2PJQ A;  2SPC A;  4UIG A;  4QXC B;  2WDV A;  5FY1 A;  4QKN A;  2LKG A;  4OYJ A;  3ZPO A;  4BJM A;  3LDQ B;  4UVC B;  3UUL A;  2Q9Q A;  4JEH B;  4H9N C;  2JQK A;  5JDF A;  4A5X A;  3O9X A;  3KFW X;  3RIU A;  3RLF F;  2VAS A;  1KK7 A;  3FZL B;  4JI4 T;  2B1E A;  3SS1 A;  3N9L A;  3HKD E;  1KEY A;  5CA0 E;  3AEC A;  2LT3 A;  3VU7 H;  1SUM B;  2IC9 A;  2X9X A;  5L3G B;  4DR7 T;  4AQY T;  3BK9 A;  1U4Q A;  2LE8 A;  5AQP B;  2ZM6 T;  1D0Y A;  3OVU A;  3ZYM A;  4HKA A;  5ABF A;  3MXZ A;  3IBP A;  1HG5 A;  3OTO T;  2PTF A;  4ANJ A;  2X67 A;  3CX7 B;  3GMI A;  3RF1 A;  4ZI2 C;  2LSY A;  5E0O A;  3PU8 A;  3LK2 B;  1FIO A;  1HNX T;  4QX7 B;  1XDO A;  4P0B A;  1T72 A;  2CXF A;  4U2Y A;  3PUW F;  3CKD A;  1OWA A;  2CEA A;  1OED B;  5AQQ B;  1E2A A;  2MYS A;  5AQH B;  4YJ3 E;  2XY8 B;  3R6N A;  4XBF B;  2WM9 A;  2ZMA A;  1FJG T;  2VQF T;  4YTM A;  5HEJ A;  2BVL A;  1YXR A;  4DO0 A;  4YSZ A;  2CLY C;  3JC6 C;  2W0G A;  3NVO A;  5ETW A;  2PG8 A;  4KHZ F;  2MBG A;  3CQG B;  5L3C B;  3LSV A;  4TV8 E;  1WR6 A;  3BQI A;  2E9X A;  3P4R A;  2A2F X;  4TWD A;  1W0B A;  4ILB A;  3ZMZ B;  3AVR A;  5JR9 A;  3UU3 A;  3HKE E;  4IRE A;  3A5X A;  4CI1 B;  2ES0 A;  2FBW A;  4YTN A;  1GQE A;  1SA0 E;  2D0U A;  3RYF E;  4DV6 T;  2FJA A;  5LHG B;  5JDL A;  1XZY A;  3K8P C;  5L3F B;  2OA5 A;  3TLU A;  3P4P A;  3CPZ A;  5J2T E;  3CML A;  3MZK B;  4CN6 A;  3L39 A;  4KX6 A;  5L47 A;  1DU2 A;  2XAQ B;  4A98 A;  4E7Z A;  5M4Y A;  3N2G E;  1N32 T;  2V5C A;  3V5S A;  5L3E B;  5AQU B;  4NXN T;  4BAY B;  5AQM B;  4LF5 T;  2VL8 A;  4CZZ B;  2M67 A;  2QGS A;  5JH7 E;  1Y64 B;  3AA6 B;  4IE6 A;  1IBK T;  2JQQ A;  3E22 E;  4I50 E;  1VRB A;  1WRD A;  1X9B A;  4YHJ A;  2K3W A;  5LXT E;  2IML A;  3EVY A;  1LRZ A;  4KBM B;  5CGM A;  2HH7 A;  3FXD B;  4MBQ A;  2KMF A;  3PUS A;  2OV9 A;  4C90 A;  3AE6 A;  2KLQ A;  3B5M A;  4V1A v;  4QH5 A;  3EUH A;  2BKO A;  1NEN A;  2M6B A;  3RC3 A;  3VHL A;  2K9A A;  2RPA A;  4EEB A;  1MND A;  1ZP0 A;  1QUU A;  5KMG P;  4YXD A;  5CJ5 A;  4LF8 T;  4LFB T;  5ABG A;  5EZY E;  5LJM A;  2DCF A;  3SFE A;  3MK7 C;  3OYX A;  2DLR A;  1YD8 G;  3ZMS B;  3AEF A;  4U72 A;  5JRC A;  2WDQ A;  4XZC A;  5IYZ E;  2CXD A;  5JQG E;  1M7K A;  3SOL A;  1FMV A;  5LBQ B;  2K24 A;  4H9S E;  1OED C;  4MLK A;  4OK0 A;  2YN6 A;  2DI4 A;  4OYK A;  2H3R A;  1YKE B;  2W4X A;  5J0Z A;  1IAP A;  1KNR A;  5FXX A;  1FMW A;  2DNX A;  4UF0 B;  3T1Y T;  2C5K T;  1IJ6 A;  2N2N A;  5KDM C;  4X1I E;  3C51 A;  4PAG A;  4DV3 T;  1HTJ F;  1H7C A;  1YQ4 A;  5AQT B;  4OFZ A;  2J47 A;  3LK4 2;  2V6Y A;  2XQ8 A;  2X9H A;  3EAB A;  4DBQ A;  2LLY A;  3K1S A;  1U5P A;  5AQK B;  5ABH A;  2I6H A;  4H63 H;  3CQC B;  3ABV A;  4JEU B;  2CRB A;  4PJL A;  4TX5 A;  3RYH E;  5LG4 A;  4JLE A;  2PFV A;  2YIN A;  2BS3 A;  5C3J A;  1VCT A;  5F3J A;  2WDR A;  2YKS A;  4AQF C;  4FI5 A;  3UFG A;  4C91 A;  3PJA A;  3Q9D A;  4GIW A;  3PUA A;  4PFP A;  1ZV4 X;  2LEH A;  2EHO A;  5HEG A;  4CXY A;  1YW0 A;  3C4W A;  4O2B E;  4U3C A;  1UUR A;  4L5G A;  5J1G A;  4HWC A;  2WU5 A;  3AEB A;  3RPU A;  3J9X 1;  4LMK A;  1S94 A;  2XQ4 A;  4M1P A;  4DR3 T;  2W63 A;  4JBW F;  4B3R T;  4CN4 A;  1UX5 A;  3C4X A;  5JTG A;  4P0A A;  3FBZ A;  2G0U A;  4H9R C;  1KF6 A;  5A1L A;  2HPL A;  2MAW A;  5CA1 E;  5LB7 B;  4HFH A;  4F6R C;  2HHH T;  4GK0 E;  2UUA T;  2A3D A;  3H37 A;  4DR4 T;  1US7 B;  5HXR A;  2X0Y A;  3EI0 A;  2Y6X A;  3PV0 F;  5LNK A;  3EHZ A;  4I55 E;  3UUB A;  2QRX A;  3ZLI A;  2AXD S;  5JRE A;  1NWM X;  2D0T A;  3RC8 A;  1XDP A;  2XZE A;  2LJL A;  2VQE T;  1JNR A;  3ANW A;  4A97 A;  2LOP A;  3PU3 A;  4MHC A;  4ZI7 E;  4OX9 T;  4PK6 A;  3ZN0 B;  2ODU A;  4KMC A;  1LVF A;  1HX1 B;  4ZI2 D;  4YSY A;  2BDE A;  4ZI3 C;  2YEV C;  1HF8 A;  1N36 T;  2VL0 A;  5LGU B;  4EXT A;  3CWZ B;  2CM0 A;  2FJE A;  3GA8 A;  4PNI A;  4X64 T;  2YDQ A;  3PDY A;  2CWY A;  3VRA A;  4J2C A;  2NTX A;  2X0H A;  3H3A A;  5JDH A;  3JAE A;  4ZS2 A;  1IZN B;  3EDV A;  5LP6 E;  3K3O A;  3JC6 D;  1R8I A;  3GN5 B;  2QA7 A;  4X5T A;  4JI8 T;  1QSD A;  3F31 A;  4B3M T;  4O4H E;  4QH1 A;  1D1B A;  4NXM T;  3FZH B;  2XAF B;  3OPC A;  4UR9 A;  4YLH A;  1IJ5 A;  3IF8 B;  3IHR A;  1T7S A;  3VRB A;  2V6X A;  1HFA A;  1HCI A;  3RIA A;  3FZK B;  4IE5 A;  4DMW A;  5CB4 E;  3ESL A;  5JVD E;  1VCS A;  2X66 A;  4COF A;  3RYI E;  2RA1 A;  4I43 B;  2BVM A;  3Q5D A;  3WI3 A;  3UQ7 A;  3ZMU B;  2XHE B;  3RHW A;  3AE4 A;  4A56 A;  3KIN B;  2UU9 T;  2BG9 B;  3KV6 A;  5FKY A;  2CPT A;  5FY0 A;  3RGL A;  2LRK A;  4HWI B;  3X1D A;  3HKC E;  5FNV E;  2IC6 A;  1WR0 A;  1Z0P A;  2KT9 A;  5FMN A;  3N2O A;  4LF4 T;  2X68 A;  2A72 A;  4DV7 T;  4LFA T;  3UU6 A;  3RRC A;  1Z8U A;  2LSI A;  5HXE A;  4JI6 T;  4HWD A;  4IDQ A;  2MPK A;  5EK4 A;  1J1J A;  1N34 T;  2E8I A;  4DV0 T;  2W00 A;  3T8O A;  1IBL T;  4IL4 A;  4ZS3 A;  4IDN A;  4QHO A;  2CXL A;  3L3P A;  3AB3 B;  2XAJ B;  1OED E;  4E7S A;  2XAS B;  4AKL A;  2LSK A;  4EED A;  5BR8 T;  2NWB A;  3AE2 A;  4DVD A;  2WCA A;  1WFD A;  4I0U A;  2C0S A;  3P4S A;  4KP3 C;  2IHR 1;  1ZHC A;  1MIW A;  3KBU A;  2BBH A;  3ZYK A;  4DV5 T;  1HS7 A;  3KV9 A;  5JDN A;  2XSB A;  4DMV A;  4BA9 A;  1SHZ C;  2J62 A;  3ZT6 A;  3AAE B;  2MOZ A;  2CE7 A;  1W09 A;  4DR6 T;  2NW8 A;  3F2E A;  4DUZ T;  5KX5 E;  5LCY A;  3ZJ2 A;  3I9Y A;  3VKH A;  3ZT7 A;  2QYW A;  2C5I T;  4LF9 T;  3RQW A;  4TWH A;  3K3N A;  2LM9 A;  4HTE A;  3ZMT B;  1UUS A;  2W67 A;  3RI5 A;  5BMV E;  2X9Y A;  1D0X A;  2W62 A;  4IL9 A;  4TNV A;  3UFE A;  3TLW A;  2IAK A;  4U7I A;  1UGO A;  2YDR A;  1MMG A;  4MFR A;  5HXS A;  2VVS A;  4DR2 T;  3AE1 A;  1D1C A;  5AQS B;  2E5L T;  4YFS A;  4JYA T;  4O2A E;  2J1D G;  5HCJ A;  3CX8 B;  4EYU A;  3SWH A;  2DHR A;  3IEE A;  3LK3 B;  5TAO A;  4OHF A;  3O1H A;  5C2T A;  3ZN1 B;  3AXJ B;  4ADZ A;  3KVB A;  4PW8 A;  4NPP A;  4L9I A;  1MNE A;  4X1Y E;  3UUX B;  4AKR B;  2I59 A;  1W0A A;  2WQY A;  2CMR A;  4ZEY A;  4ZZB A;  2EHO D;  2JRK A;  2CHN A;  1B7T A;  4IDP A;  2BG9 C;  2N9D A;  3N2K E;  3MKD A;  2UXX B;  5FXW A;  2ACZ A;  2XUE A;  3LG7 A;  2CWO A;  2L9Q A;  3S4U A;  4AXP A;  2XM2 A;  2W61 A;  3AED A;  5FYM A;  4JI2 T;  2YU1 A;  3L8R A;  4AI6 A;  2X0L B;  3AE8 A;  4DBR A;  3FZM B;  3AEE A;  2HN2 A;  2A9U A;  4GK5 E;  1NAF A;  2HPJ A;  3ETU A;  4JI3 T;  2K48 A;  3ZEF B;  2FJB A;  4HFC A;  4ILC A;  2H7O A;  2JQH A;  1AJ3 A;  5AQL B;  5LMN T;  4HEA A;  1OED A;  3V5U A;  5AQF B;  2UXD T;  1UK5 A;  4AKI A;  3ZST A;  1V9D A;  3ONJ A;  2KIN B;  3N9P A;  5KXJ A;  1EZ3 A;  3IA3 A;  2R6G F;  4YSX A;  3Q5E A;  4JI5 T;  2DL1 A;  3PTR B;  3PUG A;  3R84 B;  2NTY A;  2YOE A;  3WAK A;  1NEK A;  2ZM0 A;  2X51 A;  2Q9Q B;  5AQR B;  1BR0 A;  1G73 A;  4ZI3 D;  3CQX C;  3AEG A;  3O1I A;  2BKN A;  4TV9 E;  5AQJ B;  4UXN B;  5LBM A;  4PJM A;  3N5L A;  1VOM A;  1X79 A;  3HL6 A;  1HNZ T;  3O1J A;  2UXB T;  2WMO A;  2W2U A;  3G06 A;  4BJN A;  4X20 E;  3TLS A;  2D2S A;  5H6Q B;  2WBL A;  5ABF B;  2VB6 A;  4AQF A;  5AQO B;  1SE7 A;  2B76 A;  4UV8 B;  1MMN A;  3E08 A;  4HE8 A;  4DUY T;  3AE5 A;  4GKJ T;  3KV4 A;  4NIQ A;  3ZYL A;  4AIS A;  4HGA A;  4F8H A;  4XAX B;  4CN1 A;  2UUC T;  4DV2 T;  2JJ9 A;  3NKZ A;  5FL1 A;  5HEH A;  4PK4 A;  3N9M A;  4DID B;  3LBX A;  3FZF B;  1Y01 A;  4PJJ A;  2VKO A;  4TN7 B;  3MA9 A;  3RIF A;  1D1A A;  1YQ3 A;  2RP4 A;  3VKG A;  2QVA A;  3A8Y C;  4QX8 B;  5HXC A;  2E5V A;  3RH3 A;  2M6I A;  2DWG A;  4UV9 B;  4H9P C;  1HG2 A;  2N1G A;  5AFU L;  3L09 A;  3SFD A;  4DV1 T;  4EAH A;  5LOV E;  2VKH A;  1HR0 T;  1MIV A;  2E9X B;  4WZX A;  4DR1 T;  4AQG A;  3HA4 A;  4LF7 T;  3W15 B;  4WNK A;  2LM2 A;  2ZLY A;  3H3M A;  2IW5 B;  3ZC1 A;  2NR4 A;  3M3Z B;  4CXW A;  4HFD A;  5L4E A;  1BR4 A;  3QOF A;  5EK3 A;  5JR9 B;  1I6Z A;  1J5W A;  1JNZ A;  1CHU A;  2D9D A;  3AE7 A;  4IT4 A;  5HCM A;  4HN9 A;  4EZ4 A;  4TUY E;  2MTQ A;  3N9O A;  2K5B B;  3O4X E;  2CBI A;  3VR9 A;  4K0U A;  3AEA A;  4LMJ A;  2V7I A;  4U31 A;  2WZI A;  4YJ2 E;  4TZ4 C;  2V5D A;  4WYV A;  2Y8D A;  5ADX L;  2IUB A;  5HXH A;  3RKG A;  4GOU A;  2L3L A;  5FXV A;  4H9Q C;  4ZOL E;  1BR2 A;  2D5U A;  3TKL B;  3ZKR A;  4JI1 T;  1QLB A;  4IE0 A;  1D0Z A;  1IBM T;  4G2A A;  3QK6 A;  4UF0 A;  2OLT A;  3N9N A;  4DR5 T;  5AQI B;  5CFB A;  2Q9Q C;  1T8B A;  1WYC A;  3RIU C;  3FHN A;  2XQ9 A;  2XJ7 A;  2XPK A;  3AVS A;  3P8C D;  3C4Z A;  2Y48 B;  4JI7 T;  1I94 T;  4YTP A;  5FVL A;  3HKB E;  3C98 B;  4H9O C;  3NWI A;  4X62 T;  3WAJ A;  2IDO B;  4MAL A;  5DQW A;  2JMK A;  4K0K T;  3ZC0 A;  3SRZ A;  3PUQ A;  1M62 A;  3JAF A;  4ILU A;  2WAU A;  2BG9 E;  3AA0 B;  5HAX A;  2XAG B;  2JPF A;  4KUM B;  3KDS E;  3ZCI A;  5JRC B;  2VKD A;  1BR1 A;  4JV5 T;  2V7M A;  2LHN A;  1LVK A;  4IE7 A;  4HWH A;  5L3D B;  4AIU A;  2BZB A;  3I1A A;  2VK9 A;  1UX4 A;  2C5J A;  3BQK A;  1XNQ T;  3HI2 A;  2XQA A;  5LGT B;  1MMA A;  4TNW A;  5GON E;  3ZT5 A;  2WU2 A;  3C64 A;  3QNU A;  5IUX A;  2E2A A;  1MMD A;  3PUR A;  2ACX A;  2LHR A;  2NP9 A;  1S35 A;  2AE9 A;  3CIR A;  5FY7 A;  2PBI A;  1FEW A;  5JDQ A;  5H6R B;  3NRX A;  4Q25 A;  4EOZ B;  2BS4 A;  2V6Y B;  3M65 A;  2YK0 A;  3NBX X;  4WW0 A;  2E9X C;  4Z91 A;  4X1K E;  5DJQ C;  4TWF A;  5FXZ A;  2XTL A;  3N9Q A;  2BS2 A;  3ZSS A;  3PUX F;  5JR9 C;  2WWU A;  4L0R A;  1XMQ T;  2KND A;  3CK6 A;  5LMU T;  5IHY A;  2XQY A;  4EZH A;  2LSJ A;  2LSG A;  4IDZ A;  2X9W A;  2KWH A;  3UU8 A;  3PJA J;  4YY3 T;  3JAD A;  4ZXL A;  2EHO B;  2XQ6 A;  3AE3 A;  3OKQ A;  3D0T A;  1WCR A;  2CA5 A;  4IDO A;  4HFI A;  5FVK A;  3Q2M A;  4KI0 F;  3JCF A;  2H7V C;  3UT5 E;  3KBT A;  1KNP A;  2KXP B;  3GN5 A;  5ABE A;  1XNR T;  3MJX A;  4O8S A;  3DP7 A;  2FJD A;  2V7J A;  1MIY A;  5J2U E;  1L0V A;  4IGU A;  2WB5 A;  5L2L A;  2UXC T;  2KWI B;  1WYB A;  1CUN A;  3TLT A;  3LBX B;  3GWH A;  3AE9 A;  4YHH T;  3QC9 A;  1ZOY A;  4JUY A;  3FB2 A;  4ASK A;  4LF6 T;  4IHJ E;  1YKH B;  1KFY A;  4IST A;  3NZP A;  3P7I A;  3FXE B;  1E7P A;  5L4H A;  3ANW B;  3P4W A;  3PE0 A;  2BKP A;  2I0M A;  2V7L A;  1XWM A;  4IIJ E;  2VWA A;  2WWV A;  2WS3 A;  2BG9 A;  4EGW A;  4B6X A; 
#chains in the Genus database with same CATH homology
 4JYA T;  4NXM T;  4DR4 T;  4JI4 T;  4JV5 T;  4YY3 T;  2UXD T;  2UUB T;  2UUC T;  5BR8 T;  4DV3 T;  4GKK T;  4DV2 T;  4JI1 T;  3T1H T;  4DR7 T;  4AQY T;  2VQE T;  1IBM T;  4JI5 T;  1N33 T;  4LF8 T;  2ZM6 T;  4OX9 T;  4DV5 T;  4LFB T;  1XNQ T;  4DR5 T;  3OTO T;  4DV6 T;  1J5E T;  1XNR T;  4DV4 T;  1XMO T;  4X66 T;  4KHP T;  2F4V T;  2UXC T;  1N36 T;  2UU9 T;  1HNX T;  4DR6 T;  4YHH T;  4DUZ T;  4DV1 T;  4LFC T;  4LF6 T;  4JI0 T;  1N32 T;  1HR0 T;  4DR1 T;  4LF9 T;  4LF7 T;  4NXN T;  4JI7 T;  4X64 T;  1I94 T;  5IWA T;  4LF5 T;  4B3S T;  4LF4 T;  4DV7 T;  4LFA T;  4JI2 T;  4B3T T;  1HNZ T;  4X62 T;  2UXB T;  1FJG T;  4DR3 T;  2VQF T;  1IBK T;  4JI6 T;  4B3R T;  4X65 T;  4K0K T;  1XMQ T;  1HNW T;  4JI3 T;  1N34 T;  3T1Y T;  4DV0 T;  4JI8 T;  5LMU T;  1IBL T;  4DR2 T;  2E5L T;  4DUY T;  5LMN T;  4B3M T;  2HHH T;  4GKJ T;  2UUA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...