4B3RT

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3rT00
2UU9T 4JI3T 1J5ET 4DV2T 4DV7T 4JI7T 4DUYT 5BR8T 4B3RT 4LF8T 4OX9T 2UUAT 5LMNT 4JI8T 1IBMT 3OTOT 4JI1T 4JI5T 3T1YT 4GKKT 2UXCT 4AQYT 1FJGT 1HNXT 4X62T 1IBLT 4DV0T 1N33T 1XMQT 4GKJT 2UUCT 4DR4T 4LFCT 2E5LT 2VQET 4KHPT 1N36T 4DUZT 1XMOT 4LF6T 2F4VT 2ZM6T 4DV3T 4X64T 4DV6T 4DR1T 1IBKT 4JI0T 1N32T 5IWAT 4B3ST 1N34T 4YY3T 4JI4T 2HHHT 4X65T 4X66T 4K0KT 1XNQT 4LF9T 4DR5T 4DR7T 4LF4T 4DR3T 4YHHT 1HNWT 4LF7T 4JYAT 4DR6T 4DR2T 2UUBT 5LMUT 4LF5T 1HR0T 1I94T 4DV1T 1XNRT 4B3MT 4NXMT 4B3TT 4LFAT 1HNZT 2UXBT 4DV4T 4DV5T 3T1HT 4NXNT 4JV5T 4JI6T 2UXDT 2VQFT 4LFBT 4JI2T
chains in the Genus database with same CATH superfamily
4DMWA 2FJDA 1J1JA 2WCAA 2DLRA 2LKHA 2WP9A 5FP3A 2QA7A 3ZN1B 4PFPA 3RRWA 2MTQA 2PG8A 5L4HA 2M6IA 3ONLC 3C51A 2H89A 4UXNB 4NUUA 5FYMA 2MYSA 2E5VA 5AQIB 4A97A 4OFZA 3EUHA 4KI0F 5JQGE 3Q9DA 2KMFA 1HTJF 4WW0A 2OLTA 3PUAA 4DV3T 2KINB 2MAWA 2ACXA 3I0QA 5HCMA 1E1HB 1YQ4A 2NW8A 2W00A 1UUSA 1S35A 2M67A 2EHOD 4YTPA 2CEAA 4DR7T 1HX1B 2XASB 2I0MA 4HKAA 3ZC0A 3AVSA 3JAFA 4O4HE 3QNUA 5HWXA 3LJCA 4XBFB 3VKGA 5JDGA 4LFAT 2UXBT 5L2LA 3P4QA 4WYVA 2FJBA 2UXDT 2GK9A 2FJAA 2H7OA 4PW8A 2Q9QB 2WQYA 2Q9QA 4E7ZA 2KXPB 5AQUB 2WZHA 1HF8A 5EK3A 4QH4A 4YT0A 1SUMB 3O4XE 2WSSV 2V8SV 3L3PA 5HEHA 4ZEYA 2PJQA 2WY2A 5LP6E 2Y6XA 2CM0A 4OYJA 4KP3C 1WLXA 1ZKEA 3NRXA 3I9YA 3HKDE 3KVBA 4HTEA 4H9RC 5JDQA 3GA8A 2CWOA 3I0OA 5HEGA 4TWHA 4I43B 1KNRA 2QGSA 2Y8DA 5C3JA 3N2GE 4ISTA 3MA9A 4LF7T 4QKNA 3ZPOA 2WS3A 5LGTB 2ZLYA 4PK4A 2J62A 4ZZCA 3E0ZA 4HFVA 2VKDA 2VKOA 2W2UA 3EI0A 4H9NC 2HH7A 2CBIA 1HG5A 4PK5A 1G8XA 2C5KT 5AQQB 1QUUA 3KFWX 5LG4A 5KDMC 5BR8T 3ZJ2A 4YSXA 5LBMA 3CWZB 2V26A 3OYXA 5H6RB 3OYZA 4QXBB 4AKIA 4IDOA 3UULA 2VASA 3AB3B 4CN4A 4DV0T 4PJMA 5HXRA 2X9YA 2H88A 3X1DA 1QLBA 2YK0A 5AQFB 3SRZA 1T7SA 1CUNA 4X1YE 1S94A 4P0AA 4EIWA 5FY0A 3MZKB 4Q25A 4IE0A 4UEMA 4ZI2D 4IDQA 5CGMA 4U7YA 2WMOA 2VK9A 4IGUA 3AVRA 3OJAA 1LVFA 4HFIA 1T98A 2W66A 2XQ5A 4DR5T 4I55E 2ZM8A 2HPLA 4UVAB 3EABA 2SPCA 2V7JA 3TLUA 1BR0A 2XSAA 2YDRA 3AAIA 4UV9B 3NBXX 3AEFA 5CFBA 1HNZT 3UQ4A 1E2AA 2NTYA 4JI6T 4QWNB 3MXZA 1UURA 2BVMA 1MIYA 1X79A 2XY8B 5LHHB 4HFHA 3RYCE 4QXCB 5AQOB 1IJ5A 4O4IE 3ZYMA 3PUZF 2HN1A 1WRDA 4YLHA 2HN2A 3BQLA 2XQAA 2WMNA 4AISA 4OK0A 1Y01A 2IAKA 3IF8B 2LOPA 2Q9QD 2IC9A 3CX8B 3DTOA 2YU2A 1U5PA 4WZXA 3UU5A 3MKDA 5FKYA 4I0UA 5LGUB 1W9RA 3J9X1 3CQGB 3RYFE 5BMVE 3UQ7A 1N34T 3JC6D 3Q5WA 2WWVA 2IIUA 1YKHB 4UVCB 4YHJA 3G06A 3O1JA 2A9UA 4EEDA 4DR3T 2NWBA 3LG7A 1D1BA 4X1KE 1E7PA 2L9QA 4CZZB 3T1HT 4JV5T 3MK7C 5DQWA 2WDQA 4LFBT 3OBVE 3AEDA 2ODVA 5FXZA 2K48A 2J4GA 4AQFC 3A8YC 3PUVF 3QB5K 1OWAA 2WU5A 2YDQA 4TWFA 3PUXF 2A2FX 3TLTA 2LKGA 2W61A 2UXCT 5HWYA 3ZJ1A 5JDLA 3VRAA 3TLWA 2R6GF 5AQTB 5AQGB 1XMQT 3AAAB 1V9DA 3ONXA 3LK42 3NVOA 2NOXA 2W62A 2PFVA 4YTMA 3ZN0B 4PAGA 5EK2A 2XHEB 3GMIA 3KV4A 2V1DB 2YINA 3PJAJ 4DV6T 5L3EB 3WI3A 4HWIB 4ILUA 3KBTA 2D0TA 4U2YA 3ZYLA 4TX5A 2VL0A 5LA6E 2X9XA 3ZLIA 2I59A 3UU6A 4WBOA 5LGNB 1UX5A 4IE7A 3RC3A 1W09A 2RPAA 5KXJA 4O8SA 4KX6A 4I4TE 3C4WA 1SHZC 4X5TA 4TUYE 3LBXB 3RC8A 2YDSA 1KNZA 3LBXA 3PU8A 3JADA 3UU8A 3AE3A 2ES0A 2V7LA 4IE5A 3R84B 2DI4A 3AEGA 4DV7T 3NZQA 3CX6B 2QVAA 2Y48B 4JI8T 1VCSA 4C91A 1H7CA 3AAEB 1UK5A 3ONJA 1YW0A 4M1PA 2CBJA 3LFMA 3KINB 2K3WA 4X20E 4TNWA 4H9PC 3IBPA 4IHJE 4TV9E 4KHPT 5ABGA 5JR9C 2VVNA 3AA1B 2LM2A 4ANJA 5ETWA 1D0ZA 2F4VT 3E08A 2ZM6T 2ODUA 4JBWF 4MBQA 3SS1A 2XQYA 2VKHA 2UXXB 2B76A 4DIDB 5AQHB 1LVKA 4JI4T 2VL8A 4U7IA 5DABA 4EOZB 3VKHA 1ZV4X 2VURA 4DR2T 2LSJA 3ABVA 2UUBT 4L5GA 1XWMA 3KBUA 2XQ4A 2IMLA 4NXMT 4HFEA 4EZHA 3M65A 4OHFA 3EDUA 5FY7A 3MJXA 5CJ5A 4UVBB 2JQHA 2JIWA 3NRYA 3PUGA 4ISSA 1YD8G 3KV9A 2KT9A 3SWHA 2XSBA 3FZHB 3PUSA 5LXTE 4EYYR 3A5XA 4AQGA 3CQCB 2LEHA 3P50A 1NEKA 3AE2A 4IE6A 2KLQA 5JDHA 2CE7A 3CVRA 4JI5T 3ZYKA 4L9IA 2VB6A 5LNKA 1HS7A 5J2UE 5AQPB 2UUCT 4DR4T 2E5LT 4TNVA 3SOLA 2LSKA 4YJ2E 5FL1A 4QXHB 3HI2A 3HKBE 2LM9A 4TV8E 2XAQB 3H3MA 3PU3A 2XQ6A 3AA6B 3P4SA 2DHRA 4ZHQE 5IWAT 1M62A 4PK6A 1U4QA 4UF0B 5J0ZA 4A56A 2D0UA 4UF0A 4EAHA 4HE8A 4J2CA 4UR9A 2KSRA 3K3QC 3V5UA 2L8KA 4LF4T 3ZT5A 2LSIA 4DR6T 3EVYA 1MMGA 2V7IA 2N2NA 3RH3A 5LJMA 3O1IA 4P09A 5FL0A 3CX7B 5C8YE 1CHUA 3GWHA 1Y64B 2N1GA 4ZS3A 5AQKB 5LJNA 1YXRA 5TAOA 3ANWB 4U3CA 4EYUA 3ETUA 3ANWA 1JNZA 1UCUA 4F6RC 2WB5A 4DV2T 3UFGA 1ZP0A 2BG9E 3LDQB 2KNDA 4GK5E 1KEYA 5JRCB 3I1AA 5L3FB 2MPKA 3RLFF 5JRCA 4PJJA 3UUBA 5J2TE 4AKLA 4IDNA 4GYSA 4F8HA 5LHIB 4AQFA 2JRKA 2VVSA 1N33T 5IYZE 3NZPA 2V6XA 3AE8A 3CIRA 4ILAA 4FI5A 1FIOA 2K9AA 4U74A 1M7KA 4E7SA 4HWFA 5L3DB 3PDYA 1N32T 4ZZBA 3QK6A 2H7VC 4JEHB 2XUEA 4HFBA 4MLKA 1QSDA 3AEEA 5F5WA 2JMHA 3PUYF 1HNWT 4H63V 5M4YA 3DP7A 4HFDA 4L0RA 3RIFA 2X66A 5AQRB 2CMRA 2WDVA 3RQUA 5CA0E 3ZT6A 1W0BA 3VHLA 3C4XA 4DNDA 2CXLA 5HXCA 3N2KE 4LMJA 2BG9C 4JLEA 3BQKA 2AXDS 2IW5B 2X0LB 4ZXLA 3L09A 3V5SA 2J47A 3K1SA 4AIUA 3P7IA 1KF6A 3AE7A 4GK0E 3QUJA 3AE9A 3FXDB 3Q5XA 1EZ3A 2XQ7A 5HYAA 2JQQA 2JQKA 4QH1A 3QC9A 3FBZA 4EGWA 4H9SE 3CQXC 1MIVA 2FBWA 4ASKA 1IZNB 3KVAA 3H3AA 1FMVA 4NPPA 1KFYA 2VWAA 3ZSTA 2LSYA 4N78D 2CHOA 4ILBA 5LCYA 5JR9B 1D1CA 3RX6A 3RF1A 3J7Yq 4MHCA 5JR9A 5AFUL 2C5JA 3ZKRA 2DWKA 2XAGB 3PUWF 1ZHCA 1VOMA 3BQIA 1BR2A 3ZEFB 3HA4A 4YY3T 5HEJA 3T8OA 4BJMA 5ABHA 4CI3B 5KX5E 3EHZA 2YN6A 2M6BA 1D0YA 4ILCA 1ZOYA 4LF9T 1B7TA 2Z6EA 5JDFA 3P4PA 5E0OA 5FXVA 5ABFB 3ZMZB 5FMNA 5ABFA 2YEVC 2OA5A 3PE0A 1IAPA 1XNRT 2IDOB 1LRZA 3E22E 4PFOA 4JI2T 5JREA 2X0YA 2UU9T 4ZOLE 4IDPA 2XPKA 5AQJB 4U72A 2WAUA 2UUAT 5LMNT 3U3IA 2JMKA 4UIGA 1WYCA 2CXFA 4BAYB 4PJNA 4GKKT 5AQLB 3RKGA 3HL6A 3BK9A 2W67A 5ADXL 1J5WA 1HFAA 5L47A 3FB2A 3UTKA 2WM9A 3D0TA 1LKXA 3RPUA 2XZEA 3FBLA 4DR1T 5GONE 1IBKT 4ZI3C 1IJ6A 3N9PA 2V7KA 3NWIA 1T8BA 4HN9A 1I6ZA 2DCFA 2BVLA 3UFEA 5LG3A 4B3ST 3LK3B 1O3XA 2X0HA 1MMAA 3HKCE 4V1Av 5LHGB 4ZI3D 5FVKA 4O4LE 4IL9A 4GIWA 1AJ3A 4UELA 4XZCA 2YOEA 4AXPA 3AE6A 4B3TT 3H37A 3N2OA 4YJ3E 3MACA 3AA0B 4EZ4A 3AE1A 4TZ4C 5FY1A 1J5ET 5AQNB 2HPJA 5J1GA 4BA9A 4IE4A 2RP4A 1OXZA 4UV8B 2LE8A 3B13A 4AI6A 1IBLT 5HCJA 5F3JA 3OKQA 4GKJT 2E9XC 5L3GB 3K3NA 5LOVE 4B6XA 5AQVB 3N9OA 2E9XD 4QX8B 4CXWA 3R6NA 4X64T 5JDNA 4ZI7E 3ESLA 4NIQA 2LT3A 5FNVE 3CKDA 3FZLB 5L4EA 2LHNA 4P0BA 4O4JE 1Z8UA 5HAXA 3PV0F 1KNPA 4B3MT 4MALA 2ZM2A 1KK7A 2LSGA 2I6HA 4TN7B 2E8IA 4C90A 1OEDE 3ZMVB 2E2AA 4AKHA 2A72A 4DUYT 3N9QA 2V5DA 3PTRB 5JDMA 1IBMT 5L3BB 1MMDA 4PNIA 2BG9B 3W15B 5JVDE 3K8PC 1FMWA 2BG9A 3CMLA 4HWCA 2EHOC 5HXHA 2VQET 2LRLA 2X9HA 3CPZA 4EB6E 4DUZT 3KDSE 2WU2A 3IA3A 2X67A 1XMOT 1SE7A 5ABEA 3AECA 2V6YB 1VRBA 5L3CB 2V6YA 1YKEB 4Z90A 3PUQA 3HKEE 4DBRA 2J1DG 3N9MA 3ZCJA 2XM2A 3F31A 4DVDA 3EAMA 3TLVA 2ACZA 3I9WA 4JYAT 2CXDA 4HFCA 2D5UA 3AXJB 1HR0T 5AQMB 5JTGA 1W0AA 3AXJA 2LOSA 1R8IA 1D0XA 2BS3A 3VR8A 1HG2A 3AEAA 1UX4A 1OEDC 4COFA 1X9BA 4X1IE 3IHRA 5AQSB 4JI3T 2V5CA 2XQ3A 3CK6A 5HEOA 1ZEEA 2CLYC 4HWHA 3AE5A 2YKSA 4O2BE 2MOZA 5FXXA 1WYBA 5IHYA 3A7MA 5H6QB 4AQYT 3RIUC 1XDPA 2JPFA 3FZFB 2H3RA 3RYHE 4YXDA 1DU2A 2WWUA 1NENA 3TLSA 3K3OA 4QX7B 3Q2MA 2XAHB 1FEWA 2QRXA 3QB5A 3PURA 3UUNA 5LYJE 2KWIB 2NW7A 2V7MA 1SA0E 4AKGA 4WNKA 3M3ZB 2JQ9A 3RKOA 2W0GA 4K0UA 4U2ZA 1MNDA 3FXEB 5FXWA 2HHHT 4CI1B 4X65T 4K0KT 3P8CD 3UUXB 5C2TA 2BS2A 2XJ7A 4CXXA 1XZYA 4YFSA 5LMUT 4LF5T 1Z0PA 5EZYE 1XDOA 2CCQA 4G2AA 4U33A 2XQ9A 3B5MA 3C50A 2BS4A 3RI5A 4DV4T 3RRCA 3AA7B 3ZMSB 3OPCA 3SFEA 1GQEA 3F57A 2NW9A 5F8PA 3SFDA 4BJNA 3ZMTB 5A1LA 3HR0A 4G63A 2LHRA 4JI7T 3C4ZA 3FHNA 4QHOA 4ZI2C 2BKPA 1T72A 4KUMB 2B1EA 5KMGP 3RHWA 5CB4E 4WBNE 4JI1T 1BR1A 3T1YT 2LJLA 4DBQA 1FJGT 4DO0A 4GOUA 4X62T 5DQVA 2BKOA 2K5BB 4EEBA 3JAEA 1HCIA 4ADZA 4GYRA 4TWDA 2BKNA 3S4UA 4A98A 2PBIA 1L0VA 2BZBA 2XAJB 3WAKA 1NWMX 2E9XB 4IL4A 5EK4A 4KMCA 2VKJA 4JEUB 3LSVA 3Q5DA 2E9XA 1MIWA 3RGLA 3ZSSA 3FZMB 3L39A 4FJOA 4EV6A 2CA5A 2FUPA 3C64A 3RQWA 3Q5EA 1XNQT 2X51A 1G73A 2CHNA 4YHHT 4H9QC 3RIAA 3TKLB 2BDEA 2IHR1 1I94T 1VCTA 4U31A 4H63H 1WR6A 3ZCIA 3WAJA 2Q9QC 4LMKA 4A5XA 1UGOA 3C98B 2A3DA 3P4WA 2D2SA 2X9WA 2RA1A 1MNEA 5IUXA 4CN1A 2WDRA 4NUVA 2WBLA 1YQ3A 3ZMUB 2DWGA 1US7B 2WZIA 4HGAA 3IEEA 3OTOT 3JC6C 4IIJE 1NAFA 5LB7B 4YSZA 4ERRA 2C5IT 4DMVA 4XAXB 3UU3A 2PTFA 3N9LA 2XTLA 1N36T 4MFRA 3VRBA 3LK2B 2EHOB 3PJAA 4LF6T 2ZM0A 3KV6A 2EHOA 4JI0T 4QH5A 3AEBA 1JNRA 3VR9A 1WCRA 3DJBA 5FVLA 2BBHA 2NP9A 4X66T 2UXNB 1MMNA 2AE9A 2JJ9A 4IREA 2KZ7B 1HX8A 5JH7E 3ZC1A 2XAFB 3OVUA 2P9BA 2CPTA 2QYWA 2L3LA 4PJLA 4DV5T 2DNXA 2G0UA 2LLYA 2XQ8A 3KV5A 4OYKA 4HWDA 2VQFT 2XM1A 4CI2B 4O2AE 4AKRB 3EDVA 4IT4A 4ZS2A 1D1AA 1OEDB 5DJQC 4B3RT 4LF8T 4OX9T 3N5LA 2KWHA 3F2EA 1OEDA 2YU1A 2X68A 4YTNA 4JUYA 2IUBA 3O1HA 2ZMAA 3VU7H 2BBJA 1HNXT 1WR0A 2CLYB 3UUMA 4LFCT 3RYIE 2N9DA 5HEUA 4CN6A 5LBQB 4CQIA 2CRBA 1WFDA 3ETVA 3RIUA 5HXSA 2K24A 3B57A 4P1NA 2NR4A 2C0SA 2MBGA 1BR4A 2NTXA 2W4XA 2OV9A 2IC6A 3O9XA 4KHZF 2CWYA 4YSYA 3UT5E 3UU4A 3GN5B 3FZKB 4Z91A 3GN5A 3QOFA 4CXYA 2D9DA 3P4RA 5CA1E 3L8RA 3AE4A 4I50E 2LRKA 4DV1T 3U78A 2W63A 4IDZA 4LMLA 4HEAA 3N9NA 5HXEA 4Z8XA 3JCFA 4KBMB 4EXTA 4NXNT 3ZT7A 2FJEA 4H9OC 3NKZA 2DL1A
chains in the Genus database with same CATH topology
2UU9T 4JI3T 1J5ET 4DV2T 4DV7T 4JI7T 4DUYT 5BR8T 4B3RT 4LF8T 4OX9T 2UUAT 5LMNT 4JI8T 1IBMT 3OTOT 4JI1T 4JI5T 3T1YT 4GKKT 2UXCT 4AQYT 1FJGT 1HNXT 4X62T 1IBLT 4DV0T 1N33T 1XMQT 4GKJT 2UUCT 4DR4T 4LFCT 2E5LT 2VQET 4KHPT 1N36T 4DUZT 1XMOT 4LF6T 2F4VT 2ZM6T 4DV3T 4X64T 4DV6T 4DR1T 1IBKT 4JI0T 1N32T 5IWAT 4B3ST 1N34T 4YY3T 4JI4T 2HHHT 4X65T 4X66T 4K0KT 1XNQT 4LF9T 4DR5T 4DR7T 4LF4T 4DR3T 4YHHT 1HNWT 4LF7T 4JYAT 4DR6T 4DR2T 2UUBT 5LMUT 4LF5T 1HR0T 1I94T 4DV1T 1XNRT 4B3MT 4NXMT 4B3TT 4LFAT 1HNZT 2UXBT 4DV4T 4DV5T 3T1HT 4NXNT 4JV5T 4JI6T 2UXDT 2VQFT 4LFBT 4JI2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  4JI3 T;  1J5E T;  4DV2 T;  4DV7 T;  4JI7 T;  4DUY T;  5BR8 T;  4B3R T;  4LF8 T;  4OX9 T;  2UUA T;  5LMN T;  4JI8 T;  1IBM T;  3OTO T;  4JI1 T;  4JI5 T;  3T1Y T;  4GKK T;  2UXC T;  4AQY T;  1FJG T;  1HNX T;  4X62 T;  1IBL T;  4DV0 T;  1N33 T;  1XMQ T;  4GKJ T;  2UUC T;  4DR4 T;  4LFC T;  2E5L T;  2VQE T;  4KHP T;  1N36 T;  4DUZ T;  1XMO T;  4LF6 T;  2F4V T;  2ZM6 T;  4DV3 T;  4X64 T;  4DV6 T;  4DR1 T;  1IBK T;  4JI0 T;  1N32 T;  5IWA T;  4B3S T;  1N34 T;  4YY3 T;  4JI4 T;  2HHH T;  4X65 T;  4X66 T;  4K0K T;  1XNQ T;  4LF9 T;  4DR5 T;  4DR7 T;  4LF4 T;  4DR3 T;  4YHH T;  1HNW T;  4LF7 T;  4JYA T;  4DR6 T;  4DR2 T;  2UUB T;  5LMU T;  4LF5 T;  1HR0 T;  1I94 T;  4DV1 T;  1XNR T;  4B3M T;  4NXM T;  4B3T T;  4LFA T;  1HNZ T;  2UXB T;  4DV4 T;  4DV5 T;  3T1H T;  4NXN T;  4JV5 T;  4JI6 T;  2UXD T;  2VQF T;  4LFB T;  4JI2 T; 
#chains in the Genus database with same CATH topology
 4DMW A;  2FJD A;  1J1J A;  2WCA A;  2DLR A;  2LKH A;  2WP9 A;  5FP3 A;  2QA7 A;  3ZN1 B;  4PFP A;  3RRW A;  2MTQ A;  2PG8 A;  5L4H A;  2M6I A;  3ONL C;  3C51 A;  2H89 A;  4UXN B;  4NUU A;  5FYM A;  2MYS A;  2E5V A;  5AQI B;  4A97 A;  4OFZ A;  3EUH A;  4KI0 F;  5JQG E;  3Q9D A;  2KMF A;  1HTJ F;  4WW0 A;  2OLT A;  3PUA A;  4DV3 T;  2KIN B;  2MAW A;  2ACX A;  3I0Q A;  5HCM A;  1E1H B;  1YQ4 A;  2NW8 A;  2W00 A;  1UUS A;  1S35 A;  2M67 A;  2EHO D;  4YTP A;  2CEA A;  4DR7 T;  1HX1 B;  2XAS B;  2I0M A;  4HKA A;  3ZC0 A;  3AVS A;  3JAF A;  4O4H E;  3QNU A;  5HWX A;  3LJC A;  4XBF B;  3VKG A;  5JDG A;  4LFA T;  2UXB T;  5L2L A;  3P4Q A;  4WYV A;  2FJB A;  2UXD T;  2GK9 A;  2FJA A;  2H7O A;  4PW8 A;  2Q9Q B;  2WQY A;  2Q9Q A;  4E7Z A;  2KXP B;  5AQU B;  2WZH A;  1HF8 A;  5EK3 A;  4QH4 A;  4YT0 A;  1SUM B;  3O4X E;  2WSS V;  2V8S V;  3L3P A;  5HEH A;  4ZEY A;  2PJQ A;  2WY2 A;  5LP6 E;  2Y6X A;  2CM0 A;  4OYJ A;  4KP3 C;  1WLX A;  1ZKE A;  3NRX A;  3I9Y A;  3HKD E;  3KVB A;  4HTE A;  4H9R C;  5JDQ A;  3GA8 A;  2CWO A;  3I0O A;  5HEG A;  4TWH A;  4I43 B;  1KNR A;  2QGS A;  2Y8D A;  5C3J A;  3N2G E;  4IST A;  3MA9 A;  4LF7 T;  4QKN A;  3ZPO A;  2WS3 A;  5LGT B;  2ZLY A;  4PK4 A;  2J62 A;  4ZZC A;  3E0Z A;  4HFV A;  2VKD A;  2VKO A;  2W2U A;  3EI0 A;  4H9N C;  2HH7 A;  2CBI A;  1HG5 A;  4PK5 A;  1G8X A;  2C5K T;  5AQQ B;  1QUU A;  3KFW X;  5LG4 A;  5KDM C;  5BR8 T;  3ZJ2 A;  4YSX A;  5LBM A;  3CWZ B;  2V26 A;  3OYX A;  5H6R B;  3OYZ A;  4QXB B;  4AKI A;  4IDO A;  3UUL A;  2VAS A;  3AB3 B;  4CN4 A;  4DV0 T;  4PJM A;  5HXR A;  2X9Y A;  2H88 A;  3X1D A;  1QLB A;  2YK0 A;  5AQF B;  3SRZ A;  1T7S A;  1CUN A;  4X1Y E;  1S94 A;  4P0A A;  4EIW A;  5FY0 A;  3MZK B;  4Q25 A;  4IE0 A;  4UEM A;  4ZI2 D;  4IDQ A;  5CGM A;  4U7Y A;  2WMO A;  2VK9 A;  4IGU A;  3AVR A;  3OJA A;  1LVF A;  4HFI A;  1T98 A;  2W66 A;  2XQ5 A;  4DR5 T;  4I55 E;  2ZM8 A;  2HPL A;  4UVA B;  3EAB A;  2SPC A;  2V7J A;  3TLU A;  1BR0 A;  2XSA A;  2YDR A;  3AAI A;  4UV9 B;  3NBX X;  3AEF A;  5CFB A;  1HNZ T;  3UQ4 A;  1E2A A;  2NTY A;  4JI6 T;  4QWN B;  3MXZ A;  1UUR A;  2BVM A;  1MIY A;  1X79 A;  2XY8 B;  5LHH B;  4HFH A;  3RYC E;  4QXC B;  5AQO B;  1IJ5 A;  4O4I E;  3ZYM A;  3PUZ F;  2HN1 A;  1WRD A;  4YLH A;  2HN2 A;  3BQL A;  2XQA A;  2WMN A;  4AIS A;  4OK0 A;  1Y01 A;  2IAK A;  3IF8 B;  2LOP A;  2Q9Q D;  2IC9 A;  3CX8 B;  3DTO A;  2YU2 A;  1U5P A;  4WZX A;  3UU5 A;  3MKD A;  5FKY A;  4I0U A;  5LGU B;  1W9R A;  3J9X 1;  3CQG B;  3RYF E;  5BMV E;  3UQ7 A;  1N34 T;  3JC6 D;  3Q5W A;  2WWV A;  2IIU A;  1YKH B;  4UVC B;  4YHJ A;  3G06 A;  3O1J A;  2A9U A;  4EED A;  4DR3 T;  2NWB A;  3LG7 A;  1D1B A;  4X1K E;  1E7P A;  2L9Q A;  4CZZ B;  3T1H T;  4JV5 T;  3MK7 C;  5DQW A;  2WDQ A;  4LFB T;  3OBV E;  3AED A;  2ODV A;  5FXZ A;  2K48 A;  2J4G A;  4AQF C;  3A8Y C;  3PUV F;  3QB5 K;  1OWA A;  2WU5 A;  2YDQ A;  4TWF A;  3PUX F;  2A2F X;  3TLT A;  2LKG A;  2W61 A;  2UXC T;  5HWY A;  3ZJ1 A;  5JDL A;  3VRA A;  3TLW A;  2R6G F;  5AQT B;  5AQG B;  1XMQ T;  3AAA B;  1V9D A;  3ONX A;  3LK4 2;  3NVO A;  2NOX A;  2W62 A;  2PFV A;  4YTM A;  3ZN0 B;  4PAG A;  5EK2 A;  2XHE B;  3GMI A;  3KV4 A;  2V1D B;  2YIN A;  3PJA J;  4DV6 T;  5L3E B;  3WI3 A;  4HWI B;  4ILU A;  3KBT A;  2D0T A;  4U2Y A;  3ZYL A;  4TX5 A;  2VL0 A;  5LA6 E;  2X9X A;  3ZLI A;  2I59 A;  3UU6 A;  4WBO A;  5LGN B;  1UX5 A;  4IE7 A;  3RC3 A;  1W09 A;  2RPA A;  5KXJ A;  4O8S A;  4KX6 A;  4I4T E;  3C4W A;  1SHZ C;  4X5T A;  4TUY E;  3LBX B;  3RC8 A;  2YDS A;  1KNZ A;  3LBX A;  3PU8 A;  3JAD A;  3UU8 A;  3AE3 A;  2ES0 A;  2V7L A;  4IE5 A;  3R84 B;  2DI4 A;  3AEG A;  4DV7 T;  3NZQ A;  3CX6 B;  2QVA A;  2Y48 B;  4JI8 T;  1VCS A;  4C91 A;  1H7C A;  3AAE B;  1UK5 A;  3ONJ A;  1YW0 A;  4M1P A;  2CBJ A;  3LFM A;  3KIN B;  2K3W A;  4X20 E;  4TNW A;  4H9P C;  3IBP A;  4IHJ E;  4TV9 E;  4KHP T;  5ABG A;  5JR9 C;  2VVN A;  3AA1 B;  2LM2 A;  4ANJ A;  5ETW A;  1D0Z A;  2F4V T;  3E08 A;  2ZM6 T;  2ODU A;  4JBW F;  4MBQ A;  3SS1 A;  2XQY A;  2VKH A;  2UXX B;  2B76 A;  4DID B;  5AQH B;  1LVK A;  4JI4 T;  2VL8 A;  4U7I A;  5DAB A;  4EOZ B;  3VKH A;  1ZV4 X;  2VUR A;  4DR2 T;  2LSJ A;  3ABV A;  2UUB T;  4L5G A;  1XWM A;  3KBU A;  2XQ4 A;  2IML A;  4NXM T;  4HFE A;  4EZH A;  3M65 A;  4OHF A;  3EDU A;  5FY7 A;  3MJX A;  5CJ5 A;  4UVB B;  2JQH A;  2JIW A;  3NRY A;  3PUG A;  4ISS A;  1YD8 G;  3KV9 A;  2KT9 A;  3SWH A;  2XSB A;  3FZH B;  3PUS A;  5LXT E;  4EYY R;  3A5X A;  4AQG A;  3CQC B;  2LEH A;  3P50 A;  1NEK A;  3AE2 A;  4IE6 A;  2KLQ A;  5JDH A;  2CE7 A;  3CVR A;  4JI5 T;  3ZYK A;  4L9I A;  2VB6 A;  5LNK A;  1HS7 A;  5J2U E;  5AQP B;  2UUC T;  4DR4 T;  2E5L T;  4TNV A;  3SOL A;  2LSK A;  4YJ2 E;  5FL1 A;  4QXH B;  3HI2 A;  3HKB E;  2LM9 A;  4TV8 E;  2XAQ B;  3H3M A;  3PU3 A;  2XQ6 A;  3AA6 B;  3P4S A;  2DHR A;  4ZHQ E;  5IWA T;  1M62 A;  4PK6 A;  1U4Q A;  4UF0 B;  5J0Z A;  4A56 A;  2D0U A;  4UF0 A;  4EAH A;  4HE8 A;  4J2C A;  4UR9 A;  2KSR A;  3K3Q C;  3V5U A;  2L8K A;  4LF4 T;  3ZT5 A;  2LSI A;  4DR6 T;  3EVY A;  1MMG A;  2V7I A;  2N2N A;  3RH3 A;  5LJM A;  3O1I A;  4P09 A;  5FL0 A;  3CX7 B;  5C8Y E;  1CHU A;  3GWH A;  1Y64 B;  2N1G A;  4ZS3 A;  5AQK B;  5LJN A;  1YXR A;  5TAO A;  3ANW B;  4U3C A;  4EYU A;  3ETU A;  3ANW A;  1JNZ A;  1UCU A;  4F6R C;  2WB5 A;  4DV2 T;  3UFG A;  1ZP0 A;  2BG9 E;  3LDQ B;  2KND A;  4GK5 E;  1KEY A;  5JRC B;  3I1A A;  5L3F B;  2MPK A;  3RLF F;  5JRC A;  4PJJ A;  3UUB A;  5J2T E;  4AKL A;  4IDN A;  4GYS A;  4F8H A;  5LHI B;  4AQF A;  2JRK A;  2VVS A;  1N33 T;  5IYZ E;  3NZP A;  2V6X A;  3AE8 A;  3CIR A;  4ILA A;  4FI5 A;  1FIO A;  2K9A A;  4U74 A;  1M7K A;  4E7S A;  4HWF A;  5L3D B;  3PDY A;  1N32 T;  4ZZB A;  3QK6 A;  2H7V C;  4JEH B;  2XUE A;  4HFB A;  4MLK A;  1QSD A;  3AEE A;  5F5W A;  2JMH A;  3PUY F;  1HNW T;  4H63 V;  5M4Y A;  3DP7 A;  4HFD A;  4L0R A;  3RIF A;  2X66 A;  5AQR B;  2CMR A;  2WDV A;  3RQU A;  5CA0 E;  3ZT6 A;  1W0B A;  3VHL A;  3C4X A;  4DND A;  2CXL A;  5HXC A;  3N2K E;  4LMJ A;  2BG9 C;  4JLE A;  3BQK A;  2AXD S;  2IW5 B;  2X0L B;  4ZXL A;  3L09 A;  3V5S A;  2J47 A;  3K1S A;  4AIU A;  3P7I A;  1KF6 A;  3AE7 A;  4GK0 E;  3QUJ A;  3AE9 A;  3FXD B;  3Q5X A;  1EZ3 A;  2XQ7 A;  5HYA A;  2JQQ A;  2JQK A;  4QH1 A;  3QC9 A;  3FBZ A;  4EGW A;  4H9S E;  3CQX C;  1MIV A;  2FBW A;  4ASK A;  1IZN B;  3KVA A;  3H3A A;  1FMV A;  4NPP A;  1KFY A;  2VWA A;  3ZST A;  2LSY A;  4N78 D;  2CHO A;  4ILB A;  5LCY A;  5JR9 B;  1D1C A;  3RX6 A;  3RF1 A;  3J7Y q;  4MHC A;  5JR9 A;  5AFU L;  2C5J A;  3ZKR A;  2DWK A;  2XAG B;  3PUW F;  1ZHC A;  1VOM A;  3BQI A;  1BR2 A;  3ZEF B;  3HA4 A;  4YY3 T;  5HEJ A;  3T8O A;  4BJM A;  5ABH A;  4CI3 B;  5KX5 E;  3EHZ A;  2YN6 A;  2M6B A;  1D0Y A;  4ILC A;  1ZOY A;  4LF9 T;  1B7T A;  2Z6E A;  5JDF A;  3P4P A;  5E0O A;  5FXV A;  5ABF B;  3ZMZ B;  5FMN A;  5ABF A;  2YEV C;  2OA5 A;  3PE0 A;  1IAP A;  1XNR T;  2IDO B;  1LRZ A;  3E22 E;  4PFO A;  4JI2 T;  5JRE A;  2X0Y A;  2UU9 T;  4ZOL E;  4IDP A;  2XPK A;  5AQJ B;  4U72 A;  2WAU A;  2UUA T;  5LMN T;  3U3I A;  2JMK A;  4UIG A;  1WYC A;  2CXF A;  4BAY B;  4PJN A;  4GKK T;  5AQL B;  3RKG A;  3HL6 A;  3BK9 A;  2W67 A;  5ADX L;  1J5W A;  1HFA A;  5L47 A;  3FB2 A;  3UTK A;  2WM9 A;  3D0T A;  1LKX A;  3RPU A;  2XZE A;  3FBL A;  4DR1 T;  5GON E;  1IBK T;  4ZI3 C;  1IJ6 A;  3N9P A;  2V7K A;  3NWI A;  1T8B A;  4HN9 A;  1I6Z A;  2DCF A;  2BVL A;  3UFE A;  5LG3 A;  4B3S T;  3LK3 B;  1O3X A;  2X0H A;  1MMA A;  3HKC E;  4V1A v;  5LHG B;  4ZI3 D;  5FVK A;  4O4L E;  4IL9 A;  4GIW A;  1AJ3 A;  4UEL A;  4XZC A;  2YOE A;  4AXP A;  3AE6 A;  4B3T T;  3H37 A;  3N2O A;  4YJ3 E;  3MAC A;  3AA0 B;  4EZ4 A;  3AE1 A;  4TZ4 C;  5FY1 A;  1J5E T;  5AQN B;  2HPJ A;  5J1G A;  4BA9 A;  4IE4 A;  2RP4 A;  1OXZ A;  4UV8 B;  2LE8 A;  3B13 A;  4AI6 A;  1IBL T;  5HCJ A;  5F3J A;  3OKQ A;  4GKJ T;  2E9X C;  5L3G B;  3K3N A;  5LOV E;  4B6X A;  5AQV B;  3N9O A;  2E9X D;  4QX8 B;  4CXW A;  3R6N A;  4X64 T;  5JDN A;  4ZI7 E;  3ESL A;  4NIQ A;  2LT3 A;  5FNV E;  3CKD A;  3FZL B;  5L4E A;  2LHN A;  4P0B A;  4O4J E;  1Z8U A;  5HAX A;  3PV0 F;  1KNP A;  4B3M T;  4MAL A;  2ZM2 A;  1KK7 A;  2LSG A;  2I6H A;  4TN7 B;  2E8I A;  4C90 A;  1OED E;  3ZMV B;  2E2A A;  4AKH A;  2A72 A;  4DUY T;  3N9Q A;  2V5D A;  3PTR B;  5JDM A;  1IBM T;  5L3B B;  1MMD A;  4PNI A;  2BG9 B;  3W15 B;  5JVD E;  3K8P C;  1FMW A;  2BG9 A;  3CML A;  4HWC A;  2EHO C;  5HXH A;  2VQE T;  2LRL A;  2X9H A;  3CPZ A;  4EB6 E;  4DUZ T;  3KDS E;  2WU2 A;  3IA3 A;  2X67 A;  1XMO T;  1SE7 A;  5ABE A;  3AEC A;  2V6Y B;  1VRB A;  5L3C B;  2V6Y A;  1YKE B;  4Z90 A;  3PUQ A;  3HKE E;  4DBR A;  2J1D G;  3N9M A;  3ZCJ A;  2XM2 A;  3F31 A;  4DVD A;  3EAM A;  3TLV A;  2ACZ A;  3I9W A;  4JYA T;  2CXD A;  4HFC A;  2D5U A;  3AXJ B;  1HR0 T;  5AQM B;  5JTG A;  1W0A A;  3AXJ A;  2LOS A;  1R8I A;  1D0X A;  2BS3 A;  3VR8 A;  1HG2 A;  3AEA A;  1UX4 A;  1OED C;  4COF A;  1X9B A;  4X1I E;  3IHR A;  5AQS B;  4JI3 T;  2V5C A;  2XQ3 A;  3CK6 A;  5HEO A;  1ZEE A;  2CLY C;  4HWH A;  3AE5 A;  2YKS A;  4O2B E;  2MOZ A;  5FXX A;  1WYB A;  5IHY A;  3A7M A;  5H6Q B;  4AQY T;  3RIU C;  1XDP A;  2JPF A;  3FZF B;  2H3R A;  3RYH E;  4YXD A;  1DU2 A;  2WWU A;  1NEN A;  3TLS A;  3K3O A;  4QX7 B;  3Q2M A;  2XAH B;  1FEW A;  2QRX A;  3QB5 A;  3PUR A;  3UUN A;  5LYJ E;  2KWI B;  2NW7 A;  2V7M A;  1SA0 E;  4AKG A;  4WNK A;  3M3Z B;  2JQ9 A;  3RKO A;  2W0G A;  4K0U A;  4U2Z A;  1MND A;  3FXE B;  5FXW A;  2HHH T;  4CI1 B;  4X65 T;  4K0K T;  3P8C D;  3UUX B;  5C2T A;  2BS2 A;  2XJ7 A;  4CXX A;  1XZY A;  4YFS A;  5LMU T;  4LF5 T;  1Z0P A;  5EZY E;  1XDO A;  2CCQ A;  4G2A A;  4U33 A;  2XQ9 A;  3B5M A;  3C50 A;  2BS4 A;  3RI5 A;  4DV4 T;  3RRC A;  3AA7 B;  3ZMS B;  3OPC A;  3SFE A;  1GQE A;  3F57 A;  2NW9 A;  5F8P A;  3SFD A;  4BJN A;  3ZMT B;  5A1L A;  3HR0 A;  4G63 A;  2LHR A;  4JI7 T;  3C4Z A;  3FHN A;  4QHO A;  4ZI2 C;  2BKP A;  1T72 A;  4KUM B;  2B1E A;  5KMG P;  3RHW A;  5CB4 E;  4WBN E;  4JI1 T;  1BR1 A;  3T1Y T;  2LJL A;  4DBQ A;  1FJG T;  4DO0 A;  4GOU A;  4X62 T;  5DQV A;  2BKO A;  2K5B B;  4EEB A;  3JAE A;  1HCI A;  4ADZ A;  4GYR A;  4TWD A;  2BKN A;  3S4U A;  4A98 A;  2PBI A;  1L0V A;  2BZB A;  2XAJ B;  3WAK A;  1NWM X;  2E9X B;  4IL4 A;  5EK4 A;  4KMC A;  2VKJ A;  4JEU B;  3LSV A;  3Q5D A;  2E9X A;  1MIW A;  3RGL A;  3ZSS A;  3FZM B;  3L39 A;  4FJO A;  4EV6 A;  2CA5 A;  2FUP A;  3C64 A;  3RQW A;  3Q5E A;  1XNQ T;  2X51 A;  1G73 A;  2CHN A;  4YHH T;  4H9Q C;  3RIA A;  3TKL B;  2BDE A;  2IHR 1;  1I94 T;  1VCT A;  4U31 A;  4H63 H;  1WR6 A;  3ZCI A;  3WAJ A;  2Q9Q C;  4LMK A;  4A5X A;  1UGO A;  3C98 B;  2A3D A;  3P4W A;  2D2S A;  2X9W A;  2RA1 A;  1MNE A;  5IUX A;  4CN1 A;  2WDR A;  4NUV A;  2WBL A;  1YQ3 A;  3ZMU B;  2DWG A;  1US7 B;  2WZI A;  4HGA A;  3IEE A;  3OTO T;  3JC6 C;  4IIJ E;  1NAF A;  5LB7 B;  4YSZ A;  4ERR A;  2C5I T;  4DMV A;  4XAX B;  3UU3 A;  2PTF A;  3N9L A;  2XTL A;  1N36 T;  4MFR A;  3VRB A;  3LK2 B;  2EHO B;  3PJA A;  4LF6 T;  2ZM0 A;  3KV6 A;  2EHO A;  4JI0 T;  4QH5 A;  3AEB A;  1JNR A;  3VR9 A;  1WCR A;  3DJB A;  5FVL A;  2BBH A;  2NP9 A;  4X66 T;  2UXN B;  1MMN A;  2AE9 A;  2JJ9 A;  4IRE A;  2KZ7 B;  1HX8 A;  5JH7 E;  3ZC1 A;  2XAF B;  3OVU A;  2P9B A;  2CPT A;  2QYW A;  2L3L A;  4PJL A;  4DV5 T;  2DNX A;  2G0U A;  2LLY A;  2XQ8 A;  3KV5 A;  4OYK A;  4HWD A;  2VQF T;  2XM1 A;  4CI2 B;  4O2A E;  4AKR B;  3EDV A;  4IT4 A;  4ZS2 A;  1D1A A;  1OED B;  5DJQ C;  4B3R T;  4LF8 T;  4OX9 T;  3N5L A;  2KWH A;  3F2E A;  1OED A;  2YU1 A;  2X68 A;  4YTN A;  4JUY A;  2IUB A;  3O1H A;  2ZMA A;  3VU7 H;  2BBJ A;  1HNX T;  1WR0 A;  2CLY B;  3UUM A;  4LFC T;  3RYI E;  2N9D A;  5HEU A;  4CN6 A;  5LBQ B;  4CQI A;  2CRB A;  1WFD A;  3ETV A;  3RIU A;  5HXS A;  2K24 A;  3B57 A;  4P1N A;  2NR4 A;  2C0S A;  2MBG A;  1BR4 A;  2NTX A;  2W4X A;  2OV9 A;  2IC6 A;  3O9X A;  4KHZ F;  2CWY A;  4YSY A;  3UT5 E;  3UU4 A;  3GN5 B;  3FZK B;  4Z91 A;  3GN5 A;  3QOF A;  4CXY A;  2D9D A;  3P4R A;  5CA1 E;  3L8R A;  3AE4 A;  4I50 E;  2LRK A;  4DV1 T;  3U78 A;  2W63 A;  4IDZ A;  4LML A;  4HEA A;  3N9N A;  5HXE A;  4Z8X A;  3JCF A;  4KBM B;  4EXT A;  4NXN T;  3ZT7 A;  2FJE A;  4H9O C;  3NKZ A;  2DL1 A; 
#chains in the Genus database with same CATH homology
 2UU9 T;  4JI3 T;  1J5E T;  4DV2 T;  4DV7 T;  4JI7 T;  4DUY T;  5BR8 T;  4B3R T;  4LF8 T;  4OX9 T;  2UUA T;  5LMN T;  4JI8 T;  1IBM T;  3OTO T;  4JI1 T;  4JI5 T;  3T1Y T;  4GKK T;  2UXC T;  4AQY T;  1FJG T;  1HNX T;  4X62 T;  1IBL T;  4DV0 T;  1N33 T;  1XMQ T;  4GKJ T;  2UUC T;  4DR4 T;  4LFC T;  2E5L T;  2VQE T;  4KHP T;  1N36 T;  4DUZ T;  1XMO T;  4LF6 T;  2F4V T;  2ZM6 T;  4DV3 T;  4X64 T;  4DV6 T;  4DR1 T;  1IBK T;  4JI0 T;  1N32 T;  5IWA T;  4B3S T;  1N34 T;  4YY3 T;  4JI4 T;  2HHH T;  4X65 T;  4X66 T;  4K0K T;  1XNQ T;  4LF9 T;  4DR5 T;  4DR7 T;  4LF4 T;  4DR3 T;  4YHH T;  1HNW T;  4LF7 T;  4JYA T;  4DR6 T;  4DR2 T;  2UUB T;  5LMU T;  4LF5 T;  1HR0 T;  1I94 T;  4DV1 T;  1XNR T;  4B3M T;  4NXM T;  4B3T T;  4LFA T;  1HNZ T;  2UXB T;  4DV4 T;  4DV5 T;  3T1H T;  4NXN T;  4JV5 T;  4JI6 T;  2UXD T;  2VQF T;  4LFB T;  4JI2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...