4B3RT

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3rT00
4JI3T 1IBLT 4X66T 4X62T 4B3TT 5LMUT 4DV6T 4DR1T 1XMQT 1N33T 4JI7T 3OTOT 4JI6T 4JI2T 4JI4T 4K0KT 2UUBT 4JV5T 3T1HT 4DV4T 2F4VT 4JI5T 5BR8T 3T1YT 4GKKT 1N32T 1FJGT 4AQYT 4DUZT 5IWAT 1N36T 2UXCT 4YY3T 4DR3T 4LF4T 5LMNT 4JI1T 2VQFT 4LFCT 4X64T 1N34T 4DR5T 2UXDT 4KHPT 4OX9T 2UUCT 4GKJT 4B3ST 4LF5T 1HNWT 4NXMT 4B3MT 4X65T 4LF9T 4DUYT 4JI0T 1J5ET 1XNRT 2ZM6T 4LFAT 4DV7T 4DV1T 4LFBT 4YHHT 1I94T 4DV0T 1HNXT 1XMOT 2HHHT 4DV3T 4NXNT 4DR7T 4JI8T 1HNZT 4DR6T 4JYAT 1HR0T 4DV5T 4DR4T 2UUAT 1IBMT 1XNQT 2E5LT 4LF8T 4LF7T 2UU9T 4B3RT 4DV2T 2UXBT 2VQET 4DR2T 4LF6T 1IBKT
chains in the Genus database with same CATH superfamily
4UELA 1MMAA 3ONJA 4M1PA 3PUZF 2V26A 3ZCIA 4O4HE 4CQIA 2BS4A 3VR8A 5JREA 4QXBB 4KUMB 2D2SA 4GKKT 1G73A 1FJGT 2LJLA 1WYCA 2LEHA 3QC9A 3RYHE 3RX6A 3AE5A 3P4WA 3UUMA 2AXDS 2UXDT 1IZNB 2IAKA 2QA7A 3OKQA 2E9XD 4ZI3C 2GK9A 4EB6E 3R84B 4OK0A 4YTNA 3AEGA 2RA1A 4HWCA 4Z8XA 1WR0A 3FZFB 2MAWA 4LFAT 3SFEA 2DL1A 5C3JA 5JVDE 4LFBT 4PJNA 3H3AA 4ZZCA 3LJCA 3PU3A 4DV3T 4P0AA 4AQGA 2CBJA 4HKAA 3PU8A 3PUXF 4EYUA 5HXCA 4UXNB 4UF0A 1XNQT 1QLBA 5HXSA 2VVNA 2UU9T 3AEFA 4DV2T 4A5XA 5LHIB 5L3EB 4E7ZA 2BVMA 4X1YE 1YKHB 4HN9A 2IC6A 2LM9A 2N2NA 5EZYE 1YKEB 3NVOA 3PUQA 2PG8A 2WSSV 1HG5A 2V7KA 2WS3A 3P8CD 1ZKEA 2XJ7A 2N9DA 2ACZA 2NTXA 4TWHA 4P0BA 4DBQA 1D1BA 4EZHA 3Q2MA 2ZM2A 4PFPA 3GA8A 4A56A 5JRCA 4ILAA 3O1JA 4KMCA 3VRBA 2KXPB 3WI3A 4HWHA 5JR9A 1VCSA 4BJNA 3E22E 3EUHA 2XUEA 1Z8UA 3PURA 4UV9B 2BKOA 5JDFA 4UF0B 2W2UA 5F5WA 1G8XA 3RIFA 4QXCB 2JPFA 4IREA 2X9HA 2BBHA 1HG2A 3N2GE 2SPCA 3I1AA 5LHGB 1UCUA 4TX5A 3LK42 2BG9B 1W0BA 3DJBA 2A2FX 2FJDA 3HKBE 5DABA 5FL0A 5LOVE 3AVRA 3KV6A 4WBNE 2RP4A 3CKDA 1NWMX 3AEBA 2CEAA 2X9XA 4HFBA 5JRCB 2ODVA 2CHNA 3QUJA 1BR4A 2WAUA 1UURA 4HGAA 4N78D 2KLQA 2NW8A 4MBQA 3JADA 4X1IE 5ETWA 3UQ4A 4IGUA 3S4UA 1OEDE 4U72A 2WDQA 4ZS2A 2Z6EA 3FZMB 4PW8A 3ZMZB 4NUVA 4HWIB 2CLYB 1MNEA 4DV4T 4G63A 3N5LA 3LG7A 4KHZF 1UX4A 4QWNB 3ZJ1A 5LGNB 4H9SE 4QH4A 5LBQB 3ZC1A 2CXLA 2VVSA 5JDQA 2IUBA 2D9DA 5L3DB 4GYRA 3NZQA 3QK6A 2LSIA 3SRZA 1D1CA 2EHOD 1FMVA 2UXXB 4PK5A 2V1DB 2XASB 4EGWA 2IDOB 4CZZB 2DNXA 3MJXA 4PNIA 4OHFA 4TNVA 2PBIA 3JCFA 4YSYA 4CXXA 4JYAT 1XZYA 3HI2A 2W62A 3LDQB 2K48A 3RYIE 4CI2B 4HFHA 3L09A 3W15B 3IBPA 2XQAA 4LF6T 4XBFB 2WB5A 4EIWA 1NENA 5HCJA 2XQ9A 2WU2A 3AAIA 4JI3T 4EAHA 3D0TA 2V7LA 3HL6A 2YDQA 3EDVA 3L39A 2KT9A 5LGTB 1B7TA 4JI7T 3Q9DA 3OTOT 4AISA 2LT3A 4ERRA 2M67A 1ZEEA 4IDPA 3T1HT 3RF1A 1UUSA 3RKGA 5AQVB 5FY1A 4C90A 4IDZA 2LM2A 5HEHA 2AE9A 4AI6A 3C51A 4I55E 4WNKA 5DQVA 4OX9T 2D0TA 3PUAA 3LK3B 4JEHB 3RI5A 2X51A 1QSDA 1S94A 4QX8B 3RQWA 4DV7T 3EI0A 2JQHA 1ZHCA 2XM1A 2HHHT 4YSXA 2V6YB 3PUGA 2NW9A 5L4EA 2BDEA 2LOPA 4TUYE 5JTGA 4PJMA 2A3DA 2P9BA 4B3RT 4H9OC 4TWDA 1WCRA 2H3RA 2W61A 5FKYA 2H7VC 2MTQA 3ZCJA 1ZV4X 4A97A 1IBLT 2WBLA 4IE0A 5GONE 4FI5A 1O3XA 5HXEA 4JBWF 4EOZB 3UUBA 4IL9A 3F31A 1XMQT 3VU7H 5LJMA 5IHYA 3NRXA 4HEAA 4H9QC 2I59A 3EABA 3F2EA 2E2AA 1YQ3A 3ZEFB 3OBVE 5KX5E 4I50E 2BG9C 2K5BB 4X5TA 4IL4A 4DR3T 2OV9A 3ZYMA 2H89A 3UULA 4UIGA 3KBUA 4X64T 2VB6A 5EK3A 5AQRB 4KHPT 2CHOA 4FJOA 3AVSA 4UV8B 3IHRA 2K3WA 3P4PA 4AQFC 2WWVA 1NAFA 2XTLA 4O2AE 3OVUA 4OFZA 3BQIA 2WZIA 3JC6D 4TN7B 1T8BA 2XM2A 3PE0A 1I6ZA 2X9WA 2CLYC 5L3GB 4DO0A 4HFEA 4X20E 3JC6C 4ASKA 1MNDA 3AB3B 2WU5A 2LSGA 4K0UA 2V5CA 3OYZA 4X66T 2L9QA 2LHRA 4ILUA 1IJ6A 2LKGA 3N9PA 4DR1T 3CIRA 4YFSA 1T72A 2CBIA 4EYYR 2XAHB 2NP9A 3MXZA 2VKHA 2J62A 2JIWA 2X0HA 4V1Av 5H6QB 1LVKA 3PTRB 1HCIA 2W66A 4EEBA 5C8YE 4KP3C 3RH3A 1H7CA 3CPZA 5FXXA 4I4TE 5KXJA 1D0XA 4B6XA 3C4XA 4QHOA 3EDUA 5LMNT 2IHR1 3HKEE 4LFCT 1N34T 4U2YA 3N9OA 4LMJA 4I0UA 3M65A 4ZI3D 1YD8G 5HEJA 5FXVA 3PDYA 3ZT6A 1X9BA 2YU1A 5M4YA 3P4SA 3QNUA 1HNZT 3VHLA 5FP3A 1VCTA 5LCYA 1LVFA 2YK0A 5CGMA 4DV5T 3N9MA 4UVAB 2R6GF 3M3ZB 4KBMB 3V5SA 2K9AA 2LRLA 2VQET 5LXTE 5E0OA 1WYBA 1KK7A 2OLTA 5FY7A 2XQ3A 4YJ3E 4X62T 3EVYA 4F6RC 2DI4A 3RLFF 3TLUA 1N33T 3KINB 1DU2A 3K1SA 4JI2T 1IAPA 3CWZB 5L3CB 2DLRA 2W63A 3H3MA 2BG9A 3NWIA 1HF8A 2BKNA 2LSJA 1ZOYA 3H37A 3K8PC 2UXCT 4YY3T 1U5PA 5J2UE 3IF8B 3E0ZA 1VRBA 2UUCT 4GKJT 1OEDB 1E1HB 4AQFA 1T7SA 2ZMAA 1D0YA 5IYZE 4CXWA 5FVLA 3I0OA 2CWOA 2Q9QB 3HR0A 4IT4A 3N2KE 3GMIA 5JDGA 2VURA 2BKPA 1XMOT 2V7IA 2IW5B 4NXNT 3Q5XA 1W0AA 2MBGA 5FNVE 2BBJA 4LF8T 1U4QA 3ZSTA 4HFIA 2LSKA 2WZHA 3N9NA 2W4XA 3I9WA 2XAJB 3K3QC 3AE6A 5LMUT 2I0MA 2YDSA 2HN2A 4LMKA 4YLHA 3WAKA 3P50A 1SHZC 4AXPA 2UXNB 3ESLA 4JV5T 4QH1A 2WY2A 4H9NC 4IDOA 4F8HA 2KZ7B 2OA5A 1XDOA 2FUPA 3C4ZA 3E08A 3SS1A 3LSVA 4O4LE 2DHRA 3ZC0A 4BAYB 5BMVE 1GQEA 5AQMB 5AQIB 4IE4A 3UU4A 3GN5B 2XPKA 4QKNA 3TLVA 3ZT7A 3QB5A 3N9LA 4CN6A 2KWHA 4CN4A 3P4QA 1HNXT 4KI0F 4WBOA 3ZLIA 5J2TE 2X68A 2XSBA 3C98B 3N2OA 1BR2A 3RQUA 4ZS3A 4DNDA 4DMVA 3PJAA 4QX7B 5F8PA 1FEWA 3RRCA 4U33A 4ILCA 2NTYA 4DR2T 2XAGB 1HFAA 2XQ5A 1OXZA 3MK7C 3UFGA 1IBKT 5HXRA 5FYMA 1BR0A 5CA0E 3ZJ2A 3F57A 3V5UA 5L4HA 1S35A 2IMLA 5AQGB 5JDLA 2ZLYA 3PUWF 4H63H 2LKHA 3AE9A 5HYAA 2BVLA 3B57A 4JI5T 5BR8T 3AECA 4DBRA 2V6YA 5LG4A 2KMFA 4DUZT 2VKDA 4JEUB 5JDMA 1W09A 4GYSA 4UR9A 4AKIA 3UQ7A 1HX1B 4KX6A 2QRXA 3SFDA 2LE8A 5LHHB 2X0YA 3AE3A 3NKZA 3KV5A 3ZN0B 3VKHA 4L5GA 4WYVA 1KNRA 3G06A 4DV1T 5AFUL 4Z90A 4ZI2D 3KFWX 3KV4A 5HCMA 4IE7A 4Q25A 4O4IE 1Y64B 2CM0A 2HPJA 2E9XB 2UUAT 4ZI2C 2V7JA 3ZMUB 4G2AA 3ZN1B 3ZPOA 1EZ3A 2JJ9A 2X67A 4YTMA 2C5IT 4Z91A 2YEVC 4YHJA 4LMLA 4O8SA 2Q9QD 4P09A 4U31A 3AA7B 1OEDC 2KSRA 3TLTA 3CX6B 1YW0A 2Q9QC 2UUBT 2FJEA 5AQFB 1T98A 3TLSA 4EXTA 5AQLB 3RYFE 4U7IA 4AQYT 2C5JA 2VKOA 4L9IA 4E7SA 5LGUB 2I6HA 4HWFA 3ANWB 3RHWA 4X1KE 3UT5E 2VQFT 2FBWA 5AQSB 4PK6A 5HWXA 4BJMA 1YQ4A 3RIUC 1LRZA 4DIDB 4TV9E 1MMNA 1QUUA 4QXHB 2Y6XA 2YKSA 2V6XA 2JQ9A 4TNWA 3WAJA 3BQLA 3JAEA 5JH7E 2N1GA 5HXHA 2CRBA 2W00A 3C4WA 2E5LT 2JQKA 4DMWA 2FJBA 3B5MA 3UU3A 1D1AA 3MZKB 4UVBB 4ANJA 4EZ4A 3ETVA 3ONXA 2VL8A 2KWIB 5LP6E 3O4XE 5AQJB 5CFBA 2L8KA 1KF6A 2B1EA 4JI6T 2G0UA 1E7PA 4J2CA 3FHNA 2VWAA 1HS7A 2HH7A 5FVKA 1D0ZA 3RKOA 2XAFB 3ZMVB 5IWAT 5LB7B 2WP9A 3ABVA 2NOXA 4IDQA 3O9XA 4IHJE 2XQ6A 1KNPA 3ETUA 4L0RA 2WMNA 1FIOA 4CXYA 4MFRA 5FL1A 4DUYT 3ZMTB 2J47A 3O1IA 1M62A 2QYWA 3KVBA 1WLXA 4CI1B 3FXDB 2PTFA 3NBXX 2XQYA 4ZEYA 2E5VA 2V8SV 4DV0T 4BA9A 4XAXB 3ZYLA 4P1NA 4ZHQE 5LNKA 2KNDA 2V5DA 2XQ8A 2YDRA 2DCFA 1E2AA 4TWFA 2CA5A 1IBMT 2CWYA 3OJAA 3UTKA 2CMRA 3MA9A 4LF7T 3AE2A 3TKLB 2EHOB 5CJ5A 2IC9A 2C5KT 2IIUA 3FZHB 3SWHA 2XQ4A 4HWDA 3BQKA 1MIVA 2BZBA 3I9YA 1UK5A 4B3TT 1OEDA 3KBTA 4DV6T 3JAFA 3PJAJ 3X1DA 2Q9QA 4JI4T 1BR1A 2DWGA 3LBXA 4PFOA 5HEOA 4MALA 1SUMB 3T1YT 5ABHA 3KDSE 3FBZA 1LKXA 3AXJB 4WZXA 2W67A 2ZM0A 5AQTB 4LF4T 4AKHA 3ONLC 3C50A 3R6NA 2E9XC 3RIUA 3A7MA 4B3ST 4NXMT 4X65T 3NRYA 3P7IA 3QOFA 4LF9T 1WFDA 1J5ET 4OYJA 3ZMSB 3VRAA 4U7YA 2MOZA 2NWBA 1Z0PA 5EK2A 3L3PA 4TZ4C 1MIWA 2WDVA 1HR0T 3AA0B 5DJQC 3PUYF 3CX8B 4AKRB 3ZSSA 2WWUA 4MHCA 1WR6A 3LBXB 4O2BE 4YJ2E 4COFA 1XWMA 4IE5A 5JDNA 2M6BA 1JNZA 2LLYA 2PFVA 1CUNA 3AEAA 4H9RC 4ISSA 4YSZA 4GK5E 3CQCB 5KDMC 1CHUA 2JMHA 4I43B 3MACA 3GN5A 1KEYA 1MMGA 5ABFA 1ZP0A 3RC3A 4K0KT 4ILBA 3ZYKA 3IA3A 2XAQB 5AQKB 4TV8E 2X9YA 3I0QA 2FJAA 4ZI7E 4H63V 2JQQA 4YTPA 3HKCE 3AE7A 2ACXA 3RC8A 3CMLA 1AJ3A 1SA0E 4MLKA 5CA1E 4JI0T 3SOLA 1KFYA 3DTOA 2YN6A 5LJNA 3PV0F 3A5XA 2Y48B 4YHHT 5LBMA 2BS2A 4JUYA 3CQGB 3MKDA 2PJQA 2LSYA 3HA4A 2D0UA 3AAEB 3N9QA 5JR9B 1V9DA 2H88A 3Q5EA 1UGOA 5L3FB 5ABFB 4A98A 3FBLA 2WM9A 2CXFA 3OYXA 1WRDA 1US7B 5HEGA 4GIWA 3UU8A 1JNRA 5AQNB 3ZKRA 4YXDA 3FB2A 2H7OA 1FMWA 3VKGA 2VASA 3Q5WA 2YU2A 4AKLA 4PAGA 3J7Yq 2LOSA 1MMDA 3KVAA 2K24A 1OWAA 3UFEA 2M6IA 2QVAA 4U2ZA 2BG9E 5L47A 5KMGP 1N36T 2VL0A 5J1GA 3UU6A 1HTJF 2VK9A 3UU5A 2E9XA 3RGLA 3AA1B 3QB5K 3AE4A 5JDHA 2YOEA 4OYKA 2EHOC 5H6RB 2XHEB 3AE8A 1W9RA 2HPLA 2RPAA 5HEUA 4HTEA 4YT0A 1XNRT 2ZM6T 5AQOB 2XY8B 4H9PC 2ODUA 4IIJE 5C2TA 3U3IA 5A1LA 5LYJE 2J4GA 2D5UA 4HFCA 4JLEA 3EAMA 4DR6T 3GWHA 5L2LA 2CCQA 3CQXC 4C91A 3PUVF 1R8IA 2DWKA 4IE6A 3K3NA 3ANWA 2J1DG 3PUSA 2WQYA 4AIUA 3L8RA 4UEMA 2A72A 2VKJA 4U3CA 4HFDA 2Y8DA 3EHZA 5AQPB 4NUUA 4GOUA 4O4JE 2NW7A 2ZM8A 3BK9A 1X79A 1KNZA 3RYCE 2MPKA 2C0SA 2E8IA 4AKGA 1YXRA 4WW0A 3AEDA 5LG3A 3VR9A 5ABEA 2LHNA 1IJ5A 4EV6A 2XSAA 1L0VA 4PJLA 5HAXA 4JI1T 3FZKB 4DR5T 2A9UA 3DP7A 4GK0E 4B3MT 4PK4A 2NR4A 1J1JA 2YINA 4HE8A 3A8YC 4CN1A 5F3JA 3C64A 3U78A 1UX5A 1HX8A 2X66A 4NIQA 4JI8T 5FXZA 3O1HA 4ZZBA 2WDRA 2B76A 4EEDA 4XZCA 4DR4T 3T8OA 5CB4E 5ABGA 1M7KA 2QGSA 4ZOLE 1NEKA 3TLWA 3LK2B 2L3LA 3IEEA 2UXBT 2JMKA 3CVRA 3AE1A 3UUNA 4DVDA 4ISTA 5ADXL 2V7MA 2KINB 2CE7A 3NZPA 3AAAB 5EK4A 3AEEA 3FZLB 3CX7B 1MIYA 4UVCB 2CXDA 3RIAA 5L3BB 5FXWA 2XQ7A 5JQGE 2LRKA 5J0ZA 4U74A 2WMOA 3RPUA 5IUXA 2F4VT 2X0LB 2MYSA 5AQQB 4ZXLA 1N32T 3RRWA 3HKDE 1VOMA 2JRKA 3K3OA 1XDPA 3FXEB 1Y01A 5FMNA 5JR9C 3CK6A 3OPCA 3B13A 5TAOA 3J9X1 2EHOA 4LF5T 1HNWT 5DQWA 2BS3A 4HFVA 4PJJA 2HN1A 5LA6E 3UUXB 2CPTA 1J5WA 2WCAA 2ES0A 1I94T 3Q5DA 3KV9A 3P4RA 4QH5A 4ADZA 4DR7T 1SE7A 5FY0A 3ZT5A 5AQUB 4CI3B 5HWYA 2XZEA 4IDNA 3AA6B 2W0GA 3LFMA 3AXJA 5AQHB 4NPPA
chains in the Genus database with same CATH topology
4JI3T 1IBLT 4X66T 4X62T 4B3TT 5LMUT 4DV6T 4DR1T 1XMQT 1N33T 4JI7T 3OTOT 4JI6T 4JI2T 4JI4T 4K0KT 2UUBT 4JV5T 3T1HT 4DV4T 2F4VT 4JI5T 5BR8T 3T1YT 4GKKT 1N32T 1FJGT 4AQYT 4DUZT 5IWAT 1N36T 2UXCT 4YY3T 4DR3T 4LF4T 5LMNT 4JI1T 2VQFT 4LFCT 4X64T 1N34T 4DR5T 2UXDT 4KHPT 4OX9T 2UUCT 4GKJT 4B3ST 4LF5T 1HNWT 4NXMT 4B3MT 4X65T 4LF9T 4DUYT 4JI0T 1J5ET 1XNRT 2ZM6T 4LFAT 4DV7T 4DV1T 4LFBT 4YHHT 1I94T 4DV0T 1HNXT 1XMOT 2HHHT 4DV3T 4NXNT 4DR7T 4JI8T 1HNZT 4DR6T 4JYAT 1HR0T 4DV5T 4DR4T 2UUAT 1IBMT 1XNQT 2E5LT 4LF8T 4LF7T 2UU9T 4B3RT 4DV2T 2UXBT 2VQET 4DR2T 4LF6T 1IBKT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 T;  1IBL T;  4X66 T;  4X62 T;  4B3T T;  5LMU T;  4DV6 T;  4DR1 T;  1XMQ T;  1N33 T;  4JI7 T;  3OTO T;  4JI6 T;  4JI2 T;  4JI4 T;  4K0K T;  2UUB T;  4JV5 T;  3T1H T;  4DV4 T;  2F4V T;  4JI5 T;  5BR8 T;  3T1Y T;  4GKK T;  1N32 T;  1FJG T;  4AQY T;  4DUZ T;  5IWA T;  1N36 T;  2UXC T;  4YY3 T;  4DR3 T;  4LF4 T;  5LMN T;  4JI1 T;  2VQF T;  4LFC T;  4X64 T;  1N34 T;  4DR5 T;  2UXD T;  4KHP T;  4OX9 T;  2UUC T;  4GKJ T;  4B3S T;  4LF5 T;  1HNW T;  4NXM T;  4B3M T;  4X65 T;  4LF9 T;  4DUY T;  4JI0 T;  1J5E T;  1XNR T;  2ZM6 T;  4LFA T;  4DV7 T;  4DV1 T;  4LFB T;  4YHH T;  1I94 T;  4DV0 T;  1HNX T;  1XMO T;  2HHH T;  4DV3 T;  4NXN T;  4DR7 T;  4JI8 T;  1HNZ T;  4DR6 T;  4JYA T;  1HR0 T;  4DV5 T;  4DR4 T;  2UUA T;  1IBM T;  1XNQ T;  2E5L T;  4LF8 T;  4LF7 T;  2UU9 T;  4B3R T;  4DV2 T;  2UXB T;  2VQE T;  4DR2 T;  4LF6 T;  1IBK T; 
#chains in the Genus database with same CATH topology
 4UEL A;  1MMA A;  3ONJ A;  4M1P A;  3PUZ F;  2V26 A;  3ZCI A;  4O4H E;  4CQI A;  2BS4 A;  3VR8 A;  5JRE A;  4QXB B;  4KUM B;  2D2S A;  4GKK T;  1G73 A;  1FJG T;  2LJL A;  1WYC A;  2LEH A;  3QC9 A;  3RYH E;  3RX6 A;  3AE5 A;  3P4W A;  3UUM A;  2AXD S;  2UXD T;  1IZN B;  2IAK A;  2QA7 A;  3OKQ A;  2E9X D;  4ZI3 C;  2GK9 A;  4EB6 E;  3R84 B;  4OK0 A;  4YTN A;  3AEG A;  2RA1 A;  4HWC A;  4Z8X A;  1WR0 A;  3FZF B;  2MAW A;  4LFA T;  3SFE A;  2DL1 A;  5C3J A;  5JVD E;  4LFB T;  4PJN A;  3H3A A;  4ZZC A;  3LJC A;  3PU3 A;  4DV3 T;  4P0A A;  4AQG A;  2CBJ A;  4HKA A;  3PU8 A;  3PUX F;  4EYU A;  5HXC A;  4UXN B;  4UF0 A;  1XNQ T;  1QLB A;  5HXS A;  2VVN A;  2UU9 T;  3AEF A;  4DV2 T;  4A5X A;  5LHI B;  5L3E B;  4E7Z A;  2BVM A;  4X1Y E;  1YKH B;  4HN9 A;  2IC6 A;  2LM9 A;  2N2N A;  5EZY E;  1YKE B;  3NVO A;  3PUQ A;  2PG8 A;  2WSS V;  1HG5 A;  2V7K A;  2WS3 A;  3P8C D;  1ZKE A;  2XJ7 A;  2N9D A;  2ACZ A;  2NTX A;  4TWH A;  4P0B A;  4DBQ A;  1D1B A;  4EZH A;  3Q2M A;  2ZM2 A;  4PFP A;  3GA8 A;  4A56 A;  5JRC A;  4ILA A;  3O1J A;  4KMC A;  3VRB A;  2KXP B;  3WI3 A;  4HWH A;  5JR9 A;  1VCS A;  4BJN A;  3E22 E;  3EUH A;  2XUE A;  1Z8U A;  3PUR A;  4UV9 B;  2BKO A;  5JDF A;  4UF0 B;  2W2U A;  5F5W A;  1G8X A;  3RIF A;  4QXC B;  2JPF A;  4IRE A;  2X9H A;  2BBH A;  1HG2 A;  3N2G E;  2SPC A;  3I1A A;  5LHG B;  1UCU A;  4TX5 A;  3LK4 2;  2BG9 B;  1W0B A;  3DJB A;  2A2F X;  2FJD A;  3HKB E;  5DAB A;  5FL0 A;  5LOV E;  3AVR A;  3KV6 A;  4WBN E;  2RP4 A;  3CKD A;  1NWM X;  3AEB A;  2CEA A;  2X9X A;  4HFB A;  5JRC B;  2ODV A;  2CHN A;  3QUJ A;  1BR4 A;  2WAU A;  1UUR A;  4HGA A;  4N78 D;  2KLQ A;  2NW8 A;  4MBQ A;  3JAD A;  4X1I E;  5ETW A;  3UQ4 A;  4IGU A;  3S4U A;  1OED E;  4U72 A;  2WDQ A;  4ZS2 A;  2Z6E A;  3FZM B;  4PW8 A;  3ZMZ B;  4NUV A;  4HWI B;  2CLY B;  1MNE A;  4DV4 T;  4G63 A;  3N5L A;  3LG7 A;  4KHZ F;  1UX4 A;  4QWN B;  3ZJ1 A;  5LGN B;  4H9S E;  4QH4 A;  5LBQ B;  3ZC1 A;  2CXL A;  2VVS A;  5JDQ A;  2IUB A;  2D9D A;  5L3D B;  4GYR A;  3NZQ A;  3QK6 A;  2LSI A;  3SRZ A;  1D1C A;  2EHO D;  1FMV A;  2UXX B;  4PK5 A;  2V1D B;  2XAS B;  4EGW A;  2IDO B;  4CZZ B;  2DNX A;  3MJX A;  4PNI A;  4OHF A;  4TNV A;  2PBI A;  3JCF A;  4YSY A;  4CXX A;  4JYA T;  1XZY A;  3HI2 A;  2W62 A;  3LDQ B;  2K48 A;  3RYI E;  4CI2 B;  4HFH A;  3L09 A;  3W15 B;  3IBP A;  2XQA A;  4LF6 T;  4XBF B;  2WB5 A;  4EIW A;  1NEN A;  5HCJ A;  2XQ9 A;  2WU2 A;  3AAI A;  4JI3 T;  4EAH A;  3D0T A;  2V7L A;  3HL6 A;  2YDQ A;  3EDV A;  3L39 A;  2KT9 A;  5LGT B;  1B7T A;  4JI7 T;  3Q9D A;  3OTO T;  4AIS A;  2LT3 A;  4ERR A;  2M67 A;  1ZEE A;  4IDP A;  3T1H T;  3RF1 A;  1UUS A;  3RKG A;  5AQV B;  5FY1 A;  4C90 A;  4IDZ A;  2LM2 A;  5HEH A;  2AE9 A;  4AI6 A;  3C51 A;  4I55 E;  4WNK A;  5DQV A;  4OX9 T;  2D0T A;  3PUA A;  3LK3 B;  4JEH B;  3RI5 A;  2X51 A;  1QSD A;  1S94 A;  4QX8 B;  3RQW A;  4DV7 T;  3EI0 A;  2JQH A;  1ZHC A;  2XM1 A;  2HHH T;  4YSX A;  2V6Y B;  3PUG A;  2NW9 A;  5L4E A;  2BDE A;  2LOP A;  4TUY E;  5JTG A;  4PJM A;  2A3D A;  2P9B A;  4B3R T;  4H9O C;  4TWD A;  1WCR A;  2H3R A;  2W61 A;  5FKY A;  2H7V C;  2MTQ A;  3ZCJ A;  1ZV4 X;  4A97 A;  1IBL T;  2WBL A;  4IE0 A;  5GON E;  4FI5 A;  1O3X A;  5HXE A;  4JBW F;  4EOZ B;  3UUB A;  4IL9 A;  3F31 A;  1XMQ T;  3VU7 H;  5LJM A;  5IHY A;  3NRX A;  4HEA A;  4H9Q C;  2I59 A;  3EAB A;  3F2E A;  2E2A A;  1YQ3 A;  3ZEF B;  3OBV E;  5KX5 E;  4I50 E;  2BG9 C;  2K5B B;  4X5T A;  4IL4 A;  4DR3 T;  2OV9 A;  3ZYM A;  2H89 A;  3UUL A;  4UIG A;  3KBU A;  4X64 T;  2VB6 A;  5EK3 A;  5AQR B;  4KHP T;  2CHO A;  4FJO A;  3AVS A;  4UV8 B;  3IHR A;  2K3W A;  3P4P A;  4AQF C;  2WWV A;  1NAF A;  2XTL A;  4O2A E;  3OVU A;  4OFZ A;  3BQI A;  2WZI A;  3JC6 D;  4TN7 B;  1T8B A;  2XM2 A;  3PE0 A;  1I6Z A;  2X9W A;  2CLY C;  5L3G B;  4DO0 A;  4HFE A;  4X20 E;  3JC6 C;  4ASK A;  1MND A;  3AB3 B;  2WU5 A;  2LSG A;  4K0U A;  2V5C A;  3OYZ A;  4X66 T;  2L9Q A;  2LHR A;  4ILU A;  1IJ6 A;  2LKG A;  3N9P A;  4DR1 T;  3CIR A;  4YFS A;  1T72 A;  2CBI A;  4EYY R;  2XAH B;  2NP9 A;  3MXZ A;  2VKH A;  2J62 A;  2JIW A;  2X0H A;  4V1A v;  5H6Q B;  1LVK A;  3PTR B;  1HCI A;  2W66 A;  4EEB A;  5C8Y E;  4KP3 C;  3RH3 A;  1H7C A;  3CPZ A;  5FXX A;  4I4T E;  5KXJ A;  1D0X A;  4B6X A;  3C4X A;  4QHO A;  3EDU A;  5LMN T;  2IHR 1;  3HKE E;  4LFC T;  1N34 T;  4U2Y A;  3N9O A;  4LMJ A;  4I0U A;  3M65 A;  4ZI3 D;  1YD8 G;  5HEJ A;  5FXV A;  3PDY A;  3ZT6 A;  1X9B A;  2YU1 A;  5M4Y A;  3P4S A;  3QNU A;  1HNZ T;  3VHL A;  5FP3 A;  1VCT A;  5LCY A;  1LVF A;  2YK0 A;  5CGM A;  4DV5 T;  3N9M A;  4UVA B;  2R6G F;  3M3Z B;  4KBM B;  3V5S A;  2K9A A;  2LRL A;  2VQE T;  5LXT E;  5E0O A;  1WYB A;  1KK7 A;  2OLT A;  5FY7 A;  2XQ3 A;  4YJ3 E;  4X62 T;  3EVY A;  4F6R C;  2DI4 A;  3RLF F;  3TLU A;  1N33 T;  3KIN B;  1DU2 A;  3K1S A;  4JI2 T;  1IAP A;  3CWZ B;  5L3C B;  2DLR A;  2W63 A;  3H3M A;  2BG9 A;  3NWI A;  1HF8 A;  2BKN A;  2LSJ A;  1ZOY A;  3H37 A;  3K8P C;  2UXC T;  4YY3 T;  1U5P A;  5J2U E;  3IF8 B;  3E0Z A;  1VRB A;  2UUC T;  4GKJ T;  1OED B;  1E1H B;  4AQF A;  1T7S A;  2ZMA A;  1D0Y A;  5IYZ E;  4CXW A;  5FVL A;  3I0O A;  2CWO A;  2Q9Q B;  3HR0 A;  4IT4 A;  3N2K E;  3GMI A;  5JDG A;  2VUR A;  2BKP A;  1XMO T;  2V7I A;  2IW5 B;  4NXN T;  3Q5X A;  1W0A A;  2MBG A;  5FNV E;  2BBJ A;  4LF8 T;  1U4Q A;  3ZST A;  4HFI A;  2LSK A;  2WZH A;  3N9N A;  2W4X A;  3I9W A;  2XAJ B;  3K3Q C;  3AE6 A;  5LMU T;  2I0M A;  2YDS A;  2HN2 A;  4LMK A;  4YLH A;  3WAK A;  3P50 A;  1SHZ C;  4AXP A;  2UXN B;  3ESL A;  4JV5 T;  4QH1 A;  2WY2 A;  4H9N C;  4IDO A;  4F8H A;  2KZ7 B;  2OA5 A;  1XDO A;  2FUP A;  3C4Z A;  3E08 A;  3SS1 A;  3LSV A;  4O4L E;  2DHR A;  3ZC0 A;  4BAY B;  5BMV E;  1GQE A;  5AQM B;  5AQI B;  4IE4 A;  3UU4 A;  3GN5 B;  2XPK A;  4QKN A;  3TLV A;  3ZT7 A;  3QB5 A;  3N9L A;  4CN6 A;  2KWH A;  4CN4 A;  3P4Q A;  1HNX T;  4KI0 F;  4WBO A;  3ZLI A;  5J2T E;  2X68 A;  2XSB A;  3C98 B;  3N2O A;  1BR2 A;  3RQU A;  4ZS3 A;  4DND A;  4DMV A;  3PJA A;  4QX7 B;  5F8P A;  1FEW A;  3RRC A;  4U33 A;  4ILC A;  2NTY A;  4DR2 T;  2XAG B;  1HFA A;  2XQ5 A;  1OXZ A;  3MK7 C;  3UFG A;  1IBK T;  5HXR A;  5FYM A;  1BR0 A;  5CA0 E;  3ZJ2 A;  3F57 A;  3V5U A;  5L4H A;  1S35 A;  2IML A;  5AQG B;  5JDL A;  2ZLY A;  3PUW F;  4H63 H;  2LKH A;  3AE9 A;  5HYA A;  2BVL A;  3B57 A;  4JI5 T;  5BR8 T;  3AEC A;  4DBR A;  2V6Y A;  5LG4 A;  2KMF A;  4DUZ T;  2VKD A;  4JEU B;  5JDM A;  1W09 A;  4GYS A;  4UR9 A;  4AKI A;  3UQ7 A;  1HX1 B;  4KX6 A;  2QRX A;  3SFD A;  2LE8 A;  5LHH B;  2X0Y A;  3AE3 A;  3NKZ A;  3KV5 A;  3ZN0 B;  3VKH A;  4L5G A;  4WYV A;  1KNR A;  3G06 A;  4DV1 T;  5AFU L;  4Z90 A;  4ZI2 D;  3KFW X;  3KV4 A;  5HCM A;  4IE7 A;  4Q25 A;  4O4I E;  1Y64 B;  2CM0 A;  2HPJ A;  2E9X B;  2UUA T;  4ZI2 C;  2V7J A;  3ZMU B;  4G2A A;  3ZN1 B;  3ZPO A;  1EZ3 A;  2JJ9 A;  2X67 A;  4YTM A;  2C5I T;  4Z91 A;  2YEV C;  4YHJ A;  4LML A;  4O8S A;  2Q9Q D;  4P09 A;  4U31 A;  3AA7 B;  1OED C;  2KSR A;  3TLT A;  3CX6 B;  1YW0 A;  2Q9Q C;  2UUB T;  2FJE A;  5AQF B;  1T98 A;  3TLS A;  4EXT A;  5AQL B;  3RYF E;  4U7I A;  4AQY T;  2C5J A;  2VKO A;  4L9I A;  4E7S A;  5LGU B;  2I6H A;  4HWF A;  3ANW B;  3RHW A;  4X1K E;  3UT5 E;  2VQF T;  2FBW A;  5AQS B;  4PK6 A;  5HWX A;  4BJM A;  1YQ4 A;  3RIU C;  1LRZ A;  4DID B;  4TV9 E;  1MMN A;  1QUU A;  4QXH B;  2Y6X A;  2YKS A;  2V6X A;  2JQ9 A;  4TNW A;  3WAJ A;  3BQL A;  3JAE A;  5JH7 E;  2N1G A;  5HXH A;  2CRB A;  2W00 A;  3C4W A;  2E5L T;  2JQK A;  4DMW A;  2FJB A;  3B5M A;  3UU3 A;  1D1A A;  3MZK B;  4UVB B;  4ANJ A;  4EZ4 A;  3ETV A;  3ONX A;  2VL8 A;  2KWI B;  5LP6 E;  3O4X E;  5AQJ B;  5CFB A;  2L8K A;  1KF6 A;  2B1E A;  4JI6 T;  2G0U A;  1E7P A;  4J2C A;  3FHN A;  2VWA A;  1HS7 A;  2HH7 A;  5FVK A;  1D0Z A;  3RKO A;  2XAF B;  3ZMV B;  5IWA T;  5LB7 B;  2WP9 A;  3ABV A;  2NOX A;  4IDQ A;  3O9X A;  4IHJ E;  2XQ6 A;  1KNP A;  3ETU A;  4L0R A;  2WMN A;  1FIO A;  4CXY A;  4MFR A;  5FL1 A;  4DUY T;  3ZMT B;  2J47 A;  3O1I A;  1M62 A;  2QYW A;  3KVB A;  1WLX A;  4CI1 B;  3FXD B;  2PTF A;  3NBX X;  2XQY A;  4ZEY A;  2E5V A;  2V8S V;  4DV0 T;  4BA9 A;  4XAX B;  3ZYL A;  4P1N A;  4ZHQ E;  5LNK A;  2KND A;  2V5D A;  2XQ8 A;  2YDR A;  2DCF A;  1E2A A;  4TWF A;  2CA5 A;  1IBM T;  2CWY A;  3OJA A;  3UTK A;  2CMR A;  3MA9 A;  4LF7 T;  3AE2 A;  3TKL B;  2EHO B;  5CJ5 A;  2IC9 A;  2C5K T;  2IIU A;  3FZH B;  3SWH A;  2XQ4 A;  4HWD A;  3BQK A;  1MIV A;  2BZB A;  3I9Y A;  1UK5 A;  4B3T T;  1OED A;  3KBT A;  4DV6 T;  3JAF A;  3PJA J;  3X1D A;  2Q9Q A;  4JI4 T;  1BR1 A;  2DWG A;  3LBX A;  4PFO A;  5HEO A;  4MAL A;  1SUM B;  3T1Y T;  5ABH A;  3KDS E;  3FBZ A;  1LKX A;  3AXJ B;  4WZX A;  2W67 A;  2ZM0 A;  5AQT B;  4LF4 T;  4AKH A;  3ONL C;  3C50 A;  3R6N A;  2E9X C;  3RIU A;  3A7M A;  4B3S T;  4NXM T;  4X65 T;  3NRY A;  3P7I A;  3QOF A;  4LF9 T;  1WFD A;  1J5E T;  4OYJ A;  3ZMS B;  3VRA A;  4U7Y A;  2MOZ A;  2NWB A;  1Z0P A;  5EK2 A;  3L3P A;  4TZ4 C;  1MIW A;  2WDV A;  1HR0 T;  3AA0 B;  5DJQ C;  3PUY F;  3CX8 B;  4AKR B;  3ZSS A;  2WWU A;  4MHC A;  1WR6 A;  3LBX B;  4O2B E;  4YJ2 E;  4COF A;  1XWM A;  4IE5 A;  5JDN A;  2M6B A;  1JNZ A;  2LLY A;  2PFV A;  1CUN A;  3AEA A;  4H9R C;  4ISS A;  4YSZ A;  4GK5 E;  3CQC B;  5KDM C;  1CHU A;  2JMH A;  4I43 B;  3MAC A;  3GN5 A;  1KEY A;  1MMG A;  5ABF A;  1ZP0 A;  3RC3 A;  4K0K T;  4ILB A;  3ZYK A;  3IA3 A;  2XAQ B;  5AQK B;  4TV8 E;  2X9Y A;  3I0Q A;  2FJA A;  4ZI7 E;  4H63 V;  2JQQ A;  4YTP A;  3HKC E;  3AE7 A;  2ACX A;  3RC8 A;  3CML A;  1AJ3 A;  1SA0 E;  4MLK A;  5CA1 E;  4JI0 T;  3SOL A;  1KFY A;  3DTO A;  2YN6 A;  5LJN A;  3PV0 F;  3A5X A;  2Y48 B;  4YHH T;  5LBM A;  2BS2 A;  4JUY A;  3CQG B;  3MKD A;  2PJQ A;  2LSY A;  3HA4 A;  2D0U A;  3AAE B;  3N9Q A;  5JR9 B;  1V9D A;  2H88 A;  3Q5E A;  1UGO A;  5L3F B;  5ABF B;  4A98 A;  3FBL A;  2WM9 A;  2CXF A;  3OYX A;  1WRD A;  1US7 B;  5HEG A;  4GIW A;  3UU8 A;  1JNR A;  5AQN B;  3ZKR A;  4YXD A;  3FB2 A;  2H7O A;  1FMW A;  3VKG A;  2VAS A;  3Q5W A;  2YU2 A;  4AKL A;  4PAG A;  3J7Y q;  2LOS A;  1MMD A;  3KVA A;  2K24 A;  1OWA A;  3UFE A;  2M6I A;  2QVA A;  4U2Z A;  2BG9 E;  5L47 A;  5KMG P;  1N36 T;  2VL0 A;  5J1G A;  3UU6 A;  1HTJ F;  2VK9 A;  3UU5 A;  2E9X A;  3RGL A;  3AA1 B;  3QB5 K;  3AE4 A;  5JDH A;  2YOE A;  4OYK A;  2EHO C;  5H6R B;  2XHE B;  3AE8 A;  1W9R A;  2HPL A;  2RPA A;  5HEU A;  4HTE A;  4YT0 A;  1XNR T;  2ZM6 T;  5AQO B;  2XY8 B;  4H9P C;  2ODU A;  4IIJ E;  5C2T A;  3U3I A;  5A1L A;  5LYJ E;  2J4G A;  2D5U A;  4HFC A;  4JLE A;  3EAM A;  4DR6 T;  3GWH A;  5L2L A;  2CCQ A;  3CQX C;  4C91 A;  3PUV F;  1R8I A;  2DWK A;  4IE6 A;  3K3N A;  3ANW A;  2J1D G;  3PUS A;  2WQY A;  4AIU A;  3L8R A;  4UEM A;  2A72 A;  2VKJ A;  4U3C A;  4HFD A;  2Y8D A;  3EHZ A;  5AQP B;  4NUU A;  4GOU A;  4O4J E;  2NW7 A;  2ZM8 A;  3BK9 A;  1X79 A;  1KNZ A;  3RYC E;  2MPK A;  2C0S A;  2E8I A;  4AKG A;  1YXR A;  4WW0 A;  3AED A;  5LG3 A;  3VR9 A;  5ABE A;  2LHN A;  1IJ5 A;  4EV6 A;  2XSA A;  1L0V A;  4PJL A;  5HAX A;  4JI1 T;  3FZK B;  4DR5 T;  2A9U A;  3DP7 A;  4GK0 E;  4B3M T;  4PK4 A;  2NR4 A;  1J1J A;  2YIN A;  4HE8 A;  3A8Y C;  4CN1 A;  5F3J A;  3C64 A;  3U78 A;  1UX5 A;  1HX8 A;  2X66 A;  4NIQ A;  4JI8 T;  5FXZ A;  3O1H A;  4ZZB A;  2WDR A;  2B76 A;  4EED A;  4XZC A;  4DR4 T;  3T8O A;  5CB4 E;  5ABG A;  1M7K A;  2QGS A;  4ZOL E;  1NEK A;  3TLW A;  3LK2 B;  2L3L A;  3IEE A;  2UXB T;  2JMK A;  3CVR A;  3AE1 A;  3UUN A;  4DVD A;  4IST A;  5ADX L;  2V7M A;  2KIN B;  2CE7 A;  3NZP A;  3AAA B;  5EK4 A;  3AEE A;  3FZL B;  3CX7 B;  1MIY A;  4UVC B;  2CXD A;  3RIA A;  5L3B B;  5FXW A;  2XQ7 A;  5JQG E;  2LRK A;  5J0Z A;  4U74 A;  2WMO A;  3RPU A;  5IUX A;  2F4V T;  2X0L B;  2MYS A;  5AQQ B;  4ZXL A;  1N32 T;  3RRW A;  3HKD E;  1VOM A;  2JRK A;  3K3O A;  1XDP A;  3FXE B;  1Y01 A;  5FMN A;  5JR9 C;  3CK6 A;  3OPC A;  3B13 A;  5TAO A;  3J9X 1;  2EHO A;  4LF5 T;  1HNW T;  5DQW A;  2BS3 A;  4HFV A;  4PJJ A;  2HN1 A;  5LA6 E;  3UUX B;  2CPT A;  1J5W A;  2WCA A;  2ES0 A;  1I94 T;  3Q5D A;  3KV9 A;  3P4R A;  4QH5 A;  4ADZ A;  4DR7 T;  1SE7 A;  5FY0 A;  3ZT5 A;  5AQU B;  4CI3 B;  5HWY A;  2XZE A;  4IDN A;  3AA6 B;  2W0G A;  3LFM A;  3AXJ A;  5AQH B;  4NPP A; 
#chains in the Genus database with same CATH homology
 4JI3 T;  1IBL T;  4X66 T;  4X62 T;  4B3T T;  5LMU T;  4DV6 T;  4DR1 T;  1XMQ T;  1N33 T;  4JI7 T;  3OTO T;  4JI6 T;  4JI2 T;  4JI4 T;  4K0K T;  2UUB T;  4JV5 T;  3T1H T;  4DV4 T;  2F4V T;  4JI5 T;  5BR8 T;  3T1Y T;  4GKK T;  1N32 T;  1FJG T;  4AQY T;  4DUZ T;  5IWA T;  1N36 T;  2UXC T;  4YY3 T;  4DR3 T;  4LF4 T;  5LMN T;  4JI1 T;  2VQF T;  4LFC T;  4X64 T;  1N34 T;  4DR5 T;  2UXD T;  4KHP T;  4OX9 T;  2UUC T;  4GKJ T;  4B3S T;  4LF5 T;  1HNW T;  4NXM T;  4B3M T;  4X65 T;  4LF9 T;  4DUY T;  4JI0 T;  1J5E T;  1XNR T;  2ZM6 T;  4LFA T;  4DV7 T;  4DV1 T;  4LFB T;  4YHH T;  1I94 T;  4DV0 T;  1HNX T;  1XMO T;  2HHH T;  4DV3 T;  4NXN T;  4DR7 T;  4JI8 T;  1HNZ T;  4DR6 T;  4JYA T;  1HR0 T;  4DV5 T;  4DR4 T;  2UUA T;  1IBM T;  1XNQ T;  2E5L T;  4LF8 T;  4LF7 T;  2UU9 T;  4B3R T;  4DV2 T;  2UXB T;  2VQE T;  4DR2 T;  4LF6 T;  1IBK T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...