2WWVA

Nmr structure of the iiachitobiose-iibchitobiose complex of the n,n'- diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
b'AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2wwvA00
5FVKA 3ZT7A 2JQKA 4U7YA 4U2ZA 2V6YA 2WWVA 5CJ5A 1WFDA 2CPTA 4WZXA 5LB7B 4A5XA 5FVLA 4U7IA 2WY2A 4CN6A 3ZT5A 2V6YB 2XZEA 4U3CA 3EABA 2JQHA 3ZSTA 2A9UA 3ZT6A 2W2UA 3ZSSA 2DL1A 2V6XA 2K3WA 2LRLA 1YXRA 4U33A 4CN4A 4CN1A 2CRBA 2RPAA 4IT4A 4U2YA 4U31A 1WR0A 4NIQA 4P1NA 2MPKA 3K1SA 5CGMA 1WCRA 2LRKA 2JQ9A 4ZEYA
chains in the Genus database with same CATH superfamily
3PJAA 3EUHA 4X20E 5FVLA 2K24A 2QVAA 1EZ3A 4P09A 3RIFA 2ZM2A 3BQIA 4QHOA 4ASKA 4JUYA 4DNDA 5KX5E 5CA1E 3WAJA 2X68A 2RP4A 5IUXA 4H63V 4WBNE 2IDOB 5LG4A 3IBPA 5LJMA 2Z6EA 1YKHB 3I9YA 1R8IA 2WMOA 4C90A 1N34T 3HR0A 4ZS3A 5AQMB 2I59A 4ZOLE 5FY0A 2IC9A 5FP3A 4LFBT 4P0BA 3BK9A 4UV8B 2CCQA 2BVLA 4PK5A 5LA6E 2W67A 2UXCT 5JDGA 3HA4A 4EYUA 3ANWA 3AE5A 2CPTA 5FKYA 3RYIE 4YSXA 3EI0A 3GA8A 3CIRA 3FZMB 3RQWA 2BS2A 1LRZA 3E08A 5BMVE 3OPCA 3VR9A 2PG8A 4Q25A 4AI6A 2IMLA 2VB6A 3MA9A 4O2AE 2WBLA 4DR2T 4DUZT 2VKDA 3FZKB 4LF5T 4L0RA 5AQFB 2XQ8A 3PUZF 5CA0E 2VKJA 2WQYA 2BKNA 4ANJA 2DHRA 2HN2A 5F5WA 2ZMAA 5F3JA 5L4EA 4LF7T 4DBRA 4HGAA 2ZLYA 3BQLA 3ZN0B 5AQVB 4X1YE 5LP6E 2XJ7A 4IDPA 2G0UA 4KBMB 2IIUA 1LVFA 2WWUA 3AAAB 2PFVA 3PUSA 1CHUA 4HFBA 3ZPOA 5JREA 2OV9A 3SS1A 5KDMC 3ZMTB 4EIWA 1LVKA 3ZJ2A 4YTNA 3E0ZA 4DV6T 2PTFA 4P1NA 3P4PA 2LSJA 4PJJA 2XSBA 4UIGA 2YDSA 5DQVA 2LKHA 2KMFA 1VCSA 2AE9A 3P4WA 2W61A 2JQKA 2FJAA 1KEYA 4QXBB 4TNVA 4KHPT 3AE3A 2LKGA 2DCFA 5AQJB 3EABA 3QK6A 5ABGA 4QH5A 3UUXB 4AQYT 5C8YE 2BS4A 4FI5A 4IHJE 2K48A 5FXZA 4PJNA 4DV1T 2NWBA 3PU3A 3LBXB 5L4HA 2LHRA 4IDOA 4ZZBA 3OYXA 4MLKA 4PW8A 2YOEA 2XQ9A 2XQ4A 4I50E 4HN9A 2BKPA 3I9WA 4HWDA 4TZ4C 3TLWA 2V1DB 2MAWA 5LHIB 2KLQA 5J0ZA 4OYKA 2XHEB 4HFCA 3A8YC 4YJ2E 3RLFF 1MMDA 5ABFB 4JI4T 2V6YB 4TNWA 3NZQA 3N2KE 4H9RC 2NTXA 5AQIB 2VWAA 5LGNB 3WAKA 3N5LA 5LCYA 5HEOA 1Z0PA 4DMWA 3N9LA 1MMAA 5ABEA 3PUQA 4UVAB 5FMNA 2BG9B 4JI7T 3ZC1A 4BJNA 3UU5A 2KNDA 3RYCE 1OXZA 2KSRA 4HFIA 4JI3T 2C5KT 5BR8T 2LOSA 4LMLA 2XAFB 2X0HA 3CQXC 3R84B 4OK0A 4BJMA 4OX9T 3AEGA 4U3CA 5LBMA 4J2CA 2XY8B 2V5CA 2XQ3A 3UT5E 3AE9A 4GIWA 3FB2A 4EZHA 4IIJE 4IE6A 4DIDB 1Y01A 4AQFC 3MK7C 2N2NA 2VL0A 3AE6A 3A7MA 3Q2MA 4YTMA 3JAEA 3RC3A 4X5TA 2V7KA 4I43B 3RRWA 1QUUA 3LG7A 3ONJA 1WR0A 1WYCA 4IDZA 1IJ6A 2XQ7A 3CPZA 4PNIA 4IL9A 1JNZA 2XAQB 3QB5K 2Y6XA 1OWAA 3ZMSB 2A3DA 4CI2B 1HFAA 4EEBA 3C50A 2EHOC 5FY1A 4PFPA 5AQTB 2LJLA 4AKLA 3ONXA 4JI0T 2LOPA 4U7YA 2IW5B 2CXFA 1M62A 3AE4A 4B3RT 4YJ3E 3KV6A 3T1YT 3RX6A 2NTYA 4KX6A 3K1SA 3AE1A 4LFCT 2YU2A 1HS7A 4DR7T 2BZBA 2IHR1 2E9XB 4PK4A 2HPLA 4I55E 5LBQB 4UVBB 4LF6T 5LHGB 2UUCT 5L2LA 4UELA 1D1CA 1WLXA 1BR0A 2NOXA 2W62A 1BR2A 3ABVA 2XPKA 4UF0A 2E2AA 3LK2B 4BAYB 2FJEA 5AQRB 2CHOA 2KZ7B 5HXRA 1WRDA 4TWHA 2UUBT 4EYYR 3L09A 4XAXB 4CQIA 3TLVA 4X64T 4MHCA 3PV0F 2K9AA 4LF8T 1IBKT 2JJ9A 5JR9A 2OLTA 2L8KA 4GYRA 4YY3T 4TWFA 4AQFA 2H3RA 2P9BA 1J1JA 3FXEB 2WM9A 4ZEYA 4FJOA 4NUUA 2I0MA 2WWVA 2QGSA 1VCTA 2JMHA 5L3EB 1U5PA 4CN1A 2RPAA 4JLEA 2V7LA 1MNDA 2VVNA 5JDLA 2WS3A 3UU6A 4P0AA 3Q5WA 3Q9DA 1KK7A 1XDOA 3ANWB 4IDQA 4IREA 2KT9A 3ZT6A 2EHOA 3PUYF 1OEDC 1W9RA 3M3ZB 4HWIB 3PDYA 3TLTA 2LRKA 3OKQA 3ZLIA 2CLYB 2FJDA 5H6RB 2VL8A 5L3GB 1H7CA 5LMNT 3LDQB 3A5XA 3AEEA 4B6XA 1DU2A 4DV0T 2J4GA 5HXHA 4YXDA 1KNRA 2C5IT 5FXXA 3JC6C 4DR5T 3VR8A 2LSKA 3L8RA 3AVRA 3N9QA 3N2GE 2D2SA 3LFMA 4DV5T 4N78D 4BA9A 5JRCB 2LLYA 5AQHB 4YT0A 3MKDA 1CUNA 4DV7T 3KV4A 3ONLC 3W15B 2CXDA 2K5BB 1UX4A 3CMLA 1N36T 2YN6A 2NW7A 3KBUA 3PE0A 2X9XA 4AXPA 2DNXA 2W4XA 5IHYA 5LYJE 4AKRB 3BQKA 4LMKA 1XNQT 4IGUA 5JDMA 3TKLB 2FBWA 3C4XA 2LEHA 3PJAJ 5JDQA 3RC8A 4X66T 4CI1B 4HFVA 2IUBA 4M1PA 2V6XA 1BR1A 2QA7A 4YLHA 4ERRA 3PU8A 3AB3B 3G06A 3P4SA 4H9NC 4L9IA 2D0TA 4DR6T 3N9MA 4IL4A 4WBOA 5HEGA 3WI3A 4OHFA 2LT3A 5LGTB 2E8IA 4KUMB 2WU5A 1N33T 1AJ3A 3O9XA 4A56A 2BS3A 5HAXA 2Q9QB 2DWKA 1UX5A 2MTQA 3CQGB 3N9NA 5JTGA 3ZYLA 1HX8A 4UVCB 3UU4A 2LHNA 3GN5A 4GK5E 4KP3C 3I1AA 2LRLA 2CRBA 1UCUA 1OEDA 4HFEA 3T8OA 3I0QA 3F31A 3JADA 2ODUA 3Q5DA 2XAHB 3AXJB 2VVSA 4AIUA 1UURA 2NW8A 2D0UA 3RPUA 4EGWA 4Z90A 1SE7A 4CXYA 1MMNA 5HXCA 1HG2A 1Y64B 3QB5A 5A1LA 2DLRA 4PJLA 3UUMA 2V7MA 3AEFA 2X0YA 2WZHA 4DVDA 2GK9A 2X0LB 2WU2A 5JVDE 2UXBT 3UU3A 3RI5A 2X51A 4IE7A 3UFGA 3PUXF 2IC6A 3RRCA 1IZNB 3V5SA 2VURA 5FL1A 2V5DA 4E7SA 2OA5A 1WCRA 4CN4A 3SFDA 2W00A 3F57A 3P8CD 4IE0A 1T8BA 4TV8E 2N9DA 1Z8UA 3RYHE 4AISA 3ZT5A 4A98A 2X66A 5FNVE 5EZYE 5AQKB 3RH3A 4MALA 3PTRB 1T72A 3KDSE 3FHNA 4ILCA 1D0ZA 5F8PA 4CN6A 2XQ6A 2XQAA 4ZXLA 3K3NA 4B3TT 1QLBA 1BR4A 4ILUA 5FXVA 1OEDE 1T7SA 4JV5T 4ILAA 5AQLB 4H9OC 1NAFA 1HG5A 3LK42 3B57A 4G63A 3LBXA 4PJMA 4DUYT 2J62A 3KFWX 4IE5A 5L47A 2H7OA 3PUWF 5HCJA 5ABHA 1X9BA 1HF8A 2JQQA 5AFUL 1FIOA 4CXXA 2ACZA 2YEVC 2HH7A 4X1KE 1HNZT 2KWHA 2BBHA 5C2TA 2YDQA 2UUAT 3ZMVB 4YTPA 2ES0A 3CQCB 3J7Yq 5AQPB 3U78A 4F8HA 2HHHT 3ZC0A 1FMWA 2BDEA 2EHOD 3PURA 4YHJA 2V7JA 2VK9A 2H7VC 3C98B 3M65A 3Q5XA 3PUGA 5ABFA 3ETUA 4QXCB 2V6YA 5M4YA 3P4QA 5HEUA 5LGUB 5JDFA 5JR9C 3EVYA 4UR9A 2W2UA 4AKGA 5LMUT 4Z91A 3KINB 3AAEB 3GMIA 3RKGA 2VKOA 4UV9B 3AA1B 3ZMZB 3OTOT 1U4QA 4NUVA 1NENA 3PUVF 4HFDA 5HYAA 3PUAA 3SFEA 1UGOA 1GQEA 3O1HA 4O4LE 1T98A 4O4IE 3IHRA 2CWOA 3RQUA 3NBXX 4HEAA 4ZHQE 1XMQT 4XBFB 3B5MA 1O3XA 2B1EA 2YKSA 1MIWA 1ZV4X 1HCIA 4JI8T 4TX5A 4YHHT 4QX7B 2WDVA 3Q5EA 4TWDA 3DP7A 2CEAA 1NEKA 2VQFT 4AQGA 3AA7B 2ZM0A 4UF0B 4QH1A 2YDRA 3EDVA 3UU8A 1D0YA 2WB5A 4JI1T 1ZHCA 1D1AA 3ZCIA 1I94T 3ZT7A 3LSVA 1J5ET 4MBQA 3JAFA 2WDRA 2WY2A 3VU7H 4HWHA 3L3PA 1V9DA 3AA6B 1JNRA 5AQQB 5H6QB 4DR3T 1YXRA 3IEEA 2NR4A 4DR4T 3C4ZA 4CXWA 4O8SA 3QNUA 5ADXL 1E1HB 2RA1A 3MACA 3HKEE 4F6RC 4EAHA 5AQGB 1SA0E 3UUNA 1ZKEA 4CI3B 3CKDA 3I0OA 4UXNB 1S94A 2CLYC 2YU1A 1D0XA 3NRXA 2D5UA 4GYSA 4DMVA 2ODVA 3FZLB 5DJQC 5LB7B 5AQNB 3AEDA 5C3JA 3ZSTA 4KI0F 3HL6A 4IT4A 2XAJB 3CVRA 5AQSB 3GWHA 5CB4E 4ZI7E 3C51A 2E9XA 4TV9E 2CE7A 2H89A 3JC6D 1SHZC 4JI6T 2QRXA 2WSSV 4H9QC 3ZMUB 3H3AA 5LG3A 1YW0A 4I4TE 4EB6E 3CK6A 5CFBA 1IBLT 3AE2A 4A97A 3FZHB 4YSYA 1YD8G 2QYWA 3B13A 3DTOA 4UEMA 2KXPB 5HEJA 3QUJA 1ZP0A 4IE4A 2VKHA 3LK3B 2XTLA 1QSDA 1S35A 3K3QC 1HNWT 3LJCA 2E5LT 1G8XA 4G2AA 4NPPA 1WR6A 2M6IA 3FBZA 3P50A 4PFOA 4O2BE 4EEDA 5HWYA 2V7IA 4DO0A 3K8PC 4QX8B 2WMNA 4Z8XA 5LOVE 5J1GA 2Q9QC 4U2YA 2LM9A 3RIAA 1YKEB 3ZCJA 2LE8A 2L9QA 5KXJA 3E22E 2PBIA 1UK5A 4JI2T 3DJBA 2F4VT 3UFEA 1W0BA 4JYAT 3X1DA 4ISSA 4U7IA 3SRZA 2XM2A 5GONE 2HN1A 2JRKA 1YQ3A 3CX8B 1XMOT 2DWGA 3AA0B 4ZZCA 3T1HT 3TLSA 4CZZB 1G73A 2LSIA 3NRYA 1MIVA 3ESLA 2JQ9A 2CBIA 5HCMA 4KHZF 3UQ4A 4H9SE 3KBTA 4ISTA 5FXWA 2A72A 4QXHB 5JQGE 2CHNA 5DABA 1ZOYA 4EOZB 3GN5B 2HPJA 2WCAA 2ZM6T 2C0SA 4X65T 1OEDB 2X67A 3RIUC 2CM0A 1MNEA 4C91A 5JRCA 1W0AA 4HWFA 3EDUA 4HTEA 5L3DB 3FXDB 4JI5T 2K3WA 2J1DG 2W66A 3KVAA 3C4WA 2UXNB 3AECA 2MYSA 5LNKA 2X9YA 3L39A 2PJQA 5IWAT 4O4HE 2XASB 1N32T 3MJXA 3OYZA 2Y48B 2XQ5A 4JBWF 4DV3T 3RF1A 3AAIA 2FUPA 3JCFA 4EZ4A 3VKHA 2KINB 5IYZE 2CWYA 3O1JA 4K0KT 1FJGT 2CXLA 2H88A 4LF4T 3O4XE 3OVUA 4JEHB 2CMRA 3K3OA 1VRBA 1WYBA 1B7TA 1E2AA 2W0GA 3HKCE 4X1IE 2B76A 4DV4T 3J9X1 2BG9C 2VASA 4AKIA 5HXSA 4QKNA 3HKBE 1IBMT 3UUBA 1W09A 2AXDS 2Q9QA 3VRAA 1SUMB 5FVKA 2LM2A 2FJBA 5JH7E 4DBQA 4X62T 2X9HA 4QWNB 5J2UE 2I6HA 3TLUA 4U74A 4WW0A 3C64A 1KNPA 1HTJF 4LF9T 2KWIB 3AXJA 5L3FB 4HWCA 3ZN1B 1WFDA 4WZXA 3HI2A 4B3MT 2UXXB 4IDNA 2C5JA 3UTKA 4NXMT 2UXDT 2BBJA 3ZSSA 4B3ST 4O4JE 4KMCA 3OBVE 5J2TE 5EK3A 4ZI2D 3RIUA 1KNZA 2X9WA 2E9XD 1KFYA 1VOMA 2D9DA 2NW9A 4MFRA 2YK0A 5LHHB 3MXZA 2MOZA 2WZIA 1MIYA 2L3LA 5AQOB 3V5UA 2M6BA 3N9OA 2YINA 3D0TA 4AKHA 4YSZA 2XZEA 3NKZA 2SPCA 3VRBA 4L5GA 4U31A 1HR0T 1E7PA 3AE8A 2CBJA 3IA3A 2LSGA 5KMGP 4H63H 5HWXA 3H37A 1ZEEA 2A9UA 5HEHA 4ILBA 3R6NA 4ZI2C 2IAKA 2J47A 4XZCA 2E9XC 2JQHA 3FZFB 2BG9A 1XNRT 2Y8DA 4HKAA 3RGLA 3ETVA 4E7ZA 2DI4A 3CX6B 4COFA 5FYMA 2V26A 4LFAT 5FL0A 4U72A 3ZJ1A 1HX1B 4V1Av 2ZM8A 2NP9A 4ZS2A 4EXTA 1J5WA 2UU9T 3QOFA 3KV9A 2WAUA 5EK2A 5FY7A 4I0UA 3SWHA 4TUYE 5LJNA 1XDPA 3QC9A 1NWMX 1IJ5A 1M7KA 3CX7B 4U2ZA 3EAMA 5LXTE 2BKOA 3AEBA 2XM1A 4EV6A 3VKGA 3S4UA 5JDNA 3NZPA 3FBLA 5DQWA 4U33A 3N2OA 2XUEA 2MPKA 2DL1A 3RHWA 4H9PC 4DR1T 3AEAA 2WP9A 1L0VA 3SOLA 3P7IA 5JR9B 4WNKA 1LKXA 5CGMA 1I6ZA 3IF8B 2A2FX 4DV2T 3ZYKA 2WDQA 5CJ5A 2BG9E 1IAPA 4ZI3D 3N9PA 4HFHA 2CA5A 4OFZA 4LMJA 2E5VA 2JIWA 3NVOA 2M67A 4GK0E 3P4RA 3UQ7A 3HKDE 4YFSA 4NXNT 4PAGA 1KF6A 3ZEFB 4A5XA 2ACXA 2N1GA 4JEUB 3U3IA 3EHZA 1HNXT 3NWIA 1YQ4A 2EHOB 3KV5A 4WYVA 4OYJA 4TN7B 5L3CB 4GOUA 4GKKT 5TAOA 1D1BA 4ADZA 2LSYA 2XQYA 3O1IA 3CWZB 2JPFA 3VHLA 3H3MA 5ETWA 3RKOA 4HE8A 1X79A 4PK6A 2Q9QD 2JMKA 4ZI3C 2V8SV 3ZYMA 1US7B 5HXEA 3MZKB 2MBGA 3ZKRA 2XAGB 5E0OA 5AQUB 4GKJT 1XZYA 5EK4A 1FEWA 4QH4A 3KVBA 2VQET 2W63A 2BVMA 1XWMA 5JDHA 5L3BB 2XSAA 1FMVA 1UUSA 3RYFE 4NIQA 1MMGA 3AE7A 3UULA 2R6GF 3OJAA 4K0UA 3F2EA 3AVSA
chains in the Genus database with same CATH topology
5FVKA 3ZT7A 2JQKA 4U7YA 4U2ZA 2V6YA 2WWVA 5CJ5A 1WFDA 2CPTA 4WZXA 5LB7B 4A5XA 5FVLA 4U7IA 2WY2A 4CN6A 3ZT5A 2V6YB 2XZEA 4U3CA 3EABA 2JQHA 3ZSTA 2A9UA 3ZT6A 2W2UA 3ZSSA 2DL1A 2V6XA 2K3WA 2LRLA 1YXRA 4U33A 4CN4A 4CN1A 2CRBA 2RPAA 4IT4A 4U2YA 4U31A 1WR0A 4NIQA 4P1NA 2MPKA 3K1SA 5CGMA 1WCRA 2LRKA 2JQ9A 4ZEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVK A;  3ZT7 A;  2JQK A;  4U7Y A;  4U2Z A;  2V6Y A;  2WWV A;  5CJ5 A;  1WFD A;  2CPT A;  4WZX A;  5LB7 B;  4A5X A;  5FVL A;  4U7I A;  2WY2 A;  4CN6 A;  3ZT5 A;  2V6Y B;  2XZE A;  4U3C A;  3EAB A;  2JQH A;  3ZST A;  2A9U A;  3ZT6 A;  2W2U A;  3ZSS A;  2DL1 A;  2V6X A;  2K3W A;  2LRL A;  1YXR A;  4U33 A;  4CN4 A;  4CN1 A;  2CRB A;  2RPA A;  4IT4 A;  4U2Y A;  4U31 A;  1WR0 A;  4NIQ A;  4P1N A;  2MPK A;  3K1S A;  5CGM A;  1WCR A;  2LRK A;  2JQ9 A;  4ZEY A; 
#chains in the Genus database with same CATH topology
 3PJA A;  3EUH A;  4X20 E;  5FVL A;  2K24 A;  2QVA A;  1EZ3 A;  4P09 A;  3RIF A;  2ZM2 A;  3BQI A;  4QHO A;  4ASK A;  4JUY A;  4DND A;  5KX5 E;  5CA1 E;  3WAJ A;  2X68 A;  2RP4 A;  5IUX A;  4H63 V;  4WBN E;  2IDO B;  5LG4 A;  3IBP A;  5LJM A;  2Z6E A;  1YKH B;  3I9Y A;  1R8I A;  2WMO A;  4C90 A;  1N34 T;  3HR0 A;  4ZS3 A;  5AQM B;  2I59 A;  4ZOL E;  5FY0 A;  2IC9 A;  5FP3 A;  4LFB T;  4P0B A;  3BK9 A;  4UV8 B;  2CCQ A;  2BVL A;  4PK5 A;  5LA6 E;  2W67 A;  2UXC T;  5JDG A;  3HA4 A;  4EYU A;  3ANW A;  3AE5 A;  2CPT A;  5FKY A;  3RYI E;  4YSX A;  3EI0 A;  3GA8 A;  3CIR A;  3FZM B;  3RQW A;  2BS2 A;  1LRZ A;  3E08 A;  5BMV E;  3OPC A;  3VR9 A;  2PG8 A;  4Q25 A;  4AI6 A;  2IML A;  2VB6 A;  3MA9 A;  4O2A E;  2WBL A;  4DR2 T;  4DUZ T;  2VKD A;  3FZK B;  4LF5 T;  4L0R A;  5AQF B;  2XQ8 A;  3PUZ F;  5CA0 E;  2VKJ A;  2WQY A;  2BKN A;  4ANJ A;  2DHR A;  2HN2 A;  5F5W A;  2ZMA A;  5F3J A;  5L4E A;  4LF7 T;  4DBR A;  4HGA A;  2ZLY A;  3BQL A;  3ZN0 B;  5AQV B;  4X1Y E;  5LP6 E;  2XJ7 A;  4IDP A;  2G0U A;  4KBM B;  2IIU A;  1LVF A;  2WWU A;  3AAA B;  2PFV A;  3PUS A;  1CHU A;  4HFB A;  3ZPO A;  5JRE A;  2OV9 A;  3SS1 A;  5KDM C;  3ZMT B;  4EIW A;  1LVK A;  3ZJ2 A;  4YTN A;  3E0Z A;  4DV6 T;  2PTF A;  4P1N A;  3P4P A;  2LSJ A;  4PJJ A;  2XSB A;  4UIG A;  2YDS A;  5DQV A;  2LKH A;  2KMF A;  1VCS A;  2AE9 A;  3P4W A;  2W61 A;  2JQK A;  2FJA A;  1KEY A;  4QXB B;  4TNV A;  4KHP T;  3AE3 A;  2LKG A;  2DCF A;  5AQJ B;  3EAB A;  3QK6 A;  5ABG A;  4QH5 A;  3UUX B;  4AQY T;  5C8Y E;  2BS4 A;  4FI5 A;  4IHJ E;  2K48 A;  5FXZ A;  4PJN A;  4DV1 T;  2NWB A;  3PU3 A;  3LBX B;  5L4H A;  2LHR A;  4IDO A;  4ZZB A;  3OYX A;  4MLK A;  4PW8 A;  2YOE A;  2XQ9 A;  2XQ4 A;  4I50 E;  4HN9 A;  2BKP A;  3I9W A;  4HWD A;  4TZ4 C;  3TLW A;  2V1D B;  2MAW A;  5LHI B;  2KLQ A;  5J0Z A;  4OYK A;  2XHE B;  4HFC A;  3A8Y C;  4YJ2 E;  3RLF F;  1MMD A;  5ABF B;  4JI4 T;  2V6Y B;  4TNW A;  3NZQ A;  3N2K E;  4H9R C;  2NTX A;  5AQI B;  2VWA A;  5LGN B;  3WAK A;  3N5L A;  5LCY A;  5HEO A;  1Z0P A;  4DMW A;  3N9L A;  1MMA A;  5ABE A;  3PUQ A;  4UVA B;  5FMN A;  2BG9 B;  4JI7 T;  3ZC1 A;  4BJN A;  3UU5 A;  2KND A;  3RYC E;  1OXZ A;  2KSR A;  4HFI A;  4JI3 T;  2C5K T;  5BR8 T;  2LOS A;  4LML A;  2XAF B;  2X0H A;  3CQX C;  3R84 B;  4OK0 A;  4BJM A;  4OX9 T;  3AEG A;  4U3C A;  5LBM A;  4J2C A;  2XY8 B;  2V5C A;  2XQ3 A;  3UT5 E;  3AE9 A;  4GIW A;  3FB2 A;  4EZH A;  4IIJ E;  4IE6 A;  4DID B;  1Y01 A;  4AQF C;  3MK7 C;  2N2N A;  2VL0 A;  3AE6 A;  3A7M A;  3Q2M A;  4YTM A;  3JAE A;  3RC3 A;  4X5T A;  2V7K A;  4I43 B;  3RRW A;  1QUU A;  3LG7 A;  3ONJ A;  1WR0 A;  1WYC A;  4IDZ A;  1IJ6 A;  2XQ7 A;  3CPZ A;  4PNI A;  4IL9 A;  1JNZ A;  2XAQ B;  3QB5 K;  2Y6X A;  1OWA A;  3ZMS B;  2A3D A;  4CI2 B;  1HFA A;  4EEB A;  3C50 A;  2EHO C;  5FY1 A;  4PFP A;  5AQT B;  2LJL A;  4AKL A;  3ONX A;  4JI0 T;  2LOP A;  4U7Y A;  2IW5 B;  2CXF A;  1M62 A;  3AE4 A;  4B3R T;  4YJ3 E;  3KV6 A;  3T1Y T;  3RX6 A;  2NTY A;  4KX6 A;  3K1S A;  3AE1 A;  4LFC T;  2YU2 A;  1HS7 A;  4DR7 T;  2BZB A;  2IHR 1;  2E9X B;  4PK4 A;  2HPL A;  4I55 E;  5LBQ B;  4UVB B;  4LF6 T;  5LHG B;  2UUC T;  5L2L A;  4UEL A;  1D1C A;  1WLX A;  1BR0 A;  2NOX A;  2W62 A;  1BR2 A;  3ABV A;  2XPK A;  4UF0 A;  2E2A A;  3LK2 B;  4BAY B;  2FJE A;  5AQR B;  2CHO A;  2KZ7 B;  5HXR A;  1WRD A;  4TWH A;  2UUB T;  4EYY R;  3L09 A;  4XAX B;  4CQI A;  3TLV A;  4X64 T;  4MHC A;  3PV0 F;  2K9A A;  4LF8 T;  1IBK T;  2JJ9 A;  5JR9 A;  2OLT A;  2L8K A;  4GYR A;  4YY3 T;  4TWF A;  4AQF A;  2H3R A;  2P9B A;  1J1J A;  3FXE B;  2WM9 A;  4ZEY A;  4FJO A;  4NUU A;  2I0M A;  2WWV A;  2QGS A;  1VCT A;  2JMH A;  5L3E B;  1U5P A;  4CN1 A;  2RPA A;  4JLE A;  2V7L A;  1MND A;  2VVN A;  5JDL A;  2WS3 A;  3UU6 A;  4P0A A;  3Q5W A;  3Q9D A;  1KK7 A;  1XDO A;  3ANW B;  4IDQ A;  4IRE A;  2KT9 A;  3ZT6 A;  2EHO A;  3PUY F;  1OED C;  1W9R A;  3M3Z B;  4HWI B;  3PDY A;  3TLT A;  2LRK A;  3OKQ A;  3ZLI A;  2CLY B;  2FJD A;  5H6R B;  2VL8 A;  5L3G B;  1H7C A;  5LMN T;  3LDQ B;  3A5X A;  3AEE A;  4B6X A;  1DU2 A;  4DV0 T;  2J4G A;  5HXH A;  4YXD A;  1KNR A;  2C5I T;  5FXX A;  3JC6 C;  4DR5 T;  3VR8 A;  2LSK A;  3L8R A;  3AVR A;  3N9Q A;  3N2G E;  2D2S A;  3LFM A;  4DV5 T;  4N78 D;  4BA9 A;  5JRC B;  2LLY A;  5AQH B;  4YT0 A;  3MKD A;  1CUN A;  4DV7 T;  3KV4 A;  3ONL C;  3W15 B;  2CXD A;  2K5B B;  1UX4 A;  3CML A;  1N36 T;  2YN6 A;  2NW7 A;  3KBU A;  3PE0 A;  2X9X A;  4AXP A;  2DNX A;  2W4X A;  5IHY A;  5LYJ E;  4AKR B;  3BQK A;  4LMK A;  1XNQ T;  4IGU A;  5JDM A;  3TKL B;  2FBW A;  3C4X A;  2LEH A;  3PJA J;  5JDQ A;  3RC8 A;  4X66 T;  4CI1 B;  4HFV A;  2IUB A;  4M1P A;  2V6X A;  1BR1 A;  2QA7 A;  4YLH A;  4ERR A;  3PU8 A;  3AB3 B;  3G06 A;  3P4S A;  4H9N C;  4L9I A;  2D0T A;  4DR6 T;  3N9M A;  4IL4 A;  4WBO A;  5HEG A;  3WI3 A;  4OHF A;  2LT3 A;  5LGT B;  2E8I A;  4KUM B;  2WU5 A;  1N33 T;  1AJ3 A;  3O9X A;  4A56 A;  2BS3 A;  5HAX A;  2Q9Q B;  2DWK A;  1UX5 A;  2MTQ A;  3CQG B;  3N9N A;  5JTG A;  3ZYL A;  1HX8 A;  4UVC B;  3UU4 A;  2LHN A;  3GN5 A;  4GK5 E;  4KP3 C;  3I1A A;  2LRL A;  2CRB A;  1UCU A;  1OED A;  4HFE A;  3T8O A;  3I0Q A;  3F31 A;  3JAD A;  2ODU A;  3Q5D A;  2XAH B;  3AXJ B;  2VVS A;  4AIU A;  1UUR A;  2NW8 A;  2D0U A;  3RPU A;  4EGW A;  4Z90 A;  1SE7 A;  4CXY A;  1MMN A;  5HXC A;  1HG2 A;  1Y64 B;  3QB5 A;  5A1L A;  2DLR A;  4PJL A;  3UUM A;  2V7M A;  3AEF A;  2X0Y A;  2WZH A;  4DVD A;  2GK9 A;  2X0L B;  2WU2 A;  5JVD E;  2UXB T;  3UU3 A;  3RI5 A;  2X51 A;  4IE7 A;  3UFG A;  3PUX F;  2IC6 A;  3RRC A;  1IZN B;  3V5S A;  2VUR A;  5FL1 A;  2V5D A;  4E7S A;  2OA5 A;  1WCR A;  4CN4 A;  3SFD A;  2W00 A;  3F57 A;  3P8C D;  4IE0 A;  1T8B A;  4TV8 E;  2N9D A;  1Z8U A;  3RYH E;  4AIS A;  3ZT5 A;  4A98 A;  2X66 A;  5FNV E;  5EZY E;  5AQK B;  3RH3 A;  4MAL A;  3PTR B;  1T72 A;  3KDS E;  3FHN A;  4ILC A;  1D0Z A;  5F8P A;  4CN6 A;  2XQ6 A;  2XQA A;  4ZXL A;  3K3N A;  4B3T T;  1QLB A;  1BR4 A;  4ILU A;  5FXV A;  1OED E;  1T7S A;  4JV5 T;  4ILA A;  5AQL B;  4H9O C;  1NAF A;  1HG5 A;  3LK4 2;  3B57 A;  4G63 A;  3LBX A;  4PJM A;  4DUY T;  2J62 A;  3KFW X;  4IE5 A;  5L47 A;  2H7O A;  3PUW F;  5HCJ A;  5ABH A;  1X9B A;  1HF8 A;  2JQQ A;  5AFU L;  1FIO A;  4CXX A;  2ACZ A;  2YEV C;  2HH7 A;  4X1K E;  1HNZ T;  2KWH A;  2BBH A;  5C2T A;  2YDQ A;  2UUA T;  3ZMV B;  4YTP A;  2ES0 A;  3CQC B;  3J7Y q;  5AQP B;  3U78 A;  4F8H A;  2HHH T;  3ZC0 A;  1FMW A;  2BDE A;  2EHO D;  3PUR A;  4YHJ A;  2V7J A;  2VK9 A;  2H7V C;  3C98 B;  3M65 A;  3Q5X A;  3PUG A;  5ABF A;  3ETU A;  4QXC B;  2V6Y A;  5M4Y A;  3P4Q A;  5HEU A;  5LGU B;  5JDF A;  5JR9 C;  3EVY A;  4UR9 A;  2W2U A;  4AKG A;  5LMU T;  4Z91 A;  3KIN B;  3AAE B;  3GMI A;  3RKG A;  2VKO A;  4UV9 B;  3AA1 B;  3ZMZ B;  3OTO T;  1U4Q A;  4NUV A;  1NEN A;  3PUV F;  4HFD A;  5HYA A;  3PUA A;  3SFE A;  1UGO A;  1GQE A;  3O1H A;  4O4L E;  1T98 A;  4O4I E;  3IHR A;  2CWO A;  3RQU A;  3NBX X;  4HEA A;  4ZHQ E;  1XMQ T;  4XBF B;  3B5M A;  1O3X A;  2B1E A;  2YKS A;  1MIW A;  1ZV4 X;  1HCI A;  4JI8 T;  4TX5 A;  4YHH T;  4QX7 B;  2WDV A;  3Q5E A;  4TWD A;  3DP7 A;  2CEA A;  1NEK A;  2VQF T;  4AQG A;  3AA7 B;  2ZM0 A;  4UF0 B;  4QH1 A;  2YDR A;  3EDV A;  3UU8 A;  1D0Y A;  2WB5 A;  4JI1 T;  1ZHC A;  1D1A A;  3ZCI A;  1I94 T;  3ZT7 A;  3LSV A;  1J5E T;  4MBQ A;  3JAF A;  2WDR A;  2WY2 A;  3VU7 H;  4HWH A;  3L3P A;  1V9D A;  3AA6 B;  1JNR A;  5AQQ B;  5H6Q B;  4DR3 T;  1YXR A;  3IEE A;  2NR4 A;  4DR4 T;  3C4Z A;  4CXW A;  4O8S A;  3QNU A;  5ADX L;  1E1H B;  2RA1 A;  3MAC A;  3HKE E;  4F6R C;  4EAH A;  5AQG B;  1SA0 E;  3UUN A;  1ZKE A;  4CI3 B;  3CKD A;  3I0O A;  4UXN B;  1S94 A;  2CLY C;  2YU1 A;  1D0X A;  3NRX A;  2D5U A;  4GYS A;  4DMV A;  2ODV A;  3FZL B;  5DJQ C;  5LB7 B;  5AQN B;  3AED A;  5C3J A;  3ZST A;  4KI0 F;  3HL6 A;  4IT4 A;  2XAJ B;  3CVR A;  5AQS B;  3GWH A;  5CB4 E;  4ZI7 E;  3C51 A;  2E9X A;  4TV9 E;  2CE7 A;  2H89 A;  3JC6 D;  1SHZ C;  4JI6 T;  2QRX A;  2WSS V;  4H9Q C;  3ZMU B;  3H3A A;  5LG3 A;  1YW0 A;  4I4T E;  4EB6 E;  3CK6 A;  5CFB A;  1IBL T;  3AE2 A;  4A97 A;  3FZH B;  4YSY A;  1YD8 G;  2QYW A;  3B13 A;  3DTO A;  4UEM A;  2KXP B;  5HEJ A;  3QUJ A;  1ZP0 A;  4IE4 A;  2VKH A;  3LK3 B;  2XTL A;  1QSD A;  1S35 A;  3K3Q C;  1HNW T;  3LJC A;  2E5L T;  1G8X A;  4G2A A;  4NPP A;  1WR6 A;  2M6I A;  3FBZ A;  3P50 A;  4PFO A;  4O2B E;  4EED A;  5HWY A;  2V7I A;  4DO0 A;  3K8P C;  4QX8 B;  2WMN A;  4Z8X A;  5LOV E;  5J1G A;  2Q9Q C;  4U2Y A;  2LM9 A;  3RIA A;  1YKE B;  3ZCJ A;  2LE8 A;  2L9Q A;  5KXJ A;  3E22 E;  2PBI A;  1UK5 A;  4JI2 T;  3DJB A;  2F4V T;  3UFE A;  1W0B A;  4JYA T;  3X1D A;  4ISS A;  4U7I A;  3SRZ A;  2XM2 A;  5GON E;  2HN1 A;  2JRK A;  1YQ3 A;  3CX8 B;  1XMO T;  2DWG A;  3AA0 B;  4ZZC A;  3T1H T;  3TLS A;  4CZZ B;  1G73 A;  2LSI A;  3NRY A;  1MIV A;  3ESL A;  2JQ9 A;  2CBI A;  5HCM A;  4KHZ F;  3UQ4 A;  4H9S E;  3KBT A;  4IST A;  5FXW A;  2A72 A;  4QXH B;  5JQG E;  2CHN A;  5DAB A;  1ZOY A;  4EOZ B;  3GN5 B;  2HPJ A;  2WCA A;  2ZM6 T;  2C0S A;  4X65 T;  1OED B;  2X67 A;  3RIU C;  2CM0 A;  1MNE A;  4C91 A;  5JRC A;  1W0A A;  4HWF A;  3EDU A;  4HTE A;  5L3D B;  3FXD B;  4JI5 T;  2K3W A;  2J1D G;  2W66 A;  3KVA A;  3C4W A;  2UXN B;  3AEC A;  2MYS A;  5LNK A;  2X9Y A;  3L39 A;  2PJQ A;  5IWA T;  4O4H E;  2XAS B;  1N32 T;  3MJX A;  3OYZ A;  2Y48 B;  2XQ5 A;  4JBW F;  4DV3 T;  3RF1 A;  3AAI A;  2FUP A;  3JCF A;  4EZ4 A;  3VKH A;  2KIN B;  5IYZ E;  2CWY A;  3O1J A;  4K0K T;  1FJG T;  2CXL A;  2H88 A;  4LF4 T;  3O4X E;  3OVU A;  4JEH B;  2CMR A;  3K3O A;  1VRB A;  1WYB A;  1B7T A;  1E2A A;  2W0G A;  3HKC E;  4X1I E;  2B76 A;  4DV4 T;  3J9X 1;  2BG9 C;  2VAS A;  4AKI A;  5HXS A;  4QKN A;  3HKB E;  1IBM T;  3UUB A;  1W09 A;  2AXD S;  2Q9Q A;  3VRA A;  1SUM B;  5FVK A;  2LM2 A;  2FJB A;  5JH7 E;  4DBQ A;  4X62 T;  2X9H A;  4QWN B;  5J2U E;  2I6H A;  3TLU A;  4U74 A;  4WW0 A;  3C64 A;  1KNP A;  1HTJ F;  4LF9 T;  2KWI B;  3AXJ A;  5L3F B;  4HWC A;  3ZN1 B;  1WFD A;  4WZX A;  3HI2 A;  4B3M T;  2UXX B;  4IDN A;  2C5J A;  3UTK A;  4NXM T;  2UXD T;  2BBJ A;  3ZSS A;  4B3S T;  4O4J E;  4KMC A;  3OBV E;  5J2T E;  5EK3 A;  4ZI2 D;  3RIU A;  1KNZ A;  2X9W A;  2E9X D;  1KFY A;  1VOM A;  2D9D A;  2NW9 A;  4MFR A;  2YK0 A;  5LHH B;  3MXZ A;  2MOZ A;  2WZI A;  1MIY A;  2L3L A;  5AQO B;  3V5U A;  2M6B A;  3N9O A;  2YIN A;  3D0T A;  4AKH A;  4YSZ A;  2XZE A;  3NKZ A;  2SPC A;  3VRB A;  4L5G A;  4U31 A;  1HR0 T;  1E7P A;  3AE8 A;  2CBJ A;  3IA3 A;  2LSG A;  5KMG P;  4H63 H;  5HWX A;  3H37 A;  1ZEE A;  2A9U A;  5HEH A;  4ILB A;  3R6N A;  4ZI2 C;  2IAK A;  2J47 A;  4XZC A;  2E9X C;  2JQH A;  3FZF B;  2BG9 A;  1XNR T;  2Y8D A;  4HKA A;  3RGL A;  3ETV A;  4E7Z A;  2DI4 A;  3CX6 B;  4COF A;  5FYM A;  2V26 A;  4LFA T;  5FL0 A;  4U72 A;  3ZJ1 A;  1HX1 B;  4V1A v;  2ZM8 A;  2NP9 A;  4ZS2 A;  4EXT A;  1J5W A;  2UU9 T;  3QOF A;  3KV9 A;  2WAU A;  5EK2 A;  5FY7 A;  4I0U A;  3SWH A;  4TUY E;  5LJN A;  1XDP A;  3QC9 A;  1NWM X;  1IJ5 A;  1M7K A;  3CX7 B;  4U2Z A;  3EAM A;  5LXT E;  2BKO A;  3AEB A;  2XM1 A;  4EV6 A;  3VKG A;  3S4U A;  5JDN A;  3NZP A;  3FBL A;  5DQW A;  4U33 A;  3N2O A;  2XUE A;  2MPK A;  2DL1 A;  3RHW A;  4H9P C;  4DR1 T;  3AEA A;  2WP9 A;  1L0V A;  3SOL A;  3P7I A;  5JR9 B;  4WNK A;  1LKX A;  5CGM A;  1I6Z A;  3IF8 B;  2A2F X;  4DV2 T;  3ZYK A;  2WDQ A;  5CJ5 A;  2BG9 E;  1IAP A;  4ZI3 D;  3N9P A;  4HFH A;  2CA5 A;  4OFZ A;  4LMJ A;  2E5V A;  2JIW A;  3NVO A;  2M67 A;  4GK0 E;  3P4R A;  3UQ7 A;  3HKD E;  4YFS A;  4NXN T;  4PAG A;  1KF6 A;  3ZEF B;  4A5X A;  2ACX A;  2N1G A;  4JEU B;  3U3I A;  3EHZ A;  1HNX T;  3NWI A;  1YQ4 A;  2EHO B;  3KV5 A;  4WYV A;  4OYJ A;  4TN7 B;  5L3C B;  4GOU A;  4GKK T;  5TAO A;  1D1B A;  4ADZ A;  2LSY A;  2XQY A;  3O1I A;  3CWZ B;  2JPF A;  3VHL A;  3H3M A;  5ETW A;  3RKO A;  4HE8 A;  1X79 A;  4PK6 A;  2Q9Q D;  2JMK A;  4ZI3 C;  2V8S V;  3ZYM A;  1US7 B;  5HXE A;  3MZK B;  2MBG A;  3ZKR A;  2XAG B;  5E0O A;  5AQU B;  4GKJ T;  1XZY A;  5EK4 A;  1FEW A;  4QH4 A;  3KVB A;  2VQE T;  2W63 A;  2BVM A;  1XWM A;  5JDH A;  5L3B B;  2XSA A;  1FMV A;  1UUS A;  3RYF E;  4NIQ A;  1MMG A;  3AE7 A;  3UUL A;  2R6G F;  3OJA A;  4K0U A;  3F2E A;  3AVS A; 
#chains in the Genus database with same CATH homology
 5FVK A;  3ZT7 A;  2JQK A;  4U7Y A;  4U2Z A;  2V6Y A;  2WWV A;  5CJ5 A;  1WFD A;  2CPT A;  4WZX A;  5LB7 B;  4A5X A;  5FVL A;  4U7I A;  2WY2 A;  4CN6 A;  3ZT5 A;  2V6Y B;  2XZE A;  4U3C A;  3EAB A;  2JQH A;  3ZST A;  2A9U A;  3ZT6 A;  2W2U A;  3ZSS A;  2DL1 A;  2V6X A;  2K3W A;  2LRL A;  1YXR A;  4U33 A;  4CN4 A;  4CN1 A;  2CRB A;  2RPA A;  4IT4 A;  4U2Y A;  4U31 A;  1WR0 A;  4NIQ A;  4P1N A;  2MPK A;  3K1S A;  5CGM A;  1WCR A;  2LRK A;  2JQ9 A;  4ZEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...