2WWVA

Nmr structure of the iiachitobiose-iibchitobiose complex of the n,n'- diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2wwvA00
3ZSTA 2V6YB 4NIQA 4U31A 2WWVA 4ZEYA 4IT4A 4CN4A 4U7YA 5FVKA 4U33A 2WY2A 2A9UA 2W2UA 4P1NA 2JQKA 1WFDA 4U3CA 4U2ZA 2RPAA 4CN1A 2CRBA 2V6XA 4WZXA 5CGMA 4CN6A 2XZEA 5LB7B 3ZT5A 4U7IA 3ZSSA 2LRLA 2MPKA 2DL1A 3ZT6A 1WR0A 3EABA 2K3WA 5CJ5A 1WCRA 3K1SA 2JQHA 2CPTA 1YXRA 4A5XA 3ZT7A 2JQ9A 2LRKA 5FVLA 4U2YA 2V6YA
chains in the Genus database with same CATH superfamily
1D1AA 1B7TA 3CQGB 4QWNB 5L3FB 4O4IE 5L2LA 2W62A 5J2UE 2WBLA 2ZLYA 2LLYA 5LJNA 2Q9QA 3OBVE 3AE5A 2X51A 4I50E 5CFBA 3KV5A 1IZNB 4F6RC 3GMIA 5FP3A 3BQLA 4DUYT 1VCSA 4JI1T 2IIUA 1BR0A 2LE8A 3RIUA 3RPUA 4EEBA 5JVDE 3H3AA 4DR4T 4KBMB 2NW9A 1KNPA 2NTYA 1OEDC 3EDUA 4HFVA 5LNKA 1WFDA 2OV9A 3ZN1B 4LFBT 4NPPA 2X0YA 3ABVA 2CPTA 2CE7A 4O2AE 2JMKA 4ILAA 3ZCJA 3FZLB 2M67A 3Q5XA 1KNZA 5FY0A 4OFZA 5L4EA 2VKJA 1JNRA 3VU7H 4ANJA 5AQQB 5C8YE 4JI2T 2LJLA 3ZT7A 2CXDA 1LRZA 3EHZA 1OXZA 4DV1T 2YDSA 3T8OA 1IBMT 4WBOA 1S35A 4PW8A 2WAUA 4IE0A 3KV9A 1E1HB 2GK9A 3UUNA 3ZC1A 5AQIB 3AAEB 5A1LA 2WM9A 2Y8DA 4BJMA 3ZMVB 2V5DA 4IE4A 4HFEA 1T72A 5EK4A 2CLYC 4FI5A 3P4PA 2B1EA 3RF1A 4EYYR 5J1GA 4LFAT 1MIYA 3KINB 3HKEE 5H6RB 5ETWA 5AFUL 2IC9A 3L09A 4U3CA 2D0TA 5LBMA 3P4WA 3ZMUB 4P0BA 2H7VC 5LB7B 5FKYA 2UUBT 5JTGA 2E5VA 4ZI2C 1OEDB 2B76A 4IDQA 4IHJE 4TNWA 5LGUB 5CGMA 2ZM8A 4ILCA 4DO0A 1O3XA 3ZSSA 3OJAA 2KT9A 3AA1B 1MMGA 3CIRA 2CMRA 2UXCT 4KI0F 1HG2A 2HH7A 4HFBA 4DMVA 3SFEA 2CM0A 5IWAT 3AAIA 2LOSA 3IF8B 4LF4T 2JQQA 2K5BB 4X65T 4AQFA 4X20E 4CN6A 5JQGE 1XMQT 2J4GA 4GK5E 3FZFB 1LKXA 3ZSTA 5LJMA 4KHPT 4YY3T 4TWHA 5HWYA 1IJ5A 5AQHB 3VR9A 4DUZT 1T7SA 4C91A 4EGWA 3ZT6A 2K24A 1QLBA 2ZMAA 4EYUA 2MBGA 3FB2A 1OEDA 3RRCA 4YTNA 4B3RT 2K9AA 5DJQC 5KDMC 3AECA 5JDGA 2BVLA 3ZEFB 2XAJB 2XTLA 3NVOA 4NXMT 3AE4A 3DTOA 4DVDA 5J0ZA 3RKOA 5ABEA 3ONXA 4O4HE 1FMVA 3AE1A 4U2YA 3K3OA 4TWFA 4GYRA 5FVKA 5GONE 3KFWX 2BBJA 2YOEA 4QXCB 1BR2A 1IJ6A 2X68A 3O4XE 3F31A 1WCRA 3JCFA 3PUYF 1UURA 2G0UA 4XZCA 1WLXA 4P0AA 4P1NA 1N33T 4CXXA 3AE3A 3UU5A 4H9RC 5FNVE 5BR8T 4EOZB 4GIWA 2XQ3A 3KBUA 4BAYB 3PDYA 3ZYLA 1D1BA 3PURA 1HG5A 2H7OA 4PK5A 1R8IA 1LVKA 5LGTB 2YDRA 2L9QA 2C0SA 5AQRB 1N34T 1SUMB 2YINA 2BZBA 1D0YA 1X9BA 4IDOA 2YEVC 2IMLA 3I0OA 3GN5A 3N9PA 1MIWA 3MJXA 3AB3B 4MBQA 2I59A 1MMDA 3CVRA 4LF5T 1XMOT 5LYJE 4ASKA 5KXJA 1E2AA 4IGUA 5ABFB 1V9DA 5F8PA 2JQHA 3RYCE 1W0BA 4JI0T 5LHIB 4X1KE 2CEAA 1W9RA 4ERRA 2CHOA 4YSZA 2NOXA 4U7YA 4GYSA 3I9WA 2VASA 3ZJ2A 3PUVF 1Y64B 5LGNB 2EHOB 1FIOA 2MAWA 1WR6A 4QHOA 4JV5T 5F5WA 1YKHB 1CUNA 2DWGA 4H9QC 4ADZA 3UU6A 1VCTA 5JREA 2V1DB 2HN1A 2F4VT 2BKPA 5FMNA 2A3DA 3C98B 4YSYA 2FUPA 1G8XA 3J9X1 4K0UA 4YXDA 3ONLC 2YU2A 2WB5A 3MK7C 5ABFA 3HI2A 4DV2T 2YU1A 3QUJA 2LRLA 5HWXA 1YXRA 3P4QA 4IDPA 4JEUB 2DCFA 3TLTA 2OLTA 3EAMA 4DR1T 2W4XA 2AXDS 4YHJA 2Y6XA 5LG4A 2QGSA 2UUAT 3SWHA 4JUYA 1QUUA 3GA8A 4HE8A 3OPCA 4UIGA 2EHOA 3ZYMA 3E0ZA 2XM1A 1SHZC 4GK0E 2XQ7A 1IBLT 4QH1A 5CA0E 4LMJA 3SOLA 4ZXLA 2C5IT 1Z0PA 2LEHA 4M1PA 3FXDB 3P50A 5JDHA 2WU2A 2VWAA 5LHHB 2X9HA 2A2FX 4TNVA 2CXLA 2VKOA 1MIVA 3LK42 3RIAA 3JADA 4JI6T 3CK6A 5FXVA 5IHYA 2XQ8A 1Z8UA 3E22E 1UGOA 3RKGA 3P4SA 4UV9B 4X66T 4P09A 3AA7B 4H9SE 3W15B 5IYZE 3AVRA 2LRKA 4IE5A 3N9NA 2UXNB 2WZHA 2ZM2A 4X5TA 3CX8B 3ANWA 3PV0F 4UELA 4BA9A 3OTOT 3AE8A 2FJAA 4O4JE 5AQSB 2JJ9A 4QX7B 3UT5E 5AQOB 2QYWA 1T98A 4HWFA 4TUYE 1FMWA 5LBQB 4O8SA 5HEHA 2E9XA 5JH7E 3AEGA 2NWBA 2KWHA 4WZXA 3ZC0A 3AE6A 4YJ2E 4JYAT 3EABA 2BVMA 3RYIE 5CJ5A 1HFAA 3PUSA 1FJGT 1U4QA 2Z6EA 2XJ7A 2XAFB 2IDOB 3WI3A 4HFIA 2X67A 1US7B 4DBQA 4YTPA 2XHEB 5HEJA 3B5MA 4EIWA 2WDRA 3WAKA 3CQXC 2XQ4A 3LBXB 5HCJA 2HPJA 2V8SV 1HR0T 1S94A 3OYZA 5FYMA 2JMHA 2WZIA 1OWAA 4WNKA 4DNDA 3I9YA 2A72A 2W2UA 4ZI2D 4PAGA 5JR9B 1KNRA 3C4XA 4A97A 3K3NA 4CZZB 4U72A 2V7MA 4CQIA 4QKNA 4ISSA 3ZCIA 1GQEA 3CPZA 4IL4A 3AE7A 5ADXL 2KXPB 4A98A 5JRCB 1HX1B 3RQUA 2V6XA 4HFDA 1YKEB 4HN9A 1UX4A 2FJEA 5HXSA 1ZHCA 3H37A 2L3LA 4ILBA 3MXZA 2LHRA 4B3MT 3LBXA 4LFCT 5AQPB 1J5WA 2BG9C 2XASB 1HTJF 3KVBA 4QH5A 3DP7A 4JI4T 2H88A 2BKNA 1XWMA 2KWIB 2X9YA 1NENA 3CKDA 5LMNT 3A8YC 2UU9T 4KP3C 3O1HA 3N5LA 1W0AA 2WWUA 4B3ST 2AE9A 3LDQB 4UF0B 5JR9A 4ZS2A 3U3IA 2DL1A 4I55E 1L0VA 4JLEA 3I1AA 4DR6T 4WBNE 5EK2A 1XDPA 4JI5T 3MA9A 2NP9A 2WU5A 4ILUA 2V7KA 3PUQA 3Q2MA 2ZM6T 3NZPA 3SRZA 2X0HA 3F57A 5ABHA 2CBIA 2WSSV 3HKCE 2KMFA 4LF8T 3PUZF 2WS3A 2IC6A 2CHNA 1NEKA 3SFDA 2XUEA 4GOUA 3BK9A 2A9UA 2V5CA 2BBHA 4L5GA 3ZN0B 3H3MA 2E8IA 3UULA 4X64T 1D0XA 4BJNA 4Q25A 2L8KA 3I0QA 2DLRA 1KF6A 3NKZA 1ZEEA 2LHNA 4KUMB 1OEDE 2YN6A 4UF0A 3AE2A 2XSAA 5EZYE 4LF9T 5AQKB 2YK0A 4DR2T 1HNZT 4U7IA 2DNXA 4E7ZA 2CLYB 2DWKA 2RP4A 4DBRA 3PU8A 1D0ZA 2C5KT 3SS1A 2BS2A 5AQMB 3VR8A 5LMUT 3FZMB 4NUVA 2BG9B 4CI1B 4QXBB 2W00A 3RGLA 2Q9QD 2RA1A 4PJMA 3RLFF 4JBWF 2FJDA 2WMOA 4HWDA 3N9OA 2X66A 2V7LA 2VB6A 1T8BA 4KHZF 5DABA 5L3DB 3ZLIA 5L3CB 2WQYA 3R84B 3UFGA 1BR1A 1WR0A 3MKDA 3Q5WA 3IBPA 3RHWA 1VRBA 3UU4A 1UX5A 4I0UA 3V5SA 2MYSA 4MALA 4DV7T 1HX8A 2FBWA 2KINB 3B13A 5H6QB 1WRDA 2ZM0A 4OHFA 2WP9A 5BMVE 4AIUA 2XQ9A 2IUBA 4LMKA 4E7SA 5J2TE 2MTQA 4ZEYA 2KLQA 2ES0A 2PTFA 2BG9A 3ZMTB 4U2ZA 4ZZBA 2ODUA 4CXYA 3AVSA 2Q9QC 2V7IA 5IUXA 2W66A 1J5ET 4UR9A 3VKGA 3N9LA 2OA5A 4K0KT 4J2CA 3C4ZA 3QNUA 2LT3A 2D0UA 4ISTA 2RPAA 3RIUC 3PTRB 3RYFE 4YHHT 5F3JA 3ZT5A 5FL0A 2UXXB 3N2GE 2VVNA 4LMLA 2XAGB 3WAJA 2XQ5A 2XQ6A 4XAXB 4U33A 3V5UA 4YTMA 2CRBA 4H63H 3ZMZB 1IBKT 2NW7A 2CWOA 3PUGA 3ESLA 2PFVA 3KV4A 3UQ7A 2LOPA 4QH4A 2E2AA 2CCQA 1SA0E 4ZZCA 3IA3A 2LSJA 3HKBE 2UXBT 4IE6A 5AQGB 4YSXA 3AEAA 3VRBA 1XDOA 2VVSA 3L8RA 3RC3A 2FJBA 1N36T 2CA5A 4IIJE 4LF6T 2UUCT 5AQTB 1YQ3A 2LSIA 3KV6A 3Q9DA 1D1CA 4QX8B 2YKSA 2VK9A 2LSGA 3UUMA 3L3PA 3S4UA 3G06A 5FY1A 3AXJB 2VL8A 3O1JA 1IAPA 3FZKB 4HWCA 2LKHA 4DV4T 2KSRA 2JRKA 4UXNB 4FJOA 3BQKA 3PJAA 1Y01A 1N32T 1LVFA 1ZKEA 4IE7A 1HS7A 5FVLA 2M6IA 1KK7A 2X9XA 4AKIA 4AKGA 4KMCA 4HFHA 3UQ4A 2W0GA 4AKLA 2BKOA 2HPLA 5LCYA 5HXEA 3PE0A 4F8HA 2E5LT 4DR5T 2BDEA 1WYBA 3PU3A 2XSBA 3JC6C 4HGAA 2HN2A 4WW0A 1W09A 2WCAA 4DMWA 4COFA 2LKGA 3KVAA 4H63V 3CQCB 4HTEA 1XZYA 2P9BA 2PJQA 3C50A 1M62A 4L0RA 2N1GA 2V26A 4GKJT 3AXJA 4GKKT 4TV9E 5JDMA 4WYVA 3MACA 5E0OA 2D9DA 3Q5DA 4AQFC 4UEMA 4CN1A 5AQVB 3RX6A 1MNDA 5LXTE 3MZKB 4DR7T 2J62A 3J7Yq 1MMNA 3RI5A 4H9NC 3ETUA 3JAFA 5ABGA 3B57A 1EZ3A 5TAOA 3AE9A 4IL9A 4CXWA 5C2TA 1U5PA 3FZHB 3NWIA 5KMGP 3N2OA 4ZS3A 1WYCA 3PUAA 4N78D 4DV0T 5M4YA 3LG7A 3AEFA 3UTKA 1UUSA 1I94T 3CWZB 1HNXT 4I4TE 1HCIA 5KX5E 2LSKA 3OKQA 4DV5T 2ACZA 2QVAA 3UUBA 2LM2A 4L9IA 5EK3A 2WDQA 3QC9A 4B6XA 4H9OC 4EAHA 1ZV4X 3PJAJ 4NXNT 4IDZA 1YQ4A 2DHRA 3UFEA 3CX6B 3C64A 3QB5A 1QSDA 3A5XA 1KFYA 2VQET 1G73A 2XQYA 5HEOA 3P8CD 4MFRA 3UU3A 3R6NA 4G63A 4EB6E 1I6ZA 2NTXA 2W61A 3O1IA 4Z90A 5FXWA 2I0MA 3P4RA 4B3TT 3RYHE 2JPFA 2V7JA 3U78A 2XAHB 2UXDT 2H3RA 3HL6A 3GWHA 1J1JA 3PUXF 2MOZA 2NR4A 3TLWA 2XZEA 3QOFA 4O4LE 3E08A 5L3EB 5FY7A 3NBXX 5HCMA 2X0LB 3IEEA 4TV8E 4UVCB 4EV6A 4I43B 4TN7B 4JI7T 4PK4A 4UVAB 2LM9A 4AKHA 2CBJA 3ZKRA 4IDNA 5HXHA 4A5XA 4V1Av 2QA7A 3FBZA 4IREA 1FEWA 3A7MA 3L39A 2SPCA 5JRCA 1XNRT 3UUXB 5JDFA 4MLKA 1H7CA 5AQFB 4HFCA 2XPKA 2K48A 5HAXA 5FL1A 4U74A 1AJ3A 2QRXA 4YT0A 4YLHA 5HXRA 4X1YE 4TZ4C 4EZHA 2EHOD 5AQUB 3BQIA 1M7KA 3NRXA 1MMAA 2ODVA 3IHRA 2R6GF 3AEEA 4A56A 1X79A 3ONJA 2VKHA 5AQNB 2J1DG 3LK3B 2C5JA 3FBLA 5HEUA 3T1HT 4OX9T 5FXXA 3DJBA 2M6BA 4ZI7E 5FXZA 5L3BB 2D5UA 3N9MA 2H89A 4HWHA 1MNEA 4DV6T 4AQYT 4Z8XA 4DIDB 3VHLA 3C4WA 4PFPA 5L47A 3F2EA 2N9DA 3UU8A 3HR0A 2VURA 4OK0A 2VQFT 2IW5B 4XBFB 1HNWT 2EHOC 4EXTA 3AEBA 4G2AA 3QK6A 5CA1E 4X1IE 3GN5B 4JEHB 3VKHA 1DU2A 3C51A 5JDQA 2W67A 2E9XD 4TX5A 4EEDA 4AQGA 3JAEA 4NUUA 2IAKA 3FXEB 4PJJA 2JIWA 3PUWF 4AKRB 2WY2A 3TLUA 4OYKA 1NAFA 3AA0B 4H9PC 3K1SA 4LF7T 4Z91A 3EVYA 5LP6E 3OYXA 3RQWA 1VOMA 3NZQA 1XNQT 2JQKA 2BG9E 4AISA 3RRWA 4PK6A 4DV3T 2HHHT 3EI0A 4AI6A 2DI4A 2MPKA 3TLSA 5DQVA 5LHGB 2LSYA 3ZJ1A 1KEYA 2E9XC 2V6YB 1JNZA 2N2NA 3VRAA 1CHUA 1YD8G 3N9QA 2PBIA 1NWMX 2XAQB 1SE7A 5LG3A 4AXPA 4ZI3D 3ZPOA 4MHCA 1E7PA 1UK5A 4PFOA 4PJNA 4HKAA 3RC8A 4HEAA 5AQJB 5AQLB 3FHNA 2KZ7B 3K8PC 4O2BE 4PNIA 3P7IA 2XY8B 3K3QC 4JI3T 2WDVA 5HYAA 2K3WA 2KNDA 2XM2A 3NRYA 4CI2B 2J47A 4ZOLE 2WWVA 2XQAA 4CN4A 5CB4E 3CMLA 4UV8B 3LSVA 5L3GB 4DR3T 3ZMSB 4KX6A 3CX7B 2VKDA 1ZP0A 3HA4A 5DQWA 2Y48B 3AA6B 3JC6D 2BS3A 3AAAB 2X9WA 2V6YA 4YFSA 2WMNA 4NIQA 2IHR1 4IT4A 2W63A 2YDQA 3KDSE 3KBTA 3RIFA 4QXHB 3M3ZB 2D2SA 4HWIB 4ZI3C 4UVBB 5HEGA 2CXFA 3EUHA 3O9XA 3LFMA 2I6HA 2PG8A 4TWDA 3ANWB 3OVUA 4EZ4A 3N2KE 3Q5EA 2Q9QB 2CWYA 4X62T 3X1DA 1UCUA 3AEDA 2JQ9A 2VL0A 4U31A 3TLVA 4C90A 2E9XB 4ZHQE 4PJLA 3QB5K 5JDNA 1ZOYA 5HXCA 5JDLA 3LK2B 3D0TA 4JI8T 3T1YT 3TKLB 3RH3A 1BR4A 3EDVA 3ETVA 4OYJA 3LJCA 3M65A 5JR9C 5LA6E 3ZYKA 4CI3B 3HKDE 4YJ3E 2BS4A 5L4HA 2NW8A 2ACXA 5C3JA 5LOVE 1HF8A 1YW0A
chains in the Genus database with same CATH topology
3ZSTA 2V6YB 4NIQA 4U31A 2WWVA 4ZEYA 4IT4A 4CN4A 4U7YA 5FVKA 4U33A 2WY2A 2A9UA 2W2UA 4P1NA 2JQKA 1WFDA 4U3CA 4U2ZA 2RPAA 4CN1A 2CRBA 2V6XA 4WZXA 5CGMA 4CN6A 2XZEA 5LB7B 3ZT5A 4U7IA 3ZSSA 2LRLA 2MPKA 2DL1A 3ZT6A 1WR0A 3EABA 2K3WA 5CJ5A 1WCRA 3K1SA 2JQHA 2CPTA 1YXRA 4A5XA 3ZT7A 2JQ9A 2LRKA 5FVLA 4U2YA 2V6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZST A;  2V6Y B;  4NIQ A;  4U31 A;  2WWV A;  4ZEY A;  4IT4 A;  4CN4 A;  4U7Y A;  5FVK A;  4U33 A;  2WY2 A;  2A9U A;  2W2U A;  4P1N A;  2JQK A;  1WFD A;  4U3C A;  4U2Z A;  2RPA A;  4CN1 A;  2CRB A;  2V6X A;  4WZX A;  5CGM A;  4CN6 A;  2XZE A;  5LB7 B;  3ZT5 A;  4U7I A;  3ZSS A;  2LRL A;  2MPK A;  2DL1 A;  3ZT6 A;  1WR0 A;  3EAB A;  2K3W A;  5CJ5 A;  1WCR A;  3K1S A;  2JQH A;  2CPT A;  1YXR A;  4A5X A;  3ZT7 A;  2JQ9 A;  2LRK A;  5FVL A;  4U2Y A;  2V6Y A; 
#chains in the Genus database with same CATH topology
 1D1A A;  1B7T A;  3CQG B;  4QWN B;  5L3F B;  4O4I E;  5L2L A;  2W62 A;  5J2U E;  2WBL A;  2ZLY A;  2LLY A;  5LJN A;  2Q9Q A;  3OBV E;  3AE5 A;  2X51 A;  4I50 E;  5CFB A;  3KV5 A;  1IZN B;  4F6R C;  3GMI A;  5FP3 A;  3BQL A;  4DUY T;  1VCS A;  4JI1 T;  2IIU A;  1BR0 A;  2LE8 A;  3RIU A;  3RPU A;  4EEB A;  5JVD E;  3H3A A;  4DR4 T;  4KBM B;  2NW9 A;  1KNP A;  2NTY A;  1OED C;  3EDU A;  4HFV A;  5LNK A;  1WFD A;  2OV9 A;  3ZN1 B;  4LFB T;  4NPP A;  2X0Y A;  3ABV A;  2CPT A;  2CE7 A;  4O2A E;  2JMK A;  4ILA A;  3ZCJ A;  3FZL B;  2M67 A;  3Q5X A;  1KNZ A;  5FY0 A;  4OFZ A;  5L4E A;  2VKJ A;  1JNR A;  3VU7 H;  4ANJ A;  5AQQ B;  5C8Y E;  4JI2 T;  2LJL A;  3ZT7 A;  2CXD A;  1LRZ A;  3EHZ A;  1OXZ A;  4DV1 T;  2YDS A;  3T8O A;  1IBM T;  4WBO A;  1S35 A;  4PW8 A;  2WAU A;  4IE0 A;  3KV9 A;  1E1H B;  2GK9 A;  3UUN A;  3ZC1 A;  5AQI B;  3AAE B;  5A1L A;  2WM9 A;  2Y8D A;  4BJM A;  3ZMV B;  2V5D A;  4IE4 A;  4HFE A;  1T72 A;  5EK4 A;  2CLY C;  4FI5 A;  3P4P A;  2B1E A;  3RF1 A;  4EYY R;  5J1G A;  4LFA T;  1MIY A;  3KIN B;  3HKE E;  5H6R B;  5ETW A;  5AFU L;  2IC9 A;  3L09 A;  4U3C A;  2D0T A;  5LBM A;  3P4W A;  3ZMU B;  4P0B A;  2H7V C;  5LB7 B;  5FKY A;  2UUB T;  5JTG A;  2E5V A;  4ZI2 C;  1OED B;  2B76 A;  4IDQ A;  4IHJ E;  4TNW A;  5LGU B;  5CGM A;  2ZM8 A;  4ILC A;  4DO0 A;  1O3X A;  3ZSS A;  3OJA A;  2KT9 A;  3AA1 B;  1MMG A;  3CIR A;  2CMR A;  2UXC T;  4KI0 F;  1HG2 A;  2HH7 A;  4HFB A;  4DMV A;  3SFE A;  2CM0 A;  5IWA T;  3AAI A;  2LOS A;  3IF8 B;  4LF4 T;  2JQQ A;  2K5B B;  4X65 T;  4AQF A;  4X20 E;  4CN6 A;  5JQG E;  1XMQ T;  2J4G A;  4GK5 E;  3FZF B;  1LKX A;  3ZST A;  5LJM A;  4KHP T;  4YY3 T;  4TWH A;  5HWY A;  1IJ5 A;  5AQH B;  3VR9 A;  4DUZ T;  1T7S A;  4C91 A;  4EGW A;  3ZT6 A;  2K24 A;  1QLB A;  2ZMA A;  4EYU A;  2MBG A;  3FB2 A;  1OED A;  3RRC A;  4YTN A;  4B3R T;  2K9A A;  5DJQ C;  5KDM C;  3AEC A;  5JDG A;  2BVL A;  3ZEF B;  2XAJ B;  2XTL A;  3NVO A;  4NXM T;  3AE4 A;  3DTO A;  4DVD A;  5J0Z A;  3RKO A;  5ABE A;  3ONX A;  4O4H E;  1FMV A;  3AE1 A;  4U2Y A;  3K3O A;  4TWF A;  4GYR A;  5FVK A;  5GON E;  3KFW X;  2BBJ A;  2YOE A;  4QXC B;  1BR2 A;  1IJ6 A;  2X68 A;  3O4X E;  3F31 A;  1WCR A;  3JCF A;  3PUY F;  1UUR A;  2G0U A;  4XZC A;  1WLX A;  4P0A A;  4P1N A;  1N33 T;  4CXX A;  3AE3 A;  3UU5 A;  4H9R C;  5FNV E;  5BR8 T;  4EOZ B;  4GIW A;  2XQ3 A;  3KBU A;  4BAY B;  3PDY A;  3ZYL A;  1D1B A;  3PUR A;  1HG5 A;  2H7O A;  4PK5 A;  1R8I A;  1LVK A;  5LGT B;  2YDR A;  2L9Q A;  2C0S A;  5AQR B;  1N34 T;  1SUM B;  2YIN A;  2BZB A;  1D0Y A;  1X9B A;  4IDO A;  2YEV C;  2IML A;  3I0O A;  3GN5 A;  3N9P A;  1MIW A;  3MJX A;  3AB3 B;  4MBQ A;  2I59 A;  1MMD A;  3CVR A;  4LF5 T;  1XMO T;  5LYJ E;  4ASK A;  5KXJ A;  1E2A A;  4IGU A;  5ABF B;  1V9D A;  5F8P A;  2JQH A;  3RYC E;  1W0B A;  4JI0 T;  5LHI B;  4X1K E;  2CEA A;  1W9R A;  4ERR A;  2CHO A;  4YSZ A;  2NOX A;  4U7Y A;  4GYS A;  3I9W A;  2VAS A;  3ZJ2 A;  3PUV F;  1Y64 B;  5LGN B;  2EHO B;  1FIO A;  2MAW A;  1WR6 A;  4QHO A;  4JV5 T;  5F5W A;  1YKH B;  1CUN A;  2DWG A;  4H9Q C;  4ADZ A;  3UU6 A;  1VCT A;  5JRE A;  2V1D B;  2HN1 A;  2F4V T;  2BKP A;  5FMN A;  2A3D A;  3C98 B;  4YSY A;  2FUP A;  1G8X A;  3J9X 1;  4K0U A;  4YXD A;  3ONL C;  2YU2 A;  2WB5 A;  3MK7 C;  5ABF A;  3HI2 A;  4DV2 T;  2YU1 A;  3QUJ A;  2LRL A;  5HWX A;  1YXR A;  3P4Q A;  4IDP A;  4JEU B;  2DCF A;  3TLT A;  2OLT A;  3EAM A;  4DR1 T;  2W4X A;  2AXD S;  4YHJ A;  2Y6X A;  5LG4 A;  2QGS A;  2UUA T;  3SWH A;  4JUY A;  1QUU A;  3GA8 A;  4HE8 A;  3OPC A;  4UIG A;  2EHO A;  3ZYM A;  3E0Z A;  2XM1 A;  1SHZ C;  4GK0 E;  2XQ7 A;  1IBL T;  4QH1 A;  5CA0 E;  4LMJ A;  3SOL A;  4ZXL A;  2C5I T;  1Z0P A;  2LEH A;  4M1P A;  3FXD B;  3P50 A;  5JDH A;  2WU2 A;  2VWA A;  5LHH B;  2X9H A;  2A2F X;  4TNV A;  2CXL A;  2VKO A;  1MIV A;  3LK4 2;  3RIA A;  3JAD A;  4JI6 T;  3CK6 A;  5FXV A;  5IHY A;  2XQ8 A;  1Z8U A;  3E22 E;  1UGO A;  3RKG A;  3P4S A;  4UV9 B;  4X66 T;  4P09 A;  3AA7 B;  4H9S E;  3W15 B;  5IYZ E;  3AVR A;  2LRK A;  4IE5 A;  3N9N A;  2UXN B;  2WZH A;  2ZM2 A;  4X5T A;  3CX8 B;  3ANW A;  3PV0 F;  4UEL A;  4BA9 A;  3OTO T;  3AE8 A;  2FJA A;  4O4J E;  5AQS B;  2JJ9 A;  4QX7 B;  3UT5 E;  5AQO B;  2QYW A;  1T98 A;  4HWF A;  4TUY E;  1FMW A;  5LBQ B;  4O8S A;  5HEH A;  2E9X A;  5JH7 E;  3AEG A;  2NWB A;  2KWH A;  4WZX A;  3ZC0 A;  3AE6 A;  4YJ2 E;  4JYA T;  3EAB A;  2BVM A;  3RYI E;  5CJ5 A;  1HFA A;  3PUS A;  1FJG T;  1U4Q A;  2Z6E A;  2XJ7 A;  2XAF B;  2IDO B;  3WI3 A;  4HFI A;  2X67 A;  1US7 B;  4DBQ A;  4YTP A;  2XHE B;  5HEJ A;  3B5M A;  4EIW A;  2WDR A;  3WAK A;  3CQX C;  2XQ4 A;  3LBX B;  5HCJ A;  2HPJ A;  2V8S V;  1HR0 T;  1S94 A;  3OYZ A;  5FYM A;  2JMH A;  2WZI A;  1OWA A;  4WNK A;  4DND A;  3I9Y A;  2A72 A;  2W2U A;  4ZI2 D;  4PAG A;  5JR9 B;  1KNR A;  3C4X A;  4A97 A;  3K3N A;  4CZZ B;  4U72 A;  2V7M A;  4CQI A;  4QKN A;  4ISS A;  3ZCI A;  1GQE A;  3CPZ A;  4IL4 A;  3AE7 A;  5ADX L;  2KXP B;  4A98 A;  5JRC B;  1HX1 B;  3RQU A;  2V6X A;  4HFD A;  1YKE B;  4HN9 A;  1UX4 A;  2FJE A;  5HXS A;  1ZHC A;  3H37 A;  2L3L A;  4ILB A;  3MXZ A;  2LHR A;  4B3M T;  3LBX A;  4LFC T;  5AQP B;  1J5W A;  2BG9 C;  2XAS B;  1HTJ F;  3KVB A;  4QH5 A;  3DP7 A;  4JI4 T;  2H88 A;  2BKN A;  1XWM A;  2KWI B;  2X9Y A;  1NEN A;  3CKD A;  5LMN T;  3A8Y C;  2UU9 T;  4KP3 C;  3O1H A;  3N5L A;  1W0A A;  2WWU A;  4B3S T;  2AE9 A;  3LDQ B;  4UF0 B;  5JR9 A;  4ZS2 A;  3U3I A;  2DL1 A;  4I55 E;  1L0V A;  4JLE A;  3I1A A;  4DR6 T;  4WBN E;  5EK2 A;  1XDP A;  4JI5 T;  3MA9 A;  2NP9 A;  2WU5 A;  4ILU A;  2V7K A;  3PUQ A;  3Q2M A;  2ZM6 T;  3NZP A;  3SRZ A;  2X0H A;  3F57 A;  5ABH A;  2CBI A;  2WSS V;  3HKC E;  2KMF A;  4LF8 T;  3PUZ F;  2WS3 A;  2IC6 A;  2CHN A;  1NEK A;  3SFD A;  2XUE A;  4GOU A;  3BK9 A;  2A9U A;  2V5C A;  2BBH A;  4L5G A;  3ZN0 B;  3H3M A;  2E8I A;  3UUL A;  4X64 T;  1D0X A;  4BJN A;  4Q25 A;  2L8K A;  3I0Q A;  2DLR A;  1KF6 A;  3NKZ A;  1ZEE A;  2LHN A;  4KUM B;  1OED E;  2YN6 A;  4UF0 A;  3AE2 A;  2XSA A;  5EZY E;  4LF9 T;  5AQK B;  2YK0 A;  4DR2 T;  1HNZ T;  4U7I A;  2DNX A;  4E7Z A;  2CLY B;  2DWK A;  2RP4 A;  4DBR A;  3PU8 A;  1D0Z A;  2C5K T;  3SS1 A;  2BS2 A;  5AQM B;  3VR8 A;  5LMU T;  3FZM B;  4NUV A;  2BG9 B;  4CI1 B;  4QXB B;  2W00 A;  3RGL A;  2Q9Q D;  2RA1 A;  4PJM A;  3RLF F;  4JBW F;  2FJD A;  2WMO A;  4HWD A;  3N9O A;  2X66 A;  2V7L A;  2VB6 A;  1T8B A;  4KHZ F;  5DAB A;  5L3D B;  3ZLI A;  5L3C B;  2WQY A;  3R84 B;  3UFG A;  1BR1 A;  1WR0 A;  3MKD A;  3Q5W A;  3IBP A;  3RHW A;  1VRB A;  3UU4 A;  1UX5 A;  4I0U A;  3V5S A;  2MYS A;  4MAL A;  4DV7 T;  1HX8 A;  2FBW A;  2KIN B;  3B13 A;  5H6Q B;  1WRD A;  2ZM0 A;  4OHF A;  2WP9 A;  5BMV E;  4AIU A;  2XQ9 A;  2IUB A;  4LMK A;  4E7S A;  5J2T E;  2MTQ A;  4ZEY A;  2KLQ A;  2ES0 A;  2PTF A;  2BG9 A;  3ZMT B;  4U2Z A;  4ZZB A;  2ODU A;  4CXY A;  3AVS A;  2Q9Q C;  2V7I A;  5IUX A;  2W66 A;  1J5E T;  4UR9 A;  3VKG A;  3N9L A;  2OA5 A;  4K0K T;  4J2C A;  3C4Z A;  3QNU A;  2LT3 A;  2D0U A;  4IST A;  2RPA A;  3RIU C;  3PTR B;  3RYF E;  4YHH T;  5F3J A;  3ZT5 A;  5FL0 A;  2UXX B;  3N2G E;  2VVN A;  4LML A;  2XAG B;  3WAJ A;  2XQ5 A;  2XQ6 A;  4XAX B;  4U33 A;  3V5U A;  4YTM A;  2CRB A;  4H63 H;  3ZMZ B;  1IBK T;  2NW7 A;  2CWO A;  3PUG A;  3ESL A;  2PFV A;  3KV4 A;  3UQ7 A;  2LOP A;  4QH4 A;  2E2A A;  2CCQ A;  1SA0 E;  4ZZC A;  3IA3 A;  2LSJ A;  3HKB E;  2UXB T;  4IE6 A;  5AQG B;  4YSX A;  3AEA A;  3VRB A;  1XDO A;  2VVS A;  3L8R A;  3RC3 A;  2FJB A;  1N36 T;  2CA5 A;  4IIJ E;  4LF6 T;  2UUC T;  5AQT B;  1YQ3 A;  2LSI A;  3KV6 A;  3Q9D A;  1D1C A;  4QX8 B;  2YKS A;  2VK9 A;  2LSG A;  3UUM A;  3L3P A;  3S4U A;  3G06 A;  5FY1 A;  3AXJ B;  2VL8 A;  3O1J A;  1IAP A;  3FZK B;  4HWC A;  2LKH A;  4DV4 T;  2KSR A;  2JRK A;  4UXN B;  4FJO A;  3BQK A;  3PJA A;  1Y01 A;  1N32 T;  1LVF A;  1ZKE A;  4IE7 A;  1HS7 A;  5FVL A;  2M6I A;  1KK7 A;  2X9X A;  4AKI A;  4AKG A;  4KMC A;  4HFH A;  3UQ4 A;  2W0G A;  4AKL A;  2BKO A;  2HPL A;  5LCY A;  5HXE A;  3PE0 A;  4F8H A;  2E5L T;  4DR5 T;  2BDE A;  1WYB A;  3PU3 A;  2XSB A;  3JC6 C;  4HGA A;  2HN2 A;  4WW0 A;  1W09 A;  2WCA A;  4DMW A;  4COF A;  2LKG A;  3KVA A;  4H63 V;  3CQC B;  4HTE A;  1XZY A;  2P9B A;  2PJQ A;  3C50 A;  1M62 A;  4L0R A;  2N1G A;  2V26 A;  4GKJ T;  3AXJ A;  4GKK T;  4TV9 E;  5JDM A;  4WYV A;  3MAC A;  5E0O A;  2D9D A;  3Q5D A;  4AQF C;  4UEM A;  4CN1 A;  5AQV B;  3RX6 A;  1MND A;  5LXT E;  3MZK B;  4DR7 T;  2J62 A;  3J7Y q;  1MMN A;  3RI5 A;  4H9N C;  3ETU A;  3JAF A;  5ABG A;  3B57 A;  1EZ3 A;  5TAO A;  3AE9 A;  4IL9 A;  4CXW A;  5C2T A;  1U5P A;  3FZH B;  3NWI A;  5KMG P;  3N2O A;  4ZS3 A;  1WYC A;  3PUA A;  4N78 D;  4DV0 T;  5M4Y A;  3LG7 A;  3AEF A;  3UTK A;  1UUS A;  1I94 T;  3CWZ B;  1HNX T;  4I4T E;  1HCI A;  5KX5 E;  2LSK A;  3OKQ A;  4DV5 T;  2ACZ A;  2QVA A;  3UUB A;  2LM2 A;  4L9I A;  5EK3 A;  2WDQ A;  3QC9 A;  4B6X A;  4H9O C;  4EAH A;  1ZV4 X;  3PJA J;  4NXN T;  4IDZ A;  1YQ4 A;  2DHR A;  3UFE A;  3CX6 B;  3C64 A;  3QB5 A;  1QSD A;  3A5X A;  1KFY A;  2VQE T;  1G73 A;  2XQY A;  5HEO A;  3P8C D;  4MFR A;  3UU3 A;  3R6N A;  4G63 A;  4EB6 E;  1I6Z A;  2NTX A;  2W61 A;  3O1I A;  4Z90 A;  5FXW A;  2I0M A;  3P4R A;  4B3T T;  3RYH E;  2JPF A;  2V7J A;  3U78 A;  2XAH B;  2UXD T;  2H3R A;  3HL6 A;  3GWH A;  1J1J A;  3PUX F;  2MOZ A;  2NR4 A;  3TLW A;  2XZE A;  3QOF A;  4O4L E;  3E08 A;  5L3E B;  5FY7 A;  3NBX X;  5HCM A;  2X0L B;  3IEE A;  4TV8 E;  4UVC B;  4EV6 A;  4I43 B;  4TN7 B;  4JI7 T;  4PK4 A;  4UVA B;  2LM9 A;  4AKH A;  2CBJ A;  3ZKR A;  4IDN A;  5HXH A;  4A5X A;  4V1A v;  2QA7 A;  3FBZ A;  4IRE A;  1FEW A;  3A7M A;  3L39 A;  2SPC A;  5JRC A;  1XNR T;  3UUX B;  5JDF A;  4MLK A;  1H7C A;  5AQF B;  4HFC A;  2XPK A;  2K48 A;  5HAX A;  5FL1 A;  4U74 A;  1AJ3 A;  2QRX A;  4YT0 A;  4YLH A;  5HXR A;  4X1Y E;  4TZ4 C;  4EZH A;  2EHO D;  5AQU B;  3BQI A;  1M7K A;  3NRX A;  1MMA A;  2ODV A;  3IHR A;  2R6G F;  3AEE A;  4A56 A;  1X79 A;  3ONJ A;  2VKH A;  5AQN B;  2J1D G;  3LK3 B;  2C5J A;  3FBL A;  5HEU A;  3T1H T;  4OX9 T;  5FXX A;  3DJB A;  2M6B A;  4ZI7 E;  5FXZ A;  5L3B B;  2D5U A;  3N9M A;  2H89 A;  4HWH A;  1MNE A;  4DV6 T;  4AQY T;  4Z8X A;  4DID B;  3VHL A;  3C4W A;  4PFP A;  5L47 A;  3F2E A;  2N9D A;  3UU8 A;  3HR0 A;  2VUR A;  4OK0 A;  2VQF T;  2IW5 B;  4XBF B;  1HNW T;  2EHO C;  4EXT A;  3AEB A;  4G2A A;  3QK6 A;  5CA1 E;  4X1I E;  3GN5 B;  4JEH B;  3VKH A;  1DU2 A;  3C51 A;  5JDQ A;  2W67 A;  2E9X D;  4TX5 A;  4EED A;  4AQG A;  3JAE A;  4NUU A;  2IAK A;  3FXE B;  4PJJ A;  2JIW A;  3PUW F;  4AKR B;  2WY2 A;  3TLU A;  4OYK A;  1NAF A;  3AA0 B;  4H9P C;  3K1S A;  4LF7 T;  4Z91 A;  3EVY A;  5LP6 E;  3OYX A;  3RQW A;  1VOM A;  3NZQ A;  1XNQ T;  2JQK A;  2BG9 E;  4AIS A;  3RRW A;  4PK6 A;  4DV3 T;  2HHH T;  3EI0 A;  4AI6 A;  2DI4 A;  2MPK A;  3TLS A;  5DQV A;  5LHG B;  2LSY A;  3ZJ1 A;  1KEY A;  2E9X C;  2V6Y B;  1JNZ A;  2N2N A;  3VRA A;  1CHU A;  1YD8 G;  3N9Q A;  2PBI A;  1NWM X;  2XAQ B;  1SE7 A;  5LG3 A;  4AXP A;  4ZI3 D;  3ZPO A;  4MHC A;  1E7P A;  1UK5 A;  4PFO A;  4PJN A;  4HKA A;  3RC8 A;  4HEA A;  5AQJ B;  5AQL B;  3FHN A;  2KZ7 B;  3K8P C;  4O2B E;  4PNI A;  3P7I A;  2XY8 B;  3K3Q C;  4JI3 T;  2WDV A;  5HYA A;  2K3W A;  2KND A;  2XM2 A;  3NRY A;  4CI2 B;  2J47 A;  4ZOL E;  2WWV A;  2XQA A;  4CN4 A;  5CB4 E;  3CML A;  4UV8 B;  3LSV A;  5L3G B;  4DR3 T;  3ZMS B;  4KX6 A;  3CX7 B;  2VKD A;  1ZP0 A;  3HA4 A;  5DQW A;  2Y48 B;  3AA6 B;  3JC6 D;  2BS3 A;  3AAA B;  2X9W A;  2V6Y A;  4YFS A;  2WMN A;  4NIQ A;  2IHR 1;  4IT4 A;  2W63 A;  2YDQ A;  3KDS E;  3KBT A;  3RIF A;  4QXH B;  3M3Z B;  2D2S A;  4HWI B;  4ZI3 C;  4UVB B;  5HEG A;  2CXF A;  3EUH A;  3O9X A;  3LFM A;  2I6H A;  2PG8 A;  4TWD A;  3ANW B;  3OVU A;  4EZ4 A;  3N2K E;  3Q5E A;  2Q9Q B;  2CWY A;  4X62 T;  3X1D A;  1UCU A;  3AED A;  2JQ9 A;  2VL0 A;  4U31 A;  3TLV A;  4C90 A;  2E9X B;  4ZHQ E;  4PJL A;  3QB5 K;  5JDN A;  1ZOY A;  5HXC A;  5JDL A;  3LK2 B;  3D0T A;  4JI8 T;  3T1Y T;  3TKL B;  3RH3 A;  1BR4 A;  3EDV A;  3ETV A;  4OYJ A;  3LJC A;  3M65 A;  5JR9 C;  5LA6 E;  3ZYK A;  4CI3 B;  3HKD E;  4YJ3 E;  2BS4 A;  5L4H A;  2NW8 A;  2ACX A;  5C3J A;  5LOV E;  1HF8 A;  1YW0 A; 
#chains in the Genus database with same CATH homology
 3ZST A;  2V6Y B;  4NIQ A;  4U31 A;  2WWV A;  4ZEY A;  4IT4 A;  4CN4 A;  4U7Y A;  5FVK A;  4U33 A;  2WY2 A;  2A9U A;  2W2U A;  4P1N A;  2JQK A;  1WFD A;  4U3C A;  4U2Z A;  2RPA A;  4CN1 A;  2CRB A;  2V6X A;  4WZX A;  5CGM A;  4CN6 A;  2XZE A;  5LB7 B;  3ZT5 A;  4U7I A;  3ZSS A;  2LRL A;  2MPK A;  2DL1 A;  3ZT6 A;  1WR0 A;  3EAB A;  2K3W A;  5CJ5 A;  1WCR A;  3K1S A;  2JQH A;  2CPT A;  1YXR A;  4A5X A;  3ZT7 A;  2JQ9 A;  2LRK A;  5FVL A;  4U2Y A;  2V6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...