2WWVA

Nmr structure of the iiachitobiose-iibchitobiose complex of the n,n'- diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2wwvA00
1WR0A 2WWVA 3EABA 2LRLA 3ZSTA 4U7IA 4IT4A 5LB7B 2JQKA 4ZEYA 4U33A 3ZT5A 2LRKA 4U31A 1YXRA 4CN4A 4WZXA 2CPTA 2JQ9A 3K1SA 2V6YA 5FVKA 4P1NA 2DL1A 4CN1A 1WFDA 1WCRA 2JQHA 2WY2A 2XZEA 4U2ZA 4U3CA 4CN6A 4U2YA 5CGMA 2K3WA 4U7YA 3ZSSA 2CRBA 3ZT7A 4NIQA 2A9UA 2MPKA 2V6XA 4A5XA 2RPAA 2V6YB 2W2UA 5CJ5A 3ZT6A 5FVLA
chains in the Genus database with same CATH superfamily
1WR0A 2ZLYA 3ONJA 1R8IA 3ZCIA 3H3MA 3T1HT 1HG5A 4I0UA 2BS2A 4EEDA 5IYZE 1OEDE 2OA5A 4UELA 1BR2A 4UVAB 4ZHQE 1HNZT 4JI7T 3Q5WA 2C5IT 4DVDA 3JADA 3O1JA 4F8HA 2LHNA 2ZM6T 1N33T 4YHHT 2KLQA 3T8OA 2XAGB 3RYHE 4YSYA 4AI6A 5JR9B 1XDPA 3OTOT 4DV1T 4JI1T 3MACA 3OVUA 4XBFB 2IMLA 3ETUA 4OFZA 5AQKB 3RQUA 4AKIA 2A72A 4ERRA 3K3OA 4X65T 2ZMAA 2YU2A 4MHCA 1EZ3A 3C51A 3PUAA 1VOMA 3X1DA 2CRBA 4TZ4C 1Z0PA 3RGLA 4X5TA 2NW8A 4KUMB 4AQFC 1ZP0A 4NXNT 2LSJA 3CX6B 3PUZF 3UUNA 2UUBT 5AQOB 4NUVA 4ILBA 3OPCA 2JQQA 2XAJB 1J5ET 5HEUA 2L8KA 3B57A 5L3DB 3KBTA 4LFBT 1HS7A 3EABA 2HN1A 2DLRA 2H88A 1Y64B 3CPZA 4HGAA 2W62A 3O1HA 3L39A 2BZBA 2LRKA 2BG9C 4U31A 2WQYA 5BR8T 1E2AA 2LHRA 2BDEA 3WAJA 2UXCT 2V7JA 2UUCT 3AAEB 1FJGT 4DV0T 2KWIB 2E9XC 4ZZCA 2CHOA 2Q9QC 1ZKEA 3NKZA 4MFRA 2WAUA 4I43B 3JC6D 1BR4A 2UUAT 3PUXF 4JEUB 4PJNA 3VKGA 4UVBB 3QB5A 1E1HB 4PFOA 1IJ5A 2WSSV 2UXNB 2V7IA 3CIRA 2XY8B 2CXLA 3DP7A 1YKEB 4IGUA 3VHLA 2BVMA 5AQSB 4B3TT 5HEGA 1MIVA 3RPUA 3ZT7A 4PK5A 1UGOA 2LSGA 4PNIA 3RIAA 4YSZA 3T1YT 2D2SA 1YD8G 3AA7B 4CI1B 5JDLA 4DUZT 2YDRA 4DV5T 3LK3B 3ZMUB 2ES0A 2WU5A 3EHZA 4HFDA 4UVCB 2DNXA 3ZMVB 3UT5E 1QUUA 2H7OA 1NEKA 4X1YE 2JQKA 2BS3A 2Y8DA 4CQIA 2D0TA 3AE5A 2NW9A 3ZYMA 2VKOA 3DJBA 4K0KT 3UFGA 3UU4A 5HEOA 1T8BA 2W66A 3PJAJ 4EYYR 3N9PA 3KINB 3KV9A 2CXFA 3ZYLA 2JQHA 2WY2A 3AEGA 3C4WA 4HFVA 3AAAB 3VKHA 4L9IA 1D1AA 2AXDS 2XM2A 3U78A 3N9QA 1XDOA 3ZSSA 3BQKA 3HKDE 5DQWA 1J5WA 3GN5A 4OYJA 2E9XB 1UK5A 3ONLC 2WZHA 4LMLA 2LT3A 4TV9E 5AQVB 5LP6E 4AKRB 2K9AA 4X1KE 5CJ5A 4OK0A 1UX4A 3FZHB 4AKGA 3IHRA 3AA0B 2W0GA 3PURA 3GA8A 4I55E 4O4JE 2UXBT 5HXSA 5EZYE 2V8SV 4F6RC 4G63A 4V1Av 2CBIA 2HPJA 2VURA 2ACXA 1XZYA 3K8PC 4ISTA 2YN6A 4LMKA 3ZKRA 4LF4T 4PK4A 1WR6A 3MJXA 5AQGB 4AKHA 2IAKA 2E9XA 4EXTA 3TLVA 1MMNA 5JR9C 3UQ7A 4BA9A 5JRCA 4JV5T 4HKAA 4NPPA 4L0RA 2EHOA 4DR7T 4WBNE 1HTJF 2QA7A 5FKYA 5L3BB 2XJ7A 1XNRT 2J1DG 1SA0E 5LYJE 1T72A 4PK6A 3C98B 2XZEA 3WI3A 3PE0A 4OHFA 3NVOA 4YTNA 1VCTA 1W0AA 3ZN0B 3FZMB 1J1JA 3N9LA 2Y6XA 4PJMA 2FJDA 3U3IA 2XSAA 3KV4A 4H63H 2VQET 4LF9T 1HR0T 5FL0A 4YJ3E 5DJQC 2A3DA 1W9RA 4EZHA 4YY3T 5E0OA 3P8CD 2E5VA 3ETVA 4QXCB 4IT4A 3RC3A 1NAFA 2X67A 2V7LA 3KVAA 4HFIA 2GK9A 4U33A 3P7IA 3S4UA 4EOZB 3PUGA 5FL1A 1DU2A 5AQRB 3EAMA 5HWYA 1KEYA 3K1SA 4HN9A 4LF7T 2C5KT 4H9RC 3RIFA 3CK6A 5C3JA 4QX8B 5JREA 2BKNA 3ZYKA 1WFDA 3OBVE 4IL9A 2BS4A 3A7MA 3RRCA 4Z90A 2A2FX 3PUSA 2LSYA 5AQIB 3KV6A 4U7YA 2WB5A 4YTMA 1H7CA 5FP3A 4YXDA 1KNZA 3LFMA 2KINB 1W09A 2N2NA 2UXXB 3P4WA 4JI4T 5EK2A 4DR4T 5DQVA 3A5XA 4IE5A 4B3RT 2X68A 2XQ3A 3UU8A 1WYCA 3L09A 3RC8A 2ACZA 2KNDA 3AE2A 3RKOA 1OEDB 2KXPB 3P4PA 4CXXA 3JAFA 2I0MA 2XTLA 5JDGA 4ZZBA 2DCFA 4CN4A 2HPLA 2QVAA 3AEEA 2C5JA 2W63A 2VKHA 4Q25A 4ZS2A 4DNDA 2VVNA 5KXJA 3RQWA 2EHOC 3FHNA 3NWIA 5J2TE 3VU7H 4AIUA 3OJAA 4J2CA 1D1BA 2Q9QA 4TWFA 4XZCA 3UULA 4BJNA 2PBIA 5BMVE 2L9QA 2CWOA 2YU1A 2CE7A 4FJOA 1XMQT 2KWHA 4DMWA 1X79A 2CLYC 4IREA 5C2TA 3ZPOA 3FB2A 2XM1A 2YOEA 2W67A 3AEAA 4E7ZA 2LEHA 3LK42 4ZEYA 2BG9E 4JYAT 3UUBA 3AE7A 2PG8A 2Q9QB 3HKCE 2ODUA 3HR0A 4ZS3A 3HKEE 3B13A 3VRBA 4IE0A 4WNKA 4CXYA 4DO0A 2X0LB 2X9HA 3UU3A 3I9YA 4HWHA 2NTYA 4U72A 1FIOA 4HWIB 4LFCT 1BR0A 3M65A 4AQGA 2NR4A 4DUYT 5FXWA 1IBLT 5J1GA 3RI5A 4JI8T 1D0ZA 3AB3B 1OXZA 1S35A 3OYZA 2PTFA 4O4IE 1IJ6A 3JC6C 5ABHA 5LG3A 3J7Yq 4P0AA 1KFYA 4PFPA 2XAQB 3RHWA 1E7PA 3Q5XA 4MALA 5GONE 2VVSA 3ZJ1A 4EZ4A 3SFEA 1IBMT 2F4VT 3NZPA 3DTOA 1D1CA 1VRBA 2M6BA 2WMOA 1CUNA 2XQ5A 3N9OA 4M1PA 3ZCJA 3Q5DA 5LBQB 2XQYA 3PTRB 2WDVA 5M4YA 1KNRA 3LBXB 1Z8UA 2V5DA 3QB5K 1U5PA 2VB6A 2CBJA 4ZXLA 3EDUA 4HFCA 3PDYA 1GQEA 2JPFA 3UU6A 2W00A 1LKXA 5CA1E 3AA6B 4TUYE 3G06A 2WZIA 1BR1A 4ZI2C 3EI0A 1FMWA 1MNDA 2KSRA 3TKLB 5LB7B 4YFSA 5LXTE 1KK7A 1X9BA 2RP4A 3I9WA 2VQFT 4OX9T 5JDMA 3FXDB 1SHZC 3GN5B 2NW7A 2YK0A 3E08A 2VASA 3FZFB 3Q5EA 2B1EA 2JQ9A 4KP3C 3I1AA 4H9PC 2AE9A 4JBWF 1MMAA 1M62A 4UR9A 4CN1A 1HNWT 2HN2A 1N32T 4EAHA 4AQYT 3M3ZB 1NWMX 2XQ7A 3RKGA 4DV3T 1XNQT 3CX7B 1UX5A 4KI0F 1L0VA 5LHGB 1YQ4A 2CM0A 4HE8A 5J0ZA 1N34T 3N9MA 3RYIE 4IIJE 3BK9A 1QLBA 4UXNB 4X1IE 2EHOD 2J4GA 2D5UA 1OWAA 2JJ9A 4GYSA 5L3GB 4IDPA 5KX5E 4U74A 3VR8A 5JRCB 2W2UA 3I0OA 2KZ7B 2IC9A 2WWVA 4GYRA 2NOXA 3UU5A 1AJ3A 3CWZB 2ZM0A 1T7SA 3KDSE 5IHYA 4K0UA 3TLUA 5HYAA 3Q9DA 3QOFA 4H63V 5AQUB 1FEWA 3F57A 3NBXX 5ABGA 4KMCA 4IL4A 4HEAA 4C91A 5JDNA 3N2OA 4JI0T 3KFWX 5LOVE 5EK3A 2CPTA 1D0XA 4ZOLE 4ZI2D 4KX6A 2DWGA 1MMGA 3AEBA 2XQ4A 3LK2B 3KVBA 4DR1T 5LGTB 4X64T 1OEDC 3AE9A 4DV4T 4COFA 2BKOA 3RIUA 2CWYA 3AE4A 5ABEA 5L3CB 4U3CA 4O2AE 4H9OC 3SOLA 4EB6E 5JDQA 4WBOA 3IEEA 1IBKT 2R6GF 2M6IA 2X9WA 2Y48B 1US7B 4H9SE 5HXHA 2JIWA 5F5WA 2LOPA 5HAXA 5LBMA 4EGWA 2BBHA 3PUYF 3RLFF 4YTPA 5HXCA 2WWUA 3PU3A 4LF8T 4H9QC 5IUXA 1ZV4X 4TN7B 4WYVA 2LRLA 3N5LA 2IIUA 3MA9A 4U7IA 2FJBA 4YJ2E 4JLEA 3J9X1 3AVRA 5L3FB 2VWAA 3C50A 2H7VC 3E0ZA 5HWXA 2YDSA 2X0YA 2XAHB 3ZMTB 2OV9A 3PUQA 2RA1A 3MKDA 4P1NA 3K3NA 3MK7C 4PW8A 2H89A 4TNWA 4L5GA 5JVDE 1NENA 3AA1B 3H37A 3ZLIA 2FBWA 3ANWB 4I50E 5LGNB 5IWAT 4DR3T 4A97A 2KT9A 5LA6E 4U2ZA 2VL0A 2I6HA 4YT0A 1WLXA 3AVSA 4GOUA 4CI2B 1G8XA 3F31A 3VRAA 2A9UA 2XAFB 2V6XA 2RPAA 4QXBB 1VCSA 2PFVA 2MOZA 3HL6A 4ILUA 3ZT6A 2B76A 4HFHA 3R84B 1LRZA 5ABFA 5KDMC 5L47A 1I6ZA 5HCMA 2IC6A 5ADXL 4HTEA 4P09A 4EIWA 1O3XA 4ILCA 4O8SA 4ISSA 2L3LA 3EUHA 3SFDA 2V5CA 1HCIA 3QUJA 4QH1A 4UF0B 3FZLB 2LSIA 4AXPA 1MIWA 2LKGA 2VKJA 2E2AA 4Z8XA 5LHHB 2QRXA 3AEDA 3E22E 5LCYA 1B7TA 1MMDA 1D0YA 3W15B 4DR5T 3HKBE 1JNRA 4ZI3D 5LJMA 4EV6A 4JI6T 4CZZB 1UCUA 5LMUT 1ZOYA 5F8PA 2LKHA 3QNUA 2V7KA 2E8IA 2J47A 2XQAA 3L3PA 2K24A 3LG7A 2K3WA 4N78D 4O4HE 2W61A 4IE6A 4UEMA 3SWHA 4ILAA 4UV8B 3UFEA 5CB4E 4QKNA 4UF0A 4NIQA 2H3RA 1S94A 2W4XA 3AE3A 4A5XA 4A98A 2V6YB 2WMNA 3ESLA 2DWKA 3H3AA 4JI5T 2XQ9A 2XSBA 3O4XE 4GK0E 5FVLA 4DV2T 2FJAA 4TV8E 4QXHB 2WCAA 3UUXB 3TLSA 2D0UA 2JMKA 3CQGB 4QH5A 4TNVA 2IUBA 3N2GE 3P50A 4BJMA 4IDQA 2HHHT 3A8YC 5H6RB 3N2KE 2WP9A 2CHNA 1FMVA 1WYBA 2ZM2A 3LDQB 4B6XA 5AQTB 2IHR1 2BKPA 1KF6A 2X0HA 3Q2MA 2FJEA 4UIGA 3D0TA 4ADZA 4KHPT 3ZEFB 5LG4A 5EK4A 5HXEA 3V5UA 4GKJT 3B5MA 2UXDT 2DHRA 5L4HA 4TX5A 2XPKA 3ZMSB 3RF1A 4ASKA 1V9DA 5LJNA 4JI2T 2WS3A 3AXJA 2K5BB 4FI5A 2XQ8A 2XASB 3ZMZB 5JDFA 1N36T 4YHJA 3HI2A 3IBPA 2MPKA 4AKLA 3AE6A 5C8YE 2BG9A 3O9XA 1LVFA 5FNVE 3C4ZA 5HEHA 2EHOB 3NZQA 5CA0E 2Z6EA 2MTQA 5L2LA 5LMNT 2KMFA 2CLYB 4IE4A 2MBGA 3R6NA 3HA4A 2SPCA 2X66A 3NRYA 2X9XA 4H9NC 5FXXA 4DV6T 5AQMB 2QGSA 3C64A 1UUSA 2PJQA 3GWHA 3LJCA 4KBMB 3AXJB 5AQHB 4MBQA 2D9DA 3RYFE 3UQ4A 2IW5B 2LJLA 4CI3B 1SE7A 3PUWF 2LOSA 2CMRA 2YEVC 4IDOA 5AQJB 2LLYA 1HG2A 2N1GA 3AAIA 2DL1A 2YKSA 4PAGA 4TWHA 2X51A 3NRXA 1HFAA 1QSDA 1IAPA 1UURA 2K48A 3C4XA 3CVRA 3EVYA 5AQLB 5FYMA 3CQXC 1ZEEA 1OEDA 5HXRA 4IDZA 2E5LT 4HFEA 2LM9A 4JI3T 3CMLA 3GMIA 4NXMT 1U4QA 3RH3A 5L4EA 3O1IA 3BQLA 3QC9A 1MIYA 4NUUA 3AEFA 3ZJ2A 2WBLA 2ZM8A 3KV5A 1XWMA 4DV7T 1YQ3A 3JCFA 1G73A 4EEBA 2NWBA 5DABA 4I4TE 3FXEB 5FY0A 2IDOB 3LSVA 5LGUB 3FBZA 2V7MA 3OKQA 5CFBA 4X66T 5TAOA 3P4RA 4UV9B 3L8RA 5FY1A 5JTGA 2P9BA 4JEHB 4O4LE 5FXVA 3ZT5A 2LSKA 2LM2A 4PJJA 4WZXA 5FY7A 1HX1B 2JMHA 3MXZA 4GIWA 3IA3A 4OYKA 5AQNB 5FVKA 3TLTA 4DBQA 2VKDA 4A56A 4BAYB 4LF5T 5ABFB 5JQGE 2WDQA 5KMGP 2WDRA 1KNPA 4EYUA 4CN6A 4U2YA 5F3JA 1HNXT 2WU2A 4WW0A 5CGMA 2NTXA 1SUMB 2CXDA 4KHZF 5ETWA 2Q9QD 4G2AA 4HWDA 2V1DB 3RRWA 3PV0F 1I94T 4GKKT 5HEJA 2ODVA 2CEAA 2N9DA 3P4SA 2G0UA 2M67A 1CHUA 4IDNA 3JAEA 2X9YA 2XUEA 4DR6T 3K3QC 1Y01A 3ANWA 2FUPA 3P4QA 3WAKA 4HWFA 5LNKA 3V5SA 4QX7B 2I59A 3AE1A 3ZSTA 2DI4A 4LFAT 4HFBA 4AISA 1LVKA 3CKDA 2LE8A 1YKHB 4X62T 1MNEA 3LBXA 4IE7A 4GK5E 3SS1A 3PU8A 4Z91A 5AQPB 2XHEB 1HX8A 5AQQB 4LF6T 4DR2T 1IZNB 2VK9A 4YSXA 2V26A 2MAWA 3I0QA 5AQFB 3IF8B 4IHJE 5H6QB 1ZHCA 4HWCA 3RIUC 4DIDB 2XQ6A 1HF8A 3CX8B 3OYXA 3RYCE 1M7KA 3AECA 5HCJA 2NP9A 3MZKB 4QH4A 4O2BE 3UTKA 3ZN1B 4C90A 2E9XD 5JH7E 5A1LA 2C0SA 5LHIB 2BVLA 3ONXA 5J2UE 4B3ST 2QYWA 4MLKA 3AE8A 4LMJA 2CCQA 4TWDA 4DBRA 1YXRA 2CA5A 3QK6A 4P0BA 4PJLA 4QHOA 4B3MT 2J62A 2BG9B 1WRDA 2V6YA 2BBJA 3PJAA 4ZI3C 3UUMA 2JRKA 1W0BA 2WM9A 3FZKB 4QWNB 4XAXB 4E7SA 4DMVA 1YW0A 3KBUA 5AFUL 2HH7A 1WCRA 3ABVA 5FXZA 1JNZA 5FMNA 3TLWA 3VR9A 3PUVF 3SRZA 3EDVA 3FBLA 1T98A 3ZC1A 1XMOT 4YLHA 5JDHA 3ZC0A 4CXWA 2MYSA 3F2EA 2OLTA 2YDQA 4JUYA 4X20E 4ZI7E 2UU9T 3BQIA 3CQCB 5L3EB 5JR9A 2VL8A 3N9NA 4AQFA 3RX6A 2YINA 4ANJA
chains in the Genus database with same CATH topology
1WR0A 2WWVA 3EABA 2LRLA 3ZSTA 4U7IA 4IT4A 5LB7B 2JQKA 4ZEYA 4U33A 3ZT5A 2LRKA 4U31A 1YXRA 4CN4A 4WZXA 2CPTA 2JQ9A 3K1SA 2V6YA 5FVKA 4P1NA 2DL1A 4CN1A 1WFDA 1WCRA 2JQHA 2WY2A 2XZEA 4U2ZA 4U3CA 4CN6A 4U2YA 5CGMA 2K3WA 4U7YA 3ZSSA 2CRBA 3ZT7A 4NIQA 2A9UA 2MPKA 2V6XA 4A5XA 2RPAA 2V6YB 2W2UA 5CJ5A 3ZT6A 5FVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR0 A;  2WWV A;  3EAB A;  2LRL A;  3ZST A;  4U7I A;  4IT4 A;  5LB7 B;  2JQK A;  4ZEY A;  4U33 A;  3ZT5 A;  2LRK A;  4U31 A;  1YXR A;  4CN4 A;  4WZX A;  2CPT A;  2JQ9 A;  3K1S A;  2V6Y A;  5FVK A;  4P1N A;  2DL1 A;  4CN1 A;  1WFD A;  1WCR A;  2JQH A;  2WY2 A;  2XZE A;  4U2Z A;  4U3C A;  4CN6 A;  4U2Y A;  5CGM A;  2K3W A;  4U7Y A;  3ZSS A;  2CRB A;  3ZT7 A;  4NIQ A;  2A9U A;  2MPK A;  2V6X A;  4A5X A;  2RPA A;  2V6Y B;  2W2U A;  5CJ5 A;  3ZT6 A;  5FVL A; 
#chains in the Genus database with same CATH topology
 1WR0 A;  2ZLY A;  3ONJ A;  1R8I A;  3ZCI A;  3H3M A;  3T1H T;  1HG5 A;  4I0U A;  2BS2 A;  4EED A;  5IYZ E;  1OED E;  2OA5 A;  4UEL A;  1BR2 A;  4UVA B;  4ZHQ E;  1HNZ T;  4JI7 T;  3Q5W A;  2C5I T;  4DVD A;  3JAD A;  3O1J A;  4F8H A;  2LHN A;  2ZM6 T;  1N33 T;  4YHH T;  2KLQ A;  3T8O A;  2XAG B;  3RYH E;  4YSY A;  4AI6 A;  5JR9 B;  1XDP A;  3OTO T;  4DV1 T;  4JI1 T;  3MAC A;  3OVU A;  4XBF B;  2IML A;  3ETU A;  4OFZ A;  5AQK B;  3RQU A;  4AKI A;  2A72 A;  4ERR A;  3K3O A;  4X65 T;  2ZMA A;  2YU2 A;  4MHC A;  1EZ3 A;  3C51 A;  3PUA A;  1VOM A;  3X1D A;  2CRB A;  4TZ4 C;  1Z0P A;  3RGL A;  4X5T A;  2NW8 A;  4KUM B;  4AQF C;  1ZP0 A;  4NXN T;  2LSJ A;  3CX6 B;  3PUZ F;  3UUN A;  2UUB T;  5AQO B;  4NUV A;  4ILB A;  3OPC A;  2JQQ A;  2XAJ B;  1J5E T;  5HEU A;  2L8K A;  3B57 A;  5L3D B;  3KBT A;  4LFB T;  1HS7 A;  3EAB A;  2HN1 A;  2DLR A;  2H88 A;  1Y64 B;  3CPZ A;  4HGA A;  2W62 A;  3O1H A;  3L39 A;  2BZB A;  2LRK A;  2BG9 C;  4U31 A;  2WQY A;  5BR8 T;  1E2A A;  2LHR A;  2BDE A;  3WAJ A;  2UXC T;  2V7J A;  2UUC T;  3AAE B;  1FJG T;  4DV0 T;  2KWI B;  2E9X C;  4ZZC A;  2CHO A;  2Q9Q C;  1ZKE A;  3NKZ A;  4MFR A;  2WAU A;  4I43 B;  3JC6 D;  1BR4 A;  2UUA T;  3PUX F;  4JEU B;  4PJN A;  3VKG A;  4UVB B;  3QB5 A;  1E1H B;  4PFO A;  1IJ5 A;  2WSS V;  2UXN B;  2V7I A;  3CIR A;  2XY8 B;  2CXL A;  3DP7 A;  1YKE B;  4IGU A;  3VHL A;  2BVM A;  5AQS B;  4B3T T;  5HEG A;  1MIV A;  3RPU A;  3ZT7 A;  4PK5 A;  1UGO A;  2LSG A;  4PNI A;  3RIA A;  4YSZ A;  3T1Y T;  2D2S A;  1YD8 G;  3AA7 B;  4CI1 B;  5JDL A;  4DUZ T;  2YDR A;  4DV5 T;  3LK3 B;  3ZMU B;  2ES0 A;  2WU5 A;  3EHZ A;  4HFD A;  4UVC B;  2DNX A;  3ZMV B;  3UT5 E;  1QUU A;  2H7O A;  1NEK A;  4X1Y E;  2JQK A;  2BS3 A;  2Y8D A;  4CQI A;  2D0T A;  3AE5 A;  2NW9 A;  3ZYM A;  2VKO A;  3DJB A;  4K0K T;  3UFG A;  3UU4 A;  5HEO A;  1T8B A;  2W66 A;  3PJA J;  4EYY R;  3N9P A;  3KIN B;  3KV9 A;  2CXF A;  3ZYL A;  2JQH A;  2WY2 A;  3AEG A;  3C4W A;  4HFV A;  3AAA B;  3VKH A;  4L9I A;  1D1A A;  2AXD S;  2XM2 A;  3U78 A;  3N9Q A;  1XDO A;  3ZSS A;  3BQK A;  3HKD E;  5DQW A;  1J5W A;  3GN5 A;  4OYJ A;  2E9X B;  1UK5 A;  3ONL C;  2WZH A;  4LML A;  2LT3 A;  4TV9 E;  5AQV B;  5LP6 E;  4AKR B;  2K9A A;  4X1K E;  5CJ5 A;  4OK0 A;  1UX4 A;  3FZH B;  4AKG A;  3IHR A;  3AA0 B;  2W0G A;  3PUR A;  3GA8 A;  4I55 E;  4O4J E;  2UXB T;  5HXS A;  5EZY E;  2V8S V;  4F6R C;  4G63 A;  4V1A v;  2CBI A;  2HPJ A;  2VUR A;  2ACX A;  1XZY A;  3K8P C;  4IST A;  2YN6 A;  4LMK A;  3ZKR A;  4LF4 T;  4PK4 A;  1WR6 A;  3MJX A;  5AQG B;  4AKH A;  2IAK A;  2E9X A;  4EXT A;  3TLV A;  1MMN A;  5JR9 C;  3UQ7 A;  4BA9 A;  5JRC A;  4JV5 T;  4HKA A;  4NPP A;  4L0R A;  2EHO A;  4DR7 T;  4WBN E;  1HTJ F;  2QA7 A;  5FKY A;  5L3B B;  2XJ7 A;  1XNR T;  2J1D G;  1SA0 E;  5LYJ E;  1T72 A;  4PK6 A;  3C98 B;  2XZE A;  3WI3 A;  3PE0 A;  4OHF A;  3NVO A;  4YTN A;  1VCT A;  1W0A A;  3ZN0 B;  3FZM B;  1J1J A;  3N9L A;  2Y6X A;  4PJM A;  2FJD A;  3U3I A;  2XSA A;  3KV4 A;  4H63 H;  2VQE T;  4LF9 T;  1HR0 T;  5FL0 A;  4YJ3 E;  5DJQ C;  2A3D A;  1W9R A;  4EZH A;  4YY3 T;  5E0O A;  3P8C D;  2E5V A;  3ETV A;  4QXC B;  4IT4 A;  3RC3 A;  1NAF A;  2X67 A;  2V7L A;  3KVA A;  4HFI A;  2GK9 A;  4U33 A;  3P7I A;  3S4U A;  4EOZ B;  3PUG A;  5FL1 A;  1DU2 A;  5AQR B;  3EAM A;  5HWY A;  1KEY A;  3K1S A;  4HN9 A;  4LF7 T;  2C5K T;  4H9R C;  3RIF A;  3CK6 A;  5C3J A;  4QX8 B;  5JRE A;  2BKN A;  3ZYK A;  1WFD A;  3OBV E;  4IL9 A;  2BS4 A;  3A7M A;  3RRC A;  4Z90 A;  2A2F X;  3PUS A;  2LSY A;  5AQI B;  3KV6 A;  4U7Y A;  2WB5 A;  4YTM A;  1H7C A;  5FP3 A;  4YXD A;  1KNZ A;  3LFM A;  2KIN B;  1W09 A;  2N2N A;  2UXX B;  3P4W A;  4JI4 T;  5EK2 A;  4DR4 T;  5DQV A;  3A5X A;  4IE5 A;  4B3R T;  2X68 A;  2XQ3 A;  3UU8 A;  1WYC A;  3L09 A;  3RC8 A;  2ACZ A;  2KND A;  3AE2 A;  3RKO A;  1OED B;  2KXP B;  3P4P A;  4CXX A;  3JAF A;  2I0M A;  2XTL A;  5JDG A;  4ZZB A;  2DCF A;  4CN4 A;  2HPL A;  2QVA A;  3AEE A;  2C5J A;  2W63 A;  2VKH A;  4Q25 A;  4ZS2 A;  4DND A;  2VVN A;  5KXJ A;  3RQW A;  2EHO C;  3FHN A;  3NWI A;  5J2T E;  3VU7 H;  4AIU A;  3OJA A;  4J2C A;  1D1B A;  2Q9Q A;  4TWF A;  4XZC A;  3UUL A;  4BJN A;  2PBI A;  5BMV E;  2L9Q A;  2CWO A;  2YU1 A;  2CE7 A;  4FJO A;  1XMQ T;  2KWH A;  4DMW A;  1X79 A;  2CLY C;  4IRE A;  5C2T A;  3ZPO A;  3FB2 A;  2XM1 A;  2YOE A;  2W67 A;  3AEA A;  4E7Z A;  2LEH A;  3LK4 2;  4ZEY A;  2BG9 E;  4JYA T;  3UUB A;  3AE7 A;  2PG8 A;  2Q9Q B;  3HKC E;  2ODU A;  3HR0 A;  4ZS3 A;  3HKE E;  3B13 A;  3VRB A;  4IE0 A;  4WNK A;  4CXY A;  4DO0 A;  2X0L B;  2X9H A;  3UU3 A;  3I9Y A;  4HWH A;  2NTY A;  4U72 A;  1FIO A;  4HWI B;  4LFC T;  1BR0 A;  3M65 A;  4AQG A;  2NR4 A;  4DUY T;  5FXW A;  1IBL T;  5J1G A;  3RI5 A;  4JI8 T;  1D0Z A;  3AB3 B;  1OXZ A;  1S35 A;  3OYZ A;  2PTF A;  4O4I E;  1IJ6 A;  3JC6 C;  5ABH A;  5LG3 A;  3J7Y q;  4P0A A;  1KFY A;  4PFP A;  2XAQ B;  3RHW A;  1E7P A;  3Q5X A;  4MAL A;  5GON E;  2VVS A;  3ZJ1 A;  4EZ4 A;  3SFE A;  1IBM T;  2F4V T;  3NZP A;  3DTO A;  1D1C A;  1VRB A;  2M6B A;  2WMO A;  1CUN A;  2XQ5 A;  3N9O A;  4M1P A;  3ZCJ A;  3Q5D A;  5LBQ B;  2XQY A;  3PTR B;  2WDV A;  5M4Y A;  1KNR A;  3LBX B;  1Z8U A;  2V5D A;  3QB5 K;  1U5P A;  2VB6 A;  2CBJ A;  4ZXL A;  3EDU A;  4HFC A;  3PDY A;  1GQE A;  2JPF A;  3UU6 A;  2W00 A;  1LKX A;  5CA1 E;  3AA6 B;  4TUY E;  3G06 A;  2WZI A;  1BR1 A;  4ZI2 C;  3EI0 A;  1FMW A;  1MND A;  2KSR A;  3TKL B;  5LB7 B;  4YFS A;  5LXT E;  1KK7 A;  1X9B A;  2RP4 A;  3I9W A;  2VQF T;  4OX9 T;  5JDM A;  3FXD B;  1SHZ C;  3GN5 B;  2NW7 A;  2YK0 A;  3E08 A;  2VAS A;  3FZF B;  3Q5E A;  2B1E A;  2JQ9 A;  4KP3 C;  3I1A A;  4H9P C;  2AE9 A;  4JBW F;  1MMA A;  1M62 A;  4UR9 A;  4CN1 A;  1HNW T;  2HN2 A;  1N32 T;  4EAH A;  4AQY T;  3M3Z B;  1NWM X;  2XQ7 A;  3RKG A;  4DV3 T;  1XNQ T;  3CX7 B;  1UX5 A;  4KI0 F;  1L0V A;  5LHG B;  1YQ4 A;  2CM0 A;  4HE8 A;  5J0Z A;  1N34 T;  3N9M A;  3RYI E;  4IIJ E;  3BK9 A;  1QLB A;  4UXN B;  4X1I E;  2EHO D;  2J4G A;  2D5U A;  1OWA A;  2JJ9 A;  4GYS A;  5L3G B;  4IDP A;  5KX5 E;  4U74 A;  3VR8 A;  5JRC B;  2W2U A;  3I0O A;  2KZ7 B;  2IC9 A;  2WWV A;  4GYR A;  2NOX A;  3UU5 A;  1AJ3 A;  3CWZ B;  2ZM0 A;  1T7S A;  3KDS E;  5IHY A;  4K0U A;  3TLU A;  5HYA A;  3Q9D A;  3QOF A;  4H63 V;  5AQU B;  1FEW A;  3F57 A;  3NBX X;  5ABG A;  4KMC A;  4IL4 A;  4HEA A;  4C91 A;  5JDN A;  3N2O A;  4JI0 T;  3KFW X;  5LOV E;  5EK3 A;  2CPT A;  1D0X A;  4ZOL E;  4ZI2 D;  4KX6 A;  2DWG A;  1MMG A;  3AEB A;  2XQ4 A;  3LK2 B;  3KVB A;  4DR1 T;  5LGT B;  4X64 T;  1OED C;  3AE9 A;  4DV4 T;  4COF A;  2BKO A;  3RIU A;  2CWY A;  3AE4 A;  5ABE A;  5L3C B;  4U3C A;  4O2A E;  4H9O C;  3SOL A;  4EB6 E;  5JDQ A;  4WBO A;  3IEE A;  1IBK T;  2R6G F;  2M6I A;  2X9W A;  2Y48 B;  1US7 B;  4H9S E;  5HXH A;  2JIW A;  5F5W A;  2LOP A;  5HAX A;  5LBM A;  4EGW A;  2BBH A;  3PUY F;  3RLF F;  4YTP A;  5HXC A;  2WWU A;  3PU3 A;  4LF8 T;  4H9Q C;  5IUX A;  1ZV4 X;  4TN7 B;  4WYV A;  2LRL A;  3N5L A;  2IIU A;  3MA9 A;  4U7I A;  2FJB A;  4YJ2 E;  4JLE A;  3J9X 1;  3AVR A;  5L3F B;  2VWA A;  3C50 A;  2H7V C;  3E0Z A;  5HWX A;  2YDS A;  2X0Y A;  2XAH B;  3ZMT B;  2OV9 A;  3PUQ A;  2RA1 A;  3MKD A;  4P1N A;  3K3N A;  3MK7 C;  4PW8 A;  2H89 A;  4TNW A;  4L5G A;  5JVD E;  1NEN A;  3AA1 B;  3H37 A;  3ZLI A;  2FBW A;  3ANW B;  4I50 E;  5LGN B;  5IWA T;  4DR3 T;  4A97 A;  2KT9 A;  5LA6 E;  4U2Z A;  2VL0 A;  2I6H A;  4YT0 A;  1WLX A;  3AVS A;  4GOU A;  4CI2 B;  1G8X A;  3F31 A;  3VRA A;  2A9U A;  2XAF B;  2V6X A;  2RPA A;  4QXB B;  1VCS A;  2PFV A;  2MOZ A;  3HL6 A;  4ILU A;  3ZT6 A;  2B76 A;  4HFH A;  3R84 B;  1LRZ A;  5ABF A;  5KDM C;  5L47 A;  1I6Z A;  5HCM A;  2IC6 A;  5ADX L;  4HTE A;  4P09 A;  4EIW A;  1O3X A;  4ILC A;  4O8S A;  4ISS A;  2L3L A;  3EUH A;  3SFD A;  2V5C A;  1HCI A;  3QUJ A;  4QH1 A;  4UF0 B;  3FZL B;  2LSI A;  4AXP A;  1MIW A;  2LKG A;  2VKJ A;  2E2A A;  4Z8X A;  5LHH B;  2QRX A;  3AED A;  3E22 E;  5LCY A;  1B7T A;  1MMD A;  1D0Y A;  3W15 B;  4DR5 T;  3HKB E;  1JNR A;  4ZI3 D;  5LJM A;  4EV6 A;  4JI6 T;  4CZZ B;  1UCU A;  5LMU T;  1ZOY A;  5F8P A;  2LKH A;  3QNU A;  2V7K A;  2E8I A;  2J47 A;  2XQA A;  3L3P A;  2K24 A;  3LG7 A;  2K3W A;  4N78 D;  4O4H E;  2W61 A;  4IE6 A;  4UEM A;  3SWH A;  4ILA A;  4UV8 B;  3UFE A;  5CB4 E;  4QKN A;  4UF0 A;  4NIQ A;  2H3R A;  1S94 A;  2W4X A;  3AE3 A;  4A5X A;  4A98 A;  2V6Y B;  2WMN A;  3ESL A;  2DWK A;  3H3A A;  4JI5 T;  2XQ9 A;  2XSB A;  3O4X E;  4GK0 E;  5FVL A;  4DV2 T;  2FJA A;  4TV8 E;  4QXH B;  2WCA A;  3UUX B;  3TLS A;  2D0U A;  2JMK A;  3CQG B;  4QH5 A;  4TNV A;  2IUB A;  3N2G E;  3P50 A;  4BJM A;  4IDQ A;  2HHH T;  3A8Y C;  5H6R B;  3N2K E;  2WP9 A;  2CHN A;  1FMV A;  1WYB A;  2ZM2 A;  3LDQ B;  4B6X A;  5AQT B;  2IHR 1;  2BKP A;  1KF6 A;  2X0H A;  3Q2M A;  2FJE A;  4UIG A;  3D0T A;  4ADZ A;  4KHP T;  3ZEF B;  5LG4 A;  5EK4 A;  5HXE A;  3V5U A;  4GKJ T;  3B5M A;  2UXD T;  2DHR A;  5L4H A;  4TX5 A;  2XPK A;  3ZMS B;  3RF1 A;  4ASK A;  1V9D A;  5LJN A;  4JI2 T;  2WS3 A;  3AXJ A;  2K5B B;  4FI5 A;  2XQ8 A;  2XAS B;  3ZMZ B;  5JDF A;  1N36 T;  4YHJ A;  3HI2 A;  3IBP A;  2MPK A;  4AKL A;  3AE6 A;  5C8Y E;  2BG9 A;  3O9X A;  1LVF A;  5FNV E;  3C4Z A;  5HEH A;  2EHO B;  3NZQ A;  5CA0 E;  2Z6E A;  2MTQ A;  5L2L A;  5LMN T;  2KMF A;  2CLY B;  4IE4 A;  2MBG A;  3R6N A;  3HA4 A;  2SPC A;  2X66 A;  3NRY A;  2X9X A;  4H9N C;  5FXX A;  4DV6 T;  5AQM B;  2QGS A;  3C64 A;  1UUS A;  2PJQ A;  3GWH A;  3LJC A;  4KBM B;  3AXJ B;  5AQH B;  4MBQ A;  2D9D A;  3RYF E;  3UQ4 A;  2IW5 B;  2LJL A;  4CI3 B;  1SE7 A;  3PUW F;  2LOS A;  2CMR A;  2YEV C;  4IDO A;  5AQJ B;  2LLY A;  1HG2 A;  2N1G A;  3AAI A;  2DL1 A;  2YKS A;  4PAG A;  4TWH A;  2X51 A;  3NRX A;  1HFA A;  1QSD A;  1IAP A;  1UUR A;  2K48 A;  3C4X A;  3CVR A;  3EVY A;  5AQL B;  5FYM A;  3CQX C;  1ZEE A;  1OED A;  5HXR A;  4IDZ A;  2E5L T;  4HFE A;  2LM9 A;  4JI3 T;  3CML A;  3GMI A;  4NXM T;  1U4Q A;  3RH3 A;  5L4E A;  3O1I A;  3BQL A;  3QC9 A;  1MIY A;  4NUU A;  3AEF A;  3ZJ2 A;  2WBL A;  2ZM8 A;  3KV5 A;  1XWM A;  4DV7 T;  1YQ3 A;  3JCF A;  1G73 A;  4EEB A;  2NWB A;  5DAB A;  4I4T E;  3FXE B;  5FY0 A;  2IDO B;  3LSV A;  5LGU B;  3FBZ A;  2V7M A;  3OKQ A;  5CFB A;  4X66 T;  5TAO A;  3P4R A;  4UV9 B;  3L8R A;  5FY1 A;  5JTG A;  2P9B A;  4JEH B;  4O4L E;  5FXV A;  3ZT5 A;  2LSK A;  2LM2 A;  4PJJ A;  4WZX A;  5FY7 A;  1HX1 B;  2JMH A;  3MXZ A;  4GIW A;  3IA3 A;  4OYK A;  5AQN B;  5FVK A;  3TLT A;  4DBQ A;  2VKD A;  4A56 A;  4BAY B;  4LF5 T;  5ABF B;  5JQG E;  2WDQ A;  5KMG P;  2WDR A;  1KNP A;  4EYU A;  4CN6 A;  4U2Y A;  5F3J A;  1HNX T;  2WU2 A;  4WW0 A;  5CGM A;  2NTX A;  1SUM B;  2CXD A;  4KHZ F;  5ETW A;  2Q9Q D;  4G2A A;  4HWD A;  2V1D B;  3RRW A;  3PV0 F;  1I94 T;  4GKK T;  5HEJ A;  2ODV A;  2CEA A;  2N9D A;  3P4S A;  2G0U A;  2M67 A;  1CHU A;  4IDN A;  3JAE A;  2X9Y A;  2XUE A;  4DR6 T;  3K3Q C;  1Y01 A;  3ANW A;  2FUP A;  3P4Q A;  3WAK A;  4HWF A;  5LNK A;  3V5S A;  4QX7 B;  2I59 A;  3AE1 A;  3ZST A;  2DI4 A;  4LFA T;  4HFB A;  4AIS A;  1LVK A;  3CKD A;  2LE8 A;  1YKH B;  4X62 T;  1MNE A;  3LBX A;  4IE7 A;  4GK5 E;  3SS1 A;  3PU8 A;  4Z91 A;  5AQP B;  2XHE B;  1HX8 A;  5AQQ B;  4LF6 T;  4DR2 T;  1IZN B;  2VK9 A;  4YSX A;  2V26 A;  2MAW A;  3I0Q A;  5AQF B;  3IF8 B;  4IHJ E;  5H6Q B;  1ZHC A;  4HWC A;  3RIU C;  4DID B;  2XQ6 A;  1HF8 A;  3CX8 B;  3OYX A;  3RYC E;  1M7K A;  3AEC A;  5HCJ A;  2NP9 A;  3MZK B;  4QH4 A;  4O2B E;  3UTK A;  3ZN1 B;  4C90 A;  2E9X D;  5JH7 E;  5A1L A;  2C0S A;  5LHI B;  2BVL A;  3ONX A;  5J2U E;  4B3S T;  2QYW A;  4MLK A;  3AE8 A;  4LMJ A;  2CCQ A;  4TWD A;  4DBR A;  1YXR A;  2CA5 A;  3QK6 A;  4P0B A;  4PJL A;  4QHO A;  4B3M T;  2J62 A;  2BG9 B;  1WRD A;  2V6Y A;  2BBJ A;  3PJA A;  4ZI3 C;  3UUM A;  2JRK A;  1W0B A;  2WM9 A;  3FZK B;  4QWN B;  4XAX B;  4E7S A;  4DMV A;  1YW0 A;  3KBU A;  5AFU L;  2HH7 A;  1WCR A;  3ABV A;  5FXZ A;  1JNZ A;  5FMN A;  3TLW A;  3VR9 A;  3PUV F;  3SRZ A;  3EDV A;  3FBL A;  1T98 A;  3ZC1 A;  1XMO T;  4YLH A;  5JDH A;  3ZC0 A;  4CXW A;  2MYS A;  3F2E A;  2OLT A;  2YDQ A;  4JUY A;  4X20 E;  4ZI7 E;  2UU9 T;  3BQI A;  3CQC B;  5L3E B;  5JR9 A;  2VL8 A;  3N9N A;  4AQF A;  3RX6 A;  2YIN A;  4ANJ A; 
#chains in the Genus database with same CATH homology
 1WR0 A;  2WWV A;  3EAB A;  2LRL A;  3ZST A;  4U7I A;  4IT4 A;  5LB7 B;  2JQK A;  4ZEY A;  4U33 A;  3ZT5 A;  2LRK A;  4U31 A;  1YXR A;  4CN4 A;  4WZX A;  2CPT A;  2JQ9 A;  3K1S A;  2V6Y A;  5FVK A;  4P1N A;  2DL1 A;  4CN1 A;  1WFD A;  1WCR A;  2JQH A;  2WY2 A;  2XZE A;  4U2Z A;  4U3C A;  4CN6 A;  4U2Y A;  5CGM A;  2K3W A;  4U7Y A;  3ZSS A;  2CRB A;  3ZT7 A;  4NIQ A;  2A9U A;  2MPK A;  2V6X A;  4A5X A;  2RPA A;  2V6Y B;  2W2U A;  5CJ5 A;  3ZT6 A;  5FVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...