3VHLA

Crystal structure of the dhr-2 domain of dock8 in complex with cdc42 (t17n mutant)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
264
Chain Sequence
FGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 8
publication title DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 87
structure length 264
sequence length 273
ec nomenclature
pdb deposition date 2011-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vhlA02
3B13A 2YINA 2WMOA 3VHLA 2WM9A 2WMNA
chains in the Genus database with same CATH superfamily
2VWAA 4K0KT 3O1JA 3GMIA 3VKHA 4OK0A 3AAIA 4UR9A 2XJ7A 4O4JE 4GYSA 3NZQA 4DV3T 4IL4A 3T8OA 2DCFA 3EABA 3N2GE 2CWYA 3MK7C 2FJEA 3CQXC 4AIUA 3GN5B 2LRKA 5FNVE 2XSBA 2IHR1 2KWIB 2KWHA 2MBGA 3U3IA 4UF0A 1D0XA 4Q25A 2X0HA 3C51A 4PK5A 3ZT7A 5JTGA 2A2FX 2RP4A 3UUBA 5FP3A 2NTYA 1SE7A 2XQ8A 4WZXA 2LKHA 3D0TA 3P8CD 3RYIE 4MALA 4MFRA 2F4VT 3UUXB 3NRXA 2MOZA 3ZPOA 5JR9C 3AE5A 2XQ4A 4FI5A 4OYJA 3TLWA 2K24A 2I0MA 2VB6A 2V5DA 4UV8B 3DP7A 3P7IA 3T1YT 4H9OC 1MNDA 3RRWA 1D1CA 5LBMA 3ZMVB 1OWAA 3X1DA 3WAJA 3J7Yq 4UVAB 2WWUA 4I55E 2YU2A 2VL0A 4U72A 3TLTA 5IWAT 4LMKA 2LKGA 2XPKA 3N9OA 4IDQA 1YW0A 2LEHA 4YTPA 2DLRA 3FZHB 2K48A 2VASA 4H63V 4ILCA 2CEAA 4PJMA 1L0VA 4JI8T 1S94A 2JMHA 5BMVE 1HFAA 3J9X1 4UF0B 5AFUL 4N78D 1NWMX 2QVAA 3UFGA 1KNZA 3SFDA 2HPJA 5J2TE 4C91A 3CPZA 4PK6A 4HWFA 3SWHA 2Q9QB 3JC6D 3SFEA 5LP6E 3RI5A 2CXDA 3EUHA 5CB4E 5HXRA 5FKYA 1XMQT 1VRBA 3L39A 4EV6A 4CXWA 4HFDA 3RQUA 1SHZC 4ERRA 2JPFA 2CPTA 4YHJA 4UEMA 3C4WA 5LHHB 1Y01A 2HN2A 3O1HA 3OYZA 5JH7E 2H7OA 2CHOA 2V5CA 1M7KA 4PK4A 5C2TA 2LOPA 3PE0A 2VQET 3AE7A 2X51A 5C3JA 1AJ3A 2XQAA 4CI1B 4AKRB 1W0BA 2LHNA 2BG9B 4IHJE 4DR7T 1HCIA 3AE8A 5LNKA 4PW8A 3KVBA 4B3MT 1IAPA 4H9QC 4JBWF 3IF8B 4AKIA 3ONJA 4L9IA 4IDNA 4A5XA 4JLEA 2NP9A 4A97A 5LXTE 1U5PA 4HFIA 4DIDB 2XTLA 4MHCA 4ZEYA 4XBFB 2X67A 1KNPA 3G06A 4QX8B 3I0QA 3RIFA 2CXLA 2PBIA 3RIUA 2MYSA 5JDMA 4AKGA 3RQWA 2XQ9A 5KDMC 4B3TT 1E1HB 3GA8A 3ZYKA 3MKDA 3VR8A 2IIUA 4FJOA 4HWHA 3FXDB 1DU2A 2W63A 4NUUA 2A3DA 2ZM0A 4J2CA 2LE8A 4DR4T 3DTOA 1LRZA 1XNRT 4COFA 2PTFA 3QOFA 3H3MA 1XMOT 2IDOB 4JI7T 3UUNA 3OVUA 3ZCIA 3ZEFB 2PFVA 4CQIA 3FZLB 4LF7T 4XZCA 1UX4A 2V7IA 2WDQA 4DVDA 4QHOA 2JQKA 2XSAA 1D0ZA 3EDVA 1MIYA 3Q5DA 5FY1A 5EZYE 3N2KE 2UU9T 2UXBT 5LB7B 2WBLA 4HWDA 3N2OA 4LFAT 5AQNB 1MNEA 2V1DB 1G8XA 2CLYB 1CUNA 2EHOB 3PTRB 2X9XA 2UXCT 3PUSA 3PUQA 5CA1E 3MA9A 5HCMA 1FIOA 3HA4A 2K3WA 4EEDA 4GK0E 2MTQA 1ZKEA 3KV6A 2KNDA 5AQPB 4E7ZA 5DQWA 4EXTA 3ZJ2A 2D0TA 4EGWA 4EIWA 3PJAA 3KBUA 4KBMB 2RPAA 2CRBA 5FXXA 2HN1A 3RYHE 3AECA 5LJMA 5HXEA 4O4LE 4QXHB 1WRDA 3UU6A 2XQ5A 3H3AA 5HXSA 3Q5XA 4LMJA 1NENA 4AQFA 1ZEEA 3RHWA 5AQIB 3ZT6A 4DMVA 2G0UA 3BK9A 5L2LA 3AE1A 4IDZA 4ZHQE 3AE3A 5H6RB 4QH1A 3PUVF 2K9AA 4ZXLA 1IZNB 5IYZE 4LF6T 3ZJ1A 3ZKRA 1X9BA 3IHRA 3FBZA 3OKQA 4DR5T 4XAXB 1NAFA 4K0UA 5EK3A 5J0ZA 1UK5A 1LVFA 2V26A 5L47A 1S35A 4JV5T 4U7IA 2A72A 3ZC0A 4TUYE 4DR1T 5LBQB 2N1GA 1MMAA 2M6BA 2IC6A 2IUBA 3MACA 2E5VA 4OFZA 2JQ9A 2JJ9A 4PJLA 5TAOA 3AEAA 3ZYLA 4U7YA 5JR9B 3RIUC 3AVRA 3Q2MA 1XWMA 5CA0E 2BZBA 2WSSV 1XZYA 1YD8G 1HX8A 2XAQB 1OXZA 4X1YE 2Z6EA 3N9LA 2NTXA 5LMUT 5LJNA 3FZKB 2PJQA 3PUAA 1HNXT 3BQIA 4TWHA 2XQ6A 3AE4A 4CN4A 4LMLA 2WM9A 3CVRA 3CMLA 1W9RA 4X1KE 2B1EA 5AQKB 1FMWA 1HF8A 3JAEA 2WS3A 2CBIA 2UXXB 1MMDA 4YT0A 4YTNA 3P4PA 4YJ3E 5FY7A 3AE6A 2UUCT 4AKLA 4DR3T 2A9UA 5L3CB 3UTKA 2CM0A 2XAJB 2W67A 3RF1A 2DI4A 2H7VC 4DBRA 3ZMSB 4ASKA 3AEBA 5LGTB 5GONE 4TV9E 4EOZB 1KK7A 2CWOA 2UUAT 3JC6C 2OLTA 3AEGA 1X79A 5ABFB 4YSYA 3ABVA 3ONLC 1T7SA 3ZN0B 4HE8A 2W62A 2BS2A 4P09A 4HEAA 3C4ZA 3S4UA 1GQEA 2J62A 3HKEE 3F57A 2E9XD 2ZLYA 3L09A 4OYKA 3VKGA 5HEJA 4H9PC 1KF6A 4WBOA 4EZHA 5DQVA 3AEDA 2FBWA 3NRYA 2WP9A 1HR0T 2LSYA 4YSXA 2Y48B 4I0UA 4H9NC 5FY0A 2D5UA 2I6HA 2MPKA 5FXZA 4F8HA 4EYUA 4HKAA 4PJNA 4LF4T 4IT4A 4YJ2E 4QXCB 2QA7A 4V1Av 4A98A 4LF5T 3N5LA 4DV6T 4G2AA 1J5WA 4DNDA 2WMNA 2X9YA 4ISSA 5JRCA 4AQFC 2HHHT 4HGAA 4Z91A 4I43B 4NIQA 4AKHA 2DNXA 5CJ5A 2WU5A 3UT5E 3F2EA 1HG5A 2YEVC 4MLKA 4TNVA 2JMKA 3UQ4A 5LYJE 1QLBA 4HN9A 4PFOA 3HI2A 4ADZA 2LSKA 5M4YA 5A1LA 2VVSA 2Y6XA 3M3ZB 2CMRA 1UGOA 4BJNA 2C5JA 4HTEA 1HX1B 2KMFA 4QX7B 4ZZBA 1QUUA 2IMLA 5H6QB 3HKBE 3KDSE 2XM2A 4AISA 5L3EB 2V7MA 1MMGA 2ZMAA 4ILBA 4QH5A 4ZZCA 4JI5T 3UU3A 3W15B 4DO0A 1JNZA 1M62A 2LRLA 4EAHA 1KNRA 3LDQB 2P9BA 3N9NA 4TWDA 2NW8A 4IREA 5AQFB 2KXPB 3V5UA 3E22E 3AA1B 1T98A 2VKDA 2C5KT 4DUYT 5HAXA 5HEHA 1CHUA 1YKEB 3ZMUB 2LJLA 2E9XA 2J4GA 3UU4A 3WAKA 3I9YA 2XM1A 4YLHA 5AQSB 3K3OA 2V7JA 2FJDA 3OJAA 3RIAA 1SA0E 3ANWA 5ADXL 5FXVA 5L4EA 4TX5A 2V6YA 3AB3B 2KZ7B 3CK6A 3B5MA 4DV4T 4AQYT 3LSVA 4KP3C 2YK0A 4NXMT 5JQGE 4KHPT 1J1JA 3I9WA 2XASB 4DR6T 2YDSA 5LOVE 2LM9A 2WZIA 1YQ3A 4EB6E 4B3RT 1HNZT 4DV5T 1WFDA 4ZI3C 3VHLA 4BAYB 2VVNA 2QRXA 2WDVA 4B3ST 5L3BB 4EEBA 2M6IA 4G63A 5ABHA 4IDPA 2VQFT 3PU8A 4U74A 3P4QA 1VOMA 2H89A 3PUZF 4PAGA 1YKHB 3CWZB 3UU5A 2V7LA 4QWNB 2AXDS 3N9PA 4DMWA 3QUJA 1IBMT 3ZC1A 4AXPA 2ZM6T 2YKSA 2YDRA 3CQCB 3ZT5A 1WR0A 5AQLB 4JI4T 3NBXX 2BVMA 3QNUA 3RKOA 5LHIB 4U2YA 1XDOA 2LOSA 3LK2B 3A7MA 3P4WA 4DV1T 4JI6T 3WI3A 3ETVA 3MXZA 2CXFA 4U31A 4LF9T 4GOUA 5LMNT 1OEDA 2V8SV 2D2SA 4JEUB 3B13A 1YXRA 3ONXA 4YY3T 4EYYR 3KV5A 2ZM2A 5AQOB 4TNWA 3LFMA 1HG2A 1JNRA 3AXJA 5LA6E 3K3QC 3JADA 1J5ET 4H63H 3Q5WA 3KFWX 3PUWF 3ZCJA 3BQLA 4C90A 2BKNA 2YINA 4MBQA 5FL1A 4L5GA 4ZI3D 5HWXA 4AI6A 2Q9QD 5HWYA 4TZ4C 4QKNA 2KSRA 2JQQA 5LGNB 4CN1A 3Q9DA 5IHYA 4X62T 4IIJE 3RX6A 4M1PA 3PUGA 2LSJA 5AQRB 5AQTB 2XQ3A 3FBLA 2C5IT 4YXDA 4O2BE 2E9XC 3CX7B 4CI2B 2NWBA 4GK5E 3O9XA 5F3JA 5JDQA 2Y8DA 3ZSSA 4PJJA 2BBJA 3GN5A 3O4XE 4JEHB 1I94T 3P4RA 3QB5K 1D1AA 4X65T 3R84B 2BS3A 2X68A 2IC9A 3NVOA 2WDRA 5JDFA 3CQGB 5FVKA 1U4QA 4JI3T 2L8KA 1SUMB 5EK2A 3RPUA 2WCAA 2XY8B 4X5TA 4DV7T 2ES0A 1W0AA 3O1IA 1MIWA 4JI2T 3LK42 3K1SA 1O3XA 5AQHB 2ZM8A 5AQVB 2CCQA 1B7TA 1KFYA 4CI3B 4HWIB 4QXBB 1IBKT 1UX5A 2KINB 4O4IE 4GIWA 4P0AA 2BVLA 2DHRA 4KUMB 4KX6A 3RH3A 1XDPA 5LHGB 2JIWA 4UELA 3FZFB 2XHEB 3NZPA 2LSIA 5J2UE 3EVYA 4Z90A 1N34T 2NR4A 3GWHA 4HFBA 1UCUA 1ZOYA 5JDNA 3PV0F 5AQQB 5AQUB 2XAHB 2E2AA 3TKLB 3HL6A 4OHFA 1HS7A 2DWKA 5LCYA 3ZMTB 4HFCA 4NUVA 4A56A 1OEDE 3SOLA 2H3RA 4I4TE 2CE7A 3TLSA 2I59A 4X66T 4P1NA 2M67A 4DUZT 1D1BA 2WMOA 1ZP0A 2NOXA 4GYRA 4ANJA 2YDQA 4YFSA 1Z8UA 1WR6A 2VKOA 3N9QA 2Q9QA 3ZSTA 3TLUA 3P4SA 1MMNA 1E7PA 2WB5A 4UV9B 5HXHA 4JYAT 1OEDC 1FJGT 4ZI7E 2EHOD 5HCJA 5HEGA 5EK4A 5LG3A 4IGUA 3K3NA 2ODUA 3SRZA 5FVLA 4O4HE 4P0BA 5C8YE 5L4HA 3A5XA 3R6NA 2BBHA 3T1HT 2VK9A 2WU2A 4IDOA 3RC3A 5E0OA 2AE9A 3VR9A 4ZOLE 1NEKA 3JAFA 4IE4A 3EAMA 4IE6A 4O8SA 4IL9A 3AVSA 2X0LB 4CZZB 2BG9A 5KX5E 3Q5EA 3LK3B 3JCFA 3AE2A 4TV8E 3E0ZA 3CIRA 2PG8A 4U3CA 2VL8A 2YOEA 2NW9A 4DR2T 1D0YA 4LFCT 3UFEA 5JDLA 3FB2A 5FMNA 4ZI2D 5ETWA 3L8RA 2LLYA 2L9QA 3PU3A 3PURA 2YU1A 3UU8A 3N9MA 4KMCA 2VURA 3EI0A 2OA5A 3PJAJ 3I0OA 3NWIA 2UXDT 4ILUA 5HEOA 3EHZA 1BR1A 2J47A 3EDUA 4U33A 1UURA 3VRAA 4HFVA 3FHNA 4U2ZA 5HXCA 4YTMA 4EZ4A 2SPCA 3AA0B 2E5LT 3LG7A 2X0YA 4IE0A 3UUMA 1BR4A 2HPLA 4QH4A 5AQJB 4IE7A 4UVCB 3K8PC 2KLQA 2XAFB 5LG4A 2XAGB 1FEWA 3KVAA 3OBVE 3V5SA 4E7SA 2LT3A 4PNIA 1ZV4X 2QYWA 5JRCB 1KEYA 4DV0T 3QK6A 2FUPA 1HTJF 1E2AA 2WZHA 4GKKT 2UXNB 4O2AE 2D0UA 4H9SE 4HFHA 4Z8XA 3AA7B 3F31A 4BJMA 3AA6B 1W09A 3LJCA 5AQGB 3C98B 3MZKB 5HEUA 1LVKA 4WNKA 2EHOA 2LHRA 2ODVA 1VCSA 2X9HA 5AQMB 2W2UA 3AAAB 4LFBT 2L3LA 2D9DA 1XNQT 1N36T 1N32T 3RYFE 3CX8B 5JDHA 2W0GA 1V9DA 1ZHCA 3C64A 4UVBB 3P50A 2LSGA 5F8PA 3H37A 5JREA 3PUYF 2K5BB 2WAUA 4YHHT 3AEEA 3TLVA 2Q9QC 1Z0PA 2BG9E 3CKDA 4H9RC 4F6RC 2FJAA 1G73A 4KI0F 2HH7A 4TWFA 2YN6A 3HKCE 3ZMZB 1WYCA 3IBPA 1MIVA 2LM2A 3RC8A 4DV2T 4BA9A 5F5WA 5KXJA 2BS4A 4JI0T 5JVDE 1YQ4A 3LBXA 1BR2A 3OPCA 2C0SA 4ISTA 1FMVA 1HNWT 3PUXF 5KMGP 4DBQA 1WYBA 4NXNT 2JQHA 2E9XB 1Y64B 1I6ZA 4WBNE 3E08A 3VU7H 2FJBA 4JUYA 2B76A 2BG9C 3AAEB 5J1GA 5HYAA 1H7CA 2VKJA 3C4XA 2WWVA 2RA1A 4LF8T 3KV4A 3SS1A 2XQ7A 5BR8T 2XQYA 4PFPA 3CX6B 3ANWB 2BKOA 2R6GF 3VRBA 1IBLT 3HR0A 2W00A 2WY2A 2V6YB 4HFEA 3B57A 2H88A 2XZEA 4JI1T 2IAKA 1QSDA 3C50A 5L3DB 4AQGA 2NW7A 4CN6A 3UQ7A 5FXWA 3OTOT 3NKZA 1BR0A 4ILAA 2CHNA 2W66A 5JR9A 2VKHA 3FZMB 2BKPA 1US7B 1IJ6A 2MAWA 4TN7B 4B6XA 3IEEA 4NPPA 5LGUB 1T72A 2CA5A 3KINB 2V6XA 4L0RA 2J1DG 3I1AA 4OX9T 5L3GB 3OYXA 3BQKA 5ABGA 3PDYA 2BDEA 2ACXA 1VCTA 4CXXA 3LBXB 3ZYMA 2DL1A 2UUBT 2N2NA 2N9DA 5DJQC 3UULA 2IW5B 1N33T 1EZ3A 3RLFF 4X64T 3RKGA 2W61A 3A8YC 2W4XA 5L3FB 5CGMA 4CXYA 2CBJA 1WCRA 5ABFA 4UIGA 2JRKA 2GK9A 3DJBA 3IA3A 4YSZA 1T8BA 2CLYC 2ACZA 4IE5A 3ESLA 2EHOC 3RYCE 1UUSA 3KV9A 5IUXA 3ZN1B 2V7KA 1OEDB 5FL0A 4GKJT 3AEFA 5JDGA 3FXEB 3QB5A 2KT9A 3ZLIA 3RGLA 1WLXA 2E8IA 2X9WA 5ABEA 4X1IE 3MJXA 3L3PA 4WYVA 3HKDE 3AXJB 4KHZF 3AE9A 5CFBA 3KBTA 2WQYA 2DWGA 4I50E 4HWCA 1IJ5A 3QC9A 5DABA 5FYMA 3ETUA 2X66A 3RRCA 2OV9A 4ZS3A 1LKXA 4WW0A 4ZS2A 1R8IA 2QGSA 4X20E 3M65A 4ZI2C 4UXNB 3U78A 2XUEA
chains in the Genus database with same CATH topology
4KP3C 2YK0A 2VWAA 5JQGE 5ETWA 3I9WA 3O1JA 3RYHE 2L9QA 5LJMA 5HXEA 4O4LE 3GMIA 3PU3A 3PURA 2YU1A 4OK0A 4QXHB 3VKHA 1WRDA 3AAIA 3N9MA 4KMCA 2XASB 3H3AA 4O4JE 5HXSA 2OA5A 4GYSA 3NZQA 3I0OA 3Q5XA 5LOVE 4AQFA 3T8OA 2LM9A 1ZEEA 2DCFA 4ILUA 4EB6E 3N2GE 2CWYA 3MK7C 1BR1A 4DMVA 3EDUA 2G0UA 4ZI3C 3VHLA 4BAYB 3CQXC 3BK9A 3GN5B 5L2LA 5FNVE 4IDZA 4HFVA 4ZHQE 2KWIB 5H6RB 2KWHA 5L3BB 3FHNA 2MBGA 3U3IA 4G63A 5HXCA 2K9AA 4UF0A 4EZ4A 3PU8A 1D0XA 1IZNB 2SPCA 4U74A 5IYZE 3ZJ1A 1VOMA 3AA0B 3IHRA 3FBZA 3OKQA 3LG7A 3C51A 4PK5A 2A2FX 4IE0A 3UUMA 1BR4A 2HPLA 4XAXB 1NAFA 4K0UA 4PAGA 1YKHB 2RP4A 5EK3A 3CWZB 5FP3A 2NTYA 1LVFA 4IE7A 2V26A 4UVCB 1S35A 3K8PC 2V7LA 3D0TA 3P8CD 4QWNB 3N9PA 2KLQA 4DMWA 2A72A 2XAFB 3QUJA 5LG4A 3ZC0A 3ZC1A 4TUYE 4AXPA 5LBQB 3RYIE 4MALA 2N1GA 1MMAA 4MFRA 2XAGB 3UUXB 3NRXA 1FEWA 3CQCB 2MOZA 3ZPOA 3KVAA 2IC6A 3OBVE 3MACA 3V5SA 5JR9C 4E7SA 3NBXX 2LT3A 2BVMA 4OFZA 4PNIA 1ZV4X 5JRCB 3RKOA 2JJ9A 4PJLA 5TAOA 3ZYLA 4FI5A 5LHIB 4OYJA 3QK6A 5JR9B 2K24A 1HTJF 3AVRA 3Q2MA 2LOSA 2VB6A 5CA0E 2BZBA 2WSSV 3LK2B 4UV8B 3DP7A 3P7IA 1YD8G 1HX8A 2XAQB 4H9OC 2UXNB 4O2AE 1OXZA 2D0UA 4H9SE 1MNDA 3AA7B 4X1YE 4Z8XA 3F31A 3RRWA 1D1CA 5LBMA 3ZMVB 4BJMA 3WI3A 2Z6EA 3AA6B 1OWAA 3N9LA 2NTXA 3LJCA 5LJNA 3ETVA 3WAJA 3MXZA 3C98B 3J7Yq 2CXFA 2PJQA 3PUAA 3MZKB 2WWUA 4UVAB 1LVKA 4GOUA 4WNKA 3BQIA 2EHOA 2LHRA 4I55E 2ODVA 2D2SA 4JEUB 2X9HA 2YU2A 3B13A 3ONXA 4U72A 2WM9A 4EYYR 3KV5A 3AAAB 3CVRA 2ZM2A 3CMLA 2L3LA 4X1KE 3N9OA 2B1EA 3LFMA 1YW0A 2LEHA 1HG2A 2DLRA 1FMWA 1HF8A 2K48A 3RYFE 5LA6E 2VASA 3K3QC 4H63V 2CEAA 3CX8B 4H63H 2UXXB 1MMDA 4PJMA 5JDHA 2W0GA 1V9DA 1ZHCA 3Q5WA 3KFWX 3C64A 4YJ3E 1S94A 5FY7A 4UVBB 3ZCJA 2LSGA 4AKLA 5F8PA 2JMHA 3H37A 5BMVE 5JREA 1HFAA 3BQLA 5L3CB 3J9X1 4C90A 2K5BB 2YINA 2WAUA 4MBQA 2CM0A 4UF0B 3UTKA 4N78D 5AFUL 2XAJB 1NWMX 2DI4A 4L5GA 2Q9QC 2H7VC 4DBRA 4ZI3D 5HWXA 3ZMSB 1Z0PA 2Q9QD 4ASKA 1KNZA 3CKDA 5LGTB 4AI6A 4H9RC 2HPJA 5HWYA 4F6RC 4TZ4C 1G73A 5J2TE 5GONE 2HH7A 4TV9E 4C91A 3HKCE 4QKNA 4EOZB 3CPZA 1KK7A 2CWOA 4PK6A 3SWHA 3ZMZB 2JQQA 3JC6C 5LGNB 2Q9QB 3Q9DA 1WYCA 1X79A 3IBPA 1MIVA 5IHYA 3JC6D 4IIJE 3RX6A 3RC8A 4M1PA 3PUGA 4BA9A 5LP6E 2CXDA 3EUHA 5CB4E 5HXRA 2LSJA 3ZN0B 4HE8A 3FBLA 2C5IT 1VRBA 5JVDE 2W62A 3LBXA 4CXWA 4P09A 4HEAA 3C4ZA 3S4UA 4O2BE 1BR2A 2E9XC 3CX7B 3HKEE 4CI2B 3F57A 2NWBA 2C0SA 4ISTA 2E9XD 1FMVA 2ZLYA 3L09A 4GK5E 4OYKA 3VKGA 3O9XA 1SHZC 5F3JA 2Y8DA 5JDQA 4ERRA 5KMGP 2JPFA 4H9PC 4PJJA 4WBOA 4YHJA 3GN5A 3O4XE 1WYBA 3C4WA 4JEHB 4UEMA 4DBQA 4EZHA 5LHHB 1D1AA 5DQVA 2E9XB 3R84B 1Y64B 4WBNE 2X68A 3O1HA 3E08A 3OYZA 3VU7H 5JH7E 2H7OA 2IC9A 4JUYA 3AAEB 4PK4A 5JDFA 3NRYA 3CQGB 2LOPA 1H7CA 3PE0A 5J1GA 5HYAA 2VKJA 2X51A 3C4XA 1U4QA 2RA1A 2L8KA 1AJ3A 4CI1B 5EK2A 4AKRB 2LSYA 3RPUA 2LHNA 2Y48B 3KV4A 3SS1A 2ES0A 2XQYA 4IHJE 4PFPA 3CX6B 3O1IA 1MIWA 4H9NC 5FY0A 3ANWB 3LK42 1O3XA 1HCIA 2D5UA 2ZM8A 2CCQA 1B7TA 2W00A 3HR0A 5FXZA 4PW8A 5LNKA 4CI3B 4EYUA 3KVBA 4HKAA 4PJNA 4QXBB 3B57A 1IAPA 1UX5A 4YJ2E 4H9QC 4QXCB 2KINB 3IF8B 4O4IE 4GIWA 4P0AA 4AKIA 2BVLA 2DHRA 4ZI2D 4KUMB 2QA7A 4V1Av 2IAKA 4L9IA 3RH3A 3N5LA 1QSDA 4G2AA 3C50A 5L3DB 4DNDA 4JLEA 2WMNA 2X9YA 4ISSA 2NW7A 4AQGA 5JRCA 2NP9A 5LHGB 5FXWA 4UELA 4AQFC 4HGAA 1BR0A 5LXTE 1U5PA 2XHEB 4I43B 5JR9A 2VKHA 2XTLA 4MHCA 4AKHA 4XBFB 2DNXA 3NZPA 1US7B 2X67A 2LSIA 1IJ6A 5J2UE 3EVYA 4TN7B 3UT5E 4QX8B 4B6XA 3I0QA 3GWHA 3IEEA 2CXLA 3F2EA 2PBIA 1HG5A 2MYSA 2YEVC 5JDMA 5LGUB 4AKGA 5KDMC 4MLKA 1UCUA 2CA5A 3KINB 5JDNA 2JMKA 1E1HB 4L0RA 3GA8A 2J1DG 3ZYKA 3I1AA 3MKDA 5L3GB 5LYJE 2XAHB 4FJOA 3OYXA 3BQKA 3TKLB 3HL6A 4HN9A 3PDYA 4PFOA 3HI2A 4OHFA 4ADZA 2LSKA 1HS7A 3FXDB 2BDEA 2ACXA 2DWKA 5M4YA 5A1LA 2Y6XA 5LCYA 2W63A 2CMRA 4NUUA 4CXXA 2A3DA 4BJNA 2ZM0A 2C5JA 3LBXB 3ZMTB 4J2CA 2LE8A 3ZYMA 4NUVA 4HTEA 3DTOA 4A56A 2KMFA 2N2NA 2N9DA 1LRZA 3SOLA 5DJQC 4QX7B 1QUUA 2H3RA 5H6QB 3UULA 2IW5B 3HKBE 3KDSE 4I4TE 5FXXA 2CE7A 5L3EB 2V7MA 1MMGA 1EZ3A 2ZMAA 2I59A 3UUNA 2M67A 1D1BA 2WMOA 3W15B 4DO0A 3ZCIA 2W61A 3ZEFB 2NOXA 4GYRA 4ANJA 5L3FB 2PFVA 4CQIA 4YFSA 4EAHA 4XZCA 2P9BA 3N9NA 1WR6A 4CXYA 2VKOA 3N9QA 1UX4A 2Q9QA 2V7IA 4DVDA 2NW8A 4QHOA 2KXPB 4UIGA 1D0ZA 2JRKA 3EDVA 3V5UA 1MMNA 1MIYA 2GK9A 3E22E 3AA1B 1T98A 3DJBA 2VKDA 2C5KT 4UV9B 5HXHA 2CLYC 5FY1A 5EZYE 3N2KE 4IE5A 5HAXA 3ESLA 2EHOC 2WBLA 3RYCE 4ZI7E 1YKEB 3KV9A 2EHOD 3ZMUB 3N2OA 5EK4A 3ZN1B 4IGUA 2V7KA 1MNEA 2V1DB 1G8XA 3K3NA 2ODUA 2CLYB 3SRZA 4O4HE 2LJLA 4P0BA 1CUNA 2EHOB 5JDGA 3PTRB 2E9XA 2X9XA 3FXEB 5C8YE 2KT9A 3ZLIA 3PUSA 3PUQA 5CA1E 3A5XA 3R6NA 3MA9A 1WLXA 1FIOA 2E8IA 2VK9A 3HA4A 2X9WA 3WAKA 3I9YA 3RC3A 4X1IE 4YLHA 3MJXA 5E0OA 3K3OA 3L3PA 4ZOLE 2V7JA 3HKDE 4GK0E 2MTQA 1ZKEA 4IE4A 4IE6A 4O8SA 3KV6A 3AVSA 2X0LB 4CZZB 3KBTA 3OJAA 5KX5E 3LK3B 2KNDA 2DWGA 4I50E 1SA0E 4TV8E 3ANWA 3E0ZA 4E7ZA 5ADXL 2PG8A 1IJ5A 3QC9A 2VL8A 5FXVA 5DQWA 5DABA 4EXTA 5FYMA 2NW9A 3ETUA 2X66A 3RRCA 3ZJ2A 4TX5A 4ZS3A 1LKXA 2D0TA 4WW0A 3AB3B 4EIWA 1D0YA 2KZ7B 4ZS2A 3UFEA 3KBUA 2QGSA 4KBMB 5JDLA 4X20E 3M65A 3FB2A 5FMNA 4ZI2C 4UXNB 3U78A 2XUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B13 A;  2YIN A;  2WMO A;  3VHL A;  2WM9 A;  2WMN A; 
#chains in the Genus database with same CATH topology
 2VWA A;  4K0K T;  3O1J A;  3GMI A;  3VKH A;  4OK0 A;  3AAI A;  4UR9 A;  2XJ7 A;  4O4J E;  4GYS A;  3NZQ A;  4DV3 T;  4IL4 A;  3T8O A;  2DCF A;  3EAB A;  3N2G E;  2CWY A;  3MK7 C;  2FJE A;  3CQX C;  4AIU A;  3GN5 B;  2LRK A;  5FNV E;  2XSB A;  2IHR 1;  2KWI B;  2KWH A;  2MBG A;  3U3I A;  4UF0 A;  1D0X A;  4Q25 A;  2X0H A;  3C51 A;  4PK5 A;  3ZT7 A;  5JTG A;  2A2F X;  2RP4 A;  3UUB A;  5FP3 A;  2NTY A;  1SE7 A;  2XQ8 A;  4WZX A;  2LKH A;  3D0T A;  3P8C D;  3RYI E;  4MAL A;  4MFR A;  2F4V T;  3UUX B;  3NRX A;  2MOZ A;  3ZPO A;  5JR9 C;  3AE5 A;  2XQ4 A;  4FI5 A;  4OYJ A;  3TLW A;  2K24 A;  2I0M A;  2VB6 A;  2V5D A;  4UV8 B;  3DP7 A;  3P7I A;  3T1Y T;  4H9O C;  1MND A;  3RRW A;  1D1C A;  5LBM A;  3ZMV B;  1OWA A;  3X1D A;  3WAJ A;  3J7Y q;  4UVA B;  2WWU A;  4I55 E;  2YU2 A;  2VL0 A;  4U72 A;  3TLT A;  5IWA T;  4LMK A;  2LKG A;  2XPK A;  3N9O A;  4IDQ A;  1YW0 A;  2LEH A;  4YTP A;  2DLR A;  3FZH B;  2K48 A;  2VAS A;  4H63 V;  4ILC A;  2CEA A;  4PJM A;  1L0V A;  4JI8 T;  1S94 A;  2JMH A;  5BMV E;  1HFA A;  3J9X 1;  4UF0 B;  5AFU L;  4N78 D;  1NWM X;  2QVA A;  3UFG A;  1KNZ A;  3SFD A;  2HPJ A;  5J2T E;  4C91 A;  3CPZ A;  4PK6 A;  4HWF A;  3SWH A;  2Q9Q B;  3JC6 D;  3SFE A;  5LP6 E;  3RI5 A;  2CXD A;  3EUH A;  5CB4 E;  5HXR A;  5FKY A;  1XMQ T;  1VRB A;  3L39 A;  4EV6 A;  4CXW A;  4HFD A;  3RQU A;  1SHZ C;  4ERR A;  2JPF A;  2CPT A;  4YHJ A;  4UEM A;  3C4W A;  5LHH B;  1Y01 A;  2HN2 A;  3O1H A;  3OYZ A;  5JH7 E;  2H7O A;  2CHO A;  2V5C A;  1M7K A;  4PK4 A;  5C2T A;  2LOP A;  3PE0 A;  2VQE T;  3AE7 A;  2X51 A;  5C3J A;  1AJ3 A;  2XQA A;  4CI1 B;  4AKR B;  1W0B A;  2LHN A;  2BG9 B;  4IHJ E;  4DR7 T;  1HCI A;  3AE8 A;  5LNK A;  4PW8 A;  3KVB A;  4B3M T;  1IAP A;  4H9Q C;  4JBW F;  3IF8 B;  4AKI A;  3ONJ A;  4L9I A;  4IDN A;  4A5X A;  4JLE A;  2NP9 A;  4A97 A;  5LXT E;  1U5P A;  4HFI A;  4DID B;  2XTL A;  4MHC A;  4ZEY A;  4XBF B;  2X67 A;  1KNP A;  3G06 A;  4QX8 B;  3I0Q A;  3RIF A;  2CXL A;  2PBI A;  3RIU A;  2MYS A;  5JDM A;  4AKG A;  3RQW A;  2XQ9 A;  5KDM C;  4B3T T;  1E1H B;  3GA8 A;  3ZYK A;  3MKD A;  3VR8 A;  2IIU A;  4FJO A;  4HWH A;  3FXD B;  1DU2 A;  2W63 A;  4NUU A;  2A3D A;  2ZM0 A;  4J2C A;  2LE8 A;  4DR4 T;  3DTO A;  1LRZ A;  1XNR T;  4COF A;  2PTF A;  3QOF A;  3H3M A;  1XMO T;  2IDO B;  4JI7 T;  3UUN A;  3OVU A;  3ZCI A;  3ZEF B;  2PFV A;  4CQI A;  3FZL B;  4LF7 T;  4XZC A;  1UX4 A;  2V7I A;  2WDQ A;  4DVD A;  4QHO A;  2JQK A;  2XSA A;  1D0Z A;  3EDV A;  1MIY A;  3Q5D A;  5FY1 A;  5EZY E;  3N2K E;  2UU9 T;  2UXB T;  5LB7 B;  2WBL A;  4HWD A;  3N2O A;  4LFA T;  5AQN B;  1MNE A;  2V1D B;  1G8X A;  2CLY B;  1CUN A;  2EHO B;  3PTR B;  2X9X A;  2UXC T;  3PUS A;  3PUQ A;  5CA1 E;  3MA9 A;  5HCM A;  1FIO A;  3HA4 A;  2K3W A;  4EED A;  4GK0 E;  2MTQ A;  1ZKE A;  3KV6 A;  2KND A;  5AQP B;  4E7Z A;  5DQW A;  4EXT A;  3ZJ2 A;  2D0T A;  4EGW A;  4EIW A;  3PJA A;  3KBU A;  4KBM B;  2RPA A;  2CRB A;  5FXX A;  2HN1 A;  3RYH E;  3AEC A;  5LJM A;  5HXE A;  4O4L E;  4QXH B;  1WRD A;  3UU6 A;  2XQ5 A;  3H3A A;  5HXS A;  3Q5X A;  4LMJ A;  1NEN A;  4AQF A;  1ZEE A;  3RHW A;  5AQI B;  3ZT6 A;  4DMV A;  2G0U A;  3BK9 A;  5L2L A;  3AE1 A;  4IDZ A;  4ZHQ E;  3AE3 A;  5H6R B;  4QH1 A;  3PUV F;  2K9A A;  4ZXL A;  1IZN B;  5IYZ E;  4LF6 T;  3ZJ1 A;  3ZKR A;  1X9B A;  3IHR A;  3FBZ A;  3OKQ A;  4DR5 T;  4XAX B;  1NAF A;  4K0U A;  5EK3 A;  5J0Z A;  1UK5 A;  1LVF A;  2V26 A;  5L47 A;  1S35 A;  4JV5 T;  4U7I A;  2A72 A;  3ZC0 A;  4TUY E;  4DR1 T;  5LBQ B;  2N1G A;  1MMA A;  2M6B A;  2IC6 A;  2IUB A;  3MAC A;  2E5V A;  4OFZ A;  2JQ9 A;  2JJ9 A;  4PJL A;  5TAO A;  3AEA A;  3ZYL A;  4U7Y A;  5JR9 B;  3RIU C;  3AVR A;  3Q2M A;  1XWM A;  5CA0 E;  2BZB A;  2WSS V;  1XZY A;  1YD8 G;  1HX8 A;  2XAQ B;  1OXZ A;  4X1Y E;  2Z6E A;  3N9L A;  2NTX A;  5LMU T;  5LJN A;  3FZK B;  2PJQ A;  3PUA A;  1HNX T;  3BQI A;  4TWH A;  2XQ6 A;  3AE4 A;  4CN4 A;  4LML A;  2WM9 A;  3CVR A;  3CML A;  1W9R A;  4X1K E;  2B1E A;  5AQK B;  1FMW A;  1HF8 A;  3JAE A;  2WS3 A;  2CBI A;  2UXX B;  1MMD A;  4YT0 A;  4YTN A;  3P4P A;  4YJ3 E;  5FY7 A;  3AE6 A;  2UUC T;  4AKL A;  4DR3 T;  2A9U A;  5L3C B;  3UTK A;  2CM0 A;  2XAJ B;  2W67 A;  3RF1 A;  2DI4 A;  2H7V C;  4DBR A;  3ZMS B;  4ASK A;  3AEB A;  5LGT B;  5GON E;  4TV9 E;  4EOZ B;  1KK7 A;  2CWO A;  2UUA T;  3JC6 C;  2OLT A;  3AEG A;  1X79 A;  5ABF B;  4YSY A;  3ABV A;  3ONL C;  1T7S A;  3ZN0 B;  4HE8 A;  2W62 A;  2BS2 A;  4P09 A;  4HEA A;  3C4Z A;  3S4U A;  1GQE A;  2J62 A;  3HKE E;  3F57 A;  2E9X D;  2ZLY A;  3L09 A;  4OYK A;  3VKG A;  5HEJ A;  4H9P C;  1KF6 A;  4WBO A;  4EZH A;  5DQV A;  3AED A;  2FBW A;  3NRY A;  2WP9 A;  1HR0 T;  2LSY A;  4YSX A;  2Y48 B;  4I0U A;  4H9N C;  5FY0 A;  2D5U A;  2I6H A;  2MPK A;  5FXZ A;  4F8H A;  4EYU A;  4HKA A;  4PJN A;  4LF4 T;  4IT4 A;  4YJ2 E;  4QXC B;  2QA7 A;  4V1A v;  4A98 A;  4LF5 T;  3N5L A;  4DV6 T;  4G2A A;  1J5W A;  4DND A;  2WMN A;  2X9Y A;  4ISS A;  5JRC A;  4AQF C;  2HHH T;  4HGA A;  4Z91 A;  4I43 B;  4NIQ A;  4AKH A;  2DNX A;  5CJ5 A;  2WU5 A;  3UT5 E;  3F2E A;  1HG5 A;  2YEV C;  4MLK A;  4TNV A;  2JMK A;  3UQ4 A;  5LYJ E;  1QLB A;  4HN9 A;  4PFO A;  3HI2 A;  4ADZ A;  2LSK A;  5M4Y A;  5A1L A;  2VVS A;  2Y6X A;  3M3Z B;  2CMR A;  1UGO A;  4BJN A;  2C5J A;  4HTE A;  1HX1 B;  2KMF A;  4QX7 B;  4ZZB A;  1QUU A;  2IML A;  5H6Q B;  3HKB E;  3KDS E;  2XM2 A;  4AIS A;  5L3E B;  2V7M A;  1MMG A;  2ZMA A;  4ILB A;  4QH5 A;  4ZZC A;  4JI5 T;  3UU3 A;  3W15 B;  4DO0 A;  1JNZ A;  1M62 A;  2LRL A;  4EAH A;  1KNR A;  3LDQ B;  2P9B A;  3N9N A;  4TWD A;  2NW8 A;  4IRE A;  5AQF B;  2KXP B;  3V5U A;  3E22 E;  3AA1 B;  1T98 A;  2VKD A;  2C5K T;  4DUY T;  5HAX A;  5HEH A;  1CHU A;  1YKE B;  3ZMU B;  2LJL A;  2E9X A;  2J4G A;  3UU4 A;  3WAK A;  3I9Y A;  2XM1 A;  4YLH A;  5AQS B;  3K3O A;  2V7J A;  2FJD A;  3OJA A;  3RIA A;  1SA0 E;  3ANW A;  5ADX L;  5FXV A;  5L4E A;  4TX5 A;  2V6Y A;  3AB3 B;  2KZ7 B;  3CK6 A;  3B5M A;  4DV4 T;  4AQY T;  3LSV A;  4KP3 C;  2YK0 A;  4NXM T;  5JQG E;  4KHP T;  1J1J A;  3I9W A;  2XAS B;  4DR6 T;  2YDS A;  5LOV E;  2LM9 A;  2WZI A;  1YQ3 A;  4EB6 E;  4B3R T;  1HNZ T;  4DV5 T;  1WFD A;  4ZI3 C;  3VHL A;  4BAY B;  2VVN A;  2QRX A;  2WDV A;  4B3S T;  5L3B B;  4EEB A;  2M6I A;  4G63 A;  5ABH A;  4IDP A;  2VQF T;  3PU8 A;  4U74 A;  3P4Q A;  1VOM A;  2H89 A;  3PUZ F;  4PAG A;  1YKH B;  3CWZ B;  3UU5 A;  2V7L A;  4QWN B;  2AXD S;  3N9P A;  4DMW A;  3QUJ A;  1IBM T;  3ZC1 A;  4AXP A;  2ZM6 T;  2YKS A;  2YDR A;  3CQC B;  3ZT5 A;  1WR0 A;  5AQL B;  4JI4 T;  3NBX X;  2BVM A;  3QNU A;  3RKO A;  5LHI B;  4U2Y A;  1XDO A;  2LOS A;  3LK2 B;  3A7M A;  3P4W A;  4DV1 T;  4JI6 T;  3WI3 A;  3ETV A;  3MXZ A;  2CXF A;  4U31 A;  4LF9 T;  4GOU A;  5LMN T;  1OED A;  2V8S V;  2D2S A;  4JEU B;  3B13 A;  1YXR A;  3ONX A;  4YY3 T;  4EYY R;  3KV5 A;  2ZM2 A;  5AQO B;  4TNW A;  3LFM A;  1HG2 A;  1JNR A;  3AXJ A;  5LA6 E;  3K3Q C;  3JAD A;  1J5E T;  4H63 H;  3Q5W A;  3KFW X;  3PUW F;  3ZCJ A;  3BQL A;  4C90 A;  2BKN A;  2YIN A;  4MBQ A;  5FL1 A;  4L5G A;  4ZI3 D;  5HWX A;  4AI6 A;  2Q9Q D;  5HWY A;  4TZ4 C;  4QKN A;  2KSR A;  2JQQ A;  5LGN B;  4CN1 A;  3Q9D A;  5IHY A;  4X62 T;  4IIJ E;  3RX6 A;  4M1P A;  3PUG A;  2LSJ A;  5AQR B;  5AQT B;  2XQ3 A;  3FBL A;  2C5I T;  4YXD A;  4O2B E;  2E9X C;  3CX7 B;  4CI2 B;  2NWB A;  4GK5 E;  3O9X A;  5F3J A;  5JDQ A;  2Y8D A;  3ZSS A;  4PJJ A;  2BBJ A;  3GN5 A;  3O4X E;  4JEH B;  1I94 T;  3P4R A;  3QB5 K;  1D1A A;  4X65 T;  3R84 B;  2BS3 A;  2X68 A;  2IC9 A;  3NVO A;  2WDR A;  5JDF A;  3CQG B;  5FVK A;  1U4Q A;  4JI3 T;  2L8K A;  1SUM B;  5EK2 A;  3RPU A;  2WCA A;  2XY8 B;  4X5T A;  4DV7 T;  2ES0 A;  1W0A A;  3O1I A;  1MIW A;  4JI2 T;  3LK4 2;  3K1S A;  1O3X A;  5AQH B;  2ZM8 A;  5AQV B;  2CCQ A;  1B7T A;  1KFY A;  4CI3 B;  4HWI B;  4QXB B;  1IBK T;  1UX5 A;  2KIN B;  4O4I E;  4GIW A;  4P0A A;  2BVL A;  2DHR A;  4KUM B;  4KX6 A;  3RH3 A;  1XDP A;  5LHG B;  2JIW A;  4UEL A;  3FZF B;  2XHE B;  3NZP A;  2LSI A;  5J2U E;  3EVY A;  4Z90 A;  1N34 T;  2NR4 A;  3GWH A;  4HFB A;  1UCU A;  1ZOY A;  5JDN A;  3PV0 F;  5AQQ B;  5AQU B;  2XAH B;  2E2A A;  3TKL B;  3HL6 A;  4OHF A;  1HS7 A;  2DWK A;  5LCY A;  3ZMT B;  4HFC A;  4NUV A;  4A56 A;  1OED E;  3SOL A;  2H3R A;  4I4T E;  2CE7 A;  3TLS A;  2I59 A;  4X66 T;  4P1N A;  2M67 A;  4DUZ T;  1D1B A;  2WMO A;  1ZP0 A;  2NOX A;  4GYR A;  4ANJ A;  2YDQ A;  4YFS A;  1Z8U A;  1WR6 A;  2VKO A;  3N9Q A;  2Q9Q A;  3ZST A;  3TLU A;  3P4S A;  1MMN A;  1E7P A;  2WB5 A;  4UV9 B;  5HXH A;  4JYA T;  1OED C;  1FJG T;  4ZI7 E;  2EHO D;  5HCJ A;  5HEG A;  5EK4 A;  5LG3 A;  4IGU A;  3K3N A;  2ODU A;  3SRZ A;  5FVL A;  4O4H E;  4P0B A;  5C8Y E;  5L4H A;  3A5X A;  3R6N A;  2BBH A;  3T1H T;  2VK9 A;  2WU2 A;  4IDO A;  3RC3 A;  5E0O A;  2AE9 A;  3VR9 A;  4ZOL E;  1NEK A;  3JAF A;  4IE4 A;  3EAM A;  4IE6 A;  4O8S A;  4IL9 A;  3AVS A;  2X0L B;  4CZZ B;  2BG9 A;  5KX5 E;  3Q5E A;  3LK3 B;  3JCF A;  3AE2 A;  4TV8 E;  3E0Z A;  3CIR A;  2PG8 A;  4U3C A;  2VL8 A;  2YOE A;  2NW9 A;  4DR2 T;  1D0Y A;  4LFC T;  3UFE A;  5JDL A;  3FB2 A;  5FMN A;  4ZI2 D;  5ETW A;  3L8R A;  2LLY A;  2L9Q A;  3PU3 A;  3PUR A;  2YU1 A;  3UU8 A;  3N9M A;  4KMC A;  2VUR A;  3EI0 A;  2OA5 A;  3PJA J;  3I0O A;  3NWI A;  2UXD T;  4ILU A;  5HEO A;  3EHZ A;  1BR1 A;  2J47 A;  3EDU A;  4U33 A;  1UUR A;  3VRA A;  4HFV A;  3FHN A;  4U2Z A;  5HXC A;  4YTM A;  4EZ4 A;  2SPC A;  3AA0 B;  2E5L T;  3LG7 A;  2X0Y A;  4IE0 A;  3UUM A;  1BR4 A;  2HPL A;  4QH4 A;  5AQJ B;  4IE7 A;  4UVC B;  3K8P C;  2KLQ A;  2XAF B;  5LG4 A;  2XAG B;  1FEW A;  3KVA A;  3OBV E;  3V5S A;  4E7S A;  2LT3 A;  4PNI A;  1ZV4 X;  2QYW A;  5JRC B;  1KEY A;  4DV0 T;  3QK6 A;  2FUP A;  1HTJ F;  1E2A A;  2WZH A;  4GKK T;  2UXN B;  4O2A E;  2D0U A;  4H9S E;  4HFH A;  4Z8X A;  3AA7 B;  3F31 A;  4BJM A;  3AA6 B;  1W09 A;  3LJC A;  5AQG B;  3C98 B;  3MZK B;  5HEU A;  1LVK A;  4WNK A;  2EHO A;  2LHR A;  2ODV A;  1VCS A;  2X9H A;  5AQM B;  2W2U A;  3AAA B;  4LFB T;  2L3L A;  2D9D A;  1XNQ T;  1N36 T;  1N32 T;  3RYF E;  3CX8 B;  5JDH A;  2W0G A;  1V9D A;  1ZHC A;  3C64 A;  4UVB B;  3P50 A;  2LSG A;  5F8P A;  3H37 A;  5JRE A;  3PUY F;  2K5B B;  2WAU A;  4YHH T;  3AEE A;  3TLV A;  2Q9Q C;  1Z0P A;  2BG9 E;  3CKD A;  4H9R C;  4F6R C;  2FJA A;  1G73 A;  4KI0 F;  2HH7 A;  4TWF A;  2YN6 A;  3HKC E;  3ZMZ B;  1WYC A;  3IBP A;  1MIV A;  2LM2 A;  3RC8 A;  4DV2 T;  4BA9 A;  5F5W A;  5KXJ A;  2BS4 A;  4JI0 T;  5JVD E;  1YQ4 A;  3LBX A;  1BR2 A;  3OPC A;  2C0S A;  4IST A;  1FMV A;  1HNW T;  3PUX F;  5KMG P;  4DBQ A;  1WYB A;  4NXN T;  2JQH A;  2E9X B;  1Y64 B;  1I6Z A;  4WBN E;  3E08 A;  3VU7 H;  2FJB A;  4JUY A;  2B76 A;  2BG9 C;  3AAE B;  5J1G A;  5HYA A;  1H7C A;  2VKJ A;  3C4X A;  2WWV A;  2RA1 A;  4LF8 T;  3KV4 A;  3SS1 A;  2XQ7 A;  5BR8 T;  2XQY A;  4PFP A;  3CX6 B;  3ANW B;  2BKO A;  2R6G F;  3VRB A;  1IBL T;  3HR0 A;  2W00 A;  2WY2 A;  2V6Y B;  4HFE A;  3B57 A;  2H88 A;  2XZE A;  4JI1 T;  2IAK A;  1QSD A;  3C50 A;  5L3D B;  4AQG A;  2NW7 A;  4CN6 A;  3UQ7 A;  5FXW A;  3OTO T;  3NKZ A;  1BR0 A;  4ILA A;  2CHN A;  2W66 A;  5JR9 A;  2VKH A;  3FZM B;  2BKP A;  1US7 B;  1IJ6 A;  2MAW A;  4TN7 B;  4B6X A;  3IEE A;  4NPP A;  5LGU B;  1T72 A;  2CA5 A;  3KIN B;  2V6X A;  4L0R A;  2J1D G;  3I1A A;  4OX9 T;  5L3G B;  3OYX A;  3BQK A;  5ABG A;  3PDY A;  2BDE A;  2ACX A;  1VCT A;  4CXX A;  3LBX B;  3ZYM A;  2DL1 A;  2UUB T;  2N2N A;  2N9D A;  5DJQ C;  3UUL A;  2IW5 B;  1N33 T;  1EZ3 A;  3RLF F;  4X64 T;  3RKG A;  2W61 A;  3A8Y C;  2W4X A;  5L3F B;  5CGM A;  4CXY A;  2CBJ A;  1WCR A;  5ABF A;  4UIG A;  2JRK A;  2GK9 A;  3DJB A;  3IA3 A;  4YSZ A;  1T8B A;  2CLY C;  2ACZ A;  4IE5 A;  3ESL A;  2EHO C;  3RYC E;  1UUS A;  3KV9 A;  5IUX A;  3ZN1 B;  2V7K A;  1OED B;  5FL0 A;  4GKJ T;  3AEF A;  5JDG A;  3FXE B;  3QB5 A;  2KT9 A;  3ZLI A;  3RGL A;  1WLX A;  2E8I A;  2X9W A;  5ABE A;  4X1I E;  3MJX A;  3L3P A;  4WYV A;  3HKD E;  3AXJ B;  4KHZ F;  3AE9 A;  5CFB A;  3KBT A;  2WQY A;  2DWG A;  4I50 E;  4HWC A;  1IJ5 A;  3QC9 A;  5DAB A;  5FYM A;  3ETU A;  2X66 A;  3RRC A;  2OV9 A;  4ZS3 A;  1LKX A;  4WW0 A;  4ZS2 A;  1R8I A;  2QGS A;  4X20 E;  3M65 A;  4ZI2 C;  4UXN B;  3U78 A;  2XUE A; 
#chains in the Genus database with same CATH homology
 4KP3 C;  2YK0 A;  2VWA A;  5JQG E;  5ETW A;  3I9W A;  3O1J A;  3RYH E;  2L9Q A;  5LJM A;  5HXE A;  4O4L E;  3GMI A;  3PU3 A;  3PUR A;  2YU1 A;  4OK0 A;  4QXH B;  3VKH A;  1WRD A;  3AAI A;  3N9M A;  4KMC A;  2XAS B;  3H3A A;  4O4J E;  5HXS A;  2OA5 A;  4GYS A;  3NZQ A;  3I0O A;  3Q5X A;  5LOV E;  4AQF A;  3T8O A;  2LM9 A;  1ZEE A;  2DCF A;  4ILU A;  4EB6 E;  3N2G E;  2CWY A;  3MK7 C;  1BR1 A;  4DMV A;  3EDU A;  2G0U A;  4ZI3 C;  3VHL A;  4BAY B;  3CQX C;  3BK9 A;  3GN5 B;  5L2L A;  5FNV E;  4IDZ A;  4HFV A;  4ZHQ E;  2KWI B;  5H6R B;  2KWH A;  5L3B B;  3FHN A;  2MBG A;  3U3I A;  4G63 A;  5HXC A;  2K9A A;  4UF0 A;  4EZ4 A;  3PU8 A;  1D0X A;  1IZN B;  2SPC A;  4U74 A;  5IYZ E;  3ZJ1 A;  1VOM A;  3AA0 B;  3IHR A;  3FBZ A;  3OKQ A;  3LG7 A;  3C51 A;  4PK5 A;  2A2F X;  4IE0 A;  3UUM A;  1BR4 A;  2HPL A;  4XAX B;  1NAF A;  4K0U A;  4PAG A;  1YKH B;  2RP4 A;  5EK3 A;  3CWZ B;  5FP3 A;  2NTY A;  1LVF A;  4IE7 A;  2V26 A;  4UVC B;  1S35 A;  3K8P C;  2V7L A;  3D0T A;  3P8C D;  4QWN B;  3N9P A;  2KLQ A;  4DMW A;  2A72 A;  2XAF B;  3QUJ A;  5LG4 A;  3ZC0 A;  3ZC1 A;  4TUY E;  4AXP A;  5LBQ B;  3RYI E;  4MAL A;  2N1G A;  1MMA A;  4MFR A;  2XAG B;  3UUX B;  3NRX A;  1FEW A;  3CQC B;  2MOZ A;  3ZPO A;  3KVA A;  2IC6 A;  3OBV E;  3MAC A;  3V5S A;  5JR9 C;  4E7S A;  3NBX X;  2LT3 A;  2BVM A;  4OFZ A;  4PNI A;  1ZV4 X;  5JRC B;  3RKO A;  2JJ9 A;  4PJL A;  5TAO A;  3ZYL A;  4FI5 A;  5LHI B;  4OYJ A;  3QK6 A;  5JR9 B;  2K24 A;  1HTJ F;  3AVR A;  3Q2M A;  2LOS A;  2VB6 A;  5CA0 E;  2BZB A;  2WSS V;  3LK2 B;  4UV8 B;  3DP7 A;  3P7I A;  1YD8 G;  1HX8 A;  2XAQ B;  4H9O C;  2UXN B;  4O2A E;  1OXZ A;  2D0U A;  4H9S E;  1MND A;  3AA7 B;  4X1Y E;  4Z8X A;  3F31 A;  3RRW A;  1D1C A;  5LBM A;  3ZMV B;  4BJM A;  3WI3 A;  2Z6E A;  3AA6 B;  1OWA A;  3N9L A;  2NTX A;  3LJC A;  5LJN A;  3ETV A;  3WAJ A;  3MXZ A;  3C98 B;  3J7Y q;  2CXF A;  2PJQ A;  3PUA A;  3MZK B;  2WWU A;  4UVA B;  1LVK A;  4GOU A;  4WNK A;  3BQI A;  2EHO A;  2LHR A;  4I55 E;  2ODV A;  2D2S A;  4JEU B;  2X9H A;  2YU2 A;  3B13 A;  3ONX A;  4U72 A;  2WM9 A;  4EYY R;  3KV5 A;  3AAA B;  3CVR A;  2ZM2 A;  3CML A;  2L3L A;  4X1K E;  3N9O A;  2B1E A;  3LFM A;  1YW0 A;  2LEH A;  1HG2 A;  2DLR A;  1FMW A;  1HF8 A;  2K48 A;  3RYF E;  5LA6 E;  2VAS A;  3K3Q C;  4H63 V;  2CEA A;  3CX8 B;  4H63 H;  2UXX B;  1MMD A;  4PJM A;  5JDH A;  2W0G A;  1V9D A;  1ZHC A;  3Q5W A;  3KFW X;  3C64 A;  4YJ3 E;  1S94 A;  5FY7 A;  4UVB B;  3ZCJ A;  2LSG A;  4AKL A;  5F8P A;  2JMH A;  3H37 A;  5BMV E;  5JRE A;  1HFA A;  3BQL A;  5L3C B;  3J9X 1;  4C90 A;  2K5B B;  2YIN A;  2WAU A;  4MBQ A;  2CM0 A;  4UF0 B;  3UTK A;  4N78 D;  5AFU L;  2XAJ B;  1NWM X;  2DI4 A;  4L5G A;  2Q9Q C;  2H7V C;  4DBR A;  4ZI3 D;  5HWX A;  3ZMS B;  1Z0P A;  2Q9Q D;  4ASK A;  1KNZ A;  3CKD A;  5LGT B;  4AI6 A;  4H9R C;  2HPJ A;  5HWY A;  4F6R C;  4TZ4 C;  1G73 A;  5J2T E;  5GON E;  2HH7 A;  4TV9 E;  4C91 A;  3HKC E;  4QKN A;  4EOZ B;  3CPZ A;  1KK7 A;  2CWO A;  4PK6 A;  3SWH A;  3ZMZ B;  2JQQ A;  3JC6 C;  5LGN B;  2Q9Q B;  3Q9D A;  1WYC A;  1X79 A;  3IBP A;  1MIV A;  5IHY A;  3JC6 D;  4IIJ E;  3RX6 A;  3RC8 A;  4M1P A;  3PUG A;  4BA9 A;  5LP6 E;  2CXD A;  3EUH A;  5CB4 E;  5HXR A;  2LSJ A;  3ZN0 B;  4HE8 A;  3FBL A;  2C5I T;  1VRB A;  5JVD E;  2W62 A;  3LBX A;  4CXW A;  4P09 A;  4HEA A;  3C4Z A;  3S4U A;  4O2B E;  1BR2 A;  2E9X C;  3CX7 B;  3HKE E;  4CI2 B;  3F57 A;  2NWB A;  2C0S A;  4IST A;  2E9X D;  1FMV A;  2ZLY A;  3L09 A;  4GK5 E;  4OYK A;  3VKG A;  3O9X A;  1SHZ C;  5F3J A;  2Y8D A;  5JDQ A;  4ERR A;  5KMG P;  2JPF A;  4H9P C;  4PJJ A;  4WBO A;  4YHJ A;  3GN5 A;  3O4X E;  1WYB A;  3C4W A;  4JEH B;  4UEM A;  4DBQ A;  4EZH A;  5LHH B;  1D1A A;  5DQV A;  2E9X B;  3R84 B;  1Y64 B;  4WBN E;  2X68 A;  3O1H A;  3E08 A;  3OYZ A;  3VU7 H;  5JH7 E;  2H7O A;  2IC9 A;  4JUY A;  3AAE B;  4PK4 A;  5JDF A;  3NRY A;  3CQG B;  2LOP A;  1H7C A;  3PE0 A;  5J1G A;  5HYA A;  2VKJ A;  2X51 A;  3C4X A;  1U4Q A;  2RA1 A;  2L8K A;  1AJ3 A;  4CI1 B;  5EK2 A;  4AKR B;  2LSY A;  3RPU A;  2LHN A;  2Y48 B;  3KV4 A;  3SS1 A;  2ES0 A;  2XQY A;  4IHJ E;  4PFP A;  3CX6 B;  3O1I A;  1MIW A;  4H9N C;  5FY0 A;  3ANW B;  3LK4 2;  1O3X A;  1HCI A;  2D5U A;  2ZM8 A;  2CCQ A;  1B7T A;  2W00 A;  3HR0 A;  5FXZ A;  4PW8 A;  5LNK A;  4CI3 B;  4EYU A;  3KVB A;  4HKA A;  4PJN A;  4QXB B;  3B57 A;  1IAP A;  1UX5 A;  4YJ2 E;  4H9Q C;  4QXC B;  2KIN B;  3IF8 B;  4O4I E;  4GIW A;  4P0A A;  4AKI A;  2BVL A;  2DHR A;  4ZI2 D;  4KUM B;  2QA7 A;  4V1A v;  2IAK A;  4L9I A;  3RH3 A;  3N5L A;  1QSD A;  4G2A A;  3C50 A;  5L3D B;  4DND A;  4JLE A;  2WMN A;  2X9Y A;  4ISS A;  2NW7 A;  4AQG A;  5JRC A;  2NP9 A;  5LHG B;  5FXW A;  4UEL A;  4AQF C;  4HGA A;  1BR0 A;  5LXT E;  1U5P A;  2XHE B;  4I43 B;  5JR9 A;  2VKH A;  2XTL A;  4MHC A;  4AKH A;  4XBF B;  2DNX A;  3NZP A;  1US7 B;  2X67 A;  2LSI A;  1IJ6 A;  5J2U E;  3EVY A;  4TN7 B;  3UT5 E;  4QX8 B;  4B6X A;  3I0Q A;  3GWH A;  3IEE A;  2CXL A;  3F2E A;  2PBI A;  1HG5 A;  2MYS A;  2YEV C;  5JDM A;  5LGU B;  4AKG A;  5KDM C;  4MLK A;  1UCU A;  2CA5 A;  3KIN B;  5JDN A;  2JMK A;  1E1H B;  4L0R A;  3GA8 A;  2J1D G;  3ZYK A;  3I1A A;  3MKD A;  5L3G B;  5LYJ E;  2XAH B;  4FJO A;  3OYX A;  3BQK A;  3TKL B;  3HL6 A;  4HN9 A;  3PDY A;  4PFO A;  3HI2 A;  4OHF A;  4ADZ A;  2LSK A;  1HS7 A;  3FXD B;  2BDE A;  2ACX A;  2DWK A;  5M4Y A;  5A1L A;  2Y6X A;  5LCY A;  2W63 A;  2CMR A;  4NUU A;  4CXX A;  2A3D A;  4BJN A;  2ZM0 A;  2C5J A;  3LBX B;  3ZMT B;  4J2C A;  2LE8 A;  3ZYM A;  4NUV A;  4HTE A;  3DTO A;  4A56 A;  2KMF A;  2N2N A;  2N9D A;  1LRZ A;  3SOL A;  5DJQ C;  4QX7 B;  1QUU A;  2H3R A;  5H6Q B;  3UUL A;  2IW5 B;  3HKB E;  3KDS E;  4I4T E;  5FXX A;  2CE7 A;  5L3E B;  2V7M A;  1MMG A;  1EZ3 A;  2ZMA A;  2I59 A;  3UUN A;  2M67 A;  1D1B A;  2WMO A;  3W15 B;  4DO0 A;  3ZCI A;  2W61 A;  3ZEF B;  2NOX A;  4GYR A;  4ANJ A;  5L3F B;  2PFV A;  4CQI A;  4YFS A;  4EAH A;  4XZC A;  2P9B A;  3N9N A;  1WR6 A;  4CXY A;  2VKO A;  3N9Q A;  1UX4 A;  2Q9Q A;  2V7I A;  4DVD A;  2NW8 A;  4QHO A;  2KXP B;  4UIG A;  1D0Z A;  2JRK A;  3EDV A;  3V5U A;  1MMN A;  1MIY A;  2GK9 A;  3E22 E;  3AA1 B;  1T98 A;  3DJB A;  2VKD A;  2C5K T;  4UV9 B;  5HXH A;  2CLY C;  5FY1 A;  5EZY E;  3N2K E;  4IE5 A;  5HAX A;  3ESL A;  2EHO C;  2WBL A;  3RYC E;  4ZI7 E;  1YKE B;  3KV9 A;  2EHO D;  3ZMU B;  3N2O A;  5EK4 A;  3ZN1 B;  4IGU A;  2V7K A;  1MNE A;  2V1D B;  1G8X A;  3K3N A;  2ODU A;  2CLY B;  3SRZ A;  4O4H E;  2LJL A;  4P0B A;  1CUN A;  2EHO B;  5JDG A;  3PTR B;  2E9X A;  2X9X A;  3FXE B;  5C8Y E;  2KT9 A;  3ZLI A;  3PUS A;  3PUQ A;  5CA1 E;  3A5X A;  3R6N A;  3MA9 A;  1WLX A;  1FIO A;  2E8I A;  2VK9 A;  3HA4 A;  2X9W A;  3WAK A;  3I9Y A;  3RC3 A;  4X1I E;  4YLH A;  3MJX A;  5E0O A;  3K3O A;  3L3P A;  4ZOL E;  2V7J A;  3HKD E;  4GK0 E;  2MTQ A;  1ZKE A;  4IE4 A;  4IE6 A;  4O8S A;  3KV6 A;  3AVS A;  2X0L B;  4CZZ B;  3KBT A;  3OJA A;  5KX5 E;  3LK3 B;  2KND A;  2DWG A;  4I50 E;  1SA0 E;  4TV8 E;  3ANW A;  3E0Z A;  4E7Z A;  5ADX L;  2PG8 A;  1IJ5 A;  3QC9 A;  2VL8 A;  5FXV A;  5DQW A;  5DAB A;  4EXT A;  5FYM A;  2NW9 A;  3ETU A;  2X66 A;  3RRC A;  3ZJ2 A;  4TX5 A;  4ZS3 A;  1LKX A;  2D0T A;  4WW0 A;  3AB3 B;  4EIW A;  1D0Y A;  2KZ7 B;  4ZS2 A;  3UFE A;  3KBU A;  2QGS A;  4KBM B;  5JDL A;  4X20 E;  3M65 A;  3FB2 A;  5FMN A;  4ZI2 C;  4UXN B;  3U78 A;  2XUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...