3VHLA

Crystal structure of the dhr-2 domain of dock8 in complex with cdc42 (t17n mutant)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
264
Chain Sequence
FGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 8
publication title DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.
pubmed doi rcsb
source organism Mus musculus
total genus 87
structure length 264
sequence length 273
ec nomenclature
pdb deposition date 2011-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vhlA02
3VHLA 2WMNA 2WMOA 3B13A 2YINA 2WM9A
chains in the Genus database with same CATH superfamily
3B57A 2XAQB 5CJ5A 2OLTA 5AFUL 3ZC1A 2VQFT 2YKSA 3N9NA 1MMNA 3IF8B 2BKPA 2E9XB 1NWMX 4PAGA 2UXDT 3PUQA 5HXSA 4Z90A 2VWAA 4GIWA 4I0UA 4QXCB 4NUUA 3SWHA 3QNUA 5ABGA 4CXXA 3MK7C 2KXPB 5LMUT 4TNVA 4OYJA 1MMDA 3CQCB 3T1YT 2V7LA 1XNRT 3HKBE 3TLSA 4DBRA 3ZT5A 5JDNA 4J2CA 3HKCE 3VRAA 4DO0A 5H6RB 4AQFA 3GA8A 5J2TE 3P4RA 3Q9DA 3QB5A 2D9DA 2HH7A 3CX6B 2BS3A 3UULA 4K0KT 4IE7A 4A97A 3K3OA 4AQGA 2H89A 4PW8A 2LHNA 2HPJA 3WI3A 3JC6D 2MAWA 3ZMZB 4H9NC 2KLQA 4P0AA 1HS7A 2LSIA 4OHFA 2WMOA 4HFBA 2X0LB 4YSXA 2ES0A 1WR6A 5AQJB 2PTFA 2IC9A 3PUZF 2D0TA 1YW0A 1SHZC 5ABFA 1QUUA 3A5XA 3AEEA 5AQSB 1YQ3A 1IBMT 2BKNA 5CFBA 3UU8A 3GMIA 5JDMA 1IBLT 2FJBA 2E9XD 3ZEFB 5ABHA 3O1HA 2LM9A 2CWOA 4DV3T 2CE7A 2W61A 5HXCA 3C98B 5LMNT 3F57A 2V26A 1HF8A 3ZT6A 5C2TA 2DCFA 4CXWA 4KX6A 2LSGA 3K8PC 4HFVA 4IE6A 2D0UA 5IWAT 4ANJA 4HWFA 4MALA 5AQRB 2OA5A 3PUWF 5AQHB 4H9OC 4P0BA 2LSJA 4JI0T 2WDVA 3AE4A 3UFGA 2XQ8A 4YSZA 4AKLA 5HXEA 3VR8A 4ZI3D 2V1DB 2W62A 3AVRA 5DABA 4U72A 2WDQA 4EOZB 2VK9A 1D0YA 2E2AA 1MNDA 4QH1A 4JEHB 3OVUA 4U31A 5AQLB 4A56A 4IGUA 1XZYA 2R6GF 5LP6E 2WWUA 4KUMB 5M4YA 3AE9A 4CZZB 3A7MA 3F31A 3IEEA 3AVSA 2H3RA 5EK4A 2IAKA 2UXNB 4WBNE 4OYKA 4U7YA 3RC8A 3DP7A 4AI6A 4A98A 4B6XA 5L3BB 5JH7E 4IDQA 2CWYA 2VVSA 1JNZA 2UXXB 3P4PA 3CKDA 3RRWA 4UELA 2PJQA 4WBOA 2C0SA 3ONLC 3QUJA 5FY1A 3RYHE 4G2AA 1AJ3A 3L8RA 4IL4A 5HEGA 2CXDA 3T8OA 2JRKA 4O2AE 4ERRA 1D1BA 4H9QC 3OJAA 3A8YC 5JR9C 4ZEYA 2K48A 2NW8A 2XSAA 3LFMA 1SE7A 3AEDA 2W67A 2IW5B 3P7IA 3H3AA 4JI1T 2H88A 2V7KA 4O4LE 2VASA 4Z8XA 4IREA 4DR1T 2UUBT 3RHWA 4Z91A 2NW7A 5LNKA 3JC6C 2PG8A 1R8IA 5J1GA 2EHOD 3CQGB 4IDOA 1Z8UA 4DMVA 1LKXA 1YKHB 2WU2A 3NWIA 5EK2A 2RP4A 1BR4A 4QX7B 3ZKRA 2YDQA 3FXEB 4PFOA 3MJXA 3QB5K 2XAGB 3RI5A 2WM9A 4HWCA 4KI0F 4JBWF 2Q9QA 1HG2A 4PNIA 5FY7A 4ZZCA 4IIJE 4BJMA 4PFPA 4X20E 5L3CB 3Q5XA 3VKGA 2XQ9A 2LOSA 1BR2A 3P4SA 4GK0E 4NPPA 4WW0A 3CX8B 2LRLA 4QWNB 1T72A 1ZP0A 3Q5DA 4X66T 3AE6A 5AQKB 3VR9A 4EAHA 4X1YE 2LKHA 4CN4A 3L09A 4PJJA 3BQIA 2W0GA 4ZS2A 3O1JA 2FBWA 2DHRA 4DNDA 2CBJA 3M3ZB 5F8PA 4YY3T 4DMWA 3TKLB 3LG7A 2FUPA 2VQET 3RIUC 3RX6A 1J5ET 3X1DA 4O8SA 3O9XA 4UF0A 1J1JA 2DI4A 2K9AA 1ZKEA 5LA6E 4HWDA 2WMNA 2E5VA 4ZI2C 3ETUA 2X9WA 1N33T 4XZCA 2KMFA 3KV6A 2IDOB 1FMVA 5LYJE 3UUXB 5JDLA 2YK0A 2GK9A 1VCSA 3SFDA 1XMOT 1OWAA 2LE8A 3PE0A 4QH4A 3S4UA 5LJMA 4V1Av 2NW9A 5ETWA 3PTRB 2SPCA 3H3MA 5L4EA 4UIGA 2Y48B 2D5UA 3FB2A 2XM1A 2LT3A 2X66A 4QKNA 4EYUA 4JI8T 3G06A 2BKOA 4QXBB 3HKDE 2FJEA 3AXJA 5LXTE 4L5GA 3F2EA 4P09A 3B13A 2ZM2A 3HA4A 3NKZA 3GN5B 2W63A 3ZMSB 1UGOA 2I6HA 4GK5E 4I55E 3ZN1B 4ASKA 2A72A 4O4HE 3JAFA 4AKIA 2M6IA 4TWHA 2WWVA 1HNWT 2VKJA 5C3JA 3LK2B 2X51A 4QXHB 3FHNA 4IE4A 3EUHA 5FL1A 1XDOA 5IYZE 2UXCT 5BMVE 1NENA 4UV8B 3NBXX 4LMJA 2ZM6T 3ZYKA 4DV2T 3MXZA 1ZOYA 3UU6A 3FXDB 2VL8A 4JI7T 3PJAJ 3ETVA 2NTXA 2KNDA 4B3RT 1G8XA 4H9RC 3KV5A 5FY0A 1GQEA 5JQGE 1LVFA 1HFAA 2JQ9A 4X65T 3I0QA 5CA0E 3CMLA 1W09A 1IBKT 2X9XA 5F3JA 3RIFA 3TLUA 2BBHA 3RYCE 4NXNT 3AAIA 5LOVE 1SUMB 4PK6A 5HXHA 4YTNA 4F8HA 4O2BE 5AQUB 2NR4A 1FMWA 2X67A 2NOXA 4ZS3A 1WR0A 3SS1A 3DJBA 5AQMB 3TLTA 4Q25A 3KVBA 2CBIA 4CI1B 1VRBA 5EZYE 2BVLA 2A3DA 2CLYB 4TZ4C 3AA1B 2J62A 4OFZA 3PUSA 4IT4A 2YDSA 1W0BA 3ZCIA 4ADZA 1N36T 4AQFC 2LRKA 4DBQA 5HCMA 3U78A 5AQGB 2HN2A 2A9UA 4YLHA 4H9SE 1UX4A 2OV9A 4TV8E 4IL9A 5HWYA 4HN9A 1HG5A 2RA1A 4H63H 4HGAA 3R84B 5L2LA 2W4XA 1HR0T 3UUMA 4EYYR 4YFSA 1JNRA 4E7SA 3CVRA 2VURA 3ZYMA 4QHOA 1BR1A 3CQXC 3CIRA 3AEGA 3M65A 1WFDA 1XNQT 1BR0A 4ZZBA 2WAUA 5FKYA 3LSVA 4IDNA 3K3NA 2LEHA 1WRDA 2J1DG 3U3IA 4M1PA 4CQIA 3C64A 1VCTA 2V5DA 2K5BB 1IZNB 3FZHB 5KX5E 4DR6T 3ZMTB 4GYRA 4ZXLA 1UX5A 2H7VC 3J7Yq 2AXDS 3OKQA 2XY8B 4DR2T 2LLYA 4IHJE 1KNZA 3ZYLA 4JI4T 4PJNA 4I4TE 4MFRA 2X9HA 1W9RA 4JI3T 4DV1T 1T7SA 2EHOB 4DV6T 2KT9A 1HX1B 3RKOA 4ZI2D 4KMCA 4IDPA 3AEBA 1EZ3A 3HI2A 4HFIA 5C8YE 2BG9A 3ABVA 3SOLA 4TV9E 3SRZA 4U74A 1YD8G 1WLXA 1G73A 3PUXF 3LBXB 2W00A 3NVOA 2IHR1 2XSBA 2JIWA 5FMNA 2WP9A 2HPLA 2NP9A 3KV9A 2XQ6A 1E7PA 4DVDA 3GN5A 5JDGA 3PDYA 4LF5T 4IDZA 2XHEB 3V5UA 2Y6XA 5ABEA 2IUBA 3BQKA 2V7IA 5AQQB 2VVNA 4YTMA 3KVAA 4EZHA 3ONXA 2Y8DA 4HWIB 4AKHA 4HFEA 3FZFB 1M62A 1T8BA 5HAXA 5AQVB 2VB6A 3H37A 4WNKA 3R6NA 5FXVA 4HFDA 4TUYE 4BA9A 1X79A 2HN1A 2X9YA 4X64T 2VKOA 2CHNA 4YTPA 2WCAA 1SA0E 4ILCA 2LSYA 2V6YB 5FP3A 2E9XA 2X0YA 3C50A 4FJOA 2JJ9A 4LF7T 3PUAA 2D2SA 2Q9QC 4OX9T 2YEVC 5HEJA 1HNZT 4CN6A 3LDQB 3MACA 4COFA 2NTYA 2G0UA 1MIYA 4DR5T 2DWGA 5J2UE 3AECA 4YSYA 1NEKA 2XTLA 3CX7B 3BK9A 2MYSA 4O4JE 5JDFA 1NAFA 3LJCA 5HEOA 3OPCA 3WAJA 1E1HB 4U2YA 4JI2T 1N34T 4EZ4A 2I59A 4YJ2E 4AISA 4ILUA 5A1LA 1OEDE 3TLVA 4QX8B 4TNWA 3KDSE 3EDUA 1ZHCA 5JVDE 3PV0F 3EDVA 3N9LA 2MOZA 5LG3A 3UFEA 2CM0A 5L3DB 3RH3A 5H6QB 5FNVE 4GKJT 2XJ7A 4B3ST 4JV5T 4KP3C 2ZLYA 3NZPA 2QA7A 4EV6A 4C90A 2CEAA 1FJGT 2W66A 3N9MA 3VU7H 3ZSSA 2L3LA 2VKDA 2XUEA 5FVLA 2XM2A 5JRCB 3N2KE 1HTJF 3UU5A 3V5SA 3CPZA 4WZXA 2N2NA 1OXZA 4LF9T 2ZM8A 4CXYA 3AE2A 3MZKB 4MHCA 2C5KT 3MA9A 5JR9B 3O1IA 5CA1E 5HWXA 4JUYA 1I94T 2C5JA 4GYSA 2WSSV 4JEUB 4IE5A 4JI6T 4UVCB 1IJ6A 2IIUA 3Q5WA 4TX5A 2V7JA 1UUSA 3FZKB 2EHOA 2J4GA 4AKRB 1KK7A 5LHGB 1YQ4A 2LOPA 5AQPB 3AEAA 1MMGA 4LMKA 1Z0PA 1D0XA 2RPAA 4XAXB 1OEDC 3VKHA 3D0TA 2L9QA 2LJLA 4EGWA 5FL0A 3C4ZA 2NWBA 2LSKA 3LBXA 1UURA 2E5LT 1Y64B 1B7TA 4DV4T 3HKEE 4CN1A 3PU8A 4NXMT 1KNPA 5IUXA 5HEHA 4UEMA 2Q9QB 4LFAT 5FVKA 3KINB 3K1SA 1J5WA 2M6BA 4X62T 4HE8A 2C5IT 4EB6E 1U5PA 2JMKA 3I1AA 3WAKA 2KWHA 5AQNB 4YXDA 3FBLA 5HXRA 2WY2A 4FI5A 5FXZA 3E0ZA 2WU5A 2AE9A 3ZMVB 4UR9A 2P9BA 3KBTA 1QLBA 4X5TA 4LMLA 3N2GE 3NRXA 3N9OA 3C4XA 4HEAA 3PJAA 2WBLA 3VRBA 3ANWB 3L3PA 3AAEB 4JYAT 2E8IA 1VOMA 1X9BA 4PJLA 4DV5T 2Z6EA 3W15B 3RRCA 1XMQT 1DU2A 2X0HA 2JQHA 4DR3T 5LBQB 4TWFA 4DR7T 3RC3A 3OBVE 3RPUA 5BR8T 3C4WA 4UF0B 2DNXA 5LBMA 4DUYT 2BG9E 3HL6A 4TWDA 3MKDA 4AQYT 5J0ZA 2ACXA 1D1AA 3AEFA 2VL0A 3E22E 2V6YA 1L0VA 3CK6A 3EVYA 2WDRA 2DL1A 2QRXA 3JCFA 3I0OA 1XWMA 3ZJ1A 3FBZA 2K24A 3AE1A 3IHRA 2XASB 2JQQA 2KSRA 1Y01A 2Q9QD 3QOFA 2ZMAA 3AAAB 3ZCJA 5LHHB 2KINB 4WYVA 2QGSA 3EI0A 3AE5A 4IE0A 2I0MA 5AQOB 3QK6A 1ZEEA 1QSDA 2UUAT 2BZBA 4BAYB 3AXJB 4LFBT 4DUZT 2CRBA 1LVKA 4LFCT 2V7MA 4P1NA 2YN6A 2LHRA 3EAMA 3RQWA 2QVAA 4OK0A 3VHLA 2XQ4A 3DTOA 3ZLIA 2YINA 4LF8T 5FYMA 3EHZA 4C91A 1KFYA 3LK3B 4ZOLE 4F6RC 3PUGA 3N9PA 1MMAA 5KMGP 2WQYA 3JADA 3K3QC 3NZQA 1HCIA 2WS3A 3ZMUB 2W2UA 3SFEA 1OEDB 2XQYA 2J47A 4KHZF 2UU9T 4E7ZA 3NRYA 4ZI7E 3PURA 3O4XE 3KBUA 2CMRA 2ODVA 2JMHA 1N32T 2BG9C 3ONJA 3TLWA 1KNRA 5HYAA 2UUCT 4CI3B 4N78D 1M7KA 3AA0B 4JI5T 3I9WA 5F5WA 3ZSTA 5JRCA 4BJNA 4U3CA 4L9IA 1UCUA 5DJQC 1FEWA 4QH5A 2XQ5A 4ZHQE 5AQIB 2KZ7B 4NUVA 5L47A 2ZM0A 2V5CA 5LCYA 5LJNA 1D1CA 2FJDA 4EIWA 3UUBA 4U2ZA 4DIDB 5JR9A 3EABA 4UVAB 2XZEA 5HEUA 3PU3A 3B5MA 1YKEB 4UXNB 3HR0A 3PUVF 4LF4T 3ZN0B 3JAEA 1T98A 3AE7A 4DV7T 2MBGA 5JREA 5AQTB 2H7OA 2WZIA 4AKGA 3UUNA 4YHHT 2K3WA 3ZPOA 1ZV4X 2FJAA 3UQ7A 3UQ4A 3AE3A 5DQVA 4DV0T 5JDQA 4ISSA 3ZT7A 4DR4T 4O4IE 2MPKA 3ZC0A 1UK5A 3P4QA 4ISTA 1US7B 1D0ZA 4X1KE 2DLRA 3RQUA 3CWZB 2CA5A 3RKGA 4A5XA 3PUYF 5AQFB 5L3FB 3J9X1 2DWKA 4B3TT 4KHPT 4K0UA 4U7IA 2QYWA 2CXFA 2CPTA 4XBFB 4LF6T 5ABFB 2N1GA 3OYZA 3P8CD 2N9DA 4U33A 3IBPA 1V9DA 2E9XC 2XQ3A 4MBQA 2X68A 5ADXL 2CHOA 2WZHA 1H7CA 2YDRA 4PK5A 4MLKA 2LM2A 3UU3A 1WCRA 2B76A 2YU2A 3KV4A 3KFWX 3FZMB 2ODUA 5KXJA 2UXBT 5FXXA 2XAJB 4B3MT 2B1EA 4X1IE 5DQWA 4HKAA 1W0AA 3Q5EA 4KBMB 3BQLA 3UTKA 2XQAA 5L3EB 2BBJA 1MIVA 4GOUA 2MTQA 2XAFB 5CB4E 3ANWA 3RIUA 4H63V 2CLYC 3P50A 4EXTA 3N9QA 4CI2B 3T1HT 3Q2MA 1KEYA 4TN7B 5L4HA 4ZI3C 3IA3A 2BDEA 5HCJA 1XDPA 2M67A 1WYCA 2V6XA 3L39A 4PJMA 4G63A 4EEBA 1HX8A 5LGTB 2IC6A 3AE8A 5IHYA 1IJ5A 3UU4A 2BVMA 4AXPA 3I9YA 4AIUA 4I43B 3ZJ2A 3P4WA 4HWHA 2BS2A 3RF1A 5TAOA 4UV9B 2BS4A 2ACZA 2BG9B 3E08A 1U4QA 5JDHA 4EEDA 1E2AA 2PFVA 3RLFF 4UVBB 2HHHT 3N5LA 2V8SV 3QC9A 2CCQA 2KWIB 5E0OA 2VKHA 4YJ3E 1I6ZA 2L8KA 2JPFA 3AA6B 4ILAA 5FXWA 5LGNB 1O3XA 3RYIE 3RIAA 3AA7B 3LK42 4YT0A 2F4VT 3ESLA 5LG4A 1LRZA 2CXLA 4YHJA 5LHIB 3GWHA 2LKGA 1HNXT 3RYFE 5EK3A 1KF6A 2XPKA 4I50E 1MIWA 2YOEA 4L0RA 1FIOA 1YXRA 2JQKA 5KDMC 4H9PC 2PBIA 2IMLA 5LGUB 4NIQA 4HFHA 1S35A 2YU1A 2A2FX 5LB7B 1S94A 1CHUA 1MNEA 3N2OA 4GKKT 1WYBA 5JTGA 2XAHB 3C51A 1IAPA 4PK4A 1OEDA 4JLEA 1CUNA 2EHOC 4ILBA 3FZLB 3OYXA 5CGMA 2WB5A 5GONE 3UT5E 4HTEA 3AB3B 4HFCA 3OTOT 3RGLA 5L3GB 2XQ7A
chains in the Genus database with same CATH topology
1ZKEA 3B57A 4AKHA 5LA6E 2WMNA 2XAQB 4ZI2C 3ETUA 2X9WA 5AFUL 3QK6A 3ZC1A 1ZEEA 4XZCA 2KMFA 1QSDA 2BZBA 3KV6A 4BAYB 1FMVA 3N9NA 1MMNA 5LYJE 3IF8B 3UUXB 5HAXA 2E9XB 2VB6A 5JDLA 2YK0A 3H37A 1NWMX 2GK9A 4PAGA 1LVKA 3PUQA 5HXSA 1OWAA 2VWAA 4GIWA 2LE8A 3PE0A 4WNKA 2V7MA 3R6NA 3S4UA 5LJMA 4V1Av 2NW9A 5ETWA 3PTRB 4QXCB 4NUUA 3SWHA 5FXVA 2LHRA 4TUYE 1X79A 4BA9A 4CXXA 2SPCA 2X9YA 2VKOA 3MK7C 4OK0A 3VHLA 2KXPB 4UIGA 3DTOA 2Y48B 2D5UA 3ZLIA 2YINA 3FB2A 5FYMA 2LT3A 4C91A 2X66A 4OYJA 1MMDA 3LK3B 4QKNA 4ZOLE 3CQCB 4F6RC 2V7LA 1SA0E 4EYUA 3HKBE 3PUGA 3N9PA 1MMAA 4QXBB 3HKDE 2LSYA 4DBRA 5LXTE 5KMGP 5FP3A 4L5GA 3F2EA 2E9XA 3K3QC 1HCIA 3NZQA 4P09A 3ZMUB 5JDNA 3B13A 4J2CA 3HKCE 2XQYA 2ZM2A 3HA4A 4DO0A 5H6RB 4AQFA 3GA8A 3GN5B 3C50A 4FJOA 5J2TE 2JJ9A 2W63A 3ZMSB 3Q9DA 3PUAA 4GK5E 2D2SA 2Q9QC 2YEVC 4E7ZA 4I55E 2HH7A 3CX6B 3ZN1B 4ASKA 3NRYA 3UULA 3PURA 4ZI7E 2A72A 3O4XE 3KBUA 4O4HE 2CMRA 2ODVA 2JMHA 4AKIA 4IE7A 3K3OA 4AQGA 3MACA 4PW8A 2LHNA 2HPJA 5HYAA 3WI3A 2NTYA 2VKJA 2G0UA 3JC6D 3LK2B 3ZMZB 4H9NC 2X51A 4CI3B 1MIYA 4N78D 2KLQA 4QXHB 3FHNA 4IE4A 3EUHA 4P0AA 3AA0B 1HS7A 2LSIA 4OHFA 2DWGA 3I9WA 5J2UE 2WMOA 5JRCA 4BJNA 2XTLA 2X0LB 3CX7B 5IYZE 4L9IA 2ES0A 1UCUA 1WR6A 3BK9A 5BMVE 5DJQC 4UV8B 3NBXX 2MYSA 2IC9A 1FEWA 4O4JE 4ZHQE 2D0TA 3ZYKA 2KZ7B 4NUVA 1YW0A 2ZM0A 1SHZC 3MXZA 5JDFA 1NAFA 1QUUA 3A5XA 5LCYA 3FXDB 5LJNA 1D1CA 2VL8A 3LJCA 4EIWA 3ETVA 2NTXA 2KNDA 3WAJA 1E1HB 1G8XA 4H9RC 3KV5A 5FY0A 5JR9A 4EZ4A 2I59A 4UVAB 3GMIA 4YJ2E 5JDMA 5JQGE 2E9XD 3PU3A 1LVFA 3ZEFB 1YKEB 1HFAA 4ILUA 3O1HA 4UXNB 3HR0A 2LM9A 2CWOA 3I0QA 2CE7A 2W61A 5A1LA 3VKGA 5CA0E 5HXCA 3C98B 3CMLA 3ZN0B 3F57A 2V26A 1HF8A 4QX8B 1T98A 2DCFA 2MBGA 3KDSE 3EDUA 2X9XA 4CXWA 1ZHCA 5F3JA 2LSGA 5JVDE 3EDVA 3K8PC 5JREA 4HFVA 3N9LA 4IE6A 2D0UA 3RYCE 2MOZA 4ANJA 2H7OA 3AAIA 5LOVE 4AKGA 4MALA 3UUNA 3UFEA 4PK6A 5HXHA 2CM0A 2OA5A 5L3DB 3ZPOA 4O2BE 1ZV4X 3RH3A 4H9OC 4P0BA 2LSJA 1FMWA 5H6QB 2X67A 2NOXA 5DQVA 5FNVE 4ZS3A 2DI4A 5JDQA 4KP3C 2ZLYA 4ISSA 3NZPA 2QA7A 4O4IE 3SS1A 4C90A 3ZC0A 2CEAA 4AKLA 5HXEA 4ISTA 1US7B 3N9MA 4ZI3D 2V1DB 3DJBA 3VU7H 1D0ZA 4X1KE 2W62A 2L3LA 2VKDA 3AVRA 3KVBA 2DLRA 5DABA 2XUEA 4U72A 3CWZB 5JRCB 2CA5A 3N2KE 4CI1B 5L3FB 4EOZB 2VK9A 1VRBA 5EZYE 3J9X1 1HTJF 1D0YA 2BVLA 2A3DA 2DWKA 1MNDA 4K0UA 2CLYB 4JEHB 3V5SA 3CPZA 4TZ4C 3AA1B 2CXFA 2N2NA 1OXZA 4OFZA 3PUSA 4XBFB 2ZM8A 4IGUA 4A56A 4CXYA 2N1GA 3OYZA 3ZCIA 3P8CD 3MZKB 5LP6E 2N9DA 4ADZA 4MHCA 3IBPA 1V9DA 2WWUA 4KUMB 2C5KT 3MA9A 5JR9B 5M4YA 3O1IA 4CZZB 2E9XC 4MBQA 5CA1E 3F31A 2X68A 5ADXL 5HWXA 4JUYA 4AQFC 1H7CA 2C5JA 4GYSA 3IEEA 4PK5A 4DBQA 3U78A 3AVSA 2H3RA 2WSSV 5EK4A 4MLKA 2IAKA 2UXNB 4WBNE 4OYKA 2YU2A 3RC8A 4YLHA 3KV4A 3KFWX 4H9SE 2ODUA 3DP7A 4JEUB 1UX4A 4AI6A 4IE5A 5FXXA 4B6XA 5L3BB 5JH7E 2XAJB 4TV8E 2B1EA 5HWYA 4UVCB 2CWYA 4HN9A 1HG5A 2RA1A 4H63H 4X1IE 5DQWA 4HKAA 4HGAA 4KBMB 1IJ6A 3BQLA 3Q5WA 4TX5A 2V7JA 2UXXB 3R84B 3UTKA 2EHOA 5L3EB 3CKDA 4AKRB 3RRWA 4UELA 5L2LA 1KK7A 2PJQA 5LHGB 1MIVA 2LOPA 4GOUA 2MTQA 2XAFB 4WBOA 2C0SA 3ANWA 5CB4E 4H63V 3QUJA 1MMGA 3UUMA 4EYYR 1Z0PA 4YFSA 2CLYC 1D0XA 5FY1A 4XAXB 3RYHE 4E7SA 4EXTA 4G2AA 3N9QA 3CVRA 4CI2B 1AJ3A 2CXDA 3ZYMA 4QHOA 3T8OA 1BR1A 2JRKA 4O2AE 3VKHA 3Q2MA 3CQXC 4TN7B 3M65A 4ERRA 1D1BA 3D0TA 4ZI3C 2L9QA 2LJLA 4H9QC 3OJAA 2BDEA 1BR0A 5JR9C 2M67A 1WYCA 3C4ZA 2NWBA 2K48A 2WAUA 2LSKA 3LBXA 4PJMA 4G63A 3K3NA 2LEHA 2NW8A 1HX8A 1WRDA 2J1DG 3U3IA 4M1PA 1Y64B 1B7TA 3LFMA 4CQIA 5LGTB 3HKEE 2IC6A 5IHYA 3C64A 1IJ5A 2IW5B 2BVMA 3P7IA 3H3AA 3PU8A 4AXPA 3I9YA 4I43B 2K5BB 2V7KA 2Q9QB 4UEMA 4O4LE 3ZJ2A 1IZNB 5KX5E 2VASA 3KINB 4Z8XA 3ZMTB 2NW7A 5TAOA 5LNKA 3JC6C 2PG8A 4UV9B 4GYRA 5J1GA 1UX5A 3E08A 1U4QA 2EHOD 3CQGB 4HE8A 5JDHA 2C5IT 2H7VC 4EB6E 3J7Yq 3OKQA 4DMVA 1U5PA 2JMKA 3I1AA 3WAKA 2KWHA 2PFVA 1LKXA 1YKHB 4UVBB 5EK2A 3FBLA 4IHJE 2RP4A 1BR4A 1KNZA 5HXRA 4FI5A 4QX7B 5FXZA 3ZYLA 3FXEB 4PJNA 3E0ZA 4I4TE 4PFOA 4MFRA 3MJXA 3N5LA 2X9HA 3ZMVB 2XAGB 3QC9A 2P9BA 3KBTA 2CCQA 2KWIB 2WM9A 5E0OA 2VKHA 4YJ3E 2L8KA 2JPFA 3AA6B 3N2GE 2EHOB 3NRXA 5FXWA 2KT9A 3N9OA 3C4XA 4HEAA 1O3XA 3RKOA 4KMCA 4ZI2D 2Q9QA 1HG2A 5LGNB 2WBLA 3RYIE 4PNIA 3ANWB 3L3PA 3AA7B 3AAEB 5FY7A 3LK42 4IIJE 4BJMA 4PFPA 2E8IA 1EZ3A 1VOMA 3ESLA 4X20E 5LG4A 5L3CB 3Q5XA 3HI2A 1LRZA 2CXLA 4PJLA 4YHJA 5C8YE 3GWHA 5LHIB 2LOSA 3SOLA 2Z6EA 1BR2A 4TV9E 3W15B 3RRCA 3RYFE 5EK3A 4GK0E 3SRZA 4WW0A 3CX8B 5LBQB 4U74A 4I50E 1YD8G 1MIWA 4QWNB 4L0RA 1WLXA 3RC3A 1FIOA 3OBVE 3RPUA 5KDMC 1G73A 4H9PC 2PBIA 3LBXB 5LGUB 2W00A 4EAHA 3C4WA 1S35A 2YU1A 4X1YE 4UF0B 2A2FX 2DNXA 5LBMA 1S94A 3HL6A 3MKDA 2ACXA 1MNEA 5FMNA 1D1AA 3N2OA 3L09A 4PJJA 3E22E 3BQIA 1WYBA 2W0GA 4ZS2A 2XAHB 2HPLA 3C51A 2NP9A 3EVYA 3O1JA 2DHRA 4DNDA 1IAPA 3KV9A 4PK4A 3I0OA 5F8PA 4DVDA 4JLEA 4DMWA 3GN5A 1CUNA 3TKLB 3ZJ1A 2EHOC 3FBZA 3LG7A 2K24A 3OYXA 5JDGA 3PDYA 5GONE 3IHRA 4IDZA 3UT5E 2XASB 2JQQA 2Q9QD 2XHEB 3RX6A 4HTEA 3V5UA 2ZMAA 2Y6XA 3BQKA 3AAAB 2V7IA 3AB3B 4O8SA 3KVAA 4EZHA 3O9XA 3ZCJA 5LHHB 2KINB 3ONXA 2QGSA 5L3GB 4UF0A 2Y8DA 4IE0A 2K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHL A;  2WMN A;  2WMO A;  3B13 A;  2YIN A;  2WM9 A; 
#chains in the Genus database with same CATH topology
 3B57 A;  2XAQ B;  5CJ5 A;  2OLT A;  5AFU L;  3ZC1 A;  2VQF T;  2YKS A;  3N9N A;  1MMN A;  3IF8 B;  2BKP A;  2E9X B;  1NWM X;  4PAG A;  2UXD T;  3PUQ A;  5HXS A;  4Z90 A;  2VWA A;  4GIW A;  4I0U A;  4QXC B;  4NUU A;  3SWH A;  3QNU A;  5ABG A;  4CXX A;  3MK7 C;  2KXP B;  5LMU T;  4TNV A;  4OYJ A;  1MMD A;  3CQC B;  3T1Y T;  2V7L A;  1XNR T;  3HKB E;  3TLS A;  4DBR A;  3ZT5 A;  5JDN A;  4J2C A;  3HKC E;  3VRA A;  4DO0 A;  5H6R B;  4AQF A;  3GA8 A;  5J2T E;  3P4R A;  3Q9D A;  3QB5 A;  2D9D A;  2HH7 A;  3CX6 B;  2BS3 A;  3UUL A;  4K0K T;  4IE7 A;  4A97 A;  3K3O A;  4AQG A;  2H89 A;  4PW8 A;  2LHN A;  2HPJ A;  3WI3 A;  3JC6 D;  2MAW A;  3ZMZ B;  4H9N C;  2KLQ A;  4P0A A;  1HS7 A;  2LSI A;  4OHF A;  2WMO A;  4HFB A;  2X0L B;  4YSX A;  2ES0 A;  1WR6 A;  5AQJ B;  2PTF A;  2IC9 A;  3PUZ F;  2D0T A;  1YW0 A;  1SHZ C;  5ABF A;  1QUU A;  3A5X A;  3AEE A;  5AQS B;  1YQ3 A;  1IBM T;  2BKN A;  5CFB A;  3UU8 A;  3GMI A;  5JDM A;  1IBL T;  2FJB A;  2E9X D;  3ZEF B;  5ABH A;  3O1H A;  2LM9 A;  2CWO A;  4DV3 T;  2CE7 A;  2W61 A;  5HXC A;  3C98 B;  5LMN T;  3F57 A;  2V26 A;  1HF8 A;  3ZT6 A;  5C2T A;  2DCF A;  4CXW A;  4KX6 A;  2LSG A;  3K8P C;  4HFV A;  4IE6 A;  2D0U A;  5IWA T;  4ANJ A;  4HWF A;  4MAL A;  5AQR B;  2OA5 A;  3PUW F;  5AQH B;  4H9O C;  4P0B A;  2LSJ A;  4JI0 T;  2WDV A;  3AE4 A;  3UFG A;  2XQ8 A;  4YSZ A;  4AKL A;  5HXE A;  3VR8 A;  4ZI3 D;  2V1D B;  2W62 A;  3AVR A;  5DAB A;  4U72 A;  2WDQ A;  4EOZ B;  2VK9 A;  1D0Y A;  2E2A A;  1MND A;  4QH1 A;  4JEH B;  3OVU A;  4U31 A;  5AQL B;  4A56 A;  4IGU A;  1XZY A;  2R6G F;  5LP6 E;  2WWU A;  4KUM B;  5M4Y A;  3AE9 A;  4CZZ B;  3A7M A;  3F31 A;  3IEE A;  3AVS A;  2H3R A;  5EK4 A;  2IAK A;  2UXN B;  4WBN E;  4OYK A;  4U7Y A;  3RC8 A;  3DP7 A;  4AI6 A;  4A98 A;  4B6X A;  5L3B B;  5JH7 E;  4IDQ A;  2CWY A;  2VVS A;  1JNZ A;  2UXX B;  3P4P A;  3CKD A;  3RRW A;  4UEL A;  2PJQ A;  4WBO A;  2C0S A;  3ONL C;  3QUJ A;  5FY1 A;  3RYH E;  4G2A A;  1AJ3 A;  3L8R A;  4IL4 A;  5HEG A;  2CXD A;  3T8O A;  2JRK A;  4O2A E;  4ERR A;  1D1B A;  4H9Q C;  3OJA A;  3A8Y C;  5JR9 C;  4ZEY A;  2K48 A;  2NW8 A;  2XSA A;  3LFM A;  1SE7 A;  3AED A;  2W67 A;  2IW5 B;  3P7I A;  3H3A A;  4JI1 T;  2H88 A;  2V7K A;  4O4L E;  2VAS A;  4Z8X A;  4IRE A;  4DR1 T;  2UUB T;  3RHW A;  4Z91 A;  2NW7 A;  5LNK A;  3JC6 C;  2PG8 A;  1R8I A;  5J1G A;  2EHO D;  3CQG B;  4IDO A;  1Z8U A;  4DMV A;  1LKX A;  1YKH B;  2WU2 A;  3NWI A;  5EK2 A;  2RP4 A;  1BR4 A;  4QX7 B;  3ZKR A;  2YDQ A;  3FXE B;  4PFO A;  3MJX A;  3QB5 K;  2XAG B;  3RI5 A;  2WM9 A;  4HWC A;  4KI0 F;  4JBW F;  2Q9Q A;  1HG2 A;  4PNI A;  5FY7 A;  4ZZC A;  4IIJ E;  4BJM A;  4PFP A;  4X20 E;  5L3C B;  3Q5X A;  3VKG A;  2XQ9 A;  2LOS A;  1BR2 A;  3P4S A;  4GK0 E;  4NPP A;  4WW0 A;  3CX8 B;  2LRL A;  4QWN B;  1T72 A;  1ZP0 A;  3Q5D A;  4X66 T;  3AE6 A;  5AQK B;  3VR9 A;  4EAH A;  4X1Y E;  2LKH A;  4CN4 A;  3L09 A;  4PJJ A;  3BQI A;  2W0G A;  4ZS2 A;  3O1J A;  2FBW A;  2DHR A;  4DND A;  2CBJ A;  3M3Z B;  5F8P A;  4YY3 T;  4DMW A;  3TKL B;  3LG7 A;  2FUP A;  2VQE T;  3RIU C;  3RX6 A;  1J5E T;  3X1D A;  4O8S A;  3O9X A;  4UF0 A;  1J1J A;  2DI4 A;  2K9A A;  1ZKE A;  5LA6 E;  4HWD A;  2WMN A;  2E5V A;  4ZI2 C;  3ETU A;  2X9W A;  1N33 T;  4XZC A;  2KMF A;  3KV6 A;  2IDO B;  1FMV A;  5LYJ E;  3UUX B;  5JDL A;  2YK0 A;  2GK9 A;  1VCS A;  3SFD A;  1XMO T;  1OWA A;  2LE8 A;  3PE0 A;  4QH4 A;  3S4U A;  5LJM A;  4V1A v;  2NW9 A;  5ETW A;  3PTR B;  2SPC A;  3H3M A;  5L4E A;  4UIG A;  2Y48 B;  2D5U A;  3FB2 A;  2XM1 A;  2LT3 A;  2X66 A;  4QKN A;  4EYU A;  4JI8 T;  3G06 A;  2BKO A;  4QXB B;  3HKD E;  2FJE A;  3AXJ A;  5LXT E;  4L5G A;  3F2E A;  4P09 A;  3B13 A;  2ZM2 A;  3HA4 A;  3NKZ A;  3GN5 B;  2W63 A;  3ZMS B;  1UGO A;  2I6H A;  4GK5 E;  4I55 E;  3ZN1 B;  4ASK A;  2A72 A;  4O4H E;  3JAF A;  4AKI A;  2M6I A;  4TWH A;  2WWV A;  1HNW T;  2VKJ A;  5C3J A;  3LK2 B;  2X51 A;  4QXH B;  3FHN A;  4IE4 A;  3EUH A;  5FL1 A;  1XDO A;  5IYZ E;  2UXC T;  5BMV E;  1NEN A;  4UV8 B;  3NBX X;  4LMJ A;  2ZM6 T;  3ZYK A;  4DV2 T;  3MXZ A;  1ZOY A;  3UU6 A;  3FXD B;  2VL8 A;  4JI7 T;  3PJA J;  3ETV A;  2NTX A;  2KND A;  4B3R T;  1G8X A;  4H9R C;  3KV5 A;  5FY0 A;  1GQE A;  5JQG E;  1LVF A;  1HFA A;  2JQ9 A;  4X65 T;  3I0Q A;  5CA0 E;  3CML A;  1W09 A;  1IBK T;  2X9X A;  5F3J A;  3RIF A;  3TLU A;  2BBH A;  3RYC E;  4NXN T;  3AAI A;  5LOV E;  1SUM B;  4PK6 A;  5HXH A;  4YTN A;  4F8H A;  4O2B E;  5AQU B;  2NR4 A;  1FMW A;  2X67 A;  2NOX A;  4ZS3 A;  1WR0 A;  3SS1 A;  3DJB A;  5AQM B;  3TLT A;  4Q25 A;  3KVB A;  2CBI A;  4CI1 B;  1VRB A;  5EZY E;  2BVL A;  2A3D A;  2CLY B;  4TZ4 C;  3AA1 B;  2J62 A;  4OFZ A;  3PUS A;  4IT4 A;  2YDS A;  1W0B A;  3ZCI A;  4ADZ A;  1N36 T;  4AQF C;  2LRK A;  4DBQ A;  5HCM A;  3U78 A;  5AQG B;  2HN2 A;  2A9U A;  4YLH A;  4H9S E;  1UX4 A;  2OV9 A;  4TV8 E;  4IL9 A;  5HWY A;  4HN9 A;  1HG5 A;  2RA1 A;  4H63 H;  4HGA A;  3R84 B;  5L2L A;  2W4X A;  1HR0 T;  3UUM A;  4EYY R;  4YFS A;  1JNR A;  4E7S A;  3CVR A;  2VUR A;  3ZYM A;  4QHO A;  1BR1 A;  3CQX C;  3CIR A;  3AEG A;  3M65 A;  1WFD A;  1XNQ T;  1BR0 A;  4ZZB A;  2WAU A;  5FKY A;  3LSV A;  4IDN A;  3K3N A;  2LEH A;  1WRD A;  2J1D G;  3U3I A;  4M1P A;  4CQI A;  3C64 A;  1VCT A;  2V5D A;  2K5B B;  1IZN B;  3FZH B;  5KX5 E;  4DR6 T;  3ZMT B;  4GYR A;  4ZXL A;  1UX5 A;  2H7V C;  3J7Y q;  2AXD S;  3OKQ A;  2XY8 B;  4DR2 T;  2LLY A;  4IHJ E;  1KNZ A;  3ZYL A;  4JI4 T;  4PJN A;  4I4T E;  4MFR A;  2X9H A;  1W9R A;  4JI3 T;  4DV1 T;  1T7S A;  2EHO B;  4DV6 T;  2KT9 A;  1HX1 B;  3RKO A;  4ZI2 D;  4KMC A;  4IDP A;  3AEB A;  1EZ3 A;  3HI2 A;  4HFI A;  5C8Y E;  2BG9 A;  3ABV A;  3SOL A;  4TV9 E;  3SRZ A;  4U74 A;  1YD8 G;  1WLX A;  1G73 A;  3PUX F;  3LBX B;  2W00 A;  3NVO A;  2IHR 1;  2XSB A;  2JIW A;  5FMN A;  2WP9 A;  2HPL A;  2NP9 A;  3KV9 A;  2XQ6 A;  1E7P A;  4DVD A;  3GN5 A;  5JDG A;  3PDY A;  4LF5 T;  4IDZ A;  2XHE B;  3V5U A;  2Y6X A;  5ABE A;  2IUB A;  3BQK A;  2V7I A;  5AQQ B;  2VVN A;  4YTM A;  3KVA A;  4EZH A;  3ONX A;  2Y8D A;  4HWI B;  4AKH A;  4HFE A;  3FZF B;  1M62 A;  1T8B A;  5HAX A;  5AQV B;  2VB6 A;  3H37 A;  4WNK A;  3R6N A;  5FXV A;  4HFD A;  4TUY E;  4BA9 A;  1X79 A;  2HN1 A;  2X9Y A;  4X64 T;  2VKO A;  2CHN A;  4YTP A;  2WCA A;  1SA0 E;  4ILC A;  2LSY A;  2V6Y B;  5FP3 A;  2E9X A;  2X0Y A;  3C50 A;  4FJO A;  2JJ9 A;  4LF7 T;  3PUA A;  2D2S A;  2Q9Q C;  4OX9 T;  2YEV C;  5HEJ A;  1HNZ T;  4CN6 A;  3LDQ B;  3MAC A;  4COF A;  2NTY A;  2G0U A;  1MIY A;  4DR5 T;  2DWG A;  5J2U E;  3AEC A;  4YSY A;  1NEK A;  2XTL A;  3CX7 B;  3BK9 A;  2MYS A;  4O4J E;  5JDF A;  1NAF A;  3LJC A;  5HEO A;  3OPC A;  3WAJ A;  1E1H B;  4U2Y A;  4JI2 T;  1N34 T;  4EZ4 A;  2I59 A;  4YJ2 E;  4AIS A;  4ILU A;  5A1L A;  1OED E;  3TLV A;  4QX8 B;  4TNW A;  3KDS E;  3EDU A;  1ZHC A;  5JVD E;  3PV0 F;  3EDV A;  3N9L A;  2MOZ A;  5LG3 A;  3UFE A;  2CM0 A;  5L3D B;  3RH3 A;  5H6Q B;  5FNV E;  4GKJ T;  2XJ7 A;  4B3S T;  4JV5 T;  4KP3 C;  2ZLY A;  3NZP A;  2QA7 A;  4EV6 A;  4C90 A;  2CEA A;  1FJG T;  2W66 A;  3N9M A;  3VU7 H;  3ZSS A;  2L3L A;  2VKD A;  2XUE A;  5FVL A;  2XM2 A;  5JRC B;  3N2K E;  1HTJ F;  3UU5 A;  3V5S A;  3CPZ A;  4WZX A;  2N2N A;  1OXZ A;  4LF9 T;  2ZM8 A;  4CXY A;  3AE2 A;  3MZK B;  4MHC A;  2C5K T;  3MA9 A;  5JR9 B;  3O1I A;  5CA1 E;  5HWX A;  4JUY A;  1I94 T;  2C5J A;  4GYS A;  2WSS V;  4JEU B;  4IE5 A;  4JI6 T;  4UVC B;  1IJ6 A;  2IIU A;  3Q5W A;  4TX5 A;  2V7J A;  1UUS A;  3FZK B;  2EHO A;  2J4G A;  4AKR B;  1KK7 A;  5LHG B;  1YQ4 A;  2LOP A;  5AQP B;  3AEA A;  1MMG A;  4LMK A;  1Z0P A;  1D0X A;  2RPA A;  4XAX B;  1OED C;  3VKH A;  3D0T A;  2L9Q A;  2LJL A;  4EGW A;  5FL0 A;  3C4Z A;  2NWB A;  2LSK A;  3LBX A;  1UUR A;  2E5L T;  1Y64 B;  1B7T A;  4DV4 T;  3HKE E;  4CN1 A;  3PU8 A;  4NXM T;  1KNP A;  5IUX A;  5HEH A;  4UEM A;  2Q9Q B;  4LFA T;  5FVK A;  3KIN B;  3K1S A;  1J5W A;  2M6B A;  4X62 T;  4HE8 A;  2C5I T;  4EB6 E;  1U5P A;  2JMK A;  3I1A A;  3WAK A;  2KWH A;  5AQN B;  4YXD A;  3FBL A;  5HXR A;  2WY2 A;  4FI5 A;  5FXZ A;  3E0Z A;  2WU5 A;  2AE9 A;  3ZMV B;  4UR9 A;  2P9B A;  3KBT A;  1QLB A;  4X5T A;  4LML A;  3N2G E;  3NRX A;  3N9O A;  3C4X A;  4HEA A;  3PJA A;  2WBL A;  3VRB A;  3ANW B;  3L3P A;  3AAE B;  4JYA T;  2E8I A;  1VOM A;  1X9B A;  4PJL A;  4DV5 T;  2Z6E A;  3W15 B;  3RRC A;  1XMQ T;  1DU2 A;  2X0H A;  2JQH A;  4DR3 T;  5LBQ B;  4TWF A;  4DR7 T;  3RC3 A;  3OBV E;  3RPU A;  5BR8 T;  3C4W A;  4UF0 B;  2DNX A;  5LBM A;  4DUY T;  2BG9 E;  3HL6 A;  4TWD A;  3MKD A;  4AQY T;  5J0Z A;  2ACX A;  1D1A A;  3AEF A;  2VL0 A;  3E22 E;  2V6Y A;  1L0V A;  3CK6 A;  3EVY A;  2WDR A;  2DL1 A;  2QRX A;  3JCF A;  3I0O A;  1XWM A;  3ZJ1 A;  3FBZ A;  2K24 A;  3AE1 A;  3IHR A;  2XAS B;  2JQQ A;  2KSR A;  1Y01 A;  2Q9Q D;  3QOF A;  2ZMA A;  3AAA B;  3ZCJ A;  5LHH B;  2KIN B;  4WYV A;  2QGS A;  3EI0 A;  3AE5 A;  4IE0 A;  2I0M A;  5AQO B;  3QK6 A;  1ZEE A;  1QSD A;  2UUA T;  2BZB A;  4BAY B;  3AXJ B;  4LFB T;  4DUZ T;  2CRB A;  1LVK A;  4LFC T;  2V7M A;  4P1N A;  2YN6 A;  2LHR A;  3EAM A;  3RQW A;  2QVA A;  4OK0 A;  3VHL A;  2XQ4 A;  3DTO A;  3ZLI A;  2YIN A;  4LF8 T;  5FYM A;  3EHZ A;  4C91 A;  1KFY A;  3LK3 B;  4ZOL E;  4F6R C;  3PUG A;  3N9P A;  1MMA A;  5KMG P;  2WQY A;  3JAD A;  3K3Q C;  3NZQ A;  1HCI A;  2WS3 A;  3ZMU B;  2W2U A;  3SFE A;  1OED B;  2XQY A;  2J47 A;  4KHZ F;  2UU9 T;  4E7Z A;  3NRY A;  4ZI7 E;  3PUR A;  3O4X E;  3KBU A;  2CMR A;  2ODV A;  2JMH A;  1N32 T;  2BG9 C;  3ONJ A;  3TLW A;  1KNR A;  5HYA A;  2UUC T;  4CI3 B;  4N78 D;  1M7K A;  3AA0 B;  4JI5 T;  3I9W A;  5F5W A;  3ZST A;  5JRC A;  4BJN A;  4U3C A;  4L9I A;  1UCU A;  5DJQ C;  1FEW A;  4QH5 A;  2XQ5 A;  4ZHQ E;  5AQI B;  2KZ7 B;  4NUV A;  5L47 A;  2ZM0 A;  2V5C A;  5LCY A;  5LJN A;  1D1C A;  2FJD A;  4EIW A;  3UUB A;  4U2Z A;  4DID B;  5JR9 A;  3EAB A;  4UVA B;  2XZE A;  5HEU A;  3PU3 A;  3B5M A;  1YKE B;  4UXN B;  3HR0 A;  3PUV F;  4LF4 T;  3ZN0 B;  3JAE A;  1T98 A;  3AE7 A;  4DV7 T;  2MBG A;  5JRE A;  5AQT B;  2H7O A;  2WZI A;  4AKG A;  3UUN A;  4YHH T;  2K3W A;  3ZPO A;  1ZV4 X;  2FJA A;  3UQ7 A;  3UQ4 A;  3AE3 A;  5DQV A;  4DV0 T;  5JDQ A;  4ISS A;  3ZT7 A;  4DR4 T;  4O4I E;  2MPK A;  3ZC0 A;  1UK5 A;  3P4Q A;  4IST A;  1US7 B;  1D0Z A;  4X1K E;  2DLR A;  3RQU A;  3CWZ B;  2CA5 A;  3RKG A;  4A5X A;  3PUY F;  5AQF B;  5L3F B;  3J9X 1;  2DWK A;  4B3T T;  4KHP T;  4K0U A;  4U7I A;  2QYW A;  2CXF A;  2CPT A;  4XBF B;  4LF6 T;  5ABF B;  2N1G A;  3OYZ A;  3P8C D;  2N9D A;  4U33 A;  3IBP A;  1V9D A;  2E9X C;  2XQ3 A;  4MBQ A;  2X68 A;  5ADX L;  2CHO A;  2WZH A;  1H7C A;  2YDR A;  4PK5 A;  4MLK A;  2LM2 A;  3UU3 A;  1WCR A;  2B76 A;  2YU2 A;  3KV4 A;  3KFW X;  3FZM B;  2ODU A;  5KXJ A;  2UXB T;  5FXX A;  2XAJ B;  4B3M T;  2B1E A;  4X1I E;  5DQW A;  4HKA A;  1W0A A;  3Q5E A;  4KBM B;  3BQL A;  3UTK A;  2XQA A;  5L3E B;  2BBJ A;  1MIV A;  4GOU A;  2MTQ A;  2XAF B;  5CB4 E;  3ANW A;  3RIU A;  4H63 V;  2CLY C;  3P50 A;  4EXT A;  3N9Q A;  4CI2 B;  3T1H T;  3Q2M A;  1KEY A;  4TN7 B;  5L4H A;  4ZI3 C;  3IA3 A;  2BDE A;  5HCJ A;  1XDP A;  2M67 A;  1WYC A;  2V6X A;  3L39 A;  4PJM A;  4G63 A;  4EEB A;  1HX8 A;  5LGT B;  2IC6 A;  3AE8 A;  5IHY A;  1IJ5 A;  3UU4 A;  2BVM A;  4AXP A;  3I9Y A;  4AIU A;  4I43 B;  3ZJ2 A;  3P4W A;  4HWH A;  2BS2 A;  3RF1 A;  5TAO A;  4UV9 B;  2BS4 A;  2ACZ A;  2BG9 B;  3E08 A;  1U4Q A;  5JDH A;  4EED A;  1E2A A;  2PFV A;  3RLF F;  4UVB B;  2HHH T;  3N5L A;  2V8S V;  3QC9 A;  2CCQ A;  2KWI B;  5E0O A;  2VKH A;  4YJ3 E;  1I6Z A;  2L8K A;  2JPF A;  3AA6 B;  4ILA A;  5FXW A;  5LGN B;  1O3X A;  3RYI E;  3RIA A;  3AA7 B;  3LK4 2;  4YT0 A;  2F4V T;  3ESL A;  5LG4 A;  1LRZ A;  2CXL A;  4YHJ A;  5LHI B;  3GWH A;  2LKG A;  1HNX T;  3RYF E;  5EK3 A;  1KF6 A;  2XPK A;  4I50 E;  1MIW A;  2YOE A;  4L0R A;  1FIO A;  1YXR A;  2JQK A;  5KDM C;  4H9P C;  2PBI A;  2IML A;  5LGU B;  4NIQ A;  4HFH A;  1S35 A;  2YU1 A;  2A2F X;  5LB7 B;  1S94 A;  1CHU A;  1MNE A;  3N2O A;  4GKK T;  1WYB A;  5JTG A;  2XAH B;  3C51 A;  1IAP A;  4PK4 A;  1OED A;  4JLE A;  1CUN A;  2EHO C;  4ILB A;  3FZL B;  3OYX A;  5CGM A;  2WB5 A;  5GON E;  3UT5 E;  4HTE A;  3AB3 B;  4HFC A;  3OTO T;  3RGL A;  5L3G B;  2XQ7 A; 
#chains in the Genus database with same CATH homology
 1ZKE A;  3B57 A;  4AKH A;  5LA6 E;  2WMN A;  2XAQ B;  4ZI2 C;  3ETU A;  2X9W A;  5AFU L;  3QK6 A;  3ZC1 A;  1ZEE A;  4XZC A;  2KMF A;  1QSD A;  2BZB A;  3KV6 A;  4BAY B;  1FMV A;  3N9N A;  1MMN A;  5LYJ E;  3IF8 B;  3UUX B;  5HAX A;  2E9X B;  2VB6 A;  5JDL A;  2YK0 A;  3H37 A;  1NWM X;  2GK9 A;  4PAG A;  1LVK A;  3PUQ A;  5HXS A;  1OWA A;  2VWA A;  4GIW A;  2LE8 A;  3PE0 A;  4WNK A;  2V7M A;  3R6N A;  3S4U A;  5LJM A;  4V1A v;  2NW9 A;  5ETW A;  3PTR B;  4QXC B;  4NUU A;  3SWH A;  5FXV A;  2LHR A;  4TUY E;  1X79 A;  4BA9 A;  4CXX A;  2SPC A;  2X9Y A;  2VKO A;  3MK7 C;  4OK0 A;  3VHL A;  2KXP B;  4UIG A;  3DTO A;  2Y48 B;  2D5U A;  3ZLI A;  2YIN A;  3FB2 A;  5FYM A;  2LT3 A;  4C91 A;  2X66 A;  4OYJ A;  1MMD A;  3LK3 B;  4QKN A;  4ZOL E;  3CQC B;  4F6R C;  2V7L A;  1SA0 E;  4EYU A;  3HKB E;  3PUG A;  3N9P A;  1MMA A;  4QXB B;  3HKD E;  2LSY A;  4DBR A;  5LXT E;  5KMG P;  5FP3 A;  4L5G A;  3F2E A;  2E9X A;  3K3Q C;  1HCI A;  3NZQ A;  4P09 A;  3ZMU B;  5JDN A;  3B13 A;  4J2C A;  3HKC E;  2XQY A;  2ZM2 A;  3HA4 A;  4DO0 A;  5H6R B;  4AQF A;  3GA8 A;  3GN5 B;  3C50 A;  4FJO A;  5J2T E;  2JJ9 A;  2W63 A;  3ZMS B;  3Q9D A;  3PUA A;  4GK5 E;  2D2S A;  2Q9Q C;  2YEV C;  4E7Z A;  4I55 E;  2HH7 A;  3CX6 B;  3ZN1 B;  4ASK A;  3NRY A;  3UUL A;  3PUR A;  4ZI7 E;  2A72 A;  3O4X E;  3KBU A;  4O4H E;  2CMR A;  2ODV A;  2JMH A;  4AKI A;  4IE7 A;  3K3O A;  4AQG A;  3MAC A;  4PW8 A;  2LHN A;  2HPJ A;  5HYA A;  3WI3 A;  2NTY A;  2VKJ A;  2G0U A;  3JC6 D;  3LK2 B;  3ZMZ B;  4H9N C;  2X51 A;  4CI3 B;  1MIY A;  4N78 D;  2KLQ A;  4QXH B;  3FHN A;  4IE4 A;  3EUH A;  4P0A A;  3AA0 B;  1HS7 A;  2LSI A;  4OHF A;  2DWG A;  3I9W A;  5J2U E;  2WMO A;  5JRC A;  4BJN A;  2XTL A;  2X0L B;  3CX7 B;  5IYZ E;  4L9I A;  2ES0 A;  1UCU A;  1WR6 A;  3BK9 A;  5BMV E;  5DJQ C;  4UV8 B;  3NBX X;  2MYS A;  2IC9 A;  1FEW A;  4O4J E;  4ZHQ E;  2D0T A;  3ZYK A;  2KZ7 B;  4NUV A;  1YW0 A;  2ZM0 A;  1SHZ C;  3MXZ A;  5JDF A;  1NAF A;  1QUU A;  3A5X A;  5LCY A;  3FXD B;  5LJN A;  1D1C A;  2VL8 A;  3LJC A;  4EIW A;  3ETV A;  2NTX A;  2KND A;  3WAJ A;  1E1H B;  1G8X A;  4H9R C;  3KV5 A;  5FY0 A;  5JR9 A;  4EZ4 A;  2I59 A;  4UVA B;  3GMI A;  4YJ2 E;  5JDM A;  5JQG E;  2E9X D;  3PU3 A;  1LVF A;  3ZEF B;  1YKE B;  1HFA A;  4ILU A;  3O1H A;  4UXN B;  3HR0 A;  2LM9 A;  2CWO A;  3I0Q A;  2CE7 A;  2W61 A;  5A1L A;  3VKG A;  5CA0 E;  5HXC A;  3C98 B;  3CML A;  3ZN0 B;  3F57 A;  2V26 A;  1HF8 A;  4QX8 B;  1T98 A;  2DCF A;  2MBG A;  3KDS E;  3EDU A;  2X9X A;  4CXW A;  1ZHC A;  5F3J A;  2LSG A;  5JVD E;  3EDV A;  3K8P C;  5JRE A;  4HFV A;  3N9L A;  4IE6 A;  2D0U A;  3RYC E;  2MOZ A;  4ANJ A;  2H7O A;  3AAI A;  5LOV E;  4AKG A;  4MAL A;  3UUN A;  3UFE A;  4PK6 A;  5HXH A;  2CM0 A;  2OA5 A;  5L3D B;  3ZPO A;  4O2B E;  1ZV4 X;  3RH3 A;  4H9O C;  4P0B A;  2LSJ A;  1FMW A;  5H6Q B;  2X67 A;  2NOX A;  5DQV A;  5FNV E;  4ZS3 A;  2DI4 A;  5JDQ A;  4KP3 C;  2ZLY A;  4ISS A;  3NZP A;  2QA7 A;  4O4I E;  3SS1 A;  4C90 A;  3ZC0 A;  2CEA A;  4AKL A;  5HXE A;  4IST A;  1US7 B;  3N9M A;  4ZI3 D;  2V1D B;  3DJB A;  3VU7 H;  1D0Z A;  4X1K E;  2W62 A;  2L3L A;  2VKD A;  3AVR A;  3KVB A;  2DLR A;  5DAB A;  2XUE A;  4U72 A;  3CWZ B;  5JRC B;  2CA5 A;  3N2K E;  4CI1 B;  5L3F B;  4EOZ B;  2VK9 A;  1VRB A;  5EZY E;  3J9X 1;  1HTJ F;  1D0Y A;  2BVL A;  2A3D A;  2DWK A;  1MND A;  4K0U A;  2CLY B;  4JEH B;  3V5S A;  3CPZ A;  4TZ4 C;  3AA1 B;  2CXF A;  2N2N A;  1OXZ A;  4OFZ A;  3PUS A;  4XBF B;  2ZM8 A;  4IGU A;  4A56 A;  4CXY A;  2N1G A;  3OYZ A;  3ZCI A;  3P8C D;  3MZK B;  5LP6 E;  2N9D A;  4ADZ A;  4MHC A;  3IBP A;  1V9D A;  2WWU A;  4KUM B;  2C5K T;  3MA9 A;  5JR9 B;  5M4Y A;  3O1I A;  4CZZ B;  2E9X C;  4MBQ A;  5CA1 E;  3F31 A;  2X68 A;  5ADX L;  5HWX A;  4JUY A;  4AQF C;  1H7C A;  2C5J A;  4GYS A;  3IEE A;  4PK5 A;  4DBQ A;  3U78 A;  3AVS A;  2H3R A;  2WSS V;  5EK4 A;  4MLK A;  2IAK A;  2UXN B;  4WBN E;  4OYK A;  2YU2 A;  3RC8 A;  4YLH A;  3KV4 A;  3KFW X;  4H9S E;  2ODU A;  3DP7 A;  4JEU B;  1UX4 A;  4AI6 A;  4IE5 A;  5FXX A;  4B6X A;  5L3B B;  5JH7 E;  2XAJ B;  4TV8 E;  2B1E A;  5HWY A;  4UVC B;  2CWY A;  4HN9 A;  1HG5 A;  2RA1 A;  4H63 H;  4X1I E;  5DQW A;  4HKA A;  4HGA A;  4KBM B;  1IJ6 A;  3BQL A;  3Q5W A;  4TX5 A;  2V7J A;  2UXX B;  3R84 B;  3UTK A;  2EHO A;  5L3E B;  3CKD A;  4AKR B;  3RRW A;  4UEL A;  5L2L A;  1KK7 A;  2PJQ A;  5LHG B;  1MIV A;  2LOP A;  4GOU A;  2MTQ A;  2XAF B;  4WBO A;  2C0S A;  3ANW A;  5CB4 E;  4H63 V;  3QUJ A;  1MMG A;  3UUM A;  4EYY R;  1Z0P A;  4YFS A;  2CLY C;  1D0X A;  5FY1 A;  4XAX B;  3RYH E;  4E7S A;  4EXT A;  4G2A A;  3N9Q A;  3CVR A;  4CI2 B;  1AJ3 A;  2CXD A;  3ZYM A;  4QHO A;  3T8O A;  1BR1 A;  2JRK A;  4O2A E;  3VKH A;  3Q2M A;  3CQX C;  4TN7 B;  3M65 A;  4ERR A;  1D1B A;  3D0T A;  4ZI3 C;  2L9Q A;  2LJL A;  4H9Q C;  3OJA A;  2BDE A;  1BR0 A;  5JR9 C;  2M67 A;  1WYC A;  3C4Z A;  2NWB A;  2K48 A;  2WAU A;  2LSK A;  3LBX A;  4PJM A;  4G63 A;  3K3N A;  2LEH A;  2NW8 A;  1HX8 A;  1WRD A;  2J1D G;  3U3I A;  4M1P A;  1Y64 B;  1B7T A;  3LFM A;  4CQI A;  5LGT B;  3HKE E;  2IC6 A;  5IHY A;  3C64 A;  1IJ5 A;  2IW5 B;  2BVM A;  3P7I A;  3H3A A;  3PU8 A;  4AXP A;  3I9Y A;  4I43 B;  2K5B B;  2V7K A;  2Q9Q B;  4UEM A;  4O4L E;  3ZJ2 A;  1IZN B;  5KX5 E;  2VAS A;  3KIN B;  4Z8X A;  3ZMT B;  2NW7 A;  5TAO A;  5LNK A;  3JC6 C;  2PG8 A;  4UV9 B;  4GYR A;  5J1G A;  1UX5 A;  3E08 A;  1U4Q A;  2EHO D;  3CQG B;  4HE8 A;  5JDH A;  2C5I T;  2H7V C;  4EB6 E;  3J7Y q;  3OKQ A;  4DMV A;  1U5P A;  2JMK A;  3I1A A;  3WAK A;  2KWH A;  2PFV A;  1LKX A;  1YKH B;  4UVB B;  5EK2 A;  3FBL A;  4IHJ E;  2RP4 A;  1BR4 A;  1KNZ A;  5HXR A;  4FI5 A;  4QX7 B;  5FXZ A;  3ZYL A;  3FXE B;  4PJN A;  3E0Z A;  4I4T E;  4PFO A;  4MFR A;  3MJX A;  3N5L A;  2X9H A;  3ZMV B;  2XAG B;  3QC9 A;  2P9B A;  3KBT A;  2CCQ A;  2KWI B;  2WM9 A;  5E0O A;  2VKH A;  4YJ3 E;  2L8K A;  2JPF A;  3AA6 B;  3N2G E;  2EHO B;  3NRX A;  5FXW A;  2KT9 A;  3N9O A;  3C4X A;  4HEA A;  1O3X A;  3RKO A;  4KMC A;  4ZI2 D;  2Q9Q A;  1HG2 A;  5LGN B;  2WBL A;  3RYI E;  4PNI A;  3ANW B;  3L3P A;  3AA7 B;  3AAE B;  5FY7 A;  3LK4 2;  4IIJ E;  4BJM A;  4PFP A;  2E8I A;  1EZ3 A;  1VOM A;  3ESL A;  4X20 E;  5LG4 A;  5L3C B;  3Q5X A;  3HI2 A;  1LRZ A;  2CXL A;  4PJL A;  4YHJ A;  5C8Y E;  3GWH A;  5LHI B;  2LOS A;  3SOL A;  2Z6E A;  1BR2 A;  4TV9 E;  3W15 B;  3RRC A;  3RYF E;  5EK3 A;  4GK0 E;  3SRZ A;  4WW0 A;  3CX8 B;  5LBQ B;  4U74 A;  4I50 E;  1YD8 G;  1MIW A;  4QWN B;  4L0R A;  1WLX A;  3RC3 A;  1FIO A;  3OBV E;  3RPU A;  5KDM C;  1G73 A;  4H9P C;  2PBI A;  3LBX B;  5LGU B;  2W00 A;  4EAH A;  3C4W A;  1S35 A;  2YU1 A;  4X1Y E;  4UF0 B;  2A2F X;  2DNX A;  5LBM A;  1S94 A;  3HL6 A;  3MKD A;  2ACX A;  1MNE A;  5FMN A;  1D1A A;  3N2O A;  3L09 A;  4PJJ A;  3E22 E;  3BQI A;  1WYB A;  2W0G A;  4ZS2 A;  2XAH B;  2HPL A;  3C51 A;  2NP9 A;  3EVY A;  3O1J A;  2DHR A;  4DND A;  1IAP A;  3KV9 A;  4PK4 A;  3I0O A;  5F8P A;  4DVD A;  4JLE A;  4DMW A;  3GN5 A;  1CUN A;  3TKL B;  3ZJ1 A;  2EHO C;  3FBZ A;  3LG7 A;  2K24 A;  3OYX A;  5JDG A;  3PDY A;  5GON E;  3IHR A;  4IDZ A;  3UT5 E;  2XAS B;  2JQQ A;  2Q9Q D;  2XHE B;  3RX6 A;  4HTE A;  3V5U A;  2ZMA A;  2Y6X A;  3BQK A;  3AAA B;  2V7I A;  3AB3 B;  4O8S A;  3KVA A;  4EZH A;  3O9X A;  3ZCJ A;  5LHH B;  2KIN B;  3ONX A;  2QGS A;  5L3G B;  4UF0 A;  2Y8D A;  4IE0 A;  2K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...