3VHLA

Crystal structure of the dhr-2 domain of dock8 in complex with cdc42 (t17n mutant)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
264
Chain Sequence
b'FGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 8
publication title DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 87
structure length 264
sequence length 273
ec nomenclature
pdb deposition date 2011-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vhlA02
2WMOA 2YINA 3B13A 2WMNA 2WM9A 3VHLA
chains in the Genus database with same CATH superfamily
1KNRA 4ILBA 3C4XA 4ZHQE 1I94T 3ZMSB 1HG2A 1WR0A 4U72A 5JRCA 3CX6B 3MACA 4WNKA 4AXPA 1YW0A 3R84B 1ZOYA 2BG9C 2CMRA 2N1GA 1XMOT 4I0UA 4DUYT 3VRAA 3WI3A 4ZI2C 3TLTA 2BS3A 2VASA 3P4PA 4KHPT 4JBWF 3EDVA 4ZI2D 4DV0T 3OYZA 2X67A 1FIOA 2XSBA 2E9XA 2YOEA 2Z6EA 2LM2A 1OEDC 1T8BA 5LBQB 1D1BA 4B3ST 1E2AA 5LJNA 4GKKT 2WWUA 1U5PA 1GQEA 3ZYLA 1KNZA 2LKGA 4PNIA 2BDEA 4HWIB 2BS4A 3OKQA 2LSKA 4U7IA 4UVCB 3CK6A 4QWNB 2V1DB 3SWHA 2LKHA 3CQGB 3N9MA 2W67A 2BKOA 3L39A 2HN1A 5AQOB 1YXRA 1N36T 4X1IE 2WCAA 4TNWA 4CI2B 4H9SE 1HR0T 3T1YT 3P4WA 3K1SA 2D2SA 4H63H 5FP3A 5FKYA 3PJAJ 2X68A 2ZM2A 2CLYC 4LMKA 1KEYA 4X66T 4JUYA 1MIWA 2RP4A 4TV9E 4HE8A 3PURA 1VOMA 4HWHA 2PJQA 2Q9QB 2HPJA 4P1NA 3QNUA 2AE9A 3J7Yq 3HL6A 4BJMA 5EZYE 4MLKA 2V7IA 4ILUA 5AQNB 3AE2A 3N9QA 2DWKA 2JPFA 2UXBT 5HYAA 1KF6A 2J4GA 4QXHB 4YY3T 2WDQA 3ZKRA 3QB5A 2CM0A 1WFDA 3N9NA 4YT0A 2KT9A 2LLYA 1HX8A 2D9DA 2WZHA 4EIWA 3NWIA 4IL4A 2HH7A 2MAWA 3RC3A 2QGSA 1JNRA 3C98B 5JDHA 3P8CD 3L09A 2IMLA 2JJ9A 3H37A 3VHLA 5ABFB 4YFSA 5J2UE 2K9AA 4LFBT 3Q2MA 3K3QC 5LCYA 4DBRA 2B76A 2N2NA 2XJ7A 2W4XA 4YTNA 4O8SA 1X79A 5LOVE 4JI6T 2XAGB 3MK7C 1YD8G 3RKOA 2K5BB 3A7MA 5C2TA 2ZM8A 2XY8B 5FYMA 2ODUA 5HEJA 5HXHA 3ZEFB 4ERRA 2NR4A 4ZXLA 4L5GA 2CWYA 4EB6E 2QYWA 2H7VC 2VKDA 5CB4E 3A5XA 1YQ4A 4L0RA 4TV8E 3ONJA 1E7PA 2VURA 2NTXA 1W0AA 3RRCA 3EHZA 2J47A 5FXZA 1FMWA 3UQ4A 4YJ3E 2L8KA 3RKGA 2XQ9A 2V7KA 4JLEA 2H7OA 5CFBA 4EZHA 2XQ7A 4OHFA 1NWMX 2XAFB 4TWDA 2QVAA 3PUSA 4PFPA 2W2UA 3K3NA 2CXLA 3FB2A 4O2AE 4DR3T 5HXSA 3PJAA 2OV9A 1J1JA 2IAKA 4B3RT 4HFEA 2DL1A 5KDMC 4DV7T 3N9PA 1ZP0A 5IUXA 3LK2B 5LGNB 2IDOB 3PUGA 1CHUA 3V5UA 1XNQT 3TLUA 3GN5A 5LP6E 4BJNA 3I0QA 2X51A 5LMUT 3QB5K 1YKHB 2CEAA 4LF7T 4QH4A 4EV6A 2BVMA 4HFDA 1UURA 2XAJB 2XAHB 1LVKA 4BA9A 4JI8T 2IIUA 5AQVB 3KFWX 3F57A 4E7SA 2E2AA 2BVLA 4EZ4A 5FL0A 5TAOA 4ZZCA 1SUMB 5E0OA 3AAEB 5L3EB 2CHNA 3OJAA 3PTRB 5LHHB 3KDSE 2XASB 4BAYB 4MHCA 3AAIA 1HFAA 2V26A 1H7CA 4H63V 5J0ZA 2LHRA 2LJLA 3LG7A 4QH5A 4G63A 1SA0E 4O4LE 1YKEB 2WWVA 1MMAA 2JQ9A 2MPKA 1AJ3A 2FJDA 3AXJB 5BMVE 4U7YA 3M3ZB 3PU8A 3KV4A 2R6GF 4J2CA 4WW0A 3RF1A 2YDRA 5JQGE 1KK7A 2WMOA 2B1EA 4PW8A 5JRCB 1HTJF 5DJQC 5FY7A 2CE7A 4U31A 4LF5T 1FJGT 4KHZF 2A2FX 3FXDB 2VB6A 4B6XA 3ZT7A 3ZJ2A 2V8SV 1UX5A 4I4TE 2WU2A 2MOZA 1T7SA 2XQ4A 5IHYA 3ZN1B 4IE7A 2A3DA 1UCUA 4HKAA 1D0ZA 4JI5T 2XM1A 2CRBA 2E9XB 2FUPA 3O1JA 3ZN0B 2ZLYA 3KVAA 2A9UA 3AE6A 2V5CA 2XQAA 5L3GB 4GYSA 4V1Av 1G8XA 2WMNA 3IBPA 3HA4A 4ASKA 1HS7A 4C91A 3RYIE 2V6YB 3FXEB 2KLQA 3GA8A 4K0UA 3CKDA 3NRXA 2I59A 3N2OA 3RI5A 2XTLA 2HHHT 5FXWA 2MYSA 1Z8UA 5JDGA 2Y6XA 3ETUA 5CA1E 4TWFA 3N5LA 2KWHA 4IGUA 2DLRA 1I6ZA 5L4HA 3ZSSA 4HWCA 3AE4A 4PJNA 4TUYE 3MA9A 4IDQA 3VU7H 3E08A 3ZC1A 4IT4A 3RH3A 2V7LA 2X9XA 1J5WA 4QH1A 4P0BA 3AEFA 3FZHB 4DR6T 5FVLA 2X66A 2OA5A 4AISA 4WBOA 4YHJA 2W63A 3U3IA 4WBNE 2W66A 2X9YA 2QRXA 2VL0A 2LSYA 3AE9A 1US7B 2MTQA 2A72A 2E5VA 3RQWA 3DP7A 4JI1T 4UF0A 1FMVA 5AQQB 2LHNA 2DNXA 3RPUA 3PUQA 2VQET 2KWIB 2V7MA 4TWHA 5H6RB 2ZM0A 4PK6A 2LSGA 1G73A 3I9WA 5ABEA 3QC9A 3DTOA 4IE6A 3ZYKA 4EEDA 4KUMB 4C90A 5F5WA 5FXXA 4NUVA 3WAJA 3Q5EA 4AQGA 2JQQA 3JCFA 3Q5XA 2ACXA 5C8YE 2WU5A 1U4QA 5L3DB 4DMVA 3BQLA 4IDNA 2D0UA 4JYAT 4AQFC 3NZPA 3W15B 4DR1T 4X1YE 3EABA 3IF8B 2GK9A 3NRYA 1EZ3A 2BG9A 3ZMTB 4X1KE 4ZI7E 2UXCT 1NAFA 3E0ZA 4FJOA 4GKJT 4ANJA 2VVNA 2FBWA 2UXDT 5AQTB 4JI3T 2KXPB 5LHIB 1S35A 1N32T 4AQYT 1ZHCA 4GK0E 5CGMA 2IW5B 3VRBA 1OEDA 2XAQB 4GOUA 4U74A 3O9XA 1CUNA 2WB5A 4JI4T 4IE5A 3V5SA 5JVDE 3CX8B 5LG4A 4HWDA 2LOPA 4A98A 4NUUA 1UX4A 3LBXB 1WYCA 3AEGA 4UV9B 5DQWA 3T1HT 3PV0F 3CWZB 4KI0F 4HEAA 2Q9QC 2C5KT 2UUBT 4EGWA 4H9QC 4O4HE 3ZJ1A 4OK0A 4JI2T 5FNVE 3PU3A 3JAEA 3JC6C 2Q9QD 2XZEA 2XHEB 4PFOA 3OTOT 4LF4T 3P7IA 3JC6D 3SFDA 2YKSA 3NKZA 4I43B 1QUUA 2LSIA 2KMFA 5HEUA 4DV5T 4HFBA 3TKLB 3R6NA 1SE7A 5HCMA 4CN1A 4UXNB 3N2KE 1Z0PA 2NW9A 4P0AA 3G06A 5HXEA 5LNKA 4QX7B 2H3RA 2IC6A 4F6RC 3UFEA 4HGAA 3UFGA 3UU8A 3SS1A 3FZLB 2ODVA 5HAXA 3M65A 2NTYA 2CBJA 4U3CA 3U78A 2H89A 5HEHA 4HFIA 4NIQA 1R8IA 5LGUB 1WYBA 3C50A 3NZQA 3UT5E 4ZI3C 3H3MA 1MMGA 5AQSB 4QXBB 1IBKT 2X0LB 4H9OC 5DABA 4DV3T 4ZI3D 1HNXT 3BK9A 4CI3B 5LYJE 2KNDA 3GMIA 5M4YA 5JH7E 4PJMA 1MMNA 1MMDA 3ZMZB 2WBLA 3AA6B 4IL9A 4PAGA 2YU1A 4NPPA 4DV2T 1FEWA 4EXTA 1Y64B 1MIVA 3AB3B 5ADXL 3EAMA 2LT3A 2JMHA 2W62A 5HXRA 3PUVF 1HCIA 5A1LA 2VQFT 4IREA 3HKCE 3RIUC 5LGTB 3UU3A 2EHOB 1XDOA 2XQ5A 4EYYR 2WAUA 5JREA 2CXFA 1WRDA 2CA5A 2E5LT 2SPCA 5JR9B 4GK5E 3ZT6A 3ZCIA 3ONXA 3ZT5A 3AVSA 3S4UA 4LFCT 2C5IT 2JMKA 1BR2A 3AA0B 4I50E 3HKBE 4Z91A 3CQXC 5C3JA 4CQIA 1ZKEA 4NXMT 5FMNA 1D0XA 3SOLA 4DR4T 4O4IE 1NEKA 2EHOC 3UTKA 5AQRB 3LFMA 3A8YC 2LE8A 1VCTA 4H9RC 2VKOA 4DMWA 3N9OA 3KBTA 2EHOD 4YSXA 3I9YA 2VKJA 3CIRA 5LBMA 5JR9C 4OX9T 1JNZA 1HNWT 4ZS2A 4Z8XA 3LDQB 4ISTA 3AE3A 2CPTA 4EAHA 5JDQA 2UUAT 2WDVA 4QKNA 2LSJA 1WR6A 3ABVA 3HKDE 3T8OA 2NP9A 3RIUA 4MALA 3DJBA 5JTGA 5HWXA 5JDMA 5F3JA 4UEMA 2YN6A 3CMLA 3F2EA 2YDQA 3N2GE 3IEEA 3P4RA 5J2TE 5HXCA 5LMNT 1DU2A 2M6BA 1HG5A 3ZPOA 3I0OA 1N33T 3MZKB 5EK3A 5LG3A 3AE8A 4P09A 4EEBA 3AE1A 4CN6A 3PDYA 4TX5A 2LOSA 2P9BA 2VKHA 4N78D 4MFRA 1UUSA 3JAFA 3CX7B 2FJBA 3ANWA 2FJEA 1ZEEA 4CXWA 3PUZF 3ETVA 3AAAB 4UF0B 3FZFB 2IC9A 5LXTE 2PFVA 2FJAA 4U33A 4HFHA 4H9NC 2J62A 5LA6E 4UIGA 3AVRA 2WZIA 3LK42 4Z90A 4LF6T 5AQFB 4QHOA 4KP3C 4ILCA 2CBIA 2I6HA 4PK4A 3X1DA 3RRWA 5JDFA 4DNDA 5LB7B 5L3BB 5J1GA 1ZV4X 4A97A 3RIFA 3PUYF 2BZBA 2LM9A 2E9XC 3AEEA 5ETWA 3RGLA 2WP9A 1J5ET 2UUCT 3ZLIA 3SFEA 1D0YA 2IUBA 3ONLC 2E9XD 4MBQA 4K0KT 2WSSV 2BBJA 3AXJA 4AKGA 5HEOA 4LF9T 4HN9A 2K24A 5BR8T 2VL8A 3B13A 1BR1A 3KV5A 4OYJA 3C51A 2DWGA 1SHZC 3QUJA 1OEDB 3RX6A 3TLWA 3IA3A 4Q25A 2WY2A 4UVBB 4IE4A 5JDLA 2ACZA 4CZZB 1V9DA 3PUWF 3LK3B 4ZZBA 2HPLA 3TLSA 2BG9E 2RA1A 4WZXA 3RYFE 2BS2A 3OVUA 4DR5T 4LMLA 2PBIA 2CCQA 4AKIA 2XPKA 4DV6T 2UXXB 4O2BE 3P4QA 3K3OA 2Y8DA 3LJCA 4B3MT 3EDUA 3QK6A 1KNPA 2YK0A 4GYRA 3E22E 1D1AA 3EI0A 2C0SA 1OEDE 1LVFA 2CLYB 2X9HA 5L3FB 4CN4A 1W0BA 5KXJA 4KX6A 3EVYA 4X20E 3O4XE 4YJ2E 3RLFF 1S94A 2V6YA 3RIAA 5L4EA 2YINA 3BQKA 2UXNB 3HR0A 2KINB 1XNRT 2W0GA 3N9LA 3VR9A 2LEHA 4KBMB 3UU6A 3FBLA 3KBUA 4PK5A 3AECA 2XUEA 5HWYA 4DO0A 3KVBA 1OXZA 3OPCA 2ZM6T 5L3CB 4LFAT 5KX5E 3RQUA 2WDRA 3Q9DA 2W00A 5FXVA 4DUZT 3VKHA 1M62A 5GONE 4ADZA 3IHRA 2OLTA 3B57A 4DR2T 1IJ6A 1IBLT 2M6IA 4ZOLE 5FY0A 2KZ7B 3I1AA 4H9PC 5LJMA 3ZC0A 5ABHA 2L9QA 4AQFA 2Y48B 3AE7A 2DCFA 3J9X1 1D1CA 3ESLA 3ZMUB 4A5XA 3PE0A 3TLVA 2XQ6A 1IZNB 2BKNA 2L3LA 2WM9A 5HEGA 2K3WA 5DQVA 3BQIA 3HI2A 4ZS3A 3ZMVB 4AKLA 3GN5B 2I0MA 3H3AA 5F8PA 3OYXA 3AA1B 3C4ZA 4EYUA 4XBFB 5L2LA 2M67A 1HF8A 4IDPA 2F4VT 3Q5DA 5EK4A 5AQLB 2D5UA 4HFVA 4JI7T 5AQHB 3FHNA 4CXYA 3MXZA 4YTMA 1UGOA 4XAXB 3VKGA 4YSZA 4IIJE 4ILAA 4JI0T 4UV8B 3C64A 2Q9QA 1W09A 1X9BA 2NOXA 4WYVA 4G2AA 4HTEA 3QOFA 2NWBA 4QX8B 2HN2A 3ZSTA 4DV1T 2BKPA 5H6QB 1XZYA 4UVAB 2WS3A 2JQHA 3UUNA 3EUHA 3F31A 1XMQT 2PG8A 3B5MA 4JEHB 4TNVA 5EK2A 3AEAA 4E7ZA 2RPAA 3LBXA 2PTFA 3L3PA 3MKDA 2V7JA 1MNEA 5FVKA 4NXNT 1LRZA 4HFCA 3AE5A 4B3TT 5LHGB 2J1DG 2XQYA 4DIDB 2CXDA 4LF8T 1O3XA 2NW8A 4OFZA 5ABFA 4FI5A 2K48A 4TZ4C 5AQPB 2AXDS 2XM2A 3O1IA 1UK5A 2DI4A 5AQMB 4CXXA 3ZCJA 4L9IA 2XQ3A 5HCJA 2XQ8A 1XWMA 3ANWB 4F8HA 2UU9T 3KV9A 1HX1B 4I55E 2D0TA 4OYKA 2JQKA 4DV4T 3P4SA 4YXDA 4TN7B 4O4JE 4JV5T 3UULA 4QXCB 5FY1A 2JIWA 2CWOA 4UR9A 3SRZA 2VVSA 2IHR1 1OWAA 5AQJB 1YQ3A 2JRKA 3NVOA 2X0HA 4LMJA 3ZYMA 3P50A 2C5JA 2XSAA 3AA7B 4X5TA 1QSDA 1MIYA 2VWAA 1VRBA 5L47A 2X0YA 1IAPA 2X9WA 2WQYA 4YTPA 5KMGP 2H88A 5JDNA 4DBQA 4GIWA 1WLXA 3VR8A 4CI1B 1XDPA 3AEBA 1IBMT 2G0UA 1QLBA 2V6XA 3UUBA 4IDZA 2N9DA 3PUXF 3JADA 4DVDA 3RC8A 4X62T 4COFA 3C4WA 2ZMAA 3MJXA 3UU5A 2YU2A 3PUAA 2EHOA 5AQIB 4EOZB 3CVRA 1VCSA 3KV6A 2CHOA 4PJJA 4ZEYA 5FL1A 4UELA 3RYCE 4PJLA 3UU4A 2E8IA 4YHHT 1WCRA 3UQ7A 5JR9A 3KINB 3RYHE 1IJ5A 4AIUA 3L8RA 2KSRA 5IWAT 4AKRB 5CA0E 3GWHA 2LRKA 2MBGA 5AQGB 3WAKA 1Y01A 4X64T 3LSVA 2BBHA 3O1HA 4DR7T 1NENA 4AI6A 1T98A 2VK9A 4M1PA 1BR0A 1T72A 3Q5WA 3FZMB 3RHWA 4HWFA 5IYZE 5ABGA 1B7TA 2LRLA 4YLHA 4AKHA 4YSYA 2DHRA 2NW7A 2YEVC 3K8PC 1M7KA 4U2YA 1N34T 1L0VA 3UUXB 4KMCA 3CQCB 1MNDA 1KFYA 1BR4A 3UUMA 4A56A 2BG9B 1HNZT 5CJ5A 4U2ZA 3D0TA 3OBVE 4IDOA 3AEDA 3FZKB 1E1HB 1LKXA 3FBZA 3CPZA 3NBXX 2W61A 2QA7A 2ES0A 5AQUB 1W9RA 5AQKB 3HKEE 4IHJE 2YDSA 4XZCA 4ISSA 5AFUL 4IE0A 4X65T 4JEUB 2V5DA
chains in the Genus database with same CATH topology
3C4XA 4ZHQE 3ZMZB 2WBLA 3AA6B 3B57A 1IJ6A 4PAGA 2YU1A 3ZMSB 3KV4A 4ZOLE 5FY0A 1HG2A 4U72A 2KZ7B 5JRCA 4J2CA 3I1AA 3CX6B 3MACA 4WW0A 4WNKA 4AXPA 1YW0A 3R84B 4H9PC 5JQGE 5LJMA 3ZC0A 1FEWA 4EXTA 2CMRA 1Y64B 2N1GA 1KK7A 1MIVA 3AB3B 2WMOA 5ADXL 2B1EA 2LT3A 4PW8A 2JMHA 3WI3A 2W62A 5JRCB 1HTJF 4ZI2C 5HXRA 2L9QA 5DJQC 5FY7A 2CE7A 4AQFA 1HCIA 5A1LA 2VASA 2Y48B 2DCFA 2A2FX 1D1CA 3J9X1 3FXDB 3ESLA 2VB6A 3HKCE 3ZMUB 3EDVA 4B6XA 4ZI2D 5LGTB 2EHOB 3ZJ2A 3OYZA 3PE0A 2X67A 1IZNB 4EYYR 1FIOA 1UX5A 2WAUA 2L3LA 2WM9A 5JREA 4I4TE 2CXFA 2MOZA 5DQVA 2E9XA 3BQIA 1WRDA 3HI2A 4ZS3A 2Z6EA 5IHYA 3ZMVB 4AKLA 2CA5A 3ZN1B 5LBQB 3GN5B 1D1BA 2SPCA 5JR9B 4IE7A 4GK5E 5LJNA 2WWUA 1U5PA 2A3DA 1UCUA 4HKAA 1D0ZA 3ONXA 3ZCIA 3ZYLA 1KNZA 2E9XB 3AVSA 4PNIA 3S4UA 2BDEA 3OKQA 2C5IT 3H3AA 2JMKA 1BR2A 2LSKA 3AA0B 5F8PA 3OYXA 4I50E 3AA1B 3C4ZA 3HKBE 3O1JA 3ZN0B 4UVCB 4EYUA 4XBFB 2ZLYA 3KVAA 4QWNB 2V1DB 3CQXC 5L2LA 2M67A 1HF8A 4CQIA 1ZKEA 3SWHA 3CQGB 5L3GB 3N9MA 4GYSA 4V1Av 1G8XA 2WMNA 5FMNA 3IBPA 1D0XA 3SOLA 3HA4A 4O4IE 4ASKA 1HS7A 2EHOC 5EK4A 4X1IE 3UTKA 4C91A 2D5UA 4HFVA 3RYIE 3FXEB 3LFMA 2KLQA 2LE8A 3GA8A 4K0UA 4H9RC 3FHNA 2VKOA 3CKDA 3NRXA 4H9SE 4CI2B 4DMWA 3N9OA 2I59A 4CXYA 3N2OA 2D2SA 3KBTA 3MXZA 4H63H 2XTLA 2EHOD 5FP3A 3I9YA 5FXWA 2VKJA 5LBMA 2X68A 2MYSA 4XAXB 2ZM2A 5JDGA 3VKGA 4IIJE 5JR9C 2CLYC 2Y6XA 3ETUA 5CA1E 4UV8B 4ZS2A 3N5LA 2KWHA 3C64A 4Z8XA 4ISTA 2Q9QA 2NOXA 4IGUA 2DLRA 4JUYA 1MIWA 4G2AA 2RP4A 4PJNA 4TUYE 4TV9E 4EAHA 5JDQA 4HE8A 3MA9A 4QKNA 2LSJA 4HTEA 3PURA 1VOMA 1WR6A 2NWBA 3HKDE 4QX8B 3T8OA 2NP9A 3VU7H 2PJQA 2Q9QB 3E08A 4MALA 3DJBA 3ZC1A 5H6QB 3RH3A 5HWXA 5JDMA 2V7LA 4UVAB 2HPJA 2X9XA 5F3JA 4P0BA 4UEMA 3CMLA 3J7Yq 3UUNA 3EUHA 3F2EA 3F31A 3N2GE 3HL6A 2X66A 2OA5A 4BJMA 4WBOA 3IEEA 4YHJA 2PG8A 2W63A 5EZYE 3U3IA 4JEHB 5EK2A 5J2TE 5HXCA 4MLKA 2V7IA 4ILUA 4E7ZA 3LBXA 3N9QA 1HG5A 3ZPOA 4WBNE 2DWKA 2JPFA 3I0OA 2X9YA 2LSYA 3L3PA 5HYAA 3MKDA 2V7JA 1MNEA 1US7B 2MTQA 4QXHB 3MZKB 5EK3A 1LRZA 4P09A 2A72A 2CM0A 3PDYA 3N9NA 3DP7A 5LHGB 2J1DG 4UF0A 2KT9A 1FMVA 2LOSA 2LHNA 2VKHA 2P9BA 2XQYA 1HX8A 2DNXA 4TX5A 4N78D 4EIWA 3RPUA 3PUQA 2CXDA 2HH7A 4MFRA 1O3XA 2NW8A 4OFZA 2KWIB 2V7MA 3CX7B 3RC3A 3ANWA 4FI5A 2K48A 2QGSA 4TZ4C 1ZEEA 4CXWA 3C98B 5JDHA 5H6RB 3P8CD 3O1IA 3ETVA 3AAAB 2ZM0A 4UF0B 3L09A 4PK6A 2DI4A 2LSGA 1G73A 2IC9A 4CXXA 5LXTE 2JJ9A 4L9IA 3ZCJA 3I9WA 2PFVA 3QC9A 3H37A 3DTOA 3VHLA 4YFSA 5J2UE 3ANWB 2K9AA 4IE6A 3ZYKA 4KUMB 3Q2MA 4H9NC 4C90A 3KV9A 3K3QC 4UIGA 5LA6E 4I55E 2D0TA 4OYKA 5FXXA 3AVRA 4NUVA 5LCYA 4DBRA 3WAJA 3LK42 4AQGA 2N2NA 2JQQA 3Q5XA 4TN7B 2ACXA 4O8SA 1X79A 5LOVE 4O4JE 4QHOA 3UULA 2XAGB 3MK7C 4KP3C 4QXCB 5C8YE 1YD8G 3RKOA 1U4QA 5L3DB 5FY1A 2K5BB 3BQLA 4DMVA 2D0UA 4PK4A 4AQFC 2CWOA 2ZM8A 3NZPA 3RRWA 5JDFA 5FYMA 3W15B 3SRZA 4DNDA 2ODUA 4X1YE 5HXHA 1OWAA 3IF8B 5L3BB 5J1GA 1ZV4X 2GK9A 3ZEFB 3NRYA 4ERRA 1EZ3A 4L5GA 2CWYA 2JRKA 4EB6E 3ZMTB 4X1KE 3ZYMA 2BZBA 4ZI7E 2LM9A 2E9XC 5ETWA 2C5JA 2H7VC 2VKDA 3AA7B 1NAFA 1QSDA 1MIYA 3ZLIA 1D0YA 3E0ZA 5CB4E 2VWAA 4FJOA 1VRBA 3A5XA 2E9XD 4MBQA 4ANJA 2WSSV 4L0RA 4TV8E 4AKGA 2NTXA 2KXPB 3RRCA 1IAPA 5LHIB 2X9WA 5FXZA 1S35A 1FMWA 4YJ3E 5KMGP 4HN9A 5JDNA 4DBQA 2K24A 2L8KA 4GIWA 1WLXA 2VL8A 1ZHCA 1BR1A 3B13A 4GK0E 2IW5B 2V7KA 4JLEA 4CI1B 2H7OA 2XAQB 4GOUA 4U74A 3KV5A 2G0UA 4EZHA 4OHFA 1NWMX 3O9XA 1CUNA 2XAFB 4IDZA 4OYJA 3C51A 2N9DA 4IE5A 3V5SA 2DWGA 1SHZC 5JVDE 3QUJA 3CX8B 4DVDA 5LG4A 3PUSA 3RX6A 4PFPA 3K3NA 2CXLA 3FB2A 2LOPA 4NUUA 1UX4A 3RC8A 4O2AE 4UVBB 4IE4A 5HXSA 3LBXB 5JDLA 3C4WA 1WYCA 4UV9B 4CZZB 1V9DA 2ZMAA 3LK3B 2IAKA 2HPLA 3MJXA 5DQWA 5KDMC 3CWZB 4HEAA 2Q9QC 2RA1A 2C5KT 2YU2A 3PUAA 2EHOA 3N9PA 4H9QC 4O4HE 4EOZB 3ZJ1A 3CVRA 3LK2B 4OK0A 3RYFE 3KV6A 5FNVE 3PU3A 5LGNB 3JC6C 2PBIA 3PUGA 2CCQA 4PJJA 2Q9QD 4AKIA 4UELA 3RYCE 3V5UA 2XHEB 4PFOA 4PJLA 2UXXB 2E8IA 3GN5A 4O2BE 5JR9A 3K3OA 3P7IA 5LP6E 2Y8DA 3LJCA 3JC6D 3KINB 3EDUA 4BJNA 3QK6A 3RYHE 3I0QA 1IJ5A 4I43B 2X51A 1QUUA 2YK0A 1YKHB 2LSIA 4GYRA 2KMFA 2CEAA 3E22E 1D1AA 2BVMA 2C0SA 4AKRB 1LVFA 2CLYB 5CA0E 2XAJB 3GWHA 3TKLB 3R6NA 2MBGA 2X9HA 2XAHB 3WAKA 5L3FB 3O1HA 1LVKA 4BA9A 4AI6A 1T98A 4UXNB 3N2KE 3EVYA 2VK9A 4M1PA 3O4XE 4X20E 4YJ2E 1BR0A 1Z0PA 2NW9A 3KFWX 3F57A 4P0AA 4E7SA 3Q5WA 5HXEA 1S94A 5IYZE 5LNKA 1B7TA 4QX7B 2BVLA 4YLHA 2H3RA 2IC6A 4F6RC 4EZ4A 4AKHA 2YINA 5TAOA 2DHRA 2NW7A 2UXNB 3BQKA 4HGAA 3UFEA 3SS1A 3HR0A 5E0OA 2ODVA 2KINB 2YEVC 3K8PC 5HAXA 3AAEB 5L3EB 2W0GA 3N9LA 2LEHA 3M65A 3OJAA 2NTYA 4KBMB 3UUXB 3PTRB 3FBLA 4KMCA 5LHHB 3KBUA 3KDSE 4PK5A 3U78A 2XASB 4BAYB 4MHCA 3CQCB 2XUEA 1MNDA 3AAIA 1HFAA 5HWYA 2V26A 1BR4A 1H7CA 2LHRA 3KVBA 4H63V 3UUMA 4A56A 2LJLA 4DO0A 3LG7A 1OXZA 5LGUB 1WYBA 3C50A 3NZQA 3UT5E 4G63A 3D0TA 3OBVE 4ZI3C 1SA0E 5L3CB 5KX5E 1MMGA 4O4LE 1E1HB 4QXBB 1LKXA 2X0LB 4H9OC 1YKEB 5DABA 3FBZA 3CPZA 1MMAA 3NBXX 1AJ3A 4ZI3D 2W61A 3Q9DA 2QA7A 3BK9A 2ES0A 2W00A 5FXVA 4CI3B 3VKHA 5LYJE 2KNDA 5GONE 3GMIA 3HKEE 4IHJE 4ADZA 5M4YA 5BMVE 5JH7E 4PJMA 4XZCA 4ISSA 5AFUL 4IE0A 1MMNA 3IHRA 4JEUB 3PU8A 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2YIN A;  3B13 A;  2WMN A;  2WM9 A;  3VHL A; 
#chains in the Genus database with same CATH topology
 1KNR A;  4ILB A;  3C4X A;  4ZHQ E;  1I94 T;  3ZMS B;  1HG2 A;  1WR0 A;  4U72 A;  5JRC A;  3CX6 B;  3MAC A;  4WNK A;  4AXP A;  1YW0 A;  3R84 B;  1ZOY A;  2BG9 C;  2CMR A;  2N1G A;  1XMO T;  4I0U A;  4DUY T;  3VRA A;  3WI3 A;  4ZI2 C;  3TLT A;  2BS3 A;  2VAS A;  3P4P A;  4KHP T;  4JBW F;  3EDV A;  4ZI2 D;  4DV0 T;  3OYZ A;  2X67 A;  1FIO A;  2XSB A;  2E9X A;  2YOE A;  2Z6E A;  2LM2 A;  1OED C;  1T8B A;  5LBQ B;  1D1B A;  4B3S T;  1E2A A;  5LJN A;  4GKK T;  2WWU A;  1U5P A;  1GQE A;  3ZYL A;  1KNZ A;  2LKG A;  4PNI A;  2BDE A;  4HWI B;  2BS4 A;  3OKQ A;  2LSK A;  4U7I A;  4UVC B;  3CK6 A;  4QWN B;  2V1D B;  3SWH A;  2LKH A;  3CQG B;  3N9M A;  2W67 A;  2BKO A;  3L39 A;  2HN1 A;  5AQO B;  1YXR A;  1N36 T;  4X1I E;  2WCA A;  4TNW A;  4CI2 B;  4H9S E;  1HR0 T;  3T1Y T;  3P4W A;  3K1S A;  2D2S A;  4H63 H;  5FP3 A;  5FKY A;  3PJA J;  2X68 A;  2ZM2 A;  2CLY C;  4LMK A;  1KEY A;  4X66 T;  4JUY A;  1MIW A;  2RP4 A;  4TV9 E;  4HE8 A;  3PUR A;  1VOM A;  4HWH A;  2PJQ A;  2Q9Q B;  2HPJ A;  4P1N A;  3QNU A;  2AE9 A;  3J7Y q;  3HL6 A;  4BJM A;  5EZY E;  4MLK A;  2V7I A;  4ILU A;  5AQN B;  3AE2 A;  3N9Q A;  2DWK A;  2JPF A;  2UXB T;  5HYA A;  1KF6 A;  2J4G A;  4QXH B;  4YY3 T;  2WDQ A;  3ZKR A;  3QB5 A;  2CM0 A;  1WFD A;  3N9N A;  4YT0 A;  2KT9 A;  2LLY A;  1HX8 A;  2D9D A;  2WZH A;  4EIW A;  3NWI A;  4IL4 A;  2HH7 A;  2MAW A;  3RC3 A;  2QGS A;  1JNR A;  3C98 B;  5JDH A;  3P8C D;  3L09 A;  2IML A;  2JJ9 A;  3H37 A;  3VHL A;  5ABF B;  4YFS A;  5J2U E;  2K9A A;  4LFB T;  3Q2M A;  3K3Q C;  5LCY A;  4DBR A;  2B76 A;  2N2N A;  2XJ7 A;  2W4X A;  4YTN A;  4O8S A;  1X79 A;  5LOV E;  4JI6 T;  2XAG B;  3MK7 C;  1YD8 G;  3RKO A;  2K5B B;  3A7M A;  5C2T A;  2ZM8 A;  2XY8 B;  5FYM A;  2ODU A;  5HEJ A;  5HXH A;  3ZEF B;  4ERR A;  2NR4 A;  4ZXL A;  4L5G A;  2CWY A;  4EB6 E;  2QYW A;  2H7V C;  2VKD A;  5CB4 E;  3A5X A;  1YQ4 A;  4L0R A;  4TV8 E;  3ONJ A;  1E7P A;  2VUR A;  2NTX A;  1W0A A;  3RRC A;  3EHZ A;  2J47 A;  5FXZ A;  1FMW A;  3UQ4 A;  4YJ3 E;  2L8K A;  3RKG A;  2XQ9 A;  2V7K A;  4JLE A;  2H7O A;  5CFB A;  4EZH A;  2XQ7 A;  4OHF A;  1NWM X;  2XAF B;  4TWD A;  2QVA A;  3PUS A;  4PFP A;  2W2U A;  3K3N A;  2CXL A;  3FB2 A;  4O2A E;  4DR3 T;  5HXS A;  3PJA A;  2OV9 A;  1J1J A;  2IAK A;  4B3R T;  4HFE A;  2DL1 A;  5KDM C;  4DV7 T;  3N9P A;  1ZP0 A;  5IUX A;  3LK2 B;  5LGN B;  2IDO B;  3PUG A;  1CHU A;  3V5U A;  1XNQ T;  3TLU A;  3GN5 A;  5LP6 E;  4BJN A;  3I0Q A;  2X51 A;  5LMU T;  3QB5 K;  1YKH B;  2CEA A;  4LF7 T;  4QH4 A;  4EV6 A;  2BVM A;  4HFD A;  1UUR A;  2XAJ B;  2XAH B;  1LVK A;  4BA9 A;  4JI8 T;  2IIU A;  5AQV B;  3KFW X;  3F57 A;  4E7S A;  2E2A A;  2BVL A;  4EZ4 A;  5FL0 A;  5TAO A;  4ZZC A;  1SUM B;  5E0O A;  3AAE B;  5L3E B;  2CHN A;  3OJA A;  3PTR B;  5LHH B;  3KDS E;  2XAS B;  4BAY B;  4MHC A;  3AAI A;  1HFA A;  2V26 A;  1H7C A;  4H63 V;  5J0Z A;  2LHR A;  2LJL A;  3LG7 A;  4QH5 A;  4G63 A;  1SA0 E;  4O4L E;  1YKE B;  2WWV A;  1MMA A;  2JQ9 A;  2MPK A;  1AJ3 A;  2FJD A;  3AXJ B;  5BMV E;  4U7Y A;  3M3Z B;  3PU8 A;  3KV4 A;  2R6G F;  4J2C A;  4WW0 A;  3RF1 A;  2YDR A;  5JQG E;  1KK7 A;  2WMO A;  2B1E A;  4PW8 A;  5JRC B;  1HTJ F;  5DJQ C;  5FY7 A;  2CE7 A;  4U31 A;  4LF5 T;  1FJG T;  4KHZ F;  2A2F X;  3FXD B;  2VB6 A;  4B6X A;  3ZT7 A;  3ZJ2 A;  2V8S V;  1UX5 A;  4I4T E;  2WU2 A;  2MOZ A;  1T7S A;  2XQ4 A;  5IHY A;  3ZN1 B;  4IE7 A;  2A3D A;  1UCU A;  4HKA A;  1D0Z A;  4JI5 T;  2XM1 A;  2CRB A;  2E9X B;  2FUP A;  3O1J A;  3ZN0 B;  2ZLY A;  3KVA A;  2A9U A;  3AE6 A;  2V5C A;  2XQA A;  5L3G B;  4GYS A;  4V1A v;  1G8X A;  2WMN A;  3IBP A;  3HA4 A;  4ASK A;  1HS7 A;  4C91 A;  3RYI E;  2V6Y B;  3FXE B;  2KLQ A;  3GA8 A;  4K0U A;  3CKD A;  3NRX A;  2I59 A;  3N2O A;  3RI5 A;  2XTL A;  2HHH T;  5FXW A;  2MYS A;  1Z8U A;  5JDG A;  2Y6X A;  3ETU A;  5CA1 E;  4TWF A;  3N5L A;  2KWH A;  4IGU A;  2DLR A;  1I6Z A;  5L4H A;  3ZSS A;  4HWC A;  3AE4 A;  4PJN A;  4TUY E;  3MA9 A;  4IDQ A;  3VU7 H;  3E08 A;  3ZC1 A;  4IT4 A;  3RH3 A;  2V7L A;  2X9X A;  1J5W A;  4QH1 A;  4P0B A;  3AEF A;  3FZH B;  4DR6 T;  5FVL A;  2X66 A;  2OA5 A;  4AIS A;  4WBO A;  4YHJ A;  2W63 A;  3U3I A;  4WBN E;  2W66 A;  2X9Y A;  2QRX A;  2VL0 A;  2LSY A;  3AE9 A;  1US7 B;  2MTQ A;  2A72 A;  2E5V A;  3RQW A;  3DP7 A;  4JI1 T;  4UF0 A;  1FMV A;  5AQQ B;  2LHN A;  2DNX A;  3RPU A;  3PUQ A;  2VQE T;  2KWI B;  2V7M A;  4TWH A;  5H6R B;  2ZM0 A;  4PK6 A;  2LSG A;  1G73 A;  3I9W A;  5ABE A;  3QC9 A;  3DTO A;  4IE6 A;  3ZYK A;  4EED A;  4KUM B;  4C90 A;  5F5W A;  5FXX A;  4NUV A;  3WAJ A;  3Q5E A;  4AQG A;  2JQQ A;  3JCF A;  3Q5X A;  2ACX A;  5C8Y E;  2WU5 A;  1U4Q A;  5L3D B;  4DMV A;  3BQL A;  4IDN A;  2D0U A;  4JYA T;  4AQF C;  3NZP A;  3W15 B;  4DR1 T;  4X1Y E;  3EAB A;  3IF8 B;  2GK9 A;  3NRY A;  1EZ3 A;  2BG9 A;  3ZMT B;  4X1K E;  4ZI7 E;  2UXC T;  1NAF A;  3E0Z A;  4FJO A;  4GKJ T;  4ANJ A;  2VVN A;  2FBW A;  2UXD T;  5AQT B;  4JI3 T;  2KXP B;  5LHI B;  1S35 A;  1N32 T;  4AQY T;  1ZHC A;  4GK0 E;  5CGM A;  2IW5 B;  3VRB A;  1OED A;  2XAQ B;  4GOU A;  4U74 A;  3O9X A;  1CUN A;  2WB5 A;  4JI4 T;  4IE5 A;  3V5S A;  5JVD E;  3CX8 B;  5LG4 A;  4HWD A;  2LOP A;  4A98 A;  4NUU A;  1UX4 A;  3LBX B;  1WYC A;  3AEG A;  4UV9 B;  5DQW A;  3T1H T;  3PV0 F;  3CWZ B;  4KI0 F;  4HEA A;  2Q9Q C;  2C5K T;  2UUB T;  4EGW A;  4H9Q C;  4O4H E;  3ZJ1 A;  4OK0 A;  4JI2 T;  5FNV E;  3PU3 A;  3JAE A;  3JC6 C;  2Q9Q D;  2XZE A;  2XHE B;  4PFO A;  3OTO T;  4LF4 T;  3P7I A;  3JC6 D;  3SFD A;  2YKS A;  3NKZ A;  4I43 B;  1QUU A;  2LSI A;  2KMF A;  5HEU A;  4DV5 T;  4HFB A;  3TKL B;  3R6N A;  1SE7 A;  5HCM A;  4CN1 A;  4UXN B;  3N2K E;  1Z0P A;  2NW9 A;  4P0A A;  3G06 A;  5HXE A;  5LNK A;  4QX7 B;  2H3R A;  2IC6 A;  4F6R C;  3UFE A;  4HGA A;  3UFG A;  3UU8 A;  3SS1 A;  3FZL B;  2ODV A;  5HAX A;  3M65 A;  2NTY A;  2CBJ A;  4U3C A;  3U78 A;  2H89 A;  5HEH A;  4HFI A;  4NIQ A;  1R8I A;  5LGU B;  1WYB A;  3C50 A;  3NZQ A;  3UT5 E;  4ZI3 C;  3H3M A;  1MMG A;  5AQS B;  4QXB B;  1IBK T;  2X0L B;  4H9O C;  5DAB A;  4DV3 T;  4ZI3 D;  1HNX T;  3BK9 A;  4CI3 B;  5LYJ E;  2KND A;  3GMI A;  5M4Y A;  5JH7 E;  4PJM A;  1MMN A;  1MMD A;  3ZMZ B;  2WBL A;  3AA6 B;  4IL9 A;  4PAG A;  2YU1 A;  4NPP A;  4DV2 T;  1FEW A;  4EXT A;  1Y64 B;  1MIV A;  3AB3 B;  5ADX L;  3EAM A;  2LT3 A;  2JMH A;  2W62 A;  5HXR A;  3PUV F;  1HCI A;  5A1L A;  2VQF T;  4IRE A;  3HKC E;  3RIU C;  5LGT B;  3UU3 A;  2EHO B;  1XDO A;  2XQ5 A;  4EYY R;  2WAU A;  5JRE A;  2CXF A;  1WRD A;  2CA5 A;  2E5L T;  2SPC A;  5JR9 B;  4GK5 E;  3ZT6 A;  3ZCI A;  3ONX A;  3ZT5 A;  3AVS A;  3S4U A;  4LFC T;  2C5I T;  2JMK A;  1BR2 A;  3AA0 B;  4I50 E;  3HKB E;  4Z91 A;  3CQX C;  5C3J A;  4CQI A;  1ZKE A;  4NXM T;  5FMN A;  1D0X A;  3SOL A;  4DR4 T;  4O4I E;  1NEK A;  2EHO C;  3UTK A;  5AQR B;  3LFM A;  3A8Y C;  2LE8 A;  1VCT A;  4H9R C;  2VKO A;  4DMW A;  3N9O A;  3KBT A;  2EHO D;  4YSX A;  3I9Y A;  2VKJ A;  3CIR A;  5LBM A;  5JR9 C;  4OX9 T;  1JNZ A;  1HNW T;  4ZS2 A;  4Z8X A;  3LDQ B;  4IST A;  3AE3 A;  2CPT A;  4EAH A;  5JDQ A;  2UUA T;  2WDV A;  4QKN A;  2LSJ A;  1WR6 A;  3ABV A;  3HKD E;  3T8O A;  2NP9 A;  3RIU A;  4MAL A;  3DJB A;  5JTG A;  5HWX A;  5JDM A;  5F3J A;  4UEM A;  2YN6 A;  3CML A;  3F2E A;  2YDQ A;  3N2G E;  3IEE A;  3P4R A;  5J2T E;  5HXC A;  5LMN T;  1DU2 A;  2M6B A;  1HG5 A;  3ZPO A;  3I0O A;  1N33 T;  3MZK B;  5EK3 A;  5LG3 A;  3AE8 A;  4P09 A;  4EEB A;  3AE1 A;  4CN6 A;  3PDY A;  4TX5 A;  2LOS A;  2P9B A;  2VKH A;  4N78 D;  4MFR A;  1UUS A;  3JAF A;  3CX7 B;  2FJB A;  3ANW A;  2FJE A;  1ZEE A;  4CXW A;  3PUZ F;  3ETV A;  3AAA B;  4UF0 B;  3FZF B;  2IC9 A;  5LXT E;  2PFV A;  2FJA A;  4U33 A;  4HFH A;  4H9N C;  2J62 A;  5LA6 E;  4UIG A;  3AVR A;  2WZI A;  3LK4 2;  4Z90 A;  4LF6 T;  5AQF B;  4QHO A;  4KP3 C;  4ILC A;  2CBI A;  2I6H A;  4PK4 A;  3X1D A;  3RRW A;  5JDF A;  4DND A;  5LB7 B;  5L3B B;  5J1G A;  1ZV4 X;  4A97 A;  3RIF A;  3PUY F;  2BZB A;  2LM9 A;  2E9X C;  3AEE A;  5ETW A;  3RGL A;  2WP9 A;  1J5E T;  2UUC T;  3ZLI A;  3SFE A;  1D0Y A;  2IUB A;  3ONL C;  2E9X D;  4MBQ A;  4K0K T;  2WSS V;  2BBJ A;  3AXJ A;  4AKG A;  5HEO A;  4LF9 T;  4HN9 A;  2K24 A;  5BR8 T;  2VL8 A;  3B13 A;  1BR1 A;  3KV5 A;  4OYJ A;  3C51 A;  2DWG A;  1SHZ C;  3QUJ A;  1OED B;  3RX6 A;  3TLW A;  3IA3 A;  4Q25 A;  2WY2 A;  4UVB B;  4IE4 A;  5JDL A;  2ACZ A;  4CZZ B;  1V9D A;  3PUW F;  3LK3 B;  4ZZB A;  2HPL A;  3TLS A;  2BG9 E;  2RA1 A;  4WZX A;  3RYF E;  2BS2 A;  3OVU A;  4DR5 T;  4LML A;  2PBI A;  2CCQ A;  4AKI A;  2XPK A;  4DV6 T;  2UXX B;  4O2B E;  3P4Q A;  3K3O A;  2Y8D A;  3LJC A;  4B3M T;  3EDU A;  3QK6 A;  1KNP A;  2YK0 A;  4GYR A;  3E22 E;  1D1A A;  3EI0 A;  2C0S A;  1OED E;  1LVF A;  2CLY B;  2X9H A;  5L3F B;  4CN4 A;  1W0B A;  5KXJ A;  4KX6 A;  3EVY A;  4X20 E;  3O4X E;  4YJ2 E;  3RLF F;  1S94 A;  2V6Y A;  3RIA A;  5L4E A;  2YIN A;  3BQK A;  2UXN B;  3HR0 A;  2KIN B;  1XNR T;  2W0G A;  3N9L A;  3VR9 A;  2LEH A;  4KBM B;  3UU6 A;  3FBL A;  3KBU A;  4PK5 A;  3AEC A;  2XUE A;  5HWY A;  4DO0 A;  3KVB A;  1OXZ A;  3OPC A;  2ZM6 T;  5L3C B;  4LFA T;  5KX5 E;  3RQU A;  2WDR A;  3Q9D A;  2W00 A;  5FXV A;  4DUZ T;  3VKH A;  1M62 A;  5GON E;  4ADZ A;  3IHR A;  2OLT A;  3B57 A;  4DR2 T;  1IJ6 A;  1IBL T;  2M6I A;  4ZOL E;  5FY0 A;  2KZ7 B;  3I1A A;  4H9P C;  5LJM A;  3ZC0 A;  5ABH A;  2L9Q A;  4AQF A;  2Y48 B;  3AE7 A;  2DCF A;  3J9X 1;  1D1C A;  3ESL A;  3ZMU B;  4A5X A;  3PE0 A;  3TLV A;  2XQ6 A;  1IZN B;  2BKN A;  2L3L A;  2WM9 A;  5HEG A;  2K3W A;  5DQV A;  3BQI A;  3HI2 A;  4ZS3 A;  3ZMV B;  4AKL A;  3GN5 B;  2I0M A;  3H3A A;  5F8P A;  3OYX A;  3AA1 B;  3C4Z A;  4EYU A;  4XBF B;  5L2L A;  2M67 A;  1HF8 A;  4IDP A;  2F4V T;  3Q5D A;  5EK4 A;  5AQL B;  2D5U A;  4HFV A;  4JI7 T;  5AQH B;  3FHN A;  4CXY A;  3MXZ A;  4YTM A;  1UGO A;  4XAX B;  3VKG A;  4YSZ A;  4IIJ E;  4ILA A;  4JI0 T;  4UV8 B;  3C64 A;  2Q9Q A;  1W09 A;  1X9B A;  2NOX A;  4WYV A;  4G2A A;  4HTE A;  3QOF A;  2NWB A;  4QX8 B;  2HN2 A;  3ZST A;  4DV1 T;  2BKP A;  5H6Q B;  1XZY A;  4UVA B;  2WS3 A;  2JQH A;  3UUN A;  3EUH A;  3F31 A;  1XMQ T;  2PG8 A;  3B5M A;  4JEH B;  4TNV A;  5EK2 A;  3AEA A;  4E7Z A;  2RPA A;  3LBX A;  2PTF A;  3L3P A;  3MKD A;  2V7J A;  1MNE A;  5FVK A;  4NXN T;  1LRZ A;  4HFC A;  3AE5 A;  4B3T T;  5LHG B;  2J1D G;  2XQY A;  4DID B;  2CXD A;  4LF8 T;  1O3X A;  2NW8 A;  4OFZ A;  5ABF A;  4FI5 A;  2K48 A;  4TZ4 C;  5AQP B;  2AXD S;  2XM2 A;  3O1I A;  1UK5 A;  2DI4 A;  5AQM B;  4CXX A;  3ZCJ A;  4L9I A;  2XQ3 A;  5HCJ A;  2XQ8 A;  1XWM A;  3ANW B;  4F8H A;  2UU9 T;  3KV9 A;  1HX1 B;  4I55 E;  2D0T A;  4OYK A;  2JQK A;  4DV4 T;  3P4S A;  4YXD A;  4TN7 B;  4O4J E;  4JV5 T;  3UUL A;  4QXC B;  5FY1 A;  2JIW A;  2CWO A;  4UR9 A;  3SRZ A;  2VVS A;  2IHR 1;  1OWA A;  5AQJ B;  1YQ3 A;  2JRK A;  3NVO A;  2X0H A;  4LMJ A;  3ZYM A;  3P50 A;  2C5J A;  2XSA A;  3AA7 B;  4X5T A;  1QSD A;  1MIY A;  2VWA A;  1VRB A;  5L47 A;  2X0Y A;  1IAP A;  2X9W A;  2WQY A;  4YTP A;  5KMG P;  2H88 A;  5JDN A;  4DBQ A;  4GIW A;  1WLX A;  3VR8 A;  4CI1 B;  1XDP A;  3AEB A;  1IBM T;  2G0U A;  1QLB A;  2V6X A;  3UUB A;  4IDZ A;  2N9D A;  3PUX F;  3JAD A;  4DVD A;  3RC8 A;  4X62 T;  4COF A;  3C4W A;  2ZMA A;  3MJX A;  3UU5 A;  2YU2 A;  3PUA A;  2EHO A;  5AQI B;  4EOZ B;  3CVR A;  1VCS A;  3KV6 A;  2CHO A;  4PJJ A;  4ZEY A;  5FL1 A;  4UEL A;  3RYC E;  4PJL A;  3UU4 A;  2E8I A;  4YHH T;  1WCR A;  3UQ7 A;  5JR9 A;  3KIN B;  3RYH E;  1IJ5 A;  4AIU A;  3L8R A;  2KSR A;  5IWA T;  4AKR B;  5CA0 E;  3GWH A;  2LRK A;  2MBG A;  5AQG B;  3WAK A;  1Y01 A;  4X64 T;  3LSV A;  2BBH A;  3O1H A;  4DR7 T;  1NEN A;  4AI6 A;  1T98 A;  2VK9 A;  4M1P A;  1BR0 A;  1T72 A;  3Q5W A;  3FZM B;  3RHW A;  4HWF A;  5IYZ E;  5ABG A;  1B7T A;  2LRL A;  4YLH A;  4AKH A;  4YSY A;  2DHR A;  2NW7 A;  2YEV C;  3K8P C;  1M7K A;  4U2Y A;  1N34 T;  1L0V A;  3UUX B;  4KMC A;  3CQC B;  1MND A;  1KFY A;  1BR4 A;  3UUM A;  4A56 A;  2BG9 B;  1HNZ T;  5CJ5 A;  4U2Z A;  3D0T A;  3OBV E;  4IDO A;  3AED A;  3FZK B;  1E1H B;  1LKX A;  3FBZ A;  3CPZ A;  3NBX X;  2W61 A;  2QA7 A;  2ES0 A;  5AQU B;  1W9R A;  5AQK B;  3HKE E;  4IHJ E;  2YDS A;  4XZC A;  4ISS A;  5AFU L;  4IE0 A;  4X65 T;  4JEU B;  2V5D A; 
#chains in the Genus database with same CATH homology
 3C4X A;  4ZHQ E;  3ZMZ B;  2WBL A;  3AA6 B;  3B57 A;  1IJ6 A;  4PAG A;  2YU1 A;  3ZMS B;  3KV4 A;  4ZOL E;  5FY0 A;  1HG2 A;  4U72 A;  2KZ7 B;  5JRC A;  4J2C A;  3I1A A;  3CX6 B;  3MAC A;  4WW0 A;  4WNK A;  4AXP A;  1YW0 A;  3R84 B;  4H9P C;  5JQG E;  5LJM A;  3ZC0 A;  1FEW A;  4EXT A;  2CMR A;  1Y64 B;  2N1G A;  1KK7 A;  1MIV A;  3AB3 B;  2WMO A;  5ADX L;  2B1E A;  2LT3 A;  4PW8 A;  2JMH A;  3WI3 A;  2W62 A;  5JRC B;  1HTJ F;  4ZI2 C;  5HXR A;  2L9Q A;  5DJQ C;  5FY7 A;  2CE7 A;  4AQF A;  1HCI A;  5A1L A;  2VAS A;  2Y48 B;  2DCF A;  2A2F X;  1D1C A;  3J9X 1;  3FXD B;  3ESL A;  2VB6 A;  3HKC E;  3ZMU B;  3EDV A;  4B6X A;  4ZI2 D;  5LGT B;  2EHO B;  3ZJ2 A;  3OYZ A;  3PE0 A;  2X67 A;  1IZN B;  4EYY R;  1FIO A;  1UX5 A;  2WAU A;  2L3L A;  2WM9 A;  5JRE A;  4I4T E;  2CXF A;  2MOZ A;  5DQV A;  2E9X A;  3BQI A;  1WRD A;  3HI2 A;  4ZS3 A;  2Z6E A;  5IHY A;  3ZMV B;  4AKL A;  2CA5 A;  3ZN1 B;  5LBQ B;  3GN5 B;  1D1B A;  2SPC A;  5JR9 B;  4IE7 A;  4GK5 E;  5LJN A;  2WWU A;  1U5P A;  2A3D A;  1UCU A;  4HKA A;  1D0Z A;  3ONX A;  3ZCI A;  3ZYL A;  1KNZ A;  2E9X B;  3AVS A;  4PNI A;  3S4U A;  2BDE A;  3OKQ A;  2C5I T;  3H3A A;  2JMK A;  1BR2 A;  2LSK A;  3AA0 B;  5F8P A;  3OYX A;  4I50 E;  3AA1 B;  3C4Z A;  3HKB E;  3O1J A;  3ZN0 B;  4UVC B;  4EYU A;  4XBF B;  2ZLY A;  3KVA A;  4QWN B;  2V1D B;  3CQX C;  5L2L A;  2M67 A;  1HF8 A;  4CQI A;  1ZKE A;  3SWH A;  3CQG B;  5L3G B;  3N9M A;  4GYS A;  4V1A v;  1G8X A;  2WMN A;  5FMN A;  3IBP A;  1D0X A;  3SOL A;  3HA4 A;  4O4I E;  4ASK A;  1HS7 A;  2EHO C;  5EK4 A;  4X1I E;  3UTK A;  4C91 A;  2D5U A;  4HFV A;  3RYI E;  3FXE B;  3LFM A;  2KLQ A;  2LE8 A;  3GA8 A;  4K0U A;  4H9R C;  3FHN A;  2VKO A;  3CKD A;  3NRX A;  4H9S E;  4CI2 B;  4DMW A;  3N9O A;  2I59 A;  4CXY A;  3N2O A;  2D2S A;  3KBT A;  3MXZ A;  4H63 H;  2XTL A;  2EHO D;  5FP3 A;  3I9Y A;  5FXW A;  2VKJ A;  5LBM A;  2X68 A;  2MYS A;  4XAX B;  2ZM2 A;  5JDG A;  3VKG A;  4IIJ E;  5JR9 C;  2CLY C;  2Y6X A;  3ETU A;  5CA1 E;  4UV8 B;  4ZS2 A;  3N5L A;  2KWH A;  3C64 A;  4Z8X A;  4IST A;  2Q9Q A;  2NOX A;  4IGU A;  2DLR A;  4JUY A;  1MIW A;  4G2A A;  2RP4 A;  4PJN A;  4TUY E;  4TV9 E;  4EAH A;  5JDQ A;  4HE8 A;  3MA9 A;  4QKN A;  2LSJ A;  4HTE A;  3PUR A;  1VOM A;  1WR6 A;  2NWB A;  3HKD E;  4QX8 B;  3T8O A;  2NP9 A;  3VU7 H;  2PJQ A;  2Q9Q B;  3E08 A;  4MAL A;  3DJB A;  3ZC1 A;  5H6Q B;  3RH3 A;  5HWX A;  5JDM A;  2V7L A;  4UVA B;  2HPJ A;  2X9X A;  5F3J A;  4P0B A;  4UEM A;  3CML A;  3J7Y q;  3UUN A;  3EUH A;  3F2E A;  3F31 A;  3N2G E;  3HL6 A;  2X66 A;  2OA5 A;  4BJM A;  4WBO A;  3IEE A;  4YHJ A;  2PG8 A;  2W63 A;  5EZY E;  3U3I A;  4JEH B;  5EK2 A;  5J2T E;  5HXC A;  4MLK A;  2V7I A;  4ILU A;  4E7Z A;  3LBX A;  3N9Q A;  1HG5 A;  3ZPO A;  4WBN E;  2DWK A;  2JPF A;  3I0O A;  2X9Y A;  2LSY A;  3L3P A;  5HYA A;  3MKD A;  2V7J A;  1MNE A;  1US7 B;  2MTQ A;  4QXH B;  3MZK B;  5EK3 A;  1LRZ A;  4P09 A;  2A72 A;  2CM0 A;  3PDY A;  3N9N A;  3DP7 A;  5LHG B;  2J1D G;  4UF0 A;  2KT9 A;  1FMV A;  2LOS A;  2LHN A;  2VKH A;  2P9B A;  2XQY A;  1HX8 A;  2DNX A;  4TX5 A;  4N78 D;  4EIW A;  3RPU A;  3PUQ A;  2CXD A;  2HH7 A;  4MFR A;  1O3X A;  2NW8 A;  4OFZ A;  2KWI B;  2V7M A;  3CX7 B;  3RC3 A;  3ANW A;  4FI5 A;  2K48 A;  2QGS A;  4TZ4 C;  1ZEE A;  4CXW A;  3C98 B;  5JDH A;  5H6R B;  3P8C D;  3O1I A;  3ETV A;  3AAA B;  2ZM0 A;  4UF0 B;  3L09 A;  4PK6 A;  2DI4 A;  2LSG A;  1G73 A;  2IC9 A;  4CXX A;  5LXT E;  2JJ9 A;  4L9I A;  3ZCJ A;  3I9W A;  2PFV A;  3QC9 A;  3H37 A;  3DTO A;  3VHL A;  4YFS A;  5J2U E;  3ANW B;  2K9A A;  4IE6 A;  3ZYK A;  4KUM B;  3Q2M A;  4H9N C;  4C90 A;  3KV9 A;  3K3Q C;  4UIG A;  5LA6 E;  4I55 E;  2D0T A;  4OYK A;  5FXX A;  3AVR A;  4NUV A;  5LCY A;  4DBR A;  3WAJ A;  3LK4 2;  4AQG A;  2N2N A;  2JQQ A;  3Q5X A;  4TN7 B;  2ACX A;  4O8S A;  1X79 A;  5LOV E;  4O4J E;  4QHO A;  3UUL A;  2XAG B;  3MK7 C;  4KP3 C;  4QXC B;  5C8Y E;  1YD8 G;  3RKO A;  1U4Q A;  5L3D B;  5FY1 A;  2K5B B;  3BQL A;  4DMV A;  2D0U A;  4PK4 A;  4AQF C;  2CWO A;  2ZM8 A;  3NZP A;  3RRW A;  5JDF A;  5FYM A;  3W15 B;  3SRZ A;  4DND A;  2ODU A;  4X1Y E;  5HXH A;  1OWA A;  3IF8 B;  5L3B B;  5J1G A;  1ZV4 X;  2GK9 A;  3ZEF B;  3NRY A;  4ERR A;  1EZ3 A;  4L5G A;  2CWY A;  2JRK A;  4EB6 E;  3ZMT B;  4X1K E;  3ZYM A;  2BZB A;  4ZI7 E;  2LM9 A;  2E9X C;  5ETW A;  2C5J A;  2H7V C;  2VKD A;  3AA7 B;  1NAF A;  1QSD A;  1MIY A;  3ZLI A;  1D0Y A;  3E0Z A;  5CB4 E;  2VWA A;  4FJO A;  1VRB A;  3A5X A;  2E9X D;  4MBQ A;  4ANJ A;  2WSS V;  4L0R A;  4TV8 E;  4AKG A;  2NTX A;  2KXP B;  3RRC A;  1IAP A;  5LHI B;  2X9W A;  5FXZ A;  1S35 A;  1FMW A;  4YJ3 E;  5KMG P;  4HN9 A;  5JDN A;  4DBQ A;  2K24 A;  2L8K A;  4GIW A;  1WLX A;  2VL8 A;  1ZHC A;  1BR1 A;  3B13 A;  4GK0 E;  2IW5 B;  2V7K A;  4JLE A;  4CI1 B;  2H7O A;  2XAQ B;  4GOU A;  4U74 A;  3KV5 A;  2G0U A;  4EZH A;  4OHF A;  1NWM X;  3O9X A;  1CUN A;  2XAF B;  4IDZ A;  4OYJ A;  3C51 A;  2N9D A;  4IE5 A;  3V5S A;  2DWG A;  1SHZ C;  5JVD E;  3QUJ A;  3CX8 B;  4DVD A;  5LG4 A;  3PUS A;  3RX6 A;  4PFP A;  3K3N A;  2CXL A;  3FB2 A;  2LOP A;  4NUU A;  1UX4 A;  3RC8 A;  4O2A E;  4UVB B;  4IE4 A;  5HXS A;  3LBX B;  5JDL A;  3C4W A;  1WYC A;  4UV9 B;  4CZZ B;  1V9D A;  2ZMA A;  3LK3 B;  2IAK A;  2HPL A;  3MJX A;  5DQW A;  5KDM C;  3CWZ B;  4HEA A;  2Q9Q C;  2RA1 A;  2C5K T;  2YU2 A;  3PUA A;  2EHO A;  3N9P A;  4H9Q C;  4O4H E;  4EOZ B;  3ZJ1 A;  3CVR A;  3LK2 B;  4OK0 A;  3RYF E;  3KV6 A;  5FNV E;  3PU3 A;  5LGN B;  3JC6 C;  2PBI A;  3PUG A;  2CCQ A;  4PJJ A;  2Q9Q D;  4AKI A;  4UEL A;  3RYC E;  3V5U A;  2XHE B;  4PFO A;  4PJL A;  2UXX B;  2E8I A;  3GN5 A;  4O2B E;  5JR9 A;  3K3O A;  3P7I A;  5LP6 E;  2Y8D A;  3LJC A;  3JC6 D;  3KIN B;  3EDU A;  4BJN A;  3QK6 A;  3RYH E;  3I0Q A;  1IJ5 A;  4I43 B;  2X51 A;  1QUU A;  2YK0 A;  1YKH B;  2LSI A;  4GYR A;  2KMF A;  2CEA A;  3E22 E;  1D1A A;  2BVM A;  2C0S A;  4AKR B;  1LVF A;  2CLY B;  5CA0 E;  2XAJ B;  3GWH A;  3TKL B;  3R6N A;  2MBG A;  2X9H A;  2XAH B;  3WAK A;  5L3F B;  3O1H A;  1LVK A;  4BA9 A;  4AI6 A;  1T98 A;  4UXN B;  3N2K E;  3EVY A;  2VK9 A;  4M1P A;  3O4X E;  4X20 E;  4YJ2 E;  1BR0 A;  1Z0P A;  2NW9 A;  3KFW X;  3F57 A;  4P0A A;  4E7S A;  3Q5W A;  5HXE A;  1S94 A;  5IYZ E;  5LNK A;  1B7T A;  4QX7 B;  2BVL A;  4YLH A;  2H3R A;  2IC6 A;  4F6R C;  4EZ4 A;  4AKH A;  2YIN A;  5TAO A;  2DHR A;  2NW7 A;  2UXN B;  3BQK A;  4HGA A;  3UFE A;  3SS1 A;  3HR0 A;  5E0O A;  2ODV A;  2KIN B;  2YEV C;  3K8P C;  5HAX A;  3AAE B;  5L3E B;  2W0G A;  3N9L A;  2LEH A;  3M65 A;  3OJA A;  2NTY A;  4KBM B;  3UUX B;  3PTR B;  3FBL A;  4KMC A;  5LHH B;  3KBU A;  3KDS E;  4PK5 A;  3U78 A;  2XAS B;  4BAY B;  4MHC A;  3CQC B;  2XUE A;  1MND A;  3AAI A;  1HFA A;  5HWY A;  2V26 A;  1BR4 A;  1H7C A;  2LHR A;  3KVB A;  4H63 V;  3UUM A;  4A56 A;  2LJL A;  4DO0 A;  3LG7 A;  1OXZ A;  5LGU B;  1WYB A;  3C50 A;  3NZQ A;  3UT5 E;  4G63 A;  3D0T A;  3OBV E;  4ZI3 C;  1SA0 E;  5L3C B;  5KX5 E;  1MMG A;  4O4L E;  1E1H B;  4QXB B;  1LKX A;  2X0L B;  4H9O C;  1YKE B;  5DAB A;  3FBZ A;  3CPZ A;  1MMA A;  3NBX X;  1AJ3 A;  4ZI3 D;  2W61 A;  3Q9D A;  2QA7 A;  3BK9 A;  2ES0 A;  2W00 A;  5FXV A;  4CI3 B;  3VKH A;  5LYJ E;  2KND A;  5GON E;  3GMI A;  3HKE E;  4IHJ E;  4ADZ A;  5M4Y A;  5BMV E;  5JH7 E;  4PJM A;  4XZC A;  4ISS A;  5AFU L;  4IE0 A;  1MMN A;  3IHR A;  4JEU B;  3PU8 A;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...