3VHLA

Crystal structure of the dhr-2 domain of dock8 in complex with cdc42 (t17n mutant)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
264
Chain Sequence
FGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 8
publication title DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 87
structure length 264
sequence length 273
ec nomenclature
pdb deposition date 2011-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vhlA02
2YINA 2WMOA 3VHLA 3B13A 2WM9A 2WMNA
chains in the Genus database with same CATH superfamily
1YQ4A 4CXYA 4H9QC 5JTGA 5LMUT 3AVSA 4KX6A 2QGSA 4O8SA 4YT0A 5JRCB 2CBIA 2VL8A 2VWAA 3MA9A 4ZI3C 3UULA 5A1LA 4QKNA 5HEUA 4G63A 5LOVE 1V9DA 3PUQA 4LFCT 3CK6A 5LHHB 5JREA 1SE7A 2ODUA 2YEVC 4BAYB 2X51A 2N1GA 4KHZF 5JDFA 1G8XA 4PJMA 5CFBA 2XSBA 2KWHA 4DIDB 2DWKA 5CJ5A 3I1AA 1IBKT 2HH7A 5AQSB 1T8BA 1MNDA 2R6GF 1QSDA 4JI3T 2VB6A 1HX8A 3LSVA 3C51A 2MAWA 1N36T 1KNPA 4BA9A 5FL0A 5DQWA 2ODVA 3DJBA 1J1JA 3P50A 3ZJ2A 4UF0A 2XUEA 4CXXA 3HKEE 4YTPA 4AKLA 2IIUA 4HFCA 3ZMTB 3ZC1A 4C91A 2OV9A 4JYAT 1UCUA 3LFMA 5J2UE 4HTEA 2CXFA 3UQ4A 4WBNE 2NW8A 2WU5A 2VQFT 1ZP0A 2VVSA 4HFHA 3LG7A 5FMNA 4EB6E 1U4QA 2HPLA 2CHNA 3PE0A 4H9OC 5H6RB 3UTKA 4TV8E 1KK7A 2NWBA 4BJMA 2SPCA 2FJEA 3K8PC 4GYRA 5L2LA 1WR6A 2LSYA 2D5UA 4P1NA 4EGWA 5JRCA 4MLKA 3C4WA 3JADA 3TLWA 4IL4A 2OLTA 2XAJB 2H89A 5FXWA 4GK0E 3CQCB 4HFEA 5AQKB 4X65T 4LF5T 1MIYA 4AQFA 5JQGE 3AE7A 4WBOA 5FVLA 1IJ6A 4YFSA 2V26A 4IREA 2UXBT 4IDNA 4DR4T 4L0RA 5HAXA 2JJ9A 3AA7B 4UEMA 3ANWB 4LF7T 1US7B 2VL0A 5M4YA 5LHGB 3AE4A 1LVFA 4B3ST 3KBUA 4DUZT 1ZKEA 4UVCB 2BKNA 3ZKRA 3AEFA 3RKOA 2NP9A 3S4UA 3ZPOA 3SS1A 2K3WA 3AA6B 3FZHB 4XAXB 4E7ZA 3FBLA 2JIWA 3RLFF 3ZLIA 1UX4A 4JI7T 2CE7A 4JI0T 3EABA 2ZM8A 3UT5E 3AXJB 2JQ9A 4CN6A 1LRZA 3AEEA 2NTYA 3JAEA 1HCIA 4ILUA 4A56A 2XAGB 3UFGA 2BKPA 4MHCA 2CMRA 4UV9B 2YU1A 3VR8A 2LSIA 5HWXA 3NZQA 4X1YE 2GK9A 4DBQA 4ERRA 1YQ3A 5AQNB 1XDOA 3N5LA 3AEAA 2BS3A 4O4HE 2ZM2A 2KSRA 4L9IA 5LBQB 4QH5A 4HKAA 2XAHB 2JRKA 1OEDC 1CHUA 5ABFB 3LDQB 5F8PA 1NWMX 2C5KT 2KZ7B 4DUYT 5AQRB 3EHZA 3PUXF 4IGUA 4GYSA 4YSYA 3PJAJ 3UFEA 4OK0A 4DVDA 3A8YC 3P4QA 1ZV4X 4E7SA 5HEGA 4WW0A 5JR9C 1D0YA 2G0UA 5AQJB 4DV6T 4DV4T 4KUMB 2V7MA 4PAGA 2WZIA 1YKEB 4YSXA 5HEHA 1LKXA 2MOZA 3O1JA 4DO0A 4LF9T 3AAAB 1KNZA 4Z8XA 3NWIA 3ANWA 2KMFA 3CX6B 2N9DA 4FI5A 4WYVA 3SFEA 1HR0T 3LBXB 5JDLA 5L4EA 5HXRA 3VU7H 2KXPB 1KEYA 3KINB 1MMNA 3CX7B 1WYCA 2KINB 3ZJ1A 1D0XA 3A7MA 4O4LE 2X0LB 2XPKA 3RIUA 1W9RA 2CWOA 3RF1A 2ZMAA 3E08A 2JMHA 2V8SV 4U72A 4JI5T 3PUVF 3NRXA 3J9X1 4QXHB 3F57A 2XQ4A 2LOPA 2V5CA 5CB4E 3W15B 3KVBA 4TV9E 3KBTA 4DMVA 4EOZB 2X0HA 1QLBA 3I0OA 3RYFE 4P0BA 3JAFA 3MACA 3NKZA 4PW8A 2PJQA 3IA3A 4CI2B 5HYAA 3HKDE 1UX5A 2FJAA 4KMCA 3QB5K 4I55E 5LGUB 4EV6A 4HE8A 5FY1A 3KVAA 2W00A 4JEUB 4AQFC 3KV6A 4HWIB 5F5WA 2ZM6T 4JEHB 4TWDA 5KXJA 3SWHA 2LSKA 1FMWA 5LGTB 3KDSE 3PU8A 3UU6A 1YKHB 4I50E 3C4XA 4U2YA 5LNKA 4ISSA 3AE6A 4ZOLE 4ILBA 4DR3T 3P8CD 2VKOA 2XY8B 1KNRA 1KFYA 2Z6EA 2J1DG 3AAEB 2A72A 3ONJA 3AE5A 4LF4T 2WWUA 4I0UA 2PFVA 4M1PA 2LM2A 5AQQB 2VASA 4YXDA 3N2OA 4DR1T 2VKJA 2WWVA 5JDGA 2CHOA 4LF8T 4QH4A 5BMVE 4DV5T 4EZHA 4I4TE 5EK2A 5LG4A 2DCFA 4JUYA 2XAFB 2DLRA 2XZEA 3PDYA 4UR9A 4B3RT 2BZBA 3GA8A 2HN1A 3ZT5A 2CBJA 4NPPA 3PUWF 3PUGA 4AXPA 1KF6A 3ZT6A 3LBXA 3R6NA 2CM0A 5L3EB 5L3BB 3D0TA 2FJBA 4YTNA 4HGAA 2LSJA 3ZEFB 4U3CA 1XMOT 2Q9QB 4YY3T 1MIWA 2XQ5A 1M62A 1OEDE 4X66T 2D2SA 4HWFA 2NW7A 3CPZA 2LHNA 1DU2A 3V5SA 4EYUA 3ETUA 3Q9DA 3B13A 2E9XB 3WAKA 3FZMB 2CEAA 4GOUA 2NR4A 2LHRA 3VKHA 2L3LA 2XQ9A 2AXDS 4XBFB 3RPUA 4JI4T 4CZZB 2JQHA 3Q2MA 3M3ZB 5AQLB 4Z91A 2YDQA 4CN1A 2D0UA 1WR0A 1OXZA 4X64T 1HX1B 5EK3A 3HL6A 4UV8B 2V6YA 2NW9A 4H63H 4AIUA 1XDPA 3C50A 1YXRA 2BDEA 2QRXA 2YOEA 4WZXA 2XM2A 5FY0A 3K3NA 2D9DA 2YK0A 5FVKA 1Z8UA 3L3PA 3R84B 3MXZA 3B57A 2BKOA 5HXHA 2HHHT 3OPCA 3ZSTA 5FNVE 2WY2A 4AISA 2N2NA 3RRWA 4NUVA 1NEKA 3CVRA 2CXLA 2ZM0A 2XQAA 5HCJA 3DTOA 4YJ3E 3RIUC 3Q5WA 1HNWT 2K24A 2W67A 4LF6T 2VKHA 3PJAA 1J5ET 4IE5A 3CX8B 2UU9T 2L8KA 4HEAA 2UUBT 5KMGP 2X66A 3V5UA 2EHOA 5FL1A 3ESLA 5DABA 5DJQC 2M6BA 4L5GA 1MIVA 5CA1E 5F3JA 2LSGA 2IC9A 2WDQA 5JVDE 4ZXLA 4X1KE 2KWIB 3WAJA 4MFRA 4JV5T 3EUHA 3I9WA 2XHEB 3ZN1B 3O1HA 5LYJE 4PK6A 2BG9B 1BR4A 5HXEA 5AQHB 5AQTB 2ACXA 5JDNA 5AQFB 5H6QB 4TX5A 2LLYA 3ONLC 1WCRA 3I9YA 2E9XA 3QC9A 2IW5B 4YLHA 2M67A 3N2KE 3PURA 3TLTA 3H3AA 3ONXA 1FMVA 4AKGA 3RRCA 5FXZA 4IHJE 3C98B 3RI5A 4V1Av 3O1IA 1I94T 4EEDA 3LK3B 2FBWA 3QNUA 1BR0A 2MPKA 3RH3A 1IBLT 3T8OA 1LVKA 2ES0A 1Z0PA 4QXBB 2NOXA 2I0MA 3HR0A 3IHRA 5C3JA 4X20E 3OVUA 3UUMA 5AQVB 3NZPA 4P0AA 3OKQA 3U3IA 3JCFA 1JNZA 1SUMB 3CKDA 4NXMT 2K9AA 4U74A 1MMAA 2UUCT 5JDHA 2RP4A 2IC6A 2DWGA 3N9MA 4HWHA 4A98A 3ZSSA 4K0KT 5GONE 4DMWA 1UGOA 2VQET 3A5XA 5JH7E 1B7TA 3CWZB 1YD8G 2VKDA 3U78A 2DNXA 2JMKA 1D1CA 3UUBA 3BQKA 3AEBA 5L3GB 2K48A 2A3DA 3NVOA 2V7LA 1W0AA 4HWCA 3UUNA 3AE2A 3LK42 3ZYLA 4QXCB 5FY7A 2Y48B 4U7YA 4DV1T 2XASB 4EEBA 3RKGA 2X9XA 2WMNA 4GIWA 3GN5B 4DR6T 2QYWA 2WAUA 3M65A 2WS3A 3BK9A 2BG9A 3K1SA 3EDVA 2KT9A 3C4ZA 4DV0T 4GK5E 4WNKA 5LXTE 3RYHE 2NTXA 1WFDA 1T7SA 2CLYC 4H63V 4QX8B 4YTMA 3SRZA 4EYYR 3MZKB 4ZZBA 5ABHA 4DR7T 1WYBA 4IT4A 2UXDT 4DBRA 4LMLA 4P09A 3RQWA 4PK4A 1G73A 4AI6A 1D1BA 2KLQA 4DNDA 3FXEB 3BQIA 3NBXX 1HF8A 2PBIA 1BR1A 2LM9A 2EHOD 2L9QA 4OFZA 1HG5A 1W0BA 1WRDA 4IE0A 3ABVA 2XQ3A 2FJDA 3N9PA 1JNRA 3AEGA 3VKGA 2YDSA 4JI6T 4ZI2D 1Y01A 2EHOC 4AQGA 3AA1B 2LOSA 4PK5A 5IUXA 2PTFA 3OYZA 1D1AA 1SHZC 2XM1A 4ZI2C 3OYXA 3P7IA 3AXJA 4H9SE 2CRBA 1T98A 5BR8T 2E9XD 1ZEEA 2A9UA 4PNIA 3PV0F 5LHIB 1VCSA 2RPAA 3OBVE 2XQ7A 2YN6A 5L3DB 4DR2T 3IEEA 4U7IA 3QUJA 1OEDB 2E9XC 5LGNB 2KNDA 4EIWA 3ETVA 1UK5A 1X79A 2HN2A 3MK7C 4LMJA 4OHFA 5E0OA 3PUZF 3EAMA 4IDOA 2QVAA 1XZYA 1HTJF 3G06A 4EAHA 1W09A 4U31A 3JC6D 5ABFA 3FXDB 2WBLA 3GN5A 2V5DA 1IZNB 2LKHA 3N2GE 1QUUA 2LEHA 3WI3A 4H9NC 2LRLA 2JQKA 3IBPA 4O2BE 1ZHCA 3JC6C 4DR5T 4U33A 5JR9B 3OTOT 1MMDA 3OJAA 4TWFA 1HFAA 3UU8A 4KBMB 5ETWA 4UF0B 3L8RA 4N78D 3RGLA 3H37A 4YSZA 3T1HT 4HN9A 4IDPA 2UXNB 5LJNA 2WM9A 1T72A 5EZYE 5L3CB 2D0TA 2I6HA 3N9NA 2W62A 2X9YA 2ZLYA 3AE8A 3AE1A 5L3FB 3H3MA 1VCTA 5ABGA 3RYIE 1N33T 2JPFA 1L0VA 3GWHA 2LT3A 2WU2A 4J2CA 3KV5A 4OYJA 3NRYA 2PG8A 3EVYA 2BBHA 3P4RA 2B1EA 1HNXT 1SA0E 5EK4A 1EZ3A 2ACZA 3RIFA 2BS4A 5J0ZA 2W66A 4IDZA 2BG9C 3TLVA 3N9LA 4X5TA 3VHLA 4ANJA 3N9QA 3UU5A 2K5BB 3N9OA 2C5JA 5HXCA 5LA6E 1D0ZA 3ZT7A 2WQYA 3DP7A 2H88A 4PJJA 4TNWA 1OEDA 5AFUL 2XTLA 5AQPB 4GKKT 1HS7A 4PFPA 4B3TT 4DV2T 2MBGA 1AJ3A 2WMOA 3K3OA 2DL1A 3AECA 4U2ZA 4ADZA 1UUSA 1R8IA 1NAFA 5HCMA 5FP3A 2CPTA 3SOLA 3ZYKA 2WB5A 4YJ2E 1HG2A 4C90A 4IDQA 5JR9A 3FZFB 3P4WA 3ZCJA 2YKSA 4OYKA 3AEDA 3KV4A 2I59A 4X62T 2LRKA 3PTRB 4UXNB 4H9PC 3P4SA 1IBMT 2HPJA 3QK6A 2H7OA 3VRAA 5J1GA 2VK9A 4CQIA 2E5LT 1BR2A 2WSSV 3TLUA 3ZN0B 4KP3C 2OA5A 3AAIA 4HFDA 3FBZA 5IHYA 1VRBA 4JBWF 4CI1B 4ZZCA 1VOMA 5HXSA 3UU4A 4IE4A 3E0ZA 3EI0A 4I43B 3KV9A 1XNQT 5J2TE 4YHHT 1ZOYA 3MJXA 3VRBA 2Q9QA 2X9WA 2P9BA 2FUPA 4UVBB 4OX9T 2WDVA 3I0QA 2VURA 3PUSA 4ZS3A 4ZEYA 1XWMA 4MBQA 4Q25A 2CXDA 5ABEA 2V7KA 4JLEA 3L09A 3RHWA 4TZ4C 2VVNA 1U5PA 4LFBT 4EZ4A 2J47A 3QB5A 2E5VA 1GQEA 4UVAB 5FKYA 3TKLB 3E22E 5KDMC 4A97A 3RX6A 4TUYE 1N32T 2W63A 4CI3B 2F4VT 2V1DB 1XNRT 4O4JE 2A2FX 4O2AE 5CGMA 4TNVA 1N34T 2W0GA 3Q5XA 3X1DA 3FHNA 1J5WA 1MMGA 3O9XA 2XAQB 2LKGA 1M7KA 5DQVA 2CWYA 2IMLA 4F6RC 5HEJA 2X68A 2H3RA 2MYSA 3Q5EA 4COFA 3T1YT 5HWYA 4JI2T 2WP9A 4ISTA 4PJNA 4CXWA 2BG9E 5FXXA 1IJ5A 3AA0B 4UIGA 1E1HB 4IL9A 2J4GA 5LCYA 2W2UA 2UXXB 3RYCE 2X0YA 1MNEA 3LK2B 1FIOA 2H7VC 3AB3B 2YU2A 3F2EA 4QHOA 2IHR1 5C2TA 2X67A 4X1IE 2C5IT 4XZCA 3RQUA 4ZI7E 5L47A 2UXCT 2DHRA 3CMLA 4B6XA 2W61A 2V7JA 4IE6A 5AQMB 4EXTA 5LBMA 4AQYT 4TWHA 4GKJT 3L39A 2BVLA 3P4PA 4ASKA 4JI1T 1E7PA 2XQ6A 3B5MA 2YDRA 1FEWA 4B3MT 1WLXA 4QH1A 3FZKB 3ZYMA 2QA7A 4O4IE 4ILCA 3J7Yq 3PUYF 3CIRA 3SFDA 3RIAA 5LP6E 1FJGT 1XMQT 4AKIA 3LJCA 3EDUA 4ILAA 3C64A 5LJMA 4A5XA 4DV3T 1IAPA 2UUAT 3ZMUB 4AKRB 1I6ZA 5AQGB 1E2AA 3HKBE 5KX5E 5JDMA 2YINA 2BS2A 5AQUB 4UELA 3UQ7A 5AQIB 5LG3A 4PJLA 4ZS2A 3HI2A 4CN4A 3BQLA 3TLSA 5TAOA 2CCQA 4HWDA 4MALA 3RC8A 4JI8T 3AE3A 2Q9QD 4LMKA 1S35A 2WCAA 2X9HA 2E2AA 3AE9A 3CQXC 4IE7A 2IAKA 4KHPT 2XJ7A 5CA0E 2LJLA 2BVMA 4K0UA 2IUBA 2Q9QC 2WZHA 4QWNB 2C0SA 3UU3A 1O3XA 4AKHA 1NENA 4ZHQE 1H7CA 3FZLB 3GMIA 2IDOB 2JQQA 3HKCE 5IWAT 2J62A 3QOFA 5LB7B 4QX7B 4HFVA 3PUAA 5IYZE 4NUUA 3UUXB 4IIJE 4BJNA 2V6YB 3Q5DA 2RA1A 1OWAA 4FJOA 1YW0A 4NIQA 3AVRA 3ZMZB 2XSAA 3MKDA 4KI0F 3ZMSB 1UURA 5AQOB 2CLYB 2CA5A 1Y64B 5HEOA 4F8HA 2BBJA 3IF8B 1CUNA 1S94A 3HA4A 3K3QC 5ADXL 4HFIA 2DI4A 2Y6XA 2AE9A 3ZMVB 2LE8A 5FYMA 4Z90A 5L4HA 4DV7T 2Y8DA 3KFWX 4H9RC 2M6IA 3F31A 3VR9A 2V6XA 2W4XA 4LFAT 2XQ8A 3PU3A 3ZC0A 3CQGB 4YHJA 2E8IA 2WDRA 3O4XE 4TN7B 5JDQA 5C8YE 5LMNT 5FXVA 3ZCIA 2EHOB 1X9BA 3FB2A 4G2AA 4NXNT 1HNZT 2XQYA 2V7IA 4PFOA 2MTQA 3RC3A 4ZI3D 4HFBA 2B76A
chains in the Genus database with same CATH topology
2JMKA 5CB4E 1VRBA 3W15B 3KVBA 4CXYA 4CI1B 4TV9E 1D1CA 3KBTA 4H9QC 1VOMA 3BQKA 4DMVA 5L3GB 3AVSA 5HXSA 2K48A 2A3DA 4IE4A 3E0ZA 4I43B 2QGSA 3KV9A 2V7LA 5J2TE 4EOZB 4O8SA 3UUNA 5JRCB 2VWAA 2VL8A 3I0OA 3MA9A 3RYFE 3LK42 4ZI3C 3ZYLA 4P0BA 3MJXA 4QXCB 5FY7A 2Y48B 3UULA 5A1LA 4QKNA 3MACA 2XASB 2Q9QA 4PW8A 2X9WA 2PJQA 4CI2B 2P9BA 5HYAA 3HKDE 2X9XA 1UX5A 4KMCA 4G63A 5LOVE 2WMNA 4GIWA 4I55E 5LGUB 4UVBB 1V9DA 3PUQA 3GN5B 5LHHB 5JREA 4HE8A 3I0QA 5FY1A 3KVAA 2W00A 2ODUA 2YEVC 3PUSA 2WAUA 4ZS3A 4BAYB 3M65A 2X51A 2N1GA 3BK9A 4JEUB 5JDFA 1G8XA 4AQFC 4MBQA 4PJMA 3EDVA 2KT9A 3C4ZA 3KV6A 2KWHA 2DWKA 4GK5E 2CXDA 4JEHB 4WNKA 3I1AA 5LXTE 2V7KA 4JLEA 2NTXA 3RYHE 3L09A 5LGTB 3SWHA 2LSKA 1FMWA 4TZ4C 3KDSE 3PU8A 2CLYC 1YKHB 4H63V 4I50E 3C4XA 4QX8B 1U5PA 5LNKA 4ISSA 4EZ4A 4ZOLE 3SRZA 4EYYR 2HH7A 3MZKB 1MNDA 3P8CD 2VKOA 1WYBA 1QSDA 4UVAB 4DBRA 2VB6A 3TKLB 2Z6EA 1HX8A 2J1DG 3AAEB 4P09A 2A72A 3E22E 4PK4A 1G73A 5KDMC 4AI6A 2WWUA 3RX6A 1D1BA 3C51A 2KLQA 2PFVA 4TUYE 4DNDA 4M1PA 3FXEB 3BQIA 4BA9A 2W63A 4CI3B 2V1DB 2VASA 4O4JE 5DQWA 2ODVA 3N2OA 3DJBA 2VKJA 1HF8A 3NBXX 5JDGA 2A2FX 4O2AE 2PBIA 3ZJ2A 4UF0A 5BMVE 4EZHA 1BR1A 4I4TE 2XUEA 2LM9A 4CXXA 3HKEE 2EHOD 2W0GA 5EK2A 3Q5XA 4AKLA 3FHNA 1MMGA 2L9QA 5LG4A 2DCFA 4OFZA 1HG5A 4JUYA 1WRDA 3O9XA 2XAFB 3ZMTB 2DLRA 3PDYA 2XAQB 4IE0A 3ZC1A 4C91A 2BZBA 3GA8A 3N9PA 1UCUA 3LFMA 5J2UE 4HTEA 5DQVA 3VKGA 4ZI2D 2CWYA 2CXFA 3PUGA 2EHOC 4AXPA 4F6RC 4AQGA 3LBXA 3R6NA 2CM0A 5L3EB 2X68A 5L3BB 2H3RA 2MYSA 3AA1B 4WBNE 3D0TA 2LOSA 2NW8A 4PK5A 5HWYA 3OYZA 4HGAA 1D1AA 4ISTA 2LSJA 1SHZC 3LG7A 4PJNA 5FMNA 4ZI2C 3ZEFB 4CXWA 5FXXA 3OYXA 1IJ5A 3P7IA 3AA0B 4EB6E 1U4QA 4UIGA 1E1HB 5LCYA 2Q9QB 2UXXB 1MIWA 2HPLA 4H9SE 3PE0A 3RYCE 4H9OC 5H6RB 3UTKA 1MNEA 3LK2B 4TV8E 1FIOA 2D2SA 1T98A 2H7VC 2NW7A 3CPZA 1KK7A 2LHNA 2NWBA 2YU2A 2E9XD 2SPCA 3AB3B 4BJMA 1ZEEA 3F2EA 4QHOA 3V5SA 3K8PC 4GYRA 4PNIA 4EYUA 5L2LA 2X67A 5LHIB 1WR6A 2LSYA 2D5UA 3ETUA 4X1IE 3Q9DA 3B13A 2C5IT 2E9XB 3OBVE 3WAKA 2CEAA 4GOUA 5JRCA 5L3DB 4MLKA 3C4WA 4XZCA 3IEEA 2LHRA 3VKHA 2L3LA 3QUJA 4ZI7E 5LGNB 2E9XC 2DHRA 4XBFB 2KNDA 3CMLA 4EIWA 3ETVA 4B6XA 3RPUA 2W61A 1X79A 2V7JA 3MK7C 4IE6A 5E0OA 4OHFA 3Q2MA 4CZZB 2XAJB 4EXTA 5LBMA 1HTJF 2D0UA 5FXWA 4EAHA 4GK0E 3JC6D 3CQCB 1OXZA 2BVLA 3FXDB 2WBLA 3GN5A 4ASKA 1IZNB 1MIYA 3N2GE 4AQFA 1QUUA 2LEHA 5EK3A 3WI3A 3HL6A 5JQGE 1FEWA 4UV8B 4WBOA 2NW9A 1IJ6A 4YFSA 2V26A 4H63H 4H9NC 3IBPA 4O2BE 3C50A 1ZHCA 4L0RA 3JC6C 5HAXA 2JJ9A 2BDEA 5JR9B 1WLXA 3AA7B 4UEMA 1MMDA 3ANWB 1US7B 3ZYMA 2QA7A 4O4IE 5M4YA 3OJAA 5LHGB 5FY0A 3J7Yq 1HFAA 3K3NA 2YK0A 4KBMB 1LVFA 3L3PA 5ETWA 3R84B 3KBUA 3MXZA 4UF0B 5LP6E 3B57A 4AKIA 1ZKEA 5HXHA 3LJCA 4N78D 4UVCB 3EDUA 3C64A 5FNVE 5LJMA 3H37A 3RKOA 2N2NA 2NP9A 4HN9A 1IAPA 3S4UA 3RRWA 3ZMUB 2UXNB 4NUVA 4AKRB 3CVRA 5LJNA 2WM9A 3ZPOA 3HKBE 3SS1A 2CXLA 2ZM0A 5JDMA 5KX5E 2YINA 5EZYE 5L3CB 2D0TA 3AA6B 3N9NA 4UELA 2W62A 3DTOA 4XAXB 4YJ3E 4E7ZA 2X9YA 4PJLA 3Q5WA 3FBLA 2K24A 2ZLYA 4ZS2A 3HI2A 3ZLIA 1UX4A 3BQLA 2CE7A 5TAOA 2CCQA 2VKHA 4MALA 3RC8A 2Q9QD 5L3FB 2ZM8A 1S35A 3UT5E 3RYIE 4IE5A 3CX8B 2JPFA 2X9HA 3CQXC 2L8KA 1LRZA 3GWHA 4HEAA 4IE7A 2LT3A 2NTYA 2IAKA 5KMGP 1HCIA 2X66A 4ILUA 3V5UA 4A56A 2XAGB 3U78A 2EHOA 4MHCA 4J2CA 2CMRA 3ESLA 3KV5A 5DABA 5CA0E 2LJLA 2BVMA 4OYJA 4L5GA 5DJQC 4UV9B 4K0UA 2YU1A 3NRYA 2PG8A 1MIVA 5CA1E 5F3JA 2Q9QC 2LSGA 4QWNB 2C0SA 2LSIA 2IC9A 3EVYA 5JVDE 5HWXA 4X1KE 2KWIB 1O3XA 3NZQA 4X1YE 2B1EA 4MFRA 3WAJA 4AKHA 3EUHA 3I9WA 1SA0E 4ZHQE 2XHEB 2GK9A 3ZN1B 3O1HA 1H7CA 4DBQA 3GMIA 5EK4A 5LYJE 4ERRA 4PK6A 1EZ3A 1BR4A 3N5LA 5HXEA 2JQQA 3HKCE 4O4HE 2ZM2A 4L9IA 5LBQB 2ACXA 4IDZA 4HKAA 3N9LA 3VHLA 4ANJA 2XAHB 3N9QA 2JRKA 5JDNA 4QX7B 4HFVA 3PUAA 5IYZE 4NUUA 3UUXB 2K5BB 5H6QB 4TX5A 3N9OA 4IIJE 5F8PA 2C5JA 1NWMX 4BJNA 5HXCA 5LA6E 1D0ZA 2RA1A 3I9YA 1OWAA 2E9XA 3QC9A 2IW5B 4FJOA 1YW0A 4YLHA 2M67A 3AVRA 3N2KE 2C5KT 3ZMZB 2KZ7B 3DP7A 3MKDA 3PURA 4PJJA 4IGUA 3ZMSB 5AFUL 4GYSA 3H3AA 2CLYB 3ONXA 2CA5A 3UFEA 4OK0A 1Y64B 4DVDA 1FMVA 4AKGA 2XTLA 5FXZA 3RRCA 4IHJE 1ZV4X 4E7SA 3C98B 3IF8B 1CUNA 4WW0A 1S94A 1HS7A 5JR9C 1D0YA 4PFPA 4V1Av 2G0UA 3O1IA 3HA4A 3K3QC 5ADXL 2DI4A 2MBGA 1AJ3A 2WMOA 3LK3B 3K3OA 2Y6XA 4ADZA 4KUMB 1BR0A 2V7MA 4PAGA 3RH3A 1NAFA 5FP3A 3SOLA 1YKEB 3T8OA 3ZMVB 2LE8A 1LVKA 1LKXA 2MOZA 5FYMA 3O1JA 3ZYKA 1HG2A 2ES0A 4DO0A 4YJ2E 4C90A 3AAAB 2Y8DA 3KFWX 4H9RC 5JR9A 1KNZA 4Z8XA 3F31A 1Z0PA 3ANWA 4QXBB 2KMFA 2NOXA 3CX6B 2N9DA 3HR0A 3IHRA 4X20E 4FI5A 3ZCJA 3PU3A 4OYKA 3UUMA 3NZPA 3KV4A 3ZC0A 2I59A 3LBXB 4P0AA 3OKQA 3PTRB 3CQGB 4H9PC 4UXNB 5JDLA 5HXRA 3U3IA 3CKDA 4YHJA 3VU7H 2E8IA 2K9AA 2KXPB 2HPJA 4U74A 1MMAA 3O4XE 2H7OA 3KINB 3QK6A 1MMNA 3CX7B 1WYCA 2KINB 4TN7B 5JDHA 2RP4A 5J1GA 3ZJ1A 5JDQA 2IC6A 5C8YE 2DWGA 1D0XA 3N9MA 4O4LE 2VK9A 5FXVA 2X0LB 5GONE 4CQIA 4DMWA 3ZCIA 2EHOB 3A5XA 5JH7E 1BR2A 3FB2A 4G2AA 2CWOA 1B7TA 2WSSV 2ZMAA 3CWZB 3ZN0B 2XQYA 3E08A 2JMHA 2V7IA 2OA5A 2MTQA 4KP3C 4PFOA 4U72A 3AAIA 3RC3A 1YD8G 2VKDA 3NRXA 3J9X1 3FBZA 4ZI3D 4QXHB 3F57A 5IHYA 2DNXA 2LOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIN A;  2WMO A;  3VHL A;  3B13 A;  2WM9 A;  2WMN A; 
#chains in the Genus database with same CATH topology
 1YQ4 A;  4CXY A;  4H9Q C;  5JTG A;  5LMU T;  3AVS A;  4KX6 A;  2QGS A;  4O8S A;  4YT0 A;  5JRC B;  2CBI A;  2VL8 A;  2VWA A;  3MA9 A;  4ZI3 C;  3UUL A;  5A1L A;  4QKN A;  5HEU A;  4G63 A;  5LOV E;  1V9D A;  3PUQ A;  4LFC T;  3CK6 A;  5LHH B;  5JRE A;  1SE7 A;  2ODU A;  2YEV C;  4BAY B;  2X51 A;  2N1G A;  4KHZ F;  5JDF A;  1G8X A;  4PJM A;  5CFB A;  2XSB A;  2KWH A;  4DID B;  2DWK A;  5CJ5 A;  3I1A A;  1IBK T;  2HH7 A;  5AQS B;  1T8B A;  1MND A;  2R6G F;  1QSD A;  4JI3 T;  2VB6 A;  1HX8 A;  3LSV A;  3C51 A;  2MAW A;  1N36 T;  1KNP A;  4BA9 A;  5FL0 A;  5DQW A;  2ODV A;  3DJB A;  1J1J A;  3P50 A;  3ZJ2 A;  4UF0 A;  2XUE A;  4CXX A;  3HKE E;  4YTP A;  4AKL A;  2IIU A;  4HFC A;  3ZMT B;  3ZC1 A;  4C91 A;  2OV9 A;  4JYA T;  1UCU A;  3LFM A;  5J2U E;  4HTE A;  2CXF A;  3UQ4 A;  4WBN E;  2NW8 A;  2WU5 A;  2VQF T;  1ZP0 A;  2VVS A;  4HFH A;  3LG7 A;  5FMN A;  4EB6 E;  1U4Q A;  2HPL A;  2CHN A;  3PE0 A;  4H9O C;  5H6R B;  3UTK A;  4TV8 E;  1KK7 A;  2NWB A;  4BJM A;  2SPC A;  2FJE A;  3K8P C;  4GYR A;  5L2L A;  1WR6 A;  2LSY A;  2D5U A;  4P1N A;  4EGW A;  5JRC A;  4MLK A;  3C4W A;  3JAD A;  3TLW A;  4IL4 A;  2OLT A;  2XAJ B;  2H89 A;  5FXW A;  4GK0 E;  3CQC B;  4HFE A;  5AQK B;  4X65 T;  4LF5 T;  1MIY A;  4AQF A;  5JQG E;  3AE7 A;  4WBO A;  5FVL A;  1IJ6 A;  4YFS A;  2V26 A;  4IRE A;  2UXB T;  4IDN A;  4DR4 T;  4L0R A;  5HAX A;  2JJ9 A;  3AA7 B;  4UEM A;  3ANW B;  4LF7 T;  1US7 B;  2VL0 A;  5M4Y A;  5LHG B;  3AE4 A;  1LVF A;  4B3S T;  3KBU A;  4DUZ T;  1ZKE A;  4UVC B;  2BKN A;  3ZKR A;  3AEF A;  3RKO A;  2NP9 A;  3S4U A;  3ZPO A;  3SS1 A;  2K3W A;  3AA6 B;  3FZH B;  4XAX B;  4E7Z A;  3FBL A;  2JIW A;  3RLF F;  3ZLI A;  1UX4 A;  4JI7 T;  2CE7 A;  4JI0 T;  3EAB A;  2ZM8 A;  3UT5 E;  3AXJ B;  2JQ9 A;  4CN6 A;  1LRZ A;  3AEE A;  2NTY A;  3JAE A;  1HCI A;  4ILU A;  4A56 A;  2XAG B;  3UFG A;  2BKP A;  4MHC A;  2CMR A;  4UV9 B;  2YU1 A;  3VR8 A;  2LSI A;  5HWX A;  3NZQ A;  4X1Y E;  2GK9 A;  4DBQ A;  4ERR A;  1YQ3 A;  5AQN B;  1XDO A;  3N5L A;  3AEA A;  2BS3 A;  4O4H E;  2ZM2 A;  2KSR A;  4L9I A;  5LBQ B;  4QH5 A;  4HKA A;  2XAH B;  2JRK A;  1OED C;  1CHU A;  5ABF B;  3LDQ B;  5F8P A;  1NWM X;  2C5K T;  2KZ7 B;  4DUY T;  5AQR B;  3EHZ A;  3PUX F;  4IGU A;  4GYS A;  4YSY A;  3PJA J;  3UFE A;  4OK0 A;  4DVD A;  3A8Y C;  3P4Q A;  1ZV4 X;  4E7S A;  5HEG A;  4WW0 A;  5JR9 C;  1D0Y A;  2G0U A;  5AQJ B;  4DV6 T;  4DV4 T;  4KUM B;  2V7M A;  4PAG A;  2WZI A;  1YKE B;  4YSX A;  5HEH A;  1LKX A;  2MOZ A;  3O1J A;  4DO0 A;  4LF9 T;  3AAA B;  1KNZ A;  4Z8X A;  3NWI A;  3ANW A;  2KMF A;  3CX6 B;  2N9D A;  4FI5 A;  4WYV A;  3SFE A;  1HR0 T;  3LBX B;  5JDL A;  5L4E A;  5HXR A;  3VU7 H;  2KXP B;  1KEY A;  3KIN B;  1MMN A;  3CX7 B;  1WYC A;  2KIN B;  3ZJ1 A;  1D0X A;  3A7M A;  4O4L E;  2X0L B;  2XPK A;  3RIU A;  1W9R A;  2CWO A;  3RF1 A;  2ZMA A;  3E08 A;  2JMH A;  2V8S V;  4U72 A;  4JI5 T;  3PUV F;  3NRX A;  3J9X 1;  4QXH B;  3F57 A;  2XQ4 A;  2LOP A;  2V5C A;  5CB4 E;  3W15 B;  3KVB A;  4TV9 E;  3KBT A;  4DMV A;  4EOZ B;  2X0H A;  1QLB A;  3I0O A;  3RYF E;  4P0B A;  3JAF A;  3MAC A;  3NKZ A;  4PW8 A;  2PJQ A;  3IA3 A;  4CI2 B;  5HYA A;  3HKD E;  1UX5 A;  2FJA A;  4KMC A;  3QB5 K;  4I55 E;  5LGU B;  4EV6 A;  4HE8 A;  5FY1 A;  3KVA A;  2W00 A;  4JEU B;  4AQF C;  3KV6 A;  4HWI B;  5F5W A;  2ZM6 T;  4JEH B;  4TWD A;  5KXJ A;  3SWH A;  2LSK A;  1FMW A;  5LGT B;  3KDS E;  3PU8 A;  3UU6 A;  1YKH B;  4I50 E;  3C4X A;  4U2Y A;  5LNK A;  4ISS A;  3AE6 A;  4ZOL E;  4ILB A;  4DR3 T;  3P8C D;  2VKO A;  2XY8 B;  1KNR A;  1KFY A;  2Z6E A;  2J1D G;  3AAE B;  2A72 A;  3ONJ A;  3AE5 A;  4LF4 T;  2WWU A;  4I0U A;  2PFV A;  4M1P A;  2LM2 A;  5AQQ B;  2VAS A;  4YXD A;  3N2O A;  4DR1 T;  2VKJ A;  2WWV A;  5JDG A;  2CHO A;  4LF8 T;  4QH4 A;  5BMV E;  4DV5 T;  4EZH A;  4I4T E;  5EK2 A;  5LG4 A;  2DCF A;  4JUY A;  2XAF B;  2DLR A;  2XZE A;  3PDY A;  4UR9 A;  4B3R T;  2BZB A;  3GA8 A;  2HN1 A;  3ZT5 A;  2CBJ A;  4NPP A;  3PUW F;  3PUG A;  4AXP A;  1KF6 A;  3ZT6 A;  3LBX A;  3R6N A;  2CM0 A;  5L3E B;  5L3B B;  3D0T A;  2FJB A;  4YTN A;  4HGA A;  2LSJ A;  3ZEF B;  4U3C A;  1XMO T;  2Q9Q B;  4YY3 T;  1MIW A;  2XQ5 A;  1M62 A;  1OED E;  4X66 T;  2D2S A;  4HWF A;  2NW7 A;  3CPZ A;  2LHN A;  1DU2 A;  3V5S A;  4EYU A;  3ETU A;  3Q9D A;  3B13 A;  2E9X B;  3WAK A;  3FZM B;  2CEA A;  4GOU A;  2NR4 A;  2LHR A;  3VKH A;  2L3L A;  2XQ9 A;  2AXD S;  4XBF B;  3RPU A;  4JI4 T;  4CZZ B;  2JQH A;  3Q2M A;  3M3Z B;  5AQL B;  4Z91 A;  2YDQ A;  4CN1 A;  2D0U A;  1WR0 A;  1OXZ A;  4X64 T;  1HX1 B;  5EK3 A;  3HL6 A;  4UV8 B;  2V6Y A;  2NW9 A;  4H63 H;  4AIU A;  1XDP A;  3C50 A;  1YXR A;  2BDE A;  2QRX A;  2YOE A;  4WZX A;  2XM2 A;  5FY0 A;  3K3N A;  2D9D A;  2YK0 A;  5FVK A;  1Z8U A;  3L3P A;  3R84 B;  3MXZ A;  3B57 A;  2BKO A;  5HXH A;  2HHH T;  3OPC A;  3ZST A;  5FNV E;  2WY2 A;  4AIS A;  2N2N A;  3RRW A;  4NUV A;  1NEK A;  3CVR A;  2CXL A;  2ZM0 A;  2XQA A;  5HCJ A;  3DTO A;  4YJ3 E;  3RIU C;  3Q5W A;  1HNW T;  2K24 A;  2W67 A;  4LF6 T;  2VKH A;  3PJA A;  1J5E T;  4IE5 A;  3CX8 B;  2UU9 T;  2L8K A;  4HEA A;  2UUB T;  5KMG P;  2X66 A;  3V5U A;  2EHO A;  5FL1 A;  3ESL A;  5DAB A;  5DJQ C;  2M6B A;  4L5G A;  1MIV A;  5CA1 E;  5F3J A;  2LSG A;  2IC9 A;  2WDQ A;  5JVD E;  4ZXL A;  4X1K E;  2KWI B;  3WAJ A;  4MFR A;  4JV5 T;  3EUH A;  3I9W A;  2XHE B;  3ZN1 B;  3O1H A;  5LYJ E;  4PK6 A;  2BG9 B;  1BR4 A;  5HXE A;  5AQH B;  5AQT B;  2ACX A;  5JDN A;  5AQF B;  5H6Q B;  4TX5 A;  2LLY A;  3ONL C;  1WCR A;  3I9Y A;  2E9X A;  3QC9 A;  2IW5 B;  4YLH A;  2M67 A;  3N2K E;  3PUR A;  3TLT A;  3H3A A;  3ONX A;  1FMV A;  4AKG A;  3RRC A;  5FXZ A;  4IHJ E;  3C98 B;  3RI5 A;  4V1A v;  3O1I A;  1I94 T;  4EED A;  3LK3 B;  2FBW A;  3QNU A;  1BR0 A;  2MPK A;  3RH3 A;  1IBL T;  3T8O A;  1LVK A;  2ES0 A;  1Z0P A;  4QXB B;  2NOX A;  2I0M A;  3HR0 A;  3IHR A;  5C3J A;  4X20 E;  3OVU A;  3UUM A;  5AQV B;  3NZP A;  4P0A A;  3OKQ A;  3U3I A;  3JCF A;  1JNZ A;  1SUM B;  3CKD A;  4NXM T;  2K9A A;  4U74 A;  1MMA A;  2UUC T;  5JDH A;  2RP4 A;  2IC6 A;  2DWG A;  3N9M A;  4HWH A;  4A98 A;  3ZSS A;  4K0K T;  5GON E;  4DMW A;  1UGO A;  2VQE T;  3A5X A;  5JH7 E;  1B7T A;  3CWZ B;  1YD8 G;  2VKD A;  3U78 A;  2DNX A;  2JMK A;  1D1C A;  3UUB A;  3BQK A;  3AEB A;  5L3G B;  2K48 A;  2A3D A;  3NVO A;  2V7L A;  1W0A A;  4HWC A;  3UUN A;  3AE2 A;  3LK4 2;  3ZYL A;  4QXC B;  5FY7 A;  2Y48 B;  4U7Y A;  4DV1 T;  2XAS B;  4EEB A;  3RKG A;  2X9X A;  2WMN A;  4GIW A;  3GN5 B;  4DR6 T;  2QYW A;  2WAU A;  3M65 A;  2WS3 A;  3BK9 A;  2BG9 A;  3K1S A;  3EDV A;  2KT9 A;  3C4Z A;  4DV0 T;  4GK5 E;  4WNK A;  5LXT E;  3RYH E;  2NTX A;  1WFD A;  1T7S A;  2CLY C;  4H63 V;  4QX8 B;  4YTM A;  3SRZ A;  4EYY R;  3MZK B;  4ZZB A;  5ABH A;  4DR7 T;  1WYB A;  4IT4 A;  2UXD T;  4DBR A;  4LML A;  4P09 A;  3RQW A;  4PK4 A;  1G73 A;  4AI6 A;  1D1B A;  2KLQ A;  4DND A;  3FXE B;  3BQI A;  3NBX X;  1HF8 A;  2PBI A;  1BR1 A;  2LM9 A;  2EHO D;  2L9Q A;  4OFZ A;  1HG5 A;  1W0B A;  1WRD A;  4IE0 A;  3ABV A;  2XQ3 A;  2FJD A;  3N9P A;  1JNR A;  3AEG A;  3VKG A;  2YDS A;  4JI6 T;  4ZI2 D;  1Y01 A;  2EHO C;  4AQG A;  3AA1 B;  2LOS A;  4PK5 A;  5IUX A;  2PTF A;  3OYZ A;  1D1A A;  1SHZ C;  2XM1 A;  4ZI2 C;  3OYX A;  3P7I A;  3AXJ A;  4H9S E;  2CRB A;  1T98 A;  5BR8 T;  2E9X D;  1ZEE A;  2A9U A;  4PNI A;  3PV0 F;  5LHI B;  1VCS A;  2RPA A;  3OBV E;  2XQ7 A;  2YN6 A;  5L3D B;  4DR2 T;  3IEE A;  4U7I A;  3QUJ A;  1OED B;  2E9X C;  5LGN B;  2KND A;  4EIW A;  3ETV A;  1UK5 A;  1X79 A;  2HN2 A;  3MK7 C;  4LMJ A;  4OHF A;  5E0O A;  3PUZ F;  3EAM A;  4IDO A;  2QVA A;  1XZY A;  1HTJ F;  3G06 A;  4EAH A;  1W09 A;  4U31 A;  3JC6 D;  5ABF A;  3FXD B;  2WBL A;  3GN5 A;  2V5D A;  1IZN B;  2LKH A;  3N2G E;  1QUU A;  2LEH A;  3WI3 A;  4H9N C;  2LRL A;  2JQK A;  3IBP A;  4O2B E;  1ZHC A;  3JC6 C;  4DR5 T;  4U33 A;  5JR9 B;  3OTO T;  1MMD A;  3OJA A;  4TWF A;  1HFA A;  3UU8 A;  4KBM B;  5ETW A;  4UF0 B;  3L8R A;  4N78 D;  3RGL A;  3H37 A;  4YSZ A;  3T1H T;  4HN9 A;  4IDP A;  2UXN B;  5LJN A;  2WM9 A;  1T72 A;  5EZY E;  5L3C B;  2D0T A;  2I6H A;  3N9N A;  2W62 A;  2X9Y A;  2ZLY A;  3AE8 A;  3AE1 A;  5L3F B;  3H3M A;  1VCT A;  5ABG A;  3RYI E;  1N33 T;  2JPF A;  1L0V A;  3GWH A;  2LT3 A;  2WU2 A;  4J2C A;  3KV5 A;  4OYJ A;  3NRY A;  2PG8 A;  3EVY A;  2BBH A;  3P4R A;  2B1E A;  1HNX T;  1SA0 E;  5EK4 A;  1EZ3 A;  2ACZ A;  3RIF A;  2BS4 A;  5J0Z A;  2W66 A;  4IDZ A;  2BG9 C;  3TLV A;  3N9L A;  4X5T A;  3VHL A;  4ANJ A;  3N9Q A;  3UU5 A;  2K5B B;  3N9O A;  2C5J A;  5HXC A;  5LA6 E;  1D0Z A;  3ZT7 A;  2WQY A;  3DP7 A;  2H88 A;  4PJJ A;  4TNW A;  1OED A;  5AFU L;  2XTL A;  5AQP B;  4GKK T;  1HS7 A;  4PFP A;  4B3T T;  4DV2 T;  2MBG A;  1AJ3 A;  2WMO A;  3K3O A;  2DL1 A;  3AEC A;  4U2Z A;  4ADZ A;  1UUS A;  1R8I A;  1NAF A;  5HCM A;  5FP3 A;  2CPT A;  3SOL A;  3ZYK A;  2WB5 A;  4YJ2 E;  1HG2 A;  4C90 A;  4IDQ A;  5JR9 A;  3FZF B;  3P4W A;  3ZCJ A;  2YKS A;  4OYK A;  3AED A;  3KV4 A;  2I59 A;  4X62 T;  2LRK A;  3PTR B;  4UXN B;  4H9P C;  3P4S A;  1IBM T;  2HPJ A;  3QK6 A;  2H7O A;  3VRA A;  5J1G A;  2VK9 A;  4CQI A;  2E5L T;  1BR2 A;  2WSS V;  3TLU A;  3ZN0 B;  4KP3 C;  2OA5 A;  3AAI A;  4HFD A;  3FBZ A;  5IHY A;  1VRB A;  4JBW F;  4CI1 B;  4ZZC A;  1VOM A;  5HXS A;  3UU4 A;  4IE4 A;  3E0Z A;  3EI0 A;  4I43 B;  3KV9 A;  1XNQ T;  5J2T E;  4YHH T;  1ZOY A;  3MJX A;  3VRB A;  2Q9Q A;  2X9W A;  2P9B A;  2FUP A;  4UVB B;  4OX9 T;  2WDV A;  3I0Q A;  2VUR A;  3PUS A;  4ZS3 A;  4ZEY A;  1XWM A;  4MBQ A;  4Q25 A;  2CXD A;  5ABE A;  2V7K A;  4JLE A;  3L09 A;  3RHW A;  4TZ4 C;  2VVN A;  1U5P A;  4LFB T;  4EZ4 A;  2J47 A;  3QB5 A;  2E5V A;  1GQE A;  4UVA B;  5FKY A;  3TKL B;  3E22 E;  5KDM C;  4A97 A;  3RX6 A;  4TUY E;  1N32 T;  2W63 A;  4CI3 B;  2F4V T;  2V1D B;  1XNR T;  4O4J E;  2A2F X;  4O2A E;  5CGM A;  4TNV A;  1N34 T;  2W0G A;  3Q5X A;  3X1D A;  3FHN A;  1J5W A;  1MMG A;  3O9X A;  2XAQ B;  2LKG A;  1M7K A;  5DQV A;  2CWY A;  2IML A;  4F6R C;  5HEJ A;  2X68 A;  2H3R A;  2MYS A;  3Q5E A;  4COF A;  3T1Y T;  5HWY A;  4JI2 T;  2WP9 A;  4IST A;  4PJN A;  4CXW A;  2BG9 E;  5FXX A;  1IJ5 A;  3AA0 B;  4UIG A;  1E1H B;  4IL9 A;  2J4G A;  5LCY A;  2W2U A;  2UXX B;  3RYC E;  2X0Y A;  1MNE A;  3LK2 B;  1FIO A;  2H7V C;  3AB3 B;  2YU2 A;  3F2E A;  4QHO A;  2IHR 1;  5C2T A;  2X67 A;  4X1I E;  2C5I T;  4XZC A;  3RQU A;  4ZI7 E;  5L47 A;  2UXC T;  2DHR A;  3CML A;  4B6X A;  2W61 A;  2V7J A;  4IE6 A;  5AQM B;  4EXT A;  5LBM A;  4AQY T;  4TWH A;  4GKJ T;  3L39 A;  2BVL A;  3P4P A;  4ASK A;  4JI1 T;  1E7P A;  2XQ6 A;  3B5M A;  2YDR A;  1FEW A;  4B3M T;  1WLX A;  4QH1 A;  3FZK B;  3ZYM A;  2QA7 A;  4O4I E;  4ILC A;  3J7Y q;  3PUY F;  3CIR A;  3SFD A;  3RIA A;  5LP6 E;  1FJG T;  1XMQ T;  4AKI A;  3LJC A;  3EDU A;  4ILA A;  3C64 A;  5LJM A;  4A5X A;  4DV3 T;  1IAP A;  2UUA T;  3ZMU B;  4AKR B;  1I6Z A;  5AQG B;  1E2A A;  3HKB E;  5KX5 E;  5JDM A;  2YIN A;  2BS2 A;  5AQU B;  4UEL A;  3UQ7 A;  5AQI B;  5LG3 A;  4PJL A;  4ZS2 A;  3HI2 A;  4CN4 A;  3BQL A;  3TLS A;  5TAO A;  2CCQ A;  4HWD A;  4MAL A;  3RC8 A;  4JI8 T;  3AE3 A;  2Q9Q D;  4LMK A;  1S35 A;  2WCA A;  2X9H A;  2E2A A;  3AE9 A;  3CQX C;  4IE7 A;  2IAK A;  4KHP T;  2XJ7 A;  5CA0 E;  2LJL A;  2BVM A;  4K0U A;  2IUB A;  2Q9Q C;  2WZH A;  4QWN B;  2C0S A;  3UU3 A;  1O3X A;  4AKH A;  1NEN A;  4ZHQ E;  1H7C A;  3FZL B;  3GMI A;  2IDO B;  2JQQ A;  3HKC E;  5IWA T;  2J62 A;  3QOF A;  5LB7 B;  4QX7 B;  4HFV A;  3PUA A;  5IYZ E;  4NUU A;  3UUX B;  4IIJ E;  4BJN A;  2V6Y B;  3Q5D A;  2RA1 A;  1OWA A;  4FJO A;  1YW0 A;  4NIQ A;  3AVR A;  3ZMZ B;  2XSA A;  3MKD A;  4KI0 F;  3ZMS B;  1UUR A;  5AQO B;  2CLY B;  2CA5 A;  1Y64 B;  5HEO A;  4F8H A;  2BBJ A;  3IF8 B;  1CUN A;  1S94 A;  3HA4 A;  3K3Q C;  5ADX L;  4HFI A;  2DI4 A;  2Y6X A;  2AE9 A;  3ZMV B;  2LE8 A;  5FYM A;  4Z90 A;  5L4H A;  4DV7 T;  2Y8D A;  3KFW X;  4H9R C;  2M6I A;  3F31 A;  3VR9 A;  2V6X A;  2W4X A;  4LFA T;  2XQ8 A;  3PU3 A;  3ZC0 A;  3CQG B;  4YHJ A;  2E8I A;  2WDR A;  3O4X E;  4TN7 B;  5JDQ A;  5C8Y E;  5LMN T;  5FXV A;  3ZCI A;  2EHO B;  1X9B A;  3FB2 A;  4G2A A;  4NXN T;  1HNZ T;  2XQY A;  2V7I A;  4PFO A;  2MTQ A;  3RC3 A;  4ZI3 D;  4HFB A;  2B76 A; 
#chains in the Genus database with same CATH homology
 2JMK A;  5CB4 E;  1VRB A;  3W15 B;  3KVB A;  4CXY A;  4CI1 B;  4TV9 E;  1D1C A;  3KBT A;  4H9Q C;  1VOM A;  3BQK A;  4DMV A;  5L3G B;  3AVS A;  5HXS A;  2K48 A;  2A3D A;  4IE4 A;  3E0Z A;  4I43 B;  2QGS A;  3KV9 A;  2V7L A;  5J2T E;  4EOZ B;  4O8S A;  3UUN A;  5JRC B;  2VWA A;  2VL8 A;  3I0O A;  3MA9 A;  3RYF E;  3LK4 2;  4ZI3 C;  3ZYL A;  4P0B A;  3MJX A;  4QXC B;  5FY7 A;  2Y48 B;  3UUL A;  5A1L A;  4QKN A;  3MAC A;  2XAS B;  2Q9Q A;  4PW8 A;  2X9W A;  2PJQ A;  4CI2 B;  2P9B A;  5HYA A;  3HKD E;  2X9X A;  1UX5 A;  4KMC A;  4G63 A;  5LOV E;  2WMN A;  4GIW A;  4I55 E;  5LGU B;  4UVB B;  1V9D A;  3PUQ A;  3GN5 B;  5LHH B;  5JRE A;  4HE8 A;  3I0Q A;  5FY1 A;  3KVA A;  2W00 A;  2ODU A;  2YEV C;  3PUS A;  2WAU A;  4ZS3 A;  4BAY B;  3M65 A;  2X51 A;  2N1G A;  3BK9 A;  4JEU B;  5JDF A;  1G8X A;  4AQF C;  4MBQ A;  4PJM A;  3EDV A;  2KT9 A;  3C4Z A;  3KV6 A;  2KWH A;  2DWK A;  4GK5 E;  2CXD A;  4JEH B;  4WNK A;  3I1A A;  5LXT E;  2V7K A;  4JLE A;  2NTX A;  3RYH E;  3L09 A;  5LGT B;  3SWH A;  2LSK A;  1FMW A;  4TZ4 C;  3KDS E;  3PU8 A;  2CLY C;  1YKH B;  4H63 V;  4I50 E;  3C4X A;  4QX8 B;  1U5P A;  5LNK A;  4ISS A;  4EZ4 A;  4ZOL E;  3SRZ A;  4EYY R;  2HH7 A;  3MZK B;  1MND A;  3P8C D;  2VKO A;  1WYB A;  1QSD A;  4UVA B;  4DBR A;  2VB6 A;  3TKL B;  2Z6E A;  1HX8 A;  2J1D G;  3AAE B;  4P09 A;  2A72 A;  3E22 E;  4PK4 A;  1G73 A;  5KDM C;  4AI6 A;  2WWU A;  3RX6 A;  1D1B A;  3C51 A;  2KLQ A;  2PFV A;  4TUY E;  4DND A;  4M1P A;  3FXE B;  3BQI A;  4BA9 A;  2W63 A;  4CI3 B;  2V1D B;  2VAS A;  4O4J E;  5DQW A;  2ODV A;  3N2O A;  3DJB A;  2VKJ A;  1HF8 A;  3NBX X;  5JDG A;  2A2F X;  4O2A E;  2PBI A;  3ZJ2 A;  4UF0 A;  5BMV E;  4EZH A;  1BR1 A;  4I4T E;  2XUE A;  2LM9 A;  4CXX A;  3HKE E;  2EHO D;  2W0G A;  5EK2 A;  3Q5X A;  4AKL A;  3FHN A;  1MMG A;  2L9Q A;  5LG4 A;  2DCF A;  4OFZ A;  1HG5 A;  4JUY A;  1WRD A;  3O9X A;  2XAF B;  3ZMT B;  2DLR A;  3PDY A;  2XAQ B;  4IE0 A;  3ZC1 A;  4C91 A;  2BZB A;  3GA8 A;  3N9P A;  1UCU A;  3LFM A;  5J2U E;  4HTE A;  5DQV A;  3VKG A;  4ZI2 D;  2CWY A;  2CXF A;  3PUG A;  2EHO C;  4AXP A;  4F6R C;  4AQG A;  3LBX A;  3R6N A;  2CM0 A;  5L3E B;  2X68 A;  5L3B B;  2H3R A;  2MYS A;  3AA1 B;  4WBN E;  3D0T A;  2LOS A;  2NW8 A;  4PK5 A;  5HWY A;  3OYZ A;  4HGA A;  1D1A A;  4IST A;  2LSJ A;  1SHZ C;  3LG7 A;  4PJN A;  5FMN A;  4ZI2 C;  3ZEF B;  4CXW A;  5FXX A;  3OYX A;  1IJ5 A;  3P7I A;  3AA0 B;  4EB6 E;  1U4Q A;  4UIG A;  1E1H B;  5LCY A;  2Q9Q B;  2UXX B;  1MIW A;  2HPL A;  4H9S E;  3PE0 A;  3RYC E;  4H9O C;  5H6R B;  3UTK A;  1MNE A;  3LK2 B;  4TV8 E;  1FIO A;  2D2S A;  1T98 A;  2H7V C;  2NW7 A;  3CPZ A;  1KK7 A;  2LHN A;  2NWB A;  2YU2 A;  2E9X D;  2SPC A;  3AB3 B;  4BJM A;  1ZEE A;  3F2E A;  4QHO A;  3V5S A;  3K8P C;  4GYR A;  4PNI A;  4EYU A;  5L2L A;  2X67 A;  5LHI B;  1WR6 A;  2LSY A;  2D5U A;  3ETU A;  4X1I E;  3Q9D A;  3B13 A;  2C5I T;  2E9X B;  3OBV E;  3WAK A;  2CEA A;  4GOU A;  5JRC A;  5L3D B;  4MLK A;  3C4W A;  4XZC A;  3IEE A;  2LHR A;  3VKH A;  2L3L A;  3QUJ A;  4ZI7 E;  5LGN B;  2E9X C;  2DHR A;  4XBF B;  2KND A;  3CML A;  4EIW A;  3ETV A;  4B6X A;  3RPU A;  2W61 A;  1X79 A;  2V7J A;  3MK7 C;  4IE6 A;  5E0O A;  4OHF A;  3Q2M A;  4CZZ B;  2XAJ B;  4EXT A;  5LBM A;  1HTJ F;  2D0U A;  5FXW A;  4EAH A;  4GK0 E;  3JC6 D;  3CQC B;  1OXZ A;  2BVL A;  3FXD B;  2WBL A;  3GN5 A;  4ASK A;  1IZN B;  1MIY A;  3N2G E;  4AQF A;  1QUU A;  2LEH A;  5EK3 A;  3WI3 A;  3HL6 A;  5JQG E;  1FEW A;  4UV8 B;  4WBO A;  2NW9 A;  1IJ6 A;  4YFS A;  2V26 A;  4H63 H;  4H9N C;  3IBP A;  4O2B E;  3C50 A;  1ZHC A;  4L0R A;  3JC6 C;  5HAX A;  2JJ9 A;  2BDE A;  5JR9 B;  1WLX A;  3AA7 B;  4UEM A;  1MMD A;  3ANW B;  1US7 B;  3ZYM A;  2QA7 A;  4O4I E;  5M4Y A;  3OJA A;  5LHG B;  5FY0 A;  3J7Y q;  1HFA A;  3K3N A;  2YK0 A;  4KBM B;  1LVF A;  3L3P A;  5ETW A;  3R84 B;  3KBU A;  3MXZ A;  4UF0 B;  5LP6 E;  3B57 A;  4AKI A;  1ZKE A;  5HXH A;  3LJC A;  4N78 D;  4UVC B;  3EDU A;  3C64 A;  5FNV E;  5LJM A;  3H37 A;  3RKO A;  2N2N A;  2NP9 A;  4HN9 A;  1IAP A;  3S4U A;  3RRW A;  3ZMU B;  2UXN B;  4NUV A;  4AKR B;  3CVR A;  5LJN A;  2WM9 A;  3ZPO A;  3HKB E;  3SS1 A;  2CXL A;  2ZM0 A;  5JDM A;  5KX5 E;  2YIN A;  5EZY E;  5L3C B;  2D0T A;  3AA6 B;  3N9N A;  4UEL A;  2W62 A;  3DTO A;  4XAX B;  4YJ3 E;  4E7Z A;  2X9Y A;  4PJL A;  3Q5W A;  3FBL A;  2K24 A;  2ZLY A;  4ZS2 A;  3HI2 A;  3ZLI A;  1UX4 A;  3BQL A;  2CE7 A;  5TAO A;  2CCQ A;  2VKH A;  4MAL A;  3RC8 A;  2Q9Q D;  5L3F B;  2ZM8 A;  1S35 A;  3UT5 E;  3RYI E;  4IE5 A;  3CX8 B;  2JPF A;  2X9H A;  3CQX C;  2L8K A;  1LRZ A;  3GWH A;  4HEA A;  4IE7 A;  2LT3 A;  2NTY A;  2IAK A;  5KMG P;  1HCI A;  2X66 A;  4ILU A;  3V5U A;  4A56 A;  2XAG B;  3U78 A;  2EHO A;  4MHC A;  4J2C A;  2CMR A;  3ESL A;  3KV5 A;  5DAB A;  5CA0 E;  2LJL A;  2BVM A;  4OYJ A;  4L5G A;  5DJQ C;  4UV9 B;  4K0U A;  2YU1 A;  3NRY A;  2PG8 A;  1MIV A;  5CA1 E;  5F3J A;  2Q9Q C;  2LSG A;  4QWN B;  2C0S A;  2LSI A;  2IC9 A;  3EVY A;  5JVD E;  5HWX A;  4X1K E;  2KWI B;  1O3X A;  3NZQ A;  4X1Y E;  2B1E A;  4MFR A;  3WAJ A;  4AKH A;  3EUH A;  3I9W A;  1SA0 E;  4ZHQ E;  2XHE B;  2GK9 A;  3ZN1 B;  3O1H A;  1H7C A;  4DBQ A;  3GMI A;  5EK4 A;  5LYJ E;  4ERR A;  4PK6 A;  1EZ3 A;  1BR4 A;  3N5L A;  5HXE A;  2JQQ A;  3HKC E;  4O4H E;  2ZM2 A;  4L9I A;  5LBQ B;  2ACX A;  4IDZ A;  4HKA A;  3N9L A;  3VHL A;  4ANJ A;  2XAH B;  3N9Q A;  2JRK A;  5JDN A;  4QX7 B;  4HFV A;  3PUA A;  5IYZ E;  4NUU A;  3UUX B;  2K5B B;  5H6Q B;  4TX5 A;  3N9O A;  4IIJ E;  5F8P A;  2C5J A;  1NWM X;  4BJN A;  5HXC A;  5LA6 E;  1D0Z A;  2RA1 A;  3I9Y A;  1OWA A;  2E9X A;  3QC9 A;  2IW5 B;  4FJO A;  1YW0 A;  4YLH A;  2M67 A;  3AVR A;  3N2K E;  2C5K T;  3ZMZ B;  2KZ7 B;  3DP7 A;  3MKD A;  3PUR A;  4PJJ A;  4IGU A;  3ZMS B;  5AFU L;  4GYS A;  3H3A A;  2CLY B;  3ONX A;  2CA5 A;  3UFE A;  4OK0 A;  1Y64 B;  4DVD A;  1FMV A;  4AKG A;  2XTL A;  5FXZ A;  3RRC A;  4IHJ E;  1ZV4 X;  4E7S A;  3C98 B;  3IF8 B;  1CUN A;  4WW0 A;  1S94 A;  1HS7 A;  5JR9 C;  1D0Y A;  4PFP A;  4V1A v;  2G0U A;  3O1I A;  3HA4 A;  3K3Q C;  5ADX L;  2DI4 A;  2MBG A;  1AJ3 A;  2WMO A;  3LK3 B;  3K3O A;  2Y6X A;  4ADZ A;  4KUM B;  1BR0 A;  2V7M A;  4PAG A;  3RH3 A;  1NAF A;  5FP3 A;  3SOL A;  1YKE B;  3T8O A;  3ZMV B;  2LE8 A;  1LVK A;  1LKX A;  2MOZ A;  5FYM A;  3O1J A;  3ZYK A;  1HG2 A;  2ES0 A;  4DO0 A;  4YJ2 E;  4C90 A;  3AAA B;  2Y8D A;  3KFW X;  4H9R C;  5JR9 A;  1KNZ A;  4Z8X A;  3F31 A;  1Z0P A;  3ANW A;  4QXB B;  2KMF A;  2NOX A;  3CX6 B;  2N9D A;  3HR0 A;  3IHR A;  4X20 E;  4FI5 A;  3ZCJ A;  3PU3 A;  4OYK A;  3UUM A;  3NZP A;  3KV4 A;  3ZC0 A;  2I59 A;  3LBX B;  4P0A A;  3OKQ A;  3PTR B;  3CQG B;  4H9P C;  4UXN B;  5JDL A;  5HXR A;  3U3I A;  3CKD A;  4YHJ A;  3VU7 H;  2E8I A;  2K9A A;  2KXP B;  2HPJ A;  4U74 A;  1MMA A;  3O4X E;  2H7O A;  3KIN B;  3QK6 A;  1MMN A;  3CX7 B;  1WYC A;  2KIN B;  4TN7 B;  5JDH A;  2RP4 A;  5J1G A;  3ZJ1 A;  5JDQ A;  2IC6 A;  5C8Y E;  2DWG A;  1D0X A;  3N9M A;  4O4L E;  2VK9 A;  5FXV A;  2X0L B;  5GON E;  4CQI A;  4DMW A;  3ZCI A;  2EHO B;  3A5X A;  5JH7 E;  1BR2 A;  3FB2 A;  4G2A A;  2CWO A;  1B7T A;  2WSS V;  2ZMA A;  3CWZ B;  3ZN0 B;  2XQY A;  3E08 A;  2JMH A;  2V7I A;  2OA5 A;  2MTQ A;  4KP3 C;  4PFO A;  4U72 A;  3AAI A;  3RC3 A;  1YD8 G;  2VKD A;  3NRX A;  3J9X 1;  3FBZ A;  4ZI3 D;  4QXH B;  3F57 A;  5IHY A;  2DNX A;  2LOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...