3VHLA

Crystal structure of the dhr-2 domain of dock8 in complex with cdc42 (t17n mutant)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
264
Chain Sequence
FGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 8
total genus 87
structure length 264
sequence length 273
ec nomenclature
pdb deposition date 2011-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vhlA02
2YINA 2WMNA 2WMOA 3B13A 3VHLA 2WM9A
chains in the Genus database with same CATH superfamily
3N5LA 3L8RA 3FZMB 4TWDA 5DABA 4G63A 2WMOA 4YHHT 3IBPA 3P8CD 2BS4A 4KHZF 5AQRB 4DMVA 5JRCA 2X51A 2IAKA 2Y48B 2VK9A 2WCAA 5JR9C 3TLSA 2CLYC 4HEAA 5J2UE 5JDNA 2FJAA 1I94T 3RC8A 2LJLA 3PV0F 3ZYMA 3GN5B 4UF0B 2CWYA 3ZCJA 3GN5A 2V7LA 3M65A 2UXNB 5ABFA 3HL6A 3KBUA 4IREA 3ZMSB 4LF8T 2UXCT 2D0TA 2ZM2A 2IIUA 4K0UA 4Z8XA 4H63V 5IWAT 4O2BE 2C5IT 5LHIB 2WP9A 3AE1A 4U72A 4ZS3A 5FL0A 5JDGA 2CHNA 2A9UA 2D2SA 2ES0A 4HWDA 3AVRA 1R8IA 5AQQB 2LSGA 5AQHB 5HEGA 5AQLB 1UCUA 2K3WA 5ABGA 3WI3A 4ZXLA 3GMIA 3MACA 3ABVA 4LFCT 1JNRA 2LT3A 4HWIB 3EUHA 2J62A 5KDMC 1VRBA 4AKLA 1KNZA 1YQ3A 2YKSA 5IYZE 2H89A 1SUMB 1NWMX 3AE8A 3CKDA 3FZHB 3JAFA 2LSKA 4MLKA 2E9XB 2LRLA 4PK5A 4WW0A 2V7IA 1G8XA 2VASA 4QH4A 3QC9A 4I43B 3OKQA 4IE7A 3EDUA 1ZEEA 3AAIA 3ZT7A 5AQVB 3ZMTB 2WU5A 4HFHA 4KUMB 4NPPA 4B3ST 3RYIE 1Z8UA 1OWAA 3O1JA 4H9RC 4AQYT 1I6ZA 2XQAA 2RA1A 3C4ZA 3JC6C 5J1GA 3O9XA 2G0UA 5JDFA 2CM0A 3C4WA 4X1KE 4EGWA 5LHHB 2JPFA 3BQKA 2RP4A 5HWYA 5KXJA 3CMLA 2UU9T 1Z0PA 1KNRA 3AEBA 5FVKA 3TLTA 3C98B 2E5LT 4KP3C 4LF6T 4CZZB 5JVDE 3AA7B 4U3CA 2FBWA 3NRXA 4IE0A 4IGUA 2ZLYA 5ABHA 5F8PA 2B1EA 1B7TA 2PTFA 3PDYA 2FUPA 1VOMA 2BS3A 3N9MA 4H9OC 3R84B 4ZI3C 1T8BA 4ANJA 4PJNA 1N34T 4X66T 4Q25A 3VR9A 2IUBA 4YY3T 3BQIA 2D0UA 2QYWA 2LEHA 1W9RA 5LB7B 2CPTA 4E7SA 4DUYT 1XMOT 3EABA 4IE5A 2HHHT 5LMNT 2XQ3A 2RPAA 1YXRA 4HN9A 3QUJA 4ILAA 4A98A 3MZKB 4GKJT 5AQJB 1WLXA 4NUVA 1LKXA 2WU2A 2NP9A 3FXEB 3IF8B 4GYSA 1D0YA 4O4IE 1XNQT 1H7CA 4L0RA 1FEWA 4AI6A 4IE4A 3SFEA 2YDSA 4DV1T 4OX9T 2OV9A 3TKLB 3CVRA 2XQ8A 3ONXA 4EEBA 3DTOA 3VKHA 5EK2A 2LM9A 5FP3A 3OTOT 4UVCB 1CUNA 4HE8A 4EIWA 5HXRA 4PAGA 4MFRA 2LSJA 3PJAA 3S4UA 2FJEA 5JQGE 3UU3A 5LG3A 4AQFC 1BR2A 1J5WA 3K1SA 4PK4A 1KFYA 1T98A 2R6GF 2W67A 4LMJA 5DQVA 3U78A 4ZS2A 4CI1B 3OVUA 5HEUA 3UFGA 4DR3T 2LRKA 4HFBA 1IBLT 4JI7T 3RYCE 3NKZA 2P9BA 4GYRA 4QXBB 4UVBB 2X0YA 3ZN1B 4EZHA 2XJ7A 1ZKEA 4YT0A 1OEDE 3UU4A 2X9HA 4KHPT 2KWHA 1O3XA 3RQWA 5TAOA 2XAJB 2HPJA 2XSBA 4C91A 1HNXT 2JQKA 3AXJA 5HCMA 4PNIA 2BVMA 4ZOLE 1MNEA 4DMWA 2E5VA 2F4VT 3ZN0B 4DV0T 3M3ZB 5HXCA 1HG5A 5LA6E 4U2YA 5ABFB 3CQGB 1S35A 3T8OA 4DV5T 4TWHA 3RH3A 2VQFT 3RLFF 5JDLA 5ADXL 3J7Yq 3CK6A 2L9QA 2W61A 3HA4A 3KV4A 3I0OA 2WB5A 4ILBA 3F57A 1SA0E 3RHWA 1X9BA 4KI0F 5LCYA 5L4EA 2LKHA 3Q5DA 3IA3A 4O4HE 4KBMB 4AQGA 4UVAB 3SFDA 3OJAA 4YFSA 2WWUA 2XQ6A 3B13A 1IJ5A 3P50A 1IAPA 4IDPA 3L3PA 4X1IE 3RYFE 3UFEA 3UT5E 2JMHA 5BMVE 2YU2A 2V7MA 3UU8A 1HF8A 2ZM0A 1W0AA 3AE4A 4DNDA 5CA1E 3JCFA 3ZJ2A 3UQ7A 2A3DA 5LMUT 2UXDT 3VU7H 3KV9A 4UV8B 2CA5A 4CN4A 2WWVA 4X64T 1XDPA 4DR2T 1UX4A 1MIWA 4IDZA 4UIGA 2GK9A 4JI5T 5ETWA 2BKOA 2WDRA 4MALA 2PG8A 3U3IA 2LOPA 1HCIA 1WYBA 4YSZA 3N9LA 5HAXA 4C90A 3K3OA 1D0XA 5LP6E 3B5MA 1YKEB 1IBMT 2CCQA 4ZHQE 4TNVA 1HX1B 2VKJA 5J2TE 2XUEA 2IC9A 4KX6A 3WAKA 2VQET 2WM9A 2NW8A 4DV4T 2CLYB 2CEAA 1YD8G 3CQXC 2V8SV 3NBXX 3AXJB 3PUQA 3P4QA 3RIUC 3C50A 5C2TA 4N78D 2H7OA 2KWIB 2XQ4A 3QNUA 3ZSTA 4JI4T 1XWMA 2YU1A 3AA0B 3ZMZB 3H3MA 2CRBA 4HFIA 5CJ5A 2BG9C 3RI5A 2LM2A 1SE7A 1KNPA 4LMKA 4IDQA 4EEDA 5HYAA 3ZC0A 5FXXA 4GIWA 2UUBT 2M6BA 1US7B 5LG4A 4PW8A 3Q5WA 2HN1A 4HWCA 3N9PA 1WFDA 4UR9A 2AXDS 3AE9A 4DIDB 2IHR1 2L8KA 2PFVA 3MA9A 4QXCB 1N32T 1WR0A 2I6HA 2WY2A 4TV9E 2V7JA 3RIFA 3SWHA 4HFCA 4DV7T 4JYAT 3A7MA 4CN1A 2W66A 1G73A 5HWXA 2V1DB 2ODVA 4ZI2D 5J0ZA 1N36T 2KSRA 4X1YE 1LVFA 2CBIA 2WQYA 3H3AA 2JRKA 4GK5E 2HH7A 2HN2A 4EZ4A 3UTKA 1J5ET 4GKKT 2M67A 4I50E 5AQTB 2V7KA 5FNVE 3UQ4A 2BBHA 2XASB 4JLEA 1UURA 1JNZA 2V5DA 4DR4T 4F6RC 2Q9QC 1V9DA 1Y01A 2WSSV 1T72A 2X9YA 2BKPA 3LK42 2EHOA 3MKDA 1YKHB 3AB3B 4OYJA 2ZM6T 3J9X1 1HS7A 5LOVE 1HNWT 1NAFA 2BG9E 3N2KE 4EYYR 4YSYA 1UX5A 4QHOA 2EHOC 3N9NA 3PUXF 4DO0A 3RC3A 4P1NA 2DNXA 3QB5A 4P0BA 2L3LA 3EDVA 3EVYA 4QWNB 3OYXA 2X67A 3A5XA 3JC6D 2BS2A 4ISSA 3PUAA 2V6YA 2KINB 4HFVA 3N9QA 2IW5B 4PK6A 3BK9A 3ZLIA 2OLTA 4ADZA 5HXHA 1HR0T 2XHEB 5C3JA 5KMGP 4EV6A 4NUUA 2XSAA 2YOEA 2M6IA 4JI3T 4LFBT 4H63H 1AJ3A 4GK0E 5LGUB 1M7KA 1U4QA 2LHNA 4JI6T 2C5JA 3UU5A 4MBQA 4WZXA 5AQPB 3K3QC 2EHOD 2LOSA 1MMGA 3FBZA 3QOFA 3R6NA 4CXXA 4HFDA 4H9QC 4WBNE 1D1AA 2D5UA 2DI4A 4L5GA 3FXDB 2KMFA 5FMNA 1N33T 1XDOA 3RF1A 5A1LA 1S94A 3KVBA 5FXVA 3CX8B 4ZEYA 4U74A 5H6QB 3LBXB 3PUGA 5ABEA 4AIUA 2WDVA 1QSDA 3FBLA 4UXNB 3PU3A 1DU2A 3TLVA 3NZQA 1M62A 1KK7A 2LLYA 2XM2A 4ERRA 4YJ2E 3UUXB 3BQLA 1E1HB 1IJ6A 3SOLA 2V5CA 5M4YA 3ZMUB 2OA5A 1IBKT 4U33A 2MPKA 3AAEB 1ZP0A 2XQ9A 3OBVE 3Q2MA 4H9SE 4XZCA 3LSVA 1BR1A 2WMNA 2UUCT 4TUYE 3ZJ1A 2Y6XA 3CWZB 2JJ9A 2NWBA 5IHYA 4X65T 2QA7A 3AECA 4OYKA 4QX8B 2Z6EA 3LBXA 1WR6A 4B3TT 4YSXA 4AKHA 3FZFB 4DV3T 4K0KT 3EHZA 1D1CA 3JADA 5JH7E 5HEJA 2MTQA 3T1YT 2XAFB 3FB2A 2DLRA 3A8YC 3EAMA 3MK7C 5L4HA 3ZMVB 5FYMA 4YTNA 2H88A 4DR1T 3UULA 3RIUA 3PUVF 4IDNA 1NEKA 5HEHA 1YW0A 1GQEA 2B76A 2DHRA 4TX5A 5F3JA 4AXPA 4JI1T 2VB6A 2X66A 4IL4A 2ZMAA 5AQIB 3CQCB 3HKCE 3X1DA 5HXEA 2MBGA 4A56A 1FIOA 2WBLA 3L09A 3LJCA 4H9NC 4U31A 5EK3A 1XMQT 3C51A 2YDRA 2V26A 1HX8A 5KX5E 5L3CB 2LSYA 5JRCB 1UK5A 2XQ7A 5L3BB 4ZI7E 2X0LB 2VWAA 2QGSA 2JQQA 4DV2T 3RRWA 5AQGB 1ZOYA 1UGOA 3UUBA 2JQHA 2Q9QB 1ZV4X 3GWHA 5JR9A 4DR6T 1ZHCA 3B57A 3CX6B 4OHFA 5EZYE 2J4GA 3ZKRA 3L39A 3RKGA 2DCFA 4EYUA 2HPLA 2XQYA 2EHOB 2K24A 3UUMA 2W00A 2XPKA 3N9OA 3OYZA 4IHJE 3KV6A 5HEOA 3VRBA 3O1IA 4LF9T 4ILUA 3FZKB 3LDQB 3VR8A 3SRZA 4EAHA 2PBIA 3MJXA 4X20E 3PU8A 1T7SA 1D1BA 1LVKA 5GONE 4ILCA 4F8HA 1MIYA 3PUSA 1HFAA 4JI2T 1BR0A 2QRXA 4MHCA 3HKEE 3T1HT 3EI0A 1OEDC 3P4WA 4OFZA 1HTJF 4AKGA 4PJJA 2CXLA 4JEHB 3LK2B 1MNDA 1MMDA 2E8IA 2BBJA 2JMKA 4PFOA 1L0VA 3SS1A 5LYJE 4LF5T 3WAJA 3CIRA 4JI0T 1QUUA 2VVSA 2X0HA 3IHRA 3CPZA 3PTRB 4JBWF 3K3NA 4QH1A 2N2NA 3KFWX 5DJQC 4P09A 4AISA 2J1DG 4B6XA 1LRZA 3Q9DA 3PUYF 1HNZT 3ZSSA 3V5SA 5LNKA 4BAYB 5JR9B 2XQ5A 2NW7A 2WZHA 4J2CA 3F2EA 2BG9B 4XAXB 5JDHA 3AE7A 3HKBE 1IZNB 3P4PA 2PJQA 4V1Av 1E2AA 3C4XA 1WYCA 1WCRA 3NWIA 4DBQA 1MMNA 3PJAJ 3ETVA 3RPUA 4A97A 2LKGA 3CX7B 2XM1A 3ONLC 4GOUA 3AE3A 4NIQA 4TV8E 5AQMB 4AQFA 4X62T 4IT4A 4B3MT 2WZIA 2KLQA 4AKRB 3RX6A 5LHGB 3V5UA 3P4SA 3ZYLA 4UF0A 4JEUB 3AVSA 2WDQA 3NZPA 3RYHE 5HXSA 4CXYA 2NTXA 4BA9A 2DWKA 4HTEA 5E0OA 2NR4A 4I0UA 4TNWA 4COFA 4WNKA 5C8YE 4DR5T 5LBMA 2D9DA 3Q5XA 5AQNB 4YXDA 3AA1B 4WYVA 2H3RA 2LE8A 5L3FB 3AA6B 5JREA 1FJGT 1KF6A 3I9WA 3NVOA 4YTMA 5FXWA 2IMLA 4AKIA 1EZ3A 2KXPB 2C5KT 2BZBA 2W63A 2X9XA 1E7PA 3I0QA 3LFMA 1KEYA 3ZC1A 4LF7T 1XNRT 3C64A 5EK4A 4ASKA 4HFEA 3AEEA 3ANWB 1D0ZA 2FJBA 1OEDA 4QX7B 2A72A 4PJMA 2UXXB 2CHOA 4HWHA 3RGLA 2W4XA 3LK3B 4CI2B 2ACXA 4CQIA 2XZEA 4IDOA 2XAQB 4IE6A 1NENA 2K5BB 3RQUA 5LGTB 5L47A 3AEAA 3KV5A 2V6XA 2W2UA 3N2OA 5L3GB 3TLWA 1MMAA 2KT9A 4EB6E 3E22E 2K9AA 5LJMA 2WS3A 3TLUA 3IEEA 2JIWA 4O4JE 4U2ZA 3I9YA 2E9XD 2XAGB 4Z90A 4P0AA 3O4XE 5L3DB 3DJBA 4UELA 5CB4E 2W0GA 3F31A 4O4LE 5FY7A 3RRCA 3W15B 4QXHB 1W09A 2DWGA 3G06A 4YTPA 5AFUL 1XZYA 4DVDA 4CN6A 1QLBA 3I1AA 4U7YA 5JTGA 3ZYKA 4E7ZA 2CXDA 2NW9A 3ZPOA 2K48A 5JDMA 2NTYA 4ZZBA 2JQ9A 2IDOB 4EOZB 3MXZA 4DR7T 3NRYA 2YN6A 2V6YB 2C0SA 4LFAT 2I0MA 2CBJA 1HG2A 1FMWA 3GA8A 5CA0E 4CI3B 5IUXA 2BDEA 4DUZT 2W62A 3ESLA 3AEGA 4I55E 1FMVA 2VKDA 5AQUB 4X5TA 3K8PC 2MOZA 4KMCA 2VURA 3ETUA 2QVAA 4DV6T 5AQOB 1Y64B 2ODUA 3LG7A 4PFPA 3D0TA 2XTLA 4YJ3E 1MIVA 3QB5K 3VHLA 3ZEFB 5BR8T 2CMRA 3AEDA 1YQ4A 2Q9QD 1OXZA 3FHNA 4YHJA 2YINA 5FVLA 5LBQB 5JDQA 4UV9B 4LF4T 4JUYA 4B3RT 2FJDA 4U7IA 3VRAA 3P7IA 4TN7B 4ZI3D 2SPCA 2CXFA 2X9WA 4JI8T 2VL0A 4XBFB 4H9PC 3UU6A 3PUWF 3ZCIA 2UXBT 5DQWA 2BVLA 4HGAA 2XAHB 2N1GA 2VVNA 5F5WA 1VCTA 4G2AA 3AE6A 4PJLA 3FZLB 3JAEA 4BJMA 2X68A 4HWFA 3KDSE 5FL1A 3UUNA 4O8SA 4EXTA 4OK0A 4IL9A 4UEMA 4ZZCA 3ONJA 2LSIA 3HKDE 4HKAA 2BG9A 4LMLA 3AE5A 1J1JA 2E9XC 4FJOA 3AE2A 5FY1A 5FXZA 4QH5A 5FY0A 5CGMA 1U5PA 5AQSB 5L3EB 5AQKB 3PURA 3ZT6A 1SHZC 4I4TE 4ZI2C 3DP7A 2AE9A 2WAUA 2YDQA 5CFBA 4DBRA 2ACZA 2CE7A 2MAWA 3E08A 5AQFB 2J47A 4TZ4C 3VKGA 3E0ZA 2YEVC 2UUAT 3RIAA 3HI2A 3ZT5A 5L2LA 2E2AA 3QK6A 2I59A 2YK0A 2KZ7B 2VKHA 3P4RA 4ISTA 1BR4A 2LHRA 5FKYA 2XY8B 3PE0A 2N9DA 5LJNA 4TWFA 3KINB 2A2FX 4WBOA 2H7VC 4L9IA 3N2GE 1CHUA 2BKNA 3AEFA 3PUZF 1UUSA 4A5XA 4BJNA 1W0BA 2KNDA 2E9XA 3KVAA 4CXWA 5LXTE 2NOXA 4QKNA 2IC6A 3HR0A 3KBTA 3H37A 4IIJE 3AAAB 1OEDB 4M1PA 1VCSA 2Y8DA 3ANWA 3O1HA 4Z91A 3OPCA 4O2AE 5LGNB 2ZM8A 2CWOA 5HCJA 3Q5EA 2VL8A 4FI5A 5H6RB 4NXMT 4NXNT 1WRDA 2Q9QA 4YLHA 3RKOA 2MYSA 4JV5T 1X79A 2VKOA 2DL1A
chains in the Genus database with same CATH topology
3N5LA 5DABA 4G63A 2WMOA 3IBPA 3P8CD 4DMVA 5JRCA 2X51A 2IAKA 2Y48B 2VK9A 5JR9C 2CLYC 4HEAA 5J2UE 5JDNA 3RC8A 2LJLA 3ZYMA 3GN5B 4UF0B 2CWYA 3ZCJA 3GN5A 2V7LA 3M65A 2UXNB 3HL6A 3KBUA 3ZMSB 2D0TA 2ZM2A 4K0UA 4Z8XA 4H63V 4O2BE 2C5IT 5LHIB 4U72A 4ZS3A 5JDGA 2D2SA 2ES0A 3AVRA 2LSGA 1UCUA 3WI3A 3GMIA 3MACA 2LT3A 3EUHA 1VRBA 4AKLA 5IYZE 1NWMX 3CKDA 2LSKA 4MLKA 2E9XB 4PK5A 4WW0A 2V7IA 1G8XA 2VASA 3QC9A 4I43B 3OKQA 4IE7A 3EDUA 1ZEEA 3AAIA 3ZMTB 4KUMB 3RYIE 1OWAA 3O1JA 4H9RC 2RA1A 3C4ZA 3JC6C 5J1GA 3O9XA 2G0UA 5JDFA 2CM0A 3C4WA 4X1KE 5LHHB 2JPFA 3BQKA 2RP4A 5HWYA 3CMLA 1Z0PA 3C98B 4KP3C 4CZZB 5JVDE 3AA7B 3NRXA 4IE0A 4IGUA 2ZLYA 5F8PA 2B1EA 1B7TA 3PDYA 3R84B 1VOMA 3N9MA 4H9OC 4ZI3C 4ANJA 4PJNA 3BQIA 2D0UA 2LEHA 4E7SA 4IE5A 4HN9A 3QUJA 3MZKB 1WLXA 4NUVA 1LKXA 2NP9A 3FXEB 3IF8B 4GYSA 1D0YA 4O4IE 1H7CA 4L0RA 1FEWA 4AI6A 4IE4A 3TKLB 3CVRA 3ONXA 3VKHA 3DTOA 5EK2A 2LM9A 5FP3A 4UVCB 1CUNA 4HE8A 4EIWA 5HXRA 4PAGA 4MFRA 2LSJA 3S4UA 5JQGE 4AQFC 1BR2A 4PK4A 1T98A 3U78A 4CI1B 5DQVA 4ZS2A 3RYCE 4EZHA 2P9BA 4GYRA 4QXBB 4UVBB 3ZN1B 1ZKEA 2X9HA 2KWHA 1O3XA 5TAOA 2XAJB 2HPJA 4C91A 4PNIA 2BVMA 4ZOLE 1MNEA 4DMWA 3ZN0B 5HXCA 1HG5A 5LA6E 3CQGB 1S35A 3T8OA 3RH3A 5JDLA 3J7Yq 5ADXL 2L9QA 2W61A 3HA4A 3KV4A 3I0OA 3ZYLA 1KNZA 3F57A 1SA0E 5LCYA 4O4HE 4KBMB 4AQGA 4UVAB 3OJAA 4YFSA 2WWUA 3B13A 1IJ5A 3RYFE 1IAPA 4F6RC 3L3PA 4X1IE 3UT5E 3UFEA 5BMVE 2JMHA 5CA1E 2YU2A 2V7MA 1HF8A 2ZM0A 4DNDA 3ZJ2A 2A3DA 3VU7H 3KV9A 4UV8B 2CA5A 1UX4A 1MIWA 4IDZA 4UIGA 2GK9A 5ETWA 4MALA 2PG8A 3U3IA 2LOPA 1HCIA 1WYBA 3N9LA 5HAXA 4C90A 3K3OA 1D0XA 5LP6E 1YKEB 2CCQA 4ZHQE 2VKJA 5J2TE 2XUEA 2IC9A 3WAKA 2WM9A 2NW8A 2CLYB 2CEAA 1YD8G 3CQXC 3NBXX 3PUQA 3C50A 4N78D 2H7OA 2KWIB 2YU1A 3AA0B 3ZMZB 5HYAA 3ZC0A 5FXXA 4GIWA 1US7B 5LG4A 4PW8A 3Q5WA 3N9PA 2L8KA 2PFVA 3MA9A 4QXCB 4TV9E 2V7JA 3SWHA 1G73A 5HWXA 2ODVA 2V1DB 4ZI2D 4X1YE 1LVFA 4GK5E 3H3AA 2JRKA 4EZ4A 2HH7A 3UTKA 2M67A 4I50E 2V7KA 5FNVE 2XASB 4JLEA 2Q9QC 1V9DA 2WSSV 2X9YA 3N2OA 3LK42 2EHOA 3MKDA 1YKHB 3AB3B 4OYJA 3J9X1 1HS7A 5LOVE 1NAFA 3N2KE 4EYYR 1UX5A 4QHOA 2EHOC 3N9NA 4DO0A 3RC3A 2DNXA 4P0BA 2L3LA 3EDVA 3EVYA 4QWNB 3OYXA 2X67A 3A5XA 3JC6D 4ISSA 3PUAA 4HFVA 2KINB 3N9QA 2IW5B 4PK6A 3BK9A 3ZLIA 4ADZA 5HXHA 2XHEB 5KMGP 4NUUA 1AJ3A 4H63H 4GK0E 5LGUB 2LHNA 1U4QA 2C5JA 4MBQA 3K3QC 2EHOD 2LOSA 1MMGA 3FBZA 4CXXA 3R6NA 4WBNE 4H9QC 1D1AA 2D5UA 2DI4A 4L5GA 3FXDB 2KMFA 5FMNA 5A1LA 1S94A 3KVBA 5FXVA 3CX8B 4U74A 5H6QB 3LBXB 3PUGA 1QSDA 3FBLA 4UXNB 3PU3A 3NZQA 4ERRA 1KK7A 4YJ2E 3UUXB 3BQLA 1E1HB 1IJ6A 3SOLA 5M4YA 3ZMUB 2OA5A 4XZCA 3AAEB 3Q2MA 3OBVE 4H9SE 1BR1A 2WMNA 4TUYE 3ZJ1A 2Y6XA 3CWZB 2JJ9A 2NWBA 5IHYA 2QA7A 4OYKA 4QX8B 2Z6EA 3LBXA 1WR6A 4AKHA 5JH7E 1D1CA 2MTQA 2XAFB 3FB2A 2DLRA 3ZMVB 3MK7C 5FYMA 3UULA 5F3JA 1YW0A 2DHRA 4TX5A 4AXPA 2VB6A 2X66A 2ZMAA 5HXEA 3CQCB 3HKCE 2MBGA 4A56A 1FIOA 2WBLA 3L09A 3LJCA 4H9NC 5EK3A 3C51A 2V26A 1HX8A 5KX5E 5L3CB 2LSYA 5JRCB 5L3BB 4ZI7E 2X0LB 2VWAA 2QGSA 2JQQA 3RRWA 2Q9QB 1ZV4X 3GWHA 5JR9A 1ZHCA 3B57A 3CX6B 4OHFA 5EZYE 2DCFA 4EYUA 2HPLA 2XQYA 2EHOB 2K24A 3UUMA 2W00A 3OYZA 3N9OA 4IHJE 3KV6A 3O1IA 4ILUA 4EAHA 3SRZA 2PBIA 3MJXA 4X20E 3PU8A 1D1BA 1LVKA 5GONE 1MIYA 3PUSA 1HFAA 1BR0A 4MHCA 3HKEE 4OFZA 1HTJF 4PJJA 2CXLA 4JEHB 3LK2B 1MNDA 1MMDA 2E8IA 2JMKA 4PFOA 3SS1A 5LYJE 3WAJA 1QUUA 3IHRA 3CPZA 3PTRB 3K3NA 2N2NA 3KFWX 5DJQC 4P09A 2J1DG 4B6XA 1LRZA 3Q9DA 3V5SA 5LNKA 4BAYB 5JR9B 2NW7A 4J2CA 3F2EA 4XAXB 5JDHA 3HKBE 1IZNB 2PJQA 4V1Av 3C4XA 1WYCA 4DBQA 1MMNA 3ETVA 3RPUA 3CX7B 4GOUA 4TV8E 4AQFA 2KLQA 4AKRB 3RX6A 5LHGB 3V5UA 4UF0A 4JEUB 3AVSA 5HXSA 3NZPA 3RYHE 4CXYA 2NTXA 4BA9A 2DWKA 4HTEA 5E0OA 4WNKA 5C8YE 5LBMA 3Q5XA 3AA1B 2H3RA 2LE8A 5L3FB 3AA6B 5JREA 3I9WA 4AKIA 1EZ3A 2KXPB 2C5KT 2BZBA 2W63A 2X9XA 3I0QA 3LFMA 3ZC1A 3C64A 5EK4A 4ASKA 3ANWB 1D0ZA 4QX7B 2A72A 4PJMA 2UXXB 4CI2B 3LK3B 4CQIA 2ACXA 2XAQB 4IE6A 2K5BB 5LGTB 3KV5A 5L3GB 1MMAA 2KT9A 4EB6E 3E22E 2K9AA 5LJMA 3IEEA 4O4JE 3I9YA 2E9XD 2XAGB 4P0AA 3O4XE 5L3DB 3DJBA 4UELA 5CB4E 2W0GA 3F31A 4O4LE 5FY7A 3RRCA 3W15B 4QXHB 2DWGA 5AFUL 4AKGA 4DVDA 3I1AA 3ZYKA 4E7ZA 2CXDA 2NW9A 3ZPOA 2K48A 5JDMA 2NTYA 4EOZB 3MXZA 3NRYA 2C0SA 1HG2A 1FMWA 3GA8A 5CA0E 4CI3B 2BDEA 2W62A 3ESLA 4I55E 1FMVA 2VKDA 3K8PC 2MOZA 4KMCA 3ETUA 1Y64B 2ODUA 3LG7A 4PFPA 3D0TA 2XTLA 4YJ3E 1MIVA 3VHLA 3ZEFB 2CMRA 3FHNA 4YHJA 2Q9QD 1OXZA 2YINA 5LBQB 5JDQA 4UV9B 4JUYA 4ZI3D 3P7IA 4TN7B 2SPCA 2CXFA 2X9WA 4XBFB 4H9PC 3ZCIA 5DQWA 2BVLA 4HGAA 2XAHB 2N1GA 4G2AA 4PJLA 4BJMA 2X68A 3KDSE 3UUNA 4O8SA 4EXTA 4OK0A 4UEMA 2LSIA 3HKDE 4HKAA 2E9XC 4FJOA 5FY1A 5FXZA 5KDMC 5FY0A 5L3EB 1U5PA 3PURA 1SHZC 4I4TE 4ZI2C 3DP7A 2WAUA 4DBRA 2CE7A 3E08A 4TZ4C 3VKGA 3E0ZA 2YEVC 3HI2A 5L2LA 3QK6A 2I59A 2YK0A 2KZ7B 2VKHA 4ISTA 1BR4A 2LHRA 3PE0A 2N9DA 5LJNA 3KINB 2A2FX 4WBOA 2H7VC 4L9IA 3N2GE 4BJNA 2KNDA 3KVAA 2E9XA 4CXWA 5LXTE 2NOXA 4QKNA 2IC6A 3HR0A 3KBTA 3H37A 4IIJE 3AAAB 4M1PA 3ANWA 2Y8DA 3O1HA 4O2AE 5LGNB 2ZM8A 2CWOA 2VL8A 4FI5A 5H6RB 1WRDA 2Q9QA 4YLHA 3RKOA 2MYSA 1X79A 2VKOA 5FXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIN A;  2WMN A;  2WMO A;  3B13 A;  3VHL A;  2WM9 A; 
#chains in the Genus database with same CATH topology
 3N5L A;  3L8R A;  3FZM B;  4TWD A;  5DAB A;  4G63 A;  2WMO A;  4YHH T;  3IBP A;  3P8C D;  2BS4 A;  4KHZ F;  5AQR B;  4DMV A;  5JRC A;  2X51 A;  2IAK A;  2Y48 B;  2VK9 A;  2WCA A;  5JR9 C;  3TLS A;  2CLY C;  4HEA A;  5J2U E;  5JDN A;  2FJA A;  1I94 T;  3RC8 A;  2LJL A;  3PV0 F;  3ZYM A;  3GN5 B;  4UF0 B;  2CWY A;  3ZCJ A;  3GN5 A;  2V7L A;  3M65 A;  2UXN B;  5ABF A;  3HL6 A;  3KBU A;  4IRE A;  3ZMS B;  4LF8 T;  2UXC T;  2D0T A;  2ZM2 A;  2IIU A;  4K0U A;  4Z8X A;  4H63 V;  5IWA T;  4O2B E;  2C5I T;  5LHI B;  2WP9 A;  3AE1 A;  4U72 A;  4ZS3 A;  5FL0 A;  5JDG A;  2CHN A;  2A9U A;  2D2S A;  2ES0 A;  4HWD A;  3AVR A;  1R8I A;  5AQQ B;  2LSG A;  5AQH B;  5HEG A;  5AQL B;  1UCU A;  2K3W A;  5ABG A;  3WI3 A;  4ZXL A;  3GMI A;  3MAC A;  3ABV A;  4LFC T;  1JNR A;  2LT3 A;  4HWI B;  3EUH A;  2J62 A;  5KDM C;  1VRB A;  4AKL A;  1KNZ A;  1YQ3 A;  2YKS A;  5IYZ E;  2H89 A;  1SUM B;  1NWM X;  3AE8 A;  3CKD A;  3FZH B;  3JAF A;  2LSK A;  4MLK A;  2E9X B;  2LRL A;  4PK5 A;  4WW0 A;  2V7I A;  1G8X A;  2VAS A;  4QH4 A;  3QC9 A;  4I43 B;  3OKQ A;  4IE7 A;  3EDU A;  1ZEE A;  3AAI A;  3ZT7 A;  5AQV B;  3ZMT B;  2WU5 A;  4HFH A;  4KUM B;  4NPP A;  4B3S T;  3RYI E;  1Z8U A;  1OWA A;  3O1J A;  4H9R C;  4AQY T;  1I6Z A;  2XQA A;  2RA1 A;  3C4Z A;  3JC6 C;  5J1G A;  3O9X A;  2G0U A;  5JDF A;  2CM0 A;  3C4W A;  4X1K E;  4EGW A;  5LHH B;  2JPF A;  3BQK A;  2RP4 A;  5HWY A;  5KXJ A;  3CML A;  2UU9 T;  1Z0P A;  1KNR A;  3AEB A;  5FVK A;  3TLT A;  3C98 B;  2E5L T;  4KP3 C;  4LF6 T;  4CZZ B;  5JVD E;  3AA7 B;  4U3C A;  2FBW A;  3NRX A;  4IE0 A;  4IGU A;  2ZLY A;  5ABH A;  5F8P A;  2B1E A;  1B7T A;  2PTF A;  3PDY A;  2FUP A;  1VOM A;  2BS3 A;  3N9M A;  4H9O C;  3R84 B;  4ZI3 C;  1T8B A;  4ANJ A;  4PJN A;  1N34 T;  4X66 T;  4Q25 A;  3VR9 A;  2IUB A;  4YY3 T;  3BQI A;  2D0U A;  2QYW A;  2LEH A;  1W9R A;  5LB7 B;  2CPT A;  4E7S A;  4DUY T;  1XMO T;  3EAB A;  4IE5 A;  2HHH T;  5LMN T;  2XQ3 A;  2RPA A;  1YXR A;  4HN9 A;  3QUJ A;  4ILA A;  4A98 A;  3MZK B;  4GKJ T;  5AQJ B;  1WLX A;  4NUV A;  1LKX A;  2WU2 A;  2NP9 A;  3FXE B;  3IF8 B;  4GYS A;  1D0Y A;  4O4I E;  1XNQ T;  1H7C A;  4L0R A;  1FEW A;  4AI6 A;  4IE4 A;  3SFE A;  2YDS A;  4DV1 T;  4OX9 T;  2OV9 A;  3TKL B;  3CVR A;  2XQ8 A;  3ONX A;  4EEB A;  3DTO A;  3VKH A;  5EK2 A;  2LM9 A;  5FP3 A;  3OTO T;  4UVC B;  1CUN A;  4HE8 A;  4EIW A;  5HXR A;  4PAG A;  4MFR A;  2LSJ A;  3PJA A;  3S4U A;  2FJE A;  5JQG E;  3UU3 A;  5LG3 A;  4AQF C;  1BR2 A;  1J5W A;  3K1S A;  4PK4 A;  1KFY A;  1T98 A;  2R6G F;  2W67 A;  4LMJ A;  5DQV A;  3U78 A;  4ZS2 A;  4CI1 B;  3OVU A;  5HEU A;  3UFG A;  4DR3 T;  2LRK A;  4HFB A;  1IBL T;  4JI7 T;  3RYC E;  3NKZ A;  2P9B A;  4GYR A;  4QXB B;  4UVB B;  2X0Y A;  3ZN1 B;  4EZH A;  2XJ7 A;  1ZKE A;  4YT0 A;  1OED E;  3UU4 A;  2X9H A;  4KHP T;  2KWH A;  1O3X A;  3RQW A;  5TAO A;  2XAJ B;  2HPJ A;  2XSB A;  4C91 A;  1HNX T;  2JQK A;  3AXJ A;  5HCM A;  4PNI A;  2BVM A;  4ZOL E;  1MNE A;  4DMW A;  2E5V A;  2F4V T;  3ZN0 B;  4DV0 T;  3M3Z B;  5HXC A;  1HG5 A;  5LA6 E;  4U2Y A;  5ABF B;  3CQG B;  1S35 A;  3T8O A;  4DV5 T;  4TWH A;  3RH3 A;  2VQF T;  3RLF F;  5JDL A;  5ADX L;  3J7Y q;  3CK6 A;  2L9Q A;  2W61 A;  3HA4 A;  3KV4 A;  3I0O A;  2WB5 A;  4ILB A;  3F57 A;  1SA0 E;  3RHW A;  1X9B A;  4KI0 F;  5LCY A;  5L4E A;  2LKH A;  3Q5D A;  3IA3 A;  4O4H E;  4KBM B;  4AQG A;  4UVA B;  3SFD A;  3OJA A;  4YFS A;  2WWU A;  2XQ6 A;  3B13 A;  1IJ5 A;  3P50 A;  1IAP A;  4IDP A;  3L3P A;  4X1I E;  3RYF E;  3UFE A;  3UT5 E;  2JMH A;  5BMV E;  2YU2 A;  2V7M A;  3UU8 A;  1HF8 A;  2ZM0 A;  1W0A A;  3AE4 A;  4DND A;  5CA1 E;  3JCF A;  3ZJ2 A;  3UQ7 A;  2A3D A;  5LMU T;  2UXD T;  3VU7 H;  3KV9 A;  4UV8 B;  2CA5 A;  4CN4 A;  2WWV A;  4X64 T;  1XDP A;  4DR2 T;  1UX4 A;  1MIW A;  4IDZ A;  4UIG A;  2GK9 A;  4JI5 T;  5ETW A;  2BKO A;  2WDR A;  4MAL A;  2PG8 A;  3U3I A;  2LOP A;  1HCI A;  1WYB A;  4YSZ A;  3N9L A;  5HAX A;  4C90 A;  3K3O A;  1D0X A;  5LP6 E;  3B5M A;  1YKE B;  1IBM T;  2CCQ A;  4ZHQ E;  4TNV A;  1HX1 B;  2VKJ A;  5J2T E;  2XUE A;  2IC9 A;  4KX6 A;  3WAK A;  2VQE T;  2WM9 A;  2NW8 A;  4DV4 T;  2CLY B;  2CEA A;  1YD8 G;  3CQX C;  2V8S V;  3NBX X;  3AXJ B;  3PUQ A;  3P4Q A;  3RIU C;  3C50 A;  5C2T A;  4N78 D;  2H7O A;  2KWI B;  2XQ4 A;  3QNU A;  3ZST A;  4JI4 T;  1XWM A;  2YU1 A;  3AA0 B;  3ZMZ B;  3H3M A;  2CRB A;  4HFI A;  5CJ5 A;  2BG9 C;  3RI5 A;  2LM2 A;  1SE7 A;  1KNP A;  4LMK A;  4IDQ A;  4EED A;  5HYA A;  3ZC0 A;  5FXX A;  4GIW A;  2UUB T;  2M6B A;  1US7 B;  5LG4 A;  4PW8 A;  3Q5W A;  2HN1 A;  4HWC A;  3N9P A;  1WFD A;  4UR9 A;  2AXD S;  3AE9 A;  4DID B;  2IHR 1;  2L8K A;  2PFV A;  3MA9 A;  4QXC B;  1N32 T;  1WR0 A;  2I6H A;  2WY2 A;  4TV9 E;  2V7J A;  3RIF A;  3SWH A;  4HFC A;  4DV7 T;  4JYA T;  3A7M A;  4CN1 A;  2W66 A;  1G73 A;  5HWX A;  2V1D B;  2ODV A;  4ZI2 D;  5J0Z A;  1N36 T;  2KSR A;  4X1Y E;  1LVF A;  2CBI A;  2WQY A;  3H3A A;  2JRK A;  4GK5 E;  2HH7 A;  2HN2 A;  4EZ4 A;  3UTK A;  1J5E T;  4GKK T;  2M67 A;  4I50 E;  5AQT B;  2V7K A;  5FNV E;  3UQ4 A;  2BBH A;  2XAS B;  4JLE A;  1UUR A;  1JNZ A;  2V5D A;  4DR4 T;  4F6R C;  2Q9Q C;  1V9D A;  1Y01 A;  2WSS V;  1T72 A;  2X9Y A;  2BKP A;  3LK4 2;  2EHO A;  3MKD A;  1YKH B;  3AB3 B;  4OYJ A;  2ZM6 T;  3J9X 1;  1HS7 A;  5LOV E;  1HNW T;  1NAF A;  2BG9 E;  3N2K E;  4EYY R;  4YSY A;  1UX5 A;  4QHO A;  2EHO C;  3N9N A;  3PUX F;  4DO0 A;  3RC3 A;  4P1N A;  2DNX A;  3QB5 A;  4P0B A;  2L3L A;  3EDV A;  3EVY A;  4QWN B;  3OYX A;  2X67 A;  3A5X A;  3JC6 D;  2BS2 A;  4ISS A;  3PUA A;  2V6Y A;  2KIN B;  4HFV A;  3N9Q A;  2IW5 B;  4PK6 A;  3BK9 A;  3ZLI A;  2OLT A;  4ADZ A;  5HXH A;  1HR0 T;  2XHE B;  5C3J A;  5KMG P;  4EV6 A;  4NUU A;  2XSA A;  2YOE A;  2M6I A;  4JI3 T;  4LFB T;  4H63 H;  1AJ3 A;  4GK0 E;  5LGU B;  1M7K A;  1U4Q A;  2LHN A;  4JI6 T;  2C5J A;  3UU5 A;  4MBQ A;  4WZX A;  5AQP B;  3K3Q C;  2EHO D;  2LOS A;  1MMG A;  3FBZ A;  3QOF A;  3R6N A;  4CXX A;  4HFD A;  4H9Q C;  4WBN E;  1D1A A;  2D5U A;  2DI4 A;  4L5G A;  3FXD B;  2KMF A;  5FMN A;  1N33 T;  1XDO A;  3RF1 A;  5A1L A;  1S94 A;  3KVB A;  5FXV A;  3CX8 B;  4ZEY A;  4U74 A;  5H6Q B;  3LBX B;  3PUG A;  5ABE A;  4AIU A;  2WDV A;  1QSD A;  3FBL A;  4UXN B;  3PU3 A;  1DU2 A;  3TLV A;  3NZQ A;  1M62 A;  1KK7 A;  2LLY A;  2XM2 A;  4ERR A;  4YJ2 E;  3UUX B;  3BQL A;  1E1H B;  1IJ6 A;  3SOL A;  2V5C A;  5M4Y A;  3ZMU B;  2OA5 A;  1IBK T;  4U33 A;  2MPK A;  3AAE B;  1ZP0 A;  2XQ9 A;  3OBV E;  3Q2M A;  4H9S E;  4XZC A;  3LSV A;  1BR1 A;  2WMN A;  2UUC T;  4TUY E;  3ZJ1 A;  2Y6X A;  3CWZ B;  2JJ9 A;  2NWB A;  5IHY A;  4X65 T;  2QA7 A;  3AEC A;  4OYK A;  4QX8 B;  2Z6E A;  3LBX A;  1WR6 A;  4B3T T;  4YSX A;  4AKH A;  3FZF B;  4DV3 T;  4K0K T;  3EHZ A;  1D1C A;  3JAD A;  5JH7 E;  5HEJ A;  2MTQ A;  3T1Y T;  2XAF B;  3FB2 A;  2DLR A;  3A8Y C;  3EAM A;  3MK7 C;  5L4H A;  3ZMV B;  5FYM A;  4YTN A;  2H88 A;  4DR1 T;  3UUL A;  3RIU A;  3PUV F;  4IDN A;  1NEK A;  5HEH A;  1YW0 A;  1GQE A;  2B76 A;  2DHR A;  4TX5 A;  5F3J A;  4AXP A;  4JI1 T;  2VB6 A;  2X66 A;  4IL4 A;  2ZMA A;  5AQI B;  3CQC B;  3HKC E;  3X1D A;  5HXE A;  2MBG A;  4A56 A;  1FIO A;  2WBL A;  3L09 A;  3LJC A;  4H9N C;  4U31 A;  5EK3 A;  1XMQ T;  3C51 A;  2YDR A;  2V26 A;  1HX8 A;  5KX5 E;  5L3C B;  2LSY A;  5JRC B;  1UK5 A;  2XQ7 A;  5L3B B;  4ZI7 E;  2X0L B;  2VWA A;  2QGS A;  2JQQ A;  4DV2 T;  3RRW A;  5AQG B;  1ZOY A;  1UGO A;  3UUB A;  2JQH A;  2Q9Q B;  1ZV4 X;  3GWH A;  5JR9 A;  4DR6 T;  1ZHC A;  3B57 A;  3CX6 B;  4OHF A;  5EZY E;  2J4G A;  3ZKR A;  3L39 A;  3RKG A;  2DCF A;  4EYU A;  2HPL A;  2XQY A;  2EHO B;  2K24 A;  3UUM A;  2W00 A;  2XPK A;  3N9O A;  3OYZ A;  4IHJ E;  3KV6 A;  5HEO A;  3VRB A;  3O1I A;  4LF9 T;  4ILU A;  3FZK B;  3LDQ B;  3VR8 A;  3SRZ A;  4EAH A;  2PBI A;  3MJX A;  4X20 E;  3PU8 A;  1T7S A;  1D1B A;  1LVK A;  5GON E;  4ILC A;  4F8H A;  1MIY A;  3PUS A;  1HFA A;  4JI2 T;  1BR0 A;  2QRX A;  4MHC A;  3HKE E;  3T1H T;  3EI0 A;  1OED C;  3P4W A;  4OFZ A;  1HTJ F;  4AKG A;  4PJJ A;  2CXL A;  4JEH B;  3LK2 B;  1MND A;  1MMD A;  2E8I A;  2BBJ A;  2JMK A;  4PFO A;  1L0V A;  3SS1 A;  5LYJ E;  4LF5 T;  3WAJ A;  3CIR A;  4JI0 T;  1QUU A;  2VVS A;  2X0H A;  3IHR A;  3CPZ A;  3PTR B;  4JBW F;  3K3N A;  4QH1 A;  2N2N A;  3KFW X;  5DJQ C;  4P09 A;  4AIS A;  2J1D G;  4B6X A;  1LRZ A;  3Q9D A;  3PUY F;  1HNZ T;  3ZSS A;  3V5S A;  5LNK A;  4BAY B;  5JR9 B;  2XQ5 A;  2NW7 A;  2WZH A;  4J2C A;  3F2E A;  2BG9 B;  4XAX B;  5JDH A;  3AE7 A;  3HKB E;  1IZN B;  3P4P A;  2PJQ A;  4V1A v;  1E2A A;  3C4X A;  1WYC A;  1WCR A;  3NWI A;  4DBQ A;  1MMN A;  3PJA J;  3ETV A;  3RPU A;  4A97 A;  2LKG A;  3CX7 B;  2XM1 A;  3ONL C;  4GOU A;  3AE3 A;  4NIQ A;  4TV8 E;  5AQM B;  4AQF A;  4X62 T;  4IT4 A;  4B3M T;  2WZI A;  2KLQ A;  4AKR B;  3RX6 A;  5LHG B;  3V5U A;  3P4S A;  3ZYL A;  4UF0 A;  4JEU B;  3AVS A;  2WDQ A;  3NZP A;  3RYH E;  5HXS A;  4CXY A;  2NTX A;  4BA9 A;  2DWK A;  4HTE A;  5E0O A;  2NR4 A;  4I0U A;  4TNW A;  4COF A;  4WNK A;  5C8Y E;  4DR5 T;  5LBM A;  2D9D A;  3Q5X A;  5AQN B;  4YXD A;  3AA1 B;  4WYV A;  2H3R A;  2LE8 A;  5L3F B;  3AA6 B;  5JRE A;  1FJG T;  1KF6 A;  3I9W A;  3NVO A;  4YTM A;  5FXW A;  2IML A;  4AKI A;  1EZ3 A;  2KXP B;  2C5K T;  2BZB A;  2W63 A;  2X9X A;  1E7P A;  3I0Q A;  3LFM A;  1KEY A;  3ZC1 A;  4LF7 T;  1XNR T;  3C64 A;  5EK4 A;  4ASK A;  4HFE A;  3AEE A;  3ANW B;  1D0Z A;  2FJB A;  1OED A;  4QX7 B;  2A72 A;  4PJM A;  2UXX B;  2CHO A;  4HWH A;  3RGL A;  2W4X A;  3LK3 B;  4CI2 B;  2ACX A;  4CQI A;  2XZE A;  4IDO A;  2XAQ B;  4IE6 A;  1NEN A;  2K5B B;  3RQU A;  5LGT B;  5L47 A;  3AEA A;  3KV5 A;  2V6X A;  2W2U A;  3N2O A;  5L3G B;  3TLW A;  1MMA A;  2KT9 A;  4EB6 E;  3E22 E;  2K9A A;  5LJM A;  2WS3 A;  3TLU A;  3IEE A;  2JIW A;  4O4J E;  4U2Z A;  3I9Y A;  2E9X D;  2XAG B;  4Z90 A;  4P0A A;  3O4X E;  5L3D B;  3DJB A;  4UEL A;  5CB4 E;  2W0G A;  3F31 A;  4O4L E;  5FY7 A;  3RRC A;  3W15 B;  4QXH B;  1W09 A;  2DWG A;  3G06 A;  4YTP A;  5AFU L;  1XZY A;  4DVD A;  4CN6 A;  1QLB A;  3I1A A;  4U7Y A;  5JTG A;  3ZYK A;  4E7Z A;  2CXD A;  2NW9 A;  3ZPO A;  2K48 A;  5JDM A;  2NTY A;  4ZZB A;  2JQ9 A;  2IDO B;  4EOZ B;  3MXZ A;  4DR7 T;  3NRY A;  2YN6 A;  2V6Y B;  2C0S A;  4LFA T;  2I0M A;  2CBJ A;  1HG2 A;  1FMW A;  3GA8 A;  5CA0 E;  4CI3 B;  5IUX A;  2BDE A;  4DUZ T;  2W62 A;  3ESL A;  3AEG A;  4I55 E;  1FMV A;  2VKD A;  5AQU B;  4X5T A;  3K8P C;  2MOZ A;  4KMC A;  2VUR A;  3ETU A;  2QVA A;  4DV6 T;  5AQO B;  1Y64 B;  2ODU A;  3LG7 A;  4PFP A;  3D0T A;  2XTL A;  4YJ3 E;  1MIV A;  3QB5 K;  3VHL A;  3ZEF B;  5BR8 T;  2CMR A;  3AED A;  1YQ4 A;  2Q9Q D;  1OXZ A;  3FHN A;  4YHJ A;  2YIN A;  5FVL A;  5LBQ B;  5JDQ A;  4UV9 B;  4LF4 T;  4JUY A;  4B3R T;  2FJD A;  4U7I A;  3VRA A;  3P7I A;  4TN7 B;  4ZI3 D;  2SPC A;  2CXF A;  2X9W A;  4JI8 T;  2VL0 A;  4XBF B;  4H9P C;  3UU6 A;  3PUW F;  3ZCI A;  2UXB T;  5DQW A;  2BVL A;  4HGA A;  2XAH B;  2N1G A;  2VVN A;  5F5W A;  1VCT A;  4G2A A;  3AE6 A;  4PJL A;  3FZL B;  3JAE A;  4BJM A;  2X68 A;  4HWF A;  3KDS E;  5FL1 A;  3UUN A;  4O8S A;  4EXT A;  4OK0 A;  4IL9 A;  4UEM A;  4ZZC A;  3ONJ A;  2LSI A;  3HKD E;  4HKA A;  2BG9 A;  4LML A;  3AE5 A;  1J1J A;  2E9X C;  4FJO A;  3AE2 A;  5FY1 A;  5FXZ A;  4QH5 A;  5FY0 A;  5CGM A;  1U5P A;  5AQS B;  5L3E B;  5AQK B;  3PUR A;  3ZT6 A;  1SHZ C;  4I4T E;  4ZI2 C;  3DP7 A;  2AE9 A;  2WAU A;  2YDQ A;  5CFB A;  4DBR A;  2ACZ A;  2CE7 A;  2MAW A;  3E08 A;  5AQF B;  2J47 A;  4TZ4 C;  3VKG A;  3E0Z A;  2YEV C;  2UUA T;  3RIA A;  3HI2 A;  3ZT5 A;  5L2L A;  2E2A A;  3QK6 A;  2I59 A;  2YK0 A;  2KZ7 B;  2VKH A;  3P4R A;  4IST A;  1BR4 A;  2LHR A;  5FKY A;  2XY8 B;  3PE0 A;  2N9D A;  5LJN A;  4TWF A;  3KIN B;  2A2F X;  4WBO A;  2H7V C;  4L9I A;  3N2G E;  1CHU A;  2BKN A;  3AEF A;  3PUZ F;  1UUS A;  4A5X A;  4BJN A;  1W0B A;  2KND A;  2E9X A;  3KVA A;  4CXW A;  5LXT E;  2NOX A;  4QKN A;  2IC6 A;  3HR0 A;  3KBT A;  3H37 A;  4IIJ E;  3AAA B;  1OED B;  4M1P A;  1VCS A;  2Y8D A;  3ANW A;  3O1H A;  4Z91 A;  3OPC A;  4O2A E;  5LGN B;  2ZM8 A;  2CWO A;  5HCJ A;  3Q5E A;  2VL8 A;  4FI5 A;  5H6R B;  4NXM T;  4NXN T;  1WRD A;  2Q9Q A;  4YLH A;  3RKO A;  2MYS A;  4JV5 T;  1X79 A;  2VKO A;  2DL1 A; 
#chains in the Genus database with same CATH homology
 3N5L A;  5DAB A;  4G63 A;  2WMO A;  3IBP A;  3P8C D;  4DMV A;  5JRC A;  2X51 A;  2IAK A;  2Y48 B;  2VK9 A;  5JR9 C;  2CLY C;  4HEA A;  5J2U E;  5JDN A;  3RC8 A;  2LJL A;  3ZYM A;  3GN5 B;  4UF0 B;  2CWY A;  3ZCJ A;  3GN5 A;  2V7L A;  3M65 A;  2UXN B;  3HL6 A;  3KBU A;  3ZMS B;  2D0T A;  2ZM2 A;  4K0U A;  4Z8X A;  4H63 V;  4O2B E;  2C5I T;  5LHI B;  4U72 A;  4ZS3 A;  5JDG A;  2D2S A;  2ES0 A;  3AVR A;  2LSG A;  1UCU A;  3WI3 A;  3GMI A;  3MAC A;  2LT3 A;  3EUH A;  1VRB A;  4AKL A;  5IYZ E;  1NWM X;  3CKD A;  2LSK A;  4MLK A;  2E9X B;  4PK5 A;  4WW0 A;  2V7I A;  1G8X A;  2VAS A;  3QC9 A;  4I43 B;  3OKQ A;  4IE7 A;  3EDU A;  1ZEE A;  3AAI A;  3ZMT B;  4KUM B;  3RYI E;  1OWA A;  3O1J A;  4H9R C;  2RA1 A;  3C4Z A;  3JC6 C;  5J1G A;  3O9X A;  2G0U A;  5JDF A;  2CM0 A;  3C4W A;  4X1K E;  5LHH B;  2JPF A;  3BQK A;  2RP4 A;  5HWY A;  3CML A;  1Z0P A;  3C98 B;  4KP3 C;  4CZZ B;  5JVD E;  3AA7 B;  3NRX A;  4IE0 A;  4IGU A;  2ZLY A;  5F8P A;  2B1E A;  1B7T A;  3PDY A;  3R84 B;  1VOM A;  3N9M A;  4H9O C;  4ZI3 C;  4ANJ A;  4PJN A;  3BQI A;  2D0U A;  2LEH A;  4E7S A;  4IE5 A;  4HN9 A;  3QUJ A;  3MZK B;  1WLX A;  4NUV A;  1LKX A;  2NP9 A;  3FXE B;  3IF8 B;  4GYS A;  1D0Y A;  4O4I E;  1H7C A;  4L0R A;  1FEW A;  4AI6 A;  4IE4 A;  3TKL B;  3CVR A;  3ONX A;  3VKH A;  3DTO A;  5EK2 A;  2LM9 A;  5FP3 A;  4UVC B;  1CUN A;  4HE8 A;  4EIW A;  5HXR A;  4PAG A;  4MFR A;  2LSJ A;  3S4U A;  5JQG E;  4AQF C;  1BR2 A;  4PK4 A;  1T98 A;  3U78 A;  4CI1 B;  5DQV A;  4ZS2 A;  3RYC E;  4EZH A;  2P9B A;  4GYR A;  4QXB B;  4UVB B;  3ZN1 B;  1ZKE A;  2X9H A;  2KWH A;  1O3X A;  5TAO A;  2XAJ B;  2HPJ A;  4C91 A;  4PNI A;  2BVM A;  4ZOL E;  1MNE A;  4DMW A;  3ZN0 B;  5HXC A;  1HG5 A;  5LA6 E;  3CQG B;  1S35 A;  3T8O A;  3RH3 A;  5JDL A;  3J7Y q;  5ADX L;  2L9Q A;  2W61 A;  3HA4 A;  3KV4 A;  3I0O A;  3ZYL A;  1KNZ A;  3F57 A;  1SA0 E;  5LCY A;  4O4H E;  4KBM B;  4AQG A;  4UVA B;  3OJA A;  4YFS A;  2WWU A;  3B13 A;  1IJ5 A;  3RYF E;  1IAP A;  4F6R C;  3L3P A;  4X1I E;  3UT5 E;  3UFE A;  5BMV E;  2JMH A;  5CA1 E;  2YU2 A;  2V7M A;  1HF8 A;  2ZM0 A;  4DND A;  3ZJ2 A;  2A3D A;  3VU7 H;  3KV9 A;  4UV8 B;  2CA5 A;  1UX4 A;  1MIW A;  4IDZ A;  4UIG A;  2GK9 A;  5ETW A;  4MAL A;  2PG8 A;  3U3I A;  2LOP A;  1HCI A;  1WYB A;  3N9L A;  5HAX A;  4C90 A;  3K3O A;  1D0X A;  5LP6 E;  1YKE B;  2CCQ A;  4ZHQ E;  2VKJ A;  5J2T E;  2XUE A;  2IC9 A;  3WAK A;  2WM9 A;  2NW8 A;  2CLY B;  2CEA A;  1YD8 G;  3CQX C;  3NBX X;  3PUQ A;  3C50 A;  4N78 D;  2H7O A;  2KWI B;  2YU1 A;  3AA0 B;  3ZMZ B;  5HYA A;  3ZC0 A;  5FXX A;  4GIW A;  1US7 B;  5LG4 A;  4PW8 A;  3Q5W A;  3N9P A;  2L8K A;  2PFV A;  3MA9 A;  4QXC B;  4TV9 E;  2V7J A;  3SWH A;  1G73 A;  5HWX A;  2ODV A;  2V1D B;  4ZI2 D;  4X1Y E;  1LVF A;  4GK5 E;  3H3A A;  2JRK A;  4EZ4 A;  2HH7 A;  3UTK A;  2M67 A;  4I50 E;  2V7K A;  5FNV E;  2XAS B;  4JLE A;  2Q9Q C;  1V9D A;  2WSS V;  2X9Y A;  3N2O A;  3LK4 2;  2EHO A;  3MKD A;  1YKH B;  3AB3 B;  4OYJ A;  3J9X 1;  1HS7 A;  5LOV E;  1NAF A;  3N2K E;  4EYY R;  1UX5 A;  4QHO A;  2EHO C;  3N9N A;  4DO0 A;  3RC3 A;  2DNX A;  4P0B A;  2L3L A;  3EDV A;  3EVY A;  4QWN B;  3OYX A;  2X67 A;  3A5X A;  3JC6 D;  4ISS A;  3PUA A;  4HFV A;  2KIN B;  3N9Q A;  2IW5 B;  4PK6 A;  3BK9 A;  3ZLI A;  4ADZ A;  5HXH A;  2XHE B;  5KMG P;  4NUU A;  1AJ3 A;  4H63 H;  4GK0 E;  5LGU B;  2LHN A;  1U4Q A;  2C5J A;  4MBQ A;  3K3Q C;  2EHO D;  2LOS A;  1MMG A;  3FBZ A;  4CXX A;  3R6N A;  4WBN E;  4H9Q C;  1D1A A;  2D5U A;  2DI4 A;  4L5G A;  3FXD B;  2KMF A;  5FMN A;  5A1L A;  1S94 A;  3KVB A;  5FXV A;  3CX8 B;  4U74 A;  5H6Q B;  3LBX B;  3PUG A;  1QSD A;  3FBL A;  4UXN B;  3PU3 A;  3NZQ A;  4ERR A;  1KK7 A;  4YJ2 E;  3UUX B;  3BQL A;  1E1H B;  1IJ6 A;  3SOL A;  5M4Y A;  3ZMU B;  2OA5 A;  4XZC A;  3AAE B;  3Q2M A;  3OBV E;  4H9S E;  1BR1 A;  2WMN A;  4TUY E;  3ZJ1 A;  2Y6X A;  3CWZ B;  2JJ9 A;  2NWB A;  5IHY A;  2QA7 A;  4OYK A;  4QX8 B;  2Z6E A;  3LBX A;  1WR6 A;  4AKH A;  5JH7 E;  1D1C A;  2MTQ A;  2XAF B;  3FB2 A;  2DLR A;  3ZMV B;  3MK7 C;  5FYM A;  3UUL A;  5F3J A;  1YW0 A;  2DHR A;  4TX5 A;  4AXP A;  2VB6 A;  2X66 A;  2ZMA A;  5HXE A;  3CQC B;  3HKC E;  2MBG A;  4A56 A;  1FIO A;  2WBL A;  3L09 A;  3LJC A;  4H9N C;  5EK3 A;  3C51 A;  2V26 A;  1HX8 A;  5KX5 E;  5L3C B;  2LSY A;  5JRC B;  5L3B B;  4ZI7 E;  2X0L B;  2VWA A;  2QGS A;  2JQQ A;  3RRW A;  2Q9Q B;  1ZV4 X;  3GWH A;  5JR9 A;  1ZHC A;  3B57 A;  3CX6 B;  4OHF A;  5EZY E;  2DCF A;  4EYU A;  2HPL A;  2XQY A;  2EHO B;  2K24 A;  3UUM A;  2W00 A;  3OYZ A;  3N9O A;  4IHJ E;  3KV6 A;  3O1I A;  4ILU A;  4EAH A;  3SRZ A;  2PBI A;  3MJX A;  4X20 E;  3PU8 A;  1D1B A;  1LVK A;  5GON E;  1MIY A;  3PUS A;  1HFA A;  1BR0 A;  4MHC A;  3HKE E;  4OFZ A;  1HTJ F;  4PJJ A;  2CXL A;  4JEH B;  3LK2 B;  1MND A;  1MMD A;  2E8I A;  2JMK A;  4PFO A;  3SS1 A;  5LYJ E;  3WAJ A;  1QUU A;  3IHR A;  3CPZ A;  3PTR B;  3K3N A;  2N2N A;  3KFW X;  5DJQ C;  4P09 A;  2J1D G;  4B6X A;  1LRZ A;  3Q9D A;  3V5S A;  5LNK A;  4BAY B;  5JR9 B;  2NW7 A;  4J2C A;  3F2E A;  4XAX B;  5JDH A;  3HKB E;  1IZN B;  2PJQ A;  4V1A v;  3C4X A;  1WYC A;  4DBQ A;  1MMN A;  3ETV A;  3RPU A;  3CX7 B;  4GOU A;  4TV8 E;  4AQF A;  2KLQ A;  4AKR B;  3RX6 A;  5LHG B;  3V5U A;  4UF0 A;  4JEU B;  3AVS A;  5HXS A;  3NZP A;  3RYH E;  4CXY A;  2NTX A;  4BA9 A;  2DWK A;  4HTE A;  5E0O A;  4WNK A;  5C8Y E;  5LBM A;  3Q5X A;  3AA1 B;  2H3R A;  2LE8 A;  5L3F B;  3AA6 B;  5JRE A;  3I9W A;  4AKI A;  1EZ3 A;  2KXP B;  2C5K T;  2BZB A;  2W63 A;  2X9X A;  3I0Q A;  3LFM A;  3ZC1 A;  3C64 A;  5EK4 A;  4ASK A;  3ANW B;  1D0Z A;  4QX7 B;  2A72 A;  4PJM A;  2UXX B;  4CI2 B;  3LK3 B;  4CQI A;  2ACX A;  2XAQ B;  4IE6 A;  2K5B B;  5LGT B;  3KV5 A;  5L3G B;  1MMA A;  2KT9 A;  4EB6 E;  3E22 E;  2K9A A;  5LJM A;  3IEE A;  4O4J E;  3I9Y A;  2E9X D;  2XAG B;  4P0A A;  3O4X E;  5L3D B;  3DJB A;  4UEL A;  5CB4 E;  2W0G A;  3F31 A;  4O4L E;  5FY7 A;  3RRC A;  3W15 B;  4QXH B;  2DWG A;  5AFU L;  4AKG A;  4DVD A;  3I1A A;  3ZYK A;  4E7Z A;  2CXD A;  2NW9 A;  3ZPO A;  2K48 A;  5JDM A;  2NTY A;  4EOZ B;  3MXZ A;  3NRY A;  2C0S A;  1HG2 A;  1FMW A;  3GA8 A;  5CA0 E;  4CI3 B;  2BDE A;  2W62 A;  3ESL A;  4I55 E;  1FMV A;  2VKD A;  3K8P C;  2MOZ A;  4KMC A;  3ETU A;  1Y64 B;  2ODU A;  3LG7 A;  4PFP A;  3D0T A;  2XTL A;  4YJ3 E;  1MIV A;  3VHL A;  3ZEF B;  2CMR A;  3FHN A;  4YHJ A;  2Q9Q D;  1OXZ A;  2YIN A;  5LBQ B;  5JDQ A;  4UV9 B;  4JUY A;  4ZI3 D;  3P7I A;  4TN7 B;  2SPC A;  2CXF A;  2X9W A;  4XBF B;  4H9P C;  3ZCI A;  5DQW A;  2BVL A;  4HGA A;  2XAH B;  2N1G A;  4G2A A;  4PJL A;  4BJM A;  2X68 A;  3KDS E;  3UUN A;  4O8S A;  4EXT A;  4OK0 A;  4UEM A;  2LSI A;  3HKD E;  4HKA A;  2E9X C;  4FJO A;  5FY1 A;  5FXZ A;  5KDM C;  5FY0 A;  5L3E B;  1U5P A;  3PUR A;  1SHZ C;  4I4T E;  4ZI2 C;  3DP7 A;  2WAU A;  4DBR A;  2CE7 A;  3E08 A;  4TZ4 C;  3VKG A;  3E0Z A;  2YEV C;  3HI2 A;  5L2L A;  3QK6 A;  2I59 A;  2YK0 A;  2KZ7 B;  2VKH A;  4IST A;  1BR4 A;  2LHR A;  3PE0 A;  2N9D A;  5LJN A;  3KIN B;  2A2F X;  4WBO A;  2H7V C;  4L9I A;  3N2G E;  4BJN A;  2KND A;  3KVA A;  2E9X A;  4CXW A;  5LXT E;  2NOX A;  4QKN A;  2IC6 A;  3HR0 A;  3KBT A;  3H37 A;  4IIJ E;  3AAA B;  4M1P A;  3ANW A;  2Y8D A;  3O1H A;  4O2A E;  5LGN B;  2ZM8 A;  2CWO A;  2VL8 A;  4FI5 A;  5H6R B;  1WRD A;  2Q9Q A;  4YLH A;  3RKO A;  2MYS A;  1X79 A;  2VKO A;  5FXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...